2YO3A

Salmonella enterica sada 1185-1386 fused to gcn4 adaptors (sadak14)
Total Genus 80
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
80
sequence length
257
structure length
257
Chain Sequence
KQIEDKIEEILSKIYHIENEIARIKKLIKVTDAQVSRNTQSITNLNTQVSNLDTRVTNIENGIGDIVTTGSTKYFKTNTDGADANAQGADSVAIGSGSIAAAENSVALGTNSVADEANTVSVGSSTQQRRITNVAAGVNNTDAVNVAQLKASEAGSVRYETNADGSVNYSVLNLGDGSGGTTRIGNVSAAVNDTDAVNYAQLKRSVEEANTYTDQKMGEMNSKIKGVENKMKQIEDKIEEILSKIYHIENEIARIKK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords GENERAL CONTROL PROTEIN GCN4, PUTATIVE INNER MEMBRANE PROTEI
publication title Complete Fiber Structures of Complex Trimeric Autotransporter Adhesins Conserved in Enterobacteria.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 80
structure length 257
sequence length 257
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2012-10-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05658 YadA_head Head domain of trimeric autotransporter adhesin
A PF05662 YadA_stalk Coiled stalk of trimeric autotransporter adhesin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2yo3A01
2.60.40.4050 Mainly Beta Sandwich Immunoglobulin-like Immunoglobulin-like 2yo3A02
4B86A 1HBWA 4I2LC 1CI6B 5APTA 2ZFCA 5AW0B 1OXZA 1S9KE 2R5BA 5AW7B 2XZRA 4DZOA 3TNUB 4JYCA 1HUCA 4C46A 3P7KA 3UIAA 5APSA 3TK1A 1T2KC 2H7HA 5CMZA 3KDPB 1A02F 4EOTA 2IPPA 4XE5B 2C9LY 3M9BA 3T97A 1MV8A 3NFQA 3VMYA 2YO2A 4AUWA 3A5TA 3MD0A 3VYIA 2E43A 5APUA 1GK6A 5APYA 1H89A 4JYBA 3HTKA 3VTPC 3VMXA 3M06A 3I5CA 2JJLA 3L36A 1GTWA 5APVA 2P67A 2YNYA 2W27A 4C7NB 3OAKA 2W6AA 4M3LA 1CSBA 4GKGA 4HYTB 3O8ZA 3V4QA 3V4WA 1SLQA 3A3YB 2P2UA 2WT7B 1H88A 2XU6A 3HE5B 3VMZA 1S9KD 1JNMA 1G2CB 1CI6A 2QM8A 1FAVA 3L35A 3P8MC 2WWWA 1NWQA 1IO4A 1GU5A 3M9HA 1FOSF 3LIEA 2E42A 3V5BA 5AW1B 1MFZA 2Q7CA 1GD2E 2Q3IA 2BASA 5APWA 2R5DA 1GK4A 2KP8A 2WPSA 3HE4B 3M0AA 4KHXA 2QM7A 3P32A 2Q5UA 5AW6B 1GU4A 1MUUA 1NAFA 5AVTB 3LIDA 4I6MC 3A2AA 2N9BA 1HJBA 1A02J 3A7OA 1X8YA 5AVVB 3L37A 5AVQB 2VRSA 1FOSE 5AW8B 2P7JA 5AVWB 1DH3A 2WPRA 1KQLA 5AVSB 3NXSA 1T2KD 2WTYA 1CZQA 1SP4A 3MGNA 5APXA 5AW3B 4AQRD 5AVRB 3TNUA 1JUNA 5AW2B 5APQA 2WT7A 5AVXB 3HE5A 5AVZB 3M91A 5AVYB 2YO3A 1H8AA 2Z5HA 3NTNA 5AVUB 1OWAA 4LC1A 2ZXEB 2R32A 3TYYA 1HWTC 3SWFA 3IR9A 3NMDA 3HE4A 3VN0A 3KQGA 1J2JB 2XV5A 3M0DA 4GT1A 1GZLA 2R3CA 2WPQA 4RESB 3B8EB 5AW9B 2C9NY 4AYCA 5AW5B 4C7NA 2Z5IA 5AW4B 1YYCA
chains in the Genus database with same CATH superfamily
4N6RA 3THMH 1PG7W 3BRDA 2FEDD 1FZOA 5C92A 2QDWA 4TULL 1C5BL 2ZFCA 1R4XA 2WMPB 3FYEB 2BEZF 1P9MC 5I1AB 1T04B 3BN9D 3BO8A 5BMFH 3KLDA 5GGTH 4WK4B 4DNLA 1EWHA 1S9YA 5I1GH 4QAMB 4YJZL 4S1DD 1J5IA 4PV9B 2CK0L 2KMWA 2DWEA 1J8KA 2WXQA 2I9TB 1PKQA 5MENE 3TV8A 3WUWG 5F7KC 3S4SA 4X4MA 1C5CH 1LO3H 1OW8A 1LJ2A 3BSZL 3FBQA 3LH9A 3Q1SH 2CLVB 4NNYA 4HCRA 3MLZL 2FE0A 2WSFH 4UU9B 5C0GA 1QBLL 1QKZL 3ORJA 4L5FE 2CKBA 4Y2DD 1IGJB 1XH3B 5AYUL 5K1VA 1V54B 5J12C 1PX3A 4UB8H 5BRPA 1R3KA 2BOCA 1B4LA 1JF5A 2WNKA 1KELH 4UMSA 1LT1A 3LS5L 2H6PB 2O5XL 4J5VA 5ICYA 4WLCA 1XBRA 1SXZA 1YPZA 2OSYA 2WWOA 4N28A 4W6XB 3SDDA 1LLAA 4B9KC 4QRPB 4P5RA 3OBAA 1QG3A 4UNVA 4RGOL 1DCLA 3TFKD 3MLSL 5KJRH 3EF4A 4GRWB 1IFPA 3HG1B 3IU4H 3GIVA 4JVUA 2R9HC 1GCYA 2GW5A 4QOKD 2AEQL 3MJ7B 3PS6A 4LOEA 3AVEA 1M1JA 2ZT9C 4KHXA 1QYGL 3PAVA 4IGBC 4YXLH 4KJPC 3UCQA 4F20A 1NCDH 4H44B 1BVKB 3MNWB 5JIMA 1BYNA 2COQA 1WS7A 1SVCP 4UUJB 1LTGC 4QTHA 1KLGA 2B87B 4KX8A 1II4E 3CX5J 2H1XA 1CGVA 3FSZA 3B3IB 3GS0A 1IBZA 4KKAC 3S3CB 4U7JA 3FTGA 3KYQA 1YYML 3FF8A 5AVWB 4KROB 2UYLB 3OPUA 4ZXBC 5I8CB 3CNKA 4N8UA 3FTXA 3UJIH 1A6AA 4P2RE 1RHHA 2OYIB 1F56A 4YSSA 1J8HA 1GZHC 1E6JL 5CBOA 2C9UA 2WVUA 4P46D 3MXWL 1P5UC 1JHKL 4OCMC 3W56A 3OKDA 4JO4H 3FH5A 3G6JE 1QHQA 3LN4B 1QSED 3QJHB 7PCYA 5FEBA 4KUCD 1E2VA 1P4IH 2W07A 3A0HH 4W6YB 2NTFB 2P8MA 1VCAA 3QUMB 4X6CA 1YQ4C 2ICEC 1NO4A 2Q1KA 3VN0A 2P5PA 2A9AA 2BNQE 1RY3A 5TE6L 3SBPA 1H8LA 3NP4A 2XG4A 3Q6GL 1F1AA 4K5PA 1NGQL 1QA9A 2IIJA 3LIZL 3CWBJ 1M2VA 1DANT 2VLLB 4N26A 3R4DA 4WTQA 2XA8H 4CADB 5CSZB 1J1EB 2UZPA 2YPKB 3F01A 2CA3A 3QEQD 4K73A 4FX5A 2DQIL 2AJYL 4ZO7A 4NS0A 5J11C 4DKFL 5JW3H 1RMFH 1N8ZB 3QRFM 4ERSH 5B21A 3QUZC 2OI9B 1NAYA 2RA1A 4DZ8A 4MD4B 1IL1B 5HBBA 4NO3B 1FJ1A 2FJHA 2X0VA 25C8H 2ZXWB 4LCVA 5I1DB 4JJ5A 3FJTA 4XVSH 5IJBC 5APSA 1KYFA 3GBML 1DJGA 1JL8A 1NVOA 2WO2B 2HJFA 2Z91B 4LGDE 2AK4D 5JUEH 3OJ2C 2UZXB 4A68A 3JT2A 4ES8A 1SQXJ 4LRIC 2L91A 4OGYL 5HVHB 1AD0A 3GI8H 4JM2C 5IMKB 4N8CH 5IHWA 3BKML 5CBEA 3H1KD 4JN2A 4Z95L 2KSJA 4NNXB 2BDNH 1PF3A 1GW4A 1M8OB 1IK7A 2P5ED 2VWEE 1RIHL 1J9SA 1DCEA 5AOJA 1QUNB 1U91B 4BQ6A 3ZYOA 3D4ZA 2G3MA 4WEBH 2IH3A 4LSUL 3F6JA 5AEAA 2JKVA 1RF1A 1I1YB 1CR9H 4I5BB 1QSFE 3PFQA 1X5GA 2CALA 4NGHH 3MGOB 5BRZD 3TO2A 1ZHKA 3WYRA 2DN7A 1HH9A 4KZEH 2WNGA 3L9RB 2F7QA 5F6IC 4E41E 4LDEB 1JNLL 1RFDH 1DQJB 3SCMA 3MLRL 1LYQA 4JHUA 2NY2D 3RVUC 1CF1A 1ICTA 3LY6A 4RZKA 4PMFA 1F1GA 3IKCB 4X9HA 4FFYL 3GEFA 3FO2B 3S35X 1A9EB 2OQJA 4FTVE 2DF3A 1EAOA 4MZ3A 1OFCX 4BFNA 1H0TB 3FUEA 4XCEA 4AEHL 3NJGA 4F93B 5I16A 1JZ4A 4JE4B 4GI8A 1P84J 1FOSE 1A6WL 4MNQB 1JZJA 3VXSE 2IWGA 4HA1A 2HWZL 5GZNA 2PXYD 3UIZA 1NTMD 1ZSDA 4Z5RA 1BG1A 5I0VA 4PJ9C 3UAJA 2AZAA 4DGUA 2Q20A 1B0RB 3QIUC 1VDGA 5KLIC 3AMLA 4IS6A 2YIHA 1IM3D 1M7IA 4HUXB 4X5XA 3ZTDC 1I7TA 3F84A 5GZOA 3A4EA 1JZHA 4QTIH 5IF0B 2GA1A 2A45I 1CO1A 4O9HH 3D30A 2BHUA 1R3LB 4KKBC 1S9KC 2OM5A 2TAAA 1YYLL 4AQ8A 5DK0B 4F2ME 4QKXB 3Q6FA 3ATEA 4NFCA 5CIPH 5IR1A 1J5OH 2ZCZA 4E9RA 3CHOA 2VXVL 1MREH 1A9BB 4AQ1B 4YHKL 2WMMA 4IK6A 5ICZA 5GRXG 5TQ2H 4Z0BL 4RMVA 2BP3A 3DPBB 3RWDB 4JREB 4MAYA 4YC2B 1F3DJ 5MP6H 4GUOA 1C8PA 2F54E 2ZG2A 1Q1PA 35C8H 4OUOA 4HKZB 2BP5M 4MKMA 1E8YA 3CFEA 4ODTH 1T1YA 2SEBB 3B5NA 4UQ3B 5I0DA 2DRUA 2VH5L 5LWYL 2EILB 1UASA 2XVLA 5CMZA 1PX4A 2A83B 1AA0A 1NEUA 1T66D 1UWGL 2N7BA 4QXUL 3B9KA 3V4VL 3SDDD 4MA1B 2HP4A 4HHAA 1HF9A 4JZJA 2NQ3A 4OLUH 3O2DL 4BZ2L 5IFHL 4WENB 2XX1A 1H89A 3LHAA 4DP1X 1CE1H 2I60H 4M7ZC 4BA8A 1DJZA 4UTCA 4WEMB 1OGAD 3QO1A 5DVPA 3VMOA 1X9UA 4NZ8A 2BVUA 1U4EA 2EDQA 3VDCA 3ZE1F 1FRGL 4RRPG 5TJHA 1QI5A 1BJ1J 4LKCA 2R4SL 4MD5B 4M00A 1NTKD 5T1KA 1LNUA 4LBEA 1BMZA 1J87A 3HAEB 3WJLC 3DVGA 3T04D 5DI8A 2NUPA 1YNKL 3VFVA 1THCA 2OTUA 4P05A 3VFOA 5KN5B 3RK2C 3AXHA 4ZW5A 5J6GB 3E2HB 1PS3A 4G9FA 3CX5I 5IG7A 1E43A 1WT5C 4PI0A 5CJOL 5IK3B 2QM7A 3KEHA 1U92B 2NXYD 2CXGA 4A6YA 3UGEA 3KYAA 2OMXA 4I6MC 2FK9A 3LPPA 2A3TA 3OKNB 4LK4A 2NOYA 5HI5D 1BQLL 2XXMB 5T5NG 2FIKB 4OZFH 4W9FC 3IN0A 1X79B 1SBSH 4WFED 4OFKA 4QHPA 1T6VN 4DGVH 3BEWA 3INUH 3LZFL 1EGJH 4PWEA 4FABH 5B3JE 1ZHBB 1XF4B 2VDKL 4Y16A 4W7YA 1T2JA 1A6TB 4YXKL 3SYOA 5LNDA 3BGMA 5I2IA 1A6VL 7TAAA 5HDBE 2CXKA 3ZBMA 1PJ9A 5ELIA 1SJEA 1SF5A 4YUEH 3V8OA 2FYUJ 1S5IH 4Q7DA 5TGBB 1PGOA 1QSVA 3G04B 4GSRA 4RDQG 4I3SL 3GSXA 3Q8BA 2XWRA 5IKCB 5EA0L 4MA8H 2RGSA 2FD6H 2NNAA 1S5HA 1RE3C 3NJIA 1VZHA 4J6RL 2I1KA 2JXMB 4NENA 4UCFA 5GGVY 3MRQA 3O3AA 1G6RH 2WZPA 5F7FA 5L4FA 2NXZC 4FG0A 5FM4A 3ZGHA 1FO0H 1BFOA 1T1WA 4M43H 4UV4L 4WIQA 4GRLC 5J6HA 5CCHC 1E6OL 1TEGA 5DC4B 1BX2A 3IGAA 4XHQA 2HKHH 3SDAD 4CC1A 3O11B 3AM8C 1RZJH 2VXQH 1P1ZB 4HK3N 5HDOA 5KVEH 1DVFD 4FFZA 2QMJA 4PRPE 5DVKA 5LG1A 1CLVA 3TN0D 2N1TA 2HT2D 5CD5D 4BH8B 1LE5A 4LSRL 5HI4C 3OB0H 1OP3H 4GRWF 5DGRA 1HJ0A 3HB3C 4F15B 5EBMB 1KENH 1PFOA 3UZVB 4BH7A 3HVDA 3A22A 2A74C 1H6FA 2CCWA 2HT3D 4M6AA 4EUPB 2AAVA 1MLBA 2F15A 4G7YL 5FK9A 4L0ZA 5E8DH 1NCCL 2A9MH 5KOMC 2YN5A 3I9GH 3PAUA 5F9DC 4ENZA 3FQWB 4FQXC 4L1LA 2OQQA 3DMMB 3WTXA 4G43B 2VDPB 2MCPH 5J89A 3Q06A 3L73J 5I1IL 3ZL4H 2N4IA 2WXLA 1EBAA 4G3YH 2QKSA 4PRAB 1YEKL 3C8KA 1V7NH 3CX5K 2ZKYA 4L8DB 1BZOA 2QKIB 1TZIA 3NH7H 4AYMC 4NAQA 3KLLA 3WUWA 1BCCG 3KVPA 2L3BA 3FU9A 3HIZA 2A9BA 5GS0H 1AZVA 3ARUA 2QVFB 2WMPA 3M1BB 1OP5K 5I1AA 3K5BA 1T04A 1HTYA 3N1QC 3TT3H 2IH1B 3L2MA 2WCSA 5SX4I 2I07B 5DD1H 1P84I 4G8AC 4LFHD 4PV1B 4PV9A 1VKXB 3UAJD 2I9TA 2F74B 2YUVA 2ZCKH 5KLVE 4G2AA 4OBRA 1JWMB 1URQB 5I73C 2UWEF 3O0LA 4ZSOE 1GW0A 3SN6N 4C56E 4PJBB 1Y18A 3RBZA 4NB7A 4XN8A 3S3SA 2CLVA 2YOAA 1NCWH 2IDCA 2AXFB 4KPHH 4UU9A 5IT2L 3DVNB 2GJJA 3IBOA 4KK5D 1IGJA 1XH3A 3BRTB 3FQNB 2XI9A 1JVLA 4UANA 2FL5A 1KCRL 1A6UL 1OTTD 4AT6B 2F2HA 3TEZA 3BUBA 3NCCB 2JELH 4FQIH 4LNVA 5B1KA 1QFUH 4R7VA 5D7KE 3GXIA 1TQSA 2KNCA 1KTDB 4WTZG 4WI5A 1HGZA 2XYBA 3P9WB 3OKKB 3CHPA 5CGTA 1AS7A 5D1XD 4OT1L 4BWTA 4LVHB 3FUJA 1IGIL 1FF5A 1PG7H 5DYFA 3A6BL 3M46A 4RQQB 1HH6B 4XPGL 3Q3GB 4L8CB 1UJ3B 3MJ7A 4NNPL 4W1TA 4HIJA 2UUDH 2PWDA 2NZ9D 1BVKA 3MNWA 4WFFD 4UB6H 5CZVH 2BVYA 3WLBB 1U2YA 4UUJA 3P0GB 4GKLA 4Y19D 3B9KD 4KXAA 2PW1B 3LQMA 5A2FA 1NSNH 3OR7B 1W91A 3B3IA 3K8MA 3W68A 3MV9D 3BX7C 3FHAA 2GBAA 2UYLA 4G6AC 4LPWA 1XB6A 6FABL 5FW6A 3F89A 1U8QB 1U8OA 3UO8B 1AQ8A 4N9GB 3V6FA 2OYIA 1DD4A 2N01B 1YEHL 4PHZA 1R0AH 1EDIA 1MWAL 5AYTA 4AITA 2FT7A 3LZRA 5IB5B 5T1KD 2VC2L 3FWNA 4LQFH 1JPEA 5JOPD 5ALBH 3LN4A 1I8KA 5TDOB 3QJHA 5DJUB 4OGQB 4MJHA 3JZ7A 1VQOP 2NTFA 3P4LA 3QUXC 2OP4L 3UTSD 1UWXH 3EJUA 1F6LL 2VDQL 2UWEA 3SQOH 5FYLH 1JDAA 1P7HL 4P48A 5CP3H 1A1NB 2C9XA 2RQEA 4APQC 2Z31D 1ET5A 2F53B 3DX1A 3QCUL 5CFAA 1OCRB 4IRSC 2VLLA 5C8JA 3Q5PA 1P84K 4CADA 5CSZA 1SY6H 3VXMB 4UZUA 3QAZB 5L6YL 3STLA 5E08L 1QPPA 4L76A 4DSYA 1EDJA 1JNNH 5FDWA 1XR8B 2LLGA 3GHEH 5LDSA 1NWOA 2IEPA 4TLFA 2FEEI 2YXVA 4WO4D 1FSKC 4MD4A 1IL1A 2QT6A 1G0YR 3RWHA 4NO3A 3L5XH 4FMVA 1LDPH 3QDMB 2ZKHL 1P5VB 3EZ8A 2Z92B 4P5TB 5FYKD 3ZQWA 2YPVA 3B37A 5E0FA 1J05B 4F24A 3WY4A 2Z91A 4MFHA 2UZXA 3GWJA 4TNWK 4XZUB 4OZHB 3A2AA 2BSTB 4HIHB 2IZ0A 5I8KH 1XDTT 4XVUD 2X12A 1YHQP 3JVGA 5DYOB 5IMKA 4N78D 1CGYA 3MCLL 3C1LA 3K2KA 3SY0B 3H9SE 2E59A 1QUNA 1W9XA 4U2ZA 1U91A 3EJZC 4KVPA 4KQ3L 4XN5A 2WANA 1CQYA 2WZPD 1KJMB 5I18H 2ED9A 2J1ZA 1QR1B 3AFLA 1FGNL 2K88A 4I5BA 1L6PA 1WZAA 3POCA 3KPQB 4AGOA 1KN4H 1MIMH 1RZIB 2W0KA 3MGOA 1KCUL 1L0PA 3NJXA 3L9RA 3MZTA 4QDGA 4Z3HA 2XUWA 2DL9A 3BLBA 4IMKC 5EU3B 3QULB 1WIPA 5IFAL 4QRRB 4JFFB 3KQGA 3KL5A 2MRYA 3AITA 2V17L 4NKDB 4GQPH 4N0FB 3UMTA 3UPCA 3HI5H 3IKCA 3PU7A 4JQXA 2P26A 4ANKA 1TTFA 3FO2A 4HMEA 4WFGD 3L3GA 4G8IB 2L7QA 4DP7X 4NOBA 3OAWA 4RMTA 1YQVH 3QQNA 4N2NA 1L7IH 5LXGH 4P2OC 3WNLA 4MNQA 1LO4L 4KZ0A 1BGYE 2Y36H 2I32A 2O72A 1CUOA 1KXHA 3SGEI 3V0HA 5ES4B 1OHQA 2WXPA 1E4HA 3RLSA 3X3GH 3I74A 2ZUTA 1DZBA 1MJUL 4NPKA 3SE9H 3AXLB 4HUXA 2BIMA 2EECA 2HFEB 5IF0A 2DWYA 5KJ4A 1R3LA 3DJRA 4Y4FB 5FUCC 4MQ7A 1CE6A 1T20B 4B5EA 1L0LK 5LCVH 4NRYA 4YSDA 4QIRA 1EX0A 5DK0A 5JQHC 2C7UA 3LVTA 4P2QD 4JYBA 1A7NH 3BVUA 2VQUA 1M2OA 5FKPB 2WTOA 2XKUA 1OHZA 4KU1A 3GBDA 3GINA 2AJZB 1K72A 2O01H 4PD4E 2CIIA 4AQ1A 2C9QA 2QSTA 5EEUA 4EQ3A 3VG0H 1IEAB 1U8PB 4BFJA 4WNQB 4K8RC 3VMNA 5DZJA 1FFTB 3HI1A 3WEOA 5I0YA 4Q9RL 1G2CB 3DPBA 1NAMH 4HKXB 3RWDA 3FONB 2WWWA 4JN1H 3HOGA 4HIXH 4L23A 5ADPH 4WI0A 5F96L 3DSFL 4N2HA 4ZO8A 5JXEC 2QSQA 2SEBA 5INDB 4UQ3A 1GL2A 4XI5C 4WBAA 1ACCA 2X70B 4LAQH 4GIAA 2A83A 4NN6C 4Y9CA 4RRPA 4GAFB 2FYNB 3P73B 1INEL 4QRPD 1MCKA 3PY9A 2KI7B 2X40A 5AVQB 3MFFB 1QFHA 1DVYA 4B41A 3HG1D 5CGYD 2O61B 1UWEL 2ZNXA 3EDJA 5EIQA 2M5AB 5I0XA 1MNUL 3ULUC 2FQEA 2VTFA 1OLZA 2FWLB 2KZJA 1UD3A 2DQDL 3QZLA 1LP9B 5IVZB 2AP2A 3H2WA 3TH2T 4L4VB 3TV3L 1PY9A 2Y7MA 3RIFF 1ZVNA 4M5ZH 4I48B 5D7SH 1YN7A 1DEDA 5L4IA 4N0CC 1U93B 4HWZB 3HAEA 3GTTA 4XN4A 3RWFB 1PYWB 2C3WA 1EFXD 2CHWA 4NIKB 5TFSH 3CGTA 4FI7A 2F5AH 2BW5A 2ZYIA 5KN5A 1NMAL 2ADIB 5DURD 1N6QL 1K73Q 4XCFH 4TNWF 5C0NC 1IILE 5DEZA 3VCLB 3CC7P 3NN8A 4P5SA 3UPRB 5IK3A 3VGEA 1U92A 5DQDH 3OJMB 1GKEA 4LGPB 5GGTL 3OKNA 2KQNA 2FIKA 2VDOB 2BIQA 2JQAA 3E9UA 3K46A 3F64A 4I85A 4K94L 1ZHBA 2ZUSA 1XF4A 1A6TA 3VYPA 1FZKB 5AG9A 1CTOA 1VENA 1FZEA 3B71A 5DMGD 1AI1H 1GW3A 3RIKA 4R4LA 4NQCB 1BPLB 5CZXC 4PUBL 5TGBA 1FH5L 1SQ2N 4I3RL 3D0AA 2WXNA 1MCWM 2A9NH 3G04A 3KCWA 2R23B 5FDYA 4Z76A 1HEZB 1H0DB 1NKNA 3X14B 1UZGA 3PP3K 1PQZA 4PJBF 5IKCA 1BVOA 5A6MA 2DLGA 4Y5XA 3PGFH 2IJ0C 3WIAA 2R0KH 1PZ2A 1ZPLA 3WO4C 4M5TA 4N20A 4UV7H 1S7SB 4UIKH 1CZ8L 1YCSA 4LOUC 3WXVH 5F71A 3O4LA 5DQ9A 3TDKA 1V7MH 3ZT7A 5CWSB 5AB9A 4J28A 1ASQA 1QL2A 1FZMB 5DXWA 2J8OA 4ACPA 5J3HD 3O11A 5C0CA 4E9XA 1QMUA 4NQDD 2ZAHA 4ANUA 4EXPX 4A7PA 3KGUA 3QHZL 1BHGA 2B3IA 2OTPA 4BH8A 1QSEE 5GJSL 3MRKB 4XC1H 1KGUA 2ENJA 1F8TH 5EBMA 4W4NA 3UZVA 4N0UB 2QEXP 2ADFL 1HHHB 3TZVB 3GMOB 4IRJD 5EO0B 2A1WH 3HBGA 3HBQA 3H6AA 5GS2D 4BXSV 4EUPA 3C5ZB 3UJIL 2HA1A 4ONGL 3OB8A 4UB0L 3CU1A 4PI2A 2XETA 2G30A 3B2VH 4HEMA 4G72B 2CJUH 3FQWA 3KWUA 4YDKL 2VZOA 5KYUB 1N5YH 3G6EP 2J12B 3DMMA 4G43A 4ETQA 3QEQE 1Z1WA 1OGPA 5D1QD 4JO4L 4TS6A 4GBXA 4XTRD 3CN4A 4PRAA 3CLQA 2Z64C 4FXKC 1KTMA 1SQVK 3H1KG 3QFJB 4L8DA 4E9TA 2QKIA 4XB7A 1A3LH 4OVNF 4XBEH 3CZSA 1XCWA 4MNQD 3RL0g 2Z34A 2FYVA 3M1BA 5F0LB 3ZSSA 5FUOL 5HD8C 2H7WA 2IH1A 4YLBA 1B88A 4XMKH 1VERA 5D6DC 5D7LD 1CD8A 1S5LE 2OZ4H 3S9DB 1VKXA 2V7QH 3H1KE 2F74A 1EHLH 4GUQA 3T6VA 1BV8A 3U46B 1URQA 1KG0A 3LKRA 3AEEC 2P5EE 3GLAA 4XMWA 2VM9A 3S5YA 4PJBA 4K2UL 4ODSL 1XL4A 1RV6X 2V5YA 4WTZA 4AYSA 3UO1H 2AXFA 2ZXQA 3CFJA 1ZTXH 3DVNA 3V2QA 3GPEA 4JRYB 2C4XA 1BP3B 3FQNA 2BWQA 1XFPA 3Q9QA 1ZA3A 2QFRA 4Q4IA 4AT6A 4OD3H 4PLJD 3GI8L 4R9HA 2EEXA 4N8CL 2WGXA 1TF4A 2CGRL 4FMFA 3OF6D 3N1GC 4JKPH 3SGDI 1P7KA 1KTDA 1KGXA 1NC4D 3CX5D 3K4DA 5KSAD 3OKKA 1JY3N 3OKEB 3STBA 3EO9H 1CD0A 1K4CB 1RUKL 4RQQA 1HH6A 3QFGA 1W72H 4OZHF 4AL8C 4ZYKB 3DX7B 3O6FB 3Q3GA 1UJ3A 4K3EH 2G60L 1FNLA 4H26A 3WJMB 2WVVB 3U0TB 3PH0A 1HZLA 3DKHA 2GBTA 3FS9A 2DH3A 4N2KA 1RUPL 1NTME 3V4QA 1TTBA 2PPFA 3ARDB 1SLQA 5GXBB 2HFGH 1L7TL 3C6LB 3MHVA 1RFDL 4YNYB 3PWPB 3VTTA 2PW1A 4MNGB 2HB0A 1ZD6A 2J21A 3FRPB 3OR7A 1K05A 1GC1H 3D4CA 1KCLA 3ARGB 2W9LA 3IFLL 4M7JL 4Q74A 5DJCB 5E2WL 4AXWB 1DQML 3QDJB 3KHUA 3GLEA 3TGUG 1Z56A 1U8QA 1M1JC 4NAMA 4GQZA 4N9GA 3DOSB 4H0LD 5JW4Q 2YMXH 2RCSL 5FO8B 5B66E 1NLDH 3DBXB 1PVHA 1D7FA 5C0BD 4NQSB 4O00A 5IB5A 1R1CA 3MUGB 1R5SA 3RVTD 4R8WH 1TETL 4I7ZB 1V10A 3IXAB 4OF0A 1Q90D 4H8UA 4IJ3C 4YN3A 5DJ2B 3N4XA 3MNVA 5HHOB 1NMCC 1A5FH 2ED7A 5L2KA 4X4ME 1TEFA 2HODB 2V8MA 3NCMA 4N8PA 4AV5A 1JI1A 1A1NA 1Z3GH 1D9KD 2VMDA 3E9TA 5HXMA 5DFTA 1N5AB 3DUUB 1NBQA 2R7EB 3X1GA 5FFOA 2Z65C 3KPRB 5D2NB 3MV7A 1YNTB 3VXMA 4R90H 4QRQA 1UFUA 3BCCJ 5FW7A 1KGWA 5EEYA 5B8CB 1MREL 1XR8A 4R2GB 4NC0B 4QUOA 1YPZE 3LKSB 1VACB 3VI4B 3RI5F 3SE6A 3V0DA 1NTKG 1CC3A 1E65A 1R24B 2B7DT 3DX0A 3QDMA 1P5VA 4JKMA 1QNZH 4P5TA 1Q0YH 1J05A 1ROCA 3P0VH 5CP7B 1NTDA 1OGAE 1YHPA 1UD6A 1BW8A 1IC7L 4OZHA 1HDMB 4XZUA 3WEAA 1W5CE 3MLYH 3ZT5A 3V4VB 4P06A 2DW5A 1PNCA 1GYVA 2NX5B 5DYOA 4I77H 1YO4A 3B34A 1NTKE 3P4MB 2CD0A 3SY0A 4CA4A 3ESUF 3AS0A 2MPAH 4NQED 2NTSP 5DJYB 4QHLA 1QTSA 3BVDB 5E6UB 4JFOB 4JHWH 4OLUL 1KJMA 3RGBA 3ZKMC 1QR1A 1H3VA 2DYSB 4F2EA 1G9NH 4ZOCA 2CZNA 1UOKA 4KKNA 1PFIA 1ZK9A 3KPQA 1GJWA 3AQDA 3AY4A 1P84D 1RZIA 3NACH 4HSAC 3NFQA 4JY5L 5CZKA 1AXTL 4YGVB 3FN0H 5E6ID 3QYMA 2EXYD 3KE0A 5KTEL 4P23D 3RE0A 3OJAB 1S9VB 2R27A 4HJGH 3KDMA 4WFEE 3VTPC 5EU3A 4N1HB 2IWKA 4QRRA 4JFFA 4NKDA 4PU2A 4RA0C 2E75D 4N0FA 5IMMB 5BUAA 5KVDE 4MB1A 4TNVF 3ZX1A 1T83A 1RF1C 4G8IA 4EDXA 4GDOA 4Z7NB 1LP9F 2F1EA 3PLNA 2A9CA 3VWKD 4NQVA 1WG3A 1CDJA 2KZIA 3NQIA 1B0WA 4JVPA 2BEQD 4NO5B 1DBAH 5KW9L 4L74A 1QEWA 2BIIA 1AG6A 1X44A 5SWZB 2J6EA 3CCMP 4QO1B 1Q2NA 2VDKB 2CDFB 4QI3A 1XXDC 2X1QA 1UCBL 1LQBC 1J5DA 4DGVL 1VGEL 3AXLA 1EGJL 3BP7B 5FW8A 2QV4A 4HB1A 3LIDA 2HFEA 2YWZA 5L9DH 1T7WA 3EUUA 2VM4A 4Y4FA 1T20A 2X2IA 3NAAH 3L37A 2OR7A 4JRXB 2Y5QA 3V4LA 4NM4L 4H13B 4A2MA 1KOAA 4XPHL 3WHXB 2KSEA 4PV1D 2BNUB 3GNML 2AJZA 4K4KA 3O4OB 5GZOC 5EO1A 4NYLB 1X7QB 5F3HB 1JUNA 3QHTC 2VDNH 3QT2A 1NU1K 1IEAA 1U8PA 3C8DA 1BM7A 3LH8A 3S37L 1G2CA 1F2XK 4HKXA 5JXAL 2APXA 3FONA 4AQ8C 2E9GA 2EIJB 5DDHB 3UBFA 3EYSH 4F7TB 4E9QA 4KY1L 1FGVH 5INDA 2NCMA 3FCTB 3VXUB 1OKEA 4FHJA 2X70A 4WV1A 1TTRA 3SYQA 1N7SD 2Z3FA 4M48L 2PCFB 2AZUA 3GQFA 2VLMD 1BGXH 2EDNA 4AW4A 3HPLB 4MAYC 4N2IA 2XDJA 3GSOB 3MFFA 4YHIB 1XL6A 5F89B 5A3ID 4ZX3A 1Q7YQ 2O61A 4DAGH 2M5AA 2HG5B 3B5NC 1NJ9B 1PFCA 4GSDH 1LP9A 5IVZA 4F33B 1KTLA 5C0EB 2VJXA 3MYZA 5EZIL 2NPSB 4FTDA 1VEMA 3MCYA 3DGDA 4A7GF 5AB0A 1AZCA 4JFSA 2DPKA 1MXDA 2NT0A 4JZJC 2C4FU 2Y06H 4J4PD 4HWZA 5F1IB 3BAIA 3RWFA 4HDIB 1PYWA 4UQEA 4GODA 3S88L 1XSIA 2XKSA 4G3YL 2ODIA 2RKLA 1CXIA 2ADIA 3PWJB 4ESKA 1A7OL 1V7NL 2VQ1B 4ABUA 1TCRB 1OSEA 3SDXB 3UPRA 3L36A 1JHLH 3QA3B 5IEHB 2V5RA 4JCMA 3W37A 1NPJA 3WIFB 3HUSB 2JWDA 5KKZB 3FH8A 2LXCB 4X7FC 4QLRA 3QG7H 4UQCA 1VB9A 1N70A 1JXFA 5BW7A 2IGTA 4K7PY 3WHE1 3UP6A 1YDPB 1EUUA 3LPGA 1MIEH 3H6PA 1E0OB 1R75A 5LAXB 1IV8A 5GHWH 1FZKA 1BD2B 1BIHA 4M8UA 2ZQKA 2F53D 4U6TA 4B7LA 1P2CA 4ILDA 1WHOA 4NQCA 5SV4A 2FUQA 2VN4A 1DL7H 2Z1PA 4NZUH 4WFFE 5FF6B 1ED3B 2R23A 3EFFB 1VPCA 5K59F 3E7JA 3U1PA 3X14A 1X9VA 5CZRA 5IROD 4XPBL 3HD7B 3N6YA 4Y19E 3CN2A 3ECBB 3N0PB 4HS6B 1GKOA 3SBRA 3MV9E 1S7SA 3RDTB 3V6OA 2D4FA 3NDZE 3VD2A 2XTJD 1MOEA 3BSGA 1J1XL 2EZ0C 1J11A 1N0XL 3TA4D 3ZTJH 1V8HA 1ZIAA 4GB9A 3LNGA 2VXSL 4I1NB 4HLEA 3DV4B 3QR2A 3SO3B 2F7OA 3FSOA 3SPJA 5JOPE 2YZ1A 4A7GA 1N0LA 3NJLA 3MRKA 3N41B 4PJ7B 2FBOJ 4N0UA 5F3FA 3UTSE 3FFCB 3ULVD 3TZVA 3GMOA 5EO0A 2R29H 3SOBL 2VLJB 4YDIL 2QQNL 3C5ZA 1MWAB 4GW4B 1B3IA 1MDAA 4LSSL 4YWGL 3OV6A 5EEWA 5DWPA 2P44B 2VC2B 4Y2OB 3NUKA 3TJEH 4UNUA 3FB8B 4CRPA 5F9OL 5IIEA 1WTGT 5KYUA 3P11H 4ELMB 2CCVA 2N1TC 1R0AL 4HQQL 1Z0MA 1RULL 2PWEA 1XGYH 4PGBA 5AKRA 4JYCA 1TNMA 3CTTA 5G5DA 4F8OA 4X6DE 5CSBA 4H8HA 2BCKB 3ALWA 2ZPKH 3OGOE 4X6EB 3T1FA 1RZFL 3D25B 4QAWA 5DJ0B 5FYKE 3SQOL 2I26N 1QNIA 2H1PH 2ZKXA 3MROB 1E67A 3QRLA 4LMQE 4OF5A 5D7JD 3W11D 2O30A 4L05A 3H4FA 1M1XB 1TU3F 3HG4A 3WNJA 2Q7YB 3O6LH 4N78E 3K0WA 3QPQD 3TWCH 4EZLA 1JNNL 1FAIH 3U46A 2OK0H 3NCWA 5IJCC 3RX5A 3G5YB 3A4AA 1WCBA 3GZOA 2A77H 2R69A 1TYRA 3SBWA 2E5TA 4ZNCD 2J72A 4DCQA 4FHBD 1K2DA 4DKDC 3ULUH 2CUAA 4TUOB 4ABQA 4Y4FD 1MAML 3K5RA 1K04A 1YNTF 4JRYA 4DK3A 2C0XA 3MODL 3REVB 4F92B 4AJWA 4YE4H 2E27H 1E40A 3EH4B 3A6OA 3RKDC 2A99A 1GK4A 3UDWA 3VI4F 3AG2B 1MCSA 2W83C 4BUQA 3LCYA 1QZ1A 2X9ZA 4B95C 2D4DA 5E9NA 4H8QA 1SQVD 2WSFJ 3OKEA 1J1DB 4OD2B 4WFGE 4YHOH 5L88H 1HWWA 3GIZH 4F7KA 2QDVA 1RZGB 1AS8A 5C09B 1K4CA 3GM0A 4KJQC 4A38A 4ZYKA 1SN0A 3CUPB 3DX7A 3O6FA 1CW5A 2DQEL 3WJMA 1MIML 4OJDH 1G6VK 2WVVA 3L5IA 3U0TA 3RGUA 2W60B 3HZ3A 1DBMH 3JXAA 2P49B 2PR4L 2V37A 2GUYA 3CVHL 2FZ3B 2GSMB 4TNEA 3ARDA 4FNSA 5JW5B 2DQHH 3E0GA 1G1JA 5KZCD 1OF2B 4YNYA 3PWPA 4MNGA 5CU9A 3FRPA 5D4HA 1PAZA 4L4JA 4QPEA 1AVAA 1SVFA 3ARGA 5DJCA 2WTRB 3DIVA 3QDJA 1ZEAL 5I6NA 1YUKB 3OXSB 3QIBD 4JBZA 2EDXA 3DOSA 3HC4H 5FO8A 1T1ZB 1VF5C 3DBXA 3UYRL 2EH7L 2F1BA 1MCPH 2UY7B 3O8XD 3B5TA 4L4VD 4KUZH 4P2QE 3RPIB 3F5WB 1ET8A 4NQSA 2Y36L 4MQXD 2Y5EA 3DETD 1HN1A 3MUGA 2HTKD 3IXAA 5B39B 3X3GL 1AR1B 2B1AH 5DJ2A 5HHOA 4HEPG 2X4RA 1A0QL 1USEA 1TZAA 1TJGL 4IHBA 4KROC 4UAHA 3SE9L 4Z7NF 2ZWZA 1BYPA 5ABDE 4H88L 2VW7A 2HODA 1AG0A 7FABL 1DJHA 5DK2B 2OYIC 1E4XL 3EJYC 1HC1A 1KBVA 2M83A 2WSKA 3S5LB 1S5LH 4BUHA 4E9WA 1N5AA 2R7EA 4JO3H 1SXAA 1PD1A 3KPRA 5D2NA 2EACA 4LIQL 3M88A 1YNTA 1GA2A 3I6GA 2NY1B 3VFRB 2IF7A 3PLYA 2I9LA 5GTHH 4HPYH 5B8CA 1FIGL 3MRGA 2GG1A 3LKSA 3VI4A 4QRPE 1B2WH 3OWRA 2V9RA 3TT1L 4IMLB 3S5LG 4O5LL 1R24A 2A4EA 3K6NA 2XN2A 3HG1E 1U3HB 4ORGA 5FFLA 3L4UA 4GAGL 5CP7A 4ZTOH 4XHJC 2K9YA 3UL4A 1AQKL 1X7SA 1XGPA 3T4YB 1FORL 1OSPL 2OTWB 1HDMA 1H88A 2WLLB 1T6WA 1ECYA 4P99A 2NX5A 4FLQA 3P4MA 3KW7A 2DOCA 1F58H 2YGVA 5C1MB 1U30A 5DFVD 4BZ2A 3PJLA 3Q2WA 4H0HB 5DJYA 4X9FA 4AY0A 4BHUA 3A47A 1GD2E 2RMZA 1BZ8A 3N06B 4JFOA 1DEEG 1OZTG 5HHVH 4YOKA 2EEAA 3HE4B 4JQIL 1P4LB 1N12A 3NESA 2F5BL 2J2ZB 1T2QL 5AKSA 3L75J 3KL0A 1X9LA 2X6AA 3ZY7A 5HVHC 1VPOL 3QZWB 1KWKA 3JVGC 1CLOL 4LEOA 1ADQH 4EIJA 4YGVA 3MTUE 4FFWD 3ZU8A 3EOYG 4G42B 3ILQC 5H37A 1IAIH 4B3EA 3VP8A 2JKTM 5DRXB 5E95B 5IMMA 2IDQA 4KRMB 3VD5A 3VXRB 1T2KD 5DHMC 5EF0A 3L81A 3TZVD 1HI6A 3DA0A 4PS3A 1A64A 2CH8A 5DA0B 3ZTNH 4U33A 1CYXA 3ABKB 5E1AB 2XN0A 4BCZA 2WQUA 5IFJB 4NO5A 4AYBA 3MI6A 2BJML 5SWZA 4K3DL 4QO1A 4Y4HA 5FO7B 2CDFA 4HUWB 1RIUH 4HCRH 2GJ6B 4JQXC 5GTIH 3BATA 4C55A 1BECA 4BRVA 5GRJH 1GZLA 2X1XR 3BP7A 3QFJD 3S6CA 3SDXF 1QFWH 2R0WH 4AL8H 1N6QH 3BRVB 3EJPA 3FT3A 1DVQA 2A45G 1PZQA 3IDXL 4JDVB 4KI5F 1S7TB 3BUIA 3L8QA 5FUZH 4JRXA 1KBPA 1AI1L 1P7BA 3HZKB 3S34H 3AE4C 3WHXA 2HLEB 4KO9A 3OAZK 1BMWA 3T09A 1UM4H 2V5MA 1JM0A 3LPOA 3MLUH 4NQDE 5KUMA 4F37F 1NCAL 3NYKA 4NYLA 3UIAA 5F3HA 1JY3P 3EGDB 5LGKA 1ND0B 2COVD 5EZOH 4FMKA 1M7XA 1DJIA 1X5LA 4BGDA 2FBRA 4KHXH 4UV7L 4AMKL 3KLKA 3V2AR 3R19A 3UTTB 3L9EA 5DDHA 2QRXA 4RLDA 4Y5VC 1JWUB 3LNIA 1J0KA 3C5JB 4F7TA 1IBFA 1DBBH 3HNSH 3LD8C 4R4NC 2QVKA 5TDPA 5FFGA 3V2NA 2JTDA 4OLZH 2RD0A 3FCTA 3VXUA 3F7YA 4A04A 4AQ1C 3HRZA 3SY6A 4IKNA 4JVWA 1M57D 4NDMA 4NHUB 2P67A 4BWNA 2XIDA 3EOTH 2QMKA 5D1QE 4ZNEA 2PCFA 5A2AA 5SWSD 1LWUB 2VDRH 2GYSA 1FFNB 2DLHA 3MX0B 2YKLH 2EC9U 5GGQL 4AVKA 3IF1B 1YY9C 3HPLA 2P48B 4JREC 4K5NA 4NKMB 4YC2C 3GSOA 4YHIA 4XNXH 3B9VA 3JSSA 5F89A 2QM8A 1KCBA 3O81A 5IW1B 2A1WL 1BZ7A 1U8JB 2HG5A 1NJ9A 1GL2C 4MNQE 5TK2A 3GXMA 3I2CH 4F33A 5C0EA 1TSHA 4HJ0C 1AHWB 2NPSA 2QTEA 3UTZA 1R34A 4HAGA 2QSVA 5BUGA 5KVDH 3N41F 4PJ7F 4L4TB 3V0AC 3TF4A 4MD0B 1NAFA 3C6LD 1VL2A 2BVQB 3PWPD 3O2VH 5F1IA 1NU1D 1OB1B 1DBJL 3MBEB 3PNWB 3CPLB 4EF3A 4YL9A 3ARGD 5EF3A 2GJZB 3GSQB 3MVSA 4FJYA 4NJ9L 5K5GB 1TCRA 4ZMWA 1K9MQ 3SDXA 5FM8A 3ATBA 5IEHA 3ASNB 3E8UL 1F6AB 3GDCA 4ELMF 3CG8A 3OLEA 4HPOL 4XBEL 4DP5X 3QEGL 4P07A 3WIFA 3HUSA 1XF5B 2HZHA 4J6IA 4PWKA 3MV8B 5HHNA 1A7PH 4XMKL 4GAYA 5G55A 4CC0A 3WS3B 4XGZB 5KVGL 2P24A 2F19L 5I5MA 2Y2YA 4ZRGA 1IGCH 5CLXA 5AVZB 1CVSC 1JPTL 1YDPA 3PPEA 4I13B 4ZS7L 2D7NA 3T0ED 5BRQA 3E2HC 3O6KL 5LAXA 3F7KA 4ZZKA 2JB6B 1UB5B 1BD2A 1O7DC 3TM6A 3TSIA 4LLMB 2NQDA 3BP4A 1VQMP 2CPUA 1Y0LB 4KZCA 3OSKA 1SFHA 1V27A 3EKCA 2ZX5A 2K9JB 5FF6A 1ED3A 5JA8B 3EFFA 3EYVB 1SVBA 1EVUA 2WBJA 5IBTH 4HOXA 1DQKA 3CWBG 1J1PH 3HD7A 4OKDA 4JHVA 5TE7L 3WKYA 3CLFH 5DFAA 4K71C 5JIKA 3ECBA 2FXMA 1I75A 5JHMA 2XN9D 4HS6A 4MDIB 1NUDA 5FECB 2NY7L 5I76B 1SHMA 2K1AA 4KMTL 5D7HA 1OTSC 2AGJH 3ZXAC 4HCIA 5J56B 3PRJA 1KCVH 2PTUA 1W72L 3BPLC 3ETBJ 2R56L 3KDPB 4BRJA 5M1BA 1F4WH 1DVZA 2C9LY 4CVWA 4OCLC 1C1EH 4GS7C 3MLVL 4QKTA 4IK7A 5EZJB 5C0BE 4Y5XC 3DV4A 2XWJB 2MCMA 4ZUTA 3RBXA 5F9AC 1WFUA 4FQHB 1SQXG 4GI9A 2HFGL 2VN3A 4PJ7A 4V1DB 2OTJP 1A1OB 4XFJA 4IOFD 4OAWB 2DIEA 1DX7A 1ZE3C 2LXBA 1KYUA 2XU9A 4PN6A 4UOJA 5KBNC 2FSEB 2VLJA 3FOMB 3P69A 4RNRB 2FB4L 2D7QA 3DIFB 5I71B 3VXOA 3D71A 4Z7UB 1MWAA 1D5RA 4HUKB 1WTLA 2YK1L 4TLSA 3VRJB 2K3TA 5HHPA 2YMXL 5CJXA 1ZA6B 1AO7B 1WRGA 4ELMA 5ACMA 1KCWA 1VFUA 3J27A 3C2AL 4AG4H 1FPTH 4F15C 5DK3A 4ZMZA 4FP8H 3T2PA 1WA0X 4IL6E 1UH4A 3EFDH 4OQTL 4BFIB 1FLRL 2A06D 2V5SA 2ZXCA 3VACA 3OVUB 2QG4A 3GG2A 2BCKA 4BFKA 4W9HC 2YGQA 3AS2A 4YK4C 3KG5A 5DJ0A 1H3TA 2XKMA 1RSYA 3MROA 2DMBA 4MJ4A 4ABVA 1NCJA 3NIFB 3WFDH 1E28B 3QRBA 4GY4A 2FBJH 1M1XA 1MRCH 5SWZD 2FBWC 3MRPA 4J3OF 1MW3A 2WD0A 2Q7YA 4GBXC 3VTMA 1HJCA 3U48A 1SN5A 1F11B 1WSST 3GMQB 3QUYD 3G5YA 5EOCL 4DP9X 1CF8H 2XY2A 3PJSB 2ADGB 3IPBA 3SDYH 2FHFA 2EDWA 3F00A 3P1VA 4TUOA 4PJ0E 1MCRA 1A8ZA 3HR5B 4JKKA 4OZIB 1G7LB 4U1SB 4A7SA 4BFFA 4TNFA 3GKWH 2PFXA 3TL5A 1P84E 1I8MB 4H13D 3REVA 1DTUA 2R32A 3FB6B 1M7UA 1WYJA 2E7BA 3UBXB 2EE2A 2ZJSE 2IPTL 2W81C 5CJQH 4FG2A 4ODXB 4O02L 3L70D 2D0FA 2XIIA 3CK0H 4PS7A 4NWUH 4YVNA 4CMHC 4CU8A 2V2TB 4LDOB 2YAQA 3VWJD 2FXOA 4JO8A 1CPUA 4OD2A 1MFAH 3H54A 1E8WA 1RQVA 3PHLA 2WJ7A 2Z1KA 1RZGA 2D7TH 5C09A 2AI0H 3PQYD 3T0XA 3ZVVA 4Y2NA 4HIPA 4ZFGH 4HGKC 4JGMA 4GFXA 3PWLB 2OXHB 2W60A 2OW6A 2Q8AH 4QRBA 1MH5A 5DC2A 1PIGA 2WLZA 4JG9A 4A67A 5JW5A 1HCZA 1OF2A 5I24A 4M5YH 2HPOA 4I9XA 1DBKH 4LXFA 4DEPB 3P0YL 2MH4A 5DUPH 5EUKB 3A0BE 4LCWD 4CDHA 2WTRA 4HEPA 1UJ3C 2IMMA 2BY2A 4PGEB 2DBLL 3A6CH 2DQGH 1T1ZA 2UXGA 2YOCA 3IFPB 4FGMA 2FGWH 2UY7A 3QPXL 3F5WA 3RPIA 3AADB 1BZEA 2DM3A 4LHJB 4TUJB 2EUVA 3BCCD 2YJLA 3B83A 1NFDB 4GG8B 4KKCD 2VLKD 2FXPA 2PAJA 1UKQA 2DM4A 4TUUA 5B39A 5BV7L 5HHQB 5FYKH 3RX8A 3FFDA 4JFQB 1IJNA 4PJBE 3VXPB 1UZ6F 5AUMA 3UTOA 3GRWH 1KT2B 1X0TA 1NGPH 5DK2A 5MHSD 4GMTH 4GMSH 3FU7A 2A4CA 1DQQA 2AMGA 3H3PH 4LHUB 5FGSA 3S5LA 3U30C 1GOHA 1UEYA 4LSPL 4JY4B 1P7QB 1WWWX 2NY4D 1G7PB 4KI5D 3RDJA 3PL6D 1FZGA 3EQ2A 2X2UA 1RU9L 1TYEB 1U8MB 3OG6B 3VFRA 4OGQC 4YQXL 4LASH 3R1GL 2N9BA 1INDL 3LKQB 1ZV5A 2WXFA 5A2BA 2VLME 2WZAA 4WVZA 4GSQA 3LRSB 2VDNL 4M29A 2NW3B 4K9EH 4UTBL 4LHUG 4FL4B 3I3DA 5DVMA 2GABA 3WKNA 3KZ8A 2WPRA 1L0LE 1U3HA 3PNRB 3NFPB 2WXOA 4IKKA 4ZS6D 4WI3A 1RUAH 3HN5A 4R7LA 1DFBH 3QAZC 1ERNA 4D9QD 1J1OH 3NIGB 2OTWA 3T4YA 1FGVL 5C97A 2WLLA 3JT0A 3V4UL 4PRHB 4GEJA 1EZVI 1U95B 5EC2A 2WLYA 4UINH 3HD7D 3CDYA 2FYUG 3HI6L 1A7QH 1SJMA 2JI2A 2EEBA 4JDZA 4P5TC 3M7OA 1URIA 3RDTD 3S97C 5CBAB 1PZCA 1A7BA 2W92A 2W91A 1SQBJ 3HE4A 3T8MA 1P4LA 4IBUA 5T3ZL 4IU2B 2NY5C 4MRCA 2PUQT 2E7MA 2X4TB 4GI6A 3CCEP 3UABA 2WKGA 4LPXA 1OZUA 3KCPB 1S4XA 2Z5IA 2ZYGA 2NW2B 5FLVA 1YYCA 5EU6D 3BH4A 3DXAB 4GXUN 4XP1H 2JCCB 5DRWB 1TQVA 3KR3L 3RU8L 4FN0A 4FQJL 1CI6B 4OR1A 4G42A 2DMHA 5J5EA 4WI6A 4MX7B 4E9YA 4PVBA 5DRXA 4ONHA 1MFBH 4Y1AD 2DLEA 3TA3C 4JBSA 3VXRA 3N44B 3FFCD 4HS3B 5T1MB 3ZOAA 1YNLL 2VDLL 2W80C 4TNGA 2CRMA 5J7CC 4IBSA 1IQDB 3AY4C 4WO0A 4LCIH 5E1AA 3IFNH 1SPDA 5MEPB 1JHLL 2F53E 5IFJA 3E1RA 3M1CA 2WUCL 3CFDB 2EDKA 4HULB 2EKSB 2YO2A 1S6NA 4JHBA 1V55B 3KBEA 2WCPA 4JKNA 4O2CB 2HSIA 3TO4D 4M61A 2IG2H 2Y0DA 5FO7A 4HUWA 4RAUB 3GYRA 4MSWB 2BS9A 5I1KH 1NHLA 2IBZI 1ZW0A 1MIEL 1ROWA 2JNZA 4U3HA 3L73G 2YMKA 3RVXC 2XTJE 3CLEH 4JDVA 4HT1L 1S7TA 4YO0B 4HXAH 5I5RA 3HZKA 1GGTA 4OU3A 5F7NC 5HYSB 3H56A 1BQKA 1I1AB 3PYCA 2CRZA 5JHDB 1VDFA 2E42A 3K2IA 1GYCA 4S11A 4GRWH 3H3KA 4YHYC 4UM8B 1TVDA 4RGND 4WNSA 2WB7A 3EGDA 5BOZG 3FQ4A 2MQ3A 3VO0A 1F5WA 1ND0A 2HLFD 4FNRA 2BHFA 3N85H 1KTBA 3ULVE 4X0KB 4TVPL 2KC0A 3UTTA 2G75B 3GF3A 1MFDH 1JWUA 4U1GB 3C5JA 2OL3A 3ZE2B 4EE2A 5JQ6H 4H20H 3MUUA 1L4AD 1OIOA 2O01J 3LMJL 4K55A 1S3JA 1U58B 2WSPA 3EFOB 3QJVB 4KJMA 5F1SA 4TRPL 4NFDA 4GW5B 43CAB 2Y1ZA 3BAEL 1LWUA 3PJNA 1FFNA 3MX0A 1MFUA 2YD6A 1NA8A 5F3BB 1OGTA 1CDUA 5APQA 3IF1A 3JYCA 4R97B 2ZZUT 4KRNA 5C09D 2AQNA 4XNUL 1UC6A 2R29L 1U8JA 3D69B 1FFOB 1UWYA 3QWQB 3L5WB 4WV1C 1KEMH 5H2BB 3X1EA 4HWEH 1AHWA 3D6GA 3RWGB 2ZXGA 3B2MA 3KXFD 1OEZW 2WQSA 2KZ1B 2NY6B 3L5HA 2FYNC 3PREA 3QUMH 4JB9L 4L4TA 4MD0A 4WUUB 3D34A 3L3OB 2BVQA 1CIUA 2B77A 1OB1A 2Y9YA 3GHGB 1NBVL 4OUUB 4K8RL 4ZMAT 3QQ3B 3HE6B 2B16A 2X6VA 3RL0B 2K45A 2X6BA 3NCXA 4Z7UF 2HXAA 1LP1B 1OT1A 4ZO9A 3GSQA 2ZPKL 3OMIB 3OKMB 4G6JH 3WD5H 2MNJB 1C8QA 1LO2H 4GUPA 2FYYB 1F6AA 2K3HA 3AREB 4F1SA 2OJZH 4NHCH 4LCCB 1XF5A 4YE0A 4K7FB 3MV8A 4XBGB 4E2OA 2Y7QB 2L7UA 2W6JH 2YIUB 2W0LA 1K8IB 3VG9B 2FR4B 3WS3A 4ICXA 1SEQH 5B7MA 3QXDA 4J3OD 3TIEA 1AR1D 1NEZG 2XWBB 1W2EA 4PRIB 15C8L 2FWOB 2FWUA 1HCYA 1NGWB 2MHAB 2ILLA 1SQVE 3QNYB 5CU5A 5C71A 2V3EA 4A2GA 4S1SH 5BU5A 4BBWA 1RURH 5D1ZB 2JB6A 2JSFA 3NIFF 3ULUL 1NDGB 1G7MB 6CGTA 3SFDC 1FYHB 4I2XE 3OXRB 1RJLB 3CCUP 4LLMA 3B9EA 2E8ZA 4UT6A 1Y0LA 1FDOA 4ES9A 5B7FA 3I3BA 5J9PB 1IC5H 5ECGA 5BW7C 2E27L 2ED6A 2NY1D 2K9JA 4LLYB 4YSPA 4S0HA 2X2HA 2E76B 1F42A 1T5WA 4B0MM 2WSDA 3BGFC 4IOIB 4OZIF 4FRWA 5GS2H 2Y1YA 4MDIA 5F2FA 2OR9H 3RZCC 1AHMA 3IDYB 3VUAA 5FECA 2A73A 4V11A 3OJVC 4F3FB 1NMBL 3C09B 3MCKB 2XTLA 4K9JA 3HNVL 3ARBA 5KOVC 3CVHB 1A4CA 1LP9E 2CLRB 3SHSA 4TM9A 3FQYA 4L4VE 3W38A 3NGBC 1WFOA 1OXYA 2HAZA 1DSFL 2XWJA 2QPFA 3K7UA 4YXDC 3BJ91 4FULA 2PWHA 3KWWB 2UWJE 4V1DA 4BQCA 2MKWA 3FMGL 3V6OC 1A1OA 2FX8L 1AAJA 1L6ZA 4OAWA 4JGJA 4GP8B 3FWLA 5FHAH 4FQLL 2FSEA 4NZDA 4RNRA 3FOMA 5AWNH 3DIFA 5K9QI 4KKLD 2J4WH 1CD1B 3VRJA 1UH2A 3A0OA 3L6FB 3L7EB 2F0CA 2PYFB 1ZA6A 2EO9A 1XAKA 3K2UH 4XX5A 4X5LA 1AO7A 4M1GH 4XNAA 4MWFB 3WFCH 1G5GA 3IAPA 1A6ZB 5D9SB 3MRNB 1CBVH 1I85A 4GO6B 1A7RL 1FNGB 1QRNA 4Y9GA 3M8OH 3A23A 1AGEA 1UM6L 2B1AL 4BFIA 5LQBH 1TJIL 9PCYA 2I85A 2HFTA 5DJZB 4DN4L 2GITB 4DF9A 2G4EA 2QHRH 3C5ZC 3KH3A 3U1QA 2JB5H 3H4HA 2NNRA 1M7DB 1SVZA 2FH6A 2WQ8A 3L95B 4OBSA 4DKTA 2UUDK 3NVQA 3D3VB 4NQCE 4ONFH 1IGFL 2EXSA 3T5WA 2WYZA 3U6XS 5FOBB 1E28A 1KZUB 1XTLA 2X1PA 3QW9A 4KI1A 1NFDF 5EBWB 4KY2A 3KLAA 1Q86Q 2AW2A 1T3JA 1CBJA 1A9VA 1SYVB 4A2LA 2GJ6D 2QJPC 1F11A 1PEZA 1KB9H 3GMQA 4TSBL 1D2OA 3GMLB 2DAVA 5H8DA 1DVSA 1AP2A 1QO3B 3PJSA 1OP5H 2ADGA 4HKZH 1B2WL 4KWUA 2ZP8A 4N2DA 3DYMA 2I7OA 1IFGA 4OZIA 3HR5A 5FYJU 4IBZA 3K1DA 3U59A 1G7LA 4RX4A 2EIZB 4PWIA 4U1SA 3FAXA 1PJWA 2WXIA 4MJ5B 3C5SB 1FHGA 4K7PH 4PJHB 2H41A 4X7SL 2YJQA 5I19H 3ZTCC 2V7QJ 1I8MA 4HKBB 4JG0H 3FB6A 3GI9H 1ZLLA 2E74B 3QDGB 4XN2A 3UBXA 3TF7C 1I3RB 1XH0A 3HG5A 4XC3H 4TVUA 1UOVA 4ODXA 2CNYA 2IBBA 4M8QA 5F70A 2V2TA 1GTWA 2HKAA 3SBWC 2KLRA 4HXBH 2HTLD 3U25A 1UWXK 5EIIB 1T0OA 2OW7A 2EE6A 4N0UE 5KAQF 3MC0A 5HHVL 3UTTD 1H9VA 3W9EB 4GXVH 3NIGF 2AMUA 4QRSB 4UNIA 5J11B 2X89D 4L29A 5MI0C 3HAEH 3PWLA 3QUZB 2OXHA 3UFIA 4JFZH 1CLCA 4IOSD 3VRIB 4ZX4A 1U6AL 1A4BA 3FT4B 3JCUE 3GF7A 2MNUA 1KYOE 5AVTB 3HNTL 2PYED 4Q4EA 5ALCH 4PR5B 3PDGA 3BVNB 3QFJE 4JY6B 5EUKA 5FIEA 3O6FC 2AFNA 3HR6A 4D0CA 3WY3A 4R4BB 2XIBA 3BPOB 2V33A 1P6AB 1SQBK 4PB0H 4PGEA 3AEAC 4Z7OB 2O6CA 3CIQA 2JCCF 3QE5A 1O9VA 1OAQH 3HZVB 1H5BC 3ARDC 3TEXA 5DT1L 4C4BA 1FZBA 1ZJAA 4L4TD 1JWSB 5DZLA 4TUJA 4YGAB 4PJGB 4A2EA 2VZTA 5T33L 1NFDA 2J3SA 3N44F 5ABZA 3OA7A 1BFTA 2G4GA 5HHQA 4Z77B 2WXHA 2N7AA 3MBED 5K59E 3NABL 2X4OB 1KBGL 4XOBA 4JFQA 1R17A 1JJUA 5GPRA 3VXPA 2CKBL 4S2SB 5E00B 1MHEB 1QFWL 1KT2A 1ZLSL 4AL8L 4ZFZA 5TE4H 4QJ4B 2XQYK 1VQ8P 4ZMNA 3KM2A 4LHUA 4JL2A 2O6EA 2XZAH 3MHZA 4JRYE 3UZQB 4JY4A 1P7QA 1G7PA 1ASOA 4LDLB 1D5MB 4W9CC 1G9MC 1U8MA 4GUCA 2BSED 3RY6A 4PJ0H 1UEMA 1ZE3H 4G1MB 3LRSA 3HC3H 4MNHB 1FYTB 3HZYB 2NW3A 2JKNA 4PS4L 1YEEL 5I1LB 1JIBA 5EZOL 2JWYA 2QGCA 5KLVJ 5LBVA 2E56A 1A1MB 2ZJSH 3NFPA 1HUCA 1DLHB 1CDCA 4PJ9B 1KACB 3MXVH 1ADWA 1W0YT 3HNSL 5TPWL 3QIUB 5KLIB 3BDBA 3US9A 1RUMH 3CN1A 3L3JB 2MTAA 4RETB 5BPPA 2J56A 2YKKA 3UACA 5B8CC 4R2GC 5M7QA 5D70L 5FCUH 5EOQL 3T2OA 1U95A 2PWGA 1QLEL 3PWPE 1NU1E 1GIGH 4MNGE 1SHSA 2NXYC 4EUPH 3SPVA 2DQFB 1J0JA 3QB7C 5GJTH 5CBAA 2H0EA 4ATWA 3ZE2F 2ORBH 2Z7ZA 1MVFA 2Y25A 1QWNA 3QDJE 2VISB 4IU2A 1M3JA 1RK7A 3EUDA 4KKRA 2GSGB 2VDPH 2X4TA 1OT2A 4JR9H 4M3LA 1S3KH 3GJFK 3HS0C 5GS1B 3GXUB 3KCPA 3ZKSD 2NW2A 3GTNA 4MB5A 3ZDZE 2H8PB 3DXAA 1LEIB 2YFNA 5DRWA 4UOW1 3F7VB 2H2PD 3GSNH 5C86A 1CI6A 4XP4H 4MX7A 3IWUA 2ZUUA 4J2XA 3T0EE 2DS4A 3JQOB 4ZOAA 5JIPA 2QZ5A 4BZ1H 3KS0H 4HS3A 1QEXA 5T1MA 3DJ9A 3I6KB 3ZRFC 2B1HH 5D72L 2XZQH 2FFDB 5DEJA 1FDLH 2OMZB 3FN9A 1UB6B 3RIAK 1CGXA 5MEPA 4P5KB 1MCBA 2Z7UA 3KPRE 3CFDA 3FZUD 4PY7B 5D2NE 1AO7D 1O6SA 1UD4A 2EKSA 2OCJA 2ESVD 3ZZ1A 1RHZB 2A9DA 2XWTB 2X2YA 3RB7A 4A55A 3BPCB 4MSWA 1FG2B 2BVEA 3VI4E 4D6TJ 3P40A 2DJUA 1JRHH 2H32B 4W9JC 1IT9L 4C7RA 3NXSA 3BDYL 2XN9E 5IB4B 2VSMB 2FX9H 5LVEA 3US0A 1X6LA 3JWNC 3VXNB 1IU1A 4PTTA 5EU4B 2AJVH 4FFVC 2AQ2A 5GSVA 1C12B 5F9JB 4XOAA 2VIRB 1HWHB 5D71L 5HYSA 1I1AA 4Y4HC 5DD3H 4L18A 2EUZA 4JFXB 1H8NA 2NY3C 3ARXA 4PJXA 1SYSB 4OFYA 2J1YA 3RPBA 5JHDA 1ZGLP 3CMOH 4Z6AT 2WXJA 4UM8A 4X8XA 1J1PL 4OTXH 2HUHA 3WG7B 4GH7B 5GSRA 4LP8A 4OFPA 4MCZB 4AKOA 3S48A 4K23L 4LSVL 4X0KA 4F2FA 4DOJA 4B27A 2G75A 3GHBL 4HF5H 2GTZB 3JWOH 2A06G 4H2CA 2FHCA 3VQLA 4XP9L 1EZUA 1IAIM 1U58A 3NMEA 1CURA 3O4OC 3EFOA 2K1MA 2E4FA 3LRHA 4XB3A 3MN8A 4ZD3L 1HHKA 3J8F7 3QH3B 4GW5A 2C9VA 3BAJA 3GZPA 43CAA 4RFOL 5F3BA 4LEBA 4UT7H 3GUTB 4I18B 1OD9A 1A2YB 3S3PA 4U6VH 1OE3A 1S72P 3K8LA 4Z7NE 3FX0A 2ZOTA 5DUBB 4N86A 1RPQA 1SMOA 1XD1A 4PEEA 3A24A 3D69A 1FFOA 3HRZC 2Q2EB 4BEIA 3L5WA 2RQ8A 4U1KA 2Z35B 3L17A 5JW4N 3RWGA 4XRCB 5SWZE 1AFOA 1J7VR 5BS0D 4WUUA 1T4KB 3LKPB 4U0QB 1YITP 2NXZB 2VXUH 3L3OA 4AG4L 3F6IA 4BQBA 3Q2LA 4OUUA 4FKEA 1FVDB 4PJCE 3FGAD 3EFDL 3QQ3A 3HE6A 1JTTA 5B38B 2OMNA 2OA9A 4AWJC 4TL4A 3V9FA 1BAGA 1OTTC 1GW6A 3OKMA 3JYBA 1PTZA 3MACH 4M1CD 1NCUA 3CMGA 2L4OA 3FQRB 4PJEB 4TSCL 2FYYA 4UILL 5JORB 3AREA 4WGKA 2NPSC 3RNKB 3TH4T 2DDQH 1FAKT 4LCCA 1JSYA 1GJUA 1N7MH 3HB3B 4K7FA 1TOXA 4KKZA 3KPSD 4ZMQA 2Y7QA 5D1XC 1K8IA 2A74B 1IGML 2FR4A 3L70E 1PW3A 4XNDA 4KITB 1BA9A 5EH1A 3BZ4A 2QJDA 2XWBA 2P4AB 2P1YA 4PRIA 2FWOA 1BGYJ 4U3SB 1K8AQ 4F5CA 1NGWA 2K70A 3UZEC 2MHAA 3EJSA 3GGWA 3VD7A 5AAPA 3QNYA 1DUZB 2NY5H 1DZ0A 1XD0A 5D1ZA 2X42A 1NDGA 3G6DH 3IPEA 3PQYE 3HUSC 1AR2A 1JGLH 5AAMC 3OXRA 4FA8A 1UT9A 4YHNB 4O02B 2R8SL 1ZGLM 1OAZL 4GQ9H 5AW3B 5BZXA 4ALAL 2LVEA 4IBLT 4JPIB 4LLYA 4ZQTA 4G5ZH 4HZAA 2KQMA 4JDTH 4HZLB 3CK0L 4YHZL 3U7YL 4BFOA 4IOIA 2Y9ZA 2F8IA 3KLHC 1OTUC 3ZE0B 3BCCG 4LCWE 3L3KB 4UYPA 1OB0A 3ZZQA 3QI9C 4PJHF 3PGCB 1TR7A 2D7TL 4F3FA 3VU1A 1DE4A 1Z9NA 3MCKA 1NCOA 4LKXB 1LNQA 3JVFC 2AXTE 3PP4H 3PP3H 3CVHA 3D09A 2ENSA 1GHFH 2CLRA 2QTVA 4WSGA 3H1IJ 1Q94B 2WBJC 3EF7A 4KKQA 4PRHD 1KYAA 4CBPA 5HP5A 4AOFA 5AW4B 5EU5A 1ODAA 3BCCE 1ZKAA 1AE6L 5KJ7A 2VLKE 5IHUH 3KWWA 5A7EA 4M5YL 3SJVD 4JCLA 4WY7H 3QRGH 4LPCA 1L0NK 4X7EC 4AE0A 1AY1H 4A6YL 2PCPB 2QADB 4UIMA 5TD4A 1M3IA 2J6EH 2LV4A 3L08A 5MHSE 3H9YA 5DD5L 1CD1A 4NQTA 4U6YB 3L7EA 2Z0BA 4X83A 5E2TH 2DQGL 2PYFA 4RFNB 5BV7B 4KI5E 3SO3C 3WE6B 2OCCB 3KWXA 1PZ5B 4MWFA 5F1KC 5EU7E 4G8GB 1A6ZA 5D9SA 3MRNA 3AWFA 1NAKL 1FNGA 3X1NA 1AHKA 1IFRA 1HK6A 5GS0D 2GITA 4Z7OF 4I87A 4LNRB 1YAZA 4MS8C 4C7NB 4G6FB 4EI5B 1KPRB 1JZ5A 1BD2E 1WIUA 1M7DA 3L95A 1NGPL 5CJXC 2FNBA 3UAFA 3D3VA 1L3NA 1U7MA 5FX3A 5FOBA 4PJGF 4D9QE 4OGXL 5EBWA 3CWGA 4LGRB 5IV2B 1EO7A 1NPUA 4DO4A 1KIRB 1SYVA 4Z3EA 2IFFL 4OF7A 1ZMYA 1VGKB 3APDA 1WFTA 3GMLA 4PREB 5LJYH 1TLKA 5JIIA 4F57L 1X5MA 5JR1L 2JQMA 2Q5UA 2ZXXA 2K4WA 2ZVNB 2CNZA 4HAFA 2EIMB 1FC2C 4IIQB 5KS9B 4ZFQA 4MJ5A 3C5SA 2J88L 2KLTA 2XV6B 3EBIA 4CGTA 1UT2A 4M5SA 2DBJA 4FFZL 4PJHA 1RUAL 1LTJC 5IGXL 1DFBL 3EH2A 4HKBA 2DM2A 5EU6E 4ZUSB 5ADOL 1I3RA 1OM3H 1F02I 3I9AA 3LX9A 1JVKA 4HISA 1E8ZA 3S3JA 3I75B 1OPGH 2QHLA 2C9AA 2DV6A 2ARJQ 2NZIA 2X10A 3BSHA 5A2JH 3NIDB 5EIIA 4APQB 4LVOB 5C08B 3ARPA 3WAJA 1L9MA 1OAUH 2KZKA 3FFCE 4U49A 3LH2L 4X7TB 3L74D 2VLJE 5T5FH 5CEZH 3W9EA 4QRSA 1X6NA 4IRZA 4EXKA 3WTWA 2BOLA 2CM6A 3EOBB 2QE7H 5EBGA 3OAUL 1NFKA 3QUZA 1U0QA 3X13A 4FNLL 1FSKB 5KSBE 3IFMA 2PO6D 3I84A 3VRIA 2YBGA 4NXKA 4TULH 2VSCA 1T0PB 2G5RA 4WFHD 3FT4A 2XHNA 2K0RA 4QRUA 2VDLB 1FA4A 2ZUYA 4PWFA 5L8KB 3RK3D 2ZP0T 5C0DA 3LB6C 5LHDA 4PR5A 2D0GA 4WJ5B 3OLDA 3QARA 2CK0H 5BXFB 2EDHA 3BVNA 2V3FA 1YJDC 1L5GA 3POHA 1YEWA 1T7ZA 2VDOH 4LCIL 1F86A 3E8VA 4Q9QL 3BSZH 3HZVA 1GMEA 3GXPA 5BVPL 3VB9A 5I1EL 4FYQA 2O1KA 1HHJA 3MLZH 4UTAL 2M8RA 4WUUD 1JWSA 1CK0L 1QBLH 1KY7A 1QKZH 4PJGA 5IQ7L 5AYUH 1TZGL 4OB5H 4RGNE 5FYLD 5IUSA 2X4OA 3C9NB 4LEEA 1KPUB 3RL0D 3UJJH 2SODB 3TCXA 3ZYJA 4S2SA 5E00A 1MHEA 2O5XH 1ITBB 5MEND 2VZSA 5DHYB 4JFEB 3FK3A 3G5XB 3QIWD 4RGOH 3GEWB 4ZMTA 3UZQA 2V6HA 3I6SA 4HXAL 2ZSVB 3L3IB 4JKLA 4KTEL 1YEIL 1D6EB 3RAJL 1CICD 2AEQH 1KN2L 3WXWL 1QYGH 2GK2A 1Q4NX 2P46B 2IAND 4P2OB 1FYTA 3PHQB 5DJDB 3RWJB 4IDJL 2PCYA 5I1LA 3P8MC 2EH8L 1SQBD 1TNNA 3ELAT 3N85L 4KX7A 5C09E 1UXSB 1R5IA 1KNOB 1PU0A 1A1MA 1RLWA 1MCJA 2D3VA 4WI4A 2DTSA 1DLHA 3QYNA 4YEEA 4PJ9A 4UOZA 4KFMA 1YYMH 3FTVA 1QW9A 1RZKC 3IGUA 4HJ1A 5T3XL 3L3JA 5D5MB 3KXFE 4L1TA 4U1JB 3H1LD 3L4TA 4H25B 4JX0A 4N5UA 2P8PB 2ZWLT 1E6JH 3BQUC 4H1LG 5FA4B 1Y8AA 2AEPL 5AVVB 1AMXA 3MXWH 2D3JA 2DQFA 1JHKH 1VADB 5TF0A 3WIHA 4BWUA 3CCJP 3OMZA 5JPNC 2VISA 4PYGA 1QVOA 4X4XA 2J59M 2E9IA 2GSGA 2XFGB 1TO4A 3D1MC 5CCKL 2V7HB 1U9KA 4MJIA 1HZHL 2OFQA 5GS1A 1ZV9A 1TJHH 3QSKB 1JGDA 3JCUH 3IAOA 1PGJA 2H8PA 1LEIA 5GGRY 1KYOH 4HWEL 5HJDA 5TE6H 4AM0Q 5HY9B 2NDFA 3F7VA 3Q6GH 1WGVA 1LTXA 1NGQH 3LIZH 4N1EA 4LF3B 1HJBC 3T0EB 1WUZA 1TTAA 1PCXA 2DQIH 2AJYH 1NTMJ 1UM5L 1M71B 4DKFH 3EYFB 3I6KA 2P52A 5BZWB 3FRUB 3WD5L 4NZTL 5CCGC 2FFDA 3MUJA 2OMZA 5FO9A 4NN6B 1UB6A 4NQXB 1WT6A 1LO2L 4QCIB 4Y9FA 4PY7A 2EUXA 2BRRL 3UG4A 4YBHA 2XWZA 2IOMA 3KPNB 4GJTB 4XMPL 2H6OA 4GLRH 5DR5L 3RJQB 4EI6B 2AERT 2XWTA 2P3YA 3KNBB 3BPCA 1KFAL 2GUOB 2HKFL 2LU3A 4X7CC 2PP6A 2R9HD 4P4KD 1FG2A 2FECL 4JFHE 4OGYH 2YPVL 4AIEA 3OHXB 2ZT9D 1DO6A 5ECJE 4IGBD 1I3GL 3BKMH 3IU3B 4KJPD 4PJEF 2CUIA 4U1LA 4UQDA 1S7XA 4Z95H 5IB4A 3VXNA 5KYYB 4S1SL 1ACXA 2QZQA 1RURL 3MRLB 5EU4A 4M7LL 5HHMB 1OM9A 2K9FB 1RIHH 4ASVA 3H9ZA 1C12A 2NY0B 3JWDC 4MDJB 5E2UL 2VIRA 3VI3B 5HVGB 1UG9A 3WJLA 3NA9L 3CCQP 1E5UI 2IFGA 4BFBD 3D9AL 5IREA 4LSUH 2QFPA 1SFCC 4IRJC 2CG9X 4JFXA 1SYSA 1ML0A 4YIQB 4DGYL 3ML9A 1WISA 4ZXBD 2ID5A 2J6WA 3WLWC 2UVEA 2CBQA 1JF6A 4QTFA 1QASA 2GJRA 3H9HB 2EYTB 1JNLH 2RMNA 3MLRH 4Z7WB 2GTZA 4RVBA 5KTBA 4FFYH 3HN3A 3D6ZA 1DFXA 3QDGD 5C3LD 4R96B 2K6YA 4GAJL 3P3UA 4FG6C 4AEHH 3QH3A 1NGXA 1EEYB 1A6WH 5IP4A 2HX7A 3ZE0F 3NT0A 4NPJA 4OLWL 1IM9B 2HWZH 3GUTA 2VKXA 4I18A 3EGXA 1A2YA 2F1AA 2CLZA 4ACTA 2MCG1 5DMIL 1M1SA 5FHAL 5DUBA 1YEFL 1KQFB 1HQRB 4PJ5B 3S0PA 4GIPD 3WFEL 4F7MB 4XOEA 5K39B 4DCKA 4NCC1 3LQZB 2EEDA 4KK8C 2Z35A 2APBA 3WO4B 4XRCA 1FWXA 2X3AA 3IEAA 4M1GL 3V0VB 1K3IA 1T03L 3BIAX 4HAKA 1YYLH 1ID5I 1FZJB 1A14H 4MMYB 4XCCL 2GJ6E 3SB3A 1U2CA 3VXSD 1CS6A 3FFOA 3QJXA 3I3EA 1OLLA 3UP1A 5B38A 1V3KA 3MRJB 5IMLB 4YHKH 4JM2D 3P3YA 2VZUA 3AM8A 4CC4A 1MF2H 2JB5L 3CSGA 3FQRA 1OWAA 3P4NB 4UB8E 4PJEA 4RBPH 4MZRA 1MFCL 2DWSA 5JORA 4LLQB 4QNPF 3Q8EA 3UTPD 2RACA 1JUFB 5KSAC 2QLYA 5I26A 2A74A 1AANA 5FHBL 4BXLA 4KBPA 5E4EC 3IGKA 2R44A 1T22A 2YQ3A 2YPLB 2MSPA 4Z3GA 2B2XH 2VH5H 2YEZA 5LWYH 1XF3B 4XO8A 1DUZA 1R5VB 2E7DA 4UF7C 1UWGH 4WGWB 3BD5A 3JV4B 4QXUH 3UTTE 4LU5H 3V4VH 4HJIA 3II2A 2JKJA 2AAAA 4YHNA 4O02A 3V7AG 3O2DH 3RVUD 4BZ2H 4LVNC 5IFHH 2CK3H 4LPTA 1AZBA 1F41A 3ZDYE 1MJJB 3FCUB 4ZFFB 4FXKB 4JPIA 1HSAB 2MCAA 4HZLA 2Q3XA 2WBXA 3IDGB 1OOWA 3IVKA 4JPZB 1FRGH 2I24N 2YUWA 1KB5L 2X2JA 2R4SH 1EAPB 5KS9F 3L3KA 5TH2B 3PGCA 2CE6A 3VMXA 3MP7B 5LO7A 4GXVL 1ZXGA 4LKXA 3QIUD 5H37H 2YNYA 3D85D 2QLVB 3TBSA 3KZIH 2P7TB 2GIXA 4JFZL 5CGMA 4GINA 4L4TE 4X5RA 3NIDF 5CJOH 2A6IA 5I74C 4KKBD 2XU6A 1WBXB 1S9KD 1E7UA 5CF3A 5JA9A 1FAVA 1I1CA 2C8NA 1CWVA 2D7MA 3JWNH 5LG6A 1BQLH 3FKUS 1IZNB 5EULV 2Q9IA 1R6VA 3T0DA 1ACZA 2EIBA 2PCPA 3ARBC 4U4IA 1PKQB 3LZFH 1VRSA 2N3JA 4U6YA 4WEEA 1GYUA 2VDKH 4QHUB 1A6VH 4G6KL 1ZLVK 5FYJL 1H6TA 1PPJG 3DHJA 5TQ0L 4KQ4H 4NNYB 1PZ5A 3WE6A 5KYWB 1QOKA 2DMCA 1OCWL 5GGSY 3L75G 4UMGA 3BMVA 3QWRA 2CKBB 4OZ4B 3CDGB 1BZDA 2ITDA 2BOBA 4OIBA 1Z6JT 2BOCB 2EDEA 4G7QB 4KHTL 4OJFL 3TU6A 1D5IL 1I8AA 4F80A 4I3SH 3J2PA 2IPUK 4LNRA 4EI5A 1J9TA 4Y1SA 3DUHA 1KPRA 3BQVA 1F90L 3F58L 3AQXA 5ICYB 1GS7A 2Y0EA 3CC4P 3KMDA 4YDNA 3WDHA 4HPHA 1KTCA 3UXFA 4YBQD 3RJOA 2YAFA 5GISL 4NUMA 5IV2A 4DQAA 4NC1C 4UV4H 3JUYA 1KIQB 3MYJB 1N2DC 1E6OH 1KIRA 2XXFA 4WWID 1IAII 5H94A 3ILPB 3R4YA 2Y4SA 1BSHA 1VGKA 3WN6A 2OZNA 2D2CC 4LB8A 1L0ND 4PREA 3T3MB 1MEXL 5E03A 1SXSA 5E6IC 4G83A 2EXYC 1RIVL 4NLAA 4LSRH 4AMXA 4IIQA 5KS9A 2UXFA 4QTHB 1KLGB 5KVMC 4J27A 5ISZD 1ZT4A 5BOPA 2B4CC 1U3ZA 3AU1B 4W93A 3KBHE 2E75C 1L9QA 3NDYE 1NMCB 3MPCA 2PPCA 5E79E 1QLEB 4ZUSA 5I8EB 1RUML 3RK2D 2Y07L 4G7YH 2BERA 3T6WA 2WBWB 3VWKC 1WZ1L 1KJ3L 4P2CG 1J8HB 1QBML 2B88A 3O6QB 4X80H 1R19A 4J8QA 3DVFA 5C08A 3OQRA 2YXFA 3GK8L 2BSCA 4X7TA 4PJDB 3EHBC 4MXQC 5F88A 4Z7UE 2JJSC 5D2LB 1PIXA 1EHAA 1YEKH 5D5MF 3EOBA 2K7PA 4X6CB 1AO7E 5T1DH 1DHKA 2ESVE 1MNNA 1Q38A 2XG4B 3M06A 1Q81Q 3MRHB 2XJLA 1F00I 1XXFC 4ISVA 4LDCA 2QPUA 1G43A 2L0DA 4XP4L 4ZAKB 1USZA 3S36X 4N6JA 3A67L 4WJ5A 2QELA 3VFNB 4GQRA 5BXFA 3QQ9C 3MKKA 1TQWA 2BP0B 4CN1A 3LEYH 1BBJB 2ENYA 1Z9LA 3H42L 3NIFE 2HX8A 4WJG3 4YLCA 3NBNA 1LEKA 3UC0L 1FJ1B 2LLLA 3HUJE 4D2NA 4PG2C 5B4MC 5E8PB 4AIOA 5IT2H 2WPSA 1MI5B 5AOMA 2B59B 4CUCA 2JIXB 4B3VA 4GRLD 4N6QA 1DANU 5CCHD 3K4AA 3C9NA 4YDMA 1KCRH 1A6UH 3K3QA 1KPUA 1PCSA 3Q01A 4B60A 2XSKA 1X5IA 4GKZB 3EJCA 3BPNC 4EN3D 2FX9L 2Y0CA 4M4PA 5DHYA 3FU5A 2P10A 3GLMA 3SE4A 2ADYA 1I8UA 3G5XA 4IMKA 5HI4D 3AUVA 4C56D 3MBXL 2ICES 3HB3D 4OT1H 1E5BA 1WP6A 5D7IA 1IGIH 2ZSVA 1Q9LA 3BUPA 3A6BH 2IH3B 1D6EA 2P28B 5C0AB 1IMHC 5DD3L 4XPGH 5APXA 2GC7C 1RF1B 3TNUA 4NNPH 1RZPA 3V0JA 1HIML 3CMOL 4OCRH 3N1MC 4JG1L 1DP0A 1CL7L 1KGCD 1SUJA 5K5YA 3PHQA 4OTXL 5DJDA 3RWJA 3QG6A 1IFIA 2DTMH 4FQXD 2VR4A 1JMZA 3VI3F 4X98B 1BVLB 1UXSA 5D7KD 1KNOA 1VSCA 1WZLA 2GB2A 4J4PC 1QFOA 4HF5L 2YD3A 1YA5A 4BE5A 4L3ED 3FUFA 3D70A 5D5MA 6FABH 4U1JA 1NC2B 3J07A 4H25A 4RAVB 5BS0E 4AYCA 2P8PA 4OZFG 3CBRA 5FA4A 1EZVG 4FL4C 5BO0D 1YEHH 3GMPA 1MWAH 2Z6FA 4Z7WF 1AACA 1H3XA 2KZBA 2VC2H 3JTSA 2PNDA 4U6VL 4Z5RB 2HYMA 2FQFA 1ZY9A 1Y07A 1FI8C 3KVQA 3O9WB 4Z7VE 1VAHA 2R2EB 3QCVH 1GOGA 4UT9A 1AGCB 2V7HA 2K4AA 2O5ZL 2OP4H 3IE4A 3LZOA 5KEZA 1MFVA 3G5VB 3FL7A 3KPSE 2W8CA 4GSUA 5HY9A 3P4OB 4ZW3A 3QCUH 1NFDE 4JGUA 2JP3A 4DP6X 4LF3A 1Z3RA 3LQAC 3BAWA 5EEXA 5ESQB 5L6YH 4D6TD 2BNRD 2G2NA 4ADJA 1ZHLB 5D6CB 1M71A 1KYDA 3EYFA 3ZDXB 2OJ1A 5SX5H 5BZWA 3FRUA 1SLXA 5ICZB 2GC4C 1ZXKA 4KOCA 4KK9C 3IKKA 5E94B 5DZNA 4QCIA 1NL0H 2DDQL 2ZKHH 3HLAB 1HAWA 1N7ML 5AZ2L 3KPNA 4G7RB 4G8GD 4MAYB 4O58H 4PGCB 4EI6A 3IJ9A 3KNBA 2B08A 4N22A 2GUOA 5CLTA 1SF3A 2ZWKA 1ZIBA 5ETUB 3ZKXC 1T1YB 3FTYA 2OYHA 4F1ZA 5ITBH 4HBQA 4KKPA 1K4DB 3G3LA 3MNMA 3OHXA 1OV8A 2FLBT 4X99B 4PP1C 3MCLH 2IBZG 2CJ3A 2DIBA 4WSKA 3WDJA 1ORSB 5CEXB 3LRLA 3MRLA 3NCJH 2XKNB 3ZHKA 3CVIH 3RL1B 1JGLL 1USDA 4KQ3H 4IYKA 4A2FA 1SQQJ 1OAXL 1WMKA 1MJ8L 3IMWA 1FGNH 4PRHE 2CIKB 2Q3ZA 3RGHA 1J8RA 4MJJA 4G6AD 4PJFA 4YIQA 4JDTL 3NOIA 1KCUH 3QO1B 1T21A 4YSQA 1PGPA 5JDSB 2ATAA 2OSLB 2W0FB 3L1OH 3H9HA 3SQBB 5MEQA 2JTYA 3SJVE 1I8IB 1T5XB 4LEXH 4OIIL 2XYCA 2EYTA 4Z7WA 5FV2A 3ESVF 1R5WA 1ASPA 5IFAH 3K2MC 3LNEA 2V17H 1MG3C 2B1OA 2NUPB 3VFVB 3M91A 4HHWA 3K80A 4N24A 2BW4A 3NTNA 4G9FB 5AVUB 4R5VA 3QUXD 4KXCA 2JCCE 4ONOA 3ZMEA 1EEYA 1LO4H 2J1WA 4KXZH 3OD3A 4NZJA 1GMIA 4A6YB 4OLEA 3BFOA 4APQD 5IJKA 1IM9A 2UXTA 5IHUL 4IRSD 3EWKA 4G82A 5IUCA 2FQDA 2D0HA 1XTGB 4FEMA 1P53A 1HQRA 1MJUH 3IDJB 5K39A 4ODHH 4ZBJA 4EJ1C 3BKJL 2IV9A 2N59A 5EDSA 2BVOB 4J3OH 3A4DA 4AH2B 3W2DL 3UROR 1T5KA 5AW0B 2BZDA 3L71D 4JW3A 3V0VA 4UNTA 5B5EH 4IKIA 1FZJA 4MMYA 4ODWB 2WLJA 4DP8X 1KDJA 4KC3B 3TBWA 3RUGB