2YO3A

Salmonella enterica sada 1185-1386 fused to gcn4 adaptors (sadak14)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
b'KQIEDKIEEILSKIYHIENEIARIKKLIKVTDAQVSRNTQSITNLNTQVSNLDTRVTNIENGIGDIVTTGSTKYFKTNTDGADANAQGADSVAIGSGSIAAAENSVALGTNSVADEANTVSVGSSTQQRRITNVAAGVNNTDAVNVAQLKASEAGSVRYETNADGSVNYSVLNLGDGSGGTTRIGNVSAAVNDTDAVNYAQLKRSVEEANTYTDQKMGEMNSKIKGVENKMKQIEDKIEEILSKIYHIENEIARIKK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 80
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2yo3A01
2.60.40.4050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yo3A02
3TNUA 3A7OA 3M91A 4JYCA 5AW1B 5AVWB 4AUWA 2Q3IA 2W6AA 2JJLA 3L36A 2E42A 5APSA 4C7NB 4KHXA 3T97A 2R5DA 3B8EB 3KDPB 4I6MC 4AYCA 1A02F 5AVRB 1MV8A 2YO2A 2H7HA 2R32A 1FAVA 2KP8A 4I2LC 3M9BA 3M0DA 4RESB 5AW4B 1JNMA 1J2JB 5APXA 1G2CB 2R3CA 3VYIA 3OAKA 1X8YA 4HYTB 4LC1A 1GTWA 1OWAA 4JYBA 1A02J 1HBWA 1GD2E 1KQLA 5APVA 3NXSA 3O8ZA 3VMZA 3VTPC 5APQA 4GT1A 1YYCA 1MFZA 3HE4B 3VN0A 3V4WA 1MUUA 3UIAA 1CI6A 3P7KA 3VMYA 3V4QA 3NTNA 5APWA 1H8AA 2ZXEB 3I5CA 5AW8B 2WT7B 3L35A 3SWFA 1HJBA 4XE5B 4B86A 2ZFCA 3TNUB 5APTA 2R5BA 1T2KC 1GZLA 2WPRA 3HTKA 3IR9A 2P67A 2XZRA 2WPQA 3MD0A 3HE5A 2E43A 3NMDA 3P32A 1SP4A 3M9HA 1FOSF 2Q7CA 3LIDA 5AW9B 3LIEA 3TYYA 3A2AA 2YO3A 3MGNA 1GU4A 2P2UA 1GU5A 5AW0B 4AQRD 1GK6A 1CZQA 2WWWA 3A3YB 3P8MC 5AVVB 1H89A 2WPSA 2W27A 1CSBA 4C7NA 1GK4A 1SLQA 2IPPA 3KQGA 1H88A 2XU6A 5AVYB 4EOTA 1HUCA 5AVQB 5APYA 5AVZB 2QM7A 1JUNA 2C9LY 1S9KE 5AW7B 2QM8A 2Z5HA 2XV5A 5AW5B 3V5BA 4M3LA 5AW6B 3A5TA 5AVUB 3L37A 3NFQA 3M0AA 1DH3A 1CI6B 3M06A 5AVTB 2P7JA 2N9BA 2YNYA 5AVXB 1FOSE 1S9KD 1T2KD 1OXZA 2VRSA 3HE4A 2WTYA 1NAFA 5AVSB 4GKGA 1IO4A 3HE5B 5APUA 2Q5UA 2Z5IA 2BASA 2C9NY 1HWTC 3TK1A 4C46A 5AW2B 4DZOA 2WT7A 3VMXA 5CMZA 1NWQA 5AW3B
chains in the Genus database with same CATH superfamily
2PMZA 1LD9A 3KR3L 3EYOA 3X1EA 2VNCA 3GJFA 3MDJA 3VSVA 4OD1L 4KDWA 1JV2A 3HMXA 4BKLA 1U3NA 3BWUF 3L5JA 3FU6A 4XX1G 3B8EB 1V10A 5LDUA 1F97A 1MV8A 4I18B 2IANE 3BVWA 3UYOD 5T5FL 4IRSA 3SQRA 3PJSB 1L0XA 1F4YH 1RCYA 5F3BA 2ITDB 2E74D 4MNGA 3REVA 5K9QI 2IAAC 2BVUA 1QOKA 2AXWA 2YD6A 2Y2YA 3QCVL 1JRHL 1I8LA 2ITAA 1SXCA 1KJMB 1GD2E 1VENA 1FE8H 3A6CH 1MWAH 5CBNA 2R2BA 2Y7OA 4H1LB 5E8DL 4O02B 3RGHA 4IMLB 4C56A 4CA4A 5I1EH 3FHAA 4X4XB 5IUSA 4LF3A 4TLSA 5DMGD 4RGNB 3AAZA 5I5IA 1E79H 3QZWB 1KCWA 4OCNC 1OW7A 3V4VL 2X4QA 3PUUA 3WY2A 1E9OB 1ZLEA 1VAHA 3FYIB 5FGRA 2WQSA 5DLLA 4HS6B 4AOFA 3CPUA 2H2SC 1LXMA 2E43A 1LDPL 4Y4KA 3DRTB 3H42L 5AAPA 3GS7A 3MFGB 4PG2A 1RUQL 5I18H 3W68A 2VKWA 1HH9B 1KN4H 2A7BA 5A2LH 3ZYOA 5FPIA 1JZIA 1KG0A 4EKJA 1IAIH 4ICXA 1VQ8P 3DI3B 2DS4A 4XPFH 1LK2B 4PYGA 2X3BA 4E42B 3PWJA 5KAIE 1TZAA 2AQPA 1XB3A 1AO7B 2XNAB 1NIEA 1P9MA 3F5WB 4GRLB 2OR8A 4M43L 2VXUL 3ARBD 3RWJB 3SYOA 2YIUC 3LIZA 4PHXA 3Q1MA 3RUGF 3VRJA 2ICES 3DX7B 3RUGA 3U30C 1KFAL 5MERA 3VI4B 1D5IL 1YEFH 3HD7D 3DROA 1J1XL 2ICEA 3NJXA 5HPOA 1D7BA 3HG1D 3Q06A 3FOLB 4NN7C 5AB9A 4BZ1L 1OX3A 4X99B 4F57L 4G9FA 2I1JA 5C07A 1T21B 3ILPA 2F1BA 3G6AA 4G3YL 3FTVA 5AG8A 3ZGIA 2AHIA 1QQDB 4JRXA 1J9CT 4RRPM 1QPKA 4HH9A 4XP4L 4FXGA 1M57B 5DK0A 3SDAB 4TSBH 5B7MA 1BJ8A 5IMOA 1IBYA 1AQ5A 2R15A 4AEHH 2BRRL 2Y23A 3V7AG 5JW3H 2GB2A 3IS0X 4PB9L 3EFFK 2Y5TA 3FWNA 1A2YA 3MFFB 5M1BA 1MWOA 3BD4A 4MCMA 5CUSL 4LSTH 5F89B 2WVTA 2DIAA 4GBXA 3HZVA 2W9DH 4YBQC 4G70B 2HJFB 5KAQG 2G5BB 2R29H 1QX1A 1SXAA 4NO3A 3APFA 1JNLL 1G1YA 4DTGL 2KUBA 1IGCL 2YKKA 1H15A 1FZFA 1YLBB 2H32H 2N1TE 1HHKA 4LVHC 3EUUA 1XIWC 1KCUH 1GS7A 3LH9A 3SCMC 3W67A 4MCYB 4U2YA 4R2GC 2NNCA 1YZZA 3OJVC 1BEXA 2DEYX 2GC7C 3SFDC 1KB5A 1KJ2A 4HV8A 1AGEA 3QFJD 3MKKA 1CGSH 4P3DA 2R2HB 1AP2B 4XPAH 2QEJA 3FL7A 3IDYC 2J5UA 3OB8A 1A1NA 4WKXA 5LGYA 2H6UA 2H89C 5JHAA 1YEDA 2OJZL 2W91A 3MNVB 1IJDB 3B7RL 3DX1A 3IU4H 2Q8BL 1LEIB 3VVWA 1WFIA 1RE3A 1NOLA 4KRPC 1A7RH 1CT8A 2ADIA 4QMEA 2YD5A 2WNGA 2Z7UA 1U92A 5DQ9A 1S9XA 2EYRB 3EJQA 3WEXB 4EVNA 2J8UF 2ZSVB 5B1AB 2VDRB 4U6VL 1I3GL 4ETYA 3SQBA 4PV1D 1KXTB 2P24B 2P5WA 2YZ8A 3EGXB 4YUEL 2ICCA 5L7XL 3DWTA 3S4SG 1IEBB 5KEZA 2R8SL 1A14H 3NEEA 2IF7A 3H1KJ 2A83B 4GAAA 3VCLB 2G75A 1ADQL 4M4RA 3RX7A 5D70L 5E4EB 1VRSA 4JPWL 3QEUB 5EPMA 3I85A 3FUKA 4ODSL 5DSCA 1UYWL 3WEAA 1J1EB 3BVHA 4R96B 2WYIA 4PS4H 1N70A 3DVNA 3HD7B 2H3XC 3PJNA 4G8GD 5ANHA 2J8HA 1DQTA 4DKTA 4HVBA 3HG1B 4PSPA 4YDLB 4QXTB 5KANI 5B39A 4GSDL 3N41B 5IFHL 3L3IB 2OZ4A 3ZSTA 1G2CA 1YN7A 5CP7A 1V8HA 5IFJB 1KIRA 3BPLB 3I55P 2Z34A 1F4WL 1I9JH 1G0YR 2CDEB 2ZT9D 4I4WA 4W81A 5D8JH 1INDH 4G8GE 1R1CA 1GMEA 3IBOA 4ELMF 1FC2C 1SOKA 2HFFB 4ELMA 4G8IA 3WDHA 3MLSL 1UCBL 4FXKB 4OSUL 1QPPA 1QFUL 3Q2YA 4BH8B 5F9OL 1GGCH 2G60L 5B7FA 4HALA 1HXMA 1KPRB 1F3RB 2WT7A 1PAMA 1IGML 4IFMA 1OE2A 5C0JA 1UT1A 3DGCR 3FULA 3E0GA 2AJ3A 1H0TB 1VFAA 4LDCA 5DWUL 3Q13A 2OK0L 4NO2A 3SBPA 5AVWB 2VO5A 1FZKA 3IK2A 4U0RB 4CU8A 1A6VL 3FSAA 3KJ6H 4KVPA 1RLBA 3HC3H 2FK9A 4H2CA 3FX0A 3LRGA 2BZ7A 1QLRA 3M1BA 3PCYA 4AQAB 1T3FB 4JLRA 1YMMA 4Y16A 2GCYA 5TQ2H 2K9UA 2KH2B 5IJVA 3QDMA 5KBLA 1L0NG 2FSDA 4JHBA 4N2BA 3NZSA 4RVBA 4Z76B 4ZMOA 1BYPA 4AGOA 4LEOB 3QFJB 4ZMPA 1J2JB 4YXDC 1L6ZA 4OIAA 4DK6A 3L1OL 5L8JB 5T5NG 3P0YH 2YK1H 3T09A 1KQFB 1FSKC 4KQ4L 5HHMD 5D1XC 2BWDA 1AMYA 2OTWA 1QSED 3BAIA 2EZ0D 5D7IE 4JYBA 2VXSL 2NR6A 4FLRA 4R5TA 4HUXB 5EWIL 2G3AA 2CZNA 3T3PF 4K5LA 1INEH 1DQJA 5J6SA 1XGUA 2W88A 3WFHA 3NCBB 4OLUL 4HAFA 2VLRD 3Q2VA 5D1ZA 3E3QC 4NKOB 2ZUTA 1KWGA 1QSEE 1SDDB 1NTMD 3X1BA 3EDEA 4OCWH 4XN2A 3HBGA 1DUYA 4PMEA 3B8SA 5C6TH 1PCXA 2QHRL 1MY5A 4JAMA 2ZTBA 3QPQD 5E6IC 3V0JA 2OSYA 4MMXC 1HWWA 1OVVA 1NTME 4NQUA 4U6TA 2OMZB 3INUH 3RVVC 4ADGA 3OKDB 5MP6H 3MLTA 4PH8A 1KTCA 5FKAA 1UWGL 3PDDA 2IPUK 3FO9B 2HAZA 1RZ8A 3EFFA 1NSNL 2G3ZA 2Q86A 4HCRH 2Y7SA 4Y2LA 4AMKH 2X3AA 4B96A 5J11B 4N2IA 2C34A 5DJUB 2ENYA 3L70D 2DYPD 5IHWA 5AVYB 4XN1A 2BNQE 2CLRA 1R5IB 4R4FL 1M71A 1PZ5B 2P42B 4F8OA 3L17A 4NQDA 1MW1A 1LO0L 5HYJA 3CFEA 3TGUD 2R0WL 2YPLB 1DBMH 3BPOC 4KKLC 1CICD 1JWSA 3IJ7A 4QJ4B 3L70E 2ZT9B 1ZMEC 3H1IE 4ZKUA 1JVKA 2FFDC 2KYIA 1HS6A 1MFUA 4JB9H 5LCVA 3B83A 1BF5A 1E5YA 2JELH 2Y69B 5EUOF 2DI8A 5EUOA 3UTTA 3COOA 2OV0A 1RURL 4ODUB 1N73C 5HHXL 4BZYA 1NU1K 4UZSA 1AZVA 1S9KD 5LVEA 3MYZA 1D6EB 2EDEA 3JWNE 1EHAA 3HTKB 3TURA 2DWEA 1RIVL 2X1QA 3G3ZA 4G7YL 4W9IC 4R4NC 2ZX6A 4B9PA 4OCSL 5F2FA 2B59B 3RFRA 1MVUB 5I1HL 4D9RD 1IO4C 5CIPH 2PWFA 1FPTL 2JWAA 1YEJL 1NIAA 3MV8B 4D3CH 3WUWA 4L9LB 2VSKB 2OTKE 4ALAL 4GMTH 3ARFB 3OQ3B 1L9OA 1MIML 3QWOC 4NBZB 4GKSB 1DBAH 4D9RE 1DD3A 1JZ4A 2QKSA 1J0YA 1QHQA 1PX4A 3EO1A 3NA9L 3UG5A 5EZIH 3QCUL 1L0LJ 1XFPA 4YHIB 1MCDA 3GTNA 1HSBA 5HHMB 1QNZH 3GLAA 4PJ8D 1PY0A 3W37A 2GKIA 3RVXD 3T1WA 3JSVC 5TE4H 4YXKH 3DUUB 3ES6A 1E9QB 2X2IA 4EZLA 4IBZA 2BP3A 3HB3D 3WE6A 5T8IA 1W2EA 4OCLC 1SQQG 3WHE1 3F58L 5T33H 1X22A 4PJFE 1RF0A 2JB5L 2VLRB 3VFSB 4W9CC 6FABH 1OAXH 3SY6A 3P9LB 4HKZA 3F85A 1KPUB 4LLWA 2R69A 3ILEA 4P2AA 1RPQA 4CADA 3JVFC 3UPCA 2Q7YA 3FQRB 2VJ8A 3LX9A 3II3A 3O0RL 1HOEA 5F8RC 5LBVA 5LXVA 4IRJD 2XTSA 4FQJH 1SUHA 3WMSA 2HKHH 1T1YA 3P2DA 1S8DB 2XTJC 3KWXA 3MOQA 5AUMB 5TK4A 3R06A 3DO7A 3LEYL 4XVSH 2AXGB 3BVTA 4X7EC 3M9HA 2XV0A 4LZKA 2G30A 3BH9A 1TJMA 1IQDA 1A6WL 1BVOA 4OBRA 3HNVL 3TJEL 5C09A 43C9A 2JXMB 4DQOL 3D0AA 1RD6A 2DYPB 4ABQA 5GS1B 1SXSA 5JHDD 4XZUA 3Q2CA 4A7VA 1GZPA 2OMVA 4E9WA 3MNZA 2ARJQ 3F12B 4BFJA 1ACXA 1GGBH 5F0JB 4BRYB 2DYSB 2XQ0A 3EJTA 3CD6P 2XPGB 1FNFA 2DQDH 5IT2L 3W81A 1CICB 5KSAD 5B66E 2D7OA 3CFIC 2F7RA 2RMZA 3O4LA 4XBEL 5JXED 3FU7A 3FHQA 4X2UA 3TA3B 2VZTA 3C08L 2AK1H 3NIDB 2NX5D 5IG7B 2E7LA 1N0XL 2EDOA 5D7LB 2CO3A 1DFXA 3FO2A 1TETL 2YUWA 4DGIH 3SE6A 1LMKA 1UWEL 3DURB 4PRBA 1QEXA 1EANA 1S9VA 4NHUB 3UJTH 5DMYA 3VMNA 4YDNA 2NX5E 5I1JH 2Y9YA 1N12A 1SN0A 4DQAA 1YQ2A 4YXLH 3B9KC 1W2KT 5A16B 5GGTA 4LKXB 2C9VA 3VYPA 4G1MB 3CAFA 3PWPD 4PW3A 4FADA 2FT7A 4JVUA 1ZHBA 5IB4B 1MH5B 3QH3A 1S3KL 5KTEH 2XKUA 15C8H 4FAAB 3L54A 1I53A 3JT2A 1MAJA 3PP3H 1S7SB 2KPWA 5IB1B 1A9EB 2DM4A 5APSA 1WZAA 2V5TA 1Q9OB 4I5BA 2GUSA 4OLXH 5CLWA 4HWBH 3PWPE 5E99H 1X4XA 5BS0A 5CJ0A 4P46B 2CGYA 1U8HA 3RL2A 2DWYA 1C12B 3HKFA 5I82A 3SHSA 3TF4A 4U4IA 1M7LA 4WEBL 3ZL1A 2BVYA 2WNXA 1RUPL 3VGAC 1AKJA 1TQWA 2BW4A 3HB3B 2JCCE 4Q52A 3IFLL 2COQA 2EVIA 4X6CF 2EIBA 4PEEA 4XNYH 2DQIH 1TJHL 4XCFL 1FLRH 1RQ5A 3IJSB 4MA7H 1MHCB 4LNRA 3CQFA 1RJCA 2GW5A 43CAB 1FYHB 3VXUB 2VXVH 3FJTA 4PCSA 4U3CA 2RAMA 4XA4A 1I9IH 1KILA 3L2NA 4HEPA 4AKQA 1XZ0B 3VWKA 3RAJH 5D2LE 2ZOKB 3BE1L 3O11B 2R9HC 3ABZA 4IRJB 4GB9A 2R3SA 4HUUB 2WSPA 4KZCA 3G5VB 1XTGB 2OMXA 5E9DD 1SFCD 4P2RD 2LTQC 4QY8B 2XWJA 3SDCD 2ARWA 4J1UA 1ED3A 4O58H 2LR2A 3BPNB 3SSGA 1ZXGA 4FHJA 4L3AA 4XC3H 1YAIA 4LPTA 3O6KL 1GAFH 4NQCB 4RAVA 1ASQA 2ROYA 2P3YA 5E9DE 1N3NA 4JVWA 4PTTB 1QTPA 1RUML 4P2RE 1WBYA 4HSAC 5PCYA 2WQUA 3VFUA 4FQ1L 3CDGB 4P23A 3S5LA 2BDNH 4ANKA 5JHDB 1AOHA 1J9SA 1WAAE 2ITEA 2XVKA 2EABA 1BWMA 3P77B 2AEIT 3C5SA 3UZVA 3C6SA 4DUXA 2F74A 5KSAB 1L4AB 1U93B 4U0QB 2OSWA 3EG9B 4XMLH 3RFZA 1SXNA 2E59A 4P2CG 1HEJC 5I1KL 3VD2A 2NY2D 1YPZF 5H4ZA 1RJLB 4BK5A 5AW6B 2I32A 4J3SA 4EPSA 1OQXA 4D8PB 5IWLA 2YKOA 3WTXA 1NPJA 1J1OH 4QUOA 2HXAA 3AREA 2YD7A 5JHLA 1CBJA 4JRYD 4V33A 3BEVA 1OP5H 3I6KA 4AJVA 4IDJH 1M56D 2LR4A 3IGAB 3F7QA 3ZQWA 3ISRA 1NOHA 5TJHA 1VQ9P 4JANA 1DJIA 5DO2D 3NZUA 3S9DB 3B3BA 4XTRC 3MCKA 5E7BA 3ARXA 4P5RA 5SV4A 4OJCA 1RUKL 3D30A 1LO4H 1I9EA 4JRYE 3D06A 4WY7L 3IDNA 5HYSG 3IEAA 1FVDA 4J8RA 3TWCL 1A7OL 4X0KB 3A7OA 2BSRA 4IJ3C 3RIAF 4RDBA 2APTA 3AFLA 3WGVB 3X11A 5CP3A 2EUZA 2IGTA 4PJEB 1TYEB 3WIIH 1Y18B 1SBSH 1CK0H 1ESOA 4PI2A 3K6FA 3NIFE 1MZYA 3GLMA 3DYOA 1YG9A 4JDTH 4A2DA 2Z92B 2B0SL 4MAYD 4YDMA 4JY5H 1P4LB 3RI5F 3N1PC 2G4GA 2IOMA 3LNEA 1S9YA 1ZLUH 1DJWA 3D2TA 3LOWA 3PDGA 4Q6IA 3IVKB 5G4NA 2F8OA 2HUEA 3PDOA 1BGYJ 3EWKA 1WIUA 1ZS2A 4YNYA 4P05A 3U2JA 3TDKA 1SXBA 3LSOB 2NXYC 4FG4A 5GSVA 4UNVA 1BMWA 3DLQR 4FYQA 5DVMA 3QIBB 1J1DB 5K59F 1N7MH 2H0FA 4LSRH 1JMMA 5D72L 3BGFB 5DJ8B 2VDNH 3OX8B 5FFLA 5HVHC 3UABA 4ANWA 3NTNA 1IEAA 4GRWF 2QVMA 4N5EC 4K4KA 3LEXB 2IBZD 3DBXA 1PLAA 1K4CA 4TYUA 1P69B 6PAZA 2VL4A 1AXTH 1SQBG 3Q2LA 1K04A 1EAJA 4JY4A 3VA6A 1NGXB 1L9TA 3CDYA 4UOZA 1ZOYC 2ED8A 1GIGL 5T1KA 4KUCD 3T0VA 3FZUC 3L73D 3FF7A 3L3OB 2ZJSE 2HODA 4P59H 5BVPL 2FQEA 2OMWA 4BRVA 3C9NA 5BPPA 2ZWSA 3FYEB 1QBAA 2P80D 4WO4D 4OZ4B 3UC0H 1D9KC 2KSJA 3HE6A 1QNIA 1H88A 2H41A 2DLHA 2NY2B 2RCSH 3Q2NA 5EIIA 3UYRL 1HL4A 5TDNB 4AXWB 1C16B 4PTUA 4CC4C 4Z7NB 5EN2B 3VXSD 1UKSA 2PR4L 2X6MA 3L37A 2ZAEB 4G80B 5H2FH 4XMUA 3GMOB 3O3BB 1M56B 1MW2A 3QXTA 4YZFE 3U2SA 1CI6B 1XGQB 4JPVH 3EJYC 1EV2E 4MMYB 2BCMA 4PGDA 1T6WA 5GHWL 3Q6FA 4HIPA 2N1KA 2OMYA 5L0QB 1RU9L 2CM6A 4OIBA 1VGEH 2BFVH 3ZDYF 4EXKA 4RAUB 3PJLA 2CJ3A 2XV6B 3ERXA 3KYKH 3IMUA 2AKRA 3FOMA 5FA3A 4N0FB 4B0MB 3CXHJ 1JV5A 4Y5XC 5AW2B 2A6JA 2IBGA 3WGUB 5DFWH 1LL1A 3SN6N 1VIWA 4W68A 5KVDL 4J3OD 1JI2A 5SV3A 2XYBA 4F8PA 5IHLB 4QMAA 4XCEA 3UP6A 5HDQL 2O5XH 3HUJB 2R1YA 5DJ2B 1D5XA 5DC4B 1UM4L 3W11C 3EF7A 1DE4B 4OZFH 2HR3A 5I66A 4UV4H 4MDIA 5EOQL 2F5BL 3PL6A 4ZS6D 4ZUSA 3SE9L 4WWKD 2JO1A 1BD2B 2CALA 2Y36H 3MXVH 2FBJL 4Y2DB 1LE5B 1R3HA 3WN6A 1WF5A 4X5LA 5FUOL 2FJFA 4HQQH 4Y19B 1UKTA 4UT7H 3WJMB 4E5XA 5CCGD 1G9NH 4GSUA 2GIXA 3BN9D 4GQRA 3TV3L 2HFTA 3IDMA 2EADA 3JWDH 5DTFA 1RPUA 3H0TB 2D03H 2G0LA 1J88A 2YS4A 1AVYA 1ZN5A 3FFOA 4M1CD 4ZAKC 2BCKA 4DEUA 2OTUA 2E27H 2R23A 3CCRP 2LAGB 1E4WH 1S7TB 4L5FE 2VGLM 4NN5B 5CCGE 1TJIH 1FORH 2XCMC 5B39G 3TLRA 5C0FB 1IBFA 3OKLA 4HIEA 1PGOA 2WQWA 1JP5A 1OF2A 3IRPX 4FQXA 4XPBH 4TV3A 5EIQA 1QMUA 5CEYB 2Y4SA 1BCCJ 2EUWA 1HHJA 4APQD 3CHXA 3VG0H 2X7LB 4LBAA 2RBLA 4N2MA 2P8MA 1QR1B 4NRXA 4LHUD 3IPFA 4XCNA 4BD4A 5J9PA 4HUVA 1EHXA 2VDPB 3ECVA 3HS0A 3BH4A 3EBGA 1T1XA 3VXME 1A25A 2IAMD 4BXVA 1Q9WA 1H89A 1YITP 1BQUA 2MPAL 3VNZA 4DGVL 1WCBB 2JE8A 2PWEA 2WSSH 1YC7A 3TO2A 4GI6A 1SEBB 1MRFH 1U8PA 25C8L 4MZRA 4JG9A 2E7DA 3F7VA 4EOTA 4G6MH 3MA7B 3VXSB 5I0XA 1PNCA 1W8OA 1V3MA 3O6QA 2QADC 3KLHC 4AV0A 1D6VH 2FWLB 4RMTA 3ZGHA 3D39A 2CHDA 3LXCA 1W5CE 2BHZA 3QUZD 5FDWB 3GTTA 4P2OB 3RTQC 3S97C 1DCLA 4Z7VA 1KCSH 3RK2C 5DS8A 3EF4A 4RMVA 1DQIA 1H3PL 3FMGH 2Q87A 3UZQA 3QQ9D 1PJWA 1DQDL 1MFBH 3ROOA 4APXB 5ILTH 1YBKA 2VXTH 4N6RB 4XP1H 4YFDB 3QXWA 1B9KA 4DAGL 5DVLA 1TKWB 2IQ9L 3MJ8B 3A6OA 1R5VB 4U1JA 4FNPA 1OSEA 4LU5L 3T2OA 1KOAA 3IJHB 4EBQL 3ECBA 3TPUB 1CFVL 2BK8A 3DNKA 4WWID 5TE6L 1OCWL 3APNA 4FI6A 1WTLA 4OF5A 5EFIB 3W5MA 2GITA 1IGJB 3CVHB 1USEA 2WJ5A 3QPXH 4G6JH 1CDUA 1SQPJ 1CF8L 2DKUA 3U4EB 3DIFB 3L71G 4GXUM 3N1GC 1CFBA 4Q0XL 3TJHD 4KI1A 4ISVA 3ORJA 3ESMA 1JHKL 4IOIA 1LHZA 1EGJA 1P5UC 5H37H 2A6IA 2W8CA 4TSBL 1BDDA 5SWZD 5K5YA 3RTLA 2YEVB 3GBMH 1VFUA 4ODXB 3TZVB 1H6TA 3D5OF 2BVTA 2W0PA 2WK2A 5J6GB 5AOLA 4LIQH 5K5GB 2W6BA 3QQ4A 3SBQA 3LH8A 1LP9E 1E4KC 2YSSB 3L3KB 4FJZA 4XO5A 2MCAA 3OAKA 5SWZE 2FXOA 1JK8A 3ULUL 5EO1B 1VSCA 4H1LH 2P9RA 1PP9J 2H4EA 2H47C 2GFBB 4O02H 3LNGA 2OS7A 4GKOA 5GZOA 3OF6D 1I7RB 1CFMA 2O5YH 5I76B 2J4WL 3G9RA 4BFEA 2B08A 4L2LA 4KXCA 1M7DA 4NAMA 5HTSA 1L0LK 1EEZA 4GUOA 1OD7A 2QV2A 3L95A 3TH4T 5C0RL 2FATH 1OGAB 4MCZA 4EZMA 1UD4A 4LO9A 2DN7A 1TQBC 1GJWA 5KYXA 4BA8A 3G08A 1JMXA 1KTRL 2D8KA 2FIRT 2I25N 2ZUVA 4Q56A 4APQB 3V5DB 2VLKA 4JDVB 1GPOH 4N8CH 1YY9D 2D3VA 2Q1EA 4LHUB 3FFCB 1VQOP 2NZIA 4QHMB 4ANXA 5EBLA 1IZNB 5AD0A 3QYNA 3LIDA 3BCFA 2POHA 4FTVA 4OFDA 3MJ7A 3A4EA 1PFOA 2Q7NA 5IB3A 5LHDA 1RZGB 1BF2A 5HGBA 1KY7A 2D9CA 3LN5A 4YEEA 5EEUA 3RGBA 4XAKD 4D6TD 1OP3H 4QJ3B 2VDQH 3X13A 1FWXA 2NRGA 2IWEA 2FYYA 4GLRI 4S1QH 4J12A 4RH4A 3REWA 1HVXA 4NT6A 5CINL 3L5WA 3VRLF 3V4PL 3HZKB 3WNKA 5IHUL 1FGNL 3UBHA 3MLYH 3ARGC 3CFDB 4HMEA 3QNYB 1HHGA 4NWTH 1A14L 1W0VB 3CFBA 1OARH 3C5XA 2H0PA 1YQVL 2FQFA 2BVOA 2I9TB 4AGNA 3VWJA 3SY0B 4M1DH 1KPVA 1MCSA 1S3RA 4LRNH 1HEZB 5IQ9A 1H19A 1M9WA 5E2VH 4HIHA 4S1SH 4JCWA 3O3AA 3ZK0A 4GY4A 2KLSA 4QHNA 1ADWA 1U3HB 2WBJB 3ZOAA 2EDNA 2PLTA 4QRSA 3S7GA 5B7EA 3WSQL 4B9YA 1J5OL 2A6KB 1KLFB 2WXIA 3CNKA 4GP4B 2DWDA 4XPTL 4E9VA 4LSQL 2CWRA 4XX1E 4X6EB 2V4LA 1A6TB 1J0IA 1K05A 1H3VA 3A6BL 3LW5H 4MGXA 3BUPA 4KHXA 1CXHA 2ZXCA 4UQ9A 4HUWB 2EYTB 3GI8H 4B95C 4AYFB 4HGKC 1YVLA 1CFNA 5ETUA 3TT1H 3V6FB 3CX5J 1FZCC 4A2FA 5HDOA 4G11A 4W1TA 5G5DA 3DIDA 1Y8AA 3HZMA 3ESVF 4ZFFB 5KLIC 4J3VA 4BSWB 5FECB 2GAZB 1SDYA 3LZPA 3FT3A 2B16A 3I3DA 2CR6A 3UG3A 4N2AA 3TS8A 2NY0D 4IU2B 2HPCB 1F90L 1NANH 5BUAA 1MCPL 3CLEL 2B9AA 3MRFA 4LESA 3V55A 1NH6A 1F1AA 2C9RA 2IVFC 3FNKA 4KK6C 2H9GA 4H25B 4EUPA 3MHZA 3FSWA 2JB6A 2A38A 3U9UA 1HYSD 1HSAB 1RZPA 2MEJB 4I9WD 1LGVA 4GAFB 3VDBA 2BMKB 3Q5PA 3QEHB 3B5TA 4UTCA 4BBWA 5D2NB 4S0SD 3ZE2F 1JGLH 4NKIH 1ZLLA 3IJYA 2GJJA 5DJ6B 5C0AA 2VDRH 1UEYA 3BSGA 5KAIH 1S7XA 2FUTA 4P5TC 3AEGC 3QEQD 1BZEA 3ET9F 3CTTA 1YEEL 4I9WE 2FO8A 1G0DA 2P44B 4KZEH 3EGSB 5BOZG 3L75G 3GINA 3MJGX 4DNLA 5AL8A 5EUKB 1PTZA 1Q81Q 1F41A 3EO9L 3AEDC 4R3SA 1YO4A 1RL1A 2GUVA 5JPNA 3QEQE 4MJ5A 3LIEA 3VAEA 1EFXA 2IH3A 3GSWB 1WWBX 4E36A 1UJ3B 2YMOA 1EAPB 5IGXL 2F18A 4DT2A 1MI5A 4NNPL 3HI5H 4NZFA 2VITB 1ACYL 2VLLA 3TEUA 5I9QC 2XNXA 2R51A 5I17A 2JNZA 3QI9B 4PJHE 2WINA 4PJGA 3L13A 5C0IB 2AJUL 1NLDL 5B8CC 3U6RB 4IL6E 1JHTA 4BA0A 2QM7A 5HHPA 3KPRD 3M46A 3INUL 3PV6B 4YFEA 4QXGL 2Z8VC 1SEQH 1AQKL 1R3KB 4F37F 5AW5B 5I19L 4E41D 1UFGA 3T4AA 4GP5B 4KQ3L 4YDIH 1WICA 4GG6E 1BHGA 4OR1A 2CK2A 3SZKC 3V9FA 3WG7B 2IADB 4FABL 1KYOD 3C6LA 2XBZA 5CZRA 2BHFA 3KPRE 2X89A 5DR5H 3D25B 4PJDA 1GCFA 3SKNB 1JZ8A 2QJYB 1LEKA 4FHKA 4FNQA 5E9AA 1DBBL 1XCXA 3V7AE 3WO3B 2UY6A 3MOBL 1KYOE 1WD9A 1Q72H 4KT0J 2BP8B 3DI2B 3GMPB 4GXVH 1KN7A 5DJZA 1RQVA 3QZOA 4W9HC 1G9NC 2WLJA 5HGDB 3V2PA 4HXAH 4XMVA 1TU2B 2ZXWB 4HEPG 5E8OB 5I1IL 1CDBA 1EDHA 3JWDC 3TYFB 1BSHA 4K94H 2P8LB 4XT1C 1TU3F 1FG2B 1YSOA 2ZUYA 1KCVH 2AJSH 5AYQA 2K6WA 4G5ZH 3VFRA 4WW2B 4F7PB 1MW3A 4Z18A 2OR9H 5B4MC 3USSA 1CI3M 3FKUS 4MJIA 3SEPA 4X4ZA 2FEDD 1I3RB 3MRNA 5I1DB 2EAEA 2ZUSA 5JORA 1BSIA 2OL3A 4I2LC 2VDPL 5DQJA 4UTBL 3DX8A 5ID1A 1HKLH 1I31A 2R0LH 2JMRA 2ESVD 2WTOA 5C3LD 1BFOA 4YLCA 3RA7H 1L0PA 1ZCRA 4LC1A 3BQUD 1NBZA 3KPSA 1H5BC 4YLQT 5B38G 2MCPH 3NH7L 1K4DB 4GXFA 1N7SD 2PYFB 2VQTA 3BZ4A 3NJHA 4L4VE 4M5TA 4XCYB 5F1SA 4KKZA 1NVOA 4BQ6A 1DJXA 2Y0SA 1UXLA 4WEEA 5J1AB 4P57A 2ESVE 1NCBH 4AH2A 2G3MA 4S10A 2XVGA 4IFDK 1VQ6P 1KACB 3JT0A 3SDDA 1FLTX 4EIBA 4U4BA 5I73B 5IIEA 4PJ5E 1O6VA 3KPNA 1HCFX 4N86A 2YXVA 3OKEB 5TE4L 1ZK9A 4LLUB 5DYFA 3D69A 1M7XA 3PGCB 2BW5A 2WMPB 3BPCB 3RPIB 1A4KB 1J1PL 3CK0H 4QF1B 1T22B 1EEYA 4WK0B 4H4NA 3MRLA 3O45A 2DEXX 2Q6WB 4BINA 3O9WD 1TTBA 4ZUUB 1EXJA 1YDPA 3FB5B 1KQSO 1BEYL 4JHAH 4ENED 4J2XA 5LJYH 1FNEB 5FV1L 1RE4A 2HH0L 4IM8A 4N2CA 1J5DA 5ESQB 3NP4A 5HXMA 3L3JB 4HIIA 3KQGA 3CBKB 4A6YH 4YHMH 4KHTL 4E9XA 3PIQA 3T3MF 3T1FB 1E5AA 3LRLA 1L9SA 4DP1X 5A2KH 4E41B 4X6BA 1GYUA 1GY2A 4I18C 2JKRM 3E9TA 4GSRA 3JUYA 3AGWA 2O93L 4KKAD 3NFQA 3CN3A 1LEGB 2XN9D 3KM1A 2PPFA 4L4TD 2A9MH 4DZBB 1QA9A 4ZW7A 3BAEH 3M06A 1TQTA 3EH2A 3NSYA 1HHIA 4HUCA 4RZCB 4PRHA 3E38A 3EYUH 3QUKA 1CG9B 1GGBL 5K9JH 2ZP9A 1QLED 2XN9E 4KKCC 4IBSA 1OTUD 1EZUA 1AD9A 1WHPA 5BRZA 2A6DA 3LV3A 4FOMA 5C9JB 1WLHA 4Y2OA 1JIBA 5TFSL 2R44A 3U4BH 2GBUA 4RGNC 3C60D 1XH3A 4WGKA 1L0ND 5ES4B 3EOYG 3MLVL 1VEMA 3DDFA 4G43B 1UZ6F 3U36B 2AI0H 2GUOB 1WVZA 2W6AA 1AIFA 1I1AB 1S7UA 3DK2A 5CR1A 1JF1B 1F56A 4AX3A 3IAGC 4XO9A 3QORA 1L0NE 2L5GB 1A9BB 1MIEH 2ZYSA 2Q6QA 1L5GA 4K3EH 3UJJH 5EFWB 2FZ3B 3CXHK 3FUMA 2HN7A 1CU4H 2BNRB 3ARVA 4Q9QL 4ZPVA 2X2YA 3LQMA 4OZHE 2YXMA 3FQ1A 4NPEA 3KYMB 3SO3B 1N7SB 3M0DC 4I1RA 5AB1A 4DHLA 3MHVA 1J87A 1RK0A 3GSVB 3P11H 1AMXA 1K9MQ 4I13B 3GS0A 4CMMA 3N50A 4GRLC 5I5RA 4MX7B 4JM2B 5D1QD 2ZG3A 2P43B 5DS2A 3TN0D 3S34L 1LWHA 1MFAL 1BP3B 1A8JH 3L2MA 4M7KH 4GT1A 3ARDD 3BKJH 3RWDA 3VSQA 7FABH 1CD1A 1XD1A 3B3IB 2QSTA 2QLYA 3PGDA 1EAQA 2C0XA 4MXVE 3K5SA 3PHOA 2PYED 3PQYE 2OQQA 3FT1A 1T03L 4XNYL 1WA2X 2XV3A 1T2KC 3AXLA 4Y9GA 3TF7C 3RZCC 4X6FB 5CAYB 4I77L 3I56P 1L3WA 1VQPP 1CLVA 1OM3L 3AWGA 2VIRB 4XRCA 5CBAB 1C9SA 1GHFH 5FLUA 1R5LA 1I9IL 1VZIA 4C57C 1DVFD 2UVEA 2PYEE 4KRNA 4NN6B 1GGIL 4ZD3L 3US1A 1PKOA 3AS3A 4RJTA 3QUXA 1M3JA 1NMAL 1GK6A 1B0RB 4Z7WB 1JXGA 2X28A 4M6OL 5C1MB 3HE7B 1SLQA 1CGXA 3JWNH 4JEGB 4UT9A 1T8ZA 1JWMB 3QDJA 4PGEA 5DEGA 4PJXE 3QZPA 2FYUG 4JZJC 2N3JA 3BXNA 4B41A 1P0SE 3VGHA 1JTHA 1OSPL 4OLZL 2XV5A 4L4TB 2AS5M 4ZUVA 1NKOA 2XZAH 2E74C 1MFMA 2VH5L 5CJ8A 2BDNL 3O8XD 1QFWM 2W60A 4I89A 4TPRL 2IC2A 2NY6D 2HLOA 2GJPA 5T5FA 1AZZC 1QLEB 1YMHB 4OBSA 1A3LH 1M9SA 4G82A 1RZIA 5HP5A 4PCTA 2XA8H 4U3FG 1PAZA 4JJOA 5DMGC 4DCKA 1IX2A 4ZFQA 1Z56A 3C60B 1ZLVK 1Q8MA 3CDZA 4GS7C 1R0AH 1AOZA 3ROLB 4U3FJ 4HJJH 1BFTA 4EN2A 4M61A 4TQEH 4PR5A 1IGFH 4OZHB 1NGPH 3BEWA 1U8QA 2VISB 1JZ2A 1TQCB 2YRPA 4LLQB 2YPKB 1AYOA 1SQQD 3OAYK 4F2FA 3D4YA 4XMWA 4WHYH 3RJQB 2C3WA 2E4FA 2FWOB 1O9WA 4L1SA 1BLNA 3OPZL 5HGAA 2F9BT 4MNQA 3FQ2A 3ISYA 4RIRB 1SQPK 1OW6A 4KJMA 1NCDL 1II4E 1U8MA 1SQQE 2LLLA 3JWOH 2O6PA 1K73Q 4RA3A 3X17A 5KAFH 5D1QB 3ARBC 5IP4A 3TN0B 4ICWA 2XETA 5ISZE 1DL7H 2XHNA 4AYSA 4RKUJ 3IDXL 2HVJB 4QEGA 1EXUB 3HD7C 1KTKE 3NJGA 2J20A 2WXKA 2KERA 3DX6A 1YYCA 1JNHB 2F54B 1S4IA 4KMQA 3MIWA 3KDMA 4XOEA 4YDLC 1KGIA 3RGVD 1Z9OA 3ARZA 4GEIA 2Q8AH 4I0PD 1KTLB 4HJTA 1QSFB 3CHRA 4JN2A 2VN4A 4WDIB 3IDJA 1ZGLA 3QWNA 4QXUH 3CMOH 4FXTA 2ZX5A 1D5BB 1MJJB 5C0GA 4N8VG 3BO8B 5B66H 1DVFB 4BZ1A 2A45H 1JG9A 2K45A 2Q9IA 3FRPB 2DQCH 4KQ0A 4X50A 5EEWA 4LCCC 2QVKA 4JQXA 1PDKA 2WIMA 4P9ML 1NCCL 4OTXL 2YC1B 5DF0A 2XRAL 1CZQA 3B9VA 4WJKB 1P1ZA 1CGTA 3TBSA 2B1HH 3IDIA 4LSVL 5EF1A 2WOBA 2DQEH 4U0RC 2AJZB 1ZWIB 2FB4L 2K9JA 2FO1A 3QJUB 1GZQA 4K94C 1O75A 4PP1D 2QSCH 1L3NA 3VSUA 3WLWD 3O8XB 4GPVA 1JJUA 3CFCL 2JI2A 2FT6A 5KYYB 3KWWA 5EEXA 1TZ8A 3NK4A 3TNMA 1KDIA 2NY1B 4HC1H 4QOKD 4I0CC 4UQBA 1B9ZA 1P7QA 4JFDD 3FCSB 3RNQB 5C08B 3NZHH 4XNQB 2YR3A 2FHBA 1ID5I 4HA1A 3LYRA 3TFKD 2D2CB 2GA1A 5H35B 4ACPA 4QOKE 1M2VA 5D7JD 3V6OE 4JFDE 4Y9FA 5EU4B 1NMBH 2G9HA 5IW6A 3FO1B 5DS1A 2D7PA 2AQRA 3MBEA 2PPEA 4U7JA 3FTSA 1X79B 2R7EA 3QRGL 3QWRD 5INCA 3V52H 5B3NA 5DVPA 2NPSA 3KHQA 4DN4H 2YQBA 3CXDL 5DRWB 2FTAA 3CWGA 3A0BH 4PV1C 1QFWI 4KJWD 2NTFB 5J12B 1OCZB 3OXRB 4BJLA 3HI1B 2O1KA 4KH2A 3D18B 1QPXA 1ZDQA 1IM3D 3PWLA 1MUJB 1U30A 4XI5D 3VDAA 3L8QA 1RULH 1BVNT 1F0LA 1WO2A 5C0CA 4RMBA 5TF1H 2UYLA 1VADB 4A7GA 4Y9BA 2E47A 2EC8A 1WGOA 1PF3A 3AU0A 3FCTA 2R3CA 4FULA 3K71B 1HQ4B 2G5UA 1SHXA 2V3DA 2YKLH 2K9YA 4JKLA 3VE0B 1MCKA 1MCJA 4W4OA 5FO7B 3IFPB 5JOFB 3KL0A 1FAKT 1KBWA 4Z8FH 1ADQA 1BYNA 4JO5A 3TNNA 1J10A 2AGJL 1XF4A 3CX5K 4FFYL 4U1LA 4Y5VA 5EORH 3TCLA 4OZIF 2HX8A 3RGVB 4OD2B 1M6UA 2V5MA 2Y36L 3G5YA 1UM5H 2OBGA 1HL5A 1A6PA 1RFDL 3BWZA 4I0PB 2ZT9C 3FQWB 4LEEA 4XZ4A 2HMID 1HWGB 5K93A 3GMAA 4EQ3A 1IK7A 5DU7A 3QC6X 1PZCA 1KIPA 1QBML 4HCIA 4IMKC 4LPYA 3EOAB 4L3ED 1IFJA 1EZVX 5JA8B 1Y7VA 3CIQA 1N2DC 1OANA 4OLVL 3E8VA 5E2UH 1B4JL 3VP8A 4YXHL 3Q1SL 3VMPA 1JGVH 4MKTA 1AGFB 2V5YA 1HXKA 1CGUA 1OPGH 2GSGB 3JVGC 1BE3J 4L3EE 4DETA 1BZ7B 1UZ8B 2PETA 3T2NH 3UYPB 4E9YA 4N0CD 4OZGB 1DANT 1VKXA 4Q4EA 4JS7A 3IT8D 2KUTA 3IKKA 3LXUX 4Q9CA 5DJDA 4J27A 3T77A 1INQB 3KXFA 1BQRA 2Y6SD 4IRZH 5DRZA 4A2EA 1GJIA 3NACL 2AQSA 3B2PA 4MJ6B 5E24E 2IFGA 2Z7YA 1Q0YH 4KK8D 2KL6A 4UM8B 1BAFH 4JE0A 3TTSA 4Z3HA 2WAQA 4QOKB 4YIQA 1T5KA 4UYPA 2G2NA 1H8OA 4MTMA 4C56D 4UQEA 4QYOB 2VW7A 5ALCH 1XGTA 5AALA 2EZ0C 4FE9A 2JJSA 3X12A 2NY5H 2O1JA 4JFWA 5IVXF 5IVXA 3GZPA 2WAHA 1KTBA 5TPWL 4X6DF 1YECH 4X6DA 1XZWA 3ZE0F 4NO5A 1JN6B 5GRXG 1A1MB 5FOBB 4C56E 1E0OB 3PV7A 3DMMA 5DQDH 4OGYH 3UBFA 1OGTB 4NCC1 2NMSA 1Q94B 4Z5RA 4W7ZA 2APBA 1BBDH 3I3EA 1UOLA 3CZFA 4Y4KD 4TVPD 5D6CA 5I6PA 4C55A 2VM4A 1OL0A 4EEEA 3OAUH 3QPQC 3P3RA 3C2SA 4K9JA 4M9OA 3MLUL 3SYCA 5IVZB 1NM9A 4XWOD 1I3VA 5DMJB 3O6MH 3X14B 3AMLA 1IM3B 1CMOA 5E00A 2WVVA 3N55A 3D70A 1EDJA 2BC4A 3LNIA 1QABA 4F91B 3S3PA 2G2RA 3LS5L 3NFSL 1NC4B 3GXFA 4O9HL 5E5RB 8FABB 4B5ZA 2BSTA 2EO9A 4PREB 2FR4B 3L9EA 1KULA 3SGDH 2XSKA 2V2XB 4XP5H 3QPXL 4MZ3A 4TL4A 4JDZA 3TBVB 2P8PA 4FCAA 1F5WA 4XNMA 5BQ7A 1FGVL 2CQVA 2YLKA 3B6SA 3ARUA 1Q38A 3KLDA 1NFDB 4N24A 4ES8A 2NW3A 2WUCL 4F2ME 3PLNA 2QJPB 1NCJA 4IU3B 3AQDA 4QRUA 4RX4A 2MSPA 2W8ZA 5D6DA 4AL8H 4YX2H 3EJZD 4G9FD 2ZJSH 4HJUA 2ZXGA 5C07D 2BZDA 1CICC 2BXZA 3RUGE 1I1YB 5FX3A 4G8EB 3JWNC 4G8FA 4PLKC 4ZMVA 4LPXA 5K1VA 1IFPA 4FLOA 3S37H 2ITCA 1Q90D 1Z3RA 1SQBE 8PAZA 4IIQA 5D4HA 4XXCA 4M3JA 5I5JA 3DETD 1G94A 1LD9B 2YARA 2ZYIA 3O4OC 3CCVP 5C07E 3U2IA 1T4WA 1NCUA 2ATKA 1NCOA 1R75A 3EYOB 3ARWA 3GJFB 3OHMB 1FJ1B 1BIIA 2AJXH 2F19H 1QZNA 1AFOA 1JV2B 1CXEA 4GBXD 4BKLB 2Q7CA 3BAWA 4OJYA 4AIZA 3LCYA 1NDGA 3H7BB 3SBWC 5A2IH 5E6SB 4UIKH 2KZBA 4NGHL 4Y9EA 4CN1A 2I69A 4IRSB 2BSSA 5C92A 3M07A 4MNGB 3REVB 1V05A 2EDKA 3BKML 1KTJA 1KFMA 1I9RH 4FQ2L 4KROD 1NZRA 1ORQA 1PV3A 1WH0A 4N0YL 4BELD 3BN3B 1MFNA 5IHHA 4PJ8C 3MXWH 3RLSA 5BOPA 1IFHH 4LF3B 3RVXC 2YUVA 3AAZB 3SSUA 3K1DA 1M42A 2X4QB 2VDQL 3HB3C 4PWKA 2APWA 5JW4M 5CR8A 2OR7A 1WG3A 3W0WA 3CSFA 4AZ8A 1G7QA 4J3OH 3CVHH 3D48R 3JWOC 4AVIA 2MNJB 4OF7A 5KG9A 3BMWA 4Y4KB 1LWUA 3GKWL 2Q3ZA 4FYSA 4PS3A 3U7YH 1FFOA 1FNAA 3GDCA 4F15B 1LTJA 4IRJC 1ZDSA 2ORBH 4YSDA 2P5WD 2A06D 1UGNA 5I8OL 3BFOA 3VXOA 1Z9LA 1KG0B 2HYNA 2Y5EA 3VI4F 3VI4A 4M1DL 4FHBD 3B56A 1LM8V 2J8UE 3KBHE 5C2BH 3A0HE 3PWJB 2VLMD 4ORGA 5E2VL 2QMJA 1B4LA 1LTTC 3FT9A 5FM4A 1L4IA 4IJTA 3VGFA 1T21A 4L5FH 4HOWA 3HFML 3VRJB 1QQDA 4X4KA 3VOPA 4GP8B 2VLME 4HKJA 4KO6A 2ICEB 2YOCA 2GEEA 1OSYA 5HDBB 3B37A 4XXWA 5KYWA 2WQXA 2IEPA 4X98B 4CBPA 4G9FB 5C71A 3GHBH 3Q01A 2DWTA 5KSAC 3G6AB 1OO2A 1FF5A 4OB5H 2LU5A 2UUDK 4OI9A 4JRXB 5I0VA 5JXEC 4HH9B 3FPYA 4FXGB 5DK0B 2M8RA 4PGJA 1N6QH 5IMOB 1LTAC 4FL4B 3GBNH 4PRPA 5DRNA 1FZEA 4PYHA 5J4MA 4KV5F 4HB1A 3NN8A 5EBMA 2AEQH 3HA0A 2Y5TB 4PV8A 3OKKA 1A2YB 3H55A 5DHVA 3EBHA 5DHMC 1R5WA 3WXWH 2A5UA 3L74G 3SGEI 2AABL 1KNOB 4MB5A 2VN6A 3HZVB 4GBXB 4H26A 1G7HB 2A77H 3DJ9A 1MJ8L 4NO3B 4Q4IA 5JOPE 5FO9B 1H15B 4NAQA 4EI5A 3BSZL 1HHKB 4JM4L 3RHWF 3O6LL 2KHAA 3H85A 4ODTL 2R2HA 4TNGA 3V4UH 5HHOA 1DQLL 3NIGF 5EF3A 3NRFA 1CTOA 1HIMH 1YMMD 3BKYL 4Y16D 3CBJB 1PD6A 3QDMD 1UA6L 3QZLA 4ADIA 4NERA 1JVOA 1KB5B 1KJ2B 2DPKA 2FECL 3C75A 4HV8B 1AGEB 3TXAA 3BHBA 2FGWL 4P3DB 2OGUA 4L8CA 3JTSA 1PIXA 2ZCLH 1YMME 4XAWL 1A1NB 3WUUA 3QJQB 3FSVA 2ZSVA 1YEDB 4G6KH 3RU8H 3ESUF 4U1KA 4PVLA 2NR6D 2YRZA 2WSEH 2IDSA 2ZYAA 4H7VA 1CT8B 2ADIB 4F92B 4DK5A 3EYFA 2Z31B 2FJHA 5D1ZD 4EIUA 4X80H 4JK0D 1UB6A 3D34A 5DQ9B 3TBTA 1P6FA 3L71D 3VD1A 3L81A 4EVNB 3VCLA 5GS0L 5BJTA 5IQNA 3A4DA 3T3PE 3BQVA 3WS6C 3QIBC 4QRRE 3QEUA 5G2NA 3SQBB 2WSCH 4OFPA 4K3JH 2P5WB 4BZ2L 1YHPA 1CXLA 1NGYB 1SFCC 2MTAA 4LKCA 3L71E 3D4ZA 4R96A 3S36H 5JHBA 3TNUA 4ZFZB 5CGTA 4FA7B 1EHKB 2EDBA 3SE8H 1ZVHA 3SDCC 4UTAH 1P4IH 4YE4L 3K0WA 2G75B 2EH8H 4M4RB 4JJHA 2Y7LA 4LSUH 2DAVA 2NUTA 4DCQA 3PHQA 4P2QA 1CFTA 1A9VA 4LLYB 5EPMB 1IBDA 3WTTA 1FZAA 2CMRL 2Y1YA 2DKMA 5DSCB 1Q72L 2XXMB 3EHBB 3FS9A 4NRYA 1CZ8L 1HE7A 3DVNB 4XCCH 1T0PB 2GY7B 3A0OA 3MJ9H 2W38A 3L3OC 3LZRA 4FXKA 4BXSV 4M5ZH 5FKPA 3T0XA 3SDYH 5I8KH 1G2CB 2HG5A 3FBKA 5CP7B 3ZE1F 5HYJD 3MLPA 1B3IA 1HXYA 3GF7A 1M05A 2ADJA 3BOVA 4HJGH 3IYLW 3V5HA 1HT6A 4I4WB 1A7NH 2KI6A 4J6RH 2ZONA 1OAZH 4ELMB 2Z9TA 2NY2C 2OR9L 4G8IB 4B53A 3UTTD 1H0TA 3BW9A 5KZCD 1OW0C 5HYJE 1XIWA 5EEVA 4NZRH 3RJDA 4ZYKB 4JFFA 3V4WA 3E1F1 1KEGL 1XBRA 3H1JD 5GGQH 1HI6B 4FQCL 2ED9A 2VMCA 1SMAA 3U79A 5DC2A 2WT7B 3CCEP 5EUOE 1I1FA 1S5LE 2HRPH 3QHZH 5C0JB 2PABA 5EOCL 5JQHC 5KBDA 4DEPB 1IC4H 1KBGH 1IL1A 3FW6A 3KGRA 3HW7A 3KLKA 2AJ3B 3R4YA 1VFAB 2ZP0T 5DO2C 3VFMA 4KAQH 4NO2B 4ZBJA 4Z76A 1MRDH 3Q9QA 1OP4A 1FZKB 2VR5A 3NSDA 5EU3A 4ZXBB 1ZANL 2CHNA 1BM7A 3Q5SA 3D3VB 4DKEL 3M1BB 2NY5C 1FHNA 3TF5A 4JLRB 1C08A 4YHZH 3VYOA 4Y16B 2IPKA 2Y1VA 2X53A 2CR3A 1KB9E 2E9BA 2GCYB 2NY3D 2X05A 3ZKSD 1JAEA 7CGTA 5IJVB 3QDMB 3ZO9A 5IREA 1MZ9A 3AWEA 1NMCB 2AQ1A 2Z91A 4B6ZA 3MRIA 2J5LB 4M7LT 1GK4A 3II6A 2QZ5A 1PGRB 2J73A 1XF1A 1U4FA 5IROA 3BUTA 4M7JL 4IBQA 4AG4H 2OTWB 1LO3H 1ZV2A 4HS8H 5CXPA 3U9PH 4MAYC 3WFHB 3T3PB 1DQJB 1XGUB 4NC1C 5A2AA 2QKIC 1BXVA 1JZDC 2XZCH 1R34A 2FEJA 3P9WB 5C8JA 4ZOAA 3OKDA 3N91A 4LPVA 1FH5L 2UZXB 3QC5X 2XQYK 4N2OA 4V2BA 4A6YL 2W90A 4QRPD 1DUYB 3VJ6A 4W9JC 4JAMB 2XQBH 4AUJA 3RWHA 1QBBA 5F7AA 2Y2WA 4OCXL 2DD8L 4A7QA 4Z3JA 1SQXJ 1JE6A 2ZIDA 3GXIA 4QRPE 2X1OA 3MLTB 4AL8C 1LYQA 3QEGH 1MFEH 1R5IA 5CEZD 3FTUA 4NN5C 5FKAB 4MHHG 4JQIH 3G71P 4OCRL 1T83C 4R26H 1KEML 1E3XA 1UXMA 3EFFB 1RZ8B 4AUWA 5DHYA 2Q86B 1W72L 3EYUL 3R8QA 3EYSH 4H0GA 5D55A 4FC3E 3CXHI 5C09D 3SJVE 2J2ZA 1RV6X 4Z0BL 4YH6A 5JTWA 2BHYA 3LVTA 4ODUA 1M71B 5ECJE 1FAVA 4NQDB 2VMEA 1KUMA 1MCWM 5HYJB 3CFEB 5GRVK 4WO4C 3SE3A 4GQ9L 2VKXA 5ACZA 1JWSB 2E6JA 2AXHA 1WAPA 1ASPA 4U6HA 1H3WM 3LPGA 1VQMP 2ZAGA 4PD4I 5EUOB 3FT0A 3UTTB 3N43F 1MVUA 4OM0L 3ZY7A 5AFAA 4JJ5A 4NPDA 3L75D 3MV8A 4WFGE 4POYA 3CSGA 4L9LA 3ARFA 5APQA 2JKWA 1HCYA 3FTXA 1BVKA 2OYOA 5JNYB 3SKJL 1NLBL 5BV7L 3ESPA 4MZ2A 4S0TD 1ZTXL 3L75E 3MCLL 1GYWA 5D1XA 4IL6H 3WUWB 5FYJD 4YHIA 3I75A 5HYIA 1AYRA 5FO8A 1HILA 5KKZB 1R4XA 2DBLH 2VLJA 2HZHA 2BHUA 1XXDC 2ZZUT 2J88L 2Q3XA 3P1VA 4P49A 3VGGA 3Q8AA 1NBVL 4H44B 4PJIF 4PJIA 3MGNA 1AC0A 3EO1B 3IETA 3H3PH 4H5SA 5FYJE 3WFEL 4J3OC 1COBA 5BS0D 4N87A 3F00A 4QRQA 1AFVL 4LVNC 5AWNL 2P5EE 1HSBB 2EC9U 2PTTB 4CJ1A 1ETZA 5DZVA 2PCPA 5FGBA 1A7BA 5B3SB 3T71A 1Y0LA 1P4BL 1KYOH 3CC2P 4MMXA 4ZS6C 3SYAA 3WE6B 4HFUH 1ZE3H 2W9EH 3FT4A 4WIQA 4WU5A 4WWKC 2GK2A 1G84A 4KMTH 5DD1L 5DA4A 3LIZL 1S8DA 3N3EA 5DFTA 2NYZA 4JE4B 2F7PA 4HPOL 1ACCA 5AVUB 1Z0NA 3UC2A 3QCTL 4NM4H 4LLWB 4XO3A 1BF8A 2NQCA 1KILD 2K8MA 4CADB 1J8HD 2LHAA 5FOJA 3N1MC 2Q7YB 3VWKD 5CCGC 3TYGL 3CC7P 4X6CE 3WKNA 4TULH 3BN9C 3O2WL 5C0BA 3WFDL 4P99A 1T1YB 4N1CA 4YHLL 3QA3A 4PJ7F 4PJ7A 1OXZA 3WL9A 3S0PA 2VC2H 3RIKA 4M1CC 1BSNA 3OZLA 2X40A 3R06B 3B2MA 1MVFA 4KJPD 3DO7B 1J8HE 3CL3D 5KVEL 3FQTA 4W4NA 3VRIA 4MDJA 3QUHA 3FONA 3WYRA 1JYVA 3BH9B 4AEIH 3P2TA 3AABA 5C09B 43C9B 4APQC 3FO0H 3FTGA 3L72G 4CRPA 1X5KA 2VRQA 1T20A 3DOSA 3NIDF 2G3NA 3MV11 5D7LA 1GZPB 2OMVB 1FZJA 3MNZB 3WIHH 3L72J 1L6XA 4MA8H 3BRTB 4Q6YA 1R8EA 1R0AL 3QJSB 4HHAB 2IAMC 1U7MA 1S7VA 3O4LB 5H8DA 1XSKA 4KUZL 1VHPA 2X1XR 3LKSA 4UT6H 1MWAA 4OF8A 3E6HA 4R90L 4LGDE 2RTTA 4FA8A 4PWFA 3BVDB 4M93C 2CBQA 4WUUA 2YXRB 4F9PC 2V7HA 4OV5B 2AAAA 4PRBB 3ARED 4JZNA 2W92A 4BK8A 1JGDA 1S9VB 3BJLA 4UAOB 2KDGA 4LBEA 4XMPH 1YPZE 3B7YA 3QUZC 1I7ZB 1A9EA 1Q9OA 4HEMA 1D5MB 3V0IA 1ETB1 2GQHA 1JI1A 3RY6C 3QQ9C 2FEEL 4WGVB 4BWUA 4HPYH 1ZHBB 5TQ0H 3D71A 3QH3B 2XQYA 2DQTH 3VTAA 2DOCA 2D7TL 4K23H 3SO5A 2VM3A 4I5BB 5GGSY 4JY6A 4NPKA 1KXHA 1QUNA 3H6PA 1A7PH 4KRPD 3C5ZD 1XBDA 5BS0B 3H1LJ 4UOW1 5HSFA 1U8HB 2VZUA 3RL2B 3ULSA 3SQOL 1ZTMA 3NSXA 2GJ6D 2XG5A 1X7QA 4C7NA 4ZO8A 3TJHC 1YNLH 4QLRA 4WU7A 1AKJB 4BFFA 1NTKG 1E27A 1G7MA 3DSFL 3HMWH 4MKMA 3CCQP 1DBKL 2GJ6E 1NYHA 1TVHA 3F7KA 3P4OA 4LNRB 1ZLSL 3LZNA 4C54A 1B90A 1QI5A 3EOBA 1MZZA 1KILB 1QLEH 4S11A 3RBXA 2FH6A 4K0OA 4TNWK 5FYLL 3VWKB 1E30A 4XB3A 2X9WA 1TVBA 1V7NH 2OMXB 3DTUB 5C86A 3A21A 3ZXAC 1IARB 2YAOA 2CKBL 4I2XA 1JDAA 2XWJB 5T3ZL 4BQ9A 5FB8A 4WUKH 4F5CE 1ED3B 1BMZA 4TVSa 4KXAA 5LO7A 4OJFL 4F33B 4JW3A 3ULUF 5K59E 1QACA 1H6UA 4RAVB 4L0YA 1XSJA 2CDFA 4BH7A 1BOYA 1N3NB 1U93A 4MXWL 2CIKA 5T1KD 1WBYB 5AOJA 3VFUB 4GRWE 1ODAA 4HIXH 2XX0A 4D9LH 4P23B 1FC2D 4JFZH 5K39A 3K6OA 3S5LB 2PP7A 4EIZC 3CVCA 1YA5A 3V6ZA 1E5WA 1PYWB 2GT9A 3DK0A 1YY9C 3MRKA 5FUCE 5E1QA 3UZVB 3C6SB 2E7CA 2NSMA 3U48A 4Z1MH 1E67A 1KGJA 2DQHH 2F74B 5L4IA 3WELA 3HE6D 3RFZB 3SKOB 4Q6KA 2Y0EA 1O0VA 2X4SA 1YYLL 2H8PD 5C39A 1NMBL 4PGZA 4WTXA 5E4OA 3NPSC 5A7EA 4FFZH 1OVZA 4H20L 4UBDD 2DQMA 5CJXA 4YFLI 3VYIA 3MRGA 2FLMA 4A37A 1X3DA 1DLFL 3CX5I 3AREB 2ERJB 4H1LG 2DZEA 4N9GA 3BEVB 4TKWA 3I6KB 1A5FL 2UWEF 4PRAA 2UWEA 5F7BA 2JLLA 4JANB 1UH4A 3BH8A 5JQ6H 3QZWG 3MCKB 3QFDA 5GRJL 5I1AA 3E1ZA 4J7RA 2LAAA 1JZ3A 2JKJA 3GKZA 1JHLL 1JPFA 1P7KA 3IDNB 4QTHA 1FVDB 1WV7T 2HKFH 3V4PA 1SMDA 1SJHA 2OMNA 2BSRB 1Z66A 4NLHA 2EXTA 5EOTA 2Z92A 2NDGA 4FLQA 1OV8A 1SDAB 3VFWA 2QQLH 3ZDYE 2QJYC 3X11B 4Z8FL 2R1WA 1AZUA 2FYUD 4QD2E 4MB4A 3L9BA 1IIIA 1YEGL 2WSFH 1A6AA 1LK3H 4U6YA 1OWRM 1MNUL 2WLIB 3NCJL 3PL6D 1SLXA 5EH1A 3ELQA 1YRKA 3E3QE 2FYUE 4DESA 1ZHLA 2F5AH 1F58L 1HUCA 4Q6IB 5CD3A 3PDOB 3MV7D 4KKRA 4WW2C 3EQ2A 4YNYB 2CXKA 4U1IA 4JFHD 4ZMYA 5JOEA 5GSVB 3WBDA 2LVCA 4P5MB 1W16A 4NI3A 2XKNA 1WP6A 3RKDD 1NPUA 5LNEA 2WM0A 4P9HH 4AQ1C 1F45A 1VPCA 2NY0C 2ZOUA 3MV7E 5CBOA 2CO6B 4JFHE 3DYMA 2I8DA 4K07A 1JGUL 4NUMA 3VXRA 3ZQ9A 1IEAB 3SPIA 5AVXB 4FEMA 4Z0XA 1YEHH 2FBOJ 4TRPH 2YXFA 3DBXB 2WKGA 1K4CB 1T6BX 3FRUB 3MV9A 3N6YA 1HYSC 4X4YA 4JY4B 3L4VA 2VR4A 1N5AA 4FQXD 4W6YB 5CLZA 4K3DH 4JPZB 4AGLA 1X9UA 4R7LA 4GUQA 3QP3A 1HH6A 2YAMA 5I73C 5IBTH 2C3XA 2HODB 3TFBA 3TU6A 3MRRA 2ZAHA 4IOSA 2OMWB 2PGDA 4JYCA 1QP1A 3C9NB 4Y4HA 1E4XI 4Z7NF 1LJ2A 5CWSA 1B0IA 4PJBE 1PZUB 4RMSA 3WMM0 3F7RA 4FYTA 3HE6B 3HJEA 5HJDA 1GTNA 4IOFD 2GIMA 1C7TA 4P0DA 5IESH 3QZBA 5EIIB 2M5AA 1SQVG 1DZ0A 3MU3A 3OMNB 4RSYA 4UCFA 4BFIA 3LW5J 3LMJH 2R32A 4PTUB 1QR4A 4MNHA 2UXGA 5BXFA 3W2DL 3CZKA 2FX9L 2BJML 3R4DA 5M7QA 3MODH 2DQGL 1FZBA 3EFGA 3D39D 3U2SB 1NGQH 2NT1A 4N0FA 4I0KA 3P4MA 4PGDB 4ECNA 3HC4H 4NSKA 5DVNA 1MJUH 2OMYB 1HINH 4ERSH 1UJTA 2A9NH 1WHOA 3ZDYB 3D39E 5GGRA 1G4MA 3CX2A 5FA3B 2AKRB 1ZE3C 3FOMB 1IC5L 1JV5B 2A6JB 2OX5A 2XN2A 2KLRA 2OMUA 2C4XA 2X6UA 4HGMA 2NY4D 4XCEB 5LN4A 2R4RL 3KJ4B 3WO4B 1WBZA 2R1YB 3SZ6A 1D5XB 1TTAA 3QJHA 4AVKA 1SVCP 4O00A 4OKVB 5I66B 5A6LA 4MDIB 3BCCG 2JI3A 3MX0A 3PL6B 1KCRH 4ZUSB 4YGVB 4KVNL 2KYVA 4KX9A 2X4NA 4OM1H 4WGWB 3MN8A 3ZHLA 3LRMA 3SWKA 1KXQA 2HWZL 4W9DC 4ZT1A 3H0TA 1R3HB 4QRFA 1MJ7H 5LGJA 4X4MA 4LASH 2V3FA 1F8TL 3V2NA 1LNQA 3R0NA 4TLKA 1CFSB 2K4AA 5F7LB 3HRNA 4TLFA 2R0KL 3TO4D 1QUPA 5E1HB 4E5XB 2FEDC 3VQ1C 1GDTA 3S8WA 3FTZA 4NOFA 3I50L 3IDMB 4QWWD 1EC5A 1K5NA 5DTFB 1VQ7P 3IXTA 2OP4L 5MI0B 1XEUA 5BVJB 5GZOD 5CLTA 3QIWD 2ZAIA 2BCKB 2OTUB 2R23B 2X7LA 2TRHA 2EE6A 2IXQA 3A23A 1N6VA 1TTGA 3BQUC 4OIFA 2EEFA 3GHEL 3SO3C 1N7SC 3OKLB 4HIEB 1BJ1J 4UTBA 3HG3A 4LLDA 1OF2B 4FQXB 4XMTA 5CIPA 1CDYA 1U3YA 1HHJB 1EVTC 2OTPA 5APUA 1AZRA 3PPEA 2P8MB 4BQBA 1N68A 4F5CA 3MXWL 5CGYD 4LRIC 4XCNB 5BQDA 1IFHL 5CLXA 5J9PB 4HUVB 3GG2A 5GGTL 4JKKA 4ZSOA 2J6EL 3HS0B 1T1XB 1TSHA 2FNBA 4FTVD 4KTYA 2BS8A 2DB8A 1HC1A 3H6JA 4JGMA 3T97A 1NAMH 4P2OA 1EJOH 3BSHA 3TO2B 1BDYA 3O9WC 1U8PB 2ALWA 3CFUA 1OP5K 4JNXA 5KLVD 4ENEC 1SQXK 1KGCE 2CO2A 4QT5A 4GAJH 5E23A 2RJMA 2XWBA 4FTVE 3VG9C 4L2YA 4MAUL 4NN6C 1KJVA 5DMKA 5T1DH 2C4FU 2IWFA 4ONHA 5I71C 4OQTH 1FVCB 1N26A 1NBCA 4M1GL 1R5VA 4UILL 5C7ZA 5TE7H 1Z9SA 2VDOH 3IJHA 4Z7VB 5DS8B 3KBPA 3TPUA 4MRCA 1X5FA 3C6EA 3WJLA 2X0VA 4HBQA 5E7FA 1K6QL 3QNXA 1I1RA 5DMIH 3ROOB 3RZWA 2FHFA 2GI0A 2SEBA 1MQKL 3P40A 4FTDA 3VRLE 5EOCJ 2AAVA 3QAQA 2KOGA 1V27A 4U1JB 4KKAC 1KB3A 3ETBJ 5L88L 1RP9A 3MLXH 4CVUA 3ECBB 1I3UA 1FBIH 3GJFH 1MHEA 5J13C 4PJCA 2DTML 5I1CH 3GXDA 2GITB 3KPPA 4FMVA 2JKLA 1LTSC 4UB8H 5IB5A 2NY4B 4EN3B 4YLBA 3IMVA 1S46A 3HS9A 5DJ0A 1DSFL 2DQUL 1EO8H 3EBIA 1OTUC 1HZKA 1ZLUK 4ISVB 3BUBA 1IAIM 4JVPA 3VFNA 3D4GA 5LG1A 5LKNA 2A6IB 4JFSA 3QXDA 3C60C 4WWPA 3TBYA 2DWSA 5DVKA 3RY5A 1A4BA 1L9QA 1N0LA 3E8UH 4GAGH 1L7TL 4OV6F 3QQNA 3QQ4B 4F7EA 5MEPA 1V3JA 4NJ9L 2IBBA 3SPJA 2CO7A 1T3JA 2XBDA 3FN0L 1BQLL 1A3RH 3SGJC 1JK8B 4F9LC 3X3FH 5M94B 1JK9A 5IFAL 1NAKH 4BUHA 1UURA 4PJ9A 1OAQH 3L48A 3AE4C 3V5DA 2N59A 1IQWH 2DMBA 4FLHA 2FDBP 4J3WA 2X6BA 4LOEA 1B6UA 3WKML 3BC9A 5E8EB 4D8OA 1EEZB 5BO1H 3S5ZA 3FFCA 1Q2NA 1UWYA 2OYLA 2ADGA 4MCZB 1L9NA 5IJDC 3PRJA 3GO1L 4GRMA 5KYXB 2EIZA 2FD6H 3G08B 5D1QC 5E2WL 4IHBA 3UAAA 5C0AD 3S48A 3TN0C 3G5ZA 4TVPH 5CNHA 2P49B 4YHKL 4ZFOA 3L4FA 2VLKB 2AXJA 2JCWA 1F3JA 2OPCA 3OR6B 3ARDC 4H40A 5DUPH 1TQSA 1NTZK 4LSPH 4MQ7A 2CHXA 1I8IB 5EU6E 5EBLB 5AD0B 3CLFL 5C0AE 3RTQA 1KIUA 5F7YC 4LEBA 3GEFA 1XD0A 2YIHA 3MJ7B 3Q5TA 3H1ZA 5IB3B 2XG4A 1EFXD 5GRUH 2H6PA 2OW6A 5HGBB 1J0HA 1MI5D 4N25A 4NOBA 3X13B 2ZCHH 1WT5C 4K7PH 1DD4A 3RX9A 2WZPA 1DVFC 2XACC 5L9DL 2YD1A 3GUFA 3MUDC 3REWB 1SVBA 4NT6B 2W80C 1ZLWH 3ECUA 2Q0ZX 4LCWB 1KCKA 3IN2A 3DXAA 4RESB 3QPKA 5KJRL 3TVMD 1W9XA 5FUZH 4ONGL 1VQLP 1HHGB 4FZ8L 1U3HA 2RQ8A 2WBJA 1P4IL 1ZT7A 3CFBB 4N2LA 3ZKMC 2BVOB 2JKIS 3N42B 4A38A 3L4UA 1NCTA 3B9AA 3VWJB 3GHGC 3O41B 3LPFA 3C6LD 5DUJA 1QFOA 2F53D 3IFOA 3O8ZA 3WU2H 2X89D 4HIHB 5F0MB 3TM6A 4AI7A 3QG7H 3O3AB 3O2DL 3O8XC 1H9VA 1NTMJ 4QHNB 4KNSA 4FQIH 5JIMA 1OW8A 4QRSB 1D7FA 2HRGA 2NY6C 3KWVA 4AYFA 1FA4A 3V6FA 3GT6A 1NWPA 1WD8A 4NI6A 3BVNA 4GW4A 4Y4FA 2F53E 4AYGA 3CH1B 4FNLH 1N64L 1WWWX 5DZAA 3SD5A 3B5NA 2DWDB 3QDHA 5TD4A 3S3JA 4ZFFA 1A7NL 5IW3A 3US0A 1IM9A 4KKQA 2GAZA 4P9HC 1OAZL 3QRFM 1ICTA 1ZVSA 1CFQA 3OG6B 4XVOA 4KJYA 3HHSA 2XWTA 5ETUB 3L5IA 2YQ3A 3FC8A 3L70G 2XIIA 3L4ZA 5G5DB 3TX4A 1W6LA 1CLOH 3L3GB 4JG1L 4EF3A 2V33A 1KB5H 1FC1A 1KJ2H 4KTDL 4MJID 4H8UA 1AI1H 2MQ0A 5GISL 3NZ8A 3L70J 3FT3B 3H1IJ 4KGLA 3TGUG 1KBGL 4GKNB 5I74B 2IDBA 1J11A 3V0DA 2YD4A 4TS6A 4ZS7L 1C5BL 1KMGA 3JWNG 5DJ6A 3CMAP 4JPIA 4RGOH 3MRFB 1GXEA 3QG6B 4H0LB 3U46A 4EUPB 2H9GB 2XKMA 1T0OA 3PGFH 2JB6B 3U9UB 4Y9CA 2YMYA 2EDMA 2HP4A 4FNSA 4KPHH 3H9HA 5D4QA 5DZLA 4KGJA 4GI8A 3FUIA 3O3UN 5EUKA 4R8WL 1LVEA 3GGWA 1IAII 1TR7A 2OSLB 3ZE2B 4N78D 3IJYB 4XE0A 3SDDD 2WB1A 2MCG1 2P7JA 1S7XB 4L9DA 3WUTA 3D8MA 3FU8A 4CJ0A 4NNYA 1YNKH 3HG5A 1RF1C 1QAWA 2X88A 4KX7A 4YK4B 3EDDA 1BFVL 3RGVC 4R3SB 3ZTJH 4YHOL 3DBSA 2PO6A 2CRMA 3ARGA 4L1DA 5B3JF 4MJ5B 1EFXB 2IH3B 4I0PC 1MI5B 4NIYE 3S35L 4NKMB 3PLYA 2CPSA 5I17B 1T5XA 2HCZX 2R4SH 2V7QH 1VACA 2WINB 4N8UA 4PJGB 3WMPA 2IADA 3OKOB 2K70A 1DLHA 2OZ4H 1JHTB 4PUBL 5HHPB 1A1OA 4R83A 3PP5A 3I6GA 1R33A 4KO7A 3NJVA 4JPKH 4M6MH 3S2AA 1FVEA 4FFTA 3T4AB 1GVIA 4OD3L 4ZMNA 3GXTA 4PP1C 1E5ZA 1RZ7L 1J18A 1CDJA 3L74D 4N20A 4PJDB 3T3ME 2ZOOA 5CFHA 3HNSH 2QDVA 3WLWC 1X9RA 4JHVA 4ZFGL 1LEKB 4Z95L 1FZCA 1V3KA 4FX5A 7PAZA 2YEQA 4QR7A 4IYKA 1JNNL 1JOIA 2UY6B 4UQAA 1EJFA 4N2GA 5DJZB 1H6EA 3V6OC 3WEBA 3L74E 1LE9A 4JHWH 5BRZD 5DYOA 3LPPA 3ZU8A 5E1GA 4RFEB 2BY2A 2GBAA 2KS1A 1DP0A 3TFKC 3SE4C 3CUPA 3AS0A 5F7EH 5D7JC 3VFRB 3GSUB 2K9FB 4N6QA 4V2CB 4LSDA 4MJIB 4XCYA 2B4CH 5HY9A 3HNTL 3MRNB 4Y1AA 3BD3A 4JFEA 2C9PA 3QORD 3E80A 2OL3B 1UADC 2ETWA 5DQJB 2WYHA 4TNVK 4XOBA 3DX8B 5ID1B 2WVSA 2YAEA 3K2UL 1UZ6E 2BOCA 2WJ7A 2ZCKH 4KJWC 2WXGA 1BFOB 2FUQA 3KPSB 3T0ED 1MRCL 1NBZB 2BZCA 5DLML 2EXWD 4QGTA 4X7DC 3BZ4B 1LTBC 4XI5C 3IFNL 3U7WH 5DT1L 4P57B 1MFCL 1TEFA 2QQQA 3AITA 4AH2B 3M6DA 4MS8D 2IALA 3T0EE 1T2QH 3WN5C 4OT1H 1IGIL 5IIEB 3DUSB 2Q2LA 3NYKA 3V9EA 3D85A 2AJYL 2DM2A 1CLZH 1GGYA 2Q9OA 1JTPA 1FBMA 4P5KA 3S3SA 3ZT5A 3AMKA 1FOSE 3U0WL 4K35A 3D69B 5T1JA 3MQIA 1R3IL 2BLFA 3TPKA 5D4JA 2QJPC 2W9EL 4PRIA 3ETSA 3MOAL 5ICXB 4CAGA 4UINL 1EEYB 1ZHNA 4K9EL 3MRLB 2OYHA 3NDZE 3O45B 3OLDA 4LOFA 1HGVA 1F42A 2HMIC 4Z77A 1YDPB 3AG1B 4FFYA 5I6XB 3UAEA 2WWMD 4ES9A 4XVJH 2AVFA 3WS3A 2VDMB 4DGYL 3QUXD 3LHPH 1JZEA 4CU7A 4DZBA 4AQ8A 3D12B 2VC2L 1G1JA 3PIQB 1WAEA 3NCCB 1EGJL 1E2ZA 1S7QA 2HX7A 3BWUC 4BFRA 4FP8H 1VCAA 2K37A 3N9GH 4X6BB 1N4XH 1WFUA 4N0CC 1S7WA 2NZ9D 5LCVH 3V0WL 5D71L 1TZGH 4YC2C 1FZMB 3Q5RA 2EQDA 4N2NA 2EDQA 2I7OA 2Y6SC 2KLVA 3WNPA 1KIQB 3IDGA 3LD8B 5C9JA 1QA9B 4M5YH 1EVUA 1HHIB 4KK8C 4PRHB 3G6DL 4ZNCA 3QUKB 3CPWO 3T4YA 3WIHL 3HZ3A 4JHUA 5H2BA 5CKAA 4G43A 3N85H 1TYRA 1I8LC 4MQXD 5HBBA 2IGLA 2M0BA 4H88L 4XO4A 4YWGH 3VQMA 5BRZB 2A6DB 2LT9A 3LV3B 2NY7H 4YHNA 4AJWA 5F6IB 4ZTOL 4Y2OB 4A7UA 2M26A 4XE5B 3T08A 3BZFA 1XH3B 2EVJA 4JL1A 1AVAA 1H5BA 1Z32X 4S1RH 2Z65C 5E5UB 3U0PA 5T1LD 1ZY9A 4M62H 4OLYH 1JCCA 1C5CH 1AIFB 1S7UB 2EO1A 5HJ3A 2FCBA 2I9LA 1XF5A 1OZTG 3Q6GL 1FRGH 1ZGLP 3U7AA 4RCAA 1XTLA 1ET5A 3KHUA 1QASA 3QORB 4I3RH 1OK8A 4LMQE 3PWNA 4Y4KC 1J5IA 5GRZA 3LB6D 1L5GB 2P2UA 4JM2F 4JM2A 2O01N 4JG0H 1NCAL 1JOCA 2HN7B 5D93C 3P8MC 4ZPVB 2HUHA 3GWJA 4LQFL 4Y5YB 4XVUD 4XWOC 3D2UA 1OTSC 1MHPL 3KGUA 1T04A 3KGSA 3PWVA 4MNQD 3TEZA 5MEOA 4WTQA 1RJYA 1RK0B 4G1EA 2DL2A 3QULA 5DK2B 2NNAA 3B71A 2B87A 2R2CA 4HKZH 4GMSH 1SQ2N 4AMWA 1A7PL 2R69H 2D3LA 2MQGA 3QXAA 3RBSA 2LXBA 1FO0L 3W9DA 4KXBA 3GLEA 4MNQE 3RWDB 4HSCX 1QFWL 1AJ7H 3M0AA 4DN3L 1MFDH 3E1RA 3PGDB 4PVMA 5HI5D 1EMTL 3PHOB 5KVFL 3BP4A 4QJ5B 5A1AA 5CEZH 2WP3O 4CSSA 3EJZC 1L0QA 4XBPA 3AXLB 5T3XL 5DXWA 5CCHA 2L0DA 2BEZF 4YTPC 3N1FC 4NQTA 5BRQA 5EO9A 2Q5UA 1B2WH 2N4IA 4FXGC 4XRCB 4YZWA 1T1WB 4M8VA 4PWHA 5F72S 1FNSH 3ULVL 2EVFA 4HPHA 3DETC 4PJ0E 1H3TA 4PWEA 3DARA 3GBLA 1V7NL 3QUXB 4ODHL 2J1XA 4ELDA 4CSTA 2QRXA 3VM5A 4D7BA 4GBXC 1NWOA 5GQBA 2I60H 5HPMA 2HSIA 1F6LL 1GOGA 3QDJB 4PGEB 5DEGB 1RMFH 3D0VA 4M6NL 5CJOL 5JO5B 5IM7A 2RQEA 3BXNB 1JTHB 2Z3FA 1FFQA 1UVQA 1NICA 3WHE0 2W60B 3BT2L 1JTOA 4R0LB 4Z3IA 1L7IH 1MFVA 1PKQE 3QDGA 4U1SA 3CZSA 1YIJP 1FZGA 4KROC 3FCGA 2UZPA 4BKTC 4FG0A 3GSRA 2ZUXA 1AY1H 2IBZG 3NRPA 2YMXH 1RZIB 5F1NA 1ES0A 5I8CA 2ARJA 5FYJH 1DCEA 1WWAX 4G6FB 2JTDA 3ZO0A 4DP6X 2ADFL 5DDHA 3VH8A 3PP4H 4KVCH 3CDZB 4BUGA 5GJTL 3C2AH 1TG8A 1P84I 4PD4D 1RE3C 1MSPA 1PFCA 1S3JA 5GSRB 3L73G 2EXSA 5DD0H 3U83A 4BCZA 4PR5B 2QE7H 5I75C 1IV8A 2EE2A 2XZRA 1MY7A 4M03A 3BEWB 5DVOA 1U8QB 1J7VR 3HS8A 2CPUA 1E3ZA 1X5IA 2Q5BA 2Y9ZA 1DQQA 5HHNA 3ZYIA 2NPSD 3BKCH 1BM3L 4LARH 4QTIH 5DZ9A 5KS9A 3WOVA 1UXWA 3UIZA 4J5VA 4WZ9A 4RRPA 2ZYDA 1BLNB 1RKRA 2HVJA 5HGAB 1N18A 4MNQB 1QL2A 1JNHA 2F54A 3K81A 1U8MB 2LFGA 3S98A 5JUEL 1OVRA 1Q0XH 4TSAH 3RZCA 4IGBA 4PHZA 1AZCA 2ZVOB 4YOKA 4TSCH 4RMQA 1FCCA 2TRYA 2A9DA 1IAOA 1NDMA 1K8DA 1EDQA 3EHBC 5FGCE 4UDTA 3KCPA 2AEPL 1MJJA 1P6WA 4CVXA 3DX6B 5L4MA 3KDMB 2IANA 1ODUA 3AUVA 4J4PD 5LXGH 4ASWA 1HYRC 2EDTA 3NJIA 4FJ6A 4H8QA 2AJVH 1N10A 3ARYA 3VYNA 1HZLA 4NUQA 3O81A 2MHAA 4ABUA 4Q2ZB 3WV0A 4F58H 5CZVL 4JN2B 5E95B 3IDJB 2HFEA 1ZGLB 1EK3A 5F8QC 4JZJA 3DC0A 4JO4H 4E68A 4P3WA 4OZIE 3K72B 4JRFA 1BZDA 1ECYA 4OIIH 1NBYA 1PLGH 3KWUA 3P30H 1IZKA 4NHCH 4QPEA 3MCYA 1VESA 3WCYA 1PDKB 1U8IB 1L9PA 1NCNA 2AZUA 4M7ZB 1P1ZB 1W0WA 4OGZA 4JRWA 2BINA 1G87A 4G7VH 3VFOA 4KXDA 2K9JB 3PNRB 3NCWA 4XWGL 3S5YA 1GZQB 3VNYA 1VDGA 4XMKL 1BQ5A 4HIQA 4LCIH 4AQZA 5BW7A 5JHLH 1VGKB 4Y16C 4ZODA 3KWWB 3H25A 4TF4A 4NFBA 3W57A 3TNMB 5H35A 3JQOB 3GK8L 1NMCC 2XN0A 3BSZA 4TUKH 5EU4A 2B4CC 2J5LC 4K2UL 5HJBA 1XQ4A 2CU9A 1P7QB 1NDTA 4OGXH 3EUDA 1UIIA 3QHTC 2CPBA 4KO5A 3OTTA 1QVFO 2NR6C 2Z0UA 1IC1A 1M2VB 4XNXL 5F88A 4CW1A 2G9HB 5DUMH 4YHYB 1EIBA 2EIMB 3HI1A 2F61A 5DD5L 5IW6B 3MBEB 2EDJA 1AV1A 5D1ZC 1MPAL 5CP3H 1A0QL 3DMMD 1GOHA 4G5AA 4KMLB 1NGQL 4LHUG 1Q1JH 2R7EB 4ZQKA 1UENA 5INCB 5IVXE 1EUUA 2B7DT 5ADOL 2NPSB 2BOLA 4X6DE 1NTKD 2XWXA 3HE5A 5FHBL 3M8OH 2MH4A 3ZE0E 4ZX6A 4C4KO 1NOAA 1PW3A 5ABZA 3C8VA 1CD8A 1WFMA 2HPOA 2VSMB 4GUPA 1NTMK 3VE0A 4Q9RL 5T1MA 1K72A 3J2PA 5JOFA 3PWLB 3V2QA 1FAIL 1OAYH 3F64A 5CN2A 4JMNA 1AGBA 3ZTDC 4FKHA 1NTKE 5C0CB 3OV6A 2PXYD 2UYLB 3GRWH 4LAQH 4OD2A 5DD3L 5I15H 3EFOA 3FCTB 3MMEA 2WIIA 4BZ2A 1DYZA 4ZOEA 3OAZH 5KUMA 1SUJA 1E6JH 1F6AA 3PXJA 5AW7B 3HLAA 3TNNB 4H13D 1XF4B 4U1LB 4Y5VB 2N1TA 3TCLB 1TNNA 4GRWH 2FH8A 4LCCA 3MUGA 5GGVH 4RX4D 3TEXA 3G5YB 5D96C 4GFTB 5F96L 1A6ZA 3QJFA 1Y47A 1ZHKA 1XF2A 5MEQA 1TJGL 5FA4A 3LXAA 4KTEL 1F4XH 2ATPB 4I3SH 3RJOA 5DUBB 1KIPB 2VN3A 3V6IA 2YOAA 1PG7L 1UD2A 1M1XA 4NM8H 3F6IA 3ZVVA 2F1EA 2Z8RA 3BD5A 4OJDH 5KJ7D 3KBFA 2DTSA 2V8LA 3RWFA 4RLDA 4UM8A 5DJAA 2QSVA 4A67A 3JTBA 2JI1A 2WSCJ