2YO3A

Salmonella enterica sada 1185-1386 fused to gcn4 adaptors (sadak14)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
KQIEDKIEEILSKIYHIENEIARIKKLIKVTDAQVSRNTQSITNLNTQVSNLDTRVTNIENGIGDIVTTGSTKYFKTNTDGADANAQGADSVAIGSGSIAAAENSVALGTNSVADEANTVSVGSSTQQRRITNVAAGVNNTDAVNVAQLKASEAGSVRYETNADGSVNYSVLNLGDGSGGTTRIGNVSAAVNDTDAVNYAQLKRSVEEANTYTDQKMGEMNSKIKGVENKMKQIEDKIEEILSKIYHIENEIARIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
total genus 80
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2yo3A01
2.60.40.4050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yo3A02
2E42A 3VTPC 2ZXEB 4JYBA 1H88A 1DH3A 2XU6A 2WWWA 1S9KE 2N9BA 2R5DA 3HE5A 2W27A 3NMDA 1GK6A 3VYIA 4KHXA 2C9LY 3O8ZA 3NFQA 2ZFCA 1HJBA 1GD2E 1GU5A 5AW6B 5AVVB 1A02J 1GZLA 1CI6A 3L36A 3M06A 3KDPB 3NTNA 4LC1A 4XE5B 3SWFA 3A5TA 3NXSA 1CI6B 5AVWB 1HBWA 1OWAA 4AQRD 1YYCA 2YO3A 2P2UA 1FAVA 3OAKA 2WPQA 5AW5B 3V4WA 1IO4A 4AUWA 2H7HA 4B86A 3HE4A 1SLQA 2VRSA 3LIDA 3M9HA 1H8AA 1KQLA 5AW9B 3VN0A 5AVXB 3LIEA 1CSBA 5AVQB 2WPSA 2XZRA 2WT7A 3B8EB 3MGNA 1HUCA 1JNMA 3M0DA 3T97A 1G2CB 4EOTA 5APSA 3MD0A 3VMYA 3P8MC 1MV8A 3A7OA 3L37A 3P32A 1GK4A 3I5CA 2Q7CA 2JJLA 2QM8A 2IPPA 3TK1A 5AVTB 5AW1B 2XV5A 2W6AA 4RESB 3M9BA 4I6MC 4DZOA 2WT7B 2E43A 2YO2A 1MUUA 3P7KA 1H89A 1HWTC 3V5BA 1S9KD 4GT1A 1X8YA 2Z5HA 5AVUB 5AW4B 3M91A 2YNYA 5APVA 3L35A 5APYA 5AVRB 2BASA 4GKGA 4AYCA 3HE4B 2Q3IA 3TNUA 5APUA 1T2KD 3V4QA 2KP8A 5AW3B 5APQA 2R5BA 5AVYB 5AW2B 1A02F 4M3LA 3UIAA 2R32A 2QM7A 3TNUB 1J2JB 3HE5B 1MFZA 2R3CA 5AW7B 1JUNA 3TYYA 5APWA 1CZQA 4I2LC 3KQGA 3VMXA 2Z5IA 1T2KC 5AVSB 4C7NB 1FOSF 1SP4A 4HYTB 5CMZA 2WPRA 3VMZA 1GTWA 3HTKA 5AW0B 3A2AA 5AVZB 3A3YB 4JYCA 1GU4A 5APXA 1FOSE 2C9NY 4C7NA 3IR9A 5APTA 1NWQA 2P67A 2WTYA 5AW8B 2P7JA 4C46A 1OXZA 1NAFA 3M0AA 2Q5UA
chains in the Genus database with same CATH superfamily
2WIIB 4ZPVB 1N10A 2VZSA 3BAYA 4S1DD 2H89C 2IBGA 5D7SH 4FXKC 1A6UL 1SDYA 4YO0B 1ZGLB 3OR6B 3FU8A 2F53E 5C0IA 5E6IC 5HGHB 1AGFB 5F7HA 1BM3H 5D6DA 4CU7A 1ADQH 1EXJA 3MLUL 4OSUL 4GSXA 1FN4A 2JF1A 3MNMA 2I07A 3MBXL 1SQVG 1NIDA 2QPFA 2DLIA 3PCYA 5K39B 1JUFA 2WUCL 4KO5A 4PU2A 2X38A 4MAYB 3CLWA 2EDDA 5SX4I 4MN4C 2E7DA 1LHZA 4Z7NF 1P69B 2BVPA 4H13C 2MNUA 3G5VB 4LL1A 5DRXB 4ETQB 4JAMA 1NCIA 2OYMA 4WNQA 1AI1L 2D3LA 7FABH 4F7TB 2VW6A 3RP1A 1BXAA 4MZ3A 4LGDE 2J8UE 3HNSL 1TF4A 1H8AA 1KQLA 1OVRA 1U30A 3MODH 2BNUB 2Y6SC 3L4CA 1CSBA 1GSKA 3IAGC 2IDSA 2EIEA 2EDEA 2ADGB 3O4OB 2JKVA 2AEIT 4HEPA 1NFDE 4Y16D 5C0CD 1NAML 4LT7A 2OL3A 5JW3H 3QWOC 3P54A 2KBGA 2YAHA 3MOBL 5F3BA 1GOHA 4PTTB 2P9RA 1FH5L 1RIVL 3QO0B 1OLLA 1ORSA 4BUQA 4XXCC 4K0OA 3OR6A 5EF1A 2VZ3A 4FC3E 1MCJA 1KIPA 2GG1A 2F7QA 3I9GH 2VN6A 3MRNA 3QHZL 4JAMB 2PPDA 1WAPA 3L1OH 5LAPA 4O51A 2DF3A 3NFSL 2WLZA 3TF7C 3BUBA 5GRUH 1RI8A 1W6LA 4DP8X 3C6LC 1S7QA 4MAYA 1F58L 3FX0A 1FNGA 2ZUSA 3SQBB 5AG8A 3Q2WA 3DV4A 2Y23A 5KYYB 4YSAA 1OD7A 1FL5A 3CN3A 4CA4A 2NY1B 1PF3A 4MQXC 5APUA 1I3UA 1ZHBA 1LNUB 4YL4A 3P4NA 2QJPB 3QIUB 4AZ8B 2JELH 4EZJA 2Q2EB 1R5IA 4NSKA 1A6ZA 1KY7A 2F7OA 3QJRB 5K9QI 3BH4A 4HJ0D 3STZA 2VDKL 3T9WA 4KWUA 4GKSB 4B41A 3U2IA 5ENWB 1NKZB 1BF2A 1A3RL 3HAEA 5I1IH 2FATH 5M94B 4WSKA 1KELL 2R29A 3X3GL 1LGVA 1JXDA 5H4ZA 2OP4H 4H0LC 3EGSA 5KBKA 2XC8A 5HP5A 1D6VH 1X79B 1QQDA 2C9QA 1A2YA 1NQBA 2HN7B 2PCFA 1QMUA 4K5OA 2F7IA 4HGMA 1G2CA 3A2AA 4YH6A 5DHVH 3WIFB 4JPWH 2ZWYA 5FB8B 2GVYA 1X5LA 4HXAH 4A2DA 3S5LG 1TG8A 3O6LL 4ZSOE 4DK6A 2Z8RA 1OX3A 1U8NB 3EJPA 4FG6D 5IVXB 2UWEA 1FJKA 3L74D 3FN0H 4NN6B 4K71C 4R4NC 5DRNA 1P9MC 4U3FE 3CLEH 3HNVH 3CSTA 5F89B 2CKBA 2ILLA 3EH4B 4TLFA 2WLNA 1P4LB 5T5NF 3KPNA 1HXMA 3K6IA 1UM4L 4EI6A 3VXNA 2K7PA 3TESA 2RA1A 1QFUH 3QJHB 4MVBC 2IQ9H 2WLHA 1KGIA 3HHRB 3VD4A 4MD0B 1FLTX 4Y16B 3MKGA 5EUOE 2WVVA 4XNUH 1JNHB 2E9BA 2ZJSL 4OZHE 3AAZA 2W9EH 3H9HB 5H94A 3BWAA 1KGJA 4Q9BA 2WQ8A 1XXFC 1JRHL 5KBPA 3ZHNA 3E9TA 1IC0A 5DD3L 3H9SE 4AYFA 2BJML 2YMXH 2OKMA 2FNWA 3UZEA 5J6HA 4LB8A 2VQ1A 1YYLH 4IKKA 4N2CA 1Q72H 2J20A 3N41B 4LSTL 1KFGA 3P9MB 3RWDA 2FGWL 4LOVA 4OI8A 1N8ZA 3MHZA 4WO4D 1JD9A 1BFSA 3O3DA 2QHLA 3O3DB 1S7XB 3IETB 3JYCA 4QDGA 5DGRA 4Y2DB 5K33A 3ZUCA 2LGNA 4UINH 2FCBA 3KYQA 5FM4A 4OGZA 1HUCA 2XPGB 4Y5VB 5T3XE 2DLTA 1U8NA 5FC9A 5IVXA 2ODHA 4NQCD 3U83A 2CLRB 2VB5A 4UANA 4KJQD 1JNHA 2E6QA 3NABL 4HBQA 4B9IA 1VEPA 4JB9H 3DECA 2D03H 4F3FB 3VYNA 3WY4A 4R0LA 4KTGA 4PRNA 3D6YA 1HHJB 4ZNCA 2BNQB 3QFDB 1BCCG 2XZQL 3CBJB 4P4KB 1N5YH 4LBEB 4LLDB 1KGWA 5BV7B 2O1KA 1OQOA 4IKLA 2ZKWA 5ETUB 3VFOB 2JTDA 4XCFH 1IKFH 1SMDA 5L4JA 2O1AA 3UZVA 4NM8H 1ITBB 4NWUL 3CFJB 4QXTB 3C5ZA 3BP6B 4Z77A 4S0TD 2XN0A 4MA8L 4NYLA 2LQRA 1N64L 3H53A 1G1KA 3RB7A 5EBWA 1G94A 2V7HB 3QG6A 5AZUA 5GS1B 5EA0L 3M17B 4JY5L 4PJ6A 5C39A 1PX8A 5D2LF 3SSUA 3B7RL 1FO0A 3E8UH 3T3MF 4JZOA 3VI4E 2ZP8A 2HKFH 4I0PA 1BZ8A 3BCDA 4Y4KC 4XNDA 1PZAA 1R17A 3LEVL 4GO6B 5JPNC 4LDOB 3SYPA 3LKPA 1R3JB 3GEFA 4KKCD 5I1CL 5FM8A 2V2WB 5I1KL 4CBPA 4Z0BH 3GMMB 1ZXQA 4FMVA 3EH3B 4LLWA 1Q9KA 1A7OH 3ARDD 3VI3E 2OTWB 8PAZA 1WT5C 2AQ2A 1JY2N 5F9OL 4QYOB 3VQMA 2GHWB 3EYUH 4ZQKB 4QHLA 4J1UB 3EF7A 2FTAA 3JV5A 3PWJB 4O2CB 3X1GA 2E6PA 2GYSA 1OAXH 3IFLL 4GAJL 8FABA 3MRGB 1UXWB 3APNA 1S9KE 5LAXA 3BRGC 1I85C 3VD7A 4KNQA 1L7TH 1G7LA 2OYIC 4IBYA 2ZFCA 2GAZB 3NCWA 2AXWA 4HK3N 4WWKA 2PF6A 1TJGL 1I7TB 4GQ9L 3PPSA 1XCQB 4RGOH 3UJJL 2BH0A 3F7VA 1E4WH 4LC1A 4HV8A 4Q6IA 4WEMB 4PJXB 1CI6B 3FNKA 3P4LA 2JCWA 4ZUVA 4TVPH 3HKZA 1F3RB 1S7RB 2DQHL 3OQRA 4G8AC 2ZX5A 4PS3A 3TM6A 4KQ0A 1MCOL 3OPZH 4PJ5A 5C0AA 5IFHL 4LPXA 4JE4B 5DK2A 4KU1A 1XMEB 5DQ9B 1KXVA 4ZYKB 4Y28J 1DFXA 4HIXL 3WKMH 5T1KB 1INQA 3IDXL 2I7SA 2N1TE 4KY1L 4ZTPL 4YWGL 2WXNA 3EOAB 2OMYB 4LLMA 3EUUA 4X4MA 1MNNA 1EEZA 4O4YL 4AK1A 5E6YA 5DK3A 4AQEA 4U3FJ 2HJLB 4KRPD 2AJXL 1B4JL 1SNRA 3ARBC 1JO5A 4PREA 1SN5A 2Q7CA 1NAKH 3FB7B 1BWWA 4ZXBA 1Z9NA 2DM2A 2PO6B 1UB5B 3IB4A 2JR8A 2X28A 3CFCH 4P5MB 3SOBL 2WVTA 2IBZG 3V0AC 4GXFA 2P8MA 5D7IE 3LY6A 4J3UA 2GBUA 2Z0BA 2N56A 2BIMA 3CVBA 3QJTB 4GBXC 4X7SH 3BE1L 1AGEB 3EBHA 4PJ7B 1VZGA 4YFDB 1P5UC 4X5WB 3F7PC 2B1AL 5IGXL 3DX8B 4KZDL 3JC22 1I7RA 4NI3A 3BFOA 4IBQA 1B3JA 3FTGB 4MAUH 1RUQH 4JCLA 2DICA 4FA8A 5A3IC 4Z3EA 1HAWA 2PP7A 4F91B 2R5BA 1SFCC 4JHZA 2B88A 2CR3A 2VDMH 3GSNA 2H88C 4N8PA 5DEFB 3SB3A 5EEUA 3RURA 3ZSTA 1ERNA 4DN4H 3HMXL 4LKXA 1QBLL 4K3JL 3F7RA 2O61B 2OXGA 3GS7A 4MJJA 4W9EC 1YG9A 4QYOA 3SPJA 2LABA 3P8CD 2M8XA 4MJ6B 5I1LB 4M1CC 3HG5A 3KPSB 3L3JB 1FZOB 2QVKA 3KHOA 1RULH 2BWIA 3MLYL 1WT6A 2LU4A 3MUZ1 4WWIA 3KCWA 4QOKA 2O01H 3QQ9C 3ZE1E 1CO1A 4MBRA 5GSVA 3TBTA 1J1XH 4X80H 1AIZA 3UTOA 2ZCLL 1LDPH 3TFKD 2O5NA 1ITCA 3UTSE 2ZXDA 4FCHA 2PR4H 3SDYL 1OTTD 1LNQA 4OJEH 5D2LA 3CDGB 1QX1A 3IDYC 2G4EA 2AVGA 5D93B 5BRZB 1LEIB 1GD2E 4K5NA 1T22B 3I50H 1U93B 5SWSD 4GLRI 1I1AD 1PBYA 5I66B 3WJLC 4NZRL 1DANT 2NYZA 4RRPG 1FL6B 5CIPB 5LB1A 4PD4D 3VXSE 3GSWA 4ELDA 2NRGA 3CZGA 4MMXC 2NYYD 2DYRB 4OLXL 4FNUA 5EFIB 1Q0XL 1YTZT 5IB1A 1JV5B 5J1AA 4LHUA 4WV1C 4MB3A 1O5DT 2NQ3A 1UZ8B 3LQAC 4WU5B 4LLAA 3PDDA 4R7NA 4U05A 1XBDA 3GLAA 4JFOA 1TTCA 1L9OA 4H88H 5D5MF 2H7WA 4F37K 1MFTA 2H6PA 2X1QA 3BAEH 1J5IA 3QWQB 4DUWA 5A6LA 1TQVA 1ZD6A 3KBPA 3CPUA 3MOQA 3FULA 2YGOA 2D3JA 4FQQA 1KBGH 4ENED 1U3ZA 1NMAL 1UA6H 3M0DA 3VRLF 3APFA 3OB8A 1H3PL 2Z7YA 1X9UA 3RA7L 1T20A 4JVWA 4HDIA 1QLEH 1EAOA 1P5VB 1K8DB 1KG0B 3BP5A 1A14L 3BYTA 3GSRB 1EEQA 2FWSA 2HWZL 4IBTA 1MFUA 2GCYB 1VHPA 4IIQC 3SDCB 4HMEA 35C8L 3WKYA 3O3UN 1JK9B 2B4CH 4TYUA 2AEQH 1RLBA 3RVXD 4ELMB 3KGTA 5JA9A 4L4VB 3WLBA 5FYKH 3EDKA 5I16B 3C60B 3A0BE 2JK5A 3PP4H 3QCTH 4JRYD 1F6FB 1UXWA 5LAXB 4AENA 1JPGA 1J5DA 1NIEA 3ZZ1A 3IWUA 3GQFA 3D0VB 4XT1C 1CYXA 1U8PA 2XN9D 3DXAB 5GRVK 5T3ZE 4E0RA 4NHUB 4F15C 5IT2H 3FO1A 3HR6A 1FZCB 3D18A 1OGAB 4GAYB 4KXZH 3OKMB 1DVFD 5AKTA 3ZDYB 2GUSA 4XI5D 4U6XA 1U8KA 1U2CA 2J7LA 1B4RA 4Y5YA 3CX5I 1YNTB 1L2PA 1GJUA 3FFDA 3FSOA 3LKQA 1FL3A 3GRWL 1KCBA 1P5UB 5BMFH 3LKNA 5LN8A 1PD6A 3VXSD 4MB5A 1N7SA 5D1XA 1QBML 1YJWP 3KXFD 2Z93B 3QR0A 1NSNL 5E6IA 2DYPB 2EE3A 3WIAA 1HKFA 2R44A 1ZA6A 3RDTD 1BLNB 2GJJA 5BRZA 1LEIA 2XZQH 3GBML 1NM4A 2BO0A 2NXZD 2CJ3A 3PWLA 5KBLA 5HYQA 3ZO9A 1H3VA 3FQXB 4OZHF 3QQDB 5ABDE 3TT1L 4YZFE 2I1JA 4B60A 3LB6D 5AZ2H 1A5FH 1MIML 4KXBA 4JPVL 1MUJB 3PQYA 4LHUG 2NXZB 2WWWA 3Q3GB 4FXGC 2R5DA 4QD2E 4JFXB 2ORBL 1JYVA 3O8ZA 3IU3A 2VLRE 2WSFH 3JXAA 4XC1L 3DX4A 3A23A 1WD8A 1X5MA 2DJMA 4GRWB 1ADQA 1JTHB 1MCBA 1NEUA 2VXQA 4LP5A 2F19H 1BBJB 4YBQD 5DTFB 4OZFA 3ARYA 5MERA 3IGFA 1RUPH 2GITB 2ICEC 3JWDL 4PUBL 4QXUL 1WP6A 2E75D 2L91A 4I2XA 3UTSB 1UADC 2V2XA 2WMPB 3PGDA 3VRIB 4QHUA 1I3GH 4MHHG 3ZKSD 4A66A 5AW5B 2ZWLT 4KJMA 4YC2C 1X5FA 4E9LA 2FX8L 1FGNH 3NEOA 1G9NL 3FOMA 3O8XA 4AKOA 4PJDB 5CZXC 1ASPA 5J57B 5CN1A 2X42A 2ITDB 1U8QB 3CSGA 3KPSE 1JF1A 4R4FL 1E67A 1T5KA 1L0QA 1QFPA 2BY1A 2QL1A 3P2TA 3GBDA 4E9QA 4ZMOA 3OXSB 5AAWC 4GMTH 5JIDA 1FYTE 4Y9BA 4YDKL 3SKOB 1KCKA 4AH2B 2YLHA 2QVAA 1V54B 2X4UA 2ARJA 4OI7A 3O2DL 2DZEA 2FE0A 2R0WL 1KTLB 4P9MH 1GL2C 4B5EA 5AYUL 4X9GA 5PCYA 3NFNB 2D31A 1ET5A 1F3JA 2A0LC 3AE7C 4W70A 2QJYB 2K9YA 1G7QB 2X9YA 1T1XA 3RTQC 3VP9A 4CBZA 5K5YA 1ZIAA 3UIZA 2GTWB 3NEXA 2IH3A 5DI8A 2FYUG 3V5BA 1AJ7H 5GSVB 2R7EA 1ZLDA 1ZT1A 3B1UA 4F33A 1W0VB 4N87A 1X0TA 4Y2DC 5A7BA 2W59A 2O6PA 2OL3L 2YEQA 4LQFH 3EYOB 3FN0L 4PD4E 1J9QA 1SQVE 2NNAA 4S2SB 5BRPA 3H4FA 4FNQA 1AKJA 2B0SH 5I1DA 1SFCB 5EU6D 2FEDC 1NTZE 1YUHB 1LWHA 2N0KA 1QSEA 4M3LA 1TR7A 2BSED 4LXFA 3S9OA 4N2BA 3VQ2C 2RJMA 5D1QB 2FYUE 4QTHA 2JO1A 3JWNE 4DT2A 3H0TA 3IDGB 5EIIB 2X2IA 3R0MA 2RH0A 3F84A 4NRYA 4L74A 5DJ0B 3OMZA 1AR1C 1UXLA 3FWNA 1SQVJ 1JNNL 5DRWA 3CQFA 4KZEL 5DVPA 1JZGA 1TVHA 1FFQA 3U1SH 3VU1A 3RZCD 1BDYA 3ZQXA 1XGYL 2VSMB 4MNGE 1UA3A 1Z32X 4GAFB 4TQEH 1S2EA 3RL0g 4ZI8A 1UYWL 2C3VA 1CN4A 4IFDK 2W65A 4PJIE 3TGUG 4KKZA 1YHPA 3DROB 1EQWA 4DAGL 1D2OA 3GXUB 4YUEL 5ELIA 2CMRL 2YPLD 4G7SB 3VFVA 3IF1B 1VEOA 4G7RB 2Q7NA 1OW0C 5CU5A 1HILA 2YD5A 3MBED 3FT2B 4ZUWB 1IFDA 4TV3A 4KUCF 5DZ9A 3UL4A 3W0WA 5AZ2L 4HPOL 5H2BA 4F5CA 1IIKA 1XR9B 3CVHL 2VYRE 2E74C 5DEZA 1WAEA 5EO9B 3VRJB 1X5XA 5FW7A 4CGUB 4KK6D 1J0JA 1YC7A 3LKSA 1GYAA 3NSYA 3B5NB 1W72B 4N0YH 2EE0A 3BP7A 2ZAGA 3PAUA 3WN6A 1IFJA 3NIGE 3UO1L 3U46B 3I55P 1F6AB 3EJZD 4JUSA 1I8LC 4IOIH 4BQ8A 2ESVB 1LD9A 5JHBA 5D4JA 3ZKXB 5G4NA 2QHRH 1XGUA 1JI2A 2E86A 4FXGB 4JDEB 4WUUB 4MNQA 4G6JH 3BKJH 4C83B 1FVDA 1KLUB 2XVGA 3ULUC 3E8VA 1J0ZA 5KAFE 1HXMB 2R69H 3ZMEA 4ANXA 3QXTA 4FA7B 3U9PL 2RMZA 4C56E 4FQHB 3HZVA 3A0OA 1WJ3A 3P4MB 4GO9A 5T1DH 2VXUL 1SM3L 5DRNB 3NCJH 5B1KA 3RL1A 1T1WB 3IDJA 2VXQL 1BD2E 3MHVA 3EDDA 5APSA 5D4IA 1DQDL 3CFDA 5FLUA 2CHNA 2CIKB 4BHUA 3QHTC 1JERA 2OR9H 2NW3B 4GKZB 4X6DE 3RVWD 3RBXA 2GBTA 3CZSA 1AHMA 5B38G 1JY2O 3OJDB 4KKBD 4YSOA 5C0FB 2HYNA 3C9IA 1CWVA 4JRYE 1S9KD 5HDOA 4AGPA 1JY3O 1QSEB 1X8YA 2EILB 3CSBA 5JMRA 1F6LL 1MWOA 3JWOC 4D94A 3OKLB 3GMQB 3DMMD 4LOUC 4TNEA 4U6VH 1XF1A 2R2CA 3BW9B 3CX2A 3QRBA 3O2DA 5D7LA 3ZE0F 2JJUA 1ZLEA 3CUPA 2OYKA 2JIXA 4LVOB 2XG4A 5LXVA 3VFSA 3Q2NA 1T2KD 3N1QC 5GZOD 3IJ9A 3RX5A 1QP1A 3OB0K 4KHXL 1DLFL 5D2NA 1D6EB 4FP8L 3MRFA 2KI6A 4UBDD 2KYVA 2OULB 1OT2A 3NN8B 1VQ7P 3U25A 3KYKL 4R0LB 3GKZA 1F42A 1KXQE 2NR6C 2VDKH 2WOBA 3WSQL 1BAFL 2LU5A 1YMMB 4D6TG 3VMXA 4J6RL 5AALA 4DCKA 4PJ0H 4HOZA 2HRLA 2MIZA 2OXHA 1FNLA 4ATTA 1BX2B 4WFFD 3CWBJ 2XETA 2K4AA 4AE0A 1A3LL 5KJ4A 2I8DA 1R6VA 2QZQA 3LKSB 5CCGA 1SFDA 4U7KA 3ZIYA 3W5MA 4A7VA 1DYZA 2W94A 4BZ2L 2H26B 3PJNA 3UBXB 4MA3B 1IC1A 2NY5C 5E4AA 4G80B 3WU2H 4W93A 4XPFL 1MH5A 2YSTA 4DTGH 1S72P 3FRUA 3JTBA 3OJVC 5BV7C 3Q05A 1DFBL 3I85A 6CGTA 4HZ1A 2X09A 5F7EH 3KL0A 2P49B 1RURH 2B2XH 5I1GH 5DJTB 3QK0A 4MCYA 4O51B 1IIIA 3E6HB 1JGEA 1U2HA 4J4PC 1G1IA 2CNYA 1INDL 3TU6A 1URLA 2XWTA 1GYCA 2WTPA 3LKOB 1HXYA 2MPAH 5HYFA 4LLYB 1TU2A 2P47B 4LLUB 5FW6A 1UC6A 3ULSB 3TF5A 1VFUA 4OT1L 4RGNB 4PS7A 1E5CA 4GKSA 1KZUB 4XOCA 2B20A 2EDRA 4I3RL 2EVIA 1S3JA 2WANA 4HS6A 4KJWD 3JWNH 4B86A 1RP8A 1XO8A 4MAUL 4WU7B 2H2SD 4NO5B 5DJ2A 3WUWB 2HPCB 4Y4KB 3QT2A 3BIKB 1RQ5A 4HW6A 2F0CA 8CGTA 2DTMH 4G8FA 5IESL 4B7IA 5DURB 1L9QA 4KX7A 4HUVB 5CEXB 1VKXA 1E28B 2OCFD 2PXYA 5LHDA 3HTLX 1CFMA 4KBPA 4B9KC 3CG8A 5FA3A 4GG8B 2OW7A 3GLDA 4P5TD 2PCFB 4JN1L 3QZOA 2AJ3B 4KXCA 4DEWA 1IVTA 1IK7A 4L8SA 3Q6FA 3EAKA 2BVPB 4Y4FA 1QBBA 1AD0A 3ZTNH 4RISH 2N0MA 4GW1A 2KI7B 2MKLC 1G5GA 3LN5B 1ZR2A 2E7HA 4MDRA 1HE7A 3VJ6B 2PYFB 3FFCD 2F6AA 2GEEA 3Q8FA 4P2OC 4ZMZA 4OJCA 4YLQT 3WFHB 1KJ2A 4KC3B 4W9IC 3HE4B 1TQBB 5EF2A 1FL5B 4P2RA 3O4LD 2W9DL 4JJOA 1DCEA 3U4BL 5BPPA 4X7CC 5J9PB 3FONB 5AZEL 1H6FA 3ATAA 1IE4A 3NFPB 1IAIH 3AJ7A 4NLAA 4Y8DC 4G6KH 1NAMA 4AQAA 3L70D 5BOPA 2YPLA 1U8CA 3Q9QA 3CVHA 3MV9B 3QULA 3RG1C 3STZB 5F9WC 5C0JB 4CMHB 2ZSWA 2LTQB 1CD9B 1J1PL 3MR9A 1DBAH 1JHKL 4LQ1A 3U6RA 2AXCA 3DBSA 2K45A 5FF6B 1YSOA 5IBLC 4BV1A 5EOCJ 4ODXA 3RZCA 3FRPG 4FI8A 4JGNA 4P48A 1TJHH 4MJ5B 4TN9A 3TSIA 3QA3B 2DW5A 2VLRA 4HIEA 43C9A 4OGXH 1WTGT 1UB5A 3N85H 2BWDA 4K2UH 1G7HB 3L95B 1S7QB 1RULL 2NNXA 1GPOH 4ZDHA 3GLEA 5APTA 3W57A 3C2AH 4GG6B 3H8NA 5FM5M 2X2HA 2WLLB 1OP9A 1PCXA 4OR1A 5CJ8A 2BSDA 1X22A 4TQ8A 5E8DL 1ECYA 3MU3A 5DQDH 2E42A 2KZIA 1XBRA 3E1ZA 2BMKB 1G1JA 1CDGA 4Z7UA 1P4BL 1AVYA 1MJUH 4NOFA 1HOCB 4P3DA 1NFKA 4OLUH 5E08H 5JHDB 4K8RC 4KUZH 4W9JC 4ZODA 3SKMA 3IPFA 1NZRA 4KDTC 2EDHA 2DWSA 3WTWA 1R3LA 4YHLL 5I1AB 2R9HD 4ZXBD 3RWIA 1OE2A 1XAKA 5EOQH 3DUUB 4XE5B 3QJFB 1LK2A 3MNVA 1DSFH 3IRCA 4HGWB 3OWRA 2CRMA 3WN5B 3FB5A 1AANA 3KE0A 3NTCH 4J8QA 1S7WA 5E6ZA 2GIMA 2NY7L 2EIZA 2OMVA 4G2AA 1MCOH 3OPZL 2UYLB 4XN4A 3Q44A 4UZSA 4TUJA 2LXBA 4HWNA 2KERA 1NDGB 1KGYE 5F7DA 5IW1B 1YY8A 5EPMB 1NLBH 5A2BA 3UAAA 2HFEA 2AITA 3C5JA 4CJ1A 2FX9H 4R2GB 1UWXK 3UPRA 1KB9I 2Y5EA 2DQCH 5TE6L 3LRMA 4F7KA 2JCCF 1FYTB 3H6AA 5I1EL 1L0NG 5JIPA 3QWNA 1EXGA 1RZGA 3QJFA 3MV7B 1F00I 3Q6GH 4NQDE 1KTRL 4XBMA 3PXHA 2HWZH 5KAQF 3VGGA 1KGCE 5LBSL 3HOGA 4D6TE 3MV8A 4KMQA 1ZVHA 3NIGF 1QRNE 1QGKB 3GHEH 4AQAB 5CBOA 4RWYH 1TYRA 1KORA 2DWEA 4LDEB 3CH1A 2HVKB 1X5KA 2CIIA 1MVFA 5F7DB 2Q87A 1GY1A 2KDGA 4NRZB 3WTSA 4M43L 2XN9B 3TYGL 5J1SC 2P52A 3F12B 3RGUA 4PJHA 4U1SB 3MMEA 1QSFA 1YC8A 4KK9D 4JFDB 4OF3A 4RAHA 3BKJL 1VGKA 4F7MA 2PKDA 5C6TL 3BCFA 4WRLA 3PV7A 1I9IH 2X9WA 4YSUA 2DI8A 4OLWH 4Z76B 2XTJB 2VLRB 1VACA 1M56D 4P3CL 4BA0A 4Q0XL 3L7EA 3SHSA 4N0FA 1PY0A 3CCHA 4OCLC 3OXRA 3EOTH 4N6JA 3E9UA 4HQQL 1VIWA 4RGMC 1IC7H 4Q4EA 3MRHA 3FQ4A 4KROB 3K0YA 1CFBA 4G6ML 2RACA 1DX7A 4POZC 3BVXA 1V3MA 2BMKA 3EBAA 3T0EE 4JBZA 1NCWL 1KIRA 1W2EA 3L74J 4R5TA 4AIZA 4WNJA 3D0VA 1L4AD 4G9FB 5DD0L 2OMZB 2FNBA 4UAHA 3TJHC 5GGUB 5IJKA 1AGDA 4S1SL 1U2YA 1PS3A 1ROWA 3O3EA 25C8H 2H6PB 2IWEA 4LVHB 4WFHE 1OALA 1HZKA 2CLVA 1MCHA 3X1EA 1Z9SB 5DUPL 3FUMA 1TSHA 3H25A 4UDTA 4OWFA 3HC0A 3OKEB 2CJUH 4OUUA 2EUZA 1CFTB 1T1ZB 2IALB 3QIBD 3GF3A 3BPLC 4FP8H 5TJWK 3THMH 2B3IA 1BFVH 3II3A 1C9SA 2JH2A 4Y4FB 3ZW3A 3PHOB 3MX0A 1G7MB 5CSGA 3D39D 4C4UA 5C9KA 4JJ5B 4KDWA 1WA1X 3NXSA 5D72L 3RJDA 4Z76A 1KBBA 4OLXH 1P7QB 1SQBJ 2H8PD 4P05A 1X6LA 2WYZA 4QR7A 1WS8A 2OSYA 4U2YA 1R33A 5KVDL 1E9OB 3T1FB 2G0KA 3AT0A 2P1YA 4BD4A 2YEZB 3D0AA 1ZT4A 3PWJA 4O2CA 3MBEB 4WFED 5B66H 2R0ZL 2B8OT 1A8ZA 4YOKA 4G8GE 4JFEB 4TNWK 1QX8A 4LDLB 4B9PA 3MJGX 3P77B 1E9QB 2G60H 1KJ2L 1YEJL 4QOKB 5D7JD 1RZ8B 3SODB 3WO4C 4ABUA 1KQGB 5B8CB 5TQ2L 4V1DE 3V5DB 4U1NA 3QCUH 1CLOL 1WUNT 1VQPP 5D8JH 2UVFA 2CPBA 4NKIH 3L72J 1F56A 3BAXA 2FYUD 3GJFA 4R96A 3FHQA 4EDXA 1NTDA 2WXMA 3TN0D 2P58A 4JO4H 4PJEB 3FT9A 4I2XE 5ICXB 2AJSL 1J10A 4L75A 1KEML 3NZ8B 3CMOL 5GGQL 3U79A 4OCNC 3VB8A 2FFDB 3EO9H 1H8OA 2M1KA 3RY6C 4NO0B 5CJXA 2X9XA 3K7UA 5CXPA 4X83A 5ACLA 1ZVSB 4B9CA 1RP9A 4CN6A 4RA3A 2DWDB 2NY6C 1DZ0A 4L0ZA 2ZXCA 1DBBH 4QGYA 2Z65C 2Q10A 3RIFK 5H2FH 3GJFH 4KQ4H 1XZ0A 4V1DB 4DVBB 4G6FB 4NZUH 4Y7MA 5MP6H 4NUGL 1M1JA 5B3JE 1NANI 3TNUB 3LS4L 1CF8H 4J3OC 3ZDYE 2R3CA 2GSIA 2WGXA 4JY5H 3DUUA 2OMTB 2WUCH 3H1HD 3DYPA 3H1LG 4V11A 3TFKC 2RALA 4FYSA 3KLHD 4F8LA 4O58L 4DP6X 1KILE 3MFGB 3PQYD 5T3ZL 3X2QB 1G9HA 2AI0H 3N9GH 5FHBL 4M7LH 2CDGA 3ALXA 2CM5A 4RFOL 4XCYA 4ZMNA 4P9HC 5DRZA 3S5ZA 1JPTL 1UCBH 1XF3B 1NU1K 5DRZB 5IOKA 5AL8A 1RLWA 1UYWH 1W72A 3UDWA 3QDGE 1NGPL 1YDPB 4N20A 3VNZA 1CT8A 3ME0B 1WFJA 5CSBA 1X7SA 5EWIL 1X9QA 3H1LE 3ZTJG 1I3RB 1SOKA 2ZXGA 1KLGA 1K4CA 2GTZB 3ZE0B 3LW5H 3VTPC 1TCRB 1H15A 2WW8A 2PABA 1DH3A 3AABA 4GRWH 4NPYB 4ZW6A 4HUUA 4AM0A 2EKSA 4YHZL 1GIGH 1I1FA 3D09A 2WKGA 1MHEB 1XFPA 3WIFA 2PUQT 4QY8A 5KUKA 3LNDA 1BAWA 4UDUA 4GH7B 3BJ91 4OVVA 4D9LH 3VTAA 2NSQA 4LSRL 4EI0A 4CUCA 1BG9A 4G9FE 5J0BA 5JZ7C 5ADPL 4Z7OB 1IZJA 2WSKA 4FHKA 4OCXH 3LZPA 4N85A 4Y99C 3MLXH 4OD3L 5H37H 1GL2B 2R0KH 5HGDA 4DKEH 3IE4A 1URQD 2HYMA 4D0CA 1P4LA 1SEBB 2ENQA 3KPRA 4ZSOA 1CR9L 2PW2B 4O9BA 3F83A 4BZ1H 4KJYA 3RAJH 4XBPA 4Q9CA 1S7UB 1E4JA 1T4KB 1LWRA 4LEEA 3S96B 2HLFD 4CN4A 4ZFOA 2P28B 4AV4A 2ZUTA 1RE3A 3DTUB 5I1DB 1DVSA 4NPYA 2MNWA 4U3FD 4MJIA 5J6SA 2A83B 5TQ2H 2MQ3A 2CBMA 1OAKL 4HS8H 2R3SA 3GMRB 4M61A 3NA4A 4O4YH 1NMBH 4MDIB 2XXFA 3HS0A 1TIUA 2WV3A 3GTTA 4JFDE 4YHYC 2LE9A 1F4YL 4OGQD 4PJGE 4D6TD 1DBKL 2WVRA 1F4XL 1OTSC 4KO7A 5C7ZA 3IDMB 1JHLH 1NGXB 4FQXA 2IXQB 2YPVH 2W6AA 3C08L 4DZOA 1LJ2A 2IFMA 3U36B 2X5PA 2KZ1B 1PU0A 3O6LH 2HH0H 2WZPA 4PGCA 3A4EA 3DIDA 1J8HB 4LHUD 1WBZB 2XKSA 4ETYA 3O3BA 3KPQB 4L1TA 3QEUA 4YIQA 2WB1A 2DH3A 3H3KA 2XYBA 1SVZA 4KRMB 5E2UL 4HLJA 5I1GL 2BY3A 2YIUC 4PJDA 3KPOB 4M1GL 1SLWA 2QEXP 1I1AA 4HWEL 3NCBB 5FUOH 3S37X 3LRGA 2VMCA 4ZMXA 2EC9U 3SDAA 2Q86B 2YD9A 5F72S 4ODHL 2DQCL 4HWZB 3F65A 1TQTA 5K9OA 2XQBL 1JRHH 5IQ9A 3VFTA 1T80A 3AT9A 1CZQA 1OW7A 1HSAB 3HVNA 3AW5A 4XB3A 1EEUA 3CN4A 4MSWA 3ETSA 2WNKA 3ZKND 2FX7L 2ZPKL 1IKNC 2EEBA 4I0PD 4PCYA 4LO9A 2NTFB 3HZKB 4PW4A 2XQ0A 3MLSH 4Q6KA 4HKBB 4FG0A 4FX5A 2UZXB 3PXLA 4TNGA 1NCTA 1CF1A 1JHTA 1RUAL 4L9LB 1HH0A 3AM8C 2IOOA 4TPRL 4EDFA 4RWYL 1H3UA 2CKBB 4YPGA 1LK3H 2VAJA 4YS4A 5B7FA 2OCJA 2GTQA 2ZTBA 4XCEA 1GHFH 3CI9A 3VA6A 2N1TA 2J73A 3LH2L 3AROA 4HT1L 4N25A 1OTSD 3GXFA 4GAYA 4ACPA 1QYGH 1HEZA 2XWJA 4ZD3H 5HGGS 3BEWA 2X87A 3WFEL 2ENJA 2BVEA 2OZ4A 4OD1L 1A3QA 3SFEC 4XN1A 1PZCA 1ZY9A 1F13A 1NCCL 5ACZA 2NY3D 3OG6B 1K05A 1PZSA 4P9HL 1EO7A 2QJPC 2J1ZA 1AXTH 2XT1B 2CIKA 3QIUC 5ANME 3V5HB 4GG6E 3U4EB 5KLIC 4X4KA 3I84A 1EVTC 1YN7A 3O4LE 4HSQA 4WUKL 3RQ3A 3AADB 1OFCX 4CDGC 3WNMA 1SQXJ 1S9KC 4IRJA 2BIPA 3V0DA 1YN6A 5IB5A 2RB8A 2Z31A 3KLDA 3RI5K 3QJUB 2DWDA 4JG5A 2Y2YA 4GXVH 2VZTA 1T7VA 5TDOB 2A38A 4K3DH 3ASWA 2DQUH 2JELL 1EAJA 2HTLD 2ZICA 5GZOA 5F9OH 5DVNA 5IREA 4AVHA 3NCYP 4HIPA 3BO8A 2Q8BL 3H1LJ 2X6AA 3IFLH 2DDQH 2L7QA 3EOBB 3NCJL 1G2CB 3IU4H 1H3PH 1LDSA 1XH3B 4H8PA 4Z7WA 1L9TA 3A6CH 5ACZB 2DD8L 3BVNB 2SODB 3CZLA 3I6LD 1PYWA 4IGBB 4AQ8C 1LGHB 3KWWB 4EIGB 2JP3A 5MERB 4UUJB 4RFNB 3VRLE 3WG7B 1WRGA 3VXPB 3LHPL 3WMQA 4NZJA 4X42A 2YKLL 3U0PB 1SQBD 4QMEA 4PV8A 2X2UA 2LR2A 3MVSA 3P7KA 2V5YA 3H6PA 3FQ1A 3ERXA 5DJCB 3DOIA 4D9QD 1VB9A 2JTYA 5HPMA 1QVFO 1NTMK 2JJWA 2Z5HA 4KMTH 4MS6A 5JXEA 2IYPA 1WEJL 4G9FD 3I75A 4U6VL 5C97A 5GSRA 3PJLA 1GW3A 1BIHA 3U48A 4R4LA 3BWUC 4OZHB 1DD4A 3VI4B 4AIXA 1HSAA 2WO2B 4U3HA 5JHLL 5E4OA 4B9FA 3MCLL 1GOGA 5I8CA 4I18A 2RN0A 3UGXA 3AU0A 3GSVA 4K3EH 3T4AA 2HVBA 4MXQC 1CDHA 3V2NA 3EHBB 3GNMH 1F2XK 4PBWD 1ZT7B 3O6KH 5IUSA 2YAMA 3UGEA 4RCAA 3HBZA 3CC4P 5MENA 2A6IB 1T2KC 2A6IA 4ZUSB 5G2NA 5IHUH 4J3XA 5GZOC 3OTTA 4P5TC 4X5RA 3OAZH 1HYSD 1MEXH 5C0BB 4OGXL 2OTKE 3QFJB 3V7AG 2NW2A 5DU7A 4I7ZB 4GUOA 2WP3O 2QMKA 5IKCA 4JFYB 4X6CA 3CZFB 1BGYG 3V7MA 5DHVA 1BMWA 2V3DA 3CD6P 5EZJA 1A4CA 4Q52A 3IF1A 2DM7A 1YMMA 5E8NA 4BFRA 2P7JA 5J56B 3PGCB 4Z1MH 3X14B 2DB8A 4I13B 4PW3A 4P49A 4WB4A 4TUOB 2WWNA 1B4TA 5LJYH 2PTVA 1TXKA 3FAXA 1M7DB 4D8PA 4J3OH 3TZVA 3IMBA 2YPKB 4YZFF 3VXRD 3VDBA 3GMPB 3H1HJ 2DMCA 4N2AA 4UQ3A 3C5ZC 1RZKC 3Q6GL 43CAA 3WNNA 3R19A 4GBXB 3H1KG 1FIEA 4ZUTB 3U59A 4MQ7A 5D1ZB 1YEHH 2X3CA 5EO9A 1ORSB 1INDH 1Z5YD 2NY0C 2P5WA 2VN5A 4QYAA 5B3JF 5DHEA 2G5BA 1MIEL 1K6QL 2DWTA 2BS71 3EGDA 5KSBE 1WITA 2CR0A 2QADB 3B8SA 1SJMA 4LRNL 2OQJA 3LN5A 2PGDA 3V6FB 3CDGA 1E5WA 2IPKA 2JQZA 3IDIA 2E7BA 4LSDA 2D0FA 3QFGA 4XN2A 1G1YA 2WYIA 1QRND 5JOPD 4ODWB 3IXAB 4Z7UE 1G43A 3Q01A 1P84H 3BCCJ 2K9UA 1KDIA 5CJOH 3ZIMA 4GY4A 5EO1A 4HWBH 4JR9L 4YHOL 4P5TA 1OAQL 1T7XA 4UM8A 5HVHC 1JV5A 4LIQH 2WXHA 2XTSA 3ARVA 2VAAB 4NPDA 4ODBD 3RDTC 1FPTH 2O5XH 2Q3AA 5KG9A 1K72A 2QVTA 2C1PA 4RO0A 2EO9A 1DBJL 5CS7A 3BFWA 2WXIA 3TK1A 3CBKB 4UM9B 1OAUL 2CLVB 2OSWA 1OE1A 5GGVL 4Z3FA 4XVSH 4W81A 4MJ5A 5GISL 3VWKD 4MB4A 5JW4R 4PCKA 1OP5H 4HF5L 5ANMB 3S36X 2Y5TB 2UZIH 1CCZA 4MCZA 4HJIA 4LLYA 4C59B 3KYNA 3T4AB 4KVCL 1G9NC 2HR3A 4KKCC 5BZDA 3L54A 5ALCH 1AZCA 1V05A 3BAWA 4Y4KD 2YD6A 4BFIA 3CSYB 4M4RA 1N7ML 2XBDA 3TO2B 4DGYH 3QDME 4ZNEA 2VRQA 3MUGB 4L0PB 1MVUA 5CCGD 3WELA 1EAPB 3CVIL 4PJ5B 4M03A 3BKCL 3O0RL 4FQIH 3FB6B 4NFDA 2R8SH 3LOWA 4ZKPA 3B4NA 4IM8A 4RNRB 1JZ7A 1R3HA 2QA4P 2BVQB 4HIHA 3RGVD 2IH1A 1KFNA 3A24A 3EFGA 1RE3C 2BHUA 3PPEA 4WWKB 3MUDC 1JBJA 3QI9C 4DKFL 4HXAL 5I23A 2P67A 4DEUA 4OB5L 1ETB1 1K3ZA 1KULA 5F97E 5CBAA 5HHVL 4JPZB 3EFDL 4FFYH 4I3SH 2ITCB 5FYLH 1P4UA 2DW3A 3I3DA 3QARA 1Q94A 1PGJA 3AB0B 2CKBL 3A6BH 1KBVA 4HJJL 1YQVH 1ET8A 3VX1A 1KCUL 4KH2A 2E76C 2R4RH 4AYGA 3CGTA 4N0YL 1FYTA 1BFVL 2IQ9L 2LXCB 4G7VL 4IEFB 1R3JA 4RGOL 4J6IA 2I1KA 2P4AB 3L9BA 2A77H 4EN3D 3P77A 2W9EL 1IC4L 4L0YA 4QTIL 2DLGA 2XY2A 3M45A 3GBNL 1HSBA 4Y1AA 4WI2A 4Z8FH 4FFYA 2K9JB 5MEOA 2FX7H 2ZPKH 3IVKA 3JWNG 1NA8A 2K6WA 4PI2A 3GGWB 3DDGA 5TPWH 4DGWC 8FABB 2V2TB 1RZKL 2XV2A 3UOAB 5DEJA 3MLWL 3VP8A 3G6DL 4GDOA 5ALBH 2K6ZA 2VLKB 3AXIA 4NYLB 2D7TL 1A7PH 2H8PB 4JRYA 2F2HA 1IJNA 2P8MB 2XPYA 3HG0A 3BDYH 5C0AB 4AGOA 2FX9L 2QIWA 2WWMC 3HE7C 5IB4A 4DVRL 3PHOA 3L3KA 5JOPE 1E6JH 1LP1A 3V4UL 4PRBA 1KG0A 1SUHA 3FYEB 4LAJH 5EF3A 1CT8B 3ME0A 4HIJB 1H6TA 3UG3A 4PJXF 1BSHA 1DBJH 4JZOB 1HYRC 4XWGH 5I66A 1IAIM 2AJSH 2AFNA 1M2VA 1HEHC 4YHNB 4JF7A 1DQLL 3VXRE 4JO3L 4HA1A 2F1BA 3JUZA 3OKKA 2A5UA 4WEUD 3K72B 4X4ZA 5E8NB 3IMWA 3OMIB 4MNGA 1EK3A 1HL4A 1GGCL 1H3TA 3BWAB 3SFDC 2FFDC 3BIKA 4ZFQA 4JQXA 1UQSA 2GUYA 4PJIA 3S3DB 1BXVA 4FLRA 2ALAA 4NM8L 4MJID 3B2XA 4QHLB 1OW0A 3RTLA 3VWJA 2IMMA 2DTSA 1R75A 1GYVA 3H1LD 1U3NA 1MRCL 1AGBB 2VMFA 2KLSA 2WJ5A 1FZOA 2OX5A 2ZUUA 3LH9A 4QI3A 2IGFL 1E27A 4WHYH 3ARTA 2A2QT 3MRDA 2J21A 1NFIA 1MG3C 1AHWC 4FD0A 1S46A 4EQ3A 4R26H 2RR3A 3WSQH 3HUSA 3L4FA 4I1LA 4GIPD 4ES8A 3RK3D 2LT9A 3NZSA 1EHAA 5EUOF 4A1RA 4JG0L 1LT9A 2K8MA 3QRLA 1HOEA 5FGBA 3HUJB 3T3MB 5D2LB 4WW2F 1Z5LA 3REVB 1M1KQ 3TPUA 5JW5A 1E65A 1KPRB 1ZR4A 1PZBA 2YMOA 1CLCA 5EC2A 3UERA 1U41A 4H7VA 3IR9A 4XH2A 2AF2A 3ELQA 4K73A 1NDTA 3D08A 4LP8A 4NIKB 1USZA 3MV8B 3T2QA 5DJ0A 2ZOKA 1CZ8L 3B5GA 3KWVA 1H3WM 1P6FA 3PWPD 4JYBA 1A6AA 1SQXE 1G4RA 5MEPB 1E9QA 4NNPH 4R0LC 1OT4A 3LEYL 4WCYL 4KTDL 4RMBA 1RURL 1NJ9A 1ZA3A 1FHGA 2VO8A 4IL6H 5KLVE 2V8MA 7PAZA 1A64A 1BA9A 4PVNA 3GGWA 5FX3A 1FFNA 4IBUA 5CCHC 4PREB 4YQXL 2QADC 1OLZA 4GQQA 1UJ3B 3UJIH 3CU1A 3JCUH 4UT9H 3FFCB 2R7EB 1AE6L 2AABH 5G55A 2R0KL 5DLMH 3Q5RA 1UWFA 1P6AB 2OV0A 3PP3K 3CC5A 4LCIH 3W0WE 3RAJL 3L3OB 3HC4H 3CL3D 3VCLA 1EQ7A 1E5BA 5I1JH 3GC3A 2A1WH 5IB1B 2X89D 4RVBA 3RK2B 5D71H 3WV0A 2HLOA 1EDKA 2X41A 2LU3A 1XCXA 3CDZB 3ILPA 3JT2A 3VDAA 1JNJA 4GYBA 3N41F 3W2DL 3CPLB 4OZGE 1NLDH 3PFQA 2BSRA 4NKDA 2A4CA 3H1HG 3K72A 2NX5D 4HLZH 5E00B 1UVQA 2Y0DA 5CP7B 3IRPX 5FFOA 1MFMA 3AE6C 4Y4HD 4ODVH 2YD2A 4JO4L 1M1SA 4XVJH 3L71E 5FM5O 1S7WB 3GZKA 4G5ZL 1CI5A 1KEMH 3C1LA 4WJKB 4DCQA 1AVAA 1P2CA 3IBEA 1Q9OB 5BXFB 3V0VA 1RE4C 4XXDB 2UZYB 2NYYC 3DETD 1ZGLM 3FT2A 3S7GA 3L70J 1JWMA 1MIMH 1BBJA 3TO4A 1KBWA 2H32B 3PP4L 2GM4A 4L1LA 1D5MB 4U49A 1T4KA 3L73E 2QPUA 3HI1B 4ZFOB 4MD4B 1NC2A 5APQA 3FO0H 1AG0A 3DJTA 4M6NL 4FL4C 2QM7A 5B1AB 5I74C 1J05B 5BQ7A 1WWAX 3B7UX 1Q81Q 3VW3L 3AE3C 3WDHA 5SV4A 3GMAA 3FQXA 3IJ7A 2E59A 3EH5B 5KLVD 1MFCH 3LEXB 3U1AA 1PY9A 1E4KC 5HGBA 3EH1A 1HVXA 1NKOA 4NKDB 1G7QA 2FX8H 2XPZA 5JDSB 4RZCA 1D9KD 3VACA 3BQUB 3D3VE 2A06E 1X9VA 1OGTB 4GKNB 4QXVA 4BFGA 3LKQB 7PCYA 3RVVC 5C0AE 5IJBC 1KXVC 3MP7B 4DIXA 3KLHC 5F7LB 2FQDA 3S96A 4Q56A 1F5WA 2BSSB 2IGTA 4P46C 3V0VB 4CADB 2DWXA 1SDDB 3INUH 3VFRA 5I18H 1KTCA 2IFGA 4GT7A 1BZEA 5CLWA 1ZS2A 2YRPA 3I50L 1FLRH 3ZRFC 1E90A 5ENWA 1JZIA 5JLZA 2KS1B 3TIDB 3MJ6A 2FYZA 4NUJA 3EUDA 1RF0A 1D7BA 3ZE1B 1J9SA 4WI0B 3O0RH 4FQIL 2KK7A 3D7PA 2G9HB 1FFPA 5MHSE 1CGSH 3E3QE 3H85A 3G5XB 2Y6SD 4U1HA 4HJSA 3RFRA 4ASVA 3GMOB 2R2BA 4Y19B 4IFFA 3ILPB 5E2VH 2O93L 3RWCA 2H7HA 2BLFA 4YN3A 4O2FA 3WFBL 4R6UA 1M1JB 4GFXA 4W80A 2X70A 4XRCA 2K4WA 5FYJU 3ZGHA 1D5ZA 1K4DA 2VISA 4K9EH 4IS6B 1A4KA 3HE7B 3GDBA 3UAJC 4NQSA 1U58B 5DI8B 3LKOA 1YDPA 2IH3B 2IV9A 1YPZB 2WITA 1GZQA 1S4IA 4MKMA 4PJ9B 3ABGA 4TRPL 1LT9C 4ACTA 5GRWA 5DRXA 1BJ1J 3H54A 2DQFB 2XZAH 3LMJH 4C56D 1NBVL 5DYFA 2QEJA 5I15H 5EZJB 2ZYIA 4LCCC 3TT3H 1IC2A 1AHWA 4QO1A 2V2XB 4G11A 4B5ZA 4M8UA 4Z7NB 3L5HA 4I1NB 4PY7A 5F3BB 2H0FA 4N8VA 5ICXA 3IFPB 5H2BB 1J18A 2E6JA 2MCMA 2VDOH 1IT9H 3GJEB 4ONOA 3ZE2F 1K4CB 2KLVA 3DHJA 4P2OB 5BVPL 1DVYA 2HP4A 2AV1A 3RVVD 2ZJSE 4IOSD 1J5OH 4GAGH 1UT2A 4WFFE 1IARB 2GSMB 5IF0A 5JHLA 1AOHA 3BZDA 5JXED 2WIIA 1T66D 4HPOH 4YLBA 4ANVA 3RVTC 3RZCC 5L8RJ 2NT1A 3NJMA 3QI9B 4JPKH 3HFFA 4UZGA 3C60C 2AAVA 3FGAD 3D39E 1OTUC 1Q2NA 3D4CA 3H32B 1RK1A 3KCPB 2DTML 3SDCD 5C9JB 3EHBD 3RUGA 3G6EP 1E3ZA 2VDQH 4WWID 5CEZD 3IDIB 2OMTA 3PAVA 4HPYL 4XWOD 1LP9B 1DUYA 4EZKA 4JDZA 2WBJA 4JDVA 4GAAA 1R5WA 4ZOAA 5T5FH 4XP4L 3K2IA 3NPZB 3CPWO 1QUPA 2O72A 3QBTB 3QZLA 4UB8E 4IMKC 4Q14A 5CMAB 1OOAA 4FG2A 4U1MB 2P43B 4BGDA 1UD8A 4G3YL 4R97B 4S2SA 3DMMC 4LOUD 5CUSL 3UMTA 1OV8A 2EH7H 4LHJB 2OPCA 1EC5A 4PS4H 2Z35B 5BRZD 3O45B 1OGSA 4LL9A 5CN3A 3ESOA 1JS4A 5IMMA 3CVHB 3MV9A 3QULB 1UWEL 2HJFB 3QORB 4TPRH 4JQVA 2IAMB 4XNMB 5D1XD 1XDTT 3GO1H 3ZZQA 3BKYH 2F74B 2GK0A 2ICWB 4IRJD 5D4QA 5C09A 1OAQH 4G42A 4ZX5A 4XP9H 3WXWH 4LARH 2N9BA 5G4OA 4HS3A 4RQQA 3VFMA 3UFIA 3V6FA 3FPXA 2W1NA 2G30A 4P2QD 3T4AC 1QEWB 2YHGA 3WNIA 1VESA 3TBWB 4N8CH 1ZHNA 3QUXA 3QUYC 5MENE 1G0XA 1PEWA 3C2SA 1HJBC 4GW1B 3KAAA 5F0PB 4Y99B 4Z23A 3OKMA 4FQHA 5HYSA 4GRLD 4M7LT 2UZIL 2W91A 3GUTB 1OK8A 3CCVP 4GUCA 2FSEA 2MQGA 3NSFA 2Q8AL 1NCDL 1CLZH 2APVA 1NTMD 2GUOB 2Y7LA 4KVCH 4X7TB 5DJZA 4AIEA 5HI3C 2OYIA 1QVGO 1SN0A 1TZHA 3DRQB 4N8VG 3MNDA 1VPOH 2YPVA 3BX7C 2P26A 5F6IC 1LO4L 3L3GB 2WINB 3R7RA 4X5XB 1S5IH 1V55B 3JVGC 3O45A 3IJYB 2IOMA 3ARED 1MOEA 4OUOA 4AL8H 3A21A 2WY3B 5SWZD 1MCQA 1LTGC 2DMGA 4Y16C 4YPGB 1GTNA 4PGEA 2A74C 2OMVB 3ZJAA 2XV6B 4ATWA 5CAYB 1WFTA 2FJHB 4G7QB 1N59A 5KSBA 5H35A 1TZ8A 1MFAL 1PL5A 4GPVA 1E4WL 4UILH 4DPCX 3V6OA 4PJAB 1GPOL 1YI2P 2WSPA 5EZOL 2DMKA 2EQDA 3V0EA 4X7SL 4ZBJA 3WIIH 4OLEA 5KVMC 3QNXB 5JW4M 2J55A 3IGAB 1VQLP 3QG7H 5HDBE 1F41A 1I85A 4OKDA 3WUWG 1ZLLA 4LQFL 3AFLA 5F7AA 1BGYJ 3OVUB 5IGXH 4Y16A 5HHXL 1PSKL 2VCOA 3A67L 3BLKA 3BRDA 4ADIA 1ETZB 4Z7UB 5D7EA 2X4OB 3SDDC 3WE1A 3AG1B 3BN3B 5AW3B 1JY2P 5MP6L 2WBKA 4QT5A 3LQMA 2ZG3A 1GR7A 2F58H 2D3VA 4PRID 4ZOCA 5EH1A 4XXCA 5T1LD 1HH6A 4L8SC 2X12A 2KS0A 2MJZA 4JO5A 5APWA 4KO6A 1ACCA 1CXHA 3ML8A 1L5GB 3LJ3A 1Q8MA 1JGVH 1XXDC 4P2RE 1OVVA 2DQMA 4ZS6C 3AEBC 3QSKB 5GPRA 4R8WL 4N2OA 1MHCA 2VIRB 2ZAIA 4LSVH 1I8IB 5C0EB 5DMGC 3QUMB 1C7TA 5IMOB 2Y3AA 4E9YA 1ETZA 2Z8WC 5EPMA 3FTGA 5D2NB 2X6UA 4NO3B 1AS8A 1KENH 3QH9A 3KR3L 3S4SA 2FB4L 4XCEB 1PMYA 4MXQD 1F86A 1H3XA 1NKNA 3U1PA 3IJSB 3IGAA 2HUHA 4D2NA 5JYMA 2PYED 4TLTA 1GK6A 1II4E 1OGAD 3QO1B 4GJTB 1IBDA 1CDCA 3OLDA 4XPHL 2HPCA 3M1BA 4N8VB 4W6YB 5IB2B 2KIKA 3C5ZB 3IJ8A 4UU9B 5E9DD 4QJ3B 2OMWA 5I0VA 1JYWA 3US1A 1YJDH 3VE0A 1PL3A 2ZG1A 2K1AA 3SDDA 1N5YL 2B4CC 3L5IA 3GF7A 2IAMC 1Q9WB 3AXLA 4HUCA 4BCXA 5DMYA 1WZMA 3WKQA 1IAOB 3S35X 4E41A 1UB6A 4FTDA 5EEZA 1IGCH 1PLCA 3S3CB 4LHQB 1AFVH 4L5FH 4N0RA 3S8FB 1FBIL 2LAGB 3IJEA 3MRCA 4CAGA 3F7QA 4KAQL 5EB9A 5DJUB 5DHVB 4MXVE 4N5ED 4Z0XA 1NTZK 1GGIH 2A9BA 2ED6A 3WUWA 4JW3A 1I1AC 2R2HA 2PYFA 4ZUWA 4AZUA 3AC0A 4A55A 2E4TA 3DKHA 4JFZH 3BZFA 2HKFL 2RBLA 1B9ZA 1CD0A 3MLPA 3CC1A 5I8KL 3UTZB 1EZVD 4RJTA 2A4EA 4LRIA 3S2CA 5EC1B 1FO0H 4XN5A 3F3HA 4LOEA 5HI5C 2LLGA 3W37A 3NJLA 2WSCJ 1WCQA 4NDMA 5B3SB 1VJSA 4HEPG 3TJHD 4AYFB 2OTUA 3WUVA 5FOBA 1KB9K 2A9ML 1AZUA 3WY3A 3G4SP 3BUQA 4AJWA 2BOCB 5CEXA 1VKXB 2FEEI 3CLEL 3HNVL 4KFZC 1KPVA 4RGNC 1XF2B 4P23B 4LSQH 3VTMA 3CWBE 4APXA 1L5GA 1UM4H 1N0LA 4ZUVB 3DPDA 4BHUI 1GZPB 3H7BA 2FKWB 2G5BB 2ADIB 2ZCHH 3VMNA 3F7VB 1Y18B 3KM1A 3N4XA 2G4GA 1E2VA 5IFAH 3LN9A 5LGJB 4FTVE 2AKRA 5C07E 3U0PA 4KTYA 3LKPB 4P4KA 1ZSHA 1YTZI 4EKJA 5AFAA 1KN7A 4DN3H 1CL7H 1EZSA 3GSQA 1H0DB 5L8KB 4R90H 4XMPL 4PJGB 4F3FA 1A65A 1KJ2B 1S7TB 2I5YL 4HB1A 1UXSA 3CPLA 2CK0L 5HDQL 2MJWA 4UB0H 4OZFG 3T2PA 1UWXH 5FA4A 1I8UA 1TPXC 4GBXD 3GSUB 4M93B 4WO4B 3FUIA 1G1OA 1QO3A 4P2QE 3T0ED 2VLJE 2QJDA 5HHVH 4KKPA 4MNQE 1ZLUH 6PCYA 1Z9PA 5F7UA 3W0WD 1A5FL 3A4DA 2JKWA 2XSKA 5TE6H 1G7IA 3MZGB 4WW2C 1FZCA 4JO2L 4X6CF 2IAND 4XPHH 1Q7YQ 3SZKC 4NUGH 1I31A 4YTPC 3A0BH 4H8QA 1RMFH 4H8HA 5CM1A 3CFCL 5E6UB 1GJIA 4HWBA 3NIDB 4F1ZA 2AXFB 3RL2B 2NY6B 3QNXA 4R5XA 2ZSVA 3NGBB 4RMWA 1I8MB 2IDQA 2VR7A 1NU1D 4IRSB 4ZYKA 3N43B 4I3RH 1S7VB 2VABA 4WTQA 3V8OA 3HN3A 2VJ8A 2WUBH 2Z92A 2NPSD 5FECB 3G5YB 2QSVA 4HC1L 4YXKL 3DPBA 3MROB 5EBLB 1FZKB 5CCHE 5IWLC 5TJHA 1GSMA 4NM4H 4U0RC 1JCKA 4XXWA 3WXVH 3ZTEA 1AYOA 3TC9A 3Q3GA 2AERT 2BSCA 1NGYA 5E9DB 2E27L 1KACB 4OJFL 3T0DA 5ABZA 2B9BA 3IU4L 1N8ZB 4N26A 3QIBB 3CWBD 4PJDE 2C26A 3K74B 2VL5A 2X4TA 4H0HB 4P07A 1UJ3A 3CMAP 2BY0A 2B39A 4Z7AA 4N1HB 4G9FA 1WC7A 4LSPH 3D71A 1WC7B 2BHZA 4M7LL 3S36L 1GOFA 1MLCA 3EG9B 2BSTB 2XQYG 4JFOB 5GRYA 2E8YA 2Q7YA 3RPBA 3SY6A 3UAJA 2HA1A 5K93A 5DC2A 4Y5VA 1KEGL 3TBVB 2EXWC 5HYJA 3MLRH 3S35L 3RIAF 4K8RL 2M2DA 5AVUB 2NY1D 3CCHB 4UWQB 5HY9A 1BQHA 2QSCL 1CU4L 1LEKB 5JPNB 1EFXA 2EO7A 2K1MA 4FZEH 1YZZA 1BLIA 2Q20A 1E43A 2BHFA 2XZCL 3CC2P 3KPSD 3UG4A 1ZV9A 4GO8A 4IRSA 3C8KB 3T5WA 1CG9B 5A6MA 1RU9L 1Y7VA 5IV2A 1HDMA 3TH3T 1Y1UA 2J44A 3DNKA 2O61A 1CURA 3F6LA 4YHIA 4PJGA 4ZUUA 2NXYC 3F12A 4JM2C 4PJHB 3HD7D 4NQCE 1ONQA 3V9CA 3VD9A 2IWGA 2YOAA 2IANE 2XG5B 4JM4L 1BQHG 5EBWB 4ZFGH 2Z31D 4L4JA 4XO3A 3IXTB 4RIRA 4EDXB 1BF8A 1AP2A 3KBEA 1SQPK 1OSPH 3ARDB 5IFHH 1MEXL 2ZF9A 1L4AB 3MACH 4OM1L 4AYDC 4NGHH 3A3YB 1T1ZA 3ETTA 3WKML 3SKJH 1PKQA 2R39A 35C8H 2ZX9A 3MLVL 3RVXC 3KPMA 2Y9YA 3IE9A 2JWDA 4BFOA 1NCBL 1QNIA 3O8XC 4YHPA 3LZFH 4G8GB 1T7YA 3OPUA 1AKPA 1MLBA 2EIKB 2XXMB 4LKXB 3IFPA 3QXDA 5HHXH 2G9KA 1U3HA 5HDBF 1ZTXL 5ITBH 1L7TL 2CUAA 1CBJA 1FA4A 2J56A 3LEXA 4YHNA 3WLBB 4BCZA 1I9JL 1NAKL 1SQXG 1TJGH 3JWNC 4GQ9H 1EZVX 3OKDA 4X98A 2KT6A 4IBZA 4WI4A 3JV6B 4KJPC 1R8EA 5E56A 1PIFA 4M7JH 3IMVA 3K4AA 2Y1ZA 4KHTH 1WDAA 4HPHA 2WPGA 4XODA 2QELA 4XOEA 2Q5BA 5E4EB 3VXME 3UTTD 1Z6JT 1GAFH 2CRIA 4M3JA 3GIZH 2FYUK 2VO5A 5ITFB 4JO8A 5HSFA 3CSFA 5ITFA 5IFJA 4J3BA 4BA8A 3FB7A 4JO1H 5JXAL 2N4IA 1TZIB 4UIKH 1Y8AA 2W6JH 3W0WB 1MRFL 4ZO6A 1OCWH 3L3OC 5FUZH 1OSZA 5JDJA 4BRVA 4PJCE 4PD4K 4IRZH 3B8EB 5F93C 3RUGF 2ITDA 3P2DA 2HFGL 1LMIA 1TU3F 5KKZB 1SYSB 2YRBA 3V9EA 5ADOL 1Q9LB 5DD1H 2K6YA 2FYNC 1K5NA 3EJRA 3QJXA 4HK0B 2KLRA 3LXUX 5F7FA 5HTSA 3KPRE 3QUML 4FA6A 1UOVA 1A4BA 3D52A 3BI9X 4ONGL 2X1WL 5E8PB 4CRPA 1X7QA 2ITFA 2IADA 2WCGA 2C3WA 3NZHL 3IF4A 3RWCB 4BUHA 3WTYA 1EUTA 2GSIB 1A6TA 4PG9B 2EDKA 4HUUB 4Z1PA 3U30B 2H47C 2TRHA 4IYKA 5GRJL 4PRHE 3ZUNC 3LDBC 2NY5L 1CLYH 4XP9L 5HHNA 1D5IH 3FO1B 4DP1X 4PV9B 1DDHB 1ASQA 1MFDH 3AY4C 4FMFA 1PFIA 5J5EA 1MCWW 3B6SB 1KCSH 4NZ8A 2G2RA 3BT2H 1CF8L 4JFUA 4NT6B 4DESA 5T1MB 1Q1JH 5EU5A 3ZN6A 5DR5H 3MV7D 4HLEA 5KVDE 3HW7A 5IQ7L 3MGTB 5CLXA 4DPAX 3D34A 2WM0A 4OFYA 4FEMA 4X2UA 1OARL 4Z7VB 5IBUG 4ELMA 4M7KH 1XGTB 1U92B 3MI6A 5K59E 1XGTA 4OLYL 3LHPH 1NAYA 3ZR6A 4FFTA 4NP4L 4BWWA 1OCCB 3SKOA 3SE4A 2DQDH 3Q43A 4RBPH 1HTYA 1MFEH 5GRXG 1EH9A 1O6TA 2IDFA 2Z7WA 4APQC 2KDYA 5DD0H 4F8QA 1U7JA 3PQYB 1G7JB 4HUXB 1TETH 4KDTA 1ZT7A 5F7WC 1KXQA 4EVNA 4FQPA 1EDHA 1T1XB 2ZXEB 3GRBA 4DTGL 2JSFA 4YSDA 4AGMA 1A6UH 1JPGB 4JFFE 1MCIA 2YXFA 1W91A 1SY6A 4JFPA 3WYRA 3ZDZB 2OYIB 3DRQA 1KYFA 3ET9F 3GI8L 2OL3B 1WZ1H 1FZMA 3C6LB 1MXDA 2E47A 2GKIA 4L9DA 3M0DC 3I6LE 5D7IB 2IPTH 3V4PA 5EZOH 1KBKA 3PL6B 1CB4A 1NPNA 1EO5A 4GW4B 5HPMB 4I1RA 1JEKA 1YIJP 5I5IA 1CGTA 2WQAA 3HS8A 5IQLA 5C0NC 1TJIH 1AI1H 4Y9EA 2NMSA 4WJ5B 1MUJA 4Z95L 2VN4A 5EBGA 5FIEA 1ODAA 1QFHA 3OB0H 3WFBH 2LLNA 2XKMA 4RSYA 4HFUH 3T0XA 1KXHA 1IO4C 1R0AL 1OCRB 5DWUL 4K9EL 4ASWA 1A7PL 4Y4FC 2A45H 2EDWA 4OZFB 1UHVA 3TF4A 1ACXA 3T2NL 1J88A 4HLZG 1DFBH 2WWKO 3QEGL 1OB1B 1I1CA 3RHWF 4Z7QE 1BM3L 2OK0L 4BK4A 3DBXB 2FSEB 3R7QA 2A9NH 3VXUE 4LZKA 2CZNA 5D7IF 4LLUA 5I1HL 4UT6H 3F01A 2IALA 4LCWE 3U0WH 5CMAA 3M9BA 2EO1A 3LPOA 2FYYB 1AJYA 1HWTC 4HDIB 1FF5A 5D7LD 1PG7X 3SO5A 2CH8A 3EJYD 5B5EE 4XVUC 12E8H 1DVTA 4KITB 3AAZB 3H9HA 4NO2A 4A2FA 2M3EA 1W72L 3SPHA 4ZFZB 2W9DH 1UZ6E 3GK8L 2F8XC 5LBGA 3ZDXF 1C7SA 2OMXB 5D7KD 5IEHB 1AIFB 1S7SA 4K8RD 3WXVL 4L4VA 5GS1C 1QL1A 1CTMA 2PCXA 1KBPA 3NQKA 4DKEL 3HE5B 4K3GA 3QIWA 4LU5L 3B2VH 4HJ0C 1JB0J 1VF5B 5D1ZA 3WHE0 1OIPA 4QMAA 4PJ8D 1U95B 4CC4A 2PP9A 1D7DA 4WEEA 4Z7VF 2CDFB 1OTUD 1L0NE 3MJ9A 3U30C 3VMZA 3A6OA 1X5ZA 3BH8A 3D51A 4JEGB 2I25N 4N68A 2C0WA 3QXAB 4KKAC 4JDZB 5E99H 2XWCA 4JVUA 4H0LD 2B3RA 1EZUA 2CQVA 2TAAA 5I75C 4K8RH 2R15A 5BNXD 2HRPH 4F37F 1IBGL 3KYMA 1SXZA 4PWGA 5JTWA 1HQRA 1XGRA 3L6FB 3L72D 5T3XH 2A73A 4Z3HA 1CU4H 2L5GB 3H9SA 4XMUA 1WHPA 2YWZA 1HIMH 5FKPB 1DQJA 3AGVA 1J05A 1IFNA 4LMQI 1YN6B 2XTJD 4MRBA 5DJCA 5IB5B 3UZVB 2ZP0T 1R24B 4DGYL 4YPJA 1MKMA 3CV5A 4L3CB 3LPPA 3SBWC 1RZJH 1E4XL 1S4XA 2DIBA 4ZX4A 1UATA 1S5HA 4LEBA 1ESOA 1WWBX 4XNQA 2VLLB 4FNRA 3G5XA 4U1HB 2OARA 4UYPA 1KGUA 5FDYA 4HU2A 3EOBA 3UIYA 4GP8B 2DQHH 4KROD 5CNHA 1LO3L 4LGPB 1Q72L 4LSTH 5B5EH 3FTYA 1G9NH 2JVUA 2UXTA 1I8AA 3HB3B 4CNIA 3ISWA 3INOA 4PV1D 5K5GB 2VM4A 4DNLA 5D71L 1IQWH 1KV4A 2W88A 3T4YA 2P5WE 3ZL2A 4OAWA 5DQDL 1B9KA 3OG4B 3HE7D 2PTTB 4NJAL 5IOPA 5CKGA 3O3AA 3A6CL 5EOCH 3LD8C 1YEDB 1U92A 3CCSP 4WI0A 2R51A 5FPIA 5IHUL 5LDUA 5MEND 5C0FA 3K91A 2AMUA 2V4LA 2VR4A 4JB9L 4H1LB 4JFFD 4OGAD 4PWJA 4QRRE 4CSTA 3JSVC 3RL0C 4BSVB 2J88H 1Y07A 4FTVD 4G59C 1M05A 1UCTA 4X8GA 3ULVF 2F74A 4CVUA 2BNRB 3KEHA 5CCKL 2DY2A 4DAGH 4AQ1C 2YPKA 2QVIA 4NQCA 4R3SB 1L0ND 3T04D 3WDIA 1H19A 2ZP9A 3NTCL 4BSJA 3FCSB 5HDBB 5APYA 3KLAB 5EU4A 2BVTA 4IHBA 2D7MA 1F8TH 2C5DC 2DLFH 5C3TA 3S3SA 3U7AA 1LO2L 1ZKAA 1U3HC 9CGTA 3EGDB 3TVMC 1OCWL 5FUZL 4ZQKA 3SGKC 3N7NA 2YBRA 1J1EB 5KLVJ 4RMSA 4UTAL 3OJDA 5AOLA 4LNRA 1L0LG 32C2B 1UH2A 4AC2A 4S0HA 3CN1A 4L8CA 3SDXF 3G04A 5IQNA 4H5SB 1FU1A 5L9DH 1A9EA 1NC4B 4K3AA 4ZW7A 1HHJA 3IJHA 2FH6A 4JFQB 1CPUA 3WMPA 5AW0B 4MX7A 3H1KE 1OZUA 5KANG 1NAMB 1Z66A 5AD0A 2RHEA 2BK8A 3VXUD 1GJWA 4EMZA 4NX0A 1SQVD 2Q3XA 5DFTA 1XAUA 2OI9B 3OLIA 4FL4B 4PR5B 4TQHA 4ZDHB 3RX7A 1ZP0C 3DJ9A 2NX5A 2NW2B 3TGUJ 1KZYA 4PWEA 4FOMA 4JREB 2FJHA 1AAJA 1QNZH 4WDIB 2DKSA 4BK5C 4MZ2A 2FLRT 2VSKB 2D2OA 4X9HA 1HH9A 4AG4L 4GI8A 4FTVA 2VERN 3U2SB 4F27A 1I82A 2OR8A 2ADFH 3Q9PA 5HDWA 2M5AA 1A1NA 1UACL 3D50A 3P0VH 1GW0A 2XWZA 3RFZC 4GP5B 4RLDA 5DR5L 5DHYA 1A3RH 2WO3B 5I1IL 3LRSA 5ISZA 1NTKG 2YO3A 3LTVA 3B5NA 1JPFB 5DJDB 3CVCA 5I5MA 1JP5A 1DVUA 2N3JA 1FZJB 3HE4A 4NQQA 4RX4A 5CGYD 1A6WH 5IP4A 3DC0A 1IGCL 2A7BA 2QDVA 3UPAA 2W81C 4HH9A 5B1CA 3E1RA 2VNCA 4G72B 1N7SD 2R1XA 3MGAA 3VFUB 2XN2A 4EN3C 3GXDA 4AXWA 1ACYL 5AD0B 1OHZA 4MQ7B 1SM3H 3D6GA 3EO0B 1CLOH 1IAOA 3SE8L 3WE6B 3O4LB 4PJ0E 4R3SA 5IWLA 4K4KA 4G1MA 1T5WB 3UC0L 4CVZB 4ETQA 2HRGA 3NIDF 4I4WB 2YIUB 2BCCG 4J12A 3DV6B 2WC7A 2IDTA 1KB5H 3ECUA 3T97B 1MLBB 1CGUA 3TCXA 2B15A 4N78E 1HL5A 3P0GB 4XP6H 4RESB 3DXAD 4XHQA 4XCNB 5GISH 5B22A 4HHAA 1KMIZ 5BVPH 3CFDB 5HVFB 1BD2B 5IR1A 2VUOA 3FT3B 4G8FB 5KJ7E 4JFYA 4X6CB 3EO1A 1CDBA 5AVRB 3D3VA 3VB9A 1D7FA 4NENA 1C1EH 4EIZC 5FYLL 4MA7L 4Z95H 2EDMA 4POZD 4YXWH 3MRKA 4PHXA 4G7YL 4A6YA 4UQIM 5GS0H 1K5WA 1MCCA 3RWEB 3B2UD 4WUUE 4KMLB 2FYNB 2ZT9C 3KXDA 1JDCA 4DW2H 2OTPA 4HJGH 4FADA 1IL1A 3F7LA 3VFGL 3F2LA 2Y7OA 1U4FA 1U3YA 2P8LA 3U7WH 4PG2C 4UTAH 2BOCA 4L1DA 4J7RA 4U0RB 3W2DH 4DGUA 4F9LC 1WISA 5GS2H 2NXZC 2ZE0A 5FO7B 3D1MC 1AE6H 2CJSA 5FYKD 4G83A 3QWOA 5GTHH 5CJBA 4DGVL 2CE6A 2NQCA 1JGUH 4LCIL 1BSNA 5CEZH 3AS0A 3HE6D 3QDJE 1IKOP 4L4VD 1K8DA 5D7HA 5DUML 4DETA 3P69A 3PE9A 4MAYC 3SYQA 5JORB 1NHLA 1PPJG 2B1OA 2VXTL 5F6HI 3K6NA 4N3TA 2P44B 3GHGB 3KPRD 4JVPA 4OQTH 1ED3B 1OP5K 3HRZC 1AQ5A 1H9VA 4KZ0A 1BDCA 4M8RA 1C5BH 3VWJB 4IFMA 2VSCA 1TZAA 3RWHA 2Z4TA 2Y5QA 4BEIA 3QRGH 3Q2CA 3R06A 5DZNA 2FQFA 5I71C 5SWQB 4D7BA 3QQNA 4N2MA 4QRSB 3KLSA 3OL2A 4MNGB 3VI4A 2V2TA 1X9LA 3RZWA 1VQNP 2C7UA 1CW5A 5FCUL 3UDWC 4FQJL 3KDPB 4L76A 1N2RA 3HMXH 5KYXA 5ADPH 1OWRM 4HMCA 2MHAA 1XGQB 4N0UB 4PRHB 4GQPH 4B50A 2MTPA 1E40A 3L3OA 3FUFA 2O01N 4UDTB 2I7OA 1B0GA 3GRWA 4NLHA 4TKWA 4D3CH 1AGCB 4KRNA 1EDLA 1N64H 3TN0C 3NJHA 5BW7C 4G9DA 5HHQB 4O02B 3S0PA 2ZD0A 3LX9A 4KPHL 5GZND 1GKEA 1J8KA 1OW6A 3N50A 3TH4T 4ELKA 4Z7OE 1BQUA 1KB9D 4WI6A 3X1FA 2AJZB 3NYKA 1WQVT 1KC5H 4N3UA 3MRHB 4OD2A 1HSBB 3QXVA 3UBFA 3RK3B 3KPEA 4F57L 2XV5A 3I9GL 3ES6B 3N2JA 3W68A 2AZAA 1KY6A 1BGYD 5E6RB 5EIQA 1ACZA 2HKAA 1TQCB 5D72H 4F7PA 3EYUL 5AENA 3MLXL 5F6IB 2DI9A 2I69A 5I24A 5KAIH 1DP0A 2APXA 5D9SA 4BH7B 5BS0B 4MA7H 4TUUA 1KPVB 4AOFA 4KTEL 1HL9A 3HUJA 4U1LA 3JV4A 4K9JA 3IK2A 1UASA 1Z7JA 4ZTPH 5IMKB 1LO5A 5AVYB 1A7NL 1WTLA 1KZQA 1DJGA 2PO6D 4KXDA 5ID1B 5KZCD 1RK0B 3X13A 3SE4C 2P5PA 1HHIA 2KQNA 3HKFA 1ZCRA 4YDLB 1F3DH 3IM1A 3FU7A 3GTVA 3BP5B 3GSRA 3P3SA 2KSEA 3UJIL 3UP6A 1AGBA 4Z5RB 2W83C 1N18A 3KQGA 3MV7A 3TWCH 3EXLA 2QTEA 3D0LA 2F53A 4GFTB 4MA1B 5MEQB 3BQUA 2WXOA 4JZNA 1JGUL 4TNVK 4FABH 1JTHA 5DTFA 3RI5F 5DGQA 2NTSP 1O0VA 4WV1A 4DKAA 5KEZA 2DQDL 4LE8A 2O6CA 3US9A 5BXFA 5K9QG 2E9JA 2H2PC 3GMNA 4QXGL 5DT1L 1JZDC 2WGNB 1JGLL 3BAJA 4PG2A 4PJ5D 1F4AA 5EU3B 4Z7UF 1VZHA 5C3IA 3AU1A 3AE5C 2A06D 3HD7C 3TGXA 2DMHA 3FOMB 4W9GC 4F33B 5ID1A 1DZBA 3CH8A 2EIZB 4F58H 2FFDA 3VA2C 5D1QD 5I15L 3QAZB 1NC2B 2ZXXA 4MA1C 3G9AB 1CVSC 1DSWA 3JTSA 2CHZA 3OMAB 4MQXD 1QACA 5F2FA 2IFFL 1ULVA 4NNXB 4PJCB 4WGVB 3FU3A 1J1DB 2FO8A 2VDLH 4NPKA 3VXSB 4FS0A 3RGVB 2ARJB 3RHWK 2VW4A 5FOJA 2YZ1A 3GT6A 1C08B 2YMKA 1N5AB 4QOKE 3A0HE 1J0YA 2A9DA 1BVNP 3C8DA 5KVGH 4L4TD 2B59B 3BMWA 3BAKA 2CSPA 3H3PH 4FYTA 1SLQA 3VNYA 3SWKA 3GKWL 3N42F 4JKLA 1SQQD 4EJ1C 1USQA 3JWOH 1X5YA 3DXAA 4RDQF 2WNWA 1RJYA 1NU1E 3SGDH 5DJYB 1T0PB 1J1XL 1XTGB 3GSXB 4N8UA 4X80L 2VXVH 3HCVB 4UQCA 5IB3A 2DQGL 3P3YA 1A7RL 4P99A 3BDYL 3LQZB 4FNPA 4LCYA 1WS7A 3FQNB 1MJJA 1CD1A 3L5WB 2Y25A 4WQOA 4YHPB 4JFHE 5HHPB 5I17A 1PNDA 1T04A 4GKNA 1G84A 1U8HA 1P5UA 2XTJC 4G6MH 1ZTXE 1V7NL 5F3HB 1Q94B 5DVKA 2SEBA 4GUPA 5IW3A 2E0PA 4YC2B 3AQZA 5D93C 4BZYA 1AZNA 4BH8A 2ZUWA 2HT4D 1NTKJ 4BZ1A 3VGFA 3N04A 3DI2B 2Z0UA 5D1XC 5DD5H 1AYRA 2MPVA 5KUMA 3HBPA 1DHKA 3KXFB 2M26A 4JFVA 4APQD 4MYPA 4OZIF 3EJZC 3PDGA 3QIWC 3BDXA 1WEJH 2IV8A 5C3LD 5MI0B 1MAJA 2B0SL 1M1XB 4WFHD 5L4MA 1SJEA 2FGZA 3VXRB 1T0MA 2IANB 4FNSA 1UFUA 2DLHA 1MFDL 1LO4H 4NPEA 2IPUG 3NZUA 3QXAA 2BIOA 4NZTL 5KW9H 3M1CA 1J87A 5DJAA 1E5UI 1OGTA 1UZ8A 4WU5A 1JWMB 3GPSA 4P04A 2Q8BH 1RIUL 2QQLL 4IOFD 5ESVA 3O6KL 1O6VA 1NTKK 3ARFB 3O8XD 3LV3A 2NSXA 2OYOA 5E8OB 4HOWA 3U7YH 4ODTL 4R2GC 3WHXA 5JQHC 5AVSB 2CXGA 1SPDA 2X2JA 3C60D 1K5NB 3WI9A 2YK1L 1IAKA 1XGYH 4N0UE 3I9AA 3NG5A 2ARWA 1NTZG 3DARA 2J1XA 5IEHA 5EZLB 3O6FD 5E79H 1IQWL 2GJZA 3CFQA 3G5ZA 4F9PC 4HOMA 3U6XS 2XN9E 5T3ZD 1FVEA 1SLXA 5DJXA 5C07B 3L74G 1H88A 1WIPA 1SQQE 2ZCZA 3QI9A 3EXJA 4Z3IA 3BWZA 4Q9RH 3NMDA 1DVFB 3LCYA 3PFUA 4DVBA 5E2UH 2MCAA 1MPAL 1I7UA 3E7KA 2XG4B 3ZE2B 4QXWA 2YPVL 4JQXC 1NU1J 3GMLA 5M95B 5B8CA 3ARGC 3PLYA 2CCLA 2Z8VC 3T65A 3V6ZA 5LXGL 2QGDA 2A99A 2YKKA 4K5PA 3DTXA 4HISA 3O9WA 5I74B 1JZ8A 3MRLB 4F20A 4NQVB 1JD7A 3DOSA 3KDMB 3QEQA 3ULVH 4AT6B 1RXLA 2QZ5A 1TZHB 1MCFA 4M56A 2EIJB 3HUSC 2GI0A 4N1EA 3UBXI 4NWTL 1YPZF 2IX7C 4LCUA 2XFGB 4KROC 4NO2B 1RY7B 2FHBA 2KKQA 3R18A 4QPEA 5AYTA 1SDDA 3VFRB 2IAMA 1F1GA 2UWEF 2BXZA 1RZPA 3LS4H 4MMZC 1SYVA 4UOQA 3HZ3A 3DVIA 4WTWA 2ZYHA 2PYEE 1WE5A 2BVUA 4FHBD 4N5EC 4QJ5B 2Y2TA 2VXQH 4LP4A 5IF0B 1I7UB 2WTRB 1Y0LB 4HBCH 1GYWA 4ESKA 3F62A 3VSQA 3ECBB 1JWSA 2BOBA 3FQTA 4Y5VC 1OAYL 4JFEA 3ULVD 4MMYA 5AYQA 3S36H 1DE4B 2ZUVA 4MWFA 4OD1H 3VFPA 4XNZC 3FF8A 3ATBA 2VLJB 4ODVL 1NCNA 3ZE1F 1FZEA 2ICWA 4FNLL 1S5LE 2CO3A 5HGBB 4O2EA 1RL1A 2XWJB 5AB9A 1K6QH 3BN9D 2CLRA 3DSFL 1GGBH 4P2RD 4EIJA 1ZVYA 3FT0A 1CC3A 2FYUJ 3EBIA 4WTZG 2HFFA 4KX9A 1AR2A 4X0KB 4P23C 1ZJAA 3AY4A 1JGDA 2N1TB 3KPOA 4NAJA 1AFVL 4L5FL 1CUOA 2COQA 1W2KT 4KK5C 3UADA 1BHGA 3IMSA 3QUKB 4TULH 4IU3B 3TVMB 4MS8C 4X6BA 2BNQE 3HBQA 2DDQL 3QWRD 3JWDH 4NN5C 2UXVA 4QLRA 5FF6A 4NC1C 4WTZA 4J3SA 4OFKA 5HD8D 2PXYD 3SGEH 4GLRH 3Q2YA 4YSCA 1UKQA 4OZHA 5DF0A 2K3TA 3TL5A 4K55A 2H0JA 4K2UL 4RSVA 5BJTA 4GKOA 5A2FA 3ESMA 5KAIE 3BP4B 2QG4A 5FAAA 1OXZA 5D7LB 1ND0A 3SE6A 3GO1L 4K7PL 3E2HC 2NZ9C 2YAQA 2TSAA 4Q89A 4X6EB 3VJ6A 4I48B 3QUKA 1RUKH 3STBA 4HHAB 3AQDA 5KYYA 4YHZH 5K9JH 3GZOA 4OJYA 5A6IA 4LIQE 2CJTA 2WAQA 4JPQA 2CM6A 1A9VA 2V17L 1VFAB 4U31A 4JFQA 3TBCA 1AKJB 3NTNA 1M7IB 4XNUL 3QP3A 3SWFA 3AS3A 3CCLP 1FJ1A 3LIZH 1MI5B 3MRMB 1U8CB 3G04B 4RAUA 4AQRD 2BJMH 2YMXL 2CO6B 4EBQL 1ZIBA 3H0TB 3IDGA 2BC4A 1NWPA 1VEMA 1IBZA 5HHMB 4L3EB 4LLQB 4WW1A 4AX3A 3UACA 3G6DH 4O00A 4OLVH 4P5R