2YO3A

Salmonella enterica sada 1185-1386 fused to gcn4 adaptors (sadak14)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
KQIEDKIEEILSKIYHIENEIARIKKLIKVTDAQVSRNTQSITNLNTQVSNLDTRVTNIENGIGDIVTTGSTKYFKTNTDGADANAQGADSVAIGSGSIAAAENSVALGTNSVADEANTVSVGSSTQQRRITNVAAGVNNTDAVNVAQLKASEAGSVRYETNADGSVNYSVLNLGDGSGGTTRIGNVSAAVNDTDAVNYAQLKRSVEEANTYTDQKMGEMNSKIKGVENKMKQIEDKIEEILSKIYHIENEIARIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 80
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2yo3A01
2.60.40.4050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yo3A02
2WT7B 5AW0B 4LC1A 5AVYB 5AVZB 4B86A 1H89A 1NWQA 1MFZA 4I2LC 2WT7A 4GT1A 2P2UA 3HTKA 3TYYA 1FOSE 1HJBA 1GU5A 2ZFCA 2R5BA 1CZQA 1DH3A 3IR9A 1YYCA 1G2CB 3L35A 5APUA 3M9HA 2XZRA 1HWTC 4AYCA 1CSBA 4AUWA 3MGNA 3A2AA 1MV8A 5AVQB 1OWAA 2WTYA 1GK4A 1NAFA 1FAVA 1MUUA 2N9BA 2QM8A 1OXZA 5APSA 3A7OA 1S9KE 1H8AA 5AVUB 5AW4B 1GZLA 4XE5B 1IO4A 3VMZA 3VMXA 5AVWB 2R5DA 3A5TA 2ZXEB 3P8MC 2WPQA 3HE4B 2QM7A 5APYA 3LIDA 4JYBA 5AVXB 4C7NB 1T2KC 3L36A 3P32A 1CI6B 3HE4A 3KQGA 3OAKA 4RESB 1SP4A 2BASA 4C7NA 2Q5UA 2YO2A 3V5BA 1J2JB 1JNMA 3NXSA 5APVA 4M3LA 1CI6A 3T97A 5APTA 5AW3B 2P67A 3TK1A 3TNUB 5AVRB 1GTWA 3O8ZA 3I5CA 2YNYA 2R32A 4HYTB 3TNUA 2R3CA 2YO3A 1HBWA 5AW6B 3V4WA 3B8EB 2W27A 3M06A 3VN0A 2P7JA 3VYIA 5CMZA 3UIAA 2WPSA 3M9BA 1FOSF 1GD2E 1JUNA 2Z5HA 5AW9B 4DZOA 5AW1B 3M0DA 2E42A 1HUCA 1GK6A 1SLQA 3A3YB 1A02F 2IPPA 2KP8A 3VMYA 3M0AA 4KHXA 2WWWA 3P7KA 3HE5B 3KDPB 2Q3IA 3NFQA 5AVTB 4I6MC 3SWFA 3LIEA 1A02J 4GKGA 3NTNA 4AQRD 2Q7CA 2VRSA 2WPRA 3HE5A 3VTPC 2C9NY 1T2KD 4C46A 3NMDA 4EOTA 1H88A 2W6AA 1KQLA 2JJLA 5AW2B 3L37A 5APXA 2C9LY 5AW7B 5AW5B 5APWA 4JYCA 1S9KD 1X8YA 2XV5A 5AVSB 2H7HA 3V4QA 2Z5IA 3M91A 2E43A 1GU4A 5APQA 3MD0A 5AVVB 5AW8B 2XU6A
chains in the Genus database with same CATH superfamily
3CE1A 4PRPA 4HCRH 1BVKB 4NUGL 4FYQA 4AX3A 3LMJL 3DHJA 4C56E 1FHNA 2CGRL 1W0WB 2MRYA 2A6KA 2VDQL 2WLMA 2E7HA 4FQJH 4JFXB 4MJIA 5CILL 3SOBH 4G83A 3CU1A 4DP4X 1N7ML 3CFJB 2GJZB 1JGVL 5C0GA 2ZFCA 5EFWB 1IFNA 4PREB 1D9KA 1KUMA 1CLYL 5FUOH 4AQEB 3B7TA 5L6YH 2QQLL 3UG4A 2DMGA 3KBPA 3PWNA 4XAWH 5IHWA 1A6ZB 4APXB 1KC8Q 1JCVA 5IWLC 3V6ZB 3SKOB 3VFPA 1BGYJ 5AVQB 2XPYA 3PNWB 4EDXB 1LTBC 4N2GA 4R4ND 5L4JA 3HVNA 4H0LB 2V17L 1AACA 1FYTA 2JKXA 3KG5A 1AR1B 1URQB 2DWEA 5DUPH 4NSKB 2YRBA 2O5ZH 5GIRB 1AXTH 2VKWA 1JCCA 4I18A 1MUJA 5HI4D 3HRZC 4B9FA 2DMKA 4OLZL 1JYWA 4RVBA 3GJEB 4M02A 5HSFA 5CZVL 2JV6A 3QARA 1SM3H 3TIDA 4AT6B 1J8HA 2X53A 4GQQA 3BVTA 4QF1B 1DBKL 3PGCB 3VFOA 2M8XA 1KB9D 2C1OB 3FFDB 2RA1A 2AEMA 1A22B 1TJMA 4ODSL 4U1LA 5D1XA 3ETBJ 4JCWA 4MJ6B 1OWWA 4TVPH 3QUHA 3BPOC 1KEGL 4IU2B 2ZF8A 4HC1L 4LLVB 4WW1A 2CE6A 1R5IB 1N8OE 4QMAA 2DLFH 1BAGA 2OMWA 2XN9B 3AU0A 1KLGB 4IBLT 4GINA 4A67A 1XGUA 5H4YA 2X4PB 1NGZA 3FS9A 1AANA 1VFMA 5SWSA 4WO4B 1NCBL 1S7XB 1Z66A 3SDCD 4JAMB 4JCLA 3F5WA 3QH3A 3M0DA 2HUHA 1A8ZA 3M1OA 5HYJB 4WFGE 1I7UA 2PYEA 1NJ9B 2X3CA 5GJSH 4AM0A 3WAKA 4XMXA 5DEGA 3VMYA 3UBFA 2DEWX 1SFHA 5BV7C 1KGUA 2R2CA 5TDNB 3FTGB 4UYQA 1G0XA 2J55A 3BLKA 1CS6A 1P7HL 3NZSA 1BQLL 4XNUL 3CH1B 3VTPC 3FSVA 1F6AB 4YDIL 4WRLA 1GAFL 2P8LB 3KHUA 3KWTA 4YSQA 1QR1B 2BSDA 1V7NL 1YNLH 1KBGL 2CBMA 3HKZA 1VKXB 5K9OA 4PJFE 2QFRA 3L13A 1PMYA 1D6VH 1R0AL 1P4BL 1T6VN 4X0KB 1GXEA 1EGJL 4NENA 4F7CB 3KVDD 1KXVC 1DO6A 4QDGA 4P2RE 1CZ8H 1VFAA 4LQFH 1NUDA 1RZGA 1VSCA 3RWGB 6PCYA 5K39A 1NC4A 1FH5L 3O6FA 4Y5YA 3ECBB 1DVTA 1NAML 4LC1A 2YD0A 1IFDA 3DJ9A 2Q76A 4HK3N 4PMEA 3RX5A 2F7PA 2A9CA 2CDFB 2BLFA 3VGAB 2XIIA 2RGSA 3ZT6A 4TOYL 2WWMC 4P06A 1NMAL 3O3UN 1FAKT 4FNTA 4GI8A 5KVEE 4MJ2A 1ACXA 5JW4N 1TVHB 2YA0A 3MUGB 5HDWA 2Q8AL 1IILE 2BCKB 4XN1A 3MRDB 4R26H 3R4YA 1HCZA 1PP9J 4AEHH 3RVUD 1L0LJ 1BZ7B 1HILB 4Q74A 2HH0H 3RVVC 1AOHA 4HWZA 4S10A 4QYOA 3WJJC 3MV9B 1T2XA 4OZIB 1HF9A 2IDCA 1LTJA 2RMNA 3DPBB 4G8GB 2QQKL 4P3DA 3X3GH 1SYSA 4GKZA 4DPAX 4ZFGH 4MB4A 1AO7A 1A3QA 1QHQA 2QQQA 4K3JH 3OSKA 4LOVA 3SE3A 3NRQA 5JIIA 3HFML 3ZHKA 3BH9A 4LT7A 3UYOD 4F27A 2EH8H 2YPVL 2NQCA 3HC3L 3TH2T 1CYGA 4W70A 5KSUA 2IZ1A 4N9GB 5DWUL 1GGTA 2WTRB 2X2YA 4XGZB 1BFOA 2KKQA 3T0EC 4F91B 3ULVF 3QEQB 1NLBH 2QKIB 1FFOB 4U3SB 2CIKB 5D7JD 5I8EB 4RDQF 1UWXH 3JUZA 2J88H 4C4BA 5HPMA 4NWUH 5IJVB 4OF5A 1NCGA 2XWTA 2BNRE 1Q72H 5EBGA 1HN1A 4YR6A 3T6XA 1H3WM 1VGKB 4HCGA 1TZ8A 3HE7D 1A1NA 1DQDL 1WT5C 2BSBA 3K8LA 1LHZA 2H0PA 4DOHB 1MEXH 4PG2A 2Y6TE 5FA3B 3RIAK 3T1FA 3WS6A 3WMSA 2W95A 5D7IA 4UIKL 5TE4L 4IOSA 1U8PA 3CC5B 1KJMB 4M5YL 3BH4A 2BVTA 2FYUD 3HNVH 4XVJH 1YDPB 5JPMC 1LM8V 1FZKB 2HKFL 1WP6A 3H4FA 1IM9A 3QO1A 4NJAL 5AKVA 4DGWC 1R46A 2PR4L 4XN8A 3TOPA 2QQNL 1UEMA 3BAKA 1CXHA 3KWXA 2HJFB 5IESH 4JJOA 5B4MC 2MQ3A 5KSVB 4N8VA 3NMDA 3AWEA 5F9JB 4PRBB 4ZMPA 3OXRA 1WF5A 2IADA 5HDBB 3B7SA 3SCMB 2AITA 4GRLC 3RJQB 4HETA 2VDRL 4FXGC 3ZVVA 5DHYB 3FT0A 4I13B 4NO5B 1LE9B 3OKDA 3Q2NA 4WBAA 3KLSA 2P8MA 3FXIC 4JFTA 4PS8A 4DK3A 2F19L 2JWDA 4IRSA 3QCVH 4RLDA 3F12B 2WMPA 5HI3D 4LO9A 1JMMA 4GG6E 4G5AA 5C0AE 3ZKMC 1IC7H 5IJKA 3EZJB 5E6UB 3HTLX 4YO0A 3IDJB 4N1CA 3ULUF 4PIRF 3CFCL 2O6PA 4UOQA 2J1WA 5GGSY 3VGDA 3K71B 3U9WA 3JSSA 2B2XH 1Y6NR 4P0DA 4S1QH 4NOFA 4H44B 1OAYL 1WSST 3FF8A 2ESVA 4M62L 5EUKB 1XL6A 4DT0A 1YYCA 3D07A 1OOWA 1JOCA 1A5FL 2QT6A 3C08L 1M7DB 1J9TA 2OAAA 2WBJC 5EOCL 1GVIA 3A2AA 5JIQA 3C5ZA 5C07A 4TNFA 1J0KA 2WITA 1HZHL 3U0PA 2JH2A 2R51A 3N1FC 4BZ2A 4E41A 3ZT5A 1OT2A 3W0WD 1M57B 1NEPA 3LHAA 3P3SA 2XNAA 4G9DA 2M8RA 3T2LA 5ALBL 4E9SA 1NOAA 1NBQA 2FX7L 3SDAA 5IJDC 2YD5A 4ZBJA 3FO2B 3EUUA 2EKSB 3HI1B 4P46C 1IAMA 1LQBC 3FU7B 5IUCA 1SQPJ 4M00A 4WY4D 3UJTL 3D52A 3FPYA 1JNHB 3KPRE 1R9FA 2WZAA 4S0TD 5F88B 3IE4A 4L1DA 5TDPA 1CYWA 5MEND 3M1CA 3FHEA 2C5DC 2CK2A 4MYWB 4AIZA 2WWKO 3K0YA 4IJ3B 4GOEA 2FX9L 4N8UA 4PS3A 1I1YA 1OARH 3B5NB 2ZUQC 5F7KC 1KPUB 3POCA 3V0HA 2ZXDA 2F53E 3MV7A 4XMKH 3MO1A 2NY1D 1Q7YQ 1IAOB 3ULVH 1NZRA 4EPSA 2GCYA 4K5PA 1PU0A 2WXLA 1A3LH 1FJ1A 1SNRA 1WEJL 1BLNA 2NY0B 3AE2C 5G4NA 4XMWA 1KELH 2Y07L 4D8PA 5EBWA 3CX5D 3SKNB 2P24B 4AYDC 1IBFA 1CICB 1T2QH 1KTRL 1L4AD 1A6UL 2J3SA 1N4XL 3PP5A 1M7UA 3FC8A 4Y16B 2Y3NA 3KH4A 1BOYA 3EWKA 3PYCA 2K8MA 5FYJL 4HS8H 2BP0A 2NYYC 2EDYA 3EO9L 5D6DC 2A06G 3CFDB 4NZDA 1RE4C 7FABL 1J1DC 5MI0B 3TT3L 3PJSB 2ZCZA 4J3WA 1IFJA 1A4CA 2N1TA 1S5IL 4M5SA 1ZANL 4WI0A 3SE9L 4Z7NF 5L0QC 3ZTJG 3OLDA 4I3SH 1AC0A 1WMKA 4ZSOA 1IBYA 2V5YA 2X1XR 1H15B 4P49A 5EN3A 3VWKC 1EJ8A 2ATPA 3CN0A 2PWGA 2OXHA 1C5DB 3OKYA 1R3HA 2DLIA 1QVOB 4FKEA 2WZ0A 4XHQA 1ID5I 2QR0A 1FUNA 1FRGH 2FJUB 2OMUA 3BSZA 1QEWB 1UVQB 3JWOH 4HB1A 3QNXB 1OHQA 1OW8A 3H3BC 3OX8B 4GIOA 15C8L 1W8NA 5F44A 1CBVL 1LVEA 3DV4A 2DBLL 3B7RL 2A38A 1HQRA 1VQLP 4B95C 4QHPA 2HPCA 3QJHA 4RMRA 4HSAC 2DTSA 3ULUH 3F6JA 3U59A 2HKHL 1Q9OB 4IS6A 3UYRL 1VPCA 1R3KA 5E5UB 4KDVA 4U3XA 1MV8A 3JWNG 3PL6D 4RGNE 2W8ZA 3ATFA 3L95B 4OB5L 2C9RA 5FYLH 3WFCH 3BDYL 1AG6A 4PJCA 4F15B 4XP6H 3VFGL 3I02B 3FFCA 3T0EE 4GAJL 2HP4A 4W1TA 2B9BA 2IFGA 3LXBA 1IEAB 5IFAL 5MEPA 5JW4R 2VLJB 1UIXA 1DSFH 3NUKA 4A7GA 2E9WA 4N28A 1H8LA 4U6VH 1P6WA 3PABB 3HB3C 3OAYH 2AXCA 1G6RA 3CN2A 4JDTL 2BS8A 1L9SA 2MPAH 4HBQA 5IFJB 4MA1C 5JXAL 4M6ML 3L6FA 4ZI8A 5JO5B 2Z31D 1WISA 2FYUJ 3O8XB 3QRGH 3Q8EA 5GZND 3FCTA 4OZIE 4Z7VB 3V5DA 1MRFL 3IS0X 3MLVH 3GDCA 4ODUB 2RH0A 2VE6A 2WQWA 3I5CA 2VLRB 2JF1A 4G1EB 1JUFA 3F7LA 3H6AA 4P5TB 1ZGLM 2BY3A 2ADYA 3SOBL 1OAQH 2FQGA 2OZ4L 5C9JB 1USDA 2WPGA 3QHFH 4JREC 3V6FA 4WAFA 3S97C 2WSDA 2WKLA 4ANUA 3P40A 3UO8B 5L6YL 1H6FA 5TISE 4UINH 4XAWL 4Z78B 5JOEA 5L2JA 3MBEA 5ESQA 2IOMA 4WI7A 4HGWB 4XBPB 3KL0A 4X5WB 3D39D 2QDVA 6FABH 5JLZA 2BERA 4J3OG 4YVUA 4PBDA 4LCWB 3MDJA 5FFOA 3RL0D 2ARJB 4P4KA 3GNML 1TTBA 1OP4A 1V3JA 3I6SA 3QDJB 4DOHE 3GZOA 1IZNB 2X28A 4YDVA 5CGBA 1OZHA 4JRXA 4IQHA 3NJVA 2FJSA 5HGBB 2PW1A 1XIWD 5EDSA 4GBXB 4Y0GA 3SKJL 1C8QA 4JDVB 3GXTA 3O6LL 4NBXB 4TS6A 4NKQB 1NCIA 4N20A 2XY2A 1LDSA 5J6HB 5AVSB 2A5UA 1UQSA 4IBSA 1BFTA 3GB7B 3CQQA 2R69H 3C09B 4JO2L 1AR2A 2BW5A 4OD3H 4OQTH 3TLRA 3LIZH 4HHWA 1T04B 4TV3A 4YHNA 4OZFA 3ZQXA 2O01N 1U8JA 4A55A 2BOCA 3BZDA 4NN6B 1O9WA 2HWZH 3NEXA 4RFEB 2IQAA 1E3ZA 1U8OA 2JLPA 5I74B 2KI6A 5D5MA 3HZMB 5DD5H 2IOOA 2VUKA 1CD1A 2HJKA 3ROLB 2FIKB 5GJSL 3BLBA 3C5JB 3H4HA 4M61A 5DUJA 2Q87A 4PJ5B 3V10A 2JJWA 4DVBA 2G2PA 5KN5B 3S48A 3KLQA 3W5MA 3LN4B 4PV8A 4AG4H 4IFFA 3HG5A 1HSBA 2J6EH 2K3RA 4LPUA 1UM4H 1B2YA 3L3GA 3RPBA 4OT1L 1A7BA 4WWID 7PCYA 2VH5L 2NPSA 4PRPD 1VHPA 2PTUA 3NIDF 3ZKQD 3L74D 3MRPB 1Q81Q 3FXEA 5INDB 1YEDB 1ZY9A 2BSTB 2VDKH 1N0LA 3V6OC 2ZUXA 2KDGA 3GSOB 1TCRA 1OGSA 5B1BB 3ESUF 3CX5J 2W0LA 3QIBA 3S96B 3NH7H 1OAXL 2EYSA 4RFNC 3SZKC 4YE0A 2IPTH 2JVUA 4HZAA 4JRWA 1CZ8L 2JKVA 2RMZA 1XR9B 1OEZW 5APVA 1CF8L 2J58A 3CHOA 5ILTL 5BZDA 3S88L 4ONHB 3JZYA 4KBPA 5D2LF 2ED6A 2W0FA 2X89D 1FYTD 2CBQA 1IKFH 1UCBH 2VDLH 2CWRA 4J3SA 4DEWA 4DK5A 2HG0A 4YPGA 3MV8B 4PTTB 1VZGA 3SY0A 1Z5LA 4V11A 5CMZA 5IJCC 3A23A 4FTVB 3DETD 1AIZA 5E9NA 2AEIT 1LEIA 1J8HD 1SQXD 3L9EA 3TT1L 4AEHL 3SE8H 1G1IA 5BMFH 4XO5A 4W9EC 3S6CA 4BUHA 1DFBH 4P2OA 3HG1A 2Y0DA 5F0JB 1KB5A 1UA3A 2K6ZA 1DBML 4R4BA 3D06A 3NDZE 3X3GL 2VL4A 1SRDA 4AQRD 5KAFH 3FQNB 2QHRL 3GQFA 1UM6H 4X6FA 1EEZA 4K3JL 1JO5A 1JPGB 4HKJA 4UNUA 2CJUH 3DTXA 1TZIA 1EEUA 3TGXA 2EH8L 1HEHC 1ID2A 3RURA 3DX2A 1PY4A 2DMCA 3SPGA 2JCCE 1TYJA 1HJBC 3LKPB 1RLWA 2DQCL 1NLBL 5L2KE 4P5SA 1KB3A 4JDEB 4WFFD 4EIZC 2HTKC 2J88L 2VMEA 4AIXA 2KT6A 3Q5YA 1PLBA 4PVMA 3P73B 5F7MC 3KLLA 5FKPA 3EADA 3CFEB 3LEVL 1MWAL 2XTJD 4WNSA 3FT9A 2Z9TA 5C08E 2WXRA 3QJZA 4HLZH 3US9A 4ZMYA 1LTTC 1URZA 1QSFD 2V5RA 2P2UA 1K2DA 3WXWH 3NMEA 4PY8J 3MODH 5DC2A 2NXZD 1XD0A 2ICEB 5DS8A 2QGCA 5CGYC 3SJVA 1I3RA 4MWFA 4X5PA 2P5WB 5EORH 4GJTB 3T8VA 3QZOA 3QJUB 1PPJG 2NYZA 3R2PA 5F9WC 5E03A 4NRXA 3UAEA 3AG4B 4K07A 5D4QA 5D2NE 1K4CB 2ZX8A 1PAZA 3CZLA 1A3RH 3I6GB 4IKJA 4LCUB 4O4YL 3H1LG 3QDAA 5A6LA 5HHOA 5AWNL 3DKHA 3LQMA 4NO0A 1YECH 3P30H 2YD4A 4N6QA 4G6MH 5FS5A 5IESL 1IBGH 5AVUB 3PGDB 2UX6A 2MHAA 3AMKA 4R7DB 1QBAA 4YH6A 3IAOA 2NT1A 3L9RA 3PUUA 4CVXB 4UTAA 4AXWA 4UQ2B 1OP3K 1UFGA 4FQLH 5E8PA 3MCG1 1IKNA 5EF0A 2FJHB 1JYNA 1S5HA 4P5MB 3PHOA 3QCVL 3IDIA 4PJBE 1M56B 5CWSB 1FFNB 4KKZA 5KVMC 2ZG2A 3EOYG 4TLKA 3CTTA 4FHBD 3RGVC 3VG0H 2X7LA 1DEEB 2ZOUA 3MOAH 1NJIQ 4N22A 2KZ1B 4L9LB 4X7CC 2A6JA 4JB9H 4LL9A 4YSSA 1E40A 3M06A 5KANG 4K94H 1S1CX 4HFUL 5I6OA 3RY6C 3D85D 1KFAH 2MCMA 2AMUA 4URTB 5J6SA 1KOAA 4DHLA 3NDYE 1JWSB 3EJYC 2CZNA 1JV5A 4HVBA 3LEXB 2V2TA 3TF5A 3OPZL 1MAML 3D4ZA 1NDMB 2UUDK 5EPMB 2OMXA 4M4RB 1DQMH 2AKRB 1A9EA 4NQVA 2RR3A 35C8H 1AS8A 5HYSA 1F2QA 4TQIA 3TIEB 3BSZH 4MVBC 4OR1A 5ICXB 2LTQC 5JR1H 3DO7B 4ZNEE 3P77B 4JANB 1UJ3C 2ZSVA 4KKAD 2APSA 1ZSDB 3ARFB 1Y47A 1YPZF 1OAZL 2FO4A 1T1WB 2ZYIA 1Z5HA 3CSYA 1QL1A 3Q2VA 2F5AH 4QRRD 5D1ZA 4CNIB 3IVKA 3DVIA 3MBXH 1IMHC 2K4WA 3VXPA 3SOTA 4AMKL 1C08B 2QVIA 3RK2D 3EKCA 2XG5B 5BW7A 4XO9A 3RIKA 1CC3A 4KO5A 3B4NA 3NVQA 4H2AA 2XKUA 4ZPVB 2OMNA 4HUMB 1CGUA 4FC3E 2BSSA 3W57A 4QRPE 4RKUJ 3QUZC 3FQRB 2E9BA 1P5VA 5H94A 5I30H 2FEDC 5FLVA 4IRJA 5FUCC 5D1QB 3VSQA 4MCNA 4E9YA 1TPXC 3ULVL 5CEYA 1OSPH 2VR7A 2Y25A 2D7PA 3L74J 1IM9D 1U8KB 1CE6A 1CR9L 1TETH 3E2HB 3U7AA 2PF6A 3ZE1B 1TJHH 3HTKA 1KELL 1BJ1J 3PWPB 2D9QB 1G6RH 2AANA 3RYMA 3SO3C 2AK1H 4RMVA 4D9RE 5JORA 3SDDC 1FJPA 4NQEE 1DSYA 1T2QL 2J6WA 2WP3O 4TULL 1DX7A 4LAJH 5AZ2H 1I8MA 2DKUA 1PGOA 3VXRB 4I85A 3QDHA 4X5XA 5APUA 1QACA 3FTZA 5FR3A 2O1JA 4LHUG 2E75B 4HS8L 1OMIA 4PJGE 2MQCA 2EDDA 5KLVG 1ITBB 3BP5B 1DBJL 4IRSD 4OJCA 3E6HA 1MREH 1MW2A 2DQIH 3TF4A 3KDMB 1GGBH 4M3KB 4X9FA 1T5WA 3EBHA 4AM0Q 1QVGO 2A4CA 1OD7A 4W81A 4CILA 1Q9WB 4FQXC 4EF3A 3X3FL 4N6JA 4TUUA 5A7BA 4F9PA 2BRQA 1SQXJ 2H0FA 1BCIA 3KR3H 3REWA 2H32B 4MNHA 4TN9A 1ZS8A 4KK6C 3P11L 5B66H 1R8EA 2ESVD 4Y28J 3G04A 2EDEA 2HTLC 4NEHB 1TQCB 1J05A 3LPOA 5F3FA 4XN4A 1QX1A 2Y24A 4IL6E 3C5ZD 3GD1C 3V5HB 5I1GH 5AENA 5HYEA 2F7RA 4HIJA 1E5AA 3DHUA 3AEBC 5F1NA 2DM2A 5JUEH 1EV2E 4PLKC 2J5UA 1F3DH 4Q6KA 3UPCA 4D6TG 4OZHE 1TITA 2AEJA 4F7MB 1HYSC 4XHJD 1H5BA 3SDAD 3GJFA 3JTSB 4DWHA 2OMVB 4AGQA 3STBA 5CKGA 4N2AA 4IMKA 2QSIA 3Q48A 4KJYB 3IJ7A 4KKPA 3RHWF 4E0RB 3ME0A 3TH3T 4HS3A 2IPPA 1XCXA 4RETB 5FYLL 3HZKB 3SPCA 3WFCL 1F8TH 1LTXA 1L9RA 1T5XA 2WJ5A 4G2AA 4R84A 4DZ8B 3CVHB 2NR6C 2Z93B 3WSQL 3HG0A 3BQUC 4FN0A 5IBLC 5EC1B 1BJ8A 2GUVA 2R29H 2Z7UA 1PJWA 1E8ZA 2ZOKB 3MV7D 4ZXBB 3BCCG 4XP5H 1A64A 1PF3A 2LABA 1UKTA 4AQOA 3JXAA 3PRJA 3W11C 3TBBA 3Q05A 2K8QA 4HJGA 1T1YA 3BKYL 2Y6SC 3FKUS 3MLVL 3QRFM 3QAZC 3CSFA 4MQXC 4ABQA 3LRGA 3QIWB 4UM9B 5J5EA 1II4E 5C97A 2W8CA 3V4VA 3T4YB 1ML0A 4I89A 3D2UB 1OAQL 1MZZA 4HAGA 1NPUA 3OJMB 4PV9A 3TZVA 3E8VA 2QRXA 1Y18A 3U36B 3O9WB 3MVSA 2UX7A 4KH9A 4M7LL 1S9VB 4EN3A 3TYYA 2N1TD 4RZCA 1QLRB 2Q86B 2KS1A 3AQDA 3ZL1A 2QEXP 4FNQA 2J1KA 3H0TA 4HMEA 32C2A 5E6IB 4Q6YA 1NBZA 5HJBA 5DS1A 4BRVA 1BPLB 2HFFB 1NTZD 4P3CH 4PCSA 3QA3A 5ID1B 1KY7A 1D5MB 3SO5A 2F5BH 3H7LA 4A7SA 1J87A 1F02I 2FYVA 4P3WA 1B0RB 1MRCL 4PU2A 5DHVA 5I24A 2B87B 3EYVA 3VD9A 4GW1B 3VD2A 4GS7B 2WWMD 3MLXH 1QL2A 3QDGB 4ZUVA 4NQDD 2EDXA 4J2QA 3TCTA 1E4KC 1NU1J 5DRZB 2CPCA 1R75A 4MDIA 4N0UB 4G9FE 3H9SA 1YEGH 1SQPG 3TFBA 1LWJA 1LMIA 1KPVB 3CHPA 2FYYA 2HX8A 4ZUTB 4PJEB 4ZUSA 1OM3H 2Y7OA 1M6OA 2QBWA 1Z2KA 5GRUH 5T5FA 5C0BD 4OQTL 4GAGL 1XCTB 4HIIB 3OXSA 3MN8A 1D5ZA 1M71A 3FU3A 1U8IB 1CL7H 3S3PA 4AH2A 5E8OA 3WY1A 2H6PB 3QVAA 2Z7YA 4PRHD 2DQ6A 1HOCA 5I73B 4X6CA 1ZV2A 3QPXH 1YNTB 3BT2H 4GXUN 3C60B 3C6EA 4NP9A 2ZKYA 5MERB 2O72A 4DK6A 4HUUB 3NJHA 3KPSE 3P2TA 3MCYA 2KNCB 2D3VA 2J6EL 4YHIB 3S4SA 1PLGH 4BH8A 4G7YH 3B9DA 4H0HB 4JFQB 4UT9H 3VI3E 4FI6A 3HS0A 3ZE0F 3KXFE 3IDUA 3LKQA 2AEFA 5E9DD 3W39A 2VDQB 5C71A 2UZYB 4XCNA 3OSVA 5FUCE 3VRIA 4QRSA 3FU5A 1DDHB 5CR8A 1P84D 1MI5B 4X6BB 3ZHDA 1NGXA 5IHZB 3H54A 1C9SA 4M1CD 5F89A 1VEMA 4P23D 5DFVC 4IBVA 3OGCB 2A7BA 2XA8H 3DURB 3MCLL 2Y2YA 4KHTH 1ZE3H 4AW4A 1DE4A 4MDRA 4EVNA 3N5AA 5IB2B 5AG9A 3MXWL 4NHUA 2W07A 3DIDA 3W56A 2E74B 1IU1A 1UCBL 2H43A 2RAMA 5B4MD 2I9LB 4JY4B 3W37A 3TYFA 2FCBA 1X5IA 4CU7A 1TSRA 3EDFA 3AU1B 3FULA 3AXHA 3L1GA 5AOZA 4P4KD 3O4LB 4N2MA 4KO6A 3DO3A 1SS1A 1I7TB 1X7QA 4WWKC 3ZKXC 1JY3N 4PR5B 4WGWB 3BT0A 5D70H 4EQ2A 2DLEA 1AGFA 4WTZA 2IMMA 4JPIB 5AYUH 3IJ8A 4YIQA 1ZLUK 2M26A 1YEFL 3IBEA 5D1QE 2JKJA 5FK9B 5CCHA 1KG0B 3UJJL 2UYLB 5D93C 3C8KA 3S3SA 3D25B 3ARDA 1IQDA 3EHBB 4FG2A 3RI5F 1UM6L 3BP6B 1S7WB 3MRJB 2IQ9H 4L4VB 4XI5C 1EFXB 1GOHA 1CTMA 2CJUL 3FUKA 4DESA 4X7SH 3JWNE 2G0LA 3HPJB 4Z7QE 2X87A 3IE9A 3KPQA 2QJPC 3S34L 1IE4A 1IM3B 4UBDD 1SVZA 3O81A 2H3NA 5ES4B 3T0DA 4HK0A 1Z0MA 3V8OA 1YITP 1MPAH 4ANVA 4BCXA 2AEPH 3RUGE 4TKWA 3QYMA 1M7XA 3TH4T 4R3SB 2HB0A 2WSEH 3KPLB 2W94A 2XG4A 1SQVE 2WV3A 2PRRA 3WFDH 5H37H 1NCTA 3WXWL 3MODL 4G8EB 4NPYA 1MJ7H 2BINA 3FB5B 1G4RA 3HKFA 5B3JF 5EORL 2G75B 1P4UA 2WAHA 3L81A 5GGUA 5DDHA 1OW6A 4DZOA 2EDQA 1P7QA 2A6DB 2CIIA 3QIBD 1FGVL 2E42A 4LMQI 3T6ZA 2NY5C 3N43F 5IW6A 1A3RL 2PP7A 3F62A 1L0ND 2ZUTA 4EZMA 2HG5D 4AE0A 2W80C 1YECL 1YYLH 5FYKD 4CVZA 1I7ZB 1QLED 1NAMB 2BC4B 2K1MA 4P9MH 1FVEA 1E42A 4PJ8A 1VQOP 1NGWB 3NZHH 3FRPG 4K3AA 2JJTA 2WVTA 2XXMB 1KPRB 5FFGA 2Q3ZA 3N42F 4Y2DB 1HXKA 2BXYA 3U6RA 1JK9B 1FORL 4WKXA 5E99H 5HGGS 3WI9A 1NTZJ 3H32B 4FQLL 3BAWA 4HFWA 3HD7B 3TFKD 4NNPL 1U4FA 4MA8H 3A4FA 4HPYL 2NYYD 1LNUA 3CWGA 2AJVL 2RALA 1LP9B 2PW2A 3P02A 1PZSA 4HPOH 3HLKA 1R24B 5D9SA 3RKPA 3JTTA 3IT8D 4LOFA 4AY0A 1KENH 2DJMA 1G9NC 4ZS7L 3KEDA 2X4UB 4RRPA 4HALA 2O3JA 3D33A 4MNQE 4UOW0 1Q0XH 1KFAL 3D51A 2XKNA 4ZOEA 2G60H 3WN5B 2WLHA 1CE1L 2R1YA 4BGLA 4LEBA 2EACA 1LNQA 3HZYA 2BNUA 4PI2A 4PRNB 5JOFB 4LHUB 4D3CH 3GMNB 4TRPL 1EAOA 5L88L 4GKOA 1CVSC 2O5XL 4DO4A 1ORQA 35C8L 3ZDYE 2WXIA 3IM1A 4NWTH 5JR1L 3BSZL 5I19H 1QSEE 5C0IA 1NCHA 4K0OA 3A0HH 4LSVH 4U4IA 3MA7B 1XF5B 1XF3A 1QI5A 3QJFA 3EQ2A 2VITB 1XGPB 2F5AL 3EH1A 1UXLA 4X6CF 5JW4Q 4FNUA 4KXDA 4JW3A 2D73A 4KPHH 1MVUB 2FX8H 4JFFA 5DA0B 5DJ8A 2YKLH 3LZNA 4M6NL 3BGMB 4QCIA 4E9TA 4OAWA 2R5DA 2FZ3A 5I1KH 1EHLH 3GSVA 2ZPKL 4Q7DA 4BXVA 2CMRH 4Z1MH 4DGIH 2CNZA 1EZVY 3RILA 3S8FB 5ISZB 5B5EH 3GYRA 1FSKB 1I1AA 4EDWH 3WO3B 3RL2B 3WTTA 1KB9H 3FQYA 4EI2A 1JP5A 2VQ4A 3N1MC 1F11A 1HI6B 1AD0A 5DD1H 5T1LB 1M2OA 3ATAA 3K5SA 3NCYP 1E5YA 5DLLA 2EDJA 4QO1A 1N8RQ 5DEFB 1TETL 3BVNA 1QFOA 4HK3J 1KBKA 3TNMB 1OM9A 4NO0D 3MP7B 2POHA 1TJHL 4P04A 5DU7A 1OE1A 3HB3D 4Z3TA 5K69A 1P84J 3BVXA 1PYWB 2G5BA 4IKKA 1G6RL 4ZFZA 8FABB 2F15A 1T03L 3MRCB 1RF0A 1SOXA 3TVMD 1LD9B 2I32A 2E7BA 5JDJA 2ILLA 1UTDA 2BVQA 5AZ2L 5ICZB 5AW9B 3LVTA 3MOBL 4FDWA 4PH8A 4RIRB 3UO1H 3UTSB 3QJTB 1YTZI 2VDRB 3DRTA 4PIBA 2B4CC 2FQEA 3S98A 4FFZA 5IVXE 2APTA 3VXSE 5LLIC 3IJYA 4YXLH 5SWZE 2V7HB 4JR9H 3VOPA 3SBRA 3CLFH 4KKBD 3ABKB 1GGBL 3ARYA 4YZWA 4JQIA 3UXFA 4R7XA 2CHNA 4KK5C 3ZIYA 3RPKA 5DJCB 4KZDH 1TJIH 3QUYD 4N3TA 1ASOA 5CSZA 3HRNA 1I1RA 1HESA 4U6HA 3VFWB 3D0AA 3RKDD 1Q9KA 3KR3L 2Z4EA 3PG2A 3VP8A 3MNDA 3QQDB 1O7DC 1ZT1A 3MRKB 1FN4A 2WK2A 1GYVA 5JZ7C 1X8YA 4POZC 2BRRH 3FQUB 3P9WB 3CHSA 3ZHLA 4GOFA 4Z7UF 4BK8A 5GRJH 2G30A 3UAJC 2QJYC 4G71B 3CXHD 1A6AB 1Z3GL 2JNZA 3LAFA 4IKIA 2H2SC 2OYHC 3BGFC 2F7OA 5ITBL 4FZEL 4FOMA 4LXFA 1Q38A 3OZKA 3TO4A 3VM5A 4A68A 5AW0B 1JD9A 1RIUL 3BUDA 1DJSA 2QGBA 3HJEA 3X13A 4U1KA 5I8OL 1NCAH 1C5CH 4Q4IA 5CFAA 5D1ZD 5KSBF 3IXTA 3GMPA 1XSKA 5C8JA 4MMZB 1BYNA 4YZFF 5DO8A 3LRLA 2JKNA 4XZUA 1U8HA 1BIIB 4LNRB 3IR9A 5A2AA 3FBKA 3WXVL 1BSIA 2G5UA 3VQLA 3L70G 1SEBA 2UZXA 3ZE2E 3QDME 3AS2A 1HTLC 1F8TL 2AZUA 4CPGA 5T5FH 3RTQA 1INQB 3RU8H 3UZVB 3D7PA 4IRJD 1PPJE 1CFVH 2NLJA 3H53A 3T0XA 2BCCD 1CUOA 4JJ5B 2X4OA 4OD1H 3SDCB 4EI5A 2XCMC 2IPKA 4V1DE 3WHXB 5B39A 5FPIA 1T3JA 3LD8C 1I82A 3WENA 3Q2YA 4XPHL 2NT0A 3H1LE 1UB6A 1X3DA 1I1CA 1ZHBB 1JTHB 4H2CA 2YUXA 4JQXC 4M3HA 4NKDB 3DDGA 3IDMA 4PLJD 4NM4H 3KGUA 3S37X 3JWDC 1L0NJ 1H0TA 5IBUB 5GQBA 1OB0A 4Z77B 3PQYA 4OTXL 5A7EA 1EDJA 1YEIL 4L1LA 1PQZA 3RIFK 4BK5A 1XTCC 2OULB 4TQEH 1J10A 2A99A 4LLDA 4ABWA 5DVKA 1ZLVK 1WFTA 2Z4TA 3F58L 1NC2B 2A73A 5IZ7A 4PJXB 3IKKA 3PP3H 3LS5L 3WNOA 1NTKG 3M45A 1SQ2N 4ZMNA 3KCPA 3KNBB 4O02H 4U1SB 3N9GL 2J8UF 5DZLA 4PRDA 2GPZA 5E8DL 3WKQA 5BS0B 1W72H 1GD2E 4KQ3H 5DHMC 1F97A 1R3IH 4C56A 4WUUE 2IDFA 2PABA 4KQ4H 3FYIB 3DECA 1DANT 3JT0A 4FFWD 4KJPC 4XP4L 4MXVF 4R2GC 1OOAA 1WQVT 4WV1B 3H2QA 5EEVA 1MNUL 4FQQA 5FB8A 1N12A 3W67A 4U1JA 3AG3B 5EA0H 2OMYB 5B38B 1BQ5A 4DCKA 5C0CE 2VISB 4WTXA 3MLXL 3X11A 1RMFL 4GSXA 1ED3A 1ZLEA 2L91A 3MTRA 2FXOA 1H8NA 1DJIA 3MFGB 1M9SA 6TAAA 3RVXD 2Z8RA 3JZ7A 2KZBA 2ZCHH 4RDQG 5DRWB 1E6JL 5BZWA 2HRHA 1BAFL 2VAAA 5EUOF 1XTGB 3EH4B 1QASA 4RNRB 4JHAL 3BP4A 2YFOA 4W9IC 1Q4NX 4J3VA 2FO1A 3QHZH 1FNSH 3DGCR 3IU3B 3CZJA 5HJ3B 5IB4B 2WGXA 1XT5A 5CLTA 3IGAA 5KOVC 3RWHB 4ZZKA 5T3XE 2I60H 4PJ6A 1JYXA 1CL7L 3QWOC 3I75B 3NP3A 4X4ME 1U6AH 3VH8G 4DZBB 2WKGA 4I0CC 1LO4H 2P46B 1PY9A 2DQUL 2OJEB 3WLWC 3O2WL 4R0LC 4XO4A 5D4JA 3S7GA 5IMMB 3UL4A 3UX9B 4H0LC 4NN7C 4Y5XB 1AR1C 1NIFA 1X5LA 3L5XL 3P3YA 4OLUH 3T3PF 2E5YA 4ZJ9A 5IGXH 2WVVA 3LV3A 3LPFA 2X2HA 4N0YL 4YNYB 4OCYH 1N5AA 2BNQE 2BHFA 3Q8BA 2B7DT 4FLOA 3PWUB 1SQQD 4Y99B 4LLMB 4UT9L 1IL1B 1ZXQA 3CLEL 4Y19D 3AVEA 4G8FA 2YZ8A 3HE7B 3VTMA 4DGVH 4W9CC 3FZUC 3BHBB 1MH5A 3FRUB 5B7MA 4UOJA 4Y4KB 5E00B 1A02N 1VGEH 3NN8B 3TZVD 3VX1A 3IN0A 4GRMB 1IGFL 2HVBA 2VJXA 2K6WA 4O2CB 3Q8AA 1A1OA 5KLVE 4CMMB 1PD1A 1UXWB 4I2XB 2HODA 4RAVB 5CD5C 1YO4A 2V5SA 2O93L 4BXLA 2RACA 2VLLB 2C0XA 2VZVA 3VU2A 3TEUA 4A66A 4BWUA 5C0RL 1AGCA 4YGVB 1UH2A 4MX7B 1XZ0A 3CUPB 5E9AA 3KPPB 1B0GB 4WO4C 4ZOAA 1CMOA 4PJFA 2DI9A 2IV8A 1KDJA 3AE9C 4YX2L 3CH8A 3FW6A 1J5CA 5CJ8A 4OFDA 3LKRA 2E27H 3DI2B 3GGWB 3I6KB 3T3ME 3VFNB 1LWUC 3L71G 3AREB 3G71P 3DX9A 2CJTA 3QZBA 3QXDB 3ULAB 3EGXA 3ZR5A 1ETZA 1XTLA 5D70L 4YTPC 3MCKA 3RB5A 3QXUA 3I74A 4P2RA 4OGAC 4E5XA 4L37B 1BZ8A 1DVFC 3NZ8A 4CSPA 2YIUB 3DTUB 5KYYA 3TJPA 3ILEA 2F54B 3HPLA 2KLVA 4LLUA 3WN6A 1BE3D 1IGIL 3CX5H 2JQMA 4HPHA 4KTEH 3MUJA 4LEEA 3CXHJ 4XVUD 4D6TE 1F86A 5GISL 3BATA 3VMAA 3O3BB 4ENEC 3FRPB 1JF1B 1IBBA 5FO7A 1OE2A 5IMKA 1JPSH 5E7FA 4X50A 5DVPA 3DIFA 4R96B 4JPVH 3PFUA 2HR3A 4JBSA 3GF8A 4XPTL 4OV6F 3K5BA 5IQ9A 1N3NA 2FL5B 2ICWB 3EJYD 2WO3B 1J5OH 5HJGA 3QJOA 1FLTX 1QUNB 2ERJC 1IGJB 4UZGA 4S2SA 3U7WH 2CCWA 5J4MA 3B71A 2ZONA 4ZW5A 1U2YA 4MXWH 5LG6A 1EXUB 4MVBD 4R7NB 4I88A 4U3FD 2GKIA 1BDCA 5I6XB 1WJ3A 1NFAA 4Z95H 4EE2A 2HT2C 4ZUUA 3WNKA 4AQAB 2YKKA 2OSWA 4OGZA 3PTZA 1GU4A 1E28B 3HCVA 2HXAA 5CMAA 1KC5L 4LFHG 4L3EB 4XNQB 4LDEB 4LLAA 4DO5A 1ZHNB 2ZX7A 5EZOL 1E27A 4DP0X 1T0NB 4B86A 1JGUL 2I7OA 3IKCB 1ZVSB 2EADA 2ZT9D 3I84A 4LEOA 1SQVK 3EYUH 1TZOA 1X4YA 3B9EA 3K0WA 4MASA 4XC3H 3T77B 1NFDE 4P57A 1N6QH 2P44B 2P5EE 2BHYA 5MENB 4HF5H 5DK0B 1J18A 4FLSA 1R1CA 3RK3E 4P4RA 4BE5A 2BNRA 2JK5A 4I5BB 2Q8BL 3DIVA 3LN5B 4M56A 1T0MA 4B9YA 1KCVH 2BVOA 4YHLH 2YPLB 3MNMA 4NC0B 3V0FA 1YY9D 4C83B 1NFIB 2I8DA 3GI9H 1YYLL 2AK4E 1DZ0A 2NY1B 1G2CA 2V8MA 4JM2A 5GHWH 4MD0A 2IDTA 4MCYB 1NAFA 2DLTA 5FDWB 1IEBA 3HVDA 4X7FC 3NZHL 4JFYB 4MLIA 2BIIA 3U9UB 4UDTA 3MR9B 1NDTA 1J1XH 3UABA 4XE5B 1HYRC 4TQPA 4Z3HA 1JTTA 4OF6A 3EYSL 1QNIA 3SDDD 2QKIC 2VXSH 2PPAA 4KZCA 1Z3RA 4QPEA 4NZFA 3F7YB 1NU1G 3VGBA 4MA8L 2EVGA 2BY2A 4KI5D 3O6KH 4ZTOH 1B0IA 1WFMA 3KQGA 4OFYD 3T5WA 1BCCG 1R33A 4MKTA 2J5LB 4K71B 2ZYAA 5EU3A 4WHYG 4BKSC 4Y9FA 3SDXE 2FSEA 2X2JA 2AQ1A 1QA9B 5GZOC 5KYWB 1AXIB 2P42B 5G55A 1I3UA 3GPSA 4JQIH 2O01J 1ACYL 5FF6B 1EVTC 1NOLA 4HWBH 5M1BA 1XDTT 3OHXC 5F3HA 5FKAB 3GHGA 2ODIA 4M8RA 2VAJA 4D3CL 5JA8B 1MFBL 3F7QA 1JUNA 3H1JD 2JWYA 2XBTA 4AUYA 5IWLA 4JM0A 4GG6A 4NWTL 5IB3B 4GUOA 5C0AA 3K4AA 2XNXA 3FCSB 3K2MC 1S78C 4OKDA 3LEYH 5DD0L 5ACZA 5I19L 4OCWL 1UGNA 1UYWH 5E2UH 2K3HA 4ZW7A 5IB5A 2APFA 4IEFB 5C92A 2XWZA 1K8DA 4PY7B 3EFFK 4PJXE 2WVUA 2EEXA 2NX5B 4LLWB 5BJTA 5KBLA 1G9EA 3SCMC 1W0VA 4KPHL 5CCJA 1MWAB 2FX8L 1CFTB 3HRZA 2CPSA 1HVXA 1HYSD 4HU8A 1K8IA 1HHIA 4H40A 1EHLL 2ZXXA 1F4AA 3QFGA 4FQ2L 2CMRL 4Y4HB 4ZMQA 4N8VG 4JFXA 1RFDH 4EXKA 1RI8A 4YEEA 4ZFOA 4UNTA 2H8PD 2RIKA 3N85H 1KGYE 1ADQH 5DD1L 1SEQH 2JKTM 4M6AA 1SQQJ 4Q6IB 4HSQA 4DP2X 5C6TL 5E4AA 3M07A 5DGRA 4NAQA 5IBLD 1OKEA 5AUMA 1FFPB 1QYGH 4GUPA 2N59A 4OBRA 3KPRA 5LB1A 4H44C 1FVDA 2WB7A 4Z7OF 4HG4K 1URQA 1XFPA 1NWQA 3R7QA 4L76A 4Z7WE 2GJRA 3CK0H 4JBZA 2LQRA 3FT2B 3FTVA 4BQ9A 3REVA 2DQJH 3L2LA 1GC1C 3QFDB 3A4AA 4LLQB 1FAIH 3UO1L 2Y6SD 2JELL 3WJMA 2F53A 4CDGC 5HGAB 2XWDA 4PYGA 2ATAA 4JY6B 1LQSR 3DBSA 2DYPD 2GAZA 4UIMB 5FV1L 5TDOB 3V4VL 4YXLL 4DSYA 4LSQH 3PGCA 3NA9L 3TBSB 3VXTA 2GSGB 4FQHB 5G4OA 4J2XA 2XC8A 3KPMA 1I7RB 5GGQH 1TJIL 3E7JA 2MTPA 1UWGL 4LKCA 3ZIMA 2KOGA 3WGVB 1GZLA 3BW9A 1VL2A 4H8HA 4I3GA 2Q2EB 3KPNA 4EUPB 4OCRL 4HLZG 3L5WB 1S9XA 3NJKA 4X99B 3OA7A 3EG9A 4XNBA 2EIMB 2NY4D 1NLDH 5TFSL 2NUPA 2K37A 3PV6B 1UADC 4ODTH 5DMIL 2BOBB 1M7IA 1JY2N 2Y9ZA 1H9VA 2LU4A 4ODHH 4UYPA 3D39B 1ANUA 4KT0J 1IC5H 1JOIA 2QSQA 4NZUL 5BRPA 2BASA 4KV5E 1E3XA 3GW6A 3WG7B 2XSKA 2Y7LA 2GUOB 3CIQA 5AW3B 1G1CA 3HG4A 4HGMA 4I4WA 3AB0B 4LLYA 4YHZH 2DQEH 4L23A 2ZKMX 1GGUA 4NXSA 1NCDH 2WZPD 4ES8A 1GL2B 4GFTB 4PBWD 2WLIA 4MJ4A 3GBNH 1CICC 3MRLA 5IW3A 3VXUD 5H2FH 1ND0B 3CZFA 4NRYB 3L3IB 1IFGA 3ZK0A 2NNAA 5CZXD 3BO8A 4H8UA 4MAYC 4JFFD 4D0DA 2WVRA 2OPCA 3H7BB 4GAFB 4K23L 2O6EA 3S3JA 3H1KG 5BVZA 1QR1A 3QPKA 2X88A 5DURD 4U3FJ 2YWZA 1BD2B 1GZPB 4FQIH 1OTUD 4GP5B 4Y2OA 1RF1C 4LBAA 3OWEA 5MI0C 4HLJA 4JZNA 5IMLB 2PLTA 1I1AD 1MW0A 4W4NA 5T5FL 4DKEH 1PTZA 2AJYH 1PZ2A 3WJJA 1Q9LB 3RZCB 4F7CA 4XPBL 3O3AB 3NJXA 4UAOB 2SODB 3BISA 4AV4A 4D9LL 1JZFA 1RAMA 3DX0A 3NFQA 4OD1L 5JHDE 4JGNA 2YARA 5C9KA 2CA3A 1RQUA 4JFOB 1UC6A 1A9BB 1EEQA 3CX2A 1MFEL 1V55B 2VLKD 4WU7A 5CCGC 1S3RA 3S36H 2YC1B 3JYCA 3NIGF 4KROD 5I1LB 3CCQP 5CBAA 3F6IA 4PJ7E 3LKOB 4NM4L 4TVPE 4AVKA 1M05B 4HT1H 3T0EA 3HHSB 5F7DB 4ODVL 4FI7A 1G7QB 1KGIA 2FE0A 4PJ9C 3L3OB 4H13B 4YDJB 1IRAY 4D0BB 4P5KB 1NSNH 1YMHA 3KLKA 2D7NA 2BCKA 2EDMA 4H8VA 5DS2A 5ALCH 4FEIA 4UCFA 5CJOH 5KVFH 3RWIA 1HKLH 1RY7B 4AKOA 4MJIB 1KSRA 2WSCJ 3T6VA 1WT5A 4WENB 1OP5K 1QRNE 3PREA 3NK4A 1T66C 4OZIA 3QT2A 1N7SB 4QXUH 5C0GB 4J23A 1D9KB 3S5ZA 3DX7A 2RCSH 3WIIL 3FUFA 3GZQA 1RZKH 5CINL 3PWNB 5GTHH 4LCVA 4F15C 2N56A 3GBML 4PJAE 5CP3H 5IBTL 4OW6A 1A4AA 1AGDB 4AZ8A 2XI9A 1FYTB 3C6SA 2X38A 1JM0A 2DWEB 1QBBA 1JJUA 2WTYA 5GGVY 5A2CA 4NAJA 2Y0SA 4TUKH 4QXGH 2BO0A 2CIKA 4I18B 1MUJB 1XB6A 1I3GH 5EZLA 5I8EA 1BEXA 1CCZA 1EANA 3TO4D 4BH7A 3C1LA 4GG6F 1IO4A 2R2EB 3O8XC 4W9DC 3TPKA 2LFGA 3TIDB 3B9KC 3H1JJ 2FEJA 3IFLL 1J8HB 4OIIH 4CMHB 4DTGL 1FZGA 2JXMA 4FXGA 2J5WA 5AVXB 2OL3H 2Y9YA 1E5BA 1ET8A 1F2XK 2WSKA 4QRFA 4ODWA 5D7SL 3QHZL 1OAUH 2YXFA 1HINH 4U1LB 1C1EH 2QV2A 3BWAA 2YOAA 4TNVF 5D1XB 3E1F1 1XGYH 5I76A 2B59A 2Y5TA 5ETUA 5J13C 4IFMA 3VWJC 4WW1B 4BFGA 4AW7A 3S35X 2MMXA 1T8ZA 2OMWB 3LOWA 4NYLA 2VXQH 3THML 1YDPA 3WNIA 1XGUB 1LO4L 3P8CD 3H6JA 5F7LB 3ZUNC 1NGZB 5SWSB 4IGBA 1FFTB 1PD0A 4GRWF 4EI5D 1CWVA 2VLMD 3GXNA 1CW5A 3F5WB 3FUJA 3FFOA 3QH3B 4OLUL 1QKZH 4WDIA 1AHMA 4XOAA 1LO2L 5DRNB 1TENA 1W15A 2AQSA 1I7UB 2PYEB 5IGXL 4TSAL 4YLBA 3WCYA 1P9MA 4AM0B 4ZAKD 2A6IA 5DEGB 1H3GA 1PFIA 1T1XA 3LIUA 4OCYL 3IGLA 3D4CA 1G1KA 4GQZA 4GBXC 3T6WA 4PP1C 4AZUA 5BUGA 1AQ5A 1NA8A 4HIXH 3UPRA 1QI3A 1YJWP 2AQTA 5CNHA 1YJDC 2BWIA 3F12A 3RFZA 4XWOD 3OTTA 4P46A 1A7QL 1ULVA 4JG1H 5K9OB 2Z1PA 4K8RD 4UF7C 3OAUL 3S9OA 1EWHA 3C09C 1N2RA 4TPRH 5I6MA 1QVFO 2WLKA 1KYOK 4NENB 1X5MA 4B9GA 2NX5E 1VFAB 1RZGB 3RVTD 5EUKA 3VFUA 3DXAD 4N8CH 4NN6C 1NC4B 1D7FA 3O6FB 4Y5YB 2WNKA 2Q76B 1FDOA 3KAAA 1OV8A 3CMGA 3TM6A 3D4GA 1X7SA 1O5PA 1KBVA 3CPUA 3VXME 4P5RA 3CXDH 5K9KA 2DI7A 2VW6A 1L6PA 3KGRA 3L4XA 1WUNT 1FHGA 1RJZA 1FFQA 3HI1A 1OVUA 1TKWB 1TTRA 3P4MA 3WJLA 3GLAA 3QG7H 4E42A 3DYMA 4HDIB 1DD4A 1HL8A 1KBPA 4HWZB 1AVYA 4QYOB 4XPAH 1OP3H 5HHVH 4UTBA 3IRCA 5CR1A 1JPSL 1LTJB 2QADC 3DNKA 3ZJAA 4JPVL 4P3DB 1OCWH 1MLCA 1SYSB 4GKZB 1NKRA 2YRZA 4GOSA 4L4TE 2TSAA 1AO7B 1KJ2A 3KEHA 2AJUL 2KYIA 1MVFA 3L70E 4EYYQ 3GMQA 4JZJC 2NY7L 4P2QE 3ML8A 5HVGB 2F74A 2CBTA 4GW4A 3VFVA 2KDYA 3SQOH 3EOBA 3JVGC 5D55A 3QZWA 4CC4C 2YBRA 4X98A 4KTGA 2R9HC 3KJ6H 5KSUB 2R0WH 2O61A 2V7QJ 2C3VA 4YAQA 3L73E 2IBZX 2OSLA 1BFOB 3ATDA 4J3TA 5HVFB 5M95B 1BPVA 1BX2A 5CBEA 5DJAA 4OH2A 2NXYC 3C5SA 5HPMB 1DJZA 2UUDH 4NZJA 1BVLB 2XWTB 3LPPA 4Y16A 1OGTA 2JCCA 3MJ9H 3P3RA 4XC3L 1H0DA 2Z6FA 1XGRA 3AROA 4KXBA 1VJSA 5L2KA 3LS4H 4YBQD 1OTSD 5EN2A 2F8VA 5HI5D 4JPWH 3SIKA 3T1FB 2OM5A 5LN8A 4J8RB 5D7IB 4UV4H 3R8BB 1U8PB 5C08A 5E8NA 5CCKH 1PW3A 4GRWH 4AL8C 5CCGE 3TN0A 2CDEB 4JFEB 3AEGC 3GI9L 4QHLA 3SGDI 1IM9B 4CBPA 4LL1A 3FWLA 2WBXA 1J1XL 3P9LA 2WUBL 4L3CA 4N8VB 5F7AA 4XPFH 5FGRA 1ES0A 1HK6A 3QZLA 2VXSL 3OXRB 5D2NA 2IADB 4KVCL 3BIBX 1FZAA 4P2RD 4R97B 1LO0H 3VAEA 5AW5B 5GJTH 4MS8D 3OKDB 1ET5A 3F05A 2WANA 5DZVA 4FFZL 2Y1AA 4ZUWA 2P8MB 3FH8A 2K0RA 5BVPH 3SGEH 5BV7H 3NT0A 2EH7L 3FTSA 2ICEC 3FTUA 2WMPB 5KUKA 5IREA 3CCVP 3LRHA 4KK5D 3MD0A 4JQIL 3HC2A 4AE1A 3OAWA 1D5XA 2VZ1A 4YO0B 2JO1A 3L95A 1AYOA 1ICTA 3PGFL 3TA3A 1KLFA 2VMJA 4QHMA 4Y8AA 5DZ9A 3BWSA 4XMPL 1U7MA 3ESPA 2IH1A 2OCJA 1H8SA 4PJBA 4POZD 4GAYA 2J59M 2WINA 5L9DL 1SDDA 4XVTH 4AENA 3K1KC 5IQOA 5HYFA 5CEZL 4BINA 3C5ZB 5E2UL 1FZCB 5BU5A 5C07B 1C8PA 1NWOA 4ONFH 3U0PB 5IFJA 4YSRA 1GJUA 1YCSA 2DM4A 1EO7A 1T7WA 2W92A 4E41B 2Y4SA 4FD0A 1HHGA 1UOVA 2XNAB 3IDYB 4HHGA 4OJAA 5I71B 5GS1C 1TOXA 2NY2B 1RZJC 4LSSH 2PCPA 4LCIH 1SY6A 1H8AA 2H6OA 1CGSH 4P5TA 3F65A 1AKJD 1N9PA 5TPWH 3NFPA 1VF5C 1INEL 5C9JA 4K9EC 4ZNEA 1OF2A 5TDPB 3BP7A 1YQ4C 3F04A 3LQAC 4YOKA 3GI8H 4ZK8A 1UZGA 2LGNA 4UMGA 2XV2A 4L9LC 4IIQA 3WGUB 4OLVL 4AIZB 4BD4A 2BNRD 2QVAA 5KVGH 2PPEA 1WO2A 5JYMA 1I1YB 1ETA1 1NTDA 4HGWA 3MV7B 2P67A 1D5IL 4GP4B 3NCFB 2LOEA 1F6FB 1AZCA 1T3FA 1M1JC 1FJKA 3GMAA 2AXGA 4IL6X 4RFOH 4WW2C 5ANME 3CK0L 1FJ1B 4JO1H 1L0QA 1BLNB 2DQJL 4KU1A 3ULUE 4QRPA 5C6PB 4WGVB 1FAIL 3Q8FA 3MIWA 4UB0H 2AGJL 1SJMA 4HAKA 4D8PB 3EOAA 4XOBA 1ZPLA 1JXGA 4RAUA 1L9QA 3DMMA 1NTMG 4PQXA 4BKTC 3MI6A 3RVWD 1B4RA 3DUHA 3GT6A 1JHKH 1QMUA 3KZIH 1EZUA 2X10A 2WY3B 1BVNT 4KHXH 5GGQL 2ZG3A 3BH8A 3NACH 3H1ID 3PCYA 2C9PA 4NQEA 3MUZ1 3GB7A 4QHUA 4U2YA 4WI0B 2ARWA 2W65A 1QFUL 3SSUA 3HE5A 4JVPA 4M7ZB 4YK4C 1CF1A 4Y2NA 1MHPL 3LH2H 4PJGA 4ODTL 4TM9A 2DQTH 2XRAH 2OXHB 1SQBG 3PAZA 1IC5L 3F3HA 1R3HB 5LUMA 3GBEA 2VIRA 3HUJF 4MYPA 4TVSa 5AZEL 5B8CC 2QV4A 2QR0B 4CJ1A 2OMUB 5C0AD 5DZOA 2OX5A 3IWUA 4GDOA 1VPOH 4U1NA 4Q9RL 2DQEL 3OKLB 3Q7JA 2BW4A 1CFNA 4KNSA 3ARQA 3UC0H 3N06B 3EYOA 2ADIA 3DV4B 5HHQA 3EJPA 2YZ1A 1EDIA 3NQKA 2EE2A 1HQRB 3B1UA 5DF0A 1HE8A 2HPCB 3QJHB 2ZOOA 5CS7A 3X1EA 2E75C 2ZYSA 3HS9A 2VDNL 4W7ZA 3GTNA 4NB7A 3BAXA 4PWFA 1QLFA 4FQIL 3GSNH 5F93C 3D5OF 3HUSC 4IS6B 3T0VA 3OZ9H 3A4DA 3PPEA 4JL1A 1N6VA 1R3KB 2YD9A 3SQBA 1ZK5A 2AJYL 3DX1A 1T3UA 5ESAA 1LTGC 3QR2A 4OZHA 3VDCA 1GMEA 1VESA 2IXQB 4ELKA 4FGMA 1FL6A 1L0YA 1MHCA 3S37L 3N44B 2XQBH 3MJ7A 1VQ6P 3MUDC 1ZT7A 3FFCB 1J8RA 3VI4F 3F64A 3ESMA 1KFGA 2ICWI 3WLWD 4E9RA 4I1RA 5MEPB 4Z7NE 4H0LD 3UEQA 3O2VL 4PCKA 5B1AB 4J4PD 3PRZA 1URQD 1G6RB 2CHZA 4FNLL 5CJ4A 5E23A 5CIPA 3BPNB 3VMPA 2GTWB 3BAJA 1CVRA 5JHLA 1HS6A 3ARXA 3L72G 4FQ1L 1RV6X 4HT1L 4O2EA 4OD2B 5I0VA 2V2WA 4PW9A 3ZDXB 2A45H 2F53D 3FCTB 3E8UH 3UBGA 3V5DB 5DZAA 3UDWC 1U2CA 2GJJA 2VE6B 2NRGA 4KY1L 5ALCL 4FKKA 1JUFB 4WLCA 1VDFA 3WY4A 1A6VH 4KXAA 1M1KQ 1X9UA 4K2UL 5DJZA 2DDQH 2D2CC 1BCCE 1XAUA 2CH8A 2IDBA 3V6FB 4OI7A 3OL2A 2X4TB 3FQNA 3VW3H 1P1ZA 2WKOA 3M9QA 2GC7C 2X1WL 2XN9D 5L2JB 2QJDA 1NCCH 3MBEB 5ESQB 5LBVA 1LK3L 3L5JA 4WO4D 5JLZB 5FUZL 4QGTA 1M1XA 3AGWA 3LKNA 3RDTA 2J1YA 2KQNA 2CSPA 3VQ1C 4UNIA 2KLUA 5B7FA 3BKML 3LKPA 4QXGL 4CN1A 4KFZC 4O58H 1SLVA 5HYJD 1U57A 2V2XA 3D30A 5KTEL 1ZV9A 1I3GL 4P4KB 4PJBF 4HX1A 5FYKH 5ADPL 5AVTB 4TL4A 1A6WH 1BAWA 2UZPA 1FC2C 4RBPH 4YDVB 4JRYE 4JRXB 4Q9BA 3IMTA 4A6YH 3CN4A 4U0RB 3S35H 3H1HG 3CFEA 5DSCA 3TWCH 4FNSA 4JFEE 3N41B 2OL3L 1SN5A 2DWTA 5B1CA 1JI1A 3R7RA 1GOGA 1OAUL 5GS0C 5H4ZA 1HINL 5SX4H 3RBGA 1GJIA 3DTDA 3FOMA 1UQSB 1XGYL 2D03L 1A21A 2X1PA 3EOTL 3GRWA 5DVMA 1ZGLP 4JFHD 4X9YA 1IARB 2ZX9A 3MA9H 5AAWA 1KCRH 2WXHA 3RGVA 5EOTA 5KVEL 2PXYA 1HU8A 4YHNB 1K4CA 3ARVA 3LNFA 4G9FA 4OZFB 1MRDH 5F97E 1VZHA 1KJ2H 1U8JB 2BOCB 4M5ZH 3WUTA 3B34A 4MHHI 3WUWG 1Y1DA 4JQVC 2IQAB 1U8OB 1XV8A 2O26U 3HLAB 1QKZL 1CTNA 5D5MB 4N2CA 3PGDA 4R7DA 4HJIA 1CD1B 4KI1A 4LCCB 2HJKB 4N2DA 4XP9H 5DUML 4N1EA 1GU5A 3ISRA 4M61B 1F58H 1LO3H 1BDDA 1JNNH 1GYCA 4XA4A 3ARGC 3FQ2A 2R83A 3GINA 4NQCE 4DVBB 4L8CA 1OK8A 5KAFE 4GS7C 2L0DA 4HUCA 2GT9A 1HSBB 1UJ3A 3EFDH 4QT5A 1DEDA 3L3GB 1RUMH 3LRKA 1JGEA 2F58H 4HIXL 2NPSB 2JI3A 1CFSB 1BHGA 4DGYH 2PAJA 3CSGA 3WFBL 3Q2LA 3FQXB 5K9JH 3UIZA 4LSDA 4KNQA 4NCC1 3D0LB 1LEGB 3FSWA 3OR6A 4JG1L 4Q9QL 1R17A 3CBRA 3KPSA 1CJYA 1N0LB 3LCYA 2GFBB 4GSDL 4I9WD 1TCRB 4RGOH 1X9RA 5ERWA 1RZFL 2C9QA 3MV9D 5I5IA 1FVCA 4OUUA 3NSJA 4G8GD 2EYSB 4K9JA 5EMYA 5BQDA 2OI9B 3MLWL 4KK8C 3PLYA 3VI3A 4NPFX 3LIDA 3KXFA 4L1SA 3TU6A 4D9QE 1WIUA 4AJYV 3CLQA 2SEBB 3QUZA 1U93B 4NGHL 5BZDB 1RURH 3MLPA 2W0FB 1YEWA 3D8MA 3DYPA 4PJGF 1DLFH 1HHKB 2X6BA 2Y36H 3PV7A 3C60C 5ICXA 1E5WA 2D0GA 3EYFA 2WGNB 2OTLP 4YPGB 5B1JA 2UZIL 5F6IC 1OT1A 3SY0B 3IMBA 4XMVA 1Z5LB 3FH7A 4ZMZA 4WJ5A 4AYFB 2PWEA 1OB1A 5DA4A 3QWQB 4TMPA 4F3FA 2J56A 1LEIB 3EGDA 3F01A 2IAAC 4PWJA 3BAEH 1U91A 2JKRM 2I9TB 4O51A 4P2OB 5GRYA 5HHVL 3CDGA 1HUCA 3HG1B 4PB0H 2ZWNA 2CO4A 3QAQA 1ZKAA 4R4BB 4ZMWA 4G7SB 2DN7A 1OVZA 3S4SG 4X6FB 1N0XH 2XWEA 5BUAA 1FDMA 4XE0A 3MUUA 4HKJB 5D1QA 1MQKL 1NWPA 3NIDE 4HZLA 5JIKA 1EQ7A 5B7EA 2FT8A 4FQXA 1UT2A 4LCYA 3DTXB 3Q44A 3UG5A 1TZIB 3NCEB 3SQOL 3WS3B 1FE6A 3VD7A 4IGBD 3O4OC 1EHNA 1B4JL 3PHQA 3KJ6L 2E74C 2R44A 2R0WL 5K5YA 2ZE0A 3HOGA 1CQYA 4HOZA 1AGBA 1MN4A 1LO5A 2QPUA 2NZ2A 1F90L 3SCMD 5T8IA 4YFDB 3NBNA 5D2LE 2BY0A 3T2NH 4F20A 1JYVA 4GIFA 3KJ4B 3L8QA 4YL9A 1MXGA 4JFSA 1K2DB 3LS4L 3RUGA 4IRZA 5F7HA 3F7RA 2DEYX 1H89A 2JQAA 1XB3A 2AEQL 2MWCA 4IOFC 5DS8B 3V4UH 4JPWL 4D7BA 3SJVB 1I3RB 1ERNA 1GGCL 3KDMA 5EO0A 4UV4L 4XWGL 4G3YH 4ZFOL 1JTPA 1IQWH 3CWBG 1JFHA 4NRXB 1Q9WA 1URLA 3HE6A 4XNZB 4WTZG 4XT1C 4QD2E 4ZMOA 4FMFA 2GIMA 2Q7YA 1E79H 5DMJB 1LK2B 2FD6H 4NKMB 3EYQC 3RIFF 4H44D 4S1SH 3MGNA 5HHOB 1RZ8A 2EYTA 4NO0B 3MGTA 1WCQA 1U3HC 2WKOF 2MHAB 1HSAB 1MFUA 3OF6D 3A47A 3V5HA 1IKOP 3R4RA 2M2DA 4OY9A 1IIIA 5DVLA 4BBWA 1TQVA 3L9RB 5E0QA 4JFVA 1E4HA 4QJ3B 1WZMA 1TVBA 3P69A 5D8JL 4AXWB 5L4MA 1CFQA 1HAUA 2P49B 2DKSA 5E8PB 2AC0A 1ZRTD 3VRJA 2X2IA 5BV7L 5IT2H 1HEJC 4YXKL 4J5VA 4C7RA 4IBUA 4DCQA 3PHOB 3ROOA 3LZRA 2D7TH 1JNLL 2HPOA 3IDIB 2DOCA 4I0PC 2V7NA 4TL5A 1XGQA 2X7LB 3BSHA 2EE6A 2A6JB 3MHZA 3FN3A 2Y06L 2BCMA 4U4BA 3KHQA 1SJVA 1TO4A 1EDQA 2Z93A 1UWYA 3B5ND 4FJZA 4KWUA 3WFZA 3LHPL 4ZXBA 4XVTL 1I8LA 2QA4P 2DBJA 3SEPA 4B3VA 2V2TB 4JVUA 2OMXB 1D3CA 1SN0A 1L9OA 1KDIA 5EU7C 5HYSB 4MZIA 5DJYB 5IOPB 1BVNP 2NY0D 4MNQA 3MYJA 5HHMB 2EUWA 4A37A 4JE0A 3A24A 4Q56A 2ZSVB 5IQ7H 3BFOA 2IOIA 4JN1H 2EO9A 1DQLH 1CICD 2FO4B 3IFNL 3OKKA 3CSYB 5F7BA 5D1ZB 2ZCLH 3IVKB 2B3RA 1IBZA 4Z3FA 4Y16D 1A02J 3EFFA 1KCSH 4XCFH 1MFCH 3QUMA 5B66E 1QSEA 2E8ZA 4HLEA 4G7QB 1PBYA 1QBLH 1PV3A 3O9WA 5T1JA 2C9LY 1IUZA 1FNGB 5KVGL 4H4NA 4JYCA 1N73C 2BSSB 1IFRA 2Q86A 1JGDA 5H94B 1P5VB 1KCKA 4IRJB 1BEYH 3UZEC 3WL9A 2HFTA 5I26A 3RQ3A 3PDOA 1F3JA 5CEYB 4UT7H 1CE6B 4FQCL 4KH2A 2FGWH 1RHHA 3HTKB 5HDOA 4MAUH 4W9LC 3V2RA 1DVYA 3H56A 3MLTA 3OKNB 5JORB 2D0HA 3T8XB 4RAHA 2ITCA 5KG9A 1XH1A 2VSCA 1KILE 4X5XB 1L0PA 2VSKB 2DYSB 2P47B 1D6EA 3QIUC 1AZNA 3NJJA 4UUJB 4YHYB 2EDHA 1ASPA 3P2BA 4PW4A 4CGUB 2EABA 4APQB 1AQDA 3HG3A 1XF2A 1DVZA 1T66D 1YPZE 4Q2ZA 1FSKC 1MAJA 1T5WB 1DDTA 3TYGH 4ZMDA 4PVNA 1QSVA 2J71A 4UOZA 5C39A 5IVXA 3OAYK 4ICXA 4IOIH 3AEAC 2EDKA 3BEWA 3TA3D 3VXSA 2WQYC 5SWZA 3REWB 1IGMH 4MNHB 4OKVA 1IB5A 1IC4H 3J27A 3ZUCA 4OJYA 2W59A 5TK2A 2VC2L 3G04B 3WUUA 4NQXA 5EZPA 1B2WH 1VPOL 4GODA 1J05B 2IBBA 3HFFA 3WTUA 1LDPL 1QZ1A 5AYTA 2VN4A 4HIJB 1OPGH 4LVHC 5F1NB 2BY1A 4HJUA 3Q5OA 4EI6A 4MB3A 4QOKE 4YQXH 3DSNA 1RZ7H 4FHKA 1X9LA 1H5BB 2KQMA 4RQQB 5HD8C 3GJFB 2H88C 1G5AA 1OGAE 3BCFA 4JUSA 1HHJA 2VLRD 4P5TD 3BVUA 3K4DA 1BM3L 4Z7QF 5K1NA 3OZ9L 1HXYA 1RPKA 1PGPA 3ME0B 4NJ9L 1FA4A 2G4EA 2H3KA 3ISYA 2HYNA 1S9WA 2B16A 3OHMB 3QWNA 1UXMA 4HS3B 3U4BL 1VADB 1IAIM 4KUCD 1T5XB 3TCXA 3L7EA 1BP3B 3DURA 4XOCA 2H6UA 3Q5PA 1LWHA 3H1ZA 3LZFL 5F8QC 2HCZX 2J73A 1JRHH 2VR5A 3DVGA 1EDLA 3Q6FA 3WNLA 1SJHA 1ZV8A 4R4NC 4GI6A 3AE5C 1V10A 2HKAA 3F5HA 1I8KA 1UD8A 2EJ1A 3QDMA 2CLRA 4BFNA 2X1QA 2AAVA 5B3NA 1JWUA 4HJGB 4LCWD 5LBGA 1YC7A 2V5MA 3AU1A 1T83A 3S5YA 3W81A 1J9QA 4FLQA 5F1OB 1T1YB 1RUQH 1BGYE 1D7DA 3E8UL 4FTDA 4GEIA 4Y7MA 2E9IA 2E56A 4XXWC 4WTQA 3DMMD 4V1DA 4GBXD 3V4VB 4F7TA 3BWUC 1PZQA 1CK0H 2KLSA 3VXOA 4MMZC 1ET7A 1CO1A 5EDXA 2UXFA 3GMMA 3VN0A 2DDQL 4PV9B 3SGKA 1Y18B 3UTTE 2WQSA 4EBQH 4NQED 4PJDE 1Z9LA 1BXUA 3PXJA 3QEUB 2X0WA 3VMNA 4EN3B 4HKBA 4RZCB 1N26A 4TLSA 1AQHA 3GMRA 4LRNL 2KS1B 1KTLA 4XNYH 4OCMC 4UU9A 1F4WL 2K1AA 1DQQA 3H0TB 1NCCL 1NBZB 2MTAA 3QJRB 2EDRA 3QA3B 3V0AC 2YUZA 2Y9RT 4OVNF 3N42B 3SDCC 4LARH 1WAAF 2A9AA 3NP4A 5IP4A 2W9EL 2C9AA 2R59A 3EYVB 4OCSH 1GK4A 2OS7A 3VFMA 4PJ5D 3NSCA 5DMGD 4WUUA 5BRQA 2ZNXA 1J5DA 4ZUVB 2ZX6A 2I1KA 3E80A 3S35L 1CD0A 5IM7B 5KVDH 1K85A 4FA6A 3HNSL 3SKMB 3TWCL 5T1DL 1F4YH 5ACLA 2WSCH 2AS5M 4MDIB 4OF7A 4GUQA 1QQDB 3BUBA 1L0XA 3H9SB 4HUWB 3C5XA 5FM5O 2P8PA 4AUJA 2FYYB 5C0CA 2G75A 2X3AA 2Z4QA 4ZUSB 3QEGH 4UTBL 1M6OB 2XVBA 2MKVA 3ZDYF 4H5SA 4IFDK 4NXKA 2V37A 1AE6H 1HXMA 2ADJA 4PRIE 3OXSB 2H2PC 1D5ZB 1KJ2L 2CKBA 1M71B 4EQ3A 4AGMA 4OCXH 2ENJA 4AH2B 4KGLA 2CO3A 1KV3A 2EDLA 5E8OB 3LTVA 1WPCA 3LZOA 3ML9A 1HBWA 2ADFH 1V7ML 3K72B 1HOCB 4X6CB 4XP9L 5AD0A 1Q1PA 4AJVA 5IUSA 3ZTNH 4HKZA 4JO3L 1ZHLB 5LHDA 1F58L 1JNNL 5IEKA 1Y1UA 2R0ZH 5CN3A 1EFQA 2X4NA 2WPSA 3IJHA 4LPWA 3B8YA 1AQKL 4XVOA 1HNGA 4X4MA 1SUJA 4AQ8A 3MV8D 2WQVA 3EFDL 2PO6A 4BQ8A 2FAUA 1RUML 3S4SB 1RSYA 4FTVD 4BH8B 5FX3A 1YYML 1MHEA 4DVRH 2FATH 3HS0B 2CHDA 3C8DA 3LKQB 4XPGH 4DP9X 2VM9A 1JL8A 3W39B 5K33A 4I8DA 3SPVA 1QWNA 1NTME 2YS4A 3RVUC 5I75B 2HA1A 3VRIB 5IG7A 4TT3H 4QRSB 1F00I 1B6DA 2BNQA 1L7IH 1NGXB 1H88A 2YA1A 1I9IL 1PSKL 1T80A 1MFNA 4O9BA 1N2DC 4LSUL 5DR5H 1RURL 3KPOA 1DE4B 4EVNB 4PS4L 2NQDA 4YDJA 4NHUB 4F92B 2W07B 4HWNA 4L05A 5EC2A 3RDTD 2Z5IA 1HH6A 2Y36L 2BFVH 2DL9A 3EJTA 4Z0XA 3ULSB 3TYFB 4FCHA 4BZ1H 3D0VB 4R5XA 1KEML 1VIWA 2ZKHL 5AOLA 3K8KA 5D7JC 3RPIA 1X7QB 5J11B 1MCRA 2UVEA 4N2OA 3ARWA 1NGPH 1AGFB 2PFXA 1X6LA 1E8WA 1MVUA 2APWA 2FEEI 4ZMVA 3KYKH 2WN3A 3HE7C 1O6VA 1QSZA 4LNVA 5BRZE 1Y9BA 3LRSA 3MYZA 4Y4KC 2EDOA 2P5WD 2QPDB 3C8KB 3P4OA 4NKOA 4XCYA 3ARDB 1IQDB 5DC0A 1N0XL 3RL2A 1DD3A 3MMEA 2D31A 3ZE0E 4AI7A 1MJUH 2PXYD 1NM9A 3DVNB 5FGCB 5LGHH 2IYPA 5FAAA 4G7VH 4DKAA 2IANE 2WLZA 3PWJA 3KPQB 3KWUA 4KAQL 1TTUA 2PCFA 3ABLB 2H3NB 3LB6D 4ACPA 4XNDA 4E36A 4HK0B 5DD6A 1PYWA 4LF3A 2F08A 3LH8A 1KCUH 3AREC 3UAJA 3UC2A 3CHXA 1DQJA 5ICZA 2FBJH 3OAKA 1CN4A 5F72S 2H1LM 4OJFL 3ZE2F 2OYIC 2OYHA 2VDOH 4WJKB 3WEAA 2XG4B 1VB9A 2MPVA 4NQTA 4JL2A 4KZEL 4JM4L 3LDBB 3L72E 1SY6L 2CPUA 2BP3A 4XCCL 3ETTA 1F45A 3QYNA 1RIVL 4XNAA 4FXTA 2R3CA 1W5CE 3F8UB 3NPSB 1M56D 4P99A 4AYBA 5HI3C 1UFUA 5DJCA 3ARSA 5DDHB 5GGUB 4HUVA 4E5XG 3A0HE 1P7QB 3FU0A 2CIIB 4WKZB 2P1JA 3TASA 2VABA 1ECYA 1A0QH 3IDXH 2IG2H 4EZLA 5IW6B 2PYFA 2FD6L 5LBSH 4S1SL 5C7ZA 4N3YB 2W6JH 2RFXA 1NFDA 4DAGL 3G9VA 5GGTH 2P5EA 4NKIH 4PJ8B 4FG6D 1FVEB 5F21B 1EVUA 1NCNA 2YGVA 5CSBA 2A06D 4LOUC 2AZAA 4NZTH 3W1ZA 4XXDB 3FWNA 1G0DA 2W88A 5B5EE 4EIJA 1AZBA 1BFSA 4KXZH 4Y9GA 4NFCA 3U6RB 5AKTA 1YNKH 1KB9E 2G2NA 2AK4A 3ARFD 3LZQA 4XO3A 4JQXA 1BSHA 1YY8A 3I85A 1PG7X 2BIMA 3AY4A 3VGEA 5IT2L 5DJ6A 5EO1A 4FYRA 1J1PL 1ZAGA 3V52L 1SOKA 1LNUB 3NFSH 3EJJX 3H1HE 4WY4C 2PW2B 5D9SB 4FA7B 2JFCA 3JTTB 3T9WA 2YD3A 4OZ4A 4L8SA 1EBPA 3KHOA 3USSA 1CYXA 3VMOA 1GTNA 3MGOA 4L5FH 3DOIA 1KZQA 1T89C 2XKNB 4Z0BL 2R1YB 5D1QD 3BOVA 2WT7A 3HZYB 2BNUB 3SDXA 4JJ5A 5B3JE 2NY1C 2FYNC 4ZZFA 3FUMA 2FR4A 3S4RA 4BQBA 1ORQB 2EEDA 2F7IA 3C6LA 5HVWA 1MJ8L 3PWPD 5C0IB 3LPGA 3J07A 1JZ4A 1RPQA 2P7TA 4JN1L 5EEWA 2DIEA 1DQLL 1XF3B 4MXQD 5TE6H 2EC8A 1DTUA 1E65A 1L4AC 2UY6A 3CFKA 2Y1YA 2YD8A 4E2OA 3N4XA 3QUKB 4XCFL 3AADB 1AI1H 1RD6A 4QCIB 1NMCC 4IBTA 2FZ3B 2R4RL 4LSPH 3GSVB 2YBGA 1QBLL 2K6YA 3MLYH 1JBJA 4AWJC 3TBVA 4MA7H 2BVEA 4PJXA 4YLQT 1NYHA 1I1AB 2NRDA 2W0PA 5L8KB 1B9ZA 1JXKA 1OSZA 5L7XH 3BE1H 3K81A 2WUCH 3MXVL 1F11B 1BEYL 1AD0B 4X7TA 5FCUH 4RSYA 2CAKA 4QO1B 1XWVA 1EEYA 4UT7L 5EIIA 1MNNA 4EI0A 3BVNB 3QWOA 1WZ1H 1G9ML 4I9XA 4L0ZA 5EIVA 1HE7A 3IRZA 4FG4A 1SFCB 2G5BB 4MAUL 3POHA 4R0LA 3MAWA 4ZFZB 4EKXA 3QGVA 5JHLL 4GLRH 2VZUA 1RHZB 2BVQB 2XETA 4MDJA 2AJSH 4PEEA 3DRTB 4G43A 1W6LA 1DJXA 2VTFA 4M7KH 3IJYB 4Z7WA 1JERA 2ROXA 3II1A 3RJDA 5J06A 1SGKA 1MQ8A 4Y4HC 4C47A 1GZQA 4NNXA 5EEUA 2YKPA 4HHAB 1XL4A 1T1ZA 3GXIA 5E1GA 3EDJA 3OMNB 5T3ZD 4J3OD 5FLUA 4DUWA 5CSZB 3PL6C 5IB4A 4LESA 5JPNC 3T3MF 1EJFA 3WIHH 1RK1A 3ASOB 1HVVA 4Q6IC 1Q9KB 1IGML 3OJVC 1RERA 4I87A 1NICA 3A6BL 1UCTA 1ZT1B 1EZLA 1AJ7L 4C59B 1FN4B 1R5WA 5AB1A 4PLNC 1XZWA 4ZXBD 2NY5H 2DW5A 3VFRA 3DOHA 4Y5XA 1OO2A 3L1OL 5EWIL 4DFHA 4F5CE 1WS7A 3DV6A 2EE9A 1OAKL 1QTSA 3BMVA 4MNQD 3Q5TA 4PD4H 1FIGH 5E0FA 1LWUA 2UWJE 4YQXL 1L4IA 4DPCX 4IYKA 3EAKA 5GZNC 1JWMA 3X13B 5EULV 5GRZA 1KXTA 4U1KB 1PZUB 1P6AB 4HCRA 3QIWD 4UM9D 3IXTB 3GMPB 5C8JB 1S7VB 3D2UD 3BHBA 4ELME 1SLWA 3BX7C 3FRUA 5BUPA 4XZUB 4LKXA 3GIZL 2OJZH 5GS0D 2KSJA 1U8HB 5A1AA 2MOVA 2FYUE 4L3AA 2C3GA 3O9WD 2UZXB 1SEBB 4GAAA 4ELDA 4BSWB 5B3SB 4CMMA 1YEEH 2WC7A 2YAFA 4RAVA 3N3EA 3RTQB 3D71A 3CHQA 1O6SB 1T7VA 5E6ID 3W9DA 3ARTA 3WFEH 2VLLA 1CL7I 2NLJB 1G9NH 4EZKA 1MCPL 4MX7A 3CWBE 1CLZH 4NDMA 1FO0A 2IPKB 3HI6H 5B39B 2AVGA 2EUVA 1MCEA 2H26A 2CGYA 4UI2A 3F83A 4KO9A 5I9QC 1HGZA 4J3BA 1UB6B 2YD7A 5JW3H 3RL0C 1NFDF 4RWHA 5C2BH 3G4SP 3AB0C 1RUQL 3VNZA 5SX5K 2KB7P 3IDMB 4ZOCA 3U82B 5JHDA 5EZIL 2X12A 1GL2C 1H0TB 3APNA 5JIMA 1FZOA 3HC4L 1OSEA 2YJLA 3PQYB 3R4DA 4YC2B 1CK0L 4Z7UE 2NZIA 3NTCH 1PQZB 2QSCL 5FGCE 4WQOA 2BDNL 4ONGH 3ZDZF 4LLDB 3A67L 4PJ7A 1W91A 5G5DA 3DRQA 4EBQL 4GMTL 3E1RA 3O3BA 3VGFA 1ZTXH 4QXVA 4Y4FA 3DX6A 4XNYL 5E2WH 1S72P 3KCPB 3R0NA 3ZSTA 1U9KA 4PRDB 2Q3XA 5KSBE 1BYPA 4OSUH 4C56B 2G4GA 1KFMA 2FL5A 2ICWA 5AKSA 1U8MA 1JTOA 4LARL 1X6NA 3VVWA 3CC4P 1XTMA 1QRNA 3W0WE 4ASVA 1KYOH 1A7RL 2PPDA 3QO0A 4X6DF 5FB8B 4U1JB 1CXEA 3BSGA 1QHPA 1PZAA 2X41A 3QNFA 3ASNB 3C60D 4R7NA 2OTPA 1AS7A 3P54A 3RAJL 1G7JA 3TV8A 2CK0L 1ED3B 4PJAA 3KH3A 2QTEA 3HI5H 4KUZH 4TUJA 1IC1A 1RPUA 5E79H 4F1SA 2VDNB 1RJLA 2VAAB 1WFJA 4HJJH 2B4CH 4JKNA 1MCIA 4L75A 2QLVB 3FB6A 3BP4B 3D18A 5A2LH 1KQSO 2B77A 5IOKA 4OM1L 5K1JA 1FE8H 4L73A 2B0SL 3H3KA 1MI5D 5GZOA 2HLFD 3GHEL 1EJOL 3L5IA 4MMXA 2GABA 1AQMA 2WM0A 1ACZA 1D9KC 1YEKL 3IGAB 2IDUA 5CGMA 5GRWA 1BVOA 1KCBA 4NX0A 1GA2A 5KUMA 3OHXA 3B1TA 2WP3T 4A2DA 5MP6L 3CX5E 2Y7MA 2E74D 3IAQA 1USEA 3CFMA 3Q13A 4HD9A 3WFHA 3QDMD 2J8UE 4YDLB 3HAEH 1K5NA 2R0ZL 4GO6B 4UILL 3NGBC 2WLLA 1KFNA 2BP8A 2PTTA 5KAIH 2WVVB 3H8NA 3LV3B 4MBOA 4U49A 5CJXA 1N5AB 4F93B 4DVRL 4MXVE 1AFOA 5T1MA 1CSBA 1UD6A 2FQFA 1EXHA 4BRYA 1MH5B 4ZQKA 5IFHL 3VQMA 1SXZA 1MCOL 4IRZL 1RVFL 4YUEH 1OXZA 4GPVA 3AT9A 3FO0L 2Y2WA 5E2JA 4DO6A 1RULH 5D1XC 1A1OB 3EHBD 2KH2B 2QGDA 4Z7WF 3G08B 2HODB 1HJ0A 3P0YH 4L4VD 2F61A 1EFXD 2FTAA 2R0KH 4M43H 5EUOE 2WSPA 1AGCB 2WXKA 4JHZA 1XZ0B