1SQVG

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
b'GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
molecule tags Oxidoreductase
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqvG00
1NTZG 1BGYG 3L71G 1NTMG 2IBZG 1KB9H 3CXHH 1SQBG 4U3FG 4D6TG 3L73G 2FYUG 1BE3G 3L70G 2BCCG 1BCCG 1KYOH 1SQVG 3L75G 3TGUG 3CWBG 3H1JG 3H1LG 1PP9G 3CX5H 1NTKG 1L0NG 3H1IG 3H1KG 3L74G 3H1HG 4PD4H 3L72G 5KLVG 1EZVG 1P84H 1NU1G 1PPJG 1SQQG 3BCCG 2A06G 1SQPG 1L0LG 1SQXG
chains in the Genus database with same CATH superfamily
1KQLA 3IR9A 3L74E 4YXWH 4WY4B 1URQC 4OGQD 1N7LA 1RH5B 2KLUA 2Q6QA 4I7ZB 4Y99B 5H2FE 4D6TD 1DD4A 1LNQA 2R3SA 2WT7B 1PL5A 1LP1A 3AEGC 5GTIE 3SWFA 2KS1A 2FYUG 3H32B 3L73G 1EXJA 2E74D 1SQBJ 2BCCG 3L71J 3GHGB 1FZEA 1LP1B 3WU2E 2KSJA 1RHZB 3KYQA 2N1TB 2PGDA 1VF5B 1AVYA 1G2CA 3LIEA 2ZVNB 4IL6E 3L71D 1NAYA 3L74D 2FYZA 3I56P 1FZGA 3WUTA 2XNXA 1AVOA 3V2NA 1AA0A 3BCCJ 3H1KG 3S9OA 1FC2C 1NTZE 2JO1A 5AVUB 1S5LH 3TNUB 1ZOYC 1L0ND 2I1JA 5CCHA 5CCHC 3M9BA 5CHXA 1QVGO 2J59M 4UB8E 1NKZB 1X8YA 2FYUE 1CI6A 4HJGH 1LTJC 3CWBD 4WY4D 1KB9D 1SQVE 3RBZA 3GHGA 1GL2C 1CI6B 1CSBA 5TJHA 3W68A 3M06A 1N7SB 1IFNA 3CLQA 1BCCJ 1SFCB 1KYOI 3A2AA 4YTPC 1LJ2A 3A3YB 4L74A 3CXHH 1L0NE 1IFDA 2K3RA 3FXDA 4L76A 2GUVA 4OWFA 5APSA 5L8RJ 2B88A 3FWLA 3IF4A 3CCEP 1UIXA 2D2CC 2FYUD 3TDKA 3V4QA 4PD4E 3CMAP 1L4AD 1KB9E 2XU6A 1JUNA 1LTIC 2Y9YA 1KILA 3A5TA 2OTLP 3AE4C 1BGYE 2YKOA 4HKZH 1J1EB 1KN7A 3GF7A 4EI2A 4IFFA 5KKZB 1JCDA 3AE3C 2LXCB 2LKMA 3P32A 2QG4A 4U3FD 3CCSP 2P1JA 2YNYA 3CCVP 1LT9B 2M3EA 5AW7B 2WVRA 1Q7YQ 1SQPG 1JY2P 4PJ0H 1GL2B 1BCCE 1RE3C 3EWKA 1LTTC 3TGUD 2M8RA 3CMEP 1FZFA 2IDBA 1T3JA 1P84I 2KZIA 2V7QH 5EFWB 2Q1KA 5K5GB 1SQVJ 2JWDA 2R32A 1EDKA 1GZLA 1HWTC 1VDFA 4IFMA 1BDCA 1KB9H 1VF5C 1SQBG 3QWOC 4D6TG 4DOJA 1EDLA 2A06E 2Y0DA 5B5EE 1ZW0A 3BATA 1NTZJ 4XE5B 3UIAA 3HD7A 1DIPA 2IFNA 1K04A 3H1IJ 3H1JG 3CX5D 3CXHD 1H0TA 1NJIQ 1M1KQ 1Y8AA 1ZR2A 5C39A 4H44C 1QLED 1OVVA 3G3ZA 1RF1B 1NYHA 1EQ7A 2W90A 2FXMA 3L74G 4L73A 5APQA 5KLVD 4UB6E 2OYIC 2H7HA 1CW5A 2JR8A 4MN4C 2KI7B 3KXDA 1L2PA 4WY4C 2W6JH 3II6A 1YJWP 1BE3E 1USDA 2HFED 3JSVC 1E79H 3RK3B 3RK2B 3V4WA 1OX3A 2GM4A 2MKVA 3TGUE 1VQMP 3NMDA 2WPVB 2B89A 5AW2B 1L4AC 3A0HE 1T8ZA 2IBZI 1DEBA 2K88A 3B71A 5APWA 1GK4A 1N2DC 3V2RA 1M1JB 3CCRP 4DJGA 2H89C 2N9BA 4C7RA 1M90Q 1JM0A 5AW1B 5KAIE 1M1JA 1SQPK 1NU1E 4UB8H 4A7PA 1M57D 1LTGC 1ZV8A 1H89A 1P84E 1L0LD 1R5LA 2AXTH 3AE8C 1YHQP 2CPSA 3PP5A 5DJUB 2WT7A 2E42A 1HBWA 3VMZA 1K9MQ 1N8RQ 2LXBA 3FGAD 2P10A 3L73D 1OFCX 3Q5RA 1J1DC 2K9JB 2QJPB 1JY2O 1NU1K 1LGHB 2VRSA 3FX0A 2ZYAA 4EYYQ 3L4FA 4N78D 3CC4P 2OYIA 1OWAA 1BE3D 1MV8A 2E76C 2KNCB 2QJKC 1ZXGA 2QJYB 3FWNA 5CJ0A 2WSCH 2WITA 3TYYA 1MFTA 2E75C 2M3BA 5AW5B 3RGUA 3RK3D 2OYHB 2K9YA 1SQBD 2IBZG 5KAFH 1JB0J 3P8MC 1Q2NA 3I55P 2KXPB 2V7QJ 4U7JA 4WY4A 1HGZA 1FJPA 1BCCG 1AJYA 4BRYB 5AW0B 1NTKJ 3A0BH 3MUDC 1L0LE 2QE7H 3OA7A 3WU2H 3EFGA 2N1TA 1FOSF 1JY3O 1VQOP 3P8CD 2KZJA 5KLIC 2Z5HA 1QVFO 4ZKUA 1SQBE 2QVAA 3V5BA 1IZNB 2P67A 3AE6C 3H1HD 1OVRA 2KUBA 1EZVI 1NTME 2WQYC 4DZOA 2YO3A 1MUUA 4JF7A 1SLQA 1JY3N 1IFPA 5AVQB 3V6IA 1IK9A 1OW8A 4GOEA 4UB6H 5AVZB 3H1LE 1BGYG 5KJ7D 1N73A 1BSNA 3P7KA 4C7NB 2WPQA 4D6TJ 1A02F 1GMJA 1JMBA 2ZT9B 4JBZA 2O01J 2NRGA 2OARA 4IL6X 3D71A 2K37A 1SQVG 3L75G 3WUUA 1VQ4P 2C0XA 2WSEH 3N4XA 1SQQK 3PLNA 1JTHB 2I1KA 4IFDK 1AFOA 3H1IE 2W6AA 3MP7B 3HRNA 1NTKD 1SQQJ 1L0NG 2LR2A 1FDMA 3AEFC 2FXPA 2KK7A 2J5UA 3RK3C 1FU1A 2O01N 5KLVK 3CPWO 2B87A 4WWIA 1HGVA 5H2FH 1N7SD 1OW7A 4EOTA 3Q5PA 3W67A 1RQUA 2OYIB 3PHLA 1FE6A 3G9RA 1BCCD 1GL2A 3N7NA 3BRVB 3H1JJ 2IZ0A 2E43A 3R2PA 2E5YA 1YTZT 5B5EH 4IL6H 3T97B 1PPJE 1AQTA 2HG5D 3MHVA 3G71P 1VQ7P 3HD7B 1YIJP 4IOIH 1G2CB 2WTYA 3L35A 1PFIA 3GF3A 5E79H 3CC7P 1J2JB 3HE4B 2FBWC 4C7NA 1KILC 1S3JA 1VQ5P 5AW8B 3PH0A 4GDOA 4HH2A 4RO0A 1VQNP 1NTKK 4AQRD 3PJSK 3L37A 1FBMA 1SVFA 3L72G 1RY3A 3L72J 5KLVG 5KLVJ 1N86A 2IX7C 3A0BE 3SFEC 1JNMA 3BCCG 3USSA 1NOHA 2KSEA 4JQ0D 1L0LG 1LT9C 1W5CE 1KILD 2KP8A 1TU3F 2OGUA 2IPPA 3L72D 5DJTB 4W80A 5APXA 5KJ7A 1DD3A 1W2BO 1HTLC 2QSIA 1K8AQ 3ITKA 3KDPB 4BWNA 1PGPA 5AW3B 2E74B 1LTJA 3QH9A 3AEEC 1YJ9P 1IO4A 5GTHH 3A0HH 1NGMB 3D70A 1VL2A 3BRTB 3S1KA 3MIWA 1BE3G 1GTWA 5AVYB 2FFDA 1EDJA 1KYOH 1QGKB 2UWJE 1WMKA 2WZ7A 1K73Q 5CBOA 1U57A 2AXTE 2YKPA 3NFQA 3ABVC 3NTNA 4Z1MH 2Y9ZA 3VMXA 3H1LG 4WVZA 4RESB 3AECC 1JY3P 3AEAC 1N7SC 3H1ID 1YJNP 3L70D 4D6TE 1VQLP 3SFDC 2GA1A 3H1LD 1NU1J 2B87B 2Q5UA 1LTJB 2IBZD 1T6AA 1S5LX 2QM8A 3U59A 1FZBA 3AE5C 3C8VA 4ASVA 3MTUE 2A06G 3CWBE 1X9VA 4OH8B 4TT3H 2QJPC 2IYOA 1J1DB 3ZDMA 1BSHA 2CPBA 1FDOA 1MFZA 2M0BA 4LGDE 4C46A 2XKMA 3RL0g 1R8EA 1Q82Q 4O9BA 2HLOA 1E5WA 3MD0A 2G8YA 2KB7P 1KZUB 5KKZC 1YITP 5KLIB 1BGYJ 2XZRA 1KMIZ 2M5AA 3TK1A 3HE4A 5CJ4A 3TGUG 1AV1A 3H32A 3VP9A 4ZNCA 3MGNA 1QL1A 1ZN5A 3P8CE 4W7ZA 2ZYGA 1SQPD 1BGYD 4KJMA 2H8PD 2ZFCA 1ZR4A 3F89A 5AVVB 1L4AB 4OVNF 3WUVA 3JCUH 2E75D 4GKGA 4H13C 2Q7CA 1EZVD 4HYTB 4DT0A 3A7OA 1VQPP 1M56D 3LW5J 3RL0D 5BU8B 2FFDC 3Q5SA 1SFCC 4K3AA 3C1LA 2C9LY 1NU1D 1BE3J 1HJ0A 1NU1G 1FZAA 1PPJG 3EFFK 1P84D 4H0LC 2NPSA 2JKVA 3VMAA 1KFMA 4WBAA 1PP9J 1DEEG 3G4SP 1R5SA 2FYNC 2M5AB 2Y0CA 2NPSB 3E1RA 3KZIH 3O8ZA 4KHXA 4PD4I 5E79E 1N73B 4H44B 3U1AA 3H25A 1YYCA 1PP9D 3GW6A 5KAIH 1EZVE 4W7YA 1NTMG 2P58A 3T97A 4H13D 4XA4A 2ITAA 1OZHA 1SQBK 2V4HA 4EDFA 3KPEA 3CD6P 2BASA 1IFMA 1WRGA 1PGJA 3NXSA 3TF5A 3OAKA 2O1JA 2W6BA 4TLFA 3CX5E 1NAFA 1UIIA 2KOGA 3L71E 5APYA 3GHGC 2XDJA 1ZRTD 5KAFE 4BXLA 1RF0A 2NZ2A 1NTKG 1USEA 2SPZA 3HD7C 3IAOA 4GODA 4ASWA 1U7JA 1A02J 1EZVG 3L75E 2O3JA 3CCJP 4BRYA 5GTHE 3L70J 2OQQA 3WMM0 4AYCA 2C0WA 2JWAA 5APTA 3HTKA 1N73C 4M3LA 3RL0B 2FFDB 1LTBC 2K1AA 3RK2C 2YMKA 1LT1A 3CXHE 2FKWB 2PAJA 4N6JA 2CK3H 3EQ2A 4PV1D 1FJKA 3BASA 3H1HE 3TSIA 5B66H 1PP9E 3B8EB 4NPEA 2KS1B 2RKLA 2KLVA 2R5BA 3CCUP 1NTZK 2QRXA 5AVRB 1RE4A 4U3FG 5AW4B 5CBNA 1RF1C 2WMMA 2YMYA 1FZCB 3SWKA 4XFJA 1MZ9A 4WB4A 1PPJD 2WSSH 2D2CD 2W83C 3AE1C 3L74J 2L5GB 3GMAA 2IFMA 1SQXE 1SQQE 4LLHA 4PD4D 5GTIH 1L4AA 2ZT9D 3HTKB 1DH3A 2L91A 1HJBA 2HR3A 4Y28J 1LTSC 5AVTB 1OIPA 5KJ7C 5KTBA 1RQVA 2BEZF 1IJDB 1LWUC 1XTCC 3I5CA 3U1CA 2H43A 2YIUB 1VQKP 1M7LA 2BCCE 3L73J 2OYHA 3B4SA 1PZQA 3O6QB 4EIJA 1YI2P 1S9KE 3CX5I 1SS1A 1SQXD 2A45G 1IC2A 3KHUA 5AVXB 2H88C 2YIUC 3KQGA 2XV5A 1FAVA 3AE7C 1NWQA 1H8AA 2K9JA 1NTZG 1U7MA 1HVVA 2GUSA 3CCQP 2YKQA 2ZXXA 5AW9B 4NPDA 1GK6A 2J58A 3AEDC 1VF5D 3HUSA 2IYPA 2WSCJ 1IK7A 3HUSC 1NTZD 2A06D 3KZIE 5APUA 5CCHD 3E1IA 1EXIA 1J1EC 4N78E 3PRJA 3B5NA 3O6QA 2ZXEB 2O01H 3CC2P 1SP4A 1Z56A 2RN0A 3H1LJ 4I7ZC 1S1CX 3BCCD 2D2CB 2WPRA 1OW6A 1OXZA 4B86A 1URQD 1AQ5A 1OMIA 1ZLLA 3H1IG 1MKMA 3CL3D 1VQ8P 1X79B 4PD4H 2FY8A 3L70E 2W8ZA 1KFNA 3RL0C 1ZMEC 2KIKA 3GG2A 2E74C 2OYHC 2E75B 5TISE 2E76D 3S4RA 2WSFJ 4KT0J 1LWUA 1G1IA 1RF0C 1SFCD 4GT1A 1SQXK 4H0LD 2R5DA 2QM7A 3B5NB 4JYBA 5CCGA 1S9KD 1GU5A 1PGOA 3JC22 1DX7A 1GW3A 1KILB 1NTMK 1Y47A 1Q86Q 2HODB 4L75A 2AXCA 3CCMP 2ZJSE 1ZP0C 2POHA 1KYOD 3M0DC 2FYUK 3Q1MA 3L72E 3L70G 4R4LA 5KLVE 1Q90D 3H1KJ 1H0TB 5APVA 1FZCA 2IZ1A 1WT6A 1EC5A 2JEEA 4ZMDA 1NO4A 1PP9G 2PFXA 2HPCA 1YBKA 1S5LE 2W27A 3L36A 3B5NC 1KQSO 2NPSC 2BCCJ 3E7KA 3H6PA 3L73E 3LIDA 2N9YB 1FDIA 1KYOE 2DW3A 4GIFA 1URQB 4Y99C 1KC8Q 1QL2A 2P7JA 3FXEA 3IFMA 4H0LB 1S72P 2I8DA 2HYNA 3M9QA 3SSUA 1HH0A 1L0NJ 4OGQB 4OGQC 1NVOA 1SQXG 1JOCA 1SQVD 3MUDA 3TGUJ 1FZCC 3CWBJ 1GDTA 1VQ6P 2RH0A 3L71G 1LT9A 3CI9A 3B5ND 1NTMD 1X22A 3M91A 4PV1B 3M0DA 4JPZB 2Z4EA 3Q2YA 1EDIA 2AEFA 2KYVA 3AE2C 1T2KC 1CZQA 3V2PA 3AEBC 3SWYA 1S2EA 3CWBG 5CCGC 2G3AA 2QEXP 3M0AA 3M9HA 2ZYDA 1JTHA 1PGQA 2N1TD 3CX5H 3LW5H 2ZT9C 1KORA 1YQ3C 3AE9C 4I1LA 4K35A 3L75J 3H1HG 1Y9BA 5AVSB 1H88A 1XTGB 2OYOA 2WWWA 1SFCA 4LC1A 1P84H 1RE4C 4U3FE 2O1KA 3L75D 4RKUJ 1PV3A 5M1BA 4U3FJ 2B9BA 2HPCB 4YPCA 5AW6B 2JP3A 2YXRB 3JCUE 3VYIA 3VN0A 1NTKE 4DCKA 1IFIA 3H1KE 3CCLP 1RE3A 1JEKA 1LTAC 3RK2D 3HE5B 2QA4P 5B66E 3OW2O 2JJLA 1YTZI 5BVZA 4H44D 3IN6A 1NTMJ 3GLMA 3MZWB 2Z5IA 1JO5A 1NH4A 2Q3EA 1L0LK 2WSFH 4PV1C 3K5BA 3CXHI 5TISH 1GD2E 1KQGB 2BEQD 1JY2N 1HUCA 2E5TA 1SQQD 3H1KD 1L0LJ 3BVHA 1D7MA 1X0TA 3R4YA 3TNUA 1Q81Q 1OVUA 3HUSB 2OTJP 1JCCA 1SQPJ 2YO2A 3VMYA 3RK3E 4RJTA 2QJKB 2R44A 2XNDH 2IBZE 3HE5A 4I6MC 5CMZA 1KTMA 1FS0E 1S4XA 2WPSA 2BCCD 2R3CA 4HB1A 1QX8A 3H1JE 1KD1Q 1URQA 3F5HA 3VTPC 1HF9A 2AEMA 5AVWB 1ZRTE 1N7SA 2OTKE 2RMZA 1W2EA 2QJYC 2AEJA 2E76B 5BU5A 1KV4A 3HD7D 1GL2D 2ZVOB 3OJAB 4QMAA 2MJZA 2ZAEB 2FYUJ 2P2UA 3C9IA 4AUWA 4CPGA 2PRRA 1LWUB 1JMMA 4GOFA 3V2QA 3D6ZA 3VOPA 1RF1A 2YXQB 1T3UA 5CCGD 1NHLA 2Q3IA 1PIXA 1KILE 2QIWA 2WSEJ 1IFJA 3BCCE 4NPFX 3RBXA 3Q3DA 1KQFB 1SQPE 2N1TC 1T2KD 4YXDC 4N3YB 4ZKPA 1FOSE 1QEXA 2HODA 1GU4A 4PJ0E 1K05A 4I2LC 2A45H 1GW4A 1M1JC 2Q9IA 1L0NK 3PTZA 2FYNB 1BDDA 2Y0EA 1YQ4C 3G6EP 2C9NY 2FXOA 2JDIH 2PP6A 2KNCA 3H1HJ 3VP8A 1VQ9P 4JYCA 2NPSD 1SQQG 3D6YA 3H1JD 2A45I 1VPCA 1SQVK 4R4MA 1M8OB 1SQXJ 1KB9I 1NKNA 4H13B 1G1JA
chains in the Genus database with same CATH topology
1NTZG 1BGYG 3L71G 1NTMG 2IBZG 1KB9H 3CXHH 1SQBG 4U3FG 4D6TG 3L73G 2FYUG 1BE3G 3L70G 2BCCG 1BCCG 1KYOH 1SQVG 3L75G 3TGUG 3CWBG 3H1JG 3H1LG 1PP9G 3CX5H 1NTKG 1L0NG 3H1IG 3H1KG 3L74G 3H1HG 4PD4H 3L72G 5KLVG 1EZVG 1P84H 1NU1G 1PPJG 1SQQG 3BCCG 2A06G 1SQPG 1L0LG 1SQXG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ G;  1BGY G;  3L71 G;  1NTM G;  2IBZ G;  1KB9 H;  3CXH H;  1SQB G;  4U3F G;  4D6T G;  3L73 G;  2FYU G;  1BE3 G;  3L70 G;  2BCC G;  1BCC G;  1KYO H;  1SQV G;  3L75 G;  3TGU G;  3CWB G;  3H1J G;  3H1L G;  1PP9 G;  3CX5 H;  1NTK G;  1L0N G;  3H1I G;  3H1K G;  3L74 G;  3H1H G;  4PD4 H;  3L72 G;  5KLV G;  1EZV G;  1P84 H;  1NU1 G;  1PPJ G;  1SQQ G;  3BCC G;  2A06 G;  1SQP G;  1L0L G;  1SQX G; 
#chains in the Genus database with same CATH topology
 1KQL A;  3IR9 A;  3L74 E;  4YXW H;  4WY4 B;  1URQ C;  4OGQ D;  1N7L A;  1RH5 B;  2KLU A;  2Q6Q A;  4I7Z B;  4Y99 B;  5H2F E;  4D6T D;  1DD4 A;  1LNQ A;  2R3S A;  2WT7 B;  1PL5 A;  1LP1 A;  3AEG C;  5GTI E;  3SWF A;  2KS1 A;  2FYU G;  3H32 B;  3L73 G;  1EXJ A;  2E74 D;  1SQB J;  2BCC G;  3L71 J;  3GHG B;  1FZE A;  1LP1 B;  3WU2 E;  2KSJ A;  1RHZ B;  3KYQ A;  2N1T B;  2PGD A;  1VF5 B;  1AVY A;  1G2C A;  3LIE A;  2ZVN B;  4IL6 E;  3L71 D;  1NAY A;  3L74 D;  2FYZ A;  3I56 P;  1FZG A;  3WUT A;  2XNX A;  1AVO A;  3V2N A;  1AA0 A;  3BCC J;  3H1K G;  3S9O A;  1FC2 C;  1NTZ E;  2JO1 A;  5AVU B;  1S5L H;  3TNU B;  1ZOY C;  1L0N D;  2I1J A;  5CCH A;  5CCH C;  3M9B A;  5CHX A;  1QVG O;  2J59 M;  4UB8 E;  1NKZ B;  1X8Y A;  2FYU E;  1CI6 A;  4HJG H;  1LTJ C;  3CWB D;  4WY4 D;  1KB9 D;  1SQV E;  3RBZ A;  3GHG A;  1GL2 C;  1CI6 B;  1CSB A;  5TJH A;  3W68 A;  3M06 A;  1N7S B;  1IFN A;  3CLQ A;  1BCC J;  1SFC B;  1KYO I;  3A2A A;  4YTP C;  1LJ2 A;  3A3Y B;  4L74 A;  3CXH H;  1L0N E;  1IFD A;  2K3R A;  3FXD A;  4L76 A;  2GUV A;  4OWF A;  5APS A;  5L8R J;  2B88 A;  3FWL A;  3IF4 A;  3CCE P;  1UIX A;  2D2C C;  2FYU D;  3TDK A;  3V4Q A;  4PD4 E;  3CMA P;  1L4A D;  1KB9 E;  2XU6 A;  1JUN A;  1LTI C;  2Y9Y A;  1KIL A;  3A5T A;  2OTL P;  3AE4 C;  1BGY E;  2YKO A;  4HKZ H;  1J1E B;  1KN7 A;  3GF7 A;  4EI2 A;  4IFF A;  5KKZ B;  1JCD A;  3AE3 C;  2LXC B;  2LKM A;  3P32 A;  2QG4 A;  4U3F D;  3CCS P;  2P1J A;  2YNY A;  3CCV P;  1LT9 B;  2M3E A;  5AW7 B;  2WVR A;  1Q7Y Q;  1SQP G;  1JY2 P;  4PJ0 H;  1GL2 B;  1BCC E;  1RE3 C;  3EWK A;  1LTT C;  3TGU D;  2M8R A;  3CME P;  1FZF A;  2IDB A;  1T3J A;  1P84 I;  2KZI A;  2V7Q H;  5EFW B;  2Q1K A;  5K5G B;  1SQV J;  2JWD A;  2R32 A;  1EDK A;  1GZL A;  1HWT C;  1VDF A;  4IFM A;  1BDC A;  1KB9 H;  1VF5 C;  1SQB G;  3QWO C;  4D6T G;  4DOJ A;  1EDL A;  2A06 E;  2Y0D A;  5B5E E;  1ZW0 A;  3BAT A;  1NTZ J;  4XE5 B;  3UIA A;  3HD7 A;  1DIP A;  2IFN A;  1K04 A;  3H1I J;  3H1J G;  3CX5 D;  3CXH D;  1H0T A;  1NJI Q;  1M1K Q;  1Y8A A;  1ZR2 A;  5C39 A;  4H44 C;  1QLE D;  1OVV A;  3G3Z A;  1RF1 B;  1NYH A;  1EQ7 A;  2W90 A;  2FXM A;  3L74 G;  4L73 A;  5APQ A;  5KLV D;  4UB6 E;  2OYI C;  2H7H A;  1CW5 A;  2JR8 A;  4MN4 C;  2KI7 B;  3KXD A;  1L2P A;  4WY4 C;  2W6J H;  3II6 A;  1YJW P;  1BE3 E;  1USD A;  2HFE D;  3JSV C;  1E79 H;  3RK3 B;  3RK2 B;  3V4W A;  1OX3 A;  2GM4 A;  2MKV A;  3TGU E;  1VQM P;  3NMD A;  2WPV B;  2B89 A;  5AW2 B;  1L4A C;  3A0H E;  1T8Z A;  2IBZ I;  1DEB A;  2K88 A;  3B71 A;  5APW A;  1GK4 A;  1N2D C;  3V2R A;  1M1J B;  3CCR P;  4DJG A;  2H89 C;  2N9B A;  4C7R A;  1M90 Q;  1JM0 A;  5AW1 B;  5KAI E;  1M1J A;  1SQP K;  1NU1 E;  4UB8 H;  4A7P A;  1M57 D;  1LTG C;  1ZV8 A;  1H89 A;  1P84 E;  1L0L D;  1R5L A;  2AXT H;  3AE8 C;  1YHQ P;  2CPS A;  3PP5 A;  5DJU B;  2WT7 A;  2E42 A;  1HBW A;  3VMZ A;  1K9M Q;  1N8R Q;  2LXB A;  3FGA D;  2P10 A;  3L73 D;  1OFC X;  3Q5R A;  1J1D C;  2K9J B;  2QJP B;  1JY2 O;  1NU1 K;  1LGH B;  2VRS A;  3FX0 A;  2ZYA A;  4EYY Q;  3L4F A;  4N78 D;  3CC4 P;  2OYI A;  1OWA A;  1BE3 D;  1MV8 A;  2E76 C;  2KNC B;  2QJK C;  1ZXG A;  2QJY B;  3FWN A;  5CJ0 A;  2WSC H;  2WIT A;  3TYY A;  1MFT A;  2E75 C;  2M3B A;  5AW5 B;  3RGU A;  3RK3 D;  2OYH B;  2K9Y A;  1SQB D;  2IBZ G;  5KAF H;  1JB0 J;  3P8M C;  1Q2N A;  3I55 P;  2KXP B;  2V7Q J;  4U7J A;  4WY4 A;  1HGZ A;  1FJP A;  1BCC G;  1AJY A;  4BRY B;  5AW0 B;  1NTK J;  3A0B H;  3MUD C;  1L0L E;  2QE7 H;  3OA7 A;  3WU2 H;  3EFG A;  2N1T A;  1FOS F;  1JY3 O;  1VQO P;  3P8C D;  2KZJ A;  5KLI C;  2Z5H A;  1QVF O;  4ZKU A;  1SQB E;  2QVA A;  3V5B A;  1IZN B;  2P67 A;  3AE6 C;  3H1H D;  1OVR A;  2KUB A;  1EZV I;  1NTM E;  2WQY C;  4DZO A;  2YO3 A;  1MUU A;  4JF7 A;  1SLQ A;  1JY3 N;  1IFP A;  5AVQ B;  3V6I A;  1IK9 A;  1OW8 A;  4GOE A;  4UB6 H;  5AVZ B;  3H1L E;  1BGY G;  5KJ7 D;  1N73 A;  1BSN A;  3P7K A;  4C7N B;  2WPQ A;  4D6T J;  1A02 F;  1GMJ A;  1JMB A;  2ZT9 B;  4JBZ A;  2O01 J;  2NRG A;  2OAR A;  4IL6 X;  3D71 A;  2K37 A;  1SQV G;  3L75 G;  3WUU A;  1VQ4 P;  2C0X A;  2WSE H;  3N4X A;  1SQQ K;  3PLN A;  1JTH B;  2I1K A;  4IFD K;  1AFO A;  3H1I E;  2W6A A;  3MP7 B;  3HRN A;  1NTK D;  1SQQ J;  1L0N G;  2LR2 A;  1FDM A;  3AEF C;  2FXP A;  2KK7 A;  2J5U A;  3RK3 C;  1FU1 A;  2O01 N;  5KLV K;  3CPW O;  2B87 A;  4WWI A;  1HGV A;  5H2F H;  1N7S D;  1OW7 A;  4EOT A;  3Q5P A;  3W67 A;  1RQU A;  2OYI B;  3PHL A;  1FE6 A;  3G9R A;  1BCC D;  1GL2 A;  3N7N A;  3BRV B;  3H1J J;  2IZ0 A;  2E43 A;  3R2P A;  2E5Y A;  1YTZ T;  5B5E H;  4IL6 H;  3T97 B;  1PPJ E;  1AQT A;  2HG5 D;  3MHV A;  3G71 P;  1VQ7 P;  3HD7 B;  1YIJ P;  4IOI H;  1G2C B;  2WTY A;  3L35 A;  1PFI A;  3GF3 A;  5E79 H;  3CC7 P;  1J2J B;  3HE4 B;  2FBW C;  4C7N A;  1KIL C;  1S3J A;  1VQ5 P;  5AW8 B;  3PH0 A;  4GDO A;  4HH2 A;  4RO0 A;  1VQN P;  1NTK K;  4AQR D;  3PJS K;  3L37 A;  1FBM A;  1SVF A;  3L72 G;  1RY3 A;  3L72 J;  5KLV G;  5KLV J;  1N86 A;  2IX7 C;  3A0B E;  3SFE C;  1JNM A;  3BCC G;  3USS A;  1NOH A;  2KSE A;  4JQ0 D;  1L0L G;  1LT9 C;  1W5C E;  1KIL D;  2KP8 A;  1TU3 F;  2OGU A;  2IPP A;  3L72 D;  5DJT B;  4W80 A;  5APX A;  5KJ7 A;  1DD3 A;  1W2B O;  1HTL C;  2QSI A;  1K8A Q;  3ITK A;  3KDP B;  4BWN A;  1PGP A;  5AW3 B;  2E74 B;  1LTJ A;  3QH9 A;  3AEE C;  1YJ9 P;  1IO4 A;  5GTH H;  3A0H H;  1NGM B;  3D70 A;  1VL2 A;  3BRT B;  3S1K A;  3MIW A;  1BE3 G;  1GTW A;  5AVY B;  2FFD A;  1EDJ A;  1KYO H;  1QGK B;  2UWJ E;  1WMK A;  2WZ7 A;  1K73 Q;  5CBO A;  1U57 A;  2AXT E;  2YKP A;  3NFQ A;  3ABV C;  3NTN A;  4Z1M H;  2Y9Z A;  3VMX A;  3H1L G;  4WVZ A;  4RES B;  3AEC C;  1JY3 P;  3AEA C;  1N7S C;  3H1I D;  1YJN P;  3L70 D;  4D6T E;  1VQL P;  3SFD C;  2GA1 A;  3H1L D;  1NU1 J;  2B87 B;  2Q5U A;  1LTJ B;  2IBZ D;  1T6A A;  1S5L X;  2QM8 A;  3U59 A;  1FZB A;  3AE5 C;  3C8V A;  4ASV A;  3MTU E;  2A06 G;  3CWB E;  1X9V A;  4OH8 B;  4TT3 H;  2QJP C;  2IYO A;  1J1D B;  3ZDM A;  1BSH A;  2CPB A;  1FDO A;  1MFZ A;  2M0B A;  4LGD E;  4C46 A;  2XKM A;  3RL0 g;  1R8E A;  1Q82 Q;  4O9B A;  2HLO A;  1E5W A;  3MD0 A;  2G8Y A;  2KB7 P;  1KZU B;  5KKZ C;  1YIT P;  5KLI B;  1BGY J;  2XZR A;  1KMI Z;  2M5A A;  3TK1 A;  3HE4 A;  5CJ4 A;  3TGU G;  1AV1 A;  3H32 A;  3VP9 A;  4ZNC A;  3MGN A;  1QL1 A;  1ZN5 A;  3P8C E;  4W7Z A;  2ZYG A;  1SQP D;  1BGY D;  4KJM A;  2H8P D;  2ZFC A;  1ZR4 A;  3F89 A;  5AVV B;  1L4A B;  4OVN F;  3WUV A;  3JCU H;  2E75 D;  4GKG A;  4H13 C;  2Q7C A;  1EZV D;  4HYT B;  4DT0 A;  3A7O A;  1VQP P;  1M56 D;  3LW5 J;  3RL0 D;  5BU8 B;  2FFD C;  3Q5S A;  1SFC C;  4K3A A;  3C1L A;  2C9L Y;  1NU1 D;  1BE3 J;  1HJ0 A;  1NU1 G;  1FZA A;  1PPJ G;  3EFF K;  1P84 D;  4H0L C;  2NPS A;  2JKV A;  3VMA A;  1KFM A;  4WBA A;  1PP9 J;  1DEE G;  3G4S P;  1R5S A;  2FYN C;  2M5A B;  2Y0C A;  2NPS B;  3E1R A;  3KZI H;  3O8Z A;  4KHX A;  4PD4 I;  5E79 E;  1N73 B;  4H44 B;  3U1A A;  3H25 A;  1YYC A;  1PP9 D;  3GW6 A;  5KAI H;  1EZV E;  4W7Y A;  1NTM G;  2P58 A;  3T97 A;  4H13 D;  4XA4 A;  2ITA A;  1OZH A;  1SQB K;  2V4H A;  4EDF A;  3KPE A;  3CD6 P;  2BAS A;  1IFM A;  1WRG A;  1PGJ A;  3NXS A;  3TF5 A;  3OAK A;  2O1J A;  2W6B A;  4TLF A;  3CX5 E;  1NAF A;  1UII A;  2KOG A;  3L71 E;  5APY A;  3GHG C;  2XDJ A;  1ZRT D;  5KAF E;  4BXL A;  1RF0 A;  2NZ2 A;  1NTK G;  1USE A;  2SPZ A;  3HD7 C;  3IAO A;  4GOD A;  4ASW A;  1U7J A;  1A02 J;  1EZV G;  3L75 E;  2O3J A;  3CCJ P;  4BRY A;  5GTH E;  3L70 J;  2OQQ A;  3WMM 0;  4AYC A;  2C0W A;  2JWA A;  5APT A;  3HTK A;  1N73 C;  4M3L A;  3RL0 B;  2FFD B;  1LTB C;  2K1A A;  3RK2 C;  2YMK A;  1LT1 A;  3CXH E;  2FKW B;  2PAJ A;  4N6J A;  2CK3 H;  3EQ2 A;  4PV1 D;  1FJK A;  3BAS A;  3H1H E;  3TSI A;  5B66 H;  1PP9 E;  3B8E B;  4NPE A;  2KS1 B;  2RKL A;  2KLV A;  2R5B A;  3CCU P;  1NTZ K;  2QRX A;  5AVR B;  1RE4 A;  4U3F G;  5AW4 B;  5CBN A;  1RF1 C;  2WMM A;  2YMY A;  1FZC B;  3SWK A;  4XFJ A;  1MZ9 A;  4WB4 A;  1PPJ D;  2WSS H;  2D2C D;  2W83 C;  3AE1 C;  3L74 J;  2L5G B;  3GMA A;  2IFM A;  1SQX E;  1SQQ E;  4LLH A;  4PD4 D;  5GTI H;  1L4A A;  2ZT9 D;  3HTK B;  1DH3 A;  2L91 A;  1HJB A;  2HR3 A;  4Y28 J;  1LTS C;  5AVT B;  1OIP A;  5KJ7 C;  5KTB A;  1RQV A;  2BEZ F;  1IJD B;  1LWU C;  1XTC C;  3I5C A;  3U1C A;  2H43 A;  2YIU B;  1VQK P;  1M7L A;  2BCC E;  3L73 J;  2OYH A;  3B4S A;  1PZQ A;  3O6Q B;  4EIJ A;  1YI2 P;  1S9K E;  3CX5 I;  1SS1 A;  1SQX D;  2A45 G;  1IC2 A;  3KHU A;  5AVX B;  2H88 C;  2YIU C;  3KQG A;  2XV5 A;  1FAV A;  3AE7 C;  1NWQ A;  1H8A A;  2K9J A;  1NTZ G;  1U7M A;  1HVV A;  2GUS A;  3CCQ P;  2YKQ A;  2ZXX A;  5AW9 B;  4NPD A;  1GK6 A;  2J58 A;  3AED C;  1VF5 D;  3HUS A;  2IYP A;  2WSC J;  1IK7 A;  3HUS C;  1NTZ D;  2A06 D;  3KZI E;  5APU A;  5CCH D;  3E1I A;  1EXI A;  1J1E C;  4N78 E;  3PRJ A;  3B5N A;  3O6Q A;  2ZXE B;  2O01 H;  3CC2 P;  1SP4 A;  1Z56 A;  2RN0 A;  3H1L J;  4I7Z C;  1S1C X;  3BCC D;  2D2C B;  2WPR A;  1OW6 A;  1OXZ A;  4B86 A;  1URQ D;  1AQ5 A;  1OMI A;  1ZLL A;  3H1I G;  1MKM A;  3CL3 D;  1VQ8 P;  1X79 B;  4PD4 H;  2FY8 A;  3L70 E;  2W8Z A;  1KFN A;  3RL0 C;  1ZME C;  2KIK A;  3GG2 A;  2E74 C;  2OYH C;  2E75 B;  5TIS E;  2E76 D;  3S4R A;  2WSF J;  4KT0 J;  1LWU A;  1G1I A;  1RF0 C;  1SFC D;  4GT1 A;  1SQX K;  4H0L D;  2R5D A;  2QM7 A;  3B5N B;  4JYB A;  5CCG A;  1S9K D;  1GU5 A;  1PGO A;  3JC2 2;  1DX7 A;  1GW3 A;  1KIL B;  1NTM K;  1Y47 A;  1Q86 Q;  2HOD B;  4L75 A;  2AXC A;  3CCM P;  2ZJS E;  1ZP0 C;  2POH A;  1KYO D;  3M0D C;  2FYU K;  3Q1M A;  3L72 E;  3L70 G;  4R4L A;  5KLV E;  1Q90 D;  3H1K J;  1H0T B;  5APV A;  1FZC A;  2IZ1 A;  1WT6 A;  1EC5 A;  2JEE A;  4ZMD A;  1NO4 A;  1PP9 G;  2PFX A;  2HPC A;  1YBK A;  1S5L E;  2W27 A;  3L36 A;  3B5N C;  1KQS O;  2NPS C;  2BCC J;  3E7K A;  3H6P A;  3L73 E;  3LID A;  2N9Y B;  1FDI A;  1KYO E;  2DW3 A;  4GIF A;  1URQ B;  4Y99 C;  1KC8 Q;  1QL2 A;  2P7J A;  3FXE A;  3IFM A;  4H0L B;  1S72 P;  2I8D A;  2HYN A;  3M9Q A;  3SSU A;  1HH0 A;  1L0N J;  4OGQ B;  4OGQ C;  1NVO A;  1SQX G;  1JOC A;  1SQV D;  3MUD A;  3TGU J;  1FZC C;  3CWB J;  1GDT A;  1VQ6 P;  2RH0 A;  3L71 G;  1LT9 A;  3CI9 A;  3B5N D;  1NTM D;  1X22 A;  3M91 A;  4PV1 B;  3M0D A;  4JPZ B;  2Z4E A;  3Q2Y A;  1EDI A;  2AEF A;  2KYV A;  3AE2 C;  1T2K C;  1CZQ A;  3V2P A;  3AEB C;  3SWY A;  1S2E A;  3CWB G;  5CCG C;  2G3A A;  2QEX P;  3M0A A;  3M9H A;  2ZYD A;  1JTH A;  1PGQ A;  2N1T D;  3CX5 H;  3LW5 H;  2ZT9 C;  1KOR A;  1YQ3 C;  3AE9 C;  4I1L A;  4K35 A;  3L75 J;  3H1H G;  1Y9B A;  5AVS B;  1H88 A;  1XTG B;  2OYO A;  2WWW A;  1SFC A;  4LC1 A;  1P84 H;  1RE4 C;  4U3F E;  2O1K A;  3L75 D;  4RKU J;  1PV3 A;  5M1B A;  4U3F J;  2B9B A;  2HPC B;  4YPC A;  5AW6 B;  2JP3 A;  2YXR B;  3JCU E;  3VYI A;  3VN0 A;  1NTK E;  4DCK A;  1IFI A;  3H1K E;  3CCL P;  1RE3 A;  1JEK A;  1LTA C;  3RK2 D;  3HE5 B;  2QA4 P;  5B66 E;  3OW2 O;  2JJL A;  1YTZ I;  5BVZ A;  4H44 D;  3IN6 A;  1NTM J;  3GLM A;  3MZW B;  2Z5I A;  1JO5 A;  1NH4 A;  2Q3E A;  1L0L K;  2WSF H;  4PV1 C;  3K5B A;  3CXH I;  5TIS H;  1GD2 E;  1KQG B;  2BEQ D;  1JY2 N;  1HUC A;  2E5T A;  1SQQ D;  3H1K D;  1L0L J;  3BVH A;  1D7M A;  1X0T A;  3R4Y A;  3TNU A;  1Q81 Q;  1OVU A;  3HUS B;  2OTJ P;  1JCC A;  1SQP J;  2YO2 A;  3VMY A;  3RK3 E;  4RJT A;  2QJK B;  2R44 A;  2XND H;  2IBZ E;  3HE5 A;  4I6M C;  5CMZ A;  1KTM A;  1FS0 E;  1S4X A;  2WPS A;  2BCC D;  2R3C A;  4HB1 A;  1QX8 A;  3H1J E;  1KD1 Q;  1URQ A;  3F5H A;  3VTP C;  1HF9 A;  2AEM A;  5AVW B;  1ZRT E;  1N7S A;  2OTK E;  2RMZ A;  1W2E A;  2QJY C;  2AEJ A;  2E76 B;  5BU5 A;  1KV4 A;  3HD7 D;  1GL2 D;  2ZVO B;  3OJA B;  4QMA A;  2MJZ A;  2ZAE B;  2FYU J;  2P2U A;  3C9I A;  4AUW A;  4CPG A;  2PRR A;  1LWU B;  1JMM A;  4GOF A;  3V2Q A;  3D6Z A;  3VOP A;  1RF1 A;  2YXQ B;  1T3U A;  5CCG D;  1NHL A;  2Q3I A;  1PIX A;  1KIL E;  2QIW A;  2WSE J;  1IFJ A;  3BCC E;  4NPF X;  3RBX A;  3Q3D A;  1KQF B;  1SQP E;  2N1T C;  1T2K D;  4YXD C;  4N3Y B;  4ZKP A;  1FOS E;  1QEX A;  2HOD A;  1GU4 A;  4PJ0 E;  1K05 A;  4I2L C;  2A45 H;  1GW4 A;  1M1J C;  2Q9I A;  1L0N K;  3PTZ A;  2FYN B;  1BDD A;  2Y0E A;  1YQ4 C;  3G6E P;  2C9N Y;  2FXO A;  2JDI H;  2PP6 A;  2KNC A;  3H1H J;  3VP8 A;  1VQ9 P;  4JYC A;  2NPS D;  1SQQ G;  3D6Y A;  3H1J D;  2A45 I;  1VPC A;  1SQV K;  4R4M A;  1M8O B;  1SQX J;  1KB9 I;  1NKN A;  4H13 B;  1G1J A; 
#chains in the Genus database with same CATH homology
 1NTZ G;  1BGY G;  3L71 G;  1NTM G;  2IBZ G;  1KB9 H;  3CXH H;  1SQB G;  4U3F G;  4D6T G;  3L73 G;  2FYU G;  1BE3 G;  3L70 G;  2BCC G;  1BCC G;  1KYO H;  1SQV G;  3L75 G;  3TGU G;  3CWB G;  3H1J G;  3H1L G;  1PP9 G;  3CX5 H;  1NTK G;  1L0N G;  3H1I G;  3H1K G;  3L74 G;  3H1H G;  4PD4 H;  3L72 G;  5KLV G;  1EZV G;  1P84 H;  1NU1 G;  1PPJ G;  1SQQ G;  3BCC G;  2A06 G;  1SQP G;  1L0L G;  1SQX G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...