2YO3A

Salmonella enterica sada 1185-1386 fused to gcn4 adaptors (sadak14)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
KQIEDKIEEILSKIYHIENEIARIKKLIKVTDAQVSRNTQSITNLNTQVSNLDTRVTNIENGIGDIVTTGSTKYFKTNTDGADANAQGADSVAIGSGSIAAAENSVALGTNSVADEANTVSVGSSTQQRRITNVAAGVNNTDAVNVAQLKASEAGSVRYETNADGSVNYSVLNLGDGSGGTTRIGNVSAAVNDTDAVNYAQLKRSVEEANTYTDQKMGEMNSKIKGVENKMKQIEDKIEEILSKIYHIENEIARIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 80
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2yo3A01
2.60.40.4050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yo3A02
3KDPB 3M9BA 4AUWA 2P2UA 1H8AA 4DZOA 2R3CA 1SP4A 1YYCA 5APXA 3HE4A 1H88A 1NWQA 1NAFA 1S9KE 3I5CA 1JUNA 3V4QA 5APUA 3L35A 2YO2A 3M06A 2N9BA 5AVSB 3HE5A 5AW2B 5AW1B 1GU4A 3A2AA 2ZFCA 1CSBA 2WT7B 3TNUB 4C7NB 1GU5A 2WWWA 1GD2E 1MFZA 1GK4A 5AW7B 1A02F 2XZRA 4KHXA 1FOSE 1FAVA 2C9LY 2C9NY 4JYCA 2W27A 3VN0A 4AQRD 2Q3IA 1KQLA 5AVWB 1S9KD 4AYCA 3M91A 4HYTB 5AW3B 2ZXEB 2W6AA 4JYBA 1HWTC 1T2KD 3MD0A 2P7JA 2WT7A 3TNUA 4C7NA 1GK6A 5AVUB 1OXZA 1J2JB 5AW0B 3TK1A 1GTWA 3OAKA 3M0AA 2R5BA 5APYA 2R5DA 3VMXA 3M9HA 3VMZA 3SWFA 3P7KA 5APTA 2YO3A 5AW5B 5APVA 1SLQA 3LIDA 1T2KC 5AVRB 1GZLA 3V4WA 3VYIA 3A5TA 3IR9A 2WPSA 4XE5B 1DH3A 2WPRA 5AVZB 3A3YB 4I6MC 5CMZA 2XU6A 3M0DA 1HUCA 3V5BA 2Z5IA 5AW8B 4EOTA 1G2CB 3MGNA 5AVYB 1A02J 5APQA 4GT1A 4C46A 2Q5UA 3O8ZA 3NXSA 2Q7CA 3P8MC 1CI6B 3VMYA 2QM8A 1JNMA 2YNYA 4RESB 5AVVB 1CZQA 2P67A 3L36A 1H89A 1MV8A 2JJLA 3HTKA 5APSA 2KP8A 2E43A 1OWAA 2WTYA 5AVXB 3B8EB 3NFQA 1MUUA 3LIEA 3UIAA 1HBWA 3L37A 5AW6B 5APWA 2E42A 1FOSF 3NMDA 3VTPC 3T97A 3TYYA 1X8YA 2WPQA 3HE4B 3NTNA 2Z5HA 1CI6A 4M3LA 3P32A 4LC1A 3KQGA 2BASA 1IO4A 2IPPA 5AVTB 5AW4B 2QM7A 2VRSA 4GKGA 5AW9B 2XV5A 3HE5B 3A7OA 1HJBA 2R32A 4I2LC 4B86A 5AVQB 2H7HA
chains in the Genus database with same CATH superfamily
5T1JA 2I07A 4N2FA 5T1KA 2GUVA 3LHPL 4LP8A 4H1LB 4MMXA 5AB9A 2WZ5A 1UVQA 5DRNA 3DYOA 4IBYA 1GOGA 3SDXB 3X1GA 4GG8B 4D0CA 4ADJA 3BSHA 2EDBA 3FRUA 3NP4A 4CUCA 2E56A 1AR1C 1YIJP 1G7QB 2NR6D 3X12A 3NFSH 1L0PA 3B4SA 4F2FA 3NACH 4IOIA 4LPVA 4OI9A 2J5LC 2OXGB 1BQLL 2XVLA 4I77H 2DPKA 4P48A 5EZIH 1HSAB 1L9QA 1U8NB 5SWSD 2CDFB 4K5NA 1PPJG 3HFMH 5D70L 2CIIA 1DEEG 4P59H 3F7PC 4G1MA 2YXMA 5J8OA 3L70E 1BZQK 2GY7B 5KW9H 4NN7B 4QXUH 5FXCH 1HSBA 3IXAB 3ARYA 1FVCB 1BQSA 4JPSA 1HHJA 1KJ2L 1H0DA 2HZHA 2IOIA 2WZ6A 4HS6B 1E2ZA 1EANA 1WQVT 3E7KA 5KVEH 4HWEH 2MHAB 2YA2A 2WKOA 2LAGB 3S34H 2X4RA 1CFNA 3MTUE 3U1AA 4YXDC 3QB7C 4QOKA 4ZQTA 3H6JA 1WJ3A 4LAQH 5KSBB 1KILE 5APTA 1S7RA 1KGUA 1HH6B 1OCCB 4LEOA 1DHKA 4M7ZB 5KBNC 2XOTA 1WSST 3IFLH 4K3EL 4LL1A 2YBRB 4S1RL 4KNSA 1ZHLA 3HAEH 2K1MA 2KOGA 5AVZB 1UD5A 3BUDA 5EORL 4ORGA 3EJCA 4ODBD 5FGBA 4F5CA 3INUL 3PXLA 3K6IA 1HIMH 2R29H 3IEAA 3CU7A 3NFPB 5AWNL 3AEBC 1GZHC 1IVLA 3V4UL 3KBPA 3FQTB 4B7IA 3HPLA 1A02J 1V7NH 2R1XA 4OM1H 3RFZB 3T2PA 1AZCA 2C3GA 2Q5UA 1KQSO 2O5ZH 4PTUB 5FGSA 5JHDE 3VQLA 5IKCA 2VIRA 2WWKO 3HUSC 1EEUA 2J57A 3UCRA 1Y7VA 2X7LA 2KP8A 1JF5A 4NYLA 3FT1A 4UTCA 1PZSA 2QKSA 4LT7A 1FNHA 5MI0C 5DUBA 1AZBA 4KDTA 2J72A 3C5JB 2APSA 5JUEH 4DOHE 5GRXG 5CIPH 5HHOA 1BVLB 2ZE0A 3BQUA 3JTTA 2LLNA 5E00B 4D8PB 5T1LB 4Z78A 2HH0L 5DEGB 2XA3A 4CBZA 1FS0E 1E5BA 3L9YA 3LZFL 1OAQH 1FCGA 2XIBA 1IILE 2P24A 4HT1L 4D6TD 3ESVF 4L1SA 4WQOA 1U57A 1CXHA 3MCLL 2NTSP 2DMGA 2NR6C 5J12B 2XV6B 1MXDA 1BWWA 1FZCA 4OF0A 5C0RL 4JVWA 4MMZB 2IPUK 3WXWH 3MV8E 1S5LH 4P2RB 4N6JA 2H0EA 3QUXC 4XN5A 1U2YA 1MCFA 4UWQB 2AEPL 2K45A 5IIEA 3QNZB 2WANA 1AZUA 1L2PA 3LQZB 2CPSA 5KOVC 2FO1A 1N7SA 3JCUE 4WW1B 5INCA 1XH3A 3RZWA 3V7AG 2IH1B 3EOBB 2UY6B 4FQXB 1R3IH 4AYEC 4GMTH 4PY7B 2O5XL 2HVJA 3TFBA 4HUMB 5DC4B 4EDXB 5HYFA 2CLRB 1E6JL 3VWKA 2BLFA 4JBSA 4QXGH 1VACA 2ZJSE 3FT0A 4N2OA 4R2GB 2OTJP 2W1NA 1X9VA 1UXWB 3BAJA 4MA7H 3CFJB 5IMOA 5IMKA 6FABH 5DJDA 3BP6A 5DRZB 3ZU8A 4HPYH 4M6AA 5IP4A 3SQBB 3GK8H 3BUYB 5I74C 2Q6WA 4PGJA 2MMXA 1D5MA 4UQEA 3GMLA 5HGDA 2VC2L 4FFZA 4O58H 3RX8A 3LNDA 2CGYA 2EJ1A 3C2SA 5HY9A 1SQPK 5T1LD 1WZMA 4OJAA 3I50H 2FWUA 2D3LA 3BH9A 4BHUA 1J9QA 5DC9B 1NO4A 4U6XB 1YHPA 3BKMH 5E23A 4MNQD 4EBQH 5IW6B 5K39B 1IFDA 5DD6A 4L29B 3IKKA 2VMDA 4Z18A 3EO0A 3QNXA 2ZOKA 4M61B 3BJ91 2LR2A 3QQ4A 3U6RB 5DUJA 1KCRL 2F6AA 3WKQA 1EHNA 3CXHE 3SGEI 3M0DA 3CCQP 3SKNA 4Y89A 4I9XA 2K9UA 4B60A 4P06A 3M8OL 5ENWB 3RK3D 3GSNA 3R4DA 1TTRA 3F7LA 4CC4A 5DK0B 1MFCH 2XZZA 3FTWA 4X4ZA 5KBPA 1T4KA 1CDBA 4P5TA 2Z8SA 1GGBL 3L9RA 4PJHB 1FZAA 3CPUA 4XCEA 1R1CA 4ZMNA 1M6UA 1JPST 2HRPL 1ZHKB 2XV3A 3SJVB 1X7QB 4QUOA 4HOWA 1P4LB 1E65A 2CO7B 5G4OA 1D7FA 5KLVD 1KN7A 2XQYG 3R19A 4U1NB 2YK1L 5HHXH 3UGXA 3OAZH 4DF9A 3AE4C 1NBQA 2MPAH 4M1GL 3MNZB 4URKA 5AB0A 5CF3A 1HHKA 2X70A 4XP4L 3U0TA 2XKUA 1NCGA 4QWWD 4PU2A 5EC2A 4WWOA 1HESA 1J8HE 5AVQB 5IWLC 1I7TB 4Y19D 3FQUA 3ISYA 1RZGA 1S3RA 2QSQA 2OJ1A 4ZNEE 3W0WD 4M02A 4ZRGA 5GZNA 5B5EE 2PLTA 2MCAA 2X9ZA 4F5CE 3C6SA 4GAYA 3GF3A 1ADQA 3E1RA 1PVHA 4NOBA 4WTZG 2A6DB 4NQXA 4G8FA 1EO5A 4FNSA 4HEPG 2ZOUA 1NAKL 2XZAL 3QPKA 2EDNA 3ZKXC 3CC5A 2YWYA 4Z7WF 1A4AA 1BE3G 1PZQA 1THCA 3ALPA 3AEEC 3DTXA 5ILTH 3T71A 2Z92A 1WBYA 1HHHA 4HP5A 4LRIC 5GGSB 2CLZA 3CFKB 2HKFH 2JCWA 3BKYH 4KX7A 4NO5B 1RF0C 4J1UB 5FUCE 2X9WA 5HI5C 2L7UA 2ZX7A 1FQ9C 3KWUA 3U36A 2NY0C 1MI5D 1F6FB 5BO0D 1BD2B 3DA0A 4G42B 2J6EL 3CGTA 3MRMB 1DX7A 1BM7A 4KKNA 2DQUL 4WU5B 3VXRA 3E38A 4U6VH 1MREL 1L0ND 4F2EA 2XWJA 3AT0A 2E5TA 1VQ7P 4BQBA 3P3SA 4Z7OE 2OQJA 4C56D 3FU3A 3NA9L 4BBWA 5IB3A 5DMYA 5KYYA 3O11B 3D2UA 1YHQP 4UT6L 3RK3C 1LO5B 2YD3A 5I0XA 2IYPA 2Y9ZA 1NFIB 3L70G 3RWDB 3SKJL 1FG2B 3VFTA 3BFOA 3H7BA 4IU2B 2EO1A 3VG0L 2DJMA 5ACZA 5K5YA 4ANKA 3DROA 3NZ8B 3RWHB 3VFNB 1OGTB 1FZMA 4EQ2A 4GT1A 1T80A 3REWA 2P5EB 2VMCA 4HAFA 1HHIA 3WJMA 4TT3H 1BOGA 1AO7E 1I4FB 5ITBL 3U0WL 3UO8B 1A6WL 1TVBB 2AJXL 1ETJA 2YKOA 3T1WA 4UMSA 3U79A 3UEQA 1HQRA 4LCCA 5DLMH 2R3SA 5TQ0L 1VADB 4PB9H 3IAQA 1I1YB 1XGPB 1J0IA 2F53D 3WEXB 5HGHB 2ESVB 3PHQB 3Q13A 3MJ9A 1OGSA 1XGTA 2VLLA 1KB9D 3SCMD 1DUZB 3VWJB 4U1GB 1REIA 5I1CL 3ZR5A 3VGAC 1MG3C 5I73C 4M8VA 5D2NC 2F8IA 1QKZH 3R0MA 1RZFL 32C2A 2X41A 5DHVH 4XN9A 3RNQB 1AHMA 1PYWB 4IRJD 3B9AA 3TWCH 4R7XA 1FH5H 3UMTA 2FL5A 4OIBA 1KTBA 4ZODA 2YPVA 4G7YL 4AQOA 4MMYA 3F58L 4OZFA 4PG2C 1CFTB 3P4OB 2WGXA 2XN0A 3MRHA 1AV1A 1KC5H 1TYRA 3BIKB 2BP5M 1J7VR 4IRSD 5AG8A 3FOMB 4NRYB 5KS9B 1AXSA 2O1JA 2SEBB 3BPOC 5LBSL 3NBNA 1NDMA 2FLMA 3MO1B 3VA2C 4BDVB 2GAZB 4M6NL 3GLZA 3A2AA 1BXAA 2GTWB 1PKOA 4RWHA 4WJ5A 3AB0C 4NP4H 1L4AA 1SQVK 1X5XA 4ZMAT 4XMLL 4KHXA 4HFWB 1TVHA 1MJ7H 3F7YA 1KTRL 4HHWA 4AV4A 1FBMA 1WCBA 4XN2A 2HPOA 2AERT 4JR9L 2X4TA 4HS3A 5E2JA 1H5BC 4ZG1A 5I26A 4LLQB 3QAZC 4X98B 1NJ9A 1LO4H 4Z7NB 1GZPA 1TETL 2JV6A 3LD8C 4OFIA 4OVUA 4M7LH 1FO0H 2QA4P 4DUWA 1QGKB 1VCBC 2MFNA 2QSCH 1OW7A 2HJLA 3HC2A 1Z9SA 4W6YB 2UXFA 4YHNA 5F97E 1UJ3B 3IFNH 2ITCA 2RR3A 5TDOA 2VERN 2DQFA 5KLIB 2XN9B 3SDXE 1TYEB 3ZL1A 3FWNA 5T8IA 3QWRD 3EJRA 3WNLA 1NL0L 5C0FA 3N7NA 1EO8H 3GDBA 1JPSH 2J25A 2DQTL 3MV9D 3VH8B 4PR5A 1PKQA 1BVKB 1T6BX 3MZGB 1D5IH 2BCCD 1OOAA 4MGXA 2DQJH 2BNQA 4JRYE 1DD3A 4TQEL 3KS0J 1RUQL 4TVUA 2ZP9A 2VH5H 1FHGA 1XZWA 1OCWL 4PS8A 1SXAA 3TO4A 2D3NA 3O0RH 1BPLB 1Q0YH 3Q3GA 3UTTD 1LE5A 1JXFA 3DOSB 1JE6A 3FN3A 3MUGA 4KI5E 3LEVH 3AS0A 2WOYA 3L7FB 1BZ8A 3WE1A 4YMPA 2O6CA 2B5IC 3SCMC 3VD3A 1V7ML 4JFYB 5IJVA 3CFNA 4GKNB 2WBKA 3V8OA 1KYOE 1VQLP 1IJ9A 1M56B 4KVNH 4OFDA 3E2HB 1NKZB 3W9DA 4IRJC 4MTMA 1LNUA 2NQDA 1JZ3A 3WD5L 3CCUP 2ED6A 1IC5L 2WXIA 3PV6B 3PWLB 3CDFA 1XWVA 3P77A 5KSBE 4M8QA 3VD2A 4G3YH 4RQQB 1U92B 1G7JA 3UOAB 5DJAA 4L37A 3Q5PA 1WWAX 2YS4A 2ZYHA 3L1OL 1AD9A 2H3NB 5FS5A 3RK2C 2CK0L 2FUQA 1KB9K 2FAUA 4V1DA 3ZIMA 5EG6C 3AGVA 3NJXA 4BRYA 1FYTA 1Z0MA 4LSRH 2J1ZA 3MX0A 1IBDA 4WI8A 3SBPA 2LQRA 3RG1C 4JRYA 4B0MB 1FNEB 3O4OC 1O75A 1XGQB 2P42B 1ITCA 1QNZH 4M7KH 4AQ1C 3IB4A 1IL1B 2ADJB 4GLRI 4PJ6A 1E28B 3MROB 1E8ZA 3IMVA 5CZXD 5B38A 2ADGB 1JWUB 5EUKA 3BQVA 2KZIA 1UXSA 2GC4C 3KXFA 5J3HD 3MREB 4L1HA 5F96H 4AYDC 2NW3B 1CFMA 2JJSC 1U8PB 1ZEAH 1S8DB 1ZRUA 4OVNF 3VJ6A 3QCTL 5FOJA 4H0LB 3WY4A 5C9JB 1SQPJ 2OXHB 2EICA 2QBWA 4XGZA 4H0HB 5FDWB 3RIFF 3MLSL 2R5DA 2HX8A 3OQRA 4R5VA 4Y9FA 3BRTB 5H94B 1JXKA 3WTXA 1RPKA 4P2RE 1JHLL 1F3JB 2X6MA 4DETA 4DGIH 1AQMA 1W8NA 3P11L 1LO2L 2BVQB 3MRNB 3P73B 3V4WA 4ZUTB 3VI4B 4OM0H 4XMXA 2PYEB 2DTML 4P0DA 2J88H 2ZG1A 3D0VA 3KWXA 3RUGA 4JDTL 1YLBB 2ZXCA 3MNWA 4R90L 4WTWA 1W72A 3QJHB 2TSBA 1BOYA 2XWRA 3MUHL 2GJ6D 2Q2EB 3TBWA 5KVGL 2OMXB 3DMMD 3LKQA 4LB8A 4HVBA 1X6LA 3SKMB 4PJAA 5AD0A 3WTWA 4Z0XB 4BE5A 4NM4H 3CTTA 3A6OA 3MJWA 3PABA 2VDQL 2R2CA 3Q6FA 1HH0A 4WKZB 4BQ8A 3IS0X 4PJFB 3AGWA 5DK2B 2A74A 3QZBA 4R0LA 2ZOOA 3UBXA 3EG9B 5BVJA 3BSZH 3QIWD 4EDWH 1EZVI 3H1KE 4R4ND 2OJEA 4BUGA 4PV9A 5K5GB 3EIFA 1KB9H 1G6RH 3G6DL 3A67H 4JG9A 5F71A 3GPSA 3ARTA 3O4LD 5SWQB 1RULL 4JRXA 4X9IA 2B15A 2H2SC 3GHBH 1DQLL 1SLVA 1A4BA 2ITDA 2VN5A 2RFXB 4Z3GA 5FM5O 1VGKB 1R0AH 2FBJH 1QBLH 1T7XA 3QUMH 5DF0A 2BSRA 3HHSA 1W0YT 1R3KA 2W92A 4U1SA 2HJKB 2V2WB 2BINA 4J3XA 2Y0DA 2FWOA 5T3XL 2P5WA 1G7PA 3OWEA 5SV3A 5J9PB 1SOSA 4KK8D 5I76A 4A2HA 4UTBH 4UQ9A 3QFDA 3FFCD 1QTYT 4NQSB 3HN3A 1JY3O 3CXDL 5I28A 2YMOA 1P84D 2Q1EA 3ATEA 4LNVA 5DD5H 5E70A 3ZE1F 1U3HC 3IN0A 4FLHA 1G7IA 2YRLA 4EPSA 4RH4A 1J48A 4Q6IA 2VDML 3Q7JA 2GJRA 3V5KA 5IEHB 5DJTB 1UGNA 3FBQA 4L48A 1FFTB 3B5NB 1FFOB 1E5CA 5JDSB 4PJHE 5JXAL 1LP9A 2VM4A 2AK4D 3MV11 5DJ0A 1JNHB 4WJG3 4DK6A 1T04B 4GFTB 3VW3H 2YKPA 1D7BA 3X3FH 2OMNA 3SJVE 4M62L 4OGYH 3G3ZA 5F9AC 1DE4A 3DURB 1VAHA 3M1BB 3QFGA 5C7XL 3KPOB 4EZJA 3LS4H 3D3VA 4JN2A 4XNAA 2CBTA 4G9FD 1R24B 3LV3B 4XMZA 3T4AB 3MLUH 5L6YL 5I1LB 2QVFB 4P8QA 1GH7A 2H32B 3BLBA 2MOVA 4FZ8L 4E9XA 1AVYA 1RL1A 1D6EB 3OL2A 1X9LA 1G0DA 3K80A 3T3PF 1X22A 4JHWH 4Z95L 4WF7A 5BZXA 5FW7A 4YSRA 3NABL 1KPUA 3ZYJA 3H1ID 1PS3A 1YMMB 2K4WA 3ZR6A 5KAQF 3KLDA 1BFSA 3VXPB 5IESL 4JKLA 2EEBA 4G7VH 5DJXB 1RZ8B 4BQ6A 4LGPB 5JQIB 5DMJB 1I1AB 3HUJF 3S35L 4NCC1 1T03L 5TF1H 1URQA 2HUEA 1SEQH 4F9LC 2K6YA 1OK0A 2B20A 1HUCA 3VI3A 3NSDA 1E7VA 5TE4L 3IFPA 1UZGA 3V6ZB 4Q9RH 4FQCL 3QIWC 5FAAA 3MRKB 2I5YH 3WFDH 1A4JB 1D2OA 4KKBD 2NNRA 4APQA 1QQDA 1XGYL 4PVNA 3M1CA 2JJTA 3QVAA 1NCIA 4XXDA 1T1XB 3QORA 4H1LG 2O72A 3PGDA 4JFEB 1QD0A 3VXOA 1BD2E 1UWGL 1W0WB 3DX0A 5B7MA 2O93L 1BEXA 3J7HA 3E7JA 1EGJL 1J5OL 4DERA 1FOSF 3ES6A 4H26B 1MKMA 4LBEA 5LG1A 3AUVA 4RFOH 4D9LH 2EACA 1IC1A 5I19L 7PAZA 5IBLC 3WTSA 2ZYSA 4ZXBA 5IHZB 1FGNH 1NLDL 3UTZA 3KPQB 4Y1TA 3L75J 2R0KL 5H8DA 5MEOB 1N8ZA 1MH5A 2OTUB 4LLDB 1HL9A 1X4YA 3LKPA 2W65B 5IROA 5C08D 1QWUA 1AHKA 2PTTA 4WGKA 1QA9A 2WLIB 2DLFL 4DQOL 3KNBA 3ZL2A 4NLAA 4HKZH 2M3BA 1RVFH 4CC0A 5B8CB 1NEUA 2FEEL 1SPDA 1II4E 4JF7A 1PU0A 2P5EE 3KPTA 4NB7A 1NIDA 1R3JA 5TQ2H 2NPSD 2YIUB 1PY0A 2WSFH 2IG2H 1QWHA 1P84K 2GFBB 5F1OB 4AQ1B 3LNHA 2XY1A 3EFFB 3D70A 2NXZD 2NY4B 5KZCD 4Z7WB 1SQVJ 3P69A 1KIUA 3PNWA 3DXAB 2FQEA 4MAYB 4QY8A 4XTRC 4N1CA 5JR1H 2NUTB 4NC0B 2H26A 2GC7C 4M5SA 2A1WH 2ESVE 2IWFA 2R39A 1MIMH 1TEFA 5CLZA 3UTPE 1B9KA 3VN0A 4J8QA 3EJZD 4AWJC 2Q3IA 1SQ2N 3IJEB 3MJ7A 1BG9A 4EJ1C 2EINB 4A7QA 5MHSD 1C5BH 4H88H 1BF5A 3DSNA 1D7MA 3EDEA 4L23A 2VZOA 4IYKA 2ZIDA 4NQED 1D5BA 3HNVL 3Q8CA 2JCCF 5HYJD 2BOLA 4LLMB 2Q76A 4S1QH 2DLIA 4P9ML 1WE5A 4KAQH 4KI1A 1TNMA 2IZ0A 3QWOA 1AY1H 5F1KC 4O4YL 4L74A 4H8WC 4JFFD 1WLHA 1CTMA 1UG9A 1Z9MA 1WAAE 4Q0XL 5T33L 5KS9E 4YVUA 1CGWA 4P59L 5DHYB 5C07D 3UBXG 4KKBC 5E9DD 3QIBD 1HT6A 2XQBL 5KJ7A 4PV1D 1HFUA 4U6HA 3KPPA 2PPAA 3OR7B 5F9OH 1NCNA 4QXUL 1RZ7H 4FQPA 4HJJL 1M7IB 4PB0L 5GTIE 4OFQA 4GOFA 4OR1A 5EC1B 3SGDH 2C3XA 3RP1A 1DQJA 5AVYB 3FUDA 4H20L 2ZZUT 1FJPA 3ESPA 1IJNA 3ZDZF 2CKBB 1NINA 2XPZA 3S34L 4ZPVA 5HYIA 3VFSB 3NEXA 4WW2A 3H9SB 4XPAL 1RSFA 3GG2A 5AKTA 4Z7NE 2JJLA 3WIAA 3AEDC 1MCPH 4KDVA 2G30A 1KJMA 4QYOA 3SE9H 1HTYA 5EDSA 4ACTA 3TA3D 3Q05A 1WTLA 2EXSA 3QK0A 5F9JB 3DPBB 3L71J 5IG7A 1KIQA 1UQSB 2QVTA 3PGFL 5ECGA 1CO1A 4GRMB 4A2FA 3GXDA 3RVWC 2VXTH 1NMCC 1J05A 4JFPA 2XN9E 4M3LA 1CS6A 1FE6A 2ZYRA 2IAND 1GTFA 1BHGA 2OKMA 3HHMA 3P2BA 2FYYA 3SYOA 4UDUB 2BOBA 3QP3A 1RE4C 4PRDA 3GUTB 2HSIA 1H3XA 2FKWB 1QBML 2CA4A 2VQTA 2X1PA 3BX7C 2ISDA 8PAZA 1V7NL 2G2RA 3O3AB 4NFCA 3AMLA 1P84H 3K6NA 2NPSC 3MRQA 5DK3A 4GYBA 2RD0A 4YFLI 1HHGB 2NRDA 1KIRA 2D31B 4YFEA 2OMZB 2IBZY 4OKVA 4ZW5A 2KLVA 2E8YA 1JN6B 1Z56A 2IEPA 3QA3B 1HEJC 1SJMA 3H1KG 2D0FA 4BKLA 1FFRA 1G2CA 1U95B 3BH4A 1ZLSH 1XZ0B 2DMKA 3O45B 3S3CB 3JUZA 3L3OA 3P2TA 3CD4A 1E90A 4E9TA 3EJZC 3D52A 4TM9A 3SYPA 4GKOA 4LHQB 4U0RC 4Y9CA 1IM9A 3D85B 3X14A 3B1TA 4MA1C 1I7UA 2F5AH 1OVUA 2H6PA 2YAFA 4BH8A 3P8CE 5DZVA 3LPPA 2PW2A 4K71B 4RMSA 4ZUSA 1Z2KA 1R8EA 1IEAB 2NW2B 4HKJA 4R7DA 1SBSL 1RKRA 3G3LA 5LCVL 4GSXA 5HSFA 1RJZB 2UZPA 3TO2A 4Y99C 2ITAA 1DBKH 1KTLA 2OI9C 2XA8H 3BFWA 3MOAH 4JKWA 4AH2A 3IDYB 4KO5A 2BEQD 2VMEA 3IAPA 4MD0A 1FNAA 2WNGA 1BAFH 3OLDA 1G7HB 2FIRT 1DJIA 3EOYG 4TNGA 4WHDA 3OF6D 1DJHA 2AEQL 3QIBC 4NBXB 4XXWA 1GGIL 4PV1C 3DUUB 3PL6B 3CVHH 1BIIA 4R9HA 4FG0A 3HCVA 3KLHC 1GYUA 2XG4B 3WMSA 4N2KA 1G87A 3KCPB 4M6OL 2E7MA 2R27A 4CU7A 4L5FL 1MEXL 1CE1L 1ZV5A 3UC2A 5HVHC 3VDBA 3TJHC 5AOKA 2QKIB 4X6EB 1MLCB 4DW2H 4FQQA 4IMKA 4DIXA 3IFMA 1F1GA 2PUQT 1H15A 3D25A 4H8WH 4PJIF 4HCGA 4JDEA 1RK0A 3KPSB 3U1PA 2EKSB 1OK8A 3BAYA 4MZ2A 4XB3A 1EJOL 3C75A 4OF5A 1IE5A 3G08A 3TPKA 1PGPA 2XX0A 3OJAB 3D48R 4EDFA 3ESUF 3WKYA 4HPYL 4X8CA 2IPKB 3TA3C 2UYLB 4JB9L 3QRFM 3WMQA 5C6WH 3N85L 4GEJA 3FK3A 4XVJL 3W56A 3ZDXB 1ZS8A 4O58L 1XT5A 2YPLB 5DJ6A 1ZT7A 4HD9A 5IB1B 2K9JB 3M17A 2ZUVA 3QQDA 5DD3L 2W81C 4NUGH 4TVPE 3W39B 3D71A 1J8RA 1FN4B 1OTTD 2Y7LA 3GTNA 4JFDB 4UV7H 4WFEE 4FI8A 4ZFZA 1ZLDA 3NFQA 4LKXB 4K94C 2CNYA 1XXDC 1GJIA 3WY3A 1CZ8L 4N1EA 5A2LH 4YDJB 1GW0A 1T0MA 1G6VK 5L9DL 1Q1JL 1KMGA 4NXKA 1AHWB 4W9GC 2C3VB 4KRMB 5CLTA 2DL2A 1NU1D 4OCSL 2OYOA 3VI4E 1NM9A 2PYEE 3UJIL 3WJLA 5F88A 4GXUM 3JWOC 2FYVA 4R7NA 1Q2NA 5ES4B 1FZGA 2J6WA 2V9QA 2WTRA 4WY4A 1HWHB 3V0WH 2BHUA 1I1FA 2W59A 2YAEA 1UURA 1TEGA 4YNYB 4YPGB 4BQCA 1OSZA 2BW5A 3G6JF 3GMPA 1KLUA 1Q4NX 4XMVA 4WNJA 5IF0B 1KELH 5K1VA 3QO0A 3NSXA 4Y16A 3PAZA 3CN0A 5IVZA 4JG0L 3RL0D 1UB6B 4PJFE 4WEEA 2WXLA 3P30H 1DVUA 1N3NA 4A2MA 5A3IC 5D55A 3K6SB 3UZEC 1FDOA 3IF1A 4BD4A 3KYMB 1XCTB 4S2SA 3IJYA 2C4FU 2XZRA 2B3IA 4OLEA 2VQ1A 3S5LA 2W27A 3QG6A 2AP2A 2WMPA 4W9IC 3FQYA 1RZQA 1TU2A 4XBGA 3RBGA 1U8MA 4JZNA 3TX4A 4F33B 4DZBB 4GQRA 1F97A 3U9PH 4OWFA 4YHKL 2KQNA 2WSDA 2WKGA 5JW4N 1NCAL 2UWEB 1LTXA 3TEXA 2X28A 2FXPA 2AJZB 2AW2A 1P2CA 3QJSB 1NFDA 4HWZA 5FB8A 4XA4A 4OIAA 1QSFD 1CBVL 5IHUL 2QQKL 4X6BB 2IC2A 1H6UA 2BVYA 1BXVA 1VERA 4GQ9H 2ICEA 2AV1A 5K93A 2VWEC 5D96B 2QELA 2XZCL 2DIBA 3JT2A 5EZPA 4YXKL 1KCLA 3OHMB 1OAKH 1HAWA 1MVYA 3DHMA 5ECJE 5F1IB 2Y9RT 3IXTB 1DVZA 3TP4A 3II2A 3PAYA 3R1GL 4ZTEA 3ETBJ 2C0XA 1OTTC 3DK2A 4YHML 2V7QH 4KQ4H 5DO8A 5BRZB 5E4EC 2NXYB 2X4PB 3TBSB 2R0LL 3KPMA 1XH0A 2GVYA 1NDGA 3U9UB 5IHLB 1ZV8A 1GIGH 2WTPA 5CILL 4Y5YB 3U4KA 2EIZA 1T5XB 4HOXA 1OTSD 4IL6H 1GS6X 4Y4KC 2CRYA 3HI1A 2C4FT 4HALA 1MHCA 1TLMA 4ASWA 4NNPH 4F20A 1S7QB 1YEWA 3HZYA 3POHA 5GGVH 1Y1UA 3QYNA 3FONA 1OAUH 3NUKA 4HJGB 5CCGD 2IWGA 4GS7C 1YMME 3J2PA 4QRRD 3UERA 2X10A 3OKMB 1DBBL 4K3HA 4HJUA 3HS0C 1KWKA 4G8AC 3AREA 3MQIA 2PXYB 1N0XH 1RU9H 3RGHA 4YE4L 3ATBA 4LF3B 4B5EA 3RL0C 1ZA3B 1I7RA 3RVVD 4E5XA 1NBYA 5IQMA 4G6KH 1W15A 2G9HB 3CSYB 4FQJH 2YD9A 3K6OA 4RZKA 1BEYL 4HAGA 3FUJA 2IWEA 3T0BA 2IQ9H 4KXAA 1FZOB 1H88A 1A25A 1C8QA 2GBVA 4M43L 1MW1A 2RJMA 1V10A 2F08A 5CD5C 4LSQH 4UM9D 3OJDA 4XAKD 4U0RB 1A21A 4AYMC 5E1QA 5GZOD 1JGUH 1IGTA 1M05B 3FO2B 2JE8A 3MZTA 4HKXA 4JFEE 3VRLF 4S0TD 2BPBA 3K5BA 2OTLP 4ZOCA 3BXNA 4HWBH 3CSGA 4G71B 3UEZA 2COVD 3L74E 3VH8G 2XWCA 1UT1A 1SJVA 2BFVL 3CMAP 2C9SA 2F58L 2HT4D 3MRIB 3BIBX 1CD9B 4TNWK 1K05A 4W7YA 3DV4A 1GPOL 2BIHA 1SEBB 3S35X 1KJ2A 1A7OH 3L73J 3P2DA 4E9QA 2Z35B 4I9WE 2EKJA 2ZCHH 2AQSA 2B59A 1B4JL 2X3CA 3M7OA 2WZPA 3T3PB 5K9QG 2DJSA 3TIDA 3G9RA 3KPLB 4Z9KB 5G4MA 4L73A 3IRPX 3V4PH 3HE7C 4GSQA 4XT1C 2NQ3A 2WBXA 5I30L 1I8LA 4U1HB 4PLNC 2BSTB 1FZJA 4LLYB 5DZPA 2XC8A 4DAGL 1MFAH 1N5AB 1UA6H 4OJYA 5FM8A 2X6AA 3PIQA 4PWEA 5DURB 1JYWA 1VQMP 4Y88A 4NQCA 4EUPH 4Z7WE 1RAMA 3SDCC 5B66E 3GJFB 3DXAE 4J6IA 1L4IA 4K73A 4WK2B 5F44A 2DLGA 1CU4L 2A99A 3AY4C 4P5MB 4ELKA 3X1FA 1TPXC 3IDNA 3VD9A 2P9RA 3DVNB 1HKFA 1PF3A 5BRQA 1JPTL 4XNMA 3N40P 1CZQA 4EAEA 4Z7IA 5CCGC 5EEUA 1KCSH 1SLWA 3AG4B 3EDJA 3FFDB 1T0OA 3VB9A 3MFGB 1NTME 1UEMA 1I8MA 3INOA 3WDJA 2NLJB 1P6AB 3DOHA 1UKSA 3PAVA 2Y72A 4JQXC 4NSKB 1CVSC 4F2MA 2C9AA 1W8OA 2AXFB 1OT2A 2DF3A 3BHBB 3NIFF 3KLSA 3SY6A 5IB2A 3TYYA 2DIJA 3NJNA 1VF5D 2J12B 4EVNA 3NTNA 5DUMH 2DQJL 4QTIL 4BFGA 4WUKL 4DVBB 5GJSL 3RHWF 3I6GA 4N24A 4ZS6D 2V9RA 1JUFA 1BX2A 4K8RH 1B2WH 3FQXB 4JQVA 4N68A 1MCKA 3VXQA 2WIIB 4QYAA 2GCYB 3CN4A 3FUKA 4X8XA 5A43C 1JY3P 2UZIL 5ICYB 4L4TE 2FHCA 1A3RL 1ZT1B 1XVSA 4W6XB 5GZOC 4P4RA 2F74A 3JWDC 2GSGA 3LKNB 1JHTA 3M88A 4ZOBA 4QEGA 2W9LA 4MXQD 3QHFL 1NAFA 3CLFH 1YEHH 3QXAB 3D39A 4KVNL 4X42A 4RCAA 4P49A 1FZBA 3H9SE 2HT4C 3LN5B 4Y9BA 1K4CA 2DI7A 3BCCE 1JGDB 1XXFC 3PE9A 1PIXA 4K5LA 4WEUD 1JAEA 3BD4A 5BJTB 5JORB 1E9PB 4H13C 1WC7A 2OLDA 1J5CA 2AGJH 1XGRB 1U8JB 3Q1EA 2V8LA 3MLZL 4JZOA 4W9EC 4HV8A 3ECQA 2ZYGA 1J1PL 2XUWA 3ARGD 4UQCA 1BFTA 2VNCA 3IJSB 4M3KB 1Q0EA 1IQDA 1GC1C 2WXHA 4KTDL 4JREC 4P3WA 3FO1A 2Y0EA 4OJEH 4OD1L 2PPEA 3BZ4B 1MCEA 4FHKA 1EC5A 5F8RC 3BZFA 3TOPA 4U1KA 1BBDL 2Y5EA 2CCLA 3HJEA 3NRFA 4HD5A 1VQ4P 4B9KC 1O7DE 2WUCH 3ISRA 3EH4B 3MCKA 5EDXA 3UPAA 3T0DA 1U93A 5E8EB 3P0YL 1QVOB 2Q20A 3NJGA 3WIHL 4F15B 3KZ8A 2F7QA 4P46D 4XX1E 1QNZL 4LOUC 4L4TA 1AS6A 3TBVB 4NI3A 4FG4A 1HJBC 3OC8A 1N7SD 3N44B 2G60H 4G8GD 3VFGH 4ZFGH 2EXWD 2VLKA 3KYKL 4Z76B 4Y5XB 3VFPB 3MTXA 3ULVD 4ODSH 2HFGL 4N6QA 3OMIB 1G43A 4KV5F 1HCFX 4FTVA 1FVEA 2VLRB 5E4EB 2DQCL 4P2OD 3QDGA 5F7AA 2Q7CA 1SN0A 1PLGL 4K7FA 1ZXQA 1NDTA 4ANXA 4DNLA 1VF5C 1FC2D 4N85A 4OD2B 4Z3HA 5HD8D 4KJPD 1DTUA 5C92A 4BE6A 5DWUH 5D5MF 5TE6L 4CVXA 2GBTA 4LGDE 2IDSA 3N55A 4OQTH 4ZS6C 4AJWA 3C6EA 3AU1A 1KY6A 1ZR4A 1WFIA 4WGVB 2F54A 1C08B 4MQ7B 1IUZA 2XI9A 1CFVL 3DIDA 3D30A 3IMRA 3JT0A 2W07A 3AAZB 4G7RB 1CG9B 2B1OA 1YEFH 5FW6A 1ZT4B 4HJ0C 4YBQC 2CK3H 1VEPA 4D9QD 2OK0L 3GMQA 2WSPA 1FZKB 2PKDA 1NMBL 2OW7A 2W0FB 4PJ5B 5IMMB 2BCKA 2AAVA 4JPVH 1E4HA 2CMRH 2VW6A 3SO5A 2IPTH 4R5XA 3KPSE 4R84A 4PCSA 3PWUA 4GAJH 4PY8I 4TUOB 3KM1A 3LH2L 2L0DA 4AVHA 4UDTB 3VQ1C 1X5YA 1PFOA 1QRNA 1M3JA 43C9A 2Z0BA 5L0QC 4LEEA 3H32B 1OSPL 3H0TA 4EDWL 4WVZA 4HBCL 4RGNE 3UBFA 3DBXB 4PREA 5FHBH 5C0CE 2XXCB 4AVJA 2EDTA 1RZJC 1DQIA 3ZDXE 1YA5A 2WXNA 2YPLE 3BWUC 3T8XB 1Q0XL 4KTEL 4HMDA 4AJ0A 4EN2A 5E99L 2APVA 4TNEA 3GHBL 1U8HB 3RILA 4G80B 4ODHL 4JFDE 4NO3B 2HG5B 2BOCA 4L2YA 4UU9B 4R26L 5CBEA 3G9AB 1YEDA 3WTTA 3MLTA 1K8IA 4YXLH 4ZPTA 3NIGF 4MJ2A 1EFXD 4XCNA 4BWTA 2A73B 4G43A 1ZK9A 4MKTA 4RAUB 2JXMA 4F3FA 3B2UC 4X0NA 4OCYH 4DVRH 2MNJB 4MN4C 5ID1A 4P46C 5DD5L 1HGZA 2VDOB 3AS2A 2V7NB 4YSAA 2J6EA 4N5UA 3O6FC 4ETYA 3HZKB 2ATAA 3GSVB 1BYPA 3FSZA 4NUPA 3FB8B 2H5UA 3FBKA 5F6IB 3B5TA 1QR1B 1KIPA 2EXWC 2WNWA 4PJGF 5ESQB 3QQXA 1E7UA 3CMGA 3VRJB 5F9WB 3EYVA 4DCKA 3REVA 4UZUA 1V54B 1Z1WA 5HHVH 1YAIA 4IOIH 2BMKB 2OMVB 2WXMA 1YYML 3L74G 4P2OC 4UZSA 4UT6A 4BGDA 3D0AA 4PJIB 3VW3L 5D1ZC 5J11C 5I66A 3WS6C 2AXWA 4GP8B 1ACYH 4ODWB 1XB6A 1HI6A 1PDKB 2Y1YA 1NC2D 1FC2C 5TE7L 3O9WB 4XP1H 3KLLA 2LTQB 4FYTA 4AE0A 2BWDA 1FPTH 1O6SB 1G5GA 3CDYA 3HI6H 4MZ3A 1Y07A 3TYGH 2NY1B 4UQDA 1S9XA 3GI9H 3Q6GH 1KB5L 4LCWA 3NN8B 2DW5A 3KE0A 3LS5H 4NWTH 1LO0H 4TNVK 2QVMA 1W0VB 3VTTA 3TPUB 1C16A 1MFEH 1XH2A 4JMNA 3DUSA 1KCBA 1Y6KR 3PGCB 3QCVH 4JFXA 4AIXA 1T3JA 2BXZA 3HG1A 3FH7A 4LSPH 4GXVH 2CJUH 1N2RA 4M7JH 3VXUA 1HYSD 3ATAA 3NCMA 3MLWL 4PRIE 3V2QA 1IAMA 1ETA1 2ED9A 4X7CC 5TJHA 4GMSH 2Q9OA 2DLEA 3TF4A 1ULVA 4IGBC 4W4NA 4IU3A 4L9LA 4LIQE 4C55A 3ULUE 5B1CA 1H3PH 3D2UD 5LAPA 3HAEB 5KYNA 3IN6A 1J0JA 4FNQA 3IJ8A 1QLFB 3KHOA 4PRBA 4HS8L 4Z23A 4GRLC 5FKPB 3C8KA 5GGRY 3N42B 1UOKA 5C2BH 3GXMA 4M6MH 3GHGA 3TN0B 3EGSA 1RUPH 3H1HD 4L8BB 5AZEL 3TYFB 2M8XA 4N3TA 1T83C 1U8IB 1ZLVH 4S1SL 1SM3H 1XF1A 1NTMG 1FVDA 3LZRA 2FIKB 3RLSA 5BRZE 4Z7QF 1ND0B 1IRAY 4AXWB 3QDJD 3RDTA 5LQBL 1T22B 1UT9A 5LBSA 4OZIA 3A4DA 4HCRL 2WKLA 3WTUA 4MNHB 1MCNA 2R4SL 2QSIA 4H13B 1ROWA 2ATKB 3FT3B 4G8IA 3C09B 3IDGA 5FM4A 1XSKA 2P3YA 4AEIL 5KSAD 5I1IL 1K8DB 2D7NA 3D2TA 3LX9A 2DWTA 5CIPB 1MCIA 4PSRA 1NTKD 5GISH 2LW3A 4YWGL 5FPIA 2K8QA 2MRYA 2DWEB 4PRHA 5B3JF 2ZWYA 1UACH 3HR6A 3T77A 2WLYA 1EUUA 1RY3A 1UZ8A 4FXKB 4Z7VF 5KANI 1UWYA 4JG1L 3IETA 4HF5H 2D0GA 4LASH 1XGUB 2IG2L 5F93C 4O9HH 4DP6X 3BCCG 3CBJB 3VFWA 3FQ1A 5D7KE 5LO7A 5I8OL 1MRFL 1XB3A 4KO9A 3T2LA 4LGSB 4UOW0 3TGUE 4KDWA 2DEXX 5D6CA 2FK9A 2DV6A 3ULVH 1YECH 3ULSB 2ZXBA 1SN2A 4LSVH 1IGFH 4L8SB 4UV4H 5TK2A 3MRBA 5BRPA 4MHHI 2OYIA 2VDKH 1G9NC 4ZFOB 1RZKC 5AEAA 3VFUB 2G3MA 1HYSC 1L4AD 4YUEL 3I9AA 2YGQA 1I85A 1DUYA 1UH4A 2EUZA 1KCUH 3N1QC 5E2UH 3C60A 1G94A 2CO6A 1N8RQ 4LPCA 1BIHA 2Q8AH 4XRCB 3H4HA 3L45A 3PUUA 3QCUH 4FFZH 3T2NL 1INQB 4XX1G 2W91A 3TIEB 2N0MA 2WCPA 5EO9A 3MACH 3DTDA 4AGPA 1JGIA 2ICCA 3AJ7A 3T3PE 1AH1A 1HKLL 5BZWB 5I17A 1SHWA 1A6ZA 3RB5A 3TBYB 4Q4IA 3GTTA 4KTGA 1AMYA 4YXHL 2EDFA 3KYOB 4A7PA 1TKWB 2CZNA 3TCXA 3HZMA 2EABA 4X7SL 1ZTMA 3PJNA 2OR8A 2WZ7A 2X1OA 4NPFX 1UB5B 3X1EA 3VE0A 4RMRA 3T3MF 2J8UF 2PN5A 5B1AB 5A2AA 4N1HB 4A68A 3EYSH 1SMAA 3FB5A 1W2EA 3FZUD 1F02I 3PWVB 1UZ6F 1DVQA 4FHBD 3U4EA 3DVGA 2BNQD 4OQ1A 3SGJA 4F8OA 1ZS2A 3GSNH 3U1CA 3UZQB 5H35A 1NBCA 3HG2A 1BP3B 2YPKB 3II3A 4WJKB 3S3SA 3APNA 4KK9D 3TO4D 1ORSA 1XSJA 3EYQD 1IAKB 3N06B 5KSAC 1PNCA 4HMEA 1FH2A 2CBMA 3BISA 3G5VB 2C7UB 5E2WH 4E41B 1IFPA 1G1CA 1SUHA 1U6AH 4JM2A 1S7SA 3UADA 5D1XB 3L3IA 4FA7B 4KT0J 1JNLH 2A83A 4HIIA 3V52H 5C0AA 1QSED 1G7LA 4GQPH 4LLUB 4J12A 1B90A 2YJLA 5IV2B 4KBPA 1FOSE 3MRGB 3M9QA 5I8CB 3VYOA 2A45I 1W80A 5BU8B 4JFSA 2EADA 2IGFH 5CEZD 3HRZC 3VGFA 4JO1L 2I26N 4WHTA 4AQEB 3VXNA 5I1AA 4PJ9C 5IQOA 3QRGH 3QO1B 4M3JA 3GXPA 5KUKA 4F7MB 3HG4A 1T1YA 1HWTC 3L5XH 1FL3A 1LT9B 3TK1A 5HGAB 1MJJB 5KVFE 1NTKK 1HNYA 4KK5C 5KBKA 4CMHB 4QJ5B 1BFVH 4V1DD 2NT1A 2E46A 3VTMA 3ZMRA 5IUSA 1CGXA 4A1RA 1FYTD 4G9DB 4I8DA 5J1AA 1PX4A 3HUJA 4MJ5B 3ZL4L 4DZ8A 3CH1A 5APVA 1CD1B 4FL4C 3LRKA 5CHNB 3JV6A 3UTQA 1ADQH 2KDGA 3FSWA 3C6LB 1CTNA 2YXVA 1HZHL 1A3ZA 3KW7A 3QC6X 3UC0H 4EI5B 3K4ZA 4W9JC 4NJ9H 5F7EH 5E0FA 5FWRA 2CWRA 2WVVB 3FSOA 5KYWA 1TLKA 2AHIA 2H3XC 4F57L 3WSQH 4G5AA 3VXTA 2Y7QA 2B1AL 4L4VB 3HKZA 4HPHA 5EEZA 3JV5A 1PSKH 2H41A 4ERSL 2Z93B 1LTIC 3N9GL 5HHMD 1GHFL 2CJSA 1T21B 2AKRB 5FDYA 4GG6A 4HB1A 4J3OD 3L3KB 5T3ZD 3DGGB 3BAXA 1MAMH 3OKEA 1P84I 5FA3B 5D7JC 5FYJE 4ORZC 1WBXA 4GW5A 4AEHH 3KXFD 2O6EA 4JHZA 4F8TA 5CM1A 2E43A 2F5BL 3QZWB 3W57A 5AVXB 4IS6A 1Y9BA 2JCCE 3CSBA 2JK5B 4KKPA 4PRPD 3EO1B 1QFWL 1YNTF 2DWSA 3NIFB 4L1TA 3IS1X 1NOFA 4XNQB 1CGSH 3MRJB 3P32A 5I75B 1OVZA 2Q8BL 4ZSOA 4YC2C 3BKJH 1BE3J 1NKGA 1ZE3H 4FXGB 1IC2A 5GIRA 3RWJB 3KPNB 2E7BA 1NFKA 4KK9C 2P7TB 4UB8E 5F21B 3EYQC 5TGBA 1MLBB 4WRLA 4U6YB 3B9KC 4OCXL 2OMTA 3I3DA 5LBGA 3M9BA 3IRCA 1HEZA 4FHJA 1R5IA 4OLWL 3QUYB 4U2YA 3BT0A 3UYRL 1VLXA 3B71A 2P8MB 3CPLA 4MDRA 5D1QB 2BSSA 4MD4A 1WO2A 4X5WA 3MLVH 1NUNB 4HK3N 2VLRE 4W9FC 4NT6B 5GSRA 4DN3L 1DVFD 4XVOA 3WE6B 2PP7A 1RPUA 5I1JH 4X4XB 5CCHE 4L0ZA 1GU4A 4Y2DC 5GGVY 1WVZA 2AF2A 1P1ZA 5ITFB 1TG8A 1AGDA 2EIJB 3MJ9H 4J4PA 2OAAA 4OFYD 2WPVB 5CJXC 4OV5B 1SYSB 1EEYB 4AIZB 1FFNB 3BAWA 3ABKB 2JCCA 4Q9QH 4I18C 5B7EA 1I9IH 5LXGL 1CQKA 3CMOH 5DHVB 4PJ5E 1LD9A 3LNGA 5EFWB 2WT7A 2NYZA 2ZONA 5CXPA 1SS1A 2ZXWB 2YPVH 3FL7A 4HETA 3WFHB 1DD4A 1DN2A 4OZFH 2P5WD 1UADC 2V37A 2EE2A 3NYKA 1IZJA 1EHLH 2KHAA 3PDDA 2XG5B 4QHUA 1NGZA 4PJ8C 2W94A 2WITA 2PP6A 1C12B 1N8OE 1TJMA 2CA3A 3DYMA 1A64A 2EEFA 3ARXA 3O6QB 4HWUA 2ATPB 4OBSA 1OANA 4FG6D 4U3XA 3Q1SH 1O9VA 4XAWH 1ASOA 3HPJB 2A9NL 4Y4HC 4PS7A 5GXBB 1PBYA 2GITB 5C09A 2FQDA 3HB3C 3WY2A 4F58H 3ZHKA 5JLZA 4QCIA 4KHXH 1N73A 2OXGA 3MMEA 3E8UH 4MXWH 4OB5H 25C8H 4TSCL 4X9FA 4A63A 1GOFA 2N7AA 4AL8C 1CI6B 1UD3A 4KFZC 5FYLE 3S36H 1RLBA 3D33A 2PRRA 1A8ZA 4JO5A 3ZXAC 2HODA 2R4RL 3D3VD 2BZDA 3NSCA 4U6TA 4EQ3A 5D5MB 1L5GB 1KBGH 1QG3A 4I0PA 4WFFE 3IDUA 2WQSA 4GQ9L 3TGUG 2EXYD 3Q5RA 4XWOC 5D7LA 4CGTA 4HJEA 3VTPC 3B9VA 4PYGA 2BP3A 1EGJA 5ISZD 4GKZB 3QYMA 2OSLA 2H2PD 1CDGA 3G04B 4PHXA 3AS1A 3F12A 4RAVB 1H3WM 5LGJA 3H25A 3GLDA 3P02A 1VKXA 3WXVL 1LILA 3FQNA 4NRXB 1DVFC 3HVDA 4KKCC 4PJIE 5E6ID 3V0GA 3WO4C 1QBAA 3A24A 3ECWA 3P4NB 3NCJL 5C0EA 3B8YA 1TQWA 1I3GH 2B4CC 3FOLB 1URQD 3CLEL 2DYPA 3HNTH 1L9SA 4DFIA 1MCWW 2B1HH 3ELQA 2XKMA 1E27A 4KU1A 4YLBA 3VX0A 3FU7B 1QMUA 2VL5A 3RTQC 3I5CA 3PYCA 1CLOL 4X80H 3NZSA 2CALA 1NOHA 4C83A 1YY8B 4APQD 1RK7A 5SX4I 3LDBC 2CXGA 3BP5A 2N9BA 4J3WA 4ZI8A 4R4LA 2Z7YA 2YD0A 5KVEE 4EN3A 1ZPUA 1A1NB 1F3DH 2QMKA 3BVNB 4NKIH 5KAQG 5HYQB 3QI9B 4K94L 4N78D 1Z32X 1O6VA 4YIQA 2A3TA 2BNUB 3K91A 3H2PA 5CEZH 5AB1A 3RWEB 4RISL 4UT7H 1USZA 1JCVA 1UWEL 1M1JB 4EXPX 3NIGB 4AQ8C 3K8MA 1K2DA 2WSEH 2MSPA 5F0LB 4HYTB 2BY3A 1D9KD 5CJBA 1PAMA 1KORA 3E80A 4JZJB 3BP7A 1KYAA 3JWOL 1KNOA 4MWFA 2WLKA 4ZXBD 3FRPA 3D12B 4KXBA 2IQ9L 4P2AA 3VGBA 2WAHA 1ZA6B 4N0FB 4BJLA 1IC4L 3W0WB 3V4VL 3C08H 4JO8A 5D93C 1QL2A 4FG6C 1KGCE 1A5FH 4XVSH 4RA0C 2GBAA 5LB1A 4P05A 3CLQA 5IQNA 5HVGB 5H37G 1E9OB 1XSIA 2B0SH 4LKCA 3ETTA 1MUJB 1EBPA 3CC7P 4YDIL 4JHAH 4HWBL 1DQVA 1M7XA 3QZOA 1RF1C 2LVCA 3PLYA 3U83A 2WPRA 3B7RL 4PJBB 3SGKC 4F8LA 3LQZA 4KNTA 1AZRA 4PS4H 4RGOL 3D8MA 4K7PH 5KAFH 4PRNA 3IMBA 3BZEA 4J3OH 3GXTA 5T3ZH 3EDFA 3SDDA 1OAZL 3FT2B 4UB6H 4ODUB 4QHMB 2D3JA 5AOZA 1Q94A 1VFUA 1IFMA 3A0OA 4DO4A 1EHAA 5D7JB 3SWKA 5GJTH 2EXYC 2V2TB 1OARH 1IVTA 4QPEA 1TJGH 2AABL 3BUTA 5HPMA 3C5ZA 4X4MA 5DGQA 4NPEA 2P67A 2XN2A 4BSWA 2P8PA 3T0ED 3B3IB 3BPNC 3VU2A 3QEQD 3V4PL 5DJ8B 2WTYA 4WWKD 1YQ4C 2EVHA 4TLTA 4HA1A 4N8PA 4O02L 3TVMD 4DKDC 5ACMA 4WO4C 5E6IC 3T6VA 1SHSA 2X1WL 3OLGA 3FQ2A 4U1LA 2YMYA 3HE4B 3D07A 1IFRA 5SWZA 1IO4A 4ZDHA 1N26A 3BIAX 3GM0A 3TBBA 5EOQL 1INDH 3CZEA 2XVKA 4OLUH 1T2QH 2ZP8A 4MKMA 3ZTDC 5K9KA 3G6JA 1W72H 3SPJA 4P4KB 5I1DB 4K23L 1TOXA 4GAGH 2P44B 4DK3A 5KJ7D 1OW0C 3UL4A 3O3DA 1UOLA 4MJID 4KKAD 4OZHB 4S0HA 1O9ZA 3P9LA 3FX0A 1B0GA 1FWXA 4WFHE 3BLPX 1MQKH 4QRQB 4GW1B 1OY3B 3WN5B 4PUBL 4ENED 1JM0A 1OGPA 4LARL 4NWUL 1AVAA 3K5SA 3K6FA 3EGXB 3K2UH 4K3GA 4O5LL 3FS9A 3O6KL 3WN6A 4ZFQA 4GH7B 3QEGL 1IQWL 4J2QA 3ZDWA 1AI1H 1D9KC 2BVPB 5AW7B 1VDGA 4EE2A 5D7EA 2J4WL 4M03A 4X7FC 5B1JA 2HPCB 1IBZA 1CICA 4FEIA 4UB0H 3SE8H 1FDLL 2WUBL 3S37H 4Z5RB 1BBJB 3L3DA 5LCVA 2X6BA 5F1NA 1XX9C 2CHDA 3QUMB 3AEAC 5IJCC 2CAKA 1N5YH 1PG7X 1U41A 5ID0A 4U1NA 3L4FA 4M1CD 3BGMB 4HUCA 4D94A 5IK3B 3Q1MA 1EXUA 3G5YB 2FO8A 4Z7VB 5M7QA 2J20A 4FABL 2ICWA 4FA6A 4L3AA 4WUUD 2VRKA 3CLFL 4M5YH 5L8JB 2Z7ZA 2XFXA 2A38A 4DOJA 1LO3L 2P45B 3HI5L 3VFMB 3STZA 2FX7H 3GC3A 5MP6H 2WJ7A 4TOYH 1M53A 1LWUB 2F0CA 1L0YA 3EJUA 1NPUA 1E42A 3T6ZA 4N86A 3OB0H 3QNYA 3OKNB 2IBZE 4E41E 3V0HA 4PJ0H 2O6DA 2K7QA 5IFAH 2A6DA 3C2AL 5D1XE 4YHIB 3WUWA 3T0EC 1IM9D 5AOJA 2Q9IA 2YA1A 3APMA 1M9WA 4Z8FH 1MCHA 1NEZG 2HTLD 4WWKC 5EO1A 2CIKA 3TU6A 4TF4A 2NY6D 3TVMC 4ONFH 1EXGA 4JFQA 4DGVL 2FYUD 2AMUA 4ECNA 4KK6D 1LGVA 3CCHA 3RY6C 3QWNA 4GUPB 2AZAA 1IZNB 2KSJA 4WTQA 3GBNH 4HIHB 4PJCA 2CXKA 2X1QA 3QISA 4YSSA 4ES8A 2F1BA 3EOAA 2NY3D 5AL0A 4A39A 3PWNA 4GQQA 4PP2B 1C1EH 2OYHB 1XO8A 4RBPK 3KVQA 4AZ8B 1NBVH 1TEYA 2BVTA 2DWDB 3GPEA 3UFIA 5JIQA 3ECBA 5I16B 1IB5A 1UKTA 3MV9B 2N0KA 4FQIH 4KKAC 4IIQC 4ZW8A 1OAYL 4B6ZA 2K0RA 2A9DA 4E36A 3LY6A 4ENEC 3WS3B 1MCWM 4F9PC 4YSQA 1RI8A 2FSEB 2PCPA 4FQHA 2DQHH 4YGVB 3ROLB 2VYRE 4PWHA 5DEFB 4L4VE 4IU2A 1GZHA 3SOBH 1J8SA 1W6WA 2YD4A 2ZAEB 4GINA 5I6OA 4N2NA 3WNIA 4X4YA 1EEQA 1F1DA 4BSJA 5TJWK 1PGJA 4X0KB 1SQPE 1MVUB 3RWHA 2CCVA 2FX8L 1OGTA 3VFNA 2KS1B 4X9HA 2F7IA 3BWAB 3HUSA 1QFUL 3FQWB 2VXVH 1E5ZA 3FCSB 1YNKH 1FNSH 3MC0A 3TNUB 3K4DA 4MD5A 1JF6A 4PVBA 1E4WL 1YEJH 2QQNH 1F18A 1EHXA 1A4KB 1ONQB 1AFVH 3NIFE 1A6AB 3KGRA 5HDWA 4JPVL 2CMRL 4Y4FB 2WPGA 4NPYA 3TGXA 4FXTA 2UVEA 3PWPD 1LK2A 5I1KH 4HSQA 1H9DA 4BRJA 3I6LD 1JIBA 2KB7P 5A2BA 1AJ7L 4GAJL 4ZKPA 3GS4A 4Z3JA 5KYXB 3O6LH 2Y69B 4X7TA 2AI0H 3UP6A 2ILLA 1M71B 1SGKA 4LVNC 5JNYB 3L72D 3GXUB 2NR6A 1GMIA 2VE6A 3P3RA 4U3SB 2F8OA 1FFPA 1WK0A 1N6UA 1SRDA 1S9KC 3JWDL 1NTZD 4WY4D 1MWAL 2WK2A 3I3BA 5SWSA 5DJ2B 5DVPA 3QUXA 3RNKA 5D1QE 4HKZB 3A0BH 5IQ7H 2X12A 1BCCD 2HTLC 2OSYA 3NOIA 1DSWA 2NY6C 3D7PA 2FX9L 2PTVA 4NRYA 3LXAA 4HFUH 4AG4L 5C1MB 4TNWF 5DTFA 5BV7C 1KN4L 5MEQA 1OP3K 5KVDL 1R5LA 4NHUA 1AQ8A 1S5HB 2O5NA 3CFBA 2PO6B 2R9HC 3QARA 3MCG1 2XNDH 4UILL 1MJ8H 4IHOA 3KDMB 3HAEG 1RJYB 1U8KA 1IBBA 3OHXB 4RBPH 3W81A 5J13B 3FXIC 1L9MA 1WZ1H 4PJDF 2B08A 1IT9H 3K2IA 2YNYA 4KY1L 3QPQD 1YQVH 1GC1L 1G7MB 5JW3H 1ODAA 2AXGA 1SJHA 2FYUK 3HNSH 3KYAA 1YNTB 4YAQB 2CQVA 3F05A 3BW9B 4OSUL 4NNXA 5MERA 2ZXQA 1NOLA 3DX8B 3T1FB 3QQ3A 3QGVA 1OGAA 4WU7B 3AS3A 2J2ZA 3CDGB 1ACYL 3OZ9L 4LEXH 1Y18A 3C5SB 1FLRL 1LGHB 3IGUA 1FPTL 1BCIA 1RXLA 3SHSA 1IARB 3X2QB 5IVXF 4QXVA 1A6VL 2GJ6B 2EUVA 3QZNA 1ZSHA 3DMMB 4YPJA 3FCTA 4NWTL 1S7UA 1SQMA 2X89A 4ZAKB 4H8QA 1OF0A 3VXMA 3LZPA 4ZD3H 2GEEA 2LHAA 3FC8A 4HUXA 4KV5E 1JMMA 1AXIB 1CLZH 2AK1H 1X5HA 3B8SA 3UAEA 3WLBB 2X05A 4GXVL 5BCAA 4BQ9A 1M1KQ 1LEGB 3L6FA 1JUNA 3F7VA 2JELH 2CRIA 1BQ5A 4YPCA 3M46A 4I0KA 3DOSA 5C7ZA 2RCSL 2VERA 4PG9A 5AW2B 5FUOH 2ZOWA 5D5ME 2ZP0T 3HD7C 3PQYD 1AS7A 4UYQA 3BT2L 3O4LB 3ARBD 4PIRF 5CJQH 4GW4B 2P48B 4HX1A 1NCOA 3GJEA 2K70A 3BAEH 4OLYH 5EFIA 4GBXC 5EUOF 4BFIB 2AJ3B 3UYPB 3LKSA 4NENA 3N1MC 3Q9PA 1LXMA 2FXOA 2W0KA 3ME0B 5EZOH 5I0WA 1JHKH 2A6IB 3W2DH 3ZGIA 4D0DB 4DEPB 5LGHH 1SM3L 2JQZA 3ERXA 2HT2D 3LRGA 5CEXA 4WGWB 4W93A 3D08A 1MNNA 4GI8A 1PY4A 5IWLA 3OGCA 4RFEA 5DZ9A 5DHMC 1OP3H 3GDCA 1P0SE 1NANH 4R4FL 2H1LM 4PJ7A 1ZIAA 2N01B 1ANUA 2I9TB 1RZJL 2WPSA 4QT5B 4JY4A 3GWJA 4N0UB 3G5XA 1J87A 4UQ2A 5EO0A 1NTZK 3U7WH 3FCUB 1SXSA 5DA0B 3V0DA 4X8JB 3HC0A 4HSAC 2IDBA 5TDNB 4CVZB 3MUY1 5BV7H 4LRIA 1EZVX 1SYVB 2FHFA 2ADJA 2FJUB 3NIGE 1GL2B 2ADIB 5D9SB 4Z1PA 5KVMC 35C8L 4X9GA 1U21A 1BZOA 2AJUH 3L3GB 5T1LA 1RF0A 1F8TH 3O8XB 1FO0A 3MFFA 3RY5A 2UWJE 4TRPL 4P5SA 3VFRB 4MNQA 4NHCL 4GIFA 1A7RL 2K3TA 2OP4L 4XNYH 5BOPA 3BPLC 5IREA 4J5VA 4BCYA 4KROD 1SQXD 2W83C 1Q7YQ 2XRAL 2E75C 3W0WE 1QW9A 3ZTEA 2WZPD 5L2KB 1CLYL 4TTDC 3CVHB 5IFJB 2IBZG 2Z7WA 3KPRD 2XJKA 3L16A 1SQVE 4L3EA 4LSVL 1IGFL 1H19A 2NTFA 4UNUA 4CRPA 2W9DH 3L9BA 4FMVA 1CF8L 3H42H 3LH9A 4RO0A 4AEFA 2IQAA 2KPWA 3ZZLA 2P8LB 3HZVA 2JH2A 2ZYIA 2IPUG 4PJBE 5KTEL 2JP3A 4WV1C 1KXQA 1Q9KA 1TCRA 1KN2H 4N8CH 4GIOA 1KBKA 1F0LA 1TSHA 2FSDA 1I8AA 1A6UH 2OMXA 2K4AA 3ARBC 3P3UA 2Q8AL 4HAKA 4NUJB 1YEKL 2Y7NA 3JQOB 1ZR2A 1S9YA 4NQDB 1TZGH 3GGWA 3UTOA 1MI5E 2F9BT 3ARDB 3L35A 3L4CA 2HN7A 4KMTL 3CFDA 1HZKA 1QYGH 1ZLWH 1E4XL 2B77A 5LN4A 4IFDK 1GU5A 1DQQA 1J9SA 3WKMH 3U2IA 2QQQA 2YKQA 2IIJA 3TV8A 4LCYB 1SF3A 4Y28J 4I3SH 3AE3C 2BS71 3SY0B 3WTVA 1D6VL 2FWLB 4C56E 5GS1B 4IJTA 2HT2C 3L4TA 4QMEA 2OMUB 1KJVA 3GXIA 3EYSL 3HW7A 4Y19A 1SBBA 3GSXA 4U1JB 3BDYL 4M29A 1FV1B 2ZCLL 2ZNXA 2ZKMX 3Q2LA 5D2NA 5DYOA 2ZXEB 4OCWH 3V0VA 2QGDA 1KLFB 2VDNL 3HG5A 4ZS7L 4PJGA 3FTZA 1JO5A 1JV2A 4HGWB 1PZBA 2XDHA 4HEMA 5D8JH 1Q9LA 3D69B 3RA7L 1N6QL 2GTQA 2W38A 4KZDL 1AQTA 3UAJD 1KENL 1S5IL 3KYNB 4PG2A 4OZHE 3RBZA 1P5UB 1T1WB 4UBDD 2AV7A 2FD6H 1UD4A 3QZWG 4YEEA 1RUMH 3MV7A 3WIHA 2WXFA 3ML8A 4D9RE 4F7TB 2NXZB 5CZVL 5KZCB 4QR7A 4BHUI 1TTCA 3D39D 4PP1D 1SMDA 2O5YH 5KN5A 5IMLB 2HAZA 1QLED 2MEJB 2MTPA 4JHVA 3QYCA 4W6WB 4WSGA 1BM3H 4XXCC 4X2UA 4NI6A 2IGFL 3DIVA 2WQRA 4RFNC 1MI5A 3V2NA 3BWUF 5I5RA 1KB9E 1H8NA 5DDHB 2Q5BA 1MAJA 1GZQA 3PDOB 1OCOB 3FB6B 5F3BB 3ZQXA 3VD1A 4HUWA 1TZIA 3B37A 1QI3A 1H5BA 2BNRD 2CSPA 5GQBA 1OVVA 1DSFH 4MXVF 5HYJB 4OF6A 3VSVA 3L3JA 1AD0A 3JTSA 2ZT9D 2WGNB 1VQ5P 1MFBH 1AE6H 2H6OA 3KBFA 4Z7VE 3QIUC 1IAII 4B5ZA 4G1EB 4EI6A 2J43A 1KOAA 5CMAB 3B6SB 3GSUB 1SN5A 3BKCH 4XMPH 5FO9A 3IGAB 4NN5B 4AYID 3USSA 3FUIA 5E4IA 2KXPB 4WY7H 1SQXK 3CFIC 4PGCB 3RGVB 4WTXA 4FZEL 3H6PA 5DJXA 2V5MA 5E9NA 5HJBA 1BGYJ 1J10A 1JYXA 3ULVF 3NRQA 3NTCL 1G9NL 3SDAA 1RZKL 3QQ9D 3QH3A 3HS8A 2VLKD 2Y36L 4HUKB 5CSZA 3ARPA 2YAPA 5T1DH 2ZUWA 2FT8A 3IGFA 4FTVD 5TDPB 2AC0A 1XGZA 4YBLB 2F53A 2WXPA 1BDYA 2NNAB 3DDFA 4JKPL 4PHZA 4K3AA 1DQTA 2NX5B 1A6TB 3HD7B 1G6RA 4HMCA 3SCMA 3ZVVA 3WHXB 4F7PB 1AXTH 1UWXK 3MKKA 3GRWL 3BEVA 4LDOB 1DEDA 4U1MB 4Y5VB 4R3SB 4IRJA 3MYJB 1XIWB 5J1TC 5HHNB 1ZGLM 4PGBB 3JYCA 4BUHA 5CN2A 5DA4A 2PCYA 3WIIL 5C0BB 1JK9A 3UAJC 3MV9E 2J58A 2GUOB 2MWCA 4AIOA 3U46A 1G1OA 4UBDC 2XTJD 3T3ME 1WGOA 2TSAA 3Q8FA 3JC22 1DN0A 4K3JL 3HC4H 2HKAA 5B39B 4IJ3C 1UZ6E 4PP1C 5KYUA 3VMXA 1AKJB 1X9RA 3PP3H 4NPKA 5IJBC 3LHPH 4CJ0A 4XNDA 1T8ZA 5F7FA 5EWIH 2DIEA 2QADD 4QGTA 4N2EA 5FECB 3RWFB 3ZKQD 1QRND 4OTXL 1MG2C 2VRAA 1E79H 3F64A 3HS9A 1NLBL 3FTXA 1YY9D 1LTJC 1BZ9B 1QEWA 4JHBA 2JMRA 4QRSB 1BQLH 5CN1A 3EHBB 4DO6A 5KEZA 4AQ1A 3BYYA 3U25A 1V27A 5BUGA 5D70H 5CCKL 2Q1KA 1JP5A 2GG1A 1I8KA 3BWSA 3QRLA 3PRZA 4WK0B 5MENA 4NNYB 1HL8A 3LKOB 2VO8A 4N87A 1KB5A 1QUNB 2F15A 2MKVA 1M1XB 3L70D 1KJ2H 2PCFA 3C12A 4HDIA 1KTJA 3IE9A 2OL3L 2JJSA 4YHLH 4YR6B 4AK2A 2IAMB 5BUAA 3MRRA 3QWRA 1IGYA 4E0RA 2E75B 4TLKA 3K71A 5KOMC 4AK1A 3CN1A 3OXRB 1BG1A 3CHXA 5GGQL 4MX7A 4PGDB 2R83A 1YCSA 2J8UA 5E8OB 4HPOL 4J6RH 4B96A 1JGVL 4FKHA 4Q6YA 5KG9A 4K7PY 5BW7C 5EOCJ 1G84A 3MLRL 5JIDA 2L8AA 4UQIM 3UTTA 8FABB 3X1BA 1FL5B 3TZVC 3H1LJ 3PPEA 5IM7A 1LEIB 3AXLB 1NYHA 2E74B 1QSZA 1YPZA 3MXWL 4M8RA 2HFFA 5DHYA 3BDBA 3INUH 3C8VA 3PHAA 3RZCC 1OZTG 3QUKB 5AWNH 3V4UH 4IBWA 2R8SL 5TFSH 2ERJC 1SQQD 5LHDA 1A9BB 1T3FA 3AT8A 4LCUB 4LCWD 1CJYA 1ZVHA 3BGFC 1J9CT 3T4YA 5DQJB 2YO2A 3OGOE 4LP4A 3SODB 4N2HA 5JHDD 4G6AD 4KHTH 3L2MA 3EH1A 4NQVB 1SQVG 1RE3C 3D4CA 2XTJC 3HG1D 1GY1A 4X6CA 4M3HA 5GRUL 1AKPA 4XCYB 1TTFA 2GK2A 2VDLL 3F85A 3PJLA 1HXKA 3VXUD 1XCQB 2VLJB 3HLAA 3BRDA 1EUTA 2LU7A 1SDDB 2ZOLB 1CLVA 1I9EA 3EKCA 2EYRB 4NDMB 4O2EB 2RQ8A 4PGEB 3GW6A 1ZHNB 2HH0H 4Y2OB 4X6DB 5LN8A 2F8VA 3LZFH 4HISA 4Y9GA 1E5AA 1Q9OB 3GXNA 3ZZ1A 4HT1H 1EDYA 4X5LA 3CZGA 2YGVA 5DD1L 2QPFA 2GJ6E 3MCLH 4IW4C 3ESOA 1YY9C 5GGUA 3L95B 2E86A 2PWHA 5C0RH 2B16A 3WFBL 1WZLA 4PW3A 4ESKA 3LTVA 1GCFA 1BLNA 5JA9A 2HFEB 1L0QA 1CMOA 3RB7A 2ZYDA 1U3HA 2KERA 2L7EA 1HCVA 2AEPH 2HG0A 4QF1A 5D7IF 3ZX1A 3QDMA 2J73A 2VN4A 1NCBL 4MBRA 2IADA 2HX7A 3AWGA 4NJAL 2PTUA 5LGKA 5E79E 5L7XL 3G5WA 4UNTA 3S3JA 2AFNA 3ZYZA 3AU0A 4XPFL 2DY2A 1P4IL 3QXWA 5DD0L 5AUMB 5KSVB 3ZE2B 2BZCA 3O4LE 2KBGA 4LRNL 1E0OB 1YC8A 1E6JH 1SY6L 5B22A 1IEAA 4B3VA 3OXSB 3IU4L 3CN3A 2DM3A 5E1AB 4ZUUA 4YHPA 5DJYA 3FKUS 1IGIH 2O3JA 2IFMA 1KILC 3DX7A 4PRHD 5DR5L 3FFCE 2VC2H 3WFEL 5FO8B 1P84E 1KPVB 4XNBA 2E7DA 3T97A 5HI4D 1S7VA 4AENB 4WNSA 5EIVA 1H3UA 3S4SA 1CXLA 3MDJA 1ZVSB 4URTB 4DTGL 1VHPA 4N20A 4R7VA 4YEFA 3FT4B 1YC7A 4K7PL 3KJ4B 1CN4A 4I85A 1JXGA 2QM7A 5DJZA 4DESA 4NXSA 1MDTA 4N0UE 1CXKA 5JPMB 3A7OA 4JY6B 3GLEA 4IM8A 4E42B 1KCRH 4JFUA 2I24N 3MI6A 1EJ8A 5GGRA 4AUWA 1R17A 4N9OB 4F9LA 4LFHD 4ELMF 2ZX6A 4G6AC 5EBWB 3T65B 3DI3B 3M8OH 4CNIA 5BNXD 3QIWA 3CXHD 2AQRA 4AL8L 2KLUA 5I6PA 3WELA 4KKRA 1JI2A 3N43F 3VFOA 1GGBH 1I9JL 1SQQK 3OR6A 1PQZA 4AJYV 5L2JB 4V2CB 4HCFA 3S8FB 3TXAA 3GINA 5AOIA 3SPVA 1HILB 2HRPH 3C9NB 3FO9A 1R3LB 4NGHL 5IW1B 1INDL 2BC4A 3V8CA 1J1EC 4QRRB 2FYNB 3UPRB 2HTKC 1ORQB 3VRIB 5GRWA 4GO8A 3FYEB 2MKLC 3RX7A 3KMDA 4HJSA 4UI2A 2YK1H 3AQXA 1BZ7B 3IU3B 4G8EA 4N2IA 3FO0L 2JO1A 1PJ9A 1TZHB 1JPFA 1OL0A 1HS6A 4M1GH 3D9AL 4XP4H 3W1ZA 3V55A 1MHPL 1SQBD 1MPAL 2B4CL 3ETSA 4XZUA 1ZOYC 4JJ5A 2N1TB 5L4FA 2AK4A 2R1YB 3OSVA 1J8HD 1VQPP 2ZWZA 3KAAA 3MYZA 3WU2H 4IIZA 4LNRA 5DJCA 5EOTB 5ICZA 1NUGA 4JAMA 4EYYQ 5E6SB 3WNPA 2IGTA 4QHNB 4KJYB 3ZTCC 1F4HA 3DRQB 4NQDE 2WZ0A 3FMGL 4NX0A 3KW8A 4TUJA 3IFOB 2B39A 1CXFA 3SE8L 3U2SB 1DDTA 3CCRP 2XZAH 4G9FA 4JM2D 3EF4A 3S37L 4QRUA 3A6BL 2PW1A 3ARFB 3WNMA 1T7ZA 1PW3A 3H2QA 5GRYA 3AC0A 3TNMA 5C0AD 3RBSA 4EI0A 1GW4A 5JOPD 1TZOA 4D7PA 1JF1A 3TEZA 1I8IA 1COBA 2C9RA 2ZYAA 2V2XA 3OWRA 3V6OE 4ZMWA 3L36A 2ZUSA 3QJFA 4D0BA 3LPOA 2B87A 2J6EH 3NFNB 4PI0A 3EFOB 1U33A 2DQUH 2FX7L 2C3HA 2I07B 5T1KB 4X5XA 5KANG 5APWA 4MMXB 3GIVA 3HE6D 1DR9A 3NGBC 1UVQB 3UBXI 5DRNB 1Q9WA 4D0CB 4P5RA 3R06A 1F42A 1N7LA 2DQEH 4J3TA 2UWEA 4OCNC 3NA9H 2AJZA 4HIEA 4LU5L 5CR8A 4FLQA 4U1IA 3BVWA 4UT6H 3X12B 2CD0A 3TZVB 4IOIB 4HKBA 2XV5A 3SKJH 1JRHL 2YEZA 3HMXL 1NBZA 5HDRA 2YXRB 3E1IA 3P9MA 3O41A 1FLTX 2X4UB 4LSSL 3VG0H 2CIIB 2PWGA 4RGMB 4MHHG 4G1MB 1S3JA 4J3OF 3PREA 1KT2A 3LPWA 3T6WA 4MLSA 4PD4D 3FQ4A 4F91B 1HSBB 2UZXA 1OIOA 4PJEF 1ZHBA 1HHJB 4RRPA 5MHSE 3TFKD 1RLWA 1H0DB 4BWUA 1ECZA 3K0WA 5ITBH 2PF6A 4R97B 3U0WH 2QJKC 1QABA 1A6WH 2AJXH 4AC4A 3AE7C 5HYJE 2X4RB 1CFNB 1J5IA 2YUXA 1S9VA 3MBEC 4QOKB 1AO7D 5A2CA 4KQ3H 2ADYA 2RIKA 4NAQA 5FYKL 5B1BB 5TQ0H 3UG5A 3S97C 3VMAA 5BS0D 5CBNA 2OZ4L 4XODA 2XBTA 3PWJA 1S7RB 3CZUB 2EQDA 3L74J 4YK4C 4F7CA 2A2QT 3T09A 4MNGE 5C9JA 2M8RA 2YMKA 1EAJA 3AY2A 2VLMD 2WNKA 5C08A 1L6XA 5I1CH 1JNJA 3UZVA 2MOQA 5C07E 4H8HA 1ZHLB 2KS0A 1RZFH 4F1SA 5I5JA 3ARUA 3RUGF 2EECA 1RE4A 2K7PA 3HC3L 3OKMA 4ORGB 5FCSH 2LABA 3AM8C 1ZRTD 4LVOB 3ZMEA 3TTSA 4YXWH 5G5DA 2O01J 5IB5A 2NPSA 5T3XD 1NC4B 4G7YH 2DWXA 3OB8A 3F58H 4RJTA 3HPLB 2R1XB 4PJAF 1Z9OA 2X2IA 3WNKA 3KZIE 3LIDA 1FNSL 4HLZG 1ZLLA 4GNKB 1SQBK 5IKCB 1TVDA 2JDIH 3SE3C 3B2MA 3QJQB 4XP6L 5LBSH 3ZTJH 1V3LA 2OA9A 4CSSA 5FC9A 1JZ2A 4NUQA 2X7LB 1C9SA 1WA0X 5JZ7D 3RI5F 4NYLB 3AE2C 2NX5E 1EDLA 4M6NH 1U2CA 4CW1A 3EUUA 3BVHA 1IBYA 4IL6E 1KULA 1Z5YD 3B7SA 2E76B 2R2HA 4UIMA 4X5PA 5DUBB 5FUCC 1LTGC 4XMLH 3X11A 1RURL 4NQEA 3V5DA 5HHOB 4KWUA 2BIIA 1F6AA 3BQUB 2IALA 2A45G 2IANE 2OW6A 3JTTB 4J4PD 5E5RB 3HE6C 5AL8A 4BFEA 4JR9H 4PPTA 4Z78B 5C0BE 3R7RA 1FJKA 3MBWB 4FN0A 4KJQD 2BK8A 3ZT6A 2P43B 1NIEA 1QZ1A 2F1EA 2P24B 3IJHA 4JFFA 1SFCD 3EZ8A 3L7EA 5DMIH 1TETH 5ELIA 4LOVA 4PCKA 1FZCB 3H1JE 3RGBA 1S1CX 3SFDC 1I9RL 1IKNC 1KEML 3DETD 1DJXA 5E9DA 3QIBA 2L7QA 2GBUA 4HFUL 5IIEB 3CCLP 1AIZA 2BIMA 1A3QA 1DFBL 2XNAA 2Z31C 1NL0H 1N7SB 5INCB 3V6FA 1XH3B 3SE4C 2DQTH 4MQXC 5T5NF 3OLEA 4U05A 3FT9A 4OF7A 3IT8D 1LP9F 3TFKC 3B7TA 1H8OA 4HC1L 1N5AA 1XEDA 3CDZA 2HVJB 1N59A 1BREA 3GZPA 3BUPA 3LZOA 1RUQH 1LP1B 1EXJA 1IT9L 3P1VA 3NPZB 2MKWA 4IOFD 2MCG1 1OCWH 3EW3B 2NCEA 2VDKB 2Y07L 3UMNA 1MZYA 3VWKB 2EC8A 4ZO8A 3UJJL 1VACB 1RQUA 1HE8A 1UKQA 2V6HA 3TA3A 5JPNC 4FCAA 5HDOA 5IMOB 3DBSA 5DJDB 1FORL 2N7SA 3BP6B 4ISVA 3JVGC 4FULA 2Q6WB 1V7MH 1KV7A 2WY3B 4KI5D 2VUKA 4AITA 1YQ2A 1D5MB 2P5PA 3GMLB 5HGDB 2B14A 5GS3A 3BCCJ 3EXJA 4ZO9A 1JGLL 4ZQKA 4I0PD 1E2VA 3WD5H 1IC5H 3BH9B 2WQYC 1X5AA 1KYOD 3BASA 4AQRD 1K9MQ 2TRYA 1ETZA 1NUFA 2VISA 5DD6B 2ZX8A 3WNNA 1T2JA 1HEHC 4PCYA 4AYCA 3EO0B 3QNXB 4LOFA 2ZOKB 4N0YL 1UOVA 3QQ4B 3L1OH 1IJDB 3MRDA 5K33A 2CK0H 1IGML 1J2JB 2RGSA 2A6KA 4UAOB 2JSFA 3FQXA 1NSNL 3UYOD 3I6KA 2VJ0A 2ZXAA 3OAYH 3SKNB 2WIIA 3TCLB 3VI3F 4I4WA 4I5BA 3TT3L 2AQ2A 1I3UA 1MKFA 4DT0A 3GSNB 3V4VA 4OLXL 1ZT1A 1JYNA 4FADA 1K5NA 5F1SA 1AA0A 1T4KB 2XKNA 3Q5TA 4P5TB 3KG5A 1ZKAA 3OKKA 3L9RB 4G11A 5HVWA 2CCWA 4HWBA 2O1AA 1VPOL 4QAWA 3AECC 4XCEB 1NEPA 3UZEA 1CL7I 4EN3D 1SFCC 2Y06H 1BF2A 1LDPL 4WEBL 4CPGA 2EH7L 2VLJE 3V2RA 5TTRA 4H7VA 1JHKL 1BMWA 2DIAA 3OF6A 4BM7A 3A6CL 4OLZL 2IYOA 4H25A 5SV4A 1WFUA 4LLHA 4KKLD 3OJVC 5KBMA 1IBFA 4P2CG 1TQBC 1IBGL 4X6DE 5DEZA 2KIKA 1HHKB 3U0TB 2XSKA 3CJJA 5JW4R 3QCTH 1L0LD 5EC2B 1SFDA 3V4PA 3FQUB 1RZGB 1KBWA 3E6FA 1CI5A 3T08A 1J88A 3MLSH 4O02A 4MASA 2HKHL 5FM5M 4A2EA 3FDWA 1JHLH 3LEYL 4YHOL 2NYYD 4LLWA 2E59A 4IDJL 4LLVB 5E1GA 4BFOA 1TNNA 1A1MA 2V7HA 3P11H 1LO2H 2YARA 2IPPA 3C6SB 2QR0A 3P4MA 3PAUA 4GAYB 5ADOL 2D2CD 4P2RD 2DTMH 4EUPA 4NQXB 4CSPA 4G8FB 4H5SA 3DHUA 2QRXA 4JDTH 4R90H 1YQ3C 1MFUA 3B9DA 3CC5B 2XJLA 4NIYE 4XCCL 4PD4H 5AAWC 4APXB 4BA0A 1QVGO 3DTXB 4NN7C 5KVGH 2Z92B 1WBYB 4KI5C 3ZE2E 1HHHB 1KYUA 2EILB 2CLZB 3SDDD 2PCXA 4FQXD 5GRJL 1QI4A 4IKJA 3OKDB 2VDQH 3ILEA 1VB9A 3U36B 2OYPA 2YJQA 2IMNA 1LK3L 3C5ZD 2C9UA 1ZPLA 2Y0SA 4R2GD 2WWWA 1J0HA 3VXRB 2ZAIA 4Y4KA 2XWJB 3R18A 3G6DH 5T1MA 3N1PC 1P4BL 4M7ZC 3BSGA 5D4QA 3H1KD 2OQJB 4MB1A 4OGQD 1RULH 5IB3B 5KYYB 2YAQA 2VR7A 1LT1A 1DQLH 3D2UB 3FJTA 3TCTA 3U4BL 5DQ9A 4RWYL 3AAZA 3W68A 5SWZD 1CXIA 1S72P 3MOBL 4NKDA 1WICA 5C0GA 3HS0A 4H8PA 4MCYA 5DUPL 1YBKA 3ILPA 2OM5A 5T3XH 3VFTB 4JO4L 3H7BB 5G55A 4FNTA 1B4TA 5ACZB 4LL4A 4HZAA 43CAA 2IV9A 2YD8A 3RFZC 4BFNA 4C54A 3DROB 3RAJL 1E2WA 1JWSA 3CXDH 3MN8A 2AEFA 1FZMB 5FA4A 1UOWA 3REWB 1HHIB 3WJMB 3KEDA 3MODL 1PTZA 4XE5B 1E9QA 4I3SL 4XPBL 1XCWA 4ICWA 5IY5B 3HTLX 5JXAH 1HQRB 2VB5A 4LCCB 5AQ0A 3S3BB 4KKLC 1RK1A 2Y25A 4PJDA 4B9PA 3QS3A 4MAUL 3T5WA 3UROR 4G7QB 2YQ3A 4M62H 4OCMC 4KUCD 4C47A 2HG5A 1XGTB 2VLLB 4QRRE 5C7XH 2IXQA 1CICD 4R5TA 3B1UA 2DQDL 5KAIH 1KCKA 5K9QI 1DQML 2VDRL 2XBZA 32C2B 5L6YH 5D8JL 1A9VA 5J12C 2NYYC 1O6TA 1QSFA 5A16A 4MMZC 4E9LA 4FZ8H 2FL5B 4AKQA 4MVBD 1RUML 4MMYB 4OZFB 4Z95H 4W9CC 3NABH 5IVXA 3MRHB 2N1TE 3HE7A 3ZSSA 2AXJA 2C5DC 2EYTA 1AXSB 1TZ8A 5IESH 4EOWL 1P4UA 1OAJA 4P04A 3GS0A 4FQXC 3QG7L 1AR1D 3LXUX 3S35H 1T03H 2G2PA 1JS4A 4ZX6A 2Q7YA 1L4AB 3F7RA 4JPWL 1UGKA 4TPRH 4CA4A 1UENA 3SDCA 5TE4H 1TVHB 2WQUA 3NQKA 3F7YB 3GZQA 4FQCH 4R2GC 1HQ4A 1NCHA 2FYZA 1AQDA 3AY4A 4BK5C 1WCBB 2APWA 2C7FA 2ZUUA 2G3ZA