1SQVG

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqvG00
3TGUG 1NU1G 3L72G 1L0LG 2A06G 2FYUG 1SQPG 1SQBG 1PP9G 3L71G 3CX5H 3H1LG 3BCCG 3CXHH 3H1HG 3L75G 1NTZG 3H1KG 1EZVG 2BCCG 3CWBG 4U3FG 1BCCG 1NTMG 5KLVG 1SQVG 1BE3G 1P84H 3L73G 1KYOH 1KB9H 4D6TG 1SQXG 1L0NG 3H1IG 3L74G 4PD4H 1NTKG 1BGYG 2IBZG 1PPJG 3L70G 1SQQG 3H1JG
chains in the Genus database with same CATH superfamily
5APSA 4IL6H 1GL2A 3N7NA 2WT7B 4CPGA 1LT9A 3EWKA 5B5EE 5CMZA 2FBWC 3C8VA 5AW0B 2WPRA 2OYHA 2QJPB 4WBAA 1LTJB 1KYOH 2YIUC 2HYNA 2JJLA 4D6TG 4TT3H 3VOPA 4JPZB 1SQQG 1RE4C 1PZQA 2ZT9D 2Y0EA 4DOJA 3PJSK 3A0BE 4GODA 1DH3A 5KLVE 3VTPC 1KTMA 1YI2P 3TGUJ 1SQQJ 2WZ7A 4JQ0D 1EXIA 3PLNA 4WY4A 1T6AA 4PV1C 1ZP0C 4BXLA 1JMBA 1GK6A 2E76D 1SQPE 4IL6X 4L76A 2QM8A 2AEMA 3CC7P 4KT0J 3LW5H 2KS1A 2YKQA 3V2RA 2P1JA 1KQFB 3HTKB 3V4WA 1HVVA 2IBZE 2Q3EA 1PP9G 3RL0C 2C0WA 4I2LC 3I5CA 5KJ7D 1GD2E 3U1AA 5GTIE 5AW2B 1G1JA 1PV3A 2YMKA 1SQXG 1NU1D 1KV4A 3TK1A 3L70E 3B5NA 4U3FG 1LGHB 4U7JA 3BVHA 2RMZA 3HD7B 3RK2B 3Q3DA 3E1IA 3JCUH 3LW5J 5GTHH 1S4XA 1KB9D 1HF9A 3B4SA 4GIFA 3GHGC 2Z4EA 3AEAC 1IO4A 1GDTA 2N1TA 5TISH 1SQVK 3B8EB 2ZYGA 3OJAB 1S9KE 4GT1A 4U3FJ 1QX8A 1L0NK 1L2PA 5KLVG 3CCVP 3W67A 2KZJA 3D71A 3SFDC 1FZFA 4UB8E 3T97A 1X22A 2H88C 4NPEA 5CCGC 2B88A 3L72D 1KFNA 1H8AA 1DD3A 2QJKB 2G3AA 2ZYDA 1JY3O 1Q86Q 2YNYA 5KKZB 1DIPA 1AVYA 1DEBA 2IBZG 1FU1A 1W2EA 5APQA 1Q7YQ 1KILC 2Y0DA 3M91A 1ZV8A 2KUBA 1VQ5P 1H0TB 2P58A 4D6TD 2OTKE 1RQUA 1FDMA 3KXDA 4H13B 1GW3A 2Z5IA 3L70G 5AW3B 3RBZA 2H8PD 1OVRA 1OVVA 3A3YB 4PD4I 1NTZE 2E75C 1G2CB 1NOHA 1VQNP 3U59A 1JUNA 1N73B 3H1IE 1N2DC 2KB7P 2LXCB 2FYUE 3L71E 4JYBA 2ZJSE 2QE7H 2CPSA 2YIUB 4RO0A 1M90Q 3WU2H 2KIKA 3BASA 1ZOYC 5C39A 1PP9D 2OYHB 1P84I 3VYIA 1OMIA 2NPSD 3O6QB 3RGUA 1NJIQ 3ITKA 1SQXD 1ZW0A 5CBNA 1JEKA 3SWFA 1MZ9A 1NWQA 2OYIC 4GKGA 2H89C 1URQC 1IFNA 5KAFH 3V2NA 2ZT9C 5CCHA 1PGJA 3M0DA 3VN0A 2G8YA 2E43A 3S9OA 1SQVG 1LTTC 1M7LA 1OW6A 3RK3E 2WT7A 1EZVI 3AEDC 2QA4P 2RKLA 1L0NG 4WY4B 1LP1B 3JSVC 4OWFA 1N7SA 1RE3A 4Y28J 3HRNA 3GLMA 3RL0B 3LIEA 1XTGB 1QGKB 5KLVD 1SQVJ 2KS1B 1IK9A 1JTHA 2JKVA 4DT0A 4PD4E 3TDKA 1L0NJ 1YTZI 1NU1K 2IDBA 1GL2D 3H1IG 3M9BA 2CPBA 4QMAA 1IZNB 2V4HA 4XFJA 1VQ9P 1SQPD 2FYUG 1KQLA 3L71G 2E74D 3FWNA 1JY3N 2W27A 5AVSB 5H2FE 4OH8B 5KJ7C 1AQ5A 3H1IJ 1BGYJ 2IBZD 1L0LK 1L4AA 2QJYB 3L73E 3ZDMA 2XKMA 3GHGB 3EQ2A 3L71J 2D2CC 1P84E 3HTKA 1YJWP 1RF0A 3P8MC 3HE4B 3H1LE 1J1DB 1SVFA 3CXHD 2BCCE 2LKMA 3L70D 1EDIA 3M9HA 5APXA 1NTKE 3QH9A 3H1KJ 3USSA 5TJHA 3CX5H 1OVUA 5AVZB 2KNCB 1FDIA 3H1HE 3II6A 2M5AB 1EZVE 3G9RA 2QEXP 1M57D 3CWBE 2KP8A 3CCMP 2GA1A 3EFGA 2E42A 1S9KD 1PPJG 3S1KA 1N86A 3HD7A 1JCCA 3P7KA 3RBXA 3OW2O 2GM4A 1FOSE 1K04A 2Y9YA 3PRJA 1AQTA 3CI9A 1UIIA 3CCUP 3Q5PA 1S72P 1KFMA 1H88A 3B5ND 2P10A 4HJGH 3L36A 1MV8A 4N6JA 4YTPC 4OGQD 2E75B 1FZCC 4DZOA 3I56P 2K9YA 3G71P 3OA7A 1NAYA 2N1TD 2AEFA 1IFIA 2KZIA 1FDOA 4MN4C 1LTSC 1VL2A 2QRXA 3TNUA 3L75D 2BASA 1RF1A 3TGUE 1SQQE 2XZRA 1BE3J 2PP6A 3K5BA 1VQPP 1DEEG 1JY3P 2WSEH 2C0XA 1KB9H 2FFDC 1OW8A 4IL6E 1PGPA 1NTKG 4UB6E 1H0TA 1YJ9P 3BATA 4H44C 1NTMK 3HUSC 1NTZD 1KYOE 3H1HG 3CC4P 1VQOP 1HGZA 3H1ID 2WQYC 1N8RQ 2OYIB 2ZAEB 1ZXGA 2FYUD 1URQB 1LWUC 4YPCA 2W83C 2NPSC 1N73A 2WSSH 1FAVA 1JO5A 1NH4A 2E5YA 1VQ4P 1YQ4C 5E79E 4LC1A 3MP7B 1L0LJ 1BSNA 3V5BA 1QL2A 2O1KA 1W2BO 3A5TA 4UB6H 1KC8Q 3KZIH 1N7SB 2B9BA 4U3FE 1FJKA 3O6QA 2PGDA 2WITA 4Y99C 3TGUG 3AE9C 1JTHB 3VP9A 1OW7A 3RK3D 4IOIH 2A06E 1YBKA 4HYTB 3S4RA 1SP4A 3AEBC 4K35A 3U1CA 2I8DA 4Z1MH 2YXQB 3MZWB 2D2CB 3L4FA 4PD4D 2YXRB 2QM7A 5E79H 1LP1A 5AW9B 5B66H 5APWA 3SSUA 1RH5B 1PL5A 1SFCC 3JCUE 1L4AB 4ASVA 1G1IA 5GTHE 3H6PA 1OXZA 5TISE 4H0LD 1IK7A 1X79B 5CCHD 3BRVB 1AV1A 2HR3A 4L73A 3AEFC 3L73D 1NVOA 1IJDB 3F5HA 5EFWB 1GW4A 3V6IA 5KAIH 1NKNA 2HPCB 3CCEP 3H1LD 3CMEP 4RESB 2BCCD 3GHGA 1FOSF 3CL3D 2AXTE 1KD1Q 5BVZA 1NTKD 2ZFCA 3PP5A 2KOGA 3HE4A 4M3LA 3H1JG 5CCGA 3W68A 2A06G 3H1HD 1WRGA 1SQBG 2JWDA 1S5LH 5KTBA 1NTMJ 1EZVD 3CWBD 4C46A 1BCCD 1L4AD 2WMMA 3G3ZA 2KNCA 3V2QA 1AJYA 3H1JJ 3CLQA 3SWKA 2M5AA 1SQBJ 1CSBA 1VQKP 2WVRA 1VF5B 3CMAP 1EXJA 4OGQC 1KILA 3V2PA 4XE5B 2PFXA 2POHA 2N1TC 4O9BA 3VMZA 1RF1B 3TNUB 4H44B 4C7NB 1NTZK 2AXTH 5KLIB 5AVUB 1FC2C 1X0TA 3CXHH 3WU2E 2W90A 3BCCE 3Q5RA 1S5LX 1M56D 1R5SA 3FGAD 3HD7D 3RK2D 1SQVE 2PRRA 1SQQD 3TGUD 3KHUA 1LWUB 1L0NE 2R32A 1AVOA 3AE5C 5AW1B 3D6YA 2H7HA 2H43A 4AUWA 1T2KD 2A45H 1KILE 1U7JA 3OAKA 2Q6QA 3GMAA 5KAFE 3AE1C 3CX5I 1KYOD 1OIPA 1E5WA 1VQ7P 1PGQA 1BGYE 1LTBC 1JY2O 2YO3A 4W80A 4RKUJ 1VF5D 1M1JC 3L35A 4WVZA 1IFPA 1VQ6P 2JEEA 4I7ZC 4L75A 3KQGA 3M0AA 2OYIA 1OZHA 3AE8C 1FE6A 1YQ3C 1ZN5A 1D7MA 1PGOA 1URQA 4KJMA 2FYNC 2Y9ZA 2FKWB 1GU4A 3H1KE 2WSFH 1LTIC 4H13D 5CJ0A 3R2PA 1M1KQ 2OYOA 1NHLA 1RQVA 4TLFA 3AECC 2IYPA 4GOFA 4PV1B 3BCCG 1H89A 2WPQA 3IF4A 1JOCA 4U3FD 5AVWB 2P7JA 3AEGC 3SWYA 5APUA 1GU5A 1YTZT 2A06D 3BCCJ 2O01H 1PPJE 4EDFA 1KB9I 1HBWA 1Q82Q 1QVFO 2E76C 1MKMA 1IFJA 1KN7A 2YKOA 3G4SP 2KXPB 2K3RA 1HJ0A 2AXCA 2Q1KA 2WSFJ 1VQ8P 4H0LC 1BGYG 3CX5E 3GF7A 2J58A 5AVQB 1LTJC 2FY8A 1RE3C 1WT6A 1BE3E 1LTAC 4PV1D 2P67A 2K9JA 3A0HH 3H1KG 2O01J 3RL0g 1QVGO 4WY4D 4BRYA 3MUDC 1PFIA 1T3JA 2FYZA 2CK3H 3JC22 2M0BA 1SLQA 1JM0A 2K88A 3FWLA 3RL0D 2HPCA 1Q2NA 2IZ0A 3TSIA 1U57A 2J5UA 3KDPB 3L74J 3M9QA 3NXSA 1A02J 4AQRD 1BSHA 2P2UA 3KYQA 1KILB 3IFMA 4LLHA 2YO2A 4KHXA 1KB9E 1HJBA 1L0LE 2IFNA 3CCJP 2LXBA 3VP8A 1GK4A 1S1CX 3EFFK 2Y0CA 3WUUA 2DW3A 2L91A 2BEZF 2OQQA 5AW4B 3ABVC 1R5LA 1DX7A 2BEQD 3P8CE 2M3EA 5CHXA 5AVRB 1MFTA 2WPSA 2KK7A 3MIWA 1BE3G 3RK2C 3CCQP 5CCGD 2XDJA 1NYHA 3C1LA 1VDFA 3MD0A 4C7NA 1SQVD 4NPDA 5BU5A 3HUSA 5AW8B 1L0ND 5M1BA 4EYYQ 3MTUE 3D70A 1NU1G 4PJ0H 3E7KA 1CI6A 1KILD 2QJKC 1EDJA 3KZIE 2ZVNB 1SQXK 1LWUA 1USEA 1R8EA 4WB4A 2FXPA 3G6EP 2NPSA 4YXDC 1VPCA 1BGYD 1MFZA 5KKZC 4A7PA 1NU1J 1FZAA 4GDOA 4BWNA 2E5TA 3L71D 1L0LG 1A02F 2ZT9B 4HH2A 3MHVA 1PIXA 1EDLA 3AE3C 3AE7C 1QEXA 2J59M 2QG4A 4YXWH 2R5DA 2E75D 1FZEA 4H13C 1RY3A 2WSEJ 3HE5A 2QVAA 5B66E 4N78E 2ITAA 5KLVK 3H1KD 5L8RJ 2JO1A 1VQLP 2LR2A 2E76B 3I55P 1IC2A 1RE4A 2V7QH 1NTME 3VMAA 1SQPK 2JP3A 3L72J 3CXHI 5K5GB 2KSJA 2WSCH 1N73C 1CW5A 3BRTB 1OWAA 3H1JE 2PAJA 3TYYA 1SQBE 1FZGA 4ZNCA 5KAIE 1SFCA 2FXOA 2Q5UA 1GL2C 1PPJD 1LT9C 2YMYA 2RN0A 1URQD 2OYHC 2A45I 3PH0A 2IPPA 4I6MC 2E74C 3GW6A 1AFOA 1JMMA 2I1JA 4HKZH 4D6TJ 3CX5D 1YHQP 2L5GB 1RHZB 2V7QJ 1S5LE 2K9JB 2FXMA 1XTCC 4ZMDA 2KLVA 2WSCJ 2WTYA 4AYCA 1BE3D 3MGNA 3QWOC 1YITP 5APTA 4BRYB 1HTLC 4EOTA 5B5EH 1VQMP 1QL1A 1N7SD 3PHLA 4WY4C 4DCKA 1P84D 4EIJA 3F89A 3H32B 3KPEA 3D6ZA 3H25A 1NTMG 3E1RA 3WMM0 1JCDA 2QIWA 3A0BH 4L74A 3AE4C 2B87B 3CXHE 1PP9J 2D2CD 2W6BA 3C9IA 2VRSA 1X8YA 5AVYB 1SQXJ 2YKPA 3M06A 2XU6A 1FZCB 2QJYC 1L0LD 4JBZA 3B5NC 2W6AA 2K37A 4WWIA 2KYVA 1FJPA 5AW6B 3FX0A 4R4MA 1J1DC 2KLUA 4IFFA 2FFDB 2OTJP 2WWWA 3P8CD 5GTIH 2WPVB 4EI2A 1SQPG 3HUSB 3FXEA 5KLVJ 3V4QA 4NPFX 5AW5B 5BU8B 1HGVA 5DJUB 2KSEA 2R44A 2FYUK 1CI6B 2R3CA 1ZLLA 1SQPJ 1IFDA 2OARA 1ZRTE 1GZLA 2NPSB 4W7ZA 1Y47A 3L75E 2AEJA 1J1EC 1M1JA 4C7RA 4HB1A 2K1AA 1S2EA 4UB8H 1QLED 1GTWA 1JNMA 1YJNP 2HODB 2IZ1A 4LGDE 2SPZA 3HE5B 1KZUB 1LJ2A 2ZXXA 2GUVA 3L70J 1NGMB 4Y99B 2A45G 4H44D 4N3YB 1AA0A 1EQ7A 2R3SA 3B71A 2GUSA 2HG5D 1FBMA 1KMIZ 4N78D 5DJTB 1HUCA 1GL2B 1OFCX 1EDKA 1LT9B 3CC2P 5CJ4A 3VMYA 1UIXA 2N9BA 3L74E 2Z5HA 1U7MA 2E74B 3RK3C 2Q7CA 1NTMD 4R4LA 1SFCB 4ZKPA 1YIJP 2HLOA 2B89A 1USDA 3Q2YA 3H1JD 3A0HE 2RH0A 4JF7A 1SQBD 1KORA 3N4XA 1OX3A 3GF3A 1S3JA 2OGUA 3L75G 1BDDA 3P32A 1BDCA 1MUUA 2M8RA 3IAOA 1LTJA 5KJ7A 1K9MQ 5CCHC 1SS1A 1Q81Q 3M0DC 4IFMA 3WUVA 1WMKA 3L75J 1HWTC 2JDIH 1NTZG 1NTKK 2NRGA 1X9VA 2QJPC 2HFED 1N7SC 3FXDA 3PTZA 2O01N 1NTZJ 2XV5A 3MUDA 2XNXA 1SFCD 1FZBA 4GOEA 3NTNA 1ZR2A 1LTGC 1IFMA 3L74G 4JYCA 2FYUJ 4IFDK 3A2AA 3B5NB 2IFMA 5APYA 4W7YA 2NZ2A 4ASWA 2IYOA 2OTLP 1NU1E 1ZMEC 3R4YA 4OGQB 1L4AC 3H32A 2Q3IA 1FS0E 2N1TB 1W5CE 4PD4H 3WUTA 2ZYAA 1K8AQ 1KQSO 1CZQA 1RF0C 3LIDA 1JY2N 1KYOI 3T97B 2B87A 2C9NY 3CCSP 2O1JA 1NKZB 2JR8A 2ZXEB 1SQQK 1BCCE 5H2FH 4PJ0E 4OVNF 5AVVB 1M8OB 1EC5A 2O3JA 1FZCA 3NFQA 3CD6P 3AE6C 3L72E 1J2JB 3GG2A 1K73Q 1GMJA 1P84H 3Q5SA 1J1EB 2JWAA 3HD7C 1K05A 1N7LA 4XA4A 5AW7B 1DD4A 2UWJE 2FFDA 2R5BA 3VMXA 1JB0J 3BCCD 3NMDA 3UIAA 2IX7C 1M1JB 2QSIA 1KQGB 1T2KC 1Z56A 3IR9A 3L73G 2Q9IA 1Q90D 4I7ZB 1ZRTD 3TF5A 4K3AA 1Y8AA 4D6TE 3CCRP 4B86A 1T8ZA 3IN6A 4DJGA 3H1LG 1T3UA 3CCLP 2W6JH 2KI7B 1VF5C 2MKVA 2BCCG 3L73J 2FYNB 4RJTA 3CPWO 5APVA 5AVXB 2ZVOB 1LT1A 1LNQA 1Y9BA 2N9YB 1RF1C 5KLIC 1TU3F 3H1LJ 3RK3B 2MJZA 4ZKUA 5AVTB 2W8ZA 3L37A 3SFEC 3Q1MA 2BCCJ 1EZVG 2C9LY 3CWBG 1BCCG 1HH0A 1NTKJ 2HODA 1SQBK 2M3BA 2XNDH 3AE2C 2IBZI 3A7OA 3L72G 1ZR4A 4I1LA 3H1HJ 1YYCA 1G2CA 1JY2P 3AEEC 3CWBJ 1BCCJ 1PP9E 1E79H 1NO4A 3L74D 1NAFA 3O8ZA 4H0LB 5CBOA 1SQXE 2I1KA
chains in the Genus database with same CATH topology
3TGUG 1NU1G 3L72G 1L0LG 2A06G 2FYUG 1SQPG 1SQBG 1PP9G 3L71G 3CX5H 3H1LG 3BCCG 3CXHH 3H1HG 3L75G 1NTZG 3H1KG 1EZVG 2BCCG 3CWBG 4U3FG 1BCCG 1NTMG 5KLVG 1SQVG 1BE3G 1P84H 3L73G 1KYOH 1KB9H 4D6TG 1SQXG 1L0NG 3H1IG 3L74G 4PD4H 1NTKG 1BGYG 2IBZG 1PPJG 3L70G 1SQQG 3H1JG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TGU G;  1NU1 G;  3L72 G;  1L0L G;  2A06 G;  2FYU G;  1SQP G;  1SQB G;  1PP9 G;  3L71 G;  3CX5 H;  3H1L G;  3BCC G;  3CXH H;  3H1H G;  3L75 G;  1NTZ G;  3H1K G;  1EZV G;  2BCC G;  3CWB G;  4U3F G;  1BCC G;  1NTM G;  5KLV G;  1SQV G;  1BE3 G;  1P84 H;  3L73 G;  1KYO H;  1KB9 H;  4D6T G;  1SQX G;  1L0N G;  3H1I G;  3L74 G;  4PD4 H;  1NTK G;  1BGY G;  2IBZ G;  1PPJ G;  3L70 G;  1SQQ G;  3H1J G; 
#chains in the Genus database with same CATH topology
 5APS A;  4IL6 H;  1GL2 A;  3N7N A;  2WT7 B;  4CPG A;  1LT9 A;  3EWK A;  5B5E E;  5CMZ A;  2FBW C;  3C8V A;  5AW0 B;  2WPR A;  2OYH A;  2QJP B;  4WBA A;  1LTJ B;  1KYO H;  2YIU C;  2HYN A;  2JJL A;  4D6T G;  4TT3 H;  3VOP A;  4JPZ B;  1SQQ G;  1RE4 C;  1PZQ A;  2ZT9 D;  2Y0E A;  4DOJ A;  3PJS K;  3A0B E;  4GOD A;  1DH3 A;  5KLV E;  3VTP C;  1KTM A;  1YI2 P;  3TGU J;  1SQQ J;  2WZ7 A;  4JQ0 D;  1EXI A;  3PLN A;  4WY4 A;  1T6A A;  4PV1 C;  1ZP0 C;  4BXL A;  1JMB A;  1GK6 A;  2E76 D;  1SQP E;  4IL6 X;  4L76 A;  2QM8 A;  2AEM A;  3CC7 P;  4KT0 J;  3LW5 H;  2KS1 A;  2YKQ A;  3V2R A;  2P1J A;  1KQF B;  3HTK B;  3V4W A;  1HVV A;  2IBZ E;  2Q3E A;  1PP9 G;  3RL0 C;  2C0W A;  4I2L C;  3I5C A;  5KJ7 D;  1GD2 E;  3U1A A;  5GTI E;  5AW2 B;  1G1J A;  1PV3 A;  2YMK A;  1SQX G;  1NU1 D;  1KV4 A;  3TK1 A;  3L70 E;  3B5N A;  4U3F G;  1LGH B;  4U7J A;  3BVH A;  2RMZ A;  3HD7 B;  3RK2 B;  3Q3D A;  3E1I A;  3JCU H;  3LW5 J;  5GTH H;  1S4X A;  1KB9 D;  1HF9 A;  3B4S A;  4GIF A;  3GHG C;  2Z4E A;  3AEA C;  1IO4 A;  1GDT A;  2N1T A;  5TIS H;  1SQV K;  3B8E B;  2ZYG A;  3OJA B;  1S9K E;  4GT1 A;  4U3F J;  1QX8 A;  1L0N K;  1L2P A;  5KLV G;  3CCV P;  3W67 A;  2KZJ A;  3D71 A;  3SFD C;  1FZF A;  4UB8 E;  3T97 A;  1X22 A;  2H88 C;  4NPE A;  5CCG C;  2B88 A;  3L72 D;  1KFN A;  1H8A A;  1DD3 A;  2QJK B;  2G3A A;  2ZYD A;  1JY3 O;  1Q86 Q;  2YNY A;  5KKZ B;  1DIP A;  1AVY A;  1DEB A;  2IBZ G;  1FU1 A;  1W2E A;  5APQ A;  1Q7Y Q;  1KIL C;  2Y0D A;  3M91 A;  1ZV8 A;  2KUB A;  1VQ5 P;  1H0T B;  2P58 A;  4D6T D;  2OTK E;  1RQU A;  1FDM A;  3KXD A;  4H13 B;  1GW3 A;  2Z5I A;  3L70 G;  5AW3 B;  3RBZ A;  2H8P D;  1OVR A;  1OVV A;  3A3Y B;  4PD4 I;  1NTZ E;  2E75 C;  1G2C B;  1NOH A;  1VQN P;  3U59 A;  1JUN A;  1N73 B;  3H1I E;  1N2D C;  2KB7 P;  2LXC B;  2FYU E;  3L71 E;  4JYB A;  2ZJS E;  2QE7 H;  2CPS A;  2YIU B;  4RO0 A;  1M90 Q;  3WU2 H;  2KIK A;  3BAS A;  1ZOY C;  5C39 A;  1PP9 D;  2OYH B;  1P84 I;  3VYI A;  1OMI A;  2NPS D;  3O6Q B;  3RGU A;  1NJI Q;  3ITK A;  1SQX D;  1ZW0 A;  5CBN A;  1JEK A;  3SWF A;  1MZ9 A;  1NWQ A;  2OYI C;  4GKG A;  2H89 C;  1URQ C;  1IFN A;  5KAF H;  3V2N A;  2ZT9 C;  5CCH A;  1PGJ A;  3M0D A;  3VN0 A;  2G8Y A;  2E43 A;  3S9O A;  1SQV G;  1LTT C;  1M7L A;  1OW6 A;  3RK3 E;  2WT7 A;  1EZV I;  3AED C;  2QA4 P;  2RKL A;  1L0N G;  4WY4 B;  1LP1 B;  3JSV C;  4OWF A;  1N7S A;  1RE3 A;  4Y28 J;  3HRN A;  3GLM A;  3RL0 B;  3LIE A;  1XTG B;  1QGK B;  5KLV D;  1SQV J;  2KS1 B;  1IK9 A;  1JTH A;  2JKV A;  4DT0 A;  4PD4 E;  3TDK A;  1L0N J;  1YTZ I;  1NU1 K;  2IDB A;  1GL2 D;  3H1I G;  3M9B A;  2CPB A;  4QMA A;  1IZN B;  2V4H A;  4XFJ A;  1VQ9 P;  1SQP D;  2FYU G;  1KQL A;  3L71 G;  2E74 D;  3FWN A;  1JY3 N;  2W27 A;  5AVS B;  5H2F E;  4OH8 B;  5KJ7 C;  1AQ5 A;  3H1I J;  1BGY J;  2IBZ D;  1L0L K;  1L4A A;  2QJY B;  3L73 E;  3ZDM A;  2XKM A;  3GHG B;  3EQ2 A;  3L71 J;  2D2C C;  1P84 E;  3HTK A;  1YJW P;  1RF0 A;  3P8M C;  3HE4 B;  3H1L E;  1J1D B;  1SVF A;  3CXH D;  2BCC E;  2LKM A;  3L70 D;  1EDI A;  3M9H A;  5APX A;  1NTK E;  3QH9 A;  3H1K J;  3USS A;  5TJH A;  3CX5 H;  1OVU A;  5AVZ B;  2KNC B;  1FDI A;  3H1H E;  3II6 A;  2M5A B;  1EZV E;  3G9R A;  2QEX P;  1M57 D;  3CWB E;  2KP8 A;  3CCM P;  2GA1 A;  3EFG A;  2E42 A;  1S9K D;  1PPJ G;  3S1K A;  1N86 A;  3HD7 A;  1JCC A;  3P7K A;  3RBX A;  3OW2 O;  2GM4 A;  1FOS E;  1K04 A;  2Y9Y A;  3PRJ A;  1AQT A;  3CI9 A;  1UII A;  3CCU P;  3Q5P A;  1S72 P;  1KFM A;  1H88 A;  3B5N D;  2P10 A;  4HJG H;  3L36 A;  1MV8 A;  4N6J A;  4YTP C;  4OGQ D;  2E75 B;  1FZC C;  4DZO A;  3I56 P;  2K9Y A;  3G71 P;  3OA7 A;  1NAY A;  2N1T D;  2AEF A;  1IFI A;  2KZI A;  1FDO A;  4MN4 C;  1LTS C;  1VL2 A;  2QRX A;  3TNU A;  3L75 D;  2BAS A;  1RF1 A;  3TGU E;  1SQQ E;  2XZR A;  1BE3 J;  2PP6 A;  3K5B A;  1VQP P;  1DEE G;  1JY3 P;  2WSE H;  2C0X A;  1KB9 H;  2FFD C;  1OW8 A;  4IL6 E;  1PGP A;  1NTK G;  4UB6 E;  1H0T A;  1YJ9 P;  3BAT A;  4H44 C;  1NTM K;  3HUS C;  1NTZ D;  1KYO E;  3H1H G;  3CC4 P;  1VQO P;  1HGZ A;  3H1I D;  2WQY C;  1N8R Q;  2OYI B;  2ZAE B;  1ZXG A;  2FYU D;  1URQ B;  1LWU C;  4YPC A;  2W83 C;  2NPS C;  1N73 A;  2WSS H;  1FAV A;  1JO5 A;  1NH4 A;  2E5Y A;  1VQ4 P;  1YQ4 C;  5E79 E;  4LC1 A;  3MP7 B;  1L0L J;  1BSN A;  3V5B A;  1QL2 A;  2O1K A;  1W2B O;  3A5T A;  4UB6 H;  1KC8 Q;  3KZI H;  1N7S B;  2B9B A;  4U3F E;  1FJK A;  3O6Q A;  2PGD A;  2WIT A;  4Y99 C;  3TGU G;  3AE9 C;  1JTH B;  3VP9 A;  1OW7 A;  3RK3 D;  4IOI H;  2A06 E;  1YBK A;  4HYT B;  3S4R A;  1SP4 A;  3AEB C;  4K35 A;  3U1C A;  2I8D A;  4Z1M H;  2YXQ B;  3MZW B;  2D2C B;  3L4F A;  4PD4 D;  2YXR B;  2QM7 A;  5E79 H;  1LP1 A;  5AW9 B;  5B66 H;  5APW A;  3SSU A;  1RH5 B;  1PL5 A;  1SFC C;  3JCU E;  1L4A B;  4ASV A;  1G1I A;  5GTH E;  3H6P A;  1OXZ A;  5TIS E;  4H0L D;  1IK7 A;  1X79 B;  5CCH D;  3BRV B;  1AV1 A;  2HR3 A;  4L73 A;  3AEF C;  3L73 D;  1NVO A;  1IJD B;  3F5H A;  5EFW B;  1GW4 A;  3V6I A;  5KAI H;  1NKN A;  2HPC B;  3CCE P;  3H1L D;  3CME P;  4RES B;  2BCC D;  3GHG A;  1FOS F;  3CL3 D;  2AXT E;  1KD1 Q;  5BVZ A;  1NTK D;  2ZFC A;  3PP5 A;  2KOG A;  3HE4 A;  4M3L A;  3H1J G;  5CCG A;  3W68 A;  2A06 G;  3H1H D;  1WRG A;  1SQB G;  2JWD A;  1S5L H;  5KTB A;  1NTM J;  1EZV D;  3CWB D;  4C46 A;  1BCC D;  1L4A D;  2WMM A;  3G3Z A;  2KNC A;  3V2Q A;  1AJY A;  3H1J J;  3CLQ A;  3SWK A;  2M5A A;  1SQB J;  1CSB A;  1VQK P;  2WVR A;  1VF5 B;  3CMA P;  1EXJ A;  4OGQ C;  1KIL A;  3V2P A;  4XE5 B;  2PFX A;  2POH A;  2N1T C;  4O9B A;  3VMZ A;  1RF1 B;  3TNU B;  4H44 B;  4C7N B;  1NTZ K;  2AXT H;  5KLI B;  5AVU B;  1FC2 C;  1X0T A;  3CXH H;  3WU2 E;  2W90 A;  3BCC E;  3Q5R A;  1S5L X;  1M56 D;  1R5S A;  3FGA D;  3HD7 D;  3RK2 D;  1SQV E;  2PRR A;  1SQQ D;  3TGU D;  3KHU A;  1LWU B;  1L0N E;  2R32 A;  1AVO A;  3AE5 C;  5AW1 B;  3D6Y A;  2H7H A;  2H43 A;  4AUW A;  1T2K D;  2A45 H;  1KIL E;  1U7J A;  3OAK A;  2Q6Q A;  3GMA A;  5KAF E;  3AE1 C;  3CX5 I;  1KYO D;  1OIP A;  1E5W A;  1VQ7 P;  1PGQ A;  1BGY E;  1LTB C;  1JY2 O;  2YO3 A;  4W80 A;  4RKU J;  1VF5 D;  1M1J C;  3L35 A;  4WVZ A;  1IFP A;  1VQ6 P;  2JEE A;  4I7Z C;  4L75 A;  3KQG A;  3M0A A;  2OYI A;  1OZH A;  3AE8 C;  1FE6 A;  1YQ3 C;  1ZN5 A;  1D7M A;  1PGO A;  1URQ A;  4KJM A;  2FYN C;  2Y9Z A;  2FKW B;  1GU4 A;  3H1K E;  2WSF H;  1LTI C;  4H13 D;  5CJ0 A;  3R2P A;  1M1K Q;  2OYO A;  1NHL A;  1RQV A;  4TLF A;  3AEC C;  2IYP A;  4GOF A;  4PV1 B;  3BCC G;  1H89 A;  2WPQ A;  3IF4 A;  1JOC A;  4U3F D;  5AVW B;  2P7J A;  3AEG C;  3SWY A;  5APU A;  1GU5 A;  1YTZ T;  2A06 D;  3BCC J;  2O01 H;  1PPJ E;  4EDF A;  1KB9 I;  1HBW A;  1Q82 Q;  1QVF O;  2E76 C;  1MKM A;  1IFJ A;  1KN7 A;  2YKO A;  3G4S P;  2KXP B;  2K3R A;  1HJ0 A;  2AXC A;  2Q1K A;  2WSF J;  1VQ8 P;  4H0L C;  1BGY G;  3CX5 E;  3GF7 A;  2J58 A;  5AVQ B;  1LTJ C;  2FY8 A;  1RE3 C;  1WT6 A;  1BE3 E;  1LTA C;  4PV1 D;  2P67 A;  2K9J A;  3A0H H;  3H1K G;  2O01 J;  3RL0 g;  1QVG O;  4WY4 D;  4BRY A;  3MUD C;  1PFI A;  1T3J A;  2FYZ A;  2CK3 H;  3JC2 2;  2M0B A;  1SLQ A;  1JM0 A;  2K88 A;  3FWL A;  3RL0 D;  2HPC A;  1Q2N A;  2IZ0 A;  3TSI A;  1U57 A;  2J5U A;  3KDP B;  3L74 J;  3M9Q A;  3NXS A;  1A02 J;  4AQR D;  1BSH A;  2P2U A;  3KYQ A;  1KIL B;  3IFM A;  4LLH A;  2YO2 A;  4KHX A;  1KB9 E;  1HJB A;  1L0L E;  2IFN A;  3CCJ P;  2LXB A;  3VP8 A;  1GK4 A;  1S1C X;  3EFF K;  2Y0C A;  3WUU A;  2DW3 A;  2L91 A;  2BEZ F;  2OQQ A;  5AW4 B;  3ABV C;  1R5L A;  1DX7 A;  2BEQ D;  3P8C E;  2M3E A;  5CHX A;  5AVR B;  1MFT A;  2WPS A;  2KK7 A;  3MIW A;  1BE3 G;  3RK2 C;  3CCQ P;  5CCG D;  2XDJ A;  1NYH A;  3C1L A;  1VDF A;  3MD0 A;  4C7N A;  1SQV D;  4NPD A;  5BU5 A;  3HUS A;  5AW8 B;  1L0N D;  5M1B A;  4EYY Q;  3MTU E;  3D70 A;  1NU1 G;  4PJ0 H;  3E7K A;  1CI6 A;  1KIL D;  2QJK C;  1EDJ A;  3KZI E;  2ZVN B;  1SQX K;  1LWU A;  1USE A;  1R8E A;  4WB4 A;  2FXP A;  3G6E P;  2NPS A;  4YXD C;  1VPC A;  1BGY D;  1MFZ A;  5KKZ C;  4A7P A;  1NU1 J;  1FZA A;  4GDO A;  4BWN A;  2E5T A;  3L71 D;  1L0L G;  1A02 F;  2ZT9 B;  4HH2 A;  3MHV A;  1PIX A;  1EDL A;  3AE3 C;  3AE7 C;  1QEX A;  2J59 M;  2QG4 A;  4YXW H;  2R5D A;  2E75 D;  1FZE A;  4H13 C;  1RY3 A;  2WSE J;  3HE5 A;  2QVA A;  5B66 E;  4N78 E;  2ITA A;  5KLV K;  3H1K D;  5L8R J;  2JO1 A;  1VQL P;  2LR2 A;  2E76 B;  3I55 P;  1IC2 A;  1RE4 A;  2V7Q H;  1NTM E;  3VMA A;  1SQP K;  2JP3 A;  3L72 J;  3CXH I;  5K5G B;  2KSJ A;  2WSC H;  1N73 C;  1CW5 A;  3BRT B;  1OWA A;  3H1J E;  2PAJ A;  3TYY A;  1SQB E;  1FZG A;  4ZNC A;  5KAI E;  1SFC A;  2FXO A;  2Q5U A;  1GL2 C;  1PPJ D;  1LT9 C;  2YMY A;  2RN0 A;  1URQ D;  2OYH C;  2A45 I;  3PH0 A;  2IPP A;  4I6M C;  2E74 C;  3GW6 A;  1AFO A;  1JMM A;  2I1J A;  4HKZ H;  4D6T J;  3CX5 D;  1YHQ P;  2L5G B;  1RHZ B;  2V7Q J;  1S5L E;  2K9J B;  2FXM A;  1XTC C;  4ZMD A;  2KLV A;  2WSC J;  2WTY A;  4AYC A;  1BE3 D;  3MGN A;  3QWO C;  1YIT P;  5APT A;  4BRY B;  1HTL C;  4EOT A;  5B5E H;  1VQM P;  1QL1 A;  1N7S D;  3PHL A;  4WY4 C;  4DCK A;  1P84 D;  4EIJ A;  3F89 A;  3H32 B;  3KPE A;  3D6Z A;  3H25 A;  1NTM G;  3E1R A;  3WMM 0;  1JCD A;  2QIW A;  3A0B H;  4L74 A;  3AE4 C;  2B87 B;  3CXH E;  1PP9 J;  2D2C D;  2W6B A;  3C9I A;  2VRS A;  1X8Y A;  5AVY B;  1SQX J;  2YKP A;  3M06 A;  2XU6 A;  1FZC B;  2QJY C;  1L0L D;  4JBZ A;  3B5N C;  2W6A A;  2K37 A;  4WWI A;  2KYV A;  1FJP A;  5AW6 B;  3FX0 A;  4R4M A;  1J1D C;  2KLU A;  4IFF A;  2FFD B;  2OTJ P;  2WWW A;  3P8C D;  5GTI H;  2WPV B;  4EI2 A;  1SQP G;  3HUS B;  3FXE A;  5KLV J;  3V4Q A;  4NPF X;  5AW5 B;  5BU8 B;  1HGV A;  5DJU B;  2KSE A;  2R44 A;  2FYU K;  1CI6 B;  2R3C A;  1ZLL A;  1SQP J;  1IFD A;  2OAR A;  1ZRT E;  1GZL A;  2NPS B;  4W7Z A;  1Y47 A;  3L75 E;  2AEJ A;  1J1E C;  1M1J A;  4C7R A;  4HB1 A;  2K1A A;  1S2E A;  4UB8 H;  1QLE D;  1GTW A;  1JNM A;  1YJN P;  2HOD B;  2IZ1 A;  4LGD E;  2SPZ A;  3HE5 B;  1KZU B;  1LJ2 A;  2ZXX A;  2GUV A;  3L70 J;  1NGM B;  4Y99 B;  2A45 G;  4H44 D;  4N3Y B;  1AA0 A;  1EQ7 A;  2R3S A;  3B71 A;  2GUS A;  2HG5 D;  1FBM A;  1KMI Z;  4N78 D;  5DJT B;  1HUC A;  1GL2 B;  1OFC X;  1EDK A;  1LT9 B;  3CC2 P;  5CJ4 A;  3VMY A;  1UIX A;  2N9B A;  3L74 E;  2Z5H A;  1U7M A;  2E74 B;  3RK3 C;  2Q7C A;  1NTM D;  4R4L A;  1SFC B;  4ZKP A;  1YIJ P;  2HLO A;  2B89 A;  1USD A;  3Q2Y A;  3H1J D;  3A0H E;  2RH0 A;  4JF7 A;  1SQB D;  1KOR A;  3N4X A;  1OX3 A;  3GF3 A;  1S3J A;  2OGU A;  3L75 G;  1BDD A;  3P32 A;  1BDC A;  1MUU A;  2M8R A;  3IAO A;  1LTJ A;  5KJ7 A;  1K9M Q;  5CCH C;  1SS1 A;  1Q81 Q;  3M0D C;  4IFM A;  3WUV A;  1WMK A;  3L75 J;  1HWT C;  2JDI H;  1NTZ G;  1NTK K;  2NRG A;  1X9V A;  2QJP C;  2HFE D;  1N7S C;  3FXD A;  3PTZ A;  2O01 N;  1NTZ J;  2XV5 A;  3MUD A;  2XNX A;  1SFC D;  1FZB A;  4GOE A;  3NTN A;  1ZR2 A;  1LTG C;  1IFM A;  3L74 G;  4JYC A;  2FYU J;  4IFD K;  3A2A A;  3B5N B;  2IFM A;  5APY A;  4W7Y A;  2NZ2 A;  4ASW A;  2IYO A;  2OTL P;  1NU1 E;  1ZME C;  3R4Y A;  4OGQ B;  1L4A C;  3H32 A;  2Q3I A;  1FS0 E;  2N1T B;  1W5C E;  4PD4 H;  3WUT A;  2ZYA A;  1K8A Q;  1KQS O;  1CZQ A;  1RF0 C;  3LID A;  1JY2 N;  1KYO I;  3T97 B;  2B87 A;  2C9N Y;  3CCS P;  2O1J A;  1NKZ B;  2JR8 A;  2ZXE B;  1SQQ K;  1BCC E;  5H2F H;  4PJ0 E;  4OVN F;  5AVV B;  1M8O B;  1EC5 A;  2O3J A;  1FZC A;  3NFQ A;  3CD6 P;  3AE6 C;  3L72 E;  1J2J B;  3GG2 A;  1K73 Q;  1GMJ A;  1P84 H;  3Q5S A;  1J1E B;  2JWA A;  3HD7 C;  1K05 A;  1N7L A;  4XA4 A;  5AW7 B;  1DD4 A;  2UWJ E;  2FFD A;  2R5B A;  3VMX A;  1JB0 J;  3BCC D;  3NMD A;  3UIA A;  2IX7 C;  1M1J B;  2QSI A;  1KQG B;  1T2K C;  1Z56 A;  3IR9 A;  3L73 G;  2Q9I A;  1Q90 D;  4I7Z B;  1ZRT D;  3TF5 A;  4K3A A;  1Y8A A;  4D6T E;  3CCR P;  4B86 A;  1T8Z A;  3IN6 A;  4DJG A;  3H1L G;  1T3U A;  3CCL P;  2W6J H;  2KI7 B;  1VF5 C;  2MKV A;  2BCC G;  3L73 J;  2FYN B;  4RJT A;  3CPW O;  5APV A;  5AVX B;  2ZVO B;  1LT1 A;  1LNQ A;  1Y9B A;  2N9Y B;  1RF1 C;  5KLI C;  1TU3 F;  3H1L J;  3RK3 B;  2MJZ A;  4ZKU A;  5AVT B;  2W8Z A;  3L37 A;  3SFE C;  3Q1M A;  2BCC J;  1EZV G;  2C9L Y;  3CWB G;  1BCC G;  1HH0 A;  1NTK J;  2HOD A;  1SQB K;  2M3B A;  2XND H;  3AE2 C;  2IBZ I;  3A7O A;  3L72 G;  1ZR4 A;  4I1L A;  3H1H J;  1YYC A;  1G2C A;  1JY2 P;  3AEE C;  3CWB J;  1BCC J;  1PP9 E;  1E79 H;  1NO4 A;  3L74 D;  1NAF A;  3O8Z A;  4H0L B;  5CBO A;  1SQX E;  2I1K A; 
#chains in the Genus database with same CATH homology
 3TGU G;  1NU1 G;  3L72 G;  1L0L G;  2A06 G;  2FYU G;  1SQP G;  1SQB G;  1PP9 G;  3L71 G;  3CX5 H;  3H1L G;  3BCC G;  3CXH H;  3H1H G;  3L75 G;  1NTZ G;  3H1K G;  1EZV G;  2BCC G;  3CWB G;  4U3F G;  1BCC G;  1NTM G;  5KLV G;  1SQV G;  1BE3 G;  1P84 H;  3L73 G;  1KYO H;  1KB9 H;  4D6T G;  1SQX G;  1L0N G;  3H1I G;  3L74 G;  4PD4 H;  1NTK G;  1BGY G;  2IBZ G;  1PPJ G;  3L70 G;  1SQQ G;  3H1J G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...