1SQVG

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqvG00
3L72G 3L75G 2A06G 3H1JG 1KYOH 1PP9G 3L70G 1BCCG 5KLVG 1SQPG 3H1KG 3H1LG 1L0NG 1NTKG 3CWBG 1BGYG 3H1HG 2FYUG 1PPJG 3H1IG 1BE3G 1SQBG 3CX5H 4PD4H 2IBZG 3TGUG 4D6TG 2BCCG 3BCCG 3CXHH 3L73G 1EZVG 3L71G 1KB9H 1NU1G 1SQQG 1NTMG 1SQXG 4U3FG 3L74G 1NTZG 1SQVG 1P84H 1L0LG
chains in the Genus database with same CATH superfamily
1N86A 1Y9BA 1CZQA 1BGYE 1NU1K 3L72J 3M9HA 2KOGA 4WY4C 1W2BO 1USDA 1S4XA 3AECC 3G3ZA 4OGQB 4Y99B 3P7KA 2FY8A 1ZRTD 3ABVC 2BASA 5AW4B 4Y99C 2QA4P 1YTZT 3H1KG 1HGVA 3LW5J 4AYCA 4KHXA 2I1JA 1FJPA 1Q81Q 1VF5B 1HVVA 2A06E 1Y47A 1KFMA 2HODA 2I8DA 2Q5UA 5AW9B 3USSA 2FFDC 1QL2A 1VL2A 1SQVD 2CK3H 2JDIH 2OTJP 2WT7B 3W67A 2E76D 1XTCC 2FFDA 1IJDB 2N1TD 2E43A 3HD7D 1JUNA 3RL0g 2AXCA 1N73A 3L71G 4WY4D 4JYCA 1BDDA 1P84E 1ZOYC 2RMZA 4UB8H 4EIJA 3L72E 1NKNA 1JTHA 2HLOA 3WUUA 2ZYDA 2D2CB 1PV3A 1EDJA 2Y0DA 2YNYA 3M0DC 4XFJA 3CC7P 2KLUA 3MUDC 4OGQC 3V5BA 1FDIA 1NTZD 3H1JD 2FYUE 3HTKA 3I55P 2H89C 1BCCG 1PGPA 2YMYA 3L70D 1BCCJ 2WPQA 1VQLP 3CCRP 2WSEJ 2ZYGA 1OMIA 5KLIB 1JCDA 4H13D 3AEEC 4H44D 3TNUA 3M0AA 2KP8A 5AVUB 2WTYA 2LR2A 1JY2N 2KXPB 3KQGA 4W7ZA 1HUCA 1YIJP 4L74A 1P84I 3BASA 5E79H 1NTMJ 4WWIA 3MD0A 4N3YB 3O6QB 1GL2B 1SQXK 1PP9J 4UB8E 5AW2B 2WSEH 1X22A 3AE5C 1IZNB 3L72D 1QGKB 3GF3A 2GUSA 5TJHA 3U1CA 1CSBA 5KLVE 3BCCD 4HJGH 4I1LA 1H89A 3BATA 1E5WA 3AE8C 3EWKA 1IFNA 1L0NE 2XZRA 2KIKA 3HD7A 1LWUC 2A06D 1JOCA 2XDJA 3LW5H 2YKOA 3BCCE 2QJYB 1ZR4A 3CCEP 1E79H 2JR8A 1WRGA 3B5NA 1L0NG 1WMKA 3SFEC 3H1LD 3E7KA 4HKZH 4BWNA 4DCKA 2OYIB 1ZN5A 1ZRTE 3H32B 1SQQK 4RO0A 2E75C 1FC2C 2H43A 2OYIA 3II6A 2A45I 3HUSC 3V2RA 3GW6A 3TGUG 2K88A 3VMZA 1KILA 3CCUP 1R5SA 3M06A 2WMMA 2E5YA 1NU1G 4BRYA 3TGUE 1N7SA 2O3JA 1NO4A 4XA4A 2WZ7A 4JBZA 1LGHB 4C7NA 1L0ND 2YIUC 1NTZG 2R3SA 1LWUA 3Q5SA 2XU6A 3PHLA 1K9MQ 5AW1B 1FU1A 1EDKA 4UB6E 1RY3A 2AEMA 1G1IA 3L70G 1OWAA 2VRSA 5KLVJ 1VQNP 3O6QA 5KJ7C 5KLVG 1KYOD 1RE3A 1MZ9A 2IBZI 1D7MA 1SFCD 2J58A 3AEFC 1IFPA 2OTKE 2AXTE 4H44C 3CLQA 5TISH 1VQOP 2C9NY 3H1KE 3H1HG 2YMKA 3HD7B 3H1HJ 1PP9D 3N7NA 2OGUA 3SWFA 1LTGC 2W27A 3T97A 2ITAA 2JWDA 2MJZA 4A7PA 1SQQJ 2N9YB 1BE3E 1JO5A 1FZCA 4ZMDA 3UIAA 1KN7A 1SQQG 3EQ2A 2NPSA 3L71D 1Q90D 3CWBD 2E74D 1MV8A 2QVAA 4TT3H 4OH8B 2K37A 5KAIE 2A45G 4DJGA 3VYIA 1H8AA 3HD7C 3C1LA 2MKVA 4NPFX 2FYUD 5C39A 3SFDC 4NPDA 2I1KA 3WU2E 3RK2B 1X9VA 3L74D 3L75G 2HR3A 2A06G 2N9BA 3B8EB 4H13B 4WY4B 3RL0D 4UB6H 3H1JG 1FDOA 1N2DC 1BGYJ 1LTBC 1PGQA 1PP9G 1LT9A 2DW3A 3P8MC 3QH9A 4BRYB 3P8CD 4I2LC 1L0NK 2H7HA 3IF4A 1GMJA 3MTUE 4HB1A 2LXBA 2YO2A 3CWBG 1ZXGA 3C8VA 2BCCJ 5M1BA 1YITP 1N73C 4IL6X 1M57D 1K05A 1BE3J 5B5EH 3BRVB 2YIUB 2YO3A 4PD4H 1KC8Q 3CWBE 1SQPK 3S1KA 3CI9A 1L4AD 4ZKPA 1AQ5A 1NTZK 3QWOC 2POHA 3H1HE 3L71J 5AW0B 2M5AB 2E74B 4U3FJ 3RK2D 2PFXA 1FOSE 2AEJA 2W6AA 4PV1D 1YHQP 3PTZA 2JEEA 3VMYA 1RF0A 2O01N 1T2KD 2Y0CA 1YQ3C 1BDCA 4RKUJ 4ASWA 1M1JA 3L72G 5BU5A 4IFMA 5AW3B 4PD4I 1AFOA 3H1KJ 4N78E 4OWFA 3RK3D 1M1JB 1FE6A 1KILB 2N1TA 1ZR2A 1HH0A 3CCMP 2WQYC 1SVFA 3KPEA 4W80A 1IK9A 4LC1A 1FZCC 1NU1E 3B71A 2E75D 1BCCE 2WSCH 2ZJSE 1QLED 3VOPA 2QJPC 3CCLP 1KQSO 1KB9E 2RN0A 3TGUD 3AE9C 2FYNC 3CD6P 1ZLLA 1JY3P 3L35A 3OAKA 4DZOA 2YKQA 1DEEG 2PRRA 2E74C 2IPPA 3RL0C 3CPWO 1VQMP 4WB4A 1OVUA 1LT9C 2Y0EA 4GOEA 1VQ5P 1L0LJ 3L74G 3L75D 1R8EA 2CPBA 2QM8A 4EDFA 1L0LG 3L74J 4L76A 4U3FE 3CC4P 3AEGC 2HPCA 2E75B 3L36A 4GT1A 2QJKB 4I7ZC 4R4LA 2KS1A 3GMAA 2M0BA 2RKLA 3B5NB 3K5BA 3AEDC 1OXZA 4BXLA 5CMZA 1YJNP 1SQXD 3TSIA 5APVA 4Y28J 1VQ7P 1L4AC 1PGOA 2B87B 2GUVA 2WVRA 2ZVOB 2PP6A 3F89A 3GHGC 4M3LA 4AQRD 3BCCJ 1S9KD 1NJIQ 1NTKG 3A0BH 3G6EP 1NYHA 1NTME 4ASVA 4H0LB 1CI6A 1KB9I 1SQBJ 1RQUA 2KNCB 1LJ2A 2K9JA 2IDBA 3JSVC 3L73D 3D71A 1LT1A 1N7SB 1SQVK 2KZJA 4IL6E 3AE4C 1JM0A 1LTJB 2J5UA 1SQXJ 2HYNA 4YPCA 3A0BE 1SQXG 2O01J 3B5ND 2Z5IA 2QSIA 3LIEA 4R4MA 2R44A 3W68A 3Q2YA 1N7LA 3V2PA 1RE4A 4D6TE 2KZIA 2P67A 1NGMB 5CJ4A 1QVGO 3L37A 1EZVE 3SSUA 4Z1MH 1M56D 1WT6A 2BEQD 2P2UA 3M0DA 3A5TA 1JY3N 1RQVA 3Q5RA 2PAJA 1EXJA 1IO4A 3D70A 1OVRA 2ZYAA 2WITA 1GW3A 3G9RA 5APYA 2Q3IA 2O01H 3MUDA 4IOIH 2P10A 1FBMA 1SQPE 2QJPB 3FXEA 1K04A 2ZAEB 3ZDMA 5GTHE 3CCQP 1SP4A 1KORA 2KS1B 2LKMA 4H0LC 1DD3A 1GDTA 2ZT9B 1S5LE 1IFJA 3PLNA 4OVNF 4PV1B 4GKGA 3RBZA 5CCGA 4PJ0E 3D6YA 1DIPA 3AE2C 2QM7A 1ZP0C 1XTGB 1L4AB 2W6BA 5CJ0A 5CBOA 1LTTC 3PH0A 1PGJA 1VQPP 3FWLA 2WT7A 3E1RA 1URQA 4U7JA 3B4SA 1X0TA 2XNXA 3F5HA 4L73A 5AVTB 1A02J 4N78D 2SPZA 2KK7A 1EZVI 3RK3E 5AVZB 1J2JB 2CPSA 3CCSP 2KLVA 1HJ0A 4JF7A 1KQLA 1EDLA 1PZQA 3Q3DA 2W83C 2R5DA 2E5TA 4YXWH 2G8YA 1ZMEC 1NH4A 1FZEA 1VDFA 2QG4A 2WSFJ 1BSHA 1G1JA 3Q1MA 1KQFB 2JP3A 3EFGA 3CL3D 2HPCB 1VQ9P 3T97B 1QVFO 2ZVNB 1SQBD 3MP7B 1IFMA 1KQGB 1RF0C 2O1KA 5APUA 3TDKA 1JNMA 1L0NJ 1VPCA 1YBKA 2PGDA 3EFFK 4I7ZB 3M9QA 1BSNA 1EDIA 2L5GB 1YI2P 5KLVD 3TF5A 1IC2A 4GDOA 1KILC 1GZLA 1T6AA 1LP1A 1T8ZA 2LXCB 3OW2O 1PPJE 3H1IE 4WBAA 2IFNA 5AVYB 1J1DC 4IFFA 2BEZF 4KT0J 3RK2C 1JEKA 3RL0B 2V4HA 3H1JJ 2QEXP 3AE1C 2C9LY 3HE4B 1FAVA 1L0LD 3L75J 3GF7A 3MHVA 3H1LJ 1RE3C 5AVVB 1S5LH 4JYBA 2ZFCA 4JQ0D 2KSJA 5CCGD 3G71P 5KJ7A 1YJ9P 1NWQA 1PFIA 1SQQD 3SWYA 2A45H 4EOTA 1J1EB 4DOJA 2NRGA 4H0LD 1N7SD 1USEA 3L70E 1T3UA 2FYZA 4AUWA 1NTKD 2Q3EA 2FFDB 2Z4EA 1URQC 2NPSC 3HE5B 3PRJA 1VF5D 2IBZG 1SQQE 1GK4A 1SQBK 2M3EA 2ZT9C 3GLMA 3L73G 3NTNA 4LGDE 3VP8A 2OYHB 1SQPD 3VMXA 2FXMA 1X8YA 2M3BA 2W6JH 3H1JE 1HBWA 1K8AQ 1S5LX 1HF9A 1GU4A 3D6ZA 1P84H 2N1TB 2JKVA 5AVWB 2OTLP 1NAFA 3GHGA 1P84D 1VF5C 3OJAB 3PJSK 1YQ4C 5AW6B 1G2CA 1EZVD 1NHLA 2B89A 1Y8AA 1OIPA 2BCCD 4IL6H 4PV1C 5L8RJ 3RBXA 1SQXE 2K1AA 5AVQB 5GTIE 1G2CB 1SQPG 2UWJE 2ZT9D 4LLHA 3NXSA 5B5EE 2NPSD 4GODA 1SQBE 2ZXEB 4U3FD 1RE4C 2RH0A 5APWA 4EYYQ 1LTAC 3CCJP 1BGYG 3H6PA 3HE4A 1Z56A 2FXOA 3VMAA 3IFMA 3RK3C 2WPVB 5GTIH 5KTBA 1K73Q 2XKMA 2J59M 1JB0J 1MKMA 1EZVG 2IX7C 2K9YA 4PJ0H 3M91A 2Y9YA 2FKWB 3VN0A 1DEBA 4KJMA 3HUSA 2OYHC 1DH3A 1KB9D 1OW6A 3A0HE 5GTHH 1J1EC 5CCHC 2KYVA 3LIDA 1OZHA 1LNQA 2OQQA 5E79E 5AW7B 1SQVJ 2V7QJ 2M5AA 3AEAC 2B87A 3B5NC 3JC22 4TLFA 4GOFA 1FOSF 1NTMK 3I56P 4ZKUA 1KD1Q 1SQPJ 1JMMA 2C0WA 1S72P 1J1DB 4O9BA 2FBWC 1U57A 1HTLC 2K9JB 1NOHA 2V7QH 4XE5B 2GM4A 4CPGA 5APQA 2IBZD 3C9IA 1LTJA 2E76B 3N4XA 1SQBG 2E42A 1JY3O 1NAYA 3HRNA 3BVHA 2FXPA 4JPZB 3I5CA 1KFNA 3WMM0 4D6TD 3A7OA 5CCHD 1BCCD 2AXTH 2QJYC 5TISE 3CMEP 2W8ZA 2HG5D 1RHZB 1SQVE 4DT0A 2IFMA 5APXA 1Q2NA 2QIWA 1DX7A 1U7JA 1NKZB 1PIXA 3GG2A 1M7LA 5EFWB 1EXIA 3KYQA 4MN4C 3CX5D 2D2CD 1KILD 1TU3F 1RF1A 3H32A 3AE6C 3HE5A 1KTMA 3HUSB 4WVZA 5AVSB 3V6IA 1GU5A 1HGZA 1UIIA 1OW8A 1H88A 3L73E 3AEBC 3FGAD 1BGYD 3Q5PA 1NTKK 1RF1C 3A0HH 3TGUJ 2YXRB 5AVRB 1MFTA 3WU2H 2OARA 1YJWP 1M8OB 1URQD 3H1IJ 5KAFH 3VP9A 1DD4A 3OA7A 1GK6A 1OW7A 1PPJG 1SFCC 3H1IG 1MFZA 3L4FA 3RGUA 4ZNCA 1M90Q 1EC5A 5KJ7D 3BCCG 3H25A 3O8ZA 1L0LK 2KI7B 4QMAA 4W7YA 2P1JA 4RJTA 3KXDA 1NTMG 4I6MC 4OGQD 1N73B 3MIWA 3NMDA 2Y9ZA 2KNCA 1OFCX 3FXDA 1VQ4P 1H0TB 4NPEA 1JCCA 1YTZI 1YYCA 5APTA 5KLVK 1KV4A 4PD4D 1H0TA 5KKZB 2JO1A 4YXDC 1CW5A 1GL2A 3L74E 4HYTB 1FZGA 3CX5E 1UIXA 1JY2O 1SS1A 1SLQA 2GA1A 2KSEA 4H13C 1FZBA 1Q7YQ 1VQKP 3TYYA 1S9KE 3HTKB 2WWWA 1PL5A 3FWNA 4K3AA 3TK1A 1ZW0A 1AVOA 1OVVA 2Z5HA 1RH5B 2ZXXA 3CXHD 3V4WA 3AE7C 5BU8B 3FX0A 2WSCJ 5KKZC 3CCVP 2OYHA 2KUBA 1W2EA 5CCGC 1N7SC 1NTKJ 3CX5H 4D6TG 1LTJC 1LP1B 1KYOI 3JCUE 3TNUB 1QL1A 3IR9A 5AW8B 1AV1A 3L75E 2R3CA 1CI6B 5DJUB 3CMAP 5DJTB 4IFDK 1S3JA 2W90A 2WSSH 2IZ1A 2D2CC 1KILE 1JMBA 5BVZA 3NFQA 1FZFA 1LT9B 2B9BA 2WSFH 3MZWB 3GHGB 5KAFE 4C7RA 1AA0A 1NTZJ 3KZIH 3H1HD 3WUTA 1S2EA 2B88A 2JJLA 2P7JA 2Q1KA 2WPRA 3A3YB 2YXQB 1L4AA 1IFIA 2AEFA 2P58A 1FS0E 2QJKC 3CX5I 2HODB 3L71E 3CWBJ 1KYOH 2WPSA 3V4QA 1ZV8A 2L91A 1AVYA 2JWAA 3CXHE 5H2FH 3IAOA 1GW4A 1T3JA 1JTHB 3R2PA 4H44B 2NZ2A 1PP9E 3S9OA 1Q86Q 1Q82Q 3KZIE 1KZUB 2IYOA 3P8CE 3SWKA 3H1KD 2QE7H 2M8RA 3L73J 3P32A 1S1CX 2FYUG 3MGNA 5KAIH 1SFCB 3M9BA 1GL2D 2FYNB 1IFDA 1GTWA 1KYOE 1LTSC 5CBNA 3CXHH 5H2FE 1OX3A 5B66H 1NTMD 2H88C 1N8RQ 2Q9IA 1RF1B 1QEXA 3V2QA 2O1JA 1AQTA 1KB9H 1X79B 2G3AA 2HFED 2R32A 2Q7CA 2OYIC 2XNDH 2IYPA 1NU1J 3U59A 2QRXA 2K3RA 1LTIC 1BE3D 2C0XA 1FZCB 3V2NA 2E76C 2NPSB 1NVOA 4C7NB 4C46A 1FJKA 2YKPA 5APSA 1KMIZ 1URQB 1LWUB 3WUVA 1T2KC 3CXHI 1M1JC 3A2AA 2OYOA 3ITKA 5CCHA 1HJBA 3S4RA 1R5LA 4RESB 1QX8A 3L70J 3E1IA 4YTPC 1FZAA 3IN6A 2XV5A 1NTZE 1EQ7A 1JY2P 1GL2C 3H1LG 4WY4A 1L0LE 2H8PD 4GIFA 4EI2A 1FDMA 2IBZE 2FYUK 3VTPC 1GD2E 2FYUJ 1IK7A 3KHUA 3H1LE 1BE3G 1PPJD 3H1ID 3JCUH 3KDPB 3R4YA 1VQ8P 3CC2P 2BCCG 4K35A 3U1AA 1M1KQ 2IZ0A 4HH2A 3BRTB 5CHXA 1NU1D 5AW5B 5B66E 1NTKE 4PD4E 1HWTC 2BCCE 1W5CE 2Q6QA 5KLIC 1MUUA 1VQ6P 1U7MA 4D6TJ 4U3FG 3G4SP 1AJYA 4N6JA 1A02F 4B86A 4L75A 5AVXB 3AE3C 1SFCA 2R5BA 2KB7P 5K5GB 1L2PA 2N1TC 1SQVG 3RK3B 3PP5A
chains in the Genus database with same CATH topology
3L72G 3L75G 2A06G 3H1JG 1KYOH 1PP9G 3L70G 1BCCG 5KLVG 1SQPG 3H1KG 3H1LG 1L0NG 1NTKG 3CWBG 1BGYG 3H1HG 2FYUG 1PPJG 3H1IG 1BE3G 1SQBG 3CX5H 4PD4H 2IBZG 3TGUG 4D6TG 2BCCG 3BCCG 3CXHH 3L73G 1EZVG 3L71G 1KB9H 1NU1G 1SQQG 1NTMG 1SQXG 4U3FG 3L74G 1NTZG 1SQVG 1P84H 1L0LG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 G;  3L75 G;  2A06 G;  3H1J G;  1KYO H;  1PP9 G;  3L70 G;  1BCC G;  5KLV G;  1SQP G;  3H1K G;  3H1L G;  1L0N G;  1NTK G;  3CWB G;  1BGY G;  3H1H G;  2FYU G;  1PPJ G;  3H1I G;  1BE3 G;  1SQB G;  3CX5 H;  4PD4 H;  2IBZ G;  3TGU G;  4D6T G;  2BCC G;  3BCC G;  3CXH H;  3L73 G;  1EZV G;  3L71 G;  1KB9 H;  1NU1 G;  1SQQ G;  1NTM G;  1SQX G;  4U3F G;  3L74 G;  1NTZ G;  1SQV G;  1P84 H;  1L0L G; 
#chains in the Genus database with same CATH topology
 1N86 A;  1Y9B A;  1CZQ A;  1BGY E;  1NU1 K;  3L72 J;  3M9H A;  2KOG A;  4WY4 C;  1W2B O;  1USD A;  1S4X A;  3AEC C;  3G3Z A;  4OGQ B;  4Y99 B;  3P7K A;  2FY8 A;  1ZRT D;  3ABV C;  2BAS A;  5AW4 B;  4Y99 C;  2QA4 P;  1YTZ T;  3H1K G;  1HGV A;  3LW5 J;  4AYC A;  4KHX A;  2I1J A;  1FJP A;  1Q81 Q;  1VF5 B;  1HVV A;  2A06 E;  1Y47 A;  1KFM A;  2HOD A;  2I8D A;  2Q5U A;  5AW9 B;  3USS A;  2FFD C;  1QL2 A;  1VL2 A;  1SQV D;  2CK3 H;  2JDI H;  2OTJ P;  2WT7 B;  3W67 A;  2E76 D;  1XTC C;  2FFD A;  1IJD B;  2N1T D;  2E43 A;  3HD7 D;  1JUN A;  3RL0 g;  2AXC A;  1N73 A;  3L71 G;  4WY4 D;  4JYC A;  1BDD A;  1P84 E;  1ZOY C;  2RMZ A;  4UB8 H;  4EIJ A;  3L72 E;  1NKN A;  1JTH A;  2HLO A;  3WUU A;  2ZYD A;  2D2C B;  1PV3 A;  1EDJ A;  2Y0D A;  2YNY A;  3M0D C;  4XFJ A;  3CC7 P;  2KLU A;  3MUD C;  4OGQ C;  3V5B A;  1FDI A;  1NTZ D;  3H1J D;  2FYU E;  3HTK A;  3I55 P;  2H89 C;  1BCC G;  1PGP A;  2YMY A;  3L70 D;  1BCC J;  2WPQ A;  1VQL P;  3CCR P;  2WSE J;  2ZYG A;  1OMI A;  5KLI B;  1JCD A;  4H13 D;  3AEE C;  4H44 D;  3TNU A;  3M0A A;  2KP8 A;  5AVU B;  2WTY A;  2LR2 A;  1JY2 N;  2KXP B;  3KQG A;  4W7Z A;  1HUC A;  1YIJ P;  4L74 A;  1P84 I;  3BAS A;  5E79 H;  1NTM J;  4WWI A;  3MD0 A;  4N3Y B;  3O6Q B;  1GL2 B;  1SQX K;  1PP9 J;  4UB8 E;  5AW2 B;  2WSE H;  1X22 A;  3AE5 C;  1IZN B;  3L72 D;  1QGK B;  3GF3 A;  2GUS A;  5TJH A;  3U1C A;  1CSB A;  5KLV E;  3BCC D;  4HJG H;  4I1L A;  1H89 A;  3BAT A;  1E5W A;  3AE8 C;  3EWK A;  1IFN A;  1L0N E;  2XZR A;  2KIK A;  3HD7 A;  1LWU C;  2A06 D;  1JOC A;  2XDJ A;  3LW5 H;  2YKO A;  3BCC E;  2QJY B;  1ZR4 A;  3CCE P;  1E79 H;  2JR8 A;  1WRG A;  3B5N A;  1L0N G;  1WMK A;  3SFE C;  3H1L D;  3E7K A;  4HKZ H;  4BWN A;  4DCK A;  2OYI B;  1ZN5 A;  1ZRT E;  3H32 B;  1SQQ K;  4RO0 A;  2E75 C;  1FC2 C;  2H43 A;  2OYI A;  3II6 A;  2A45 I;  3HUS C;  3V2R A;  3GW6 A;  3TGU G;  2K88 A;  3VMZ A;  1KIL A;  3CCU P;  1R5S A;  3M06 A;  2WMM A;  2E5Y A;  1NU1 G;  4BRY A;  3TGU E;  1N7S A;  2O3J A;  1NO4 A;  4XA4 A;  2WZ7 A;  4JBZ A;  1LGH B;  4C7N A;  1L0N D;  2YIU C;  1NTZ G;  2R3S A;  1LWU A;  3Q5S A;  2XU6 A;  3PHL A;  1K9M Q;  5AW1 B;  1FU1 A;  1EDK A;  4UB6 E;  1RY3 A;  2AEM A;  1G1I A;  3L70 G;  1OWA A;  2VRS A;  5KLV J;  1VQN P;  3O6Q A;  5KJ7 C;  5KLV G;  1KYO D;  1RE3 A;  1MZ9 A;  2IBZ I;  1D7M A;  1SFC D;  2J58 A;  3AEF C;  1IFP A;  2OTK E;  2AXT E;  4H44 C;  3CLQ A;  5TIS H;  1VQO P;  2C9N Y;  3H1K E;  3H1H G;  2YMK A;  3HD7 B;  3H1H J;  1PP9 D;  3N7N A;  2OGU A;  3SWF A;  1LTG C;  2W27 A;  3T97 A;  2ITA A;  2JWD A;  2MJZ A;  4A7P A;  1SQQ J;  2N9Y B;  1BE3 E;  1JO5 A;  1FZC A;  4ZMD A;  3UIA A;  1KN7 A;  1SQQ G;  3EQ2 A;  2NPS A;  3L71 D;  1Q90 D;  3CWB D;  2E74 D;  1MV8 A;  2QVA A;  4TT3 H;  4OH8 B;  2K37 A;  5KAI E;  2A45 G;  4DJG A;  3VYI A;  1H8A A;  3HD7 C;  3C1L A;  2MKV A;  4NPF X;  2FYU D;  5C39 A;  3SFD C;  4NPD A;  2I1K A;  3WU2 E;  3RK2 B;  1X9V A;  3L74 D;  3L75 G;  2HR3 A;  2A06 G;  2N9B A;  3B8E B;  4H13 B;  4WY4 B;  3RL0 D;  4UB6 H;  3H1J G;  1FDO A;  1N2D C;  1BGY J;  1LTB C;  1PGQ A;  1PP9 G;  1LT9 A;  2DW3 A;  3P8M C;  3QH9 A;  4BRY B;  3P8C D;  4I2L C;  1L0N K;  2H7H A;  3IF4 A;  1GMJ A;  3MTU E;  4HB1 A;  2LXB A;  2YO2 A;  3CWB G;  1ZXG A;  3C8V A;  2BCC J;  5M1B A;  1YIT P;  1N73 C;  4IL6 X;  1M57 D;  1K05 A;  1BE3 J;  5B5E H;  3BRV B;  2YIU B;  2YO3 A;  4PD4 H;  1KC8 Q;  3CWB E;  1SQP K;  3S1K A;  3CI9 A;  1L4A D;  4ZKP A;  1AQ5 A;  1NTZ K;  3QWO C;  2POH A;  3H1H E;  3L71 J;  5AW0 B;  2M5A B;  2E74 B;  4U3F J;  3RK2 D;  2PFX A;  1FOS E;  2AEJ A;  2W6A A;  4PV1 D;  1YHQ P;  3PTZ A;  2JEE A;  3VMY A;  1RF0 A;  2O01 N;  1T2K D;  2Y0C A;  1YQ3 C;  1BDC A;  4RKU J;  4ASW A;  1M1J A;  3L72 G;  5BU5 A;  4IFM A;  5AW3 B;  4PD4 I;  1AFO A;  3H1K J;  4N78 E;  4OWF A;  3RK3 D;  1M1J B;  1FE6 A;  1KIL B;  2N1T A;  1ZR2 A;  1HH0 A;  3CCM P;  2WQY C;  1SVF A;  3KPE A;  4W80 A;  1IK9 A;  4LC1 A;  1FZC C;  1NU1 E;  3B71 A;  2E75 D;  1BCC E;  2WSC H;  2ZJS E;  1QLE D;  3VOP A;  2QJP C;  3CCL P;  1KQS O;  1KB9 E;  2RN0 A;  3TGU D;  3AE9 C;  2FYN C;  3CD6 P;  1ZLL A;  1JY3 P;  3L35 A;  3OAK A;  4DZO A;  2YKQ A;  1DEE G;  2PRR A;  2E74 C;  2IPP A;  3RL0 C;  3CPW O;  1VQM P;  4WB4 A;  1OVU A;  1LT9 C;  2Y0E A;  4GOE A;  1VQ5 P;  1L0L J;  3L74 G;  3L75 D;  1R8E A;  2CPB A;  2QM8 A;  4EDF A;  1L0L G;  3L74 J;  4L76 A;  4U3F E;  3CC4 P;  3AEG C;  2HPC A;  2E75 B;  3L36 A;  4GT1 A;  2QJK B;  4I7Z C;  4R4L A;  2KS1 A;  3GMA A;  2M0B A;  2RKL A;  3B5N B;  3K5B A;  3AED C;  1OXZ A;  4BXL A;  5CMZ A;  1YJN P;  1SQX D;  3TSI A;  5APV A;  4Y28 J;  1VQ7 P;  1L4A C;  1PGO A;  2B87 B;  2GUV A;  2WVR A;  2ZVO B;  2PP6 A;  3F89 A;  3GHG C;  4M3L A;  4AQR D;  3BCC J;  1S9K D;  1NJI Q;  1NTK G;  3A0B H;  3G6E P;  1NYH A;  1NTM E;  4ASV A;  4H0L B;  1CI6 A;  1KB9 I;  1SQB J;  1RQU A;  2KNC B;  1LJ2 A;  2K9J A;  2IDB A;  3JSV C;  3L73 D;  3D71 A;  1LT1 A;  1N7S B;  1SQV K;  2KZJ A;  4IL6 E;  3AE4 C;  1JM0 A;  1LTJ B;  2J5U A;  1SQX J;  2HYN A;  4YPC A;  3A0B E;  1SQX G;  2O01 J;  3B5N D;  2Z5I A;  2QSI A;  3LIE A;  4R4M A;  2R44 A;  3W68 A;  3Q2Y A;  1N7L A;  3V2P A;  1RE4 A;  4D6T E;  2KZI A;  2P67 A;  1NGM B;  5CJ4 A;  1QVG O;  3L37 A;  1EZV E;  3SSU A;  4Z1M H;  1M56 D;  1WT6 A;  2BEQ D;  2P2U A;  3M0D A;  3A5T A;  1JY3 N;  1RQV A;  3Q5R A;  2PAJ A;  1EXJ A;  1IO4 A;  3D70 A;  1OVR A;  2ZYA A;  2WIT A;  1GW3 A;  3G9R A;  5APY A;  2Q3I A;  2O01 H;  3MUD A;  4IOI H;  2P10 A;  1FBM A;  1SQP E;  2QJP B;  3FXE A;  1K04 A;  2ZAE B;  3ZDM A;  5GTH E;  3CCQ P;  1SP4 A;  1KOR A;  2KS1 B;  2LKM A;  4H0L C;  1DD3 A;  1GDT A;  2ZT9 B;  1S5L E;  1IFJ A;  3PLN A;  4OVN F;  4PV1 B;  4GKG A;  3RBZ A;  5CCG A;  4PJ0 E;  3D6Y A;  1DIP A;  3AE2 C;  2QM7 A;  1ZP0 C;  1XTG B;  1L4A B;  2W6B A;  5CJ0 A;  5CBO A;  1LTT C;  3PH0 A;  1PGJ A;  1VQP P;  3FWL A;  2WT7 A;  3E1R A;  1URQ A;  4U7J A;  3B4S A;  1X0T A;  2XNX A;  3F5H A;  4L73 A;  5AVT B;  1A02 J;  4N78 D;  2SPZ A;  2KK7 A;  1EZV I;  3RK3 E;  5AVZ B;  1J2J B;  2CPS A;  3CCS P;  2KLV A;  1HJ0 A;  4JF7 A;  1KQL A;  1EDL A;  1PZQ A;  3Q3D A;  2W83 C;  2R5D A;  2E5T A;  4YXW H;  2G8Y A;  1ZME C;  1NH4 A;  1FZE A;  1VDF A;  2QG4 A;  2WSF J;  1BSH A;  1G1J A;  3Q1M A;  1KQF B;  2JP3 A;  3EFG A;  3CL3 D;  2HPC B;  1VQ9 P;  3T97 B;  1QVF O;  2ZVN B;  1SQB D;  3MP7 B;  1IFM A;  1KQG B;  1RF0 C;  2O1K A;  5APU A;  3TDK A;  1JNM A;  1L0N J;  1VPC A;  1YBK A;  2PGD A;  3EFF K;  4I7Z B;  3M9Q A;  1BSN A;  1EDI A;  2L5G B;  1YI2 P;  5KLV D;  3TF5 A;  1IC2 A;  4GDO A;  1KIL C;  1GZL A;  1T6A A;  1LP1 A;  1T8Z A;  2LXC B;  3OW2 O;  1PPJ E;  3H1I E;  4WBA A;  2IFN A;  5AVY B;  1J1D C;  4IFF A;  2BEZ F;  4KT0 J;  3RK2 C;  1JEK A;  3RL0 B;  2V4H A;  3H1J J;  2QEX P;  3AE1 C;  2C9L Y;  3HE4 B;  1FAV A;  1L0L D;  3L75 J;  3GF7 A;  3MHV A;  3H1L J;  1RE3 C;  5AVV B;  1S5L H;  4JYB A;  2ZFC A;  4JQ0 D;  2KSJ A;  5CCG D;  3G71 P;  5KJ7 A;  1YJ9 P;  1NWQ A;  1PFI A;  1SQQ D;  3SWY A;  2A45 H;  4EOT A;  1J1E B;  4DOJ A;  2NRG A;  4H0L D;  1N7S D;  1USE A;  3L70 E;  1T3U A;  2FYZ A;  4AUW A;  1NTK D;  2Q3E A;  2FFD B;  2Z4E A;  1URQ C;  2NPS C;  3HE5 B;  3PRJ A;  1VF5 D;  2IBZ G;  1SQQ E;  1GK4 A;  1SQB K;  2M3E A;  2ZT9 C;  3GLM A;  3L73 G;  3NTN A;  4LGD E;  3VP8 A;  2OYH B;  1SQP D;  3VMX A;  2FXM A;  1X8Y A;  2M3B A;  2W6J H;  3H1J E;  1HBW A;  1K8A Q;  1S5L X;  1HF9 A;  1GU4 A;  3D6Z A;  1P84 H;  2N1T B;  2JKV A;  5AVW B;  2OTL P;  1NAF A;  3GHG A;  1P84 D;  1VF5 C;  3OJA B;  3PJS K;  1YQ4 C;  5AW6 B;  1G2C A;  1EZV D;  1NHL A;  2B89 A;  1Y8A A;  1OIP A;  2BCC D;  4IL6 H;  4PV1 C;  5L8R J;  3RBX A;  1SQX E;  2K1A A;  5AVQ B;  5GTI E;  1G2C B;  1SQP G;  2UWJ E;  2ZT9 D;  4LLH A;  3NXS A;  5B5E E;  2NPS D;  4GOD A;  1SQB E;  2ZXE B;  4U3F D;  1RE4 C;  2RH0 A;  5APW A;  4EYY Q;  1LTA C;  3CCJ P;  1BGY G;  3H6P A;  3HE4 A;  1Z56 A;  2FXO A;  3VMA A;  3IFM A;  3RK3 C;  2WPV B;  5GTI H;  5KTB A;  1K73 Q;  2XKM A;  2J59 M;  1JB0 J;  1MKM A;  1EZV G;  2IX7 C;  2K9Y A;  4PJ0 H;  3M91 A;  2Y9Y A;  2FKW B;  3VN0 A;  1DEB A;  4KJM A;  3HUS A;  2OYH C;  1DH3 A;  1KB9 D;  1OW6 A;  3A0H E;  5GTH H;  1J1E C;  5CCH C;  2KYV A;  3LID A;  1OZH A;  1LNQ A;  2OQQ A;  5E79 E;  5AW7 B;  1SQV J;  2V7Q J;  2M5A A;  3AEA C;  2B87 A;  3B5N C;  3JC2 2;  4TLF A;  4GOF A;  1FOS F;  1NTM K;  3I56 P;  4ZKU A;  1KD1 Q;  1SQP J;  1JMM A;  2C0W A;  1S72 P;  1J1D B;  4O9B A;  2FBW C;  1U57 A;  1HTL C;  2K9J B;  1NOH A;  2V7Q H;  4XE5 B;  2GM4 A;  4CPG A;  5APQ A;  2IBZ D;  3C9I A;  1LTJ A;  2E76 B;  3N4X A;  1SQB G;  2E42 A;  1JY3 O;  1NAY A;  3HRN A;  3BVH A;  2FXP A;  4JPZ B;  3I5C A;  1KFN A;  3WMM 0;  4D6T D;  3A7O A;  5CCH D;  1BCC D;  2AXT H;  2QJY C;  5TIS E;  3CME P;  2W8Z A;  2HG5 D;  1RHZ B;  1SQV E;  4DT0 A;  2IFM A;  5APX A;  1Q2N A;  2QIW A;  1DX7 A;  1U7J A;  1NKZ B;  1PIX A;  3GG2 A;  1M7L A;  5EFW B;  1EXI A;  3KYQ A;  4MN4 C;  3CX5 D;  2D2C D;  1KIL D;  1TU3 F;  1RF1 A;  3H32 A;  3AE6 C;  3HE5 A;  1KTM A;  3HUS B;  4WVZ A;  5AVS B;  3V6I A;  1GU5 A;  1HGZ A;  1UII A;  1OW8 A;  1H88 A;  3L73 E;  3AEB C;  3FGA D;  1BGY D;  3Q5P A;  1NTK K;  1RF1 C;  3A0H H;  3TGU J;  2YXR B;  5AVR B;  1MFT A;  3WU2 H;  2OAR A;  1YJW P;  1M8O B;  1URQ D;  3H1I J;  5KAF H;  3VP9 A;  1DD4 A;  3OA7 A;  1GK6 A;  1OW7 A;  1PPJ G;  1SFC C;  3H1I G;  1MFZ A;  3L4F A;  3RGU A;  4ZNC A;  1M90 Q;  1EC5 A;  5KJ7 D;  3BCC G;  3H25 A;  3O8Z A;  1L0L K;  2KI7 B;  4QMA A;  4W7Y A;  2P1J A;  4RJT A;  3KXD A;  1NTM G;  4I6M C;  4OGQ D;  1N73 B;  3MIW A;  3NMD A;  2Y9Z A;  2KNC A;  1OFC X;  3FXD A;  1VQ4 P;  1H0T B;  4NPE A;  1JCC A;  1YTZ I;  1YYC A;  5APT A;  5KLV K;  1KV4 A;  4PD4 D;  1H0T A;  5KKZ B;  2JO1 A;  4YXD C;  1CW5 A;  1GL2 A;  3L74 E;  4HYT B;  1FZG A;  3CX5 E;  1UIX A;  1JY2 O;  1SS1 A;  1SLQ A;  2GA1 A;  2KSE A;  4H13 C;  1FZB A;  1Q7Y Q;  1VQK P;  3TYY A;  1S9K E;  3HTK B;  2WWW A;  1PL5 A;  3FWN A;  4K3A A;  3TK1 A;  1ZW0 A;  1AVO A;  1OVV A;  2Z5H A;  1RH5 B;  2ZXX A;  3CXH D;  3V4W A;  3AE7 C;  5BU8 B;  3FX0 A;  2WSC J;  5KKZ C;  3CCV P;  2OYH A;  2KUB A;  1W2E A;  5CCG C;  1N7S C;  1NTK J;  3CX5 H;  4D6T G;  1LTJ C;  1LP1 B;  1KYO I;  3JCU E;  3TNU B;  1QL1 A;  3IR9 A;  5AW8 B;  1AV1 A;  3L75 E;  2R3C A;  1CI6 B;  5DJU B;  3CMA P;  5DJT B;  4IFD K;  1S3J A;  2W90 A;  2WSS H;  2IZ1 A;  2D2C C;  1KIL E;  1JMB A;  5BVZ A;  3NFQ A;  1FZF A;  1LT9 B;  2B9B A;  2WSF H;  3MZW B;  3GHG B;  5KAF E;  4C7R A;  1AA0 A;  1NTZ J;  3KZI H;  3H1H D;  3WUT A;  1S2E A;  2B88 A;  2JJL A;  2P7J A;  2Q1K A;  2WPR A;  3A3Y B;  2YXQ B;  1L4A A;  1IFI A;  2AEF A;  2P58 A;  1FS0 E;  2QJK C;  3CX5 I;  2HOD B;  3L71 E;  3CWB J;  1KYO H;  2WPS A;  3V4Q A;  1ZV8 A;  2L91 A;  1AVY A;  2JWA A;  3CXH E;  5H2F H;  3IAO A;  1GW4 A;  1T3J A;  1JTH B;  3R2P A;  4H44 B;  2NZ2 A;  1PP9 E;  3S9O A;  1Q86 Q;  1Q82 Q;  3KZI E;  1KZU B;  2IYO A;  3P8C E;  3SWK A;  3H1K D;  2QE7 H;  2M8R A;  3L73 J;  3P32 A;  1S1C X;  2FYU G;  3MGN A;  5KAI H;  1SFC B;  3M9B A;  1GL2 D;  2FYN B;  1IFD A;  1GTW A;  1KYO E;  1LTS C;  5CBN A;  3CXH H;  5H2F E;  1OX3 A;  5B66 H;  1NTM D;  2H88 C;  1N8R Q;  2Q9I A;  1RF1 B;  1QEX A;  3V2Q A;  2O1J A;  1AQT A;  1KB9 H;  1X79 B;  2G3A A;  2HFE D;  2R32 A;  2Q7C A;  2OYI C;  2XND H;  2IYP A;  1NU1 J;  3U59 A;  2QRX A;  2K3R A;  1LTI C;  1BE3 D;  2C0X A;  1FZC B;  3V2N A;  2E76 C;  2NPS B;  1NVO A;  4C7N B;  4C46 A;  1FJK A;  2YKP A;  5APS A;  1KMI Z;  1URQ B;  1LWU B;  3WUV A;  1T2K C;  3CXH I;  1M1J C;  3A2A A;  2OYO A;  3ITK A;  5CCH A;  1HJB A;  3S4R A;  1R5L A;  4RES B;  1QX8 A;  3L70 J;  3E1I A;  4YTP C;  1FZA A;  3IN6 A;  2XV5 A;  1NTZ E;  1EQ7 A;  1JY2 P;  1GL2 C;  3H1L G;  4WY4 A;  1L0L E;  2H8P D;  4GIF A;  4EI2 A;  1FDM A;  2IBZ E;  2FYU K;  3VTP C;  1GD2 E;  2FYU J;  1IK7 A;  3KHU A;  3H1L E;  1BE3 G;  1PPJ D;  3H1I D;  3JCU H;  3KDP B;  3R4Y A;  1VQ8 P;  3CC2 P;  2BCC G;  4K35 A;  3U1A A;  1M1K Q;  2IZ0 A;  4HH2 A;  3BRT B;  5CHX A;  1NU1 D;  5AW5 B;  5B66 E;  1NTK E;  4PD4 E;  1HWT C;  2BCC E;  1W5C E;  2Q6Q A;  5KLI C;  1MUU A;  1VQ6 P;  1U7M A;  4D6T J;  4U3F G;  3G4S P;  1AJY A;  4N6J A;  1A02 F;  4B86 A;  4L75 A;  5AVX B;  3AE3 C;  1SFC A;  2R5B A;  2KB7 P;  5K5G B;  1L2P A;  2N1T C;  1SQV G;  3RK3 B;  3PP5 A; 
#chains in the Genus database with same CATH homology
 3L72 G;  3L75 G;  2A06 G;  3H1J G;  1KYO H;  1PP9 G;  3L70 G;  1BCC G;  5KLV G;  1SQP G;  3H1K G;  3H1L G;  1L0N G;  1NTK G;  3CWB G;  1BGY G;  3H1H G;  2FYU G;  1PPJ G;  3H1I G;  1BE3 G;  1SQB G;  3CX5 H;  4PD4 H;  2IBZ G;  3TGU G;  4D6T G;  2BCC G;  3BCC G;  3CXH H;  3L73 G;  1EZV G;  3L71 G;  1KB9 H;  1NU1 G;  1SQQ G;  1NTM G;  1SQX G;  4U3F G;  3L74 G;  1NTZ G;  1SQV G;  1P84 H;  1L0L G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...