1SQVG

Crystal structure analysis of bovine bc1 with uhdbt
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 16
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqvG00
1KB9H 1PPJG 1L0LG 1SQPG 3CXHH 1NTMG 3L71G 1L0NG 1NTKG 3L75G 3H1LG 3L72G 3TGUG 1P84H 1SQVG 2IBZG 1EZVG 4PD4H 3CWBG 1SQBG 3L73G 2A06G 1BE3G 5KLVG 2FYUG 3H1JG 1BCCG 1SQQG 3H1IG 2BCCG 1PP9G 1BGYG 3H1HG 3L74G 1SQXG 3L70G 1NTZG 3CX5H 4U3FG 3BCCG 1KYOH 3H1KG 1NU1G 4D6TG
chains in the Genus database with same CATH superfamily
2ZJSE 1XTCC 5KTBA 2J58A 4ZMDA 1N73A 1SQQK 1NTMJ 1NWQA 3AEEC 2NZ2A 1OVRA 3MTUE 3A3YB 2PFXA 1AQTA 2L5GB 1ZW0A 5CBOA 1LTTC 3C9IA 5KLIB 2MKVA 5AVTB 2KS1A 1KQFB 1PP9G 1A02J 1OVVA 2KZJA 2FXOA 5APYA 5KLVJ 1KV4A 1ZOYC 1FDOA 1R5SA 4GT1A 2M3BA 1EQ7A 2E42A 1U7JA 2WPVB 3L74D 1ZRTD 4M3LA 3CC2P 3AECC 1NU1K 2E43A 2O1JA 2H43A 3LIDA 3A0BH 2ZYGA 1HVVA 4UB6H 5AW9B 2K1AA 3H32B 3MUDC 3CWBD 1P84H 2FYUK 1WT6A 2FFDA 3CPWO 1KYOE 2N1TA 2NPSC 4DOJA 1ZV8A 1HWTC 2RKLA 1L2PA 4KHXA 1U7MA 2A06D 3AE7C 2KLUA 2QA4P 2IZ0A 1M1JC 1PGPA 3VMAA 2W27A 3CXHD 1IFIA 3L73J 2WT7A 4I7ZC 1FE6A 3CCQP 3P32A 1FC2C 4W80A 1PPJG 1LT9C 1NTMG 1RF0C 3CCJP 1Y47A 3L4FA 4GOEA 2FYUD 3CI9A 3HE5A 3P7KA 1IK7A 1KYOI 2E5TA 5CBNA 1PIXA 2QSIA 3QH9A 1PPJE 2P7JA 3A2AA 3SSUA 3VP8A 2QJPC 1LP1B 1NTME 2H89C 1NTKG 1YI2P 3L72G 5KAFE 1USEA 1VQ9P 1RE4C 1EXJA 5KLVG 2Q9IA 4RKUJ 2K3RA 2FYNB 3N7NA 2IX7C 3L35A 1GL2B 1UIIA 4I2LC 3SWKA 2YXQB 1NTKE 1M57D 1IC2A 1FDMA 5CCHD 3L72E 4OWFA 3M0DC 1RF1C 5APXA 2HPCA 3WUVA 3E1IA 4Z1MH 1KC8Q 2QM8A 3G9RA 1SQQJ 3L74J 2XDJA 2M5AB 5CHXA 3LW5J 1N73B 2Q3EA 1QX8A 2RH0A 2LR2A 2IYPA 1S3JA 3CWBJ 2FKWB 1H0TA 1KILD 5CCHC 3HD7B 5DJUB 1VF5B 1JCDA 2R3SA 2BEQD 3TF5A 2IPPA 2GM4A 3USSA 3FGAD 2M3EA 2C0WA 5GTHH 1E79H 3BRVB 3RK3B 1IK9A 1JM0A 1URQD 4PJ0E 2HLOA 1G1JA 4RO0A 3EWKA 2HG5D 3F89A 2OYHA 5APQA 1KQLA 1SQXK 1NGMB 1S4XA 1SQBG 3ABVC 3L36A 3OJAB 2K9JA 3O6QA 4DJGA 3U1AA 1FZAA 3V4QA 3L71D 2FYUJ 1KILC 3TYYA 1X8YA 3HTKA 1Q7YQ 1YJWP 4I6MC 4A7PA 3WMM0 3AE2C 3P8MC 1SQBE 1T3JA 3GW6A 1JMMA 3AE9C 3V2PA 3VOPA 1N7LA 3FXEA 1LTJA 1URQC 2ZVNB 3CCMP 3SWYA 2N1TB 3AE6C 1BSHA 2LKMA 5TISH 4BRYA 3G3ZA 3M06A 1SQXD 2VRSA 1SQQG 3Q1MA 2WT7B 2OARA 2FBWC 1KB9H 3H1LD 2YO3A 3I55P 2E75B 5AVSB 1VQOP 1EZVG 3TGUJ 3I5CA 2V4HA 1DD4A 1SQQE 3V2RA 3H25A 1FOSE 3A7OA 4OGQD 1FZCA 3CL3D 2Z5IA 1SP4A 3KPEA 4DCKA 1EZVE 1FU1A 2ZFCA 1BSNA 4LLHA 4JBZA 1VQKP 2KSJA 1RH5B 1P84D 3MIWA 1QGKB 2W8ZA 3FX0A 1NU1G 2ZYDA 2XV5A 3AEFC 3P8CE 3AE1C 1AVYA 4KT0J 1VQNP 1QVGO 4ZKPA 1JY2O 4PD4E 3T97A 5KLVK 4WVZA 1OW6A 3PP5A 2G3AA 2FYUG 2HPCB 3B71A 1NO4A 1BE3J 1NU1E 3H1KE 1FZGA 3GG2A 4YTPC 4K3AA 1JY2N 1EZVI 1KQGB 3A0HH 3L71J 3FWNA 2FYUE 4UB8H 2GUSA 1EDKA 3Q3DA 3GHGC 5KKZB 1VQ6P 5BU8B 1HGZA 2A45G 1VF5D 3E1RA 4PD4I 2CPSA 1KORA 3I56P 2XNXA 5AVZB 1KMIZ 2Q7CA 1T8ZA 1SQPD 4IL6X 1GU5A 1N73C 1SQXJ 3CC4P 3TGUG 3HE4B 2Y9ZA 3H1LJ 1FS0E 2K9JB 3CMEP 3O6QB 4IOIH 1YJ9P 3W67A 2YMKA 2AEJA 1YQ3C 1CW5A 1VF5C 3HTKB 2QJYC 2Y9YA 1VQ4P 3TGUE 2IDBA 1VQ5P 1J1EB 3L70D 1JNMA 1W2BO 1K9MQ 1PGQA 2N1TD 2QIWA 1GL2A 2A45I 5H2FE 1GK4A 1JMBA 4OVNF 4BRYB 2WSCH 4CPGA 4YPCA 1BE3G 1NHLA 3Q5PA 5CMZA 2I1KA 2E75D 5CJ4A 1PV3A 3L71G 1X79B 5GTIE 1LJ2A 2M5AA 1NJIQ 2R44A 3CC7P 2KUBA 2FFDC 3H1JD 4HJGH 1GZLA 4L74A 1QVFO 1ZN5A 1BE3E 2K37A 1CI6A 2N1TC 2Q6QA 3E7KA 1JTHB 3S1KA 1FZCB 3PTZA 3L71E 3D6ZA 1OX3A 1YBKA 3HD7A 4H0LB 2BCCD 1BGYD 1X22A 1YHQP 5AW4B 3JC22 3CX5E 4U3FD 3AE5C 3KXDA 1SQXG 4GODA 5AVXB 4TLFA 3N4XA 2E75C 1T3UA 1S5LE 3H1LG 2NPSD 1DEBA 3T97B 1SQPJ 2YXRB 3H1ID 2OTKE 1BCCG 4XA4A 1PP9E 1SQXE 2R3CA 3AEBC 3AEAC 1YJNP 5B5EE 1KYOH 2XNDH 2CPBA 1GTWA 2IBZD 1VQ7P 1SFCA 1KB9D 3CX5I 1BCCE 1L4AB 2JO1A 3VMZA 3L70J 4GKGA 3NTNA 1IZNB 2E74D 5AW1B 3JCUE 1S2EA 2ZXEB 1KFMA 2JJLA 4IL6H 4W7ZA 1NOHA 4H13B 4RESB 5B66H 1KFNA 1LTIC 3EFFK 1FJKA 4AUWA 2NRGA 3AE8C 3SWFA 4EOTA 2W83C 1VQPP 5KAFH 1Z56A 3W68A 2E76B 4GIFA 5KKZC 2OYIA 3H1JJ 3AEDC 3TDKA 2KIKA 2E74C 3JSVC 1ZXGA 2W6BA 5AVRB 1FZFA 2JP3A 2Q1KA 3PH0A 3KDPB 4ZKUA 2BCCJ 1BGYJ 3II6A 3KZIE 1SQPG 2OYHC 1IFPA 4U3FJ 4L76A 2QM7A 2D2CD 1AFOA 3H1HD 3LIEA 3GMAA 5KLVE 1E5WA 5DJTB 3OAKA 2C9NY 2WSEJ 3CLQA 3H1IJ 4JQ0D 4MN4C 2IYOA 1J1EC 1OIPA 4I1LA 1USDA 1YTZI 1LTJC 1JB0J 1CI6B 1OFCX 1GD2E 3L70G 1HJ0A 2KSEA 5KJ7A 3EFGA 3D6YA 1FAVA 1OZHA 4PJ0H 2QJKB 2D2CC 3L73G 3S9OA 5BVZA 1T2KD 3G6EP 3BCCD 3L70E 4HB1A 1NKNA 2KZIA 2ZVOB 2QRXA 4N78D 3B5NB 3HE4A 3B8EB 3L73E 3M91A 1QLED 4JPZB 3Q5SA 1FZCC 2QVAA 2YIUB 2K9YA 2QEXP 1DH3A 2B89A 1M90Q 4NPDA 5KLIC 2P58A 1SFCB 1SS1A 1LNQA 3A5TA 1T2KC 2H8PD 2JWDA 3VTPC 3MP7B 2BCCG 1BGYG 1T6AA 2V7QH 4U3FG 1H8AA 1SVFA 4W7YA 3V2QA 3VN0A 5E79E 2B88A 4C7NA 3O8ZA 3BASA 1K05A 4B86A 1MFTA 1Q2NA 1LTBC 4GDOA 1JY3P 2POHA 1XTGB 3G71P 3H1IG 3CD6P 2BCCE 2C9LY 1BGYE 5M1BA 3L74G 4EI2A 3M0AA 2XZRA 2XKMA 1KTMA 3H1HJ 1YIJP 4L73A 5KAIE 1KQSO 3CWBG 5L8RJ 4NPFX 2E76D 2J59M 3L74E 1ZRTE 2JWAA 2OYIB 1MUUA 2W6JH 3AE4C 1NH4A 2LXCB 1MZ9A 1JTHA 1FDIA 4YXDC 1LTSC 1EDIA 3BRTB 4Y28J 1KYOD 1IO4A 1S5LX 3D71A 4PD4H 3CWBE 4IFDK 2A06G 2AXTE 1FOSF 5APSA 2WPSA 1GL2D 1G2CA 3GLMA 3L75D 1HUCA 1OXZA 1Q81Q 2GUVA 1K73Q 3KYQA 3AE3C 2FYZA 3BCCJ 5AW3B 3QWOC 4EDFA 2E76C 2A06E 2JDIH 1SQPK 1W2EA 5CCGA 3CXHE 2ZXXA 2ZT9B 3PRJA 2XU6A 3WU2E 4O9BA 5K5GB 2WSCJ 4EIJA 1EXIA 4WB4A 4WY4A 2FYNC 2I8DA 1GL2C 2AXCA 1L4AA 2WPRA 4I7ZB 2WSSH 3MGNA 4ASWA 3RBXA 3HD7D 2HR3A 1PGJA 1LTGC 3V5BA 2A45H 3IAOA 1HTLC 1NAFA 3H1HG 3RK3D 3CXHI 1NTKD 3L72D 4AQRD 3TNUB 3KHUA 3CMAP 3V2NA 2WQYC 3M9BA 2N9YB 1NTZK 3MD0A 2G8YA 3HUSA 1DEEG 3M9HA 5AVQB 1PZQA 2QG4A 3HD7C 1SFCD 4QMAA 3V4WA 5H2FH 4IFMA 2P67A 1X0TA 2PAJA 3RK3C 3U1CA 3BCCG 2KYVA 3NXSA 4XFJA 2WSFH 4C7NB 1KILE 1BDDA 5GTIH 5AW2B 1RY3A 2O3JA 3L75J 5AW0B 4ASVA 1FZEA 1NTZD 3C1LA 2AEFA 3BATA 1HJBA 2ITAA 2RMZA 2WWWA 4L75A 2AEMA 3F5HA 5BU5A 1SFCC 3GF7A 2DW3A 4DZOA 5AVWB 1YYCA 1S1CX 1N2DC 2Z4EA 2R5BA 2R32A 1LGHB 1DD3A 1VPCA 1OW7A 3IR9A 1L0LK 2PP6A 3WUUA 1Q82Q 3CX5H 1N7SA 1N8RQ 1LWUA 2KK7A 2WMMA 1M56D 5TJHA 1SQBD 5AW5B 2Q3IA 1S5LH 5APVA 1VL2A 2KLVA 3MZWB 1VQ8P 1OVUA 1OMIA 1RHZB 3V6IA 1GW4A 1JEKA 1ZR4A 1RE3A 3D70A 2GA1A 1G2CB 2W90A 3RBZA 5B5EH 1KILB 1KZUB 3MHVA 4HYTB 3B5NA 1NTKJ 4HKZH 3L72J 2H88C 1NVOA 2OYIC 2YKQA 3SFEC 2JR8A 2ZT9D 2M0BA 2M8RA 1LTAC 2IFNA 1L0LD 3NMDA 2Y0EA 1URQB 2SPZA 1HGVA 2IZ1A 3G4SP 2KXPB 5CJ0A 3H1LE 3VYIA 1SQQD 4YXWH 2QE7H 4WY4B 1VQLP 5KJ7D 3JCUH 1AJYA 2WTYA 1DIPA 1EZVD 1Y9BA 2O01H 3L75G 4Y99B 2KNCA 3A0BE 1TU3F 2ZT9C 3U59A 4UB6E 1L0NK 3P8CD 2Y0CA 3CCUP 2I1JA 2Y0DA 1ZR2A 4PD4D 1QEXA 1P84E 1NTZJ 2B87A 3BVHA 1OW8A 3L75E 3L37A 3HUSB 5KJ7C 4HH2A 1CZQA 1J1DB 1NU1D 1UIXA 3H1KD 1JOCA 4D6TD 1CSBA 1FZBA 1BDCA 4IFFA 2YKOA 1W5CE 3CCSP 3CCVP 3OW2O 3CCEP 1EDJA 3KZIH 4IL6E 5AW7B 2H7HA 1EDLA 5B66E 1SQBJ 3RL0g 1L0ND 2UWJE 1R5LA 3R2PA 5APTA 1P84I 4OGQB 1IFDA 4LGDE 1RQUA 2B9BA 4XE5B 4DT0A 3IF4A 1ZLLA 2IFMA 2OTJP 3MUDA 3RL0B 1VDFA 5EFWB 2P1JA 3OA7A 2P2UA 3AEGC 1MKMA 2CK3H 2WITA 1QL1A 2V7QJ 1SQVK 3RK3E 1YTZT 1PGOA 4H44B 1SQPE 3GHGB 2NPSA 1L0LJ 1M1KQ 4C46A 1A02F 1GW3A 1M1JA 1N7SB 2KOGA 2YMYA 1LWUB 1J2JB 1IFNA 3TGUD 1S9KD 1G1IA 1NKZB 1EC5A 2HODA 4JYCA 1X9VA 1LT9A 4H0LD 4BXLA 3S4RA 1DX7A 1RF0A 2YNYA 3RK2B 1NTZG 4JYBA 5C39A 1SQVD 5APWA 3TNUA 3B4SA 1YITP 5AW8B 2QJYB 5AVUB 2KS1B 1R8EA 3VP9A 1VQMP 1RQVA 3NFQA 1IFJA 3H1JG 2OYOA 5CCGD 3IFMA 1RE4A 1NTZE 4PV1B 2W6AA 1IFMA 2J5UA 2BASA 4EYYQ 1KD1Q 4H0LC 1NU1J 3H1KJ 4D6TJ 1BE3D 4WY4D 1K8AQ 5AVVB 5E79H 2YO2A 3RGUA 5GTHE 2LXBA 3CCRP 1FBMA 3H1JE 1AA0A 2WPQA 3M0DA 1RF1A 1L4AD 3IN6A 2KP8A 2HYNA 2FXMA 2Q5UA 1Y8AA 1WRGA 3CX5D 2KNCB 1L0NJ 1Q86Q 2FFDB 2K88A 5KAIH 2RN0A 5CCGC 4H13D 2WSEH 4U3FE 1L0LG 2B87B 2KB7P 4C7RA 3LW5H 1ZP0C 4WY4C 5AW6B 3VMYA 2HFED 2IBZG 3PHLA 5CCHA 1PP9D 2KI7B 3TSIA 5AVYB 1L4AC 3H1IE 1AVOA 1JO5A 2AXTH 2MJZA 3HRNA 4Y99C 4U7JA 1L0LE 5TISE 4NPEA 2L91A 2PGDA 1YQ4C 1HBWA 1JY2P 1AV1A 2IBZE 1BCCD 1IJDB 3HE5B 2ZAEB 1JY3O 3ITKA 2OQQA 1D7MA 4LC1A 1NYHA 1NTMK 1KB9E 4H13C 2WZ7A 1HF9A 3FWLA 1HH0A 3ZDMA 3CXHH 3WU2H 4ZNCA 4N6JA 1KILA 3RL0D 3HUSC 1WMKA 1J1DC 1JY3N 1SQVJ 2BEZF 3SFDC 1M7LA 3Q2YA 1GK6A 2R5DA 1NTKK 3K5BA 4H44D 3H1KG 1OWAA 4D6TG 1URQA 4TT3H 2WSFJ 1SLQA 1PL5A 1MV8A 2NPSB 2IBZI 1M8OB 2PRRA 2FY8A 1M1JB 1N7SD 1KB9I 1PPJD 4OGQC 5APUA 3UIAA 3Q5RA 1NTMD 4WWIA 4D6TE 3C8VA 2HODB 3H32A 1L0NG 3RL0C 1LT9B 4R4LA 1H88A 1S72P 1H89A 2OGUA 2WVRA 3RK2D 4R4MA 2FXPA 2O1KA 1PFIA 4H44C 4KJMA 1H0TB 4WBAA 1L0NE 3A0HE 4N3YB 3B5ND 1U57A 1ZMEC 2QJPB 5KLVD 4JF7A 4UB8E 1GU4A 2E74B 2YKPA 2JKVA 1N7SC 2C0XA 1LWUC 4PV1D 3GF3A 3WUTA 3H1HE 1PP9J 3TK1A 2E5YA 3R4YA 2QJKC 3EQ2A 2OYHB 2N9BA 1FJPA 4BWNA 1MFZA 3VMXA 3RK2C 1RE3C 1GMJA 1JUNA 1RF1B 1N86A 1BCCJ 3H6PA 3PJSK 1K04A 3PLNA 1LP1A 2Z5HA 3B5NC 1QL2A 1SQBK 1S9KE 3M9QA 1SQVG 4RJTA 2OTLP 4PV1C 1LTJB 1Q90D 4GOFA 2YIUC 2ZYAA 3BCCE 1AQ5A 3KQGA 2O01J 4AYCA 3GHGA 3L73D 2JEEA 1SQVE 2O01N 4K35A 1LT1A 4OH8B 1JCCA 4N78E 2D2CB 1KN7A 1GDTA 3CCLP 3FXDA 2P10A 1NAYA
chains in the Genus database with same CATH topology
1KB9H 1PPJG 1L0LG 1SQPG 3CXHH 1NTMG 3L71G 1L0NG 1NTKG 3L75G 3H1LG 3L72G 3TGUG 1P84H 1SQVG 2IBZG 1EZVG 4PD4H 3CWBG 1SQBG 3L73G 2A06G 1BE3G 5KLVG 2FYUG 3H1JG 1BCCG 1SQQG 3H1IG 2BCCG 1PP9G 1BGYG 3H1HG 3L74G 1SQXG 3L70G 1NTZG 3CX5H 4U3FG 3BCCG 1KYOH 3H1KG 1NU1G 4D6TG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KB9 H;  1PPJ G;  1L0L G;  1SQP G;  3CXH H;  1NTM G;  3L71 G;  1L0N G;  1NTK G;  3L75 G;  3H1L G;  3L72 G;  3TGU G;  1P84 H;  1SQV G;  2IBZ G;  1EZV G;  4PD4 H;  3CWB G;  1SQB G;  3L73 G;  2A06 G;  1BE3 G;  5KLV G;  2FYU G;  3H1J G;  1BCC G;  1SQQ G;  3H1I G;  2BCC G;  1PP9 G;  1BGY G;  3H1H G;  3L74 G;  1SQX G;  3L70 G;  1NTZ G;  3CX5 H;  4U3F G;  3BCC G;  1KYO H;  3H1K G;  1NU1 G;  4D6T G; 
#chains in the Genus database with same CATH topology
 2ZJS E;  1XTC C;  5KTB A;  2J58 A;  4ZMD A;  1N73 A;  1SQQ K;  1NTM J;  1NWQ A;  3AEE C;  2NZ2 A;  1OVR A;  3MTU E;  3A3Y B;  2PFX A;  1AQT A;  2L5G B;  1ZW0 A;  5CBO A;  1LTT C;  3C9I A;  5KLI B;  2MKV A;  5AVT B;  2KS1 A;  1KQF B;  1PP9 G;  1A02 J;  1OVV A;  2KZJ A;  2FXO A;  5APY A;  5KLV J;  1KV4 A;  1ZOY C;  1FDO A;  1R5S A;  4GT1 A;  2M3B A;  1EQ7 A;  2E42 A;  1U7J A;  2WPV B;  3L74 D;  1ZRT D;  4M3L A;  3CC2 P;  3AEC C;  1NU1 K;  2E43 A;  2O1J A;  2H43 A;  3LID A;  3A0B H;  2ZYG A;  1HVV A;  4UB6 H;  5AW9 B;  2K1A A;  3H32 B;  3MUD C;  3CWB D;  1P84 H;  2FYU K;  1WT6 A;  2FFD A;  3CPW O;  1KYO E;  2N1T A;  2NPS C;  4DOJ A;  1ZV8 A;  1HWT C;  2RKL A;  1L2P A;  4KHX A;  1U7M A;  2A06 D;  3AE7 C;  2KLU A;  2QA4 P;  2IZ0 A;  1M1J C;  1PGP A;  3VMA A;  2W27 A;  3CXH D;  1IFI A;  3L73 J;  2WT7 A;  4I7Z C;  1FE6 A;  3CCQ P;  3P32 A;  1FC2 C;  4W80 A;  1PPJ G;  1LT9 C;  1NTM G;  1RF0 C;  3CCJ P;  1Y47 A;  3L4F A;  4GOE A;  2FYU D;  3CI9 A;  3HE5 A;  3P7K A;  1IK7 A;  1KYO I;  2E5T A;  5CBN A;  1PIX A;  2QSI A;  3QH9 A;  1PPJ E;  2P7J A;  3A2A A;  3SSU A;  3VP8 A;  2QJP C;  1LP1 B;  1NTM E;  2H89 C;  1NTK G;  1YI2 P;  3L72 G;  5KAF E;  1USE A;  1VQ9 P;  1RE4 C;  1EXJ A;  5KLV G;  2Q9I A;  4RKU J;  2K3R A;  2FYN B;  3N7N A;  2IX7 C;  3L35 A;  1GL2 B;  1UII A;  4I2L C;  3SWK A;  2YXQ B;  1NTK E;  1M57 D;  1IC2 A;  1FDM A;  5CCH D;  3L72 E;  4OWF A;  3M0D C;  1RF1 C;  5APX A;  2HPC A;  3WUV A;  3E1I A;  4Z1M H;  1KC8 Q;  2QM8 A;  3G9R A;  1SQQ J;  3L74 J;  2XDJ A;  2M5A B;  5CHX A;  3LW5 J;  1N73 B;  2Q3E A;  1QX8 A;  2RH0 A;  2LR2 A;  2IYP A;  1S3J A;  3CWB J;  2FKW B;  1H0T A;  1KIL D;  5CCH C;  3HD7 B;  5DJU B;  1VF5 B;  1JCD A;  2R3S A;  2BEQ D;  3TF5 A;  2IPP A;  2GM4 A;  3USS A;  3FGA D;  2M3E A;  2C0W A;  5GTH H;  1E79 H;  3BRV B;  3RK3 B;  1IK9 A;  1JM0 A;  1URQ D;  4PJ0 E;  2HLO A;  1G1J A;  4RO0 A;  3EWK A;  2HG5 D;  3F89 A;  2OYH A;  5APQ A;  1KQL A;  1SQX K;  1NGM B;  1S4X A;  1SQB G;  3ABV C;  3L36 A;  3OJA B;  2K9J A;  3O6Q A;  4DJG A;  3U1A A;  1FZA A;  3V4Q A;  3L71 D;  2FYU J;  1KIL C;  3TYY A;  1X8Y A;  3HTK A;  1Q7Y Q;  1YJW P;  4I6M C;  4A7P A;  3WMM 0;  3AE2 C;  3P8M C;  1SQB E;  1T3J A;  3GW6 A;  1JMM A;  3AE9 C;  3V2P A;  3VOP A;  1N7L A;  3FXE A;  1LTJ A;  1URQ C;  2ZVN B;  3CCM P;  3SWY A;  2N1T B;  3AE6 C;  1BSH A;  2LKM A;  5TIS H;  4BRY A;  3G3Z A;  3M06 A;  1SQX D;  2VRS A;  1SQQ G;  3Q1M A;  2WT7 B;  2OAR A;  2FBW C;  1KB9 H;  3H1L D;  2YO3 A;  3I55 P;  2E75 B;  5AVS B;  1VQO P;  1EZV G;  3TGU J;  3I5C A;  2V4H A;  1DD4 A;  1SQQ E;  3V2R A;  3H25 A;  1FOS E;  3A7O A;  4OGQ D;  1FZC A;  3CL3 D;  2Z5I A;  1SP4 A;  3KPE A;  4DCK A;  1EZV E;  1FU1 A;  2ZFC A;  1BSN A;  4LLH A;  4JBZ A;  1VQK P;  2KSJ A;  1RH5 B;  1P84 D;  3MIW A;  1QGK B;  2W8Z A;  3FX0 A;  1NU1 G;  2ZYD A;  2XV5 A;  3AEF C;  3P8C E;  3AE1 C;  1AVY A;  4KT0 J;  1VQN P;  1QVG O;  4ZKP A;  1JY2 O;  4PD4 E;  3T97 A;  5KLV K;  4WVZ A;  1OW6 A;  3PP5 A;  2G3A A;  2FYU G;  2HPC B;  3B71 A;  1NO4 A;  1BE3 J;  1NU1 E;  3H1K E;  1FZG A;  3GG2 A;  4YTP C;  4K3A A;  1JY2 N;  1EZV I;  1KQG B;  3A0H H;  3L71 J;  3FWN A;  2FYU E;  4UB8 H;  2GUS A;  1EDK A;  3Q3D A;  3GHG C;  5KKZ B;  1VQ6 P;  5BU8 B;  1HGZ A;  2A45 G;  1VF5 D;  3E1R A;  4PD4 I;  2CPS A;  1KOR A;  3I56 P;  2XNX A;  5AVZ B;  1KMI Z;  2Q7C A;  1T8Z A;  1SQP D;  4IL6 X;  1GU5 A;  1N73 C;  1SQX J;  3CC4 P;  3TGU G;  3HE4 B;  2Y9Z A;  3H1L J;  1FS0 E;  2K9J B;  3CME P;  3O6Q B;  4IOI H;  1YJ9 P;  3W67 A;  2YMK A;  2AEJ A;  1YQ3 C;  1CW5 A;  1VF5 C;  3HTK B;  2QJY C;  2Y9Y A;  1VQ4 P;  3TGU E;  2IDB A;  1VQ5 P;  1J1E B;  3L70 D;  1JNM A;  1W2B O;  1K9M Q;  1PGQ A;  2N1T D;  2QIW A;  1GL2 A;  2A45 I;  5H2F E;  1GK4 A;  1JMB A;  4OVN F;  4BRY B;  2WSC H;  4CPG A;  4YPC A;  1BE3 G;  1NHL A;  3Q5P A;  5CMZ A;  2I1K A;  2E75 D;  5CJ4 A;  1PV3 A;  3L71 G;  1X79 B;  5GTI E;  1LJ2 A;  2M5A A;  1NJI Q;  2R44 A;  3CC7 P;  2KUB A;  2FFD C;  3H1J D;  4HJG H;  1GZL A;  4L74 A;  1QVF O;  1ZN5 A;  1BE3 E;  2K37 A;  1CI6 A;  2N1T C;  2Q6Q A;  3E7K A;  1JTH B;  3S1K A;  1FZC B;  3PTZ A;  3L71 E;  3D6Z A;  1OX3 A;  1YBK A;  3HD7 A;  4H0L B;  2BCC D;  1BGY D;  1X22 A;  1YHQ P;  5AW4 B;  3JC2 2;  3CX5 E;  4U3F D;  3AE5 C;  3KXD A;  1SQX G;  4GOD A;  5AVX B;  4TLF A;  3N4X A;  2E75 C;  1T3U A;  1S5L E;  3H1L G;  2NPS D;  1DEB A;  3T97 B;  1SQP J;  2YXR B;  3H1I D;  2OTK E;  1BCC G;  4XA4 A;  1PP9 E;  1SQX E;  2R3C A;  3AEB C;  3AEA C;  1YJN P;  5B5E E;  1KYO H;  2XND H;  2CPB A;  1GTW A;  2IBZ D;  1VQ7 P;  1SFC A;  1KB9 D;  3CX5 I;  1BCC E;  1L4A B;  2JO1 A;  3VMZ A;  3L70 J;  4GKG A;  3NTN A;  1IZN B;  2E74 D;  5AW1 B;  3JCU E;  1S2E A;  2ZXE B;  1KFM A;  2JJL A;  4IL6 H;  4W7Z A;  1NOH A;  4H13 B;  4RES B;  5B66 H;  1KFN A;  1LTI C;  3EFF K;  1FJK A;  4AUW A;  2NRG A;  3AE8 C;  3SWF A;  4EOT A;  2W83 C;  1VQP P;  5KAF H;  1Z56 A;  3W68 A;  2E76 B;  4GIF A;  5KKZ C;  2OYI A;  3H1J J;  3AED C;  3TDK A;  2KIK A;  2E74 C;  3JSV C;  1ZXG A;  2W6B A;  5AVR B;  1FZF A;  2JP3 A;  2Q1K A;  3PH0 A;  3KDP B;  4ZKU A;  2BCC J;  1BGY J;  3II6 A;  3KZI E;  1SQP G;  2OYH C;  1IFP A;  4U3F J;  4L76 A;  2QM7 A;  2D2C D;  1AFO A;  3H1H D;  3LIE A;  3GMA A;  5KLV E;  1E5W A;  5DJT B;  3OAK A;  2C9N Y;  2WSE J;  3CLQ A;  3H1I J;  4JQ0 D;  4MN4 C;  2IYO A;  1J1E C;  1OIP A;  4I1L A;  1USD A;  1YTZ I;  1LTJ C;  1JB0 J;  1CI6 B;  1OFC X;  1GD2 E;  3L70 G;  1HJ0 A;  2KSE A;  5KJ7 A;  3EFG A;  3D6Y A;  1FAV A;  1OZH A;  4PJ0 H;  2QJK B;  2D2C C;  3L73 G;  3S9O A;  5BVZ A;  1T2K D;  3G6E P;  3BCC D;  3L70 E;  4HB1 A;  1NKN A;  2KZI A;  2ZVO B;  2QRX A;  4N78 D;  3B5N B;  3HE4 A;  3B8E B;  3L73 E;  3M91 A;  1QLE D;  4JPZ B;  3Q5S A;  1FZC C;  2QVA A;  2YIU B;  2K9Y A;  2QEX P;  1DH3 A;  2B89 A;  1M90 Q;  4NPD A;  5KLI C;  2P58 A;  1SFC B;  1SS1 A;  1LNQ A;  3A5T A;  1T2K C;  2H8P D;  2JWD A;  3VTP C;  3MP7 B;  2BCC G;  1BGY G;  1T6A A;  2V7Q H;  4U3F G;  1H8A A;  1SVF A;  4W7Y A;  3V2Q A;  3VN0 A;  5E79 E;  2B88 A;  4C7N A;  3O8Z A;  3BAS A;  1K05 A;  4B86 A;  1MFT A;  1Q2N A;  1LTB C;  4GDO A;  1JY3 P;  2POH A;  1XTG B;  3G71 P;  3H1I G;  3CD6 P;  2BCC E;  2C9L Y;  1BGY E;  5M1B A;  3L74 G;  4EI2 A;  3M0A A;  2XZR A;  2XKM A;  1KTM A;  3H1H J;  1YIJ P;  4L73 A;  5KAI E;  1KQS O;  3CWB G;  5L8R J;  4NPF X;  2E76 D;  2J59 M;  3L74 E;  1ZRT E;  2JWA A;  2OYI B;  1MUU A;  2W6J H;  3AE4 C;  1NH4 A;  2LXC B;  1MZ9 A;  1JTH A;  1FDI A;  4YXD C;  1LTS C;  1EDI A;  3BRT B;  4Y28 J;  1KYO D;  1IO4 A;  1S5L X;  3D71 A;  4PD4 H;  3CWB E;  4IFD K;  2A06 G;  2AXT E;  1FOS F;  5APS A;  2WPS A;  1GL2 D;  1G2C A;  3GLM A;  3L75 D;  1HUC A;  1OXZ A;  1Q81 Q;  2GUV A;  1K73 Q;  3KYQ A;  3AE3 C;  2FYZ A;  3BCC J;  5AW3 B;  3QWO C;  4EDF A;  2E76 C;  2A06 E;  2JDI H;  1SQP K;  1W2E A;  5CCG A;  3CXH E;  2ZXX A;  2ZT9 B;  3PRJ A;  2XU6 A;  3WU2 E;  4O9B A;  5K5G B;  2WSC J;  4EIJ A;  1EXI A;  4WB4 A;  4WY4 A;  2FYN C;  2I8D A;  1GL2 C;  2AXC A;  1L4A A;  2WPR A;  4I7Z B;  2WSS H;  3MGN A;  4ASW A;  3RBX A;  3HD7 D;  2HR3 A;  1PGJ A;  1LTG C;  3V5B A;  2A45 H;  3IAO A;  1HTL C;  1NAF A;  3H1H G;  3RK3 D;  3CXH I;  1NTK D;  3L72 D;  4AQR D;  3TNU B;  3KHU A;  3CMA P;  3V2N A;  2WQY C;  3M9B A;  2N9Y B;  1NTZ K;  3MD0 A;  2G8Y A;  3HUS A;  1DEE G;  3M9H A;  5AVQ B;  1PZQ A;  2QG4 A;  3HD7 C;  1SFC D;  4QMA A;  3V4W A;  5H2F H;  4IFM A;  2P67 A;  1X0T A;  2PAJ A;  3RK3 C;  3U1C A;  3BCC G;  2KYV A;  3NXS A;  4XFJ A;  2WSF H;  4C7N B;  1KIL E;  1BDD A;  5GTI H;  5AW2 B;  1RY3 A;  2O3J A;  3L75 J;  5AW0 B;  4ASV A;  1FZE A;  1NTZ D;  3C1L A;  2AEF A;  3BAT A;  1HJB A;  2ITA A;  2RMZ A;  2WWW A;  4L75 A;  2AEM A;  3F5H A;  5BU5 A;  1SFC C;  3GF7 A;  2DW3 A;  4DZO A;  5AVW B;  1YYC A;  1S1C X;  1N2D C;  2Z4E A;  2R5B A;  2R32 A;  1LGH B;  1DD3 A;  1VPC A;  1OW7 A;  3IR9 A;  1L0L K;  2PP6 A;  3WUU A;  1Q82 Q;  3CX5 H;  1N7S A;  1N8R Q;  1LWU A;  2KK7 A;  2WMM A;  1M56 D;  5TJH A;  1SQB D;  5AW5 B;  2Q3I A;  1S5L H;  5APV A;  1VL2 A;  2KLV A;  3MZW B;  1VQ8 P;  1OVU A;  1OMI A;  1RHZ B;  3V6I A;  1GW4 A;  1JEK A;  1ZR4 A;  1RE3 A;  3D70 A;  2GA1 A;  1G2C B;  2W90 A;  3RBZ A;  5B5E H;  1KIL B;  1KZU B;  3MHV A;  4HYT B;  3B5N A;  1NTK J;  4HKZ H;  3L72 J;  2H88 C;  1NVO A;  2OYI C;  2YKQ A;  3SFE C;  2JR8 A;  2ZT9 D;  2M0B A;  2M8R A;  1LTA C;  2IFN A;  1L0L D;  3NMD A;  2Y0E A;  1URQ B;  2SPZ A;  1HGV A;  2IZ1 A;  3G4S P;  2KXP B;  5CJ0 A;  3H1L E;  3VYI A;  1SQQ D;  4YXW H;  2QE7 H;  4WY4 B;  1VQL P;  5KJ7 D;  3JCU H;  1AJY A;  2WTY A;  1DIP A;  1EZV D;  1Y9B A;  2O01 H;  3L75 G;  4Y99 B;  2KNC A;  3A0B E;  1TU3 F;  2ZT9 C;  3U59 A;  4UB6 E;  1L0N K;  3P8C D;  2Y0C A;  3CCU P;  2I1J A;  2Y0D A;  1ZR2 A;  4PD4 D;  1QEX A;  1P84 E;  1NTZ J;  2B87 A;  3BVH A;  1OW8 A;  3L75 E;  3L37 A;  3HUS B;  5KJ7 C;  4HH2 A;  1CZQ A;  1J1D B;  1NU1 D;  1UIX A;  3H1K D;  1JOC A;  4D6T D;  1CSB A;  1FZB A;  1BDC A;  4IFF A;  2YKO A;  1W5C E;  3CCS P;  3CCV P;  3OW2 O;  3CCE P;  1EDJ A;  3KZI H;  4IL6 E;  5AW7 B;  2H7H A;  1EDL A;  5B66 E;  1SQB J;  3RL0 g;  1L0N D;  2UWJ E;  1R5L A;  3R2P A;  5APT A;  1P84 I;  4OGQ B;  1IFD A;  4LGD E;  1RQU A;  2B9B A;  4XE5 B;  4DT0 A;  3IF4 A;  1ZLL A;  2IFM A;  2OTJ P;  3MUD A;  3RL0 B;  1VDF A;  5EFW B;  2P1J A;  3OA7 A;  2P2U A;  3AEG C;  1MKM A;  2CK3 H;  2WIT A;  1QL1 A;  2V7Q J;  1SQV K;  3RK3 E;  1YTZ T;  1PGO A;  4H44 B;  1SQP E;  3GHG B;  2NPS A;  1L0L J;  1M1K Q;  4C46 A;  1A02 F;  1GW3 A;  1M1J A;  1N7S B;  2KOG A;  2YMY A;  1LWU B;  1J2J B;  1IFN A;  3TGU D;  1S9K D;  1G1I A;  1NKZ B;  1EC5 A;  2HOD A;  4JYC A;  1X9V A;  1LT9 A;  4H0L D;  4BXL A;  3S4R A;  1DX7 A;  1RF0 A;  2YNY A;  3RK2 B;  1NTZ G;  4JYB A;  5C39 A;  1SQV D;  5APW A;  3TNU A;  3B4S A;  1YIT P;  5AW8 B;  2QJY B;  5AVU B;  2KS1 B;  1R8E A;  3VP9 A;  1VQM P;  1RQV A;  3NFQ A;  1IFJ A;  3H1J G;  2OYO A;  5CCG D;  3IFM A;  1RE4 A;  1NTZ E;  4PV1 B;  2W6A A;  1IFM A;  2J5U A;  2BAS A;  4EYY Q;  1KD1 Q;  4H0L C;  1NU1 J;  3H1K J;  4D6T J;  1BE3 D;  4WY4 D;  1K8A Q;  5AVV B;  5E79 H;  2YO2 A;  3RGU A;  5GTH E;  2LXB A;  3CCR P;  1FBM A;  3H1J E;  1AA0 A;  2WPQ A;  3M0D A;  1RF1 A;  1L4A D;  3IN6 A;  2KP8 A;  2HYN A;  2FXM A;  2Q5U A;  1Y8A A;  1WRG A;  3CX5 D;  2KNC B;  1L0N J;  1Q86 Q;  2FFD B;  2K88 A;  5KAI H;  2RN0 A;  5CCG C;  4H13 D;  2WSE H;  4U3F E;  1L0L G;  2B87 B;  2KB7 P;  4C7R A;  3LW5 H;  1ZP0 C;  4WY4 C;  5AW6 B;  3VMY A;  2HFE D;  2IBZ G;  3PHL A;  5CCH A;  1PP9 D;  2KI7 B;  3TSI A;  5AVY B;  1L4A C;  3H1I E;  1AVO A;  1JO5 A;  2AXT H;  2MJZ A;  3HRN A;  4Y99 C;  4U7J A;  1L0L E;  5TIS E;  4NPE A;  2L91 A;  2PGD A;  1YQ4 C;  1HBW A;  1JY2 P;  1AV1 A;  2IBZ E;  1BCC D;  1IJD B;  3HE5 B;  2ZAE B;  1JY3 O;  3ITK A;  2OQQ A;  1D7M A;  4LC1 A;  1NYH A;  1NTM K;  1KB9 E;  4H13 C;  2WZ7 A;  1HF9 A;  3FWL A;  1HH0 A;  3ZDM A;  3CXH H;  3WU2 H;  4ZNC A;  4N6J A;  1KIL A;  3RL0 D;  3HUS C;  1WMK A;  1J1D C;  1JY3 N;  1SQV J;  2BEZ F;  3SFD C;  1M7L A;  3Q2Y A;  1GK6 A;  2R5D A;  1NTK K;  3K5B A;  4H44 D;  3H1K G;  1OWA A;  4D6T G;  1URQ A;  4TT3 H;  2WSF J;  1SLQ A;  1PL5 A;  1MV8 A;  2NPS B;  2IBZ I;  1M8O B;  2PRR A;  2FY8 A;  1M1J B;  1N7S D;  1KB9 I;  1PPJ D;  4OGQ C;  5APU A;  3UIA A;  3Q5R A;  1NTM D;  4WWI A;  4D6T E;  3C8V A;  2HOD B;  3H32 A;  1L0N G;  3RL0 C;  1LT9 B;  4R4L A;  1H88 A;  1S72 P;  1H89 A;  2OGU A;  2WVR A;  3RK2 D;  4R4M A;  2FXP A;  2O1K A;  1PFI A;  4H44 C;  4KJM A;  1H0T B;  4WBA A;  1L0N E;  3A0H E;  4N3Y B;  3B5N D;  1U57 A;  1ZME C;  2QJP B;  5KLV D;  4JF7 A;  4UB8 E;  1GU4 A;  2E74 B;  2YKP A;  2JKV A;  1N7S C;  2C0X A;  1LWU C;  4PV1 D;  3GF3 A;  3WUT A;  3H1H E;  1PP9 J;  3TK1 A;  2E5Y A;  3R4Y A;  2QJK C;  3EQ2 A;  2OYH B;  2N9B A;  1FJP A;  4BWN A;  1MFZ A;  3VMX A;  3RK2 C;  1RE3 C;  1GMJ A;  1JUN A;  1RF1 B;  1N86 A;  1BCC J;  3H6P A;  3PJS K;  1K04 A;  3PLN A;  1LP1 A;  2Z5H A;  3B5N C;  1QL2 A;  1SQB K;  1S9K E;  3M9Q A;  1SQV G;  4RJT A;  2OTL P;  4PV1 C;  1LTJ B;  1Q90 D;  4GOF A;  2YIU C;  2ZYA A;  3BCC E;  1AQ5 A;  3KQG A;  2O01 J;  4AYC A;  3GHG A;  3L73 D;  2JEE A;  1SQV E;  2O01 N;  4K35 A;  1LT1 A;  4OH8 B;  1JCC A;  4N78 E;  2D2C B;  1KN7 A;  1GDT A;  3CCL P;  3FXD A;  2P10 A;  1NAY A; 
#chains in the Genus database with same CATH homology
 1KB9 H;  1PPJ G;  1L0L G;  1SQP G;  3CXH H;  1NTM G;  3L71 G;  1L0N G;  1NTK G;  3L75 G;  3H1L G;  3L72 G;  3TGU G;  1P84 H;  1SQV G;  2IBZ G;  1EZV G;  4PD4 H;  3CWB G;  1SQB G;  3L73 G;  2A06 G;  1BE3 G;  5KLV G;  2FYU G;  3H1J G;  1BCC G;  1SQQ G;  3H1I G;  2BCC G;  1PP9 G;  1BGY G;  3H1H G;  3L74 G;  1SQX G;  3L70 G;  1NTZ G;  3CX5 H;  4U3F G;  3BCC G;  1KYO H;  3H1K G;  1NU1 G;  4D6T G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...