4HJGH

Meditope-enabled trastuzumab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
b'GSYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4hjgH00
1LP1A 2JWDA 2B87B 5EFWB 4K35A 2QRXA 2LXBA 1H0TA 2B87A 1DEEG 1JMBA 1LT1A 1JM0A 4HB1A 1U7JA 1SS1A 1OVUA 1BDCA 3ZDMA 2LR2A 3FXDA 4EYYQ 3PH0A 1U7MA 2B89A 5CBNA 1ZW0A 2R44A 3S1KA 2KIKA 1X0TA 1OVVA 2KI7B 4MN4C 2WMMA 5K5GB 4ASVA 2K3RA 5CBOA 4HKZH 4ZMDA 4WWIA 1EC5A 3MHVA 3MZWB 1EDIA 1NVOA 2B88A 4GODA 1Y47A 2M5AB 2KUBA 4KJMA 4K3AA 2KZJA 4NPFX 1S3JA 4HJGH 1EDKA 2M0BA 2I8DA 1MFTA 4IOIH 1BDDA 1EDJA 4NPDA 3QWOC 1H0TB 2UWJE 1FC2C 1EDLA 4GOEA 4JBZA 2KZIA 2Q1KA 4GOFA 2KS1B 2RKLA 1Q2NA 4CPGA 2HR3A 2ZAEB 3RGUA 4ZNCA 2QVAA 1ZXGA 4NPEA 1OVRA 2LXCB 1LP1B 5C39A 4BXLA 2P58A 2M5AA 2OTKE 5DJTB 2SPZA 5DJUB 3FXEA 4ASWA
chains in the Genus database with same CATH superfamily
1BE3E 1GD2E 1YQ3C 3KZIH 1SQVE 1J1DC 3V4QA 4PJ0H 1JY2O 1N73A 1PFIA 1T6AA 2Y0EA 3FGAD 3VMXA 1KFMA 2FFDC 3CI9A 1S1CX 1PP9J 3V2RA 3G6EP 4ZKPA 2HYNA 4WY4D 1J1DB 1L0LJ 3QH9A 1URQD 5KLVE 2K3RA 4H13C 2BCCJ 1OXZA 1KB9H 2FFDB 2WZ7A 1PGPA 1EDIA 3AE7C 3AE6C 2GUVA 1FZAA 3KZIE 3RL0C 4I7ZC 4PJ0E 2E75D 1NU1J 4XE5B 1KILE 1R5SA 1NTZK 2WSFH 5AVTB 5B66H 2IX7C 1FBMA 4NPFX 1HWTC 4UB8E 4H13B 5AVZB 1P84I 4BWNA 1T2KD 4DT0A 5KJ7C 1BGYE 1GK6A 3L37A 3H1LJ 1VQ8P 2P10A 3RL0B 2J58A 3KYQA 4I7ZB 2RKLA 3TGUJ 1IFMA 2OYIA 1SVFA 3GMAA 3CXHI 4EDFA 2QEXP 3EWKA 3I56P 3M9BA 4JPZB 1FDOA 2IBZE 5AVWB 4TT3H 1A02F 3AEFC 5B66E 4WY4A 1VDFA 1H0TA 2C9NY 1URQA 4H44D 1FDIA 1ZLLA 2WITA 3M06A 1T8ZA 4C7RA 2K37A 1JUNA 2GA1A 2MJZA 1NTMD 1LTTC 3A0HE 1EC5A 3Q5PA 1L0ND 3RBXA 3L73G 1SFCD 1AV1A 3EQ2A 1KYOI 1H88A 3D6YA 2FYUG 3L70G 2H43A 1NAFA 1EXJA 1RF1A 2ITAA 1NTMG 2NPSB 4U3FE 1PP9E 1LTBC 2ZFCA 1YJWP 1LJ2A 1FC2C 3AECC 4HH2A 1FJKA 1Q2NA 2WT7B 2Z5HA 5L8RJ 2BCCE 3W67A 4BXLA 2FXOA 2FBWC 2KSJA 3CCJP 3G4SP 3TF5A 1NTKD 3H1ID 1KQFB 4WBAA 5EFWB 1P84E 2IFMA 4D6TG 3H1HD 4JYCA 4I2LC 1MUUA 1JTHB 3MP7B 4PD4I 2G3AA 3H1LE 2KLUA 2FXMA 1PPJD 5CMZA 3LW5J 5H2FH 1SFCA 1XTCC 2B89A 3H1IG 3KQGA 4IL6X 1VL2A 1OVVA 2QM7A 3H1JJ 2ZYDA 1RQUA 3MUDC 2M8RA 1CI6A 3H1HG 1ZR2A 1AVYA 1JMMA 4ZMDA 3CMAP 1NAYA 3CD6P 1NGMB 3D6ZA 1LT9A 1QLED 3IR9A 4OGQD 1FE6A 1KQGB 3E1IA 3H6PA 3SSUA 1FZEA 1JEKA 1PGQA 3CLQA 1IZNB 1S3JA 1BSHA 3EFGA 2I8DA 1OW6A 4QMAA 5AW9B 5H2FE 4UB6E 1EDJA 1KILC 2AXCA 5AW8B 1U57A 1EDLA 3GHGA 2K9YA 3T97B 3JCUE 1IJDB 1KYOE 3HD7C 5C39A 2P58A 2O3JA 1PGJA 5DJUB 3FXEA 1S9KE 3PRJA 1KILB 4EIJA 2AEFA 3JSVC 5CJ4A 1FDMA 3KHUA 3C9IA 2OYOA 1JY2N 3HE5A 1EZVI 2ZT9D 5AVVB 3KXDA 2B87A 1S5LE 2HFED 3HD7B 4OH8B 1LT1A 1RE4C 2KS1A 4ZKUA 4OWFA 1OVUA 1KMIZ 2JO1A 1DX7A 3PH0A 3GF3A 1K73Q 4EI2A 3PLNA 1X22A 2E42A 1OW7A 1RHZB 3H1KJ 2XKMA 3M91A 4BRYB 1L4AD 1OW8A 3H32A 3TYYA 3AE3C 2R32A 4AUWA 5GTIE 2D2CD 4PD4E 3B5NA 3L75G 3BRVB 3OAKA 2W8ZA 3ABVC 1FAVA 2A45G 1S72P 3M0DC 1W2EA 1NOHA 2HODB 2IBZG 3CCUP 3CWBD 1VQ5P 1BE3J 5KAIH 1GL2C 2A06G 1SQVJ 1OMIA 4IFDK 3JC22 2I1KA 3CX5D 1JOCA 1NTMK 5KAFH 3L71D 1L0NK 4N78D 1LTJC 2BEZF 4C7NA 2OTLP 1RE3C 3AE8C 1GL2B 3SWYA 2PAJA 5AW4B 3A0BH 4HB1A 3BCCD 5KLVJ 3HUSA 1UIXA 1L4AA 1SQQD 1CW5A 3L71G 1L0LD 1GMJA 1VPCA 5M1BA 1LTJB 2KIKA 2IFNA 3L72D 1USDA 4GDOA 2KNCB 1M56D 4AQRD 3G71P 3G3ZA 4HKZH 5KAFE 4XFJA 1M1KQ 1L0NE 1N8RQ 3BCCG 4U7JA 1PP9G 5AVQB 1N73C 1EZVE 5E79H 3A2AA 3AEEC 1QX8A 4N6JA 4YTPC 2B88A 1L0LG 5KTBA 1Y47A 2IPPA 1NTKK 1QVFO 3L72G 1LWUA 2AXTH 1D7MA 3CCVP 1JY3N 2N1TC 2KSEA 3P8CD 3BRTB 1N73B 1WRGA 1NU1G 2ZXXA 1KB9I 1HGVA 1BCCD 2YKOA 3II6A 5CCGD 1NTZJ 1QVGO 3N4XA 3V2PA 1T3JA 2AEMA 2YO3A 5B5EH 1GTWA 3VP9A 2WSFJ 4NPEA 3WUUA 2WSEH 2YKQA 1JCCA 1NTKE 1OWAA 5APTA 1LP1A 2E74C 2W90A 3TGUG 3HE4A 2C9LY 2G8YA 1VF5D 3SWFA 1ZP0C 1X79B 1PPJE 3NFQA 2OYIC 1JNMA 1VQLP 1E5WA 2E74B 3P7KA 1LTSC 1GDTA 4MN4C 5B5EE 2OQQA 2ZVOB 1SQPD 4WY4C 2P2UA 2KP8A 2XDJA 4U3FJ 1LGHB 4HYTB 1URQC 2YMYA 1IFPA 2OYIB 1SQBD 5CCGA 4KJMA 1UIIA 1AQ5A 3LIDA 1SQPG 2E75C 3C8VA 4WY4B 3A3YB 3A7OA 4IFFA 1H0TB 1URQB 1IK7A 2UWJE 3IAOA 1SQBG 2Q9IA 4PV1D 1T2KC 2K9JA 4N3YB 2PP6A 5CCHA 2E75B 2WPSA 3AEBC 1N86A 1RF1C 2XV5A 4I1LA 1J1EC 4LC1A 1FZBA 1TU3F 2ZYGA 1NKZB 1KB9E 2O1JA 1SS1A 1BDCA 1SQXD 1NTZE 2WPRA 5AW0B 1RF1B 1DIPA 5AW2B 5AVSB 4H44C 4YXDC 1J1EB 4L74A 1NO4A 1H8AA 3CX5H 2RMZA 1SP4A 3L73D 5AVUB 2WSCH 1SQXG 3B71A 2FYUD 4H44B 4GODA 3H1JG 2VRSA 1QGKB 3L70D 2R3CA 1SFCC 2W83C 1GU4A 2NPSC 1N7SD 1BDDA 1FU1A 2BASA 1HTLC 4W7ZA 2E76D 1YITP 3CWBE 4R4LA 3V4WA 1SQQK 1YI2P 3OW2O 3VOPA 2Z5IA 1L0LK 1JO5A 2IDBA 1LT9C 1CSBA 4YXWH 1KN7A 1SFCB 3CX5E 3CCLP 3AE9C 2SPZA 1JY3O 3IF4A 1RF0A 1Y8AA 4ASWA 1M8OB 2MKVA 2H7HA 4N78E 1CI6B 5APYA 1RH5B 2FXPA 1KV4A 1S5LX 4D6TD 3VYIA 3FWLA 3WU2H 1LT9B 3MTUE 4EOTA 3WUTA 1J2JB 1M7LA 3N7NA 1U7JA 4KT0J 3GHGC 3CC7P 3D71A 5CBNA 1X8YA 3KPEA 1Q7YQ 1ZW0A 4L75A 2JEEA 1USEA 3L74D 2Q3EA 3VMZA 3Q5SA 1N7SA 3GHGB 1AQTA 1Y9BA 1N7LA 3GW6A 3O8ZA 3H1KG 1Q81Q 1YJNP 3L74G 2O01H 2H8PD 1LNQA 4OGQC 1PIXA 1FZGA 3CCRP 2W6BA 2P1JA 1ZRTD 1YYCA 2YIUC 3P8CE 3HE5B 2QJYC 1IFIA 1BE3D 2QE7H 1BCCE 2QIWA 3BVHA 1SQVD 1AFOA 3FX0A 2Q1KA 4JQ0D 3D70A 2KS1B 2R5BA 1OX3A 2CPSA 3RGUA 3P8MC 2LXCB 3AEAC 1IK9A 4OGQB 2HPCA 1K8AQ 2YIUB 1VQPP 1IFJA 5CJ0A 3RK2D 2QJYB 1SQPK 1BE3G 3CCMP 1M1JA 1FS0E 2IYOA 1SQVG 3B5ND 1KD1Q 2QRXA 3H32B 1SQBK 2JKVA 3O6QA 3RK3D 1NTMJ 4DJGA 1GW3A 4RJTA 1VQ4P 1L0NJ 4EYYQ 2ZT9C 3H25A 1Q86Q 5K5GB 3P32A 1PZQA 5KLVG 3Q5RA 4WWIA 3HRNA 3MHVA 1BGYD 3U1AA 2ZT9B 1MV8A 3SWKA 3HUSC 3L75D 4Z1MH 4IL6H 5GTHH 5AW6B 2K88A 2E5YA 2HG5D 1EDKA 4IOIH 4C7NB 2D2CC 1HH0A 3M9HA 3QWOC 1BGYG 2IBZD 3CC2P 1NTKJ 2XNXA 3H1IJ 4DZOA 3HTKA 1SQXK 3OA7A 1AA0A 2A06D 3HUSB 3SFEC 2N9YB 3A5TA 2I1JA 3H1HJ 3E1RA 2OTKE 1FOSE 2W27A 2D2CB 2YO2A 1LWUC 4H0LD 4GIFA 4IL6E 1YQ4C 4RO0A 2FYUK 5AW1B 1JM0A 3R2PA 3TNUB 2WSEJ 2LR2A 2JDIH 1LWUB 2WVRA 4I6MC 2IZ0A 3U59A 2C0XA 2L5GB 1YHQP 3LIEA 5CBOA 3CMEP 3L73E 1PP9D 1FZCA 3PHLA 2FYUE 5KAIE 3AEGC 4Y28J 3L70E 1NTME 3CPWO 1HVVA 2BCCD 1VQ7P 3TSIA 3HE4B 4U3FG 2JJLA 1IC2A 3NXSA 1NU1D 3CCEP 4GOEA 1LTGC 2KZIA 1P84D 3B4SA 4JF7A 2HODA 1VQ9P 4M3LA 1NKNA 3A0BE 5AW3B 1OVRA 2BCCG 3OJAB 2XNDH 1HGZA 2M5AA 3H1LD 5DJTB 1GK4A 5CCGC 1YTZI 1K04A 3C1LA 1KTMA 3TGUD 2JR8A 1RQVA 4D6TE 4K35A 3CXHD 3V2NA 3M0DA 2KXPB 1S4XA 2ZJSE 3NTNA 5BU5A 3W68A 1OZHA 3H1LG 1YJ9P 4XA4A 5E79E 1WMKA 3H1IE 4R4MA 3VP8A 1NH4A 1VF5C 3FXDA 3CCQP 2KOGA 1LTAC 2N1TD 3I55P 3WUVA 2XU6A 1H89A 3MD0A 3H1HE 1T3UA 1SLQA 1M90Q 1SQVK 2OYHA 2L91A 2AXTE 1RE3A 5CCHD 1NHLA 2BEQD 1JB0J 2WSSH 5TJHA 2O1KA 1K9MQ 3MIWA 1VF5B 2K9JB 4L73A 3TK1A 2IYPA 1G2CA 3CWBJ 3L35A 2B9BA 1VQKP 1KYOD 1KORA 1HJ0A 3ITKA 2JWAA 1S9KD 1M57D 5AVRB 2CPBA 2R3SA 2NZ2A 1DEBA 3L71J 3CX5I 5APUA 2WSCJ 4O9BA 1AVOA 3EFFK 1IO4A 1FZFA 2ZXEB 2QVAA 3NMDA 1ZXGA 4UB8H 1XTGB 5KLIC 3L4FA 3BCCJ 2R5DA 4PV1C 1SQQJ 2V4HA 3I5CA 2N1TA 5CHXA 3V5BA 2POHA 1YBKA 3L72J 5AW5B 2J5UA 3RK3E 3K5BA 2IZ1A 3AE5C 2A45H 3S9OA 5KLIB 2GM4A 2YXQB 3IFMA 4H13D 4PV1B 2R44A 4PD4D 1KQSO 2KI7B 3USSA 4IFMA 3RL0D 1RF0C 3AE2C 3V2QA 1NYHA 3WMM0 2FY8A 2OTJP 3MZWB 3BATA 1OIPA 2DW3A 3H1JD 1MKMA 5AVYB 3L75E 5KJ7D 2KUBA 2RH0A 2Z4EA 1BCCJ 2KZJA 2PRRA 1S2EA 3IN6A 4HJGH 1R5LA 3A0HH 1PL5A 4RESB 4NPDA 2KB7P 1W2BO 2XZRA 2FFDA 4JBZA 2A06E 1HUCA 1N7SC 4RKUJ 1PGOA 2KLVA 2E76C 2O01J 3UIAA 2JP3A 2WWWA 3MGNA 2Y0DA 2QG4A 3PJSK 1N7SB 1CZQA 5APQA 3TDKA 2E76B 1A02J 1IFDA 1SQPJ 3L71E 1OFCX 1EZVD 2KK7A 2NPSD 4AYCA 1HJBA 1U7MA 3GLMA 1N2DC 1R8EA 1SQBJ 2PFXA 1NU1K 1P84H 5KJ7A 2YNYA 4ASVA 1FOSF 1M1JC 4B86A 3BCCE 1SQQE 1L0NG 1ZR4A 1EZVG 3RL0g 1L0LE 2WPQA 3SFDC 2HPCB 3L72E 1AJYA 1Q90D 3CXHH 4A7PA 4W80A 1NWQA 3H1KD 4DCKA 2K1AA 2Y9YA 1JY2P 1M1JB 1KZUB 2ZVNB 3L36A 2P67A 1JCDA 1NU1E 3O6QB 3M0AA 3WU2E 4CPGA 2HR3A 2QM8A 4L76A 1PV3A 2Y0CA 3PTZA 1YIJP 4UB6H 1NTKG 3AE4C 1VQ6P 2JWDA 1GU5A 2NPSA 3TGUE 2ZYAA 1SQXJ 2B87B 3CXHE 2QSIA 3PP5A 3JCUH 4TLFA 2LXBA 2HLOA 1NJIQ 1G1JA 1KYOH 3RK2C 3Q3DA 3Q2YA 2GUSA 2WT7A 1EXIA 1WT6A 3B5NC 2N9BA 3ZDMA 5TISH 1PPJG 3L73J 2LKMA 3RK3C 2YKPA 2WMMA 2FYUJ 2W6JH 1S5LH 5KLVD 3L70J 3RK2B 1VQNP 3RBZA 3HTKB 3B5NB 2FYZA 1JTHA 3E7KA 3VN0A 5AW7B 3RK3B 1KILD 2V7QJ 3VTPC 3B8EB 1SQPE 2NRGA 2M0BA 1BSNA 5TISE 3HD7D 1SQBE 5GTIH 2Q5UA 4PD4H 3FWNA 1L4AC 4D6TJ 1ZOYC 1FZCC 1G1IA 3GG2A 1KB9D 1FJPA 2Q6QA 3LW5H 3MUDA 1NTZD 2Y9ZA 2AEJA 1DH3A 4WVZA 3M9QA 3F5HA 3GF7A 1L4AB 2W6AA 1YTZT 1FZCB 3L74J 2FKWB 3KDPB 2QJPC 3T97A 1DD4A 4H0LC 3G9RA 1IFNA 2CK3H 2KYVA 5APWA 1NTZG 2QA4P 1JY3P 3S1KA 4LGDE 1EQ7A 1L2PA 3AE1C 1KILA 5GTHE 2QJPB 1ZV8A 4H0LB 1SQXE 4KHXA 2OGUA 3HD7A 5APXA 3H1JE 2O01N 3VMYA 1VQMP 5APVA 2J59M 2M5AB 2V7QH 3Q1MA 2M3BA 4LLHA 4OVNF 2QJKC 3F89A 1MZ9A 2C0WA 5BVZA 2WPVB 1GL2D 1MFTA 4U3FD 3AEDC 2OYHC 2PGDA 2YMKA 1RE4A 2FYNC 4BRYA 1W5CE 3CWBG 1VQOP 1QL2A 4JYBA 2ZAEB 4ZNCA 2QJKB 4WB4A 1LP1B 1QL1A 1MFZA 3U1CA 1GZLA 1X9VA 1KFNA 4C46A 2OYHB 1KC8Q 1QEXA 2FYNB 1HF9A 5APSA 2H89C 1DEEG 1JMBA 2YXRB 2M3EA 1Z56A 2P7JA 3VMAA 1SQQG 1G2CB 2Q3IA 4DOJA 3TNUA 1BGYJ 2E5TA 4GKGA 1X0TA 2WTYA 3CL3D 1K05A 3L75J 4W7YA 2WQYC 2OARA 1Q82Q 2H88C 1GL2A 1E79H 4YPCA 1NVOA 2A45I 5AVXB 3H1KE 4K3AA 5CCHC 3L74E 2Q7CA 1ZN5A 2IBZI 3R4YA 4Y99C 1HBWA 3BASA 1LTJA 5KKZC 1RY3A 2N1TB 2KNCA 5BU8B 3S4RA 1DD3A 1KQLA 1BCCG 4GOFA 2RN0A 3V6IA 2E74D 3CC4P 2E43A 1LTIC 4Y99B 1ZMEC 1ZRTE 1GW4A 5KKZB 4GT1A 3CCSP 5KLVK
chains in the Genus database with same CATH topology
1LP1A 2JWDA 2B87B 5EFWB 4K35A 2QRXA 2LXBA 1H0TA 2B87A 1DEEG 1JMBA 1LT1A 1JM0A 4HB1A 1U7JA 1SS1A 1OVUA 1BDCA 3ZDMA 2LR2A 3FXDA 4EYYQ 3PH0A 1U7MA 2B89A 5CBNA 1ZW0A 2R44A 3S1KA 2KIKA 1X0TA 1OVVA 2KI7B 4MN4C 2WMMA 5K5GB 4ASVA 2K3RA 5CBOA 4HKZH 4ZMDA 4WWIA 1EC5A 3MHVA 3MZWB 1EDIA 1NVOA 2B88A 4GODA 1Y47A 2M5AB 2KUBA 4KJMA 4K3AA 2KZJA 4NPFX 1S3JA 4HJGH 1EDKA 2M0BA 2I8DA 1MFTA 4IOIH 1BDDA 1EDJA 4NPDA 3QWOC 1H0TB 2UWJE 1FC2C 1EDLA 4GOEA 4JBZA 2KZIA 2Q1KA 4GOFA 2KS1B 2RKLA 1Q2NA 4CPGA 2HR3A 2ZAEB 3RGUA 4ZNCA 2QVAA 1ZXGA 4NPEA 1OVRA 2LXCB 1LP1B 5C39A 4BXLA 2P58A 2M5AA 2OTKE 5DJTB 2SPZA 5DJUB 3FXEA 4ASWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LP1 A;  2JWD A;  2B87 B;  5EFW B;  4K35 A;  2QRX A;  2LXB A;  1H0T A;  2B87 A;  1DEE G;  1JMB A;  1LT1 A;  1JM0 A;  4HB1 A;  1U7J A;  1SS1 A;  1OVU A;  1BDC A;  3ZDM A;  2LR2 A;  3FXD A;  4EYY Q;  3PH0 A;  1U7M A;  2B89 A;  5CBN A;  1ZW0 A;  2R44 A;  3S1K A;  2KIK A;  1X0T A;  1OVV A;  2KI7 B;  4MN4 C;  2WMM A;  5K5G B;  4ASV A;  2K3R A;  5CBO A;  4HKZ H;  4ZMD A;  4WWI A;  1EC5 A;  3MHV A;  3MZW B;  1EDI A;  1NVO A;  2B88 A;  4GOD A;  1Y47 A;  2M5A B;  2KUB A;  4KJM A;  4K3A A;  2KZJ A;  4NPF X;  1S3J A;  4HJG H;  1EDK A;  2M0B A;  2I8D A;  1MFT A;  4IOI H;  1BDD A;  1EDJ A;  4NPD A;  3QWO C;  1H0T B;  2UWJ E;  1FC2 C;  1EDL A;  4GOE A;  4JBZ A;  2KZI A;  2Q1K A;  4GOF A;  2KS1 B;  2RKL A;  1Q2N A;  4CPG A;  2HR3 A;  2ZAE B;  3RGU A;  4ZNC A;  2QVA A;  1ZXG A;  4NPE A;  1OVR A;  2LXC B;  1LP1 B;  5C39 A;  4BXL A;  2P58 A;  2M5A A;  2OTK E;  5DJT B;  2SPZ A;  5DJU B;  3FXE A;  4ASW A; 
#chains in the Genus database with same CATH topology
 1BE3 E;  1GD2 E;  1YQ3 C;  3KZI H;  1SQV E;  1J1D C;  3V4Q A;  4PJ0 H;  1JY2 O;  1N73 A;  1PFI A;  1T6A A;  2Y0E A;  3FGA D;  3VMX A;  1KFM A;  2FFD C;  3CI9 A;  1S1C X;  1PP9 J;  3V2R A;  3G6E P;  4ZKP A;  2HYN A;  4WY4 D;  1J1D B;  1L0L J;  3QH9 A;  1URQ D;  5KLV E;  2K3R A;  4H13 C;  2BCC J;  1OXZ A;  1KB9 H;  2FFD B;  2WZ7 A;  1PGP A;  1EDI A;  3AE7 C;  3AE6 C;  2GUV A;  1FZA A;  3KZI E;  3RL0 C;  4I7Z C;  4PJ0 E;  2E75 D;  1NU1 J;  4XE5 B;  1KIL E;  1R5S A;  1NTZ K;  2WSF H;  5AVT B;  5B66 H;  2IX7 C;  1FBM A;  4NPF X;  1HWT C;  4UB8 E;  4H13 B;  5AVZ B;  1P84 I;  4BWN A;  1T2K D;  4DT0 A;  5KJ7 C;  1BGY E;  1GK6 A;  3L37 A;  3H1L J;  1VQ8 P;  2P10 A;  3RL0 B;  2J58 A;  3KYQ A;  4I7Z B;  2RKL A;  3TGU J;  1IFM A;  2OYI A;  1SVF A;  3GMA A;  3CXH I;  4EDF A;  2QEX P;  3EWK A;  3I56 P;  3M9B A;  4JPZ B;  1FDO A;  2IBZ E;  5AVW B;  4TT3 H;  1A02 F;  3AEF C;  5B66 E;  4WY4 A;  1VDF A;  1H0T A;  2C9N Y;  1URQ A;  4H44 D;  1FDI A;  1ZLL A;  2WIT A;  3M06 A;  1T8Z A;  4C7R A;  2K37 A;  1JUN A;  2GA1 A;  2MJZ A;  1NTM D;  1LTT C;  3A0H E;  1EC5 A;  3Q5P A;  1L0N D;  3RBX A;  3L73 G;  1SFC D;  1AV1 A;  3EQ2 A;  1KYO I;  1H88 A;  3D6Y A;  2FYU G;  3L70 G;  2H43 A;  1NAF A;  1EXJ A;  1RF1 A;  2ITA A;  1NTM G;  2NPS B;  4U3F E;  1PP9 E;  1LTB C;  2ZFC A;  1YJW P;  1LJ2 A;  1FC2 C;  3AEC C;  4HH2 A;  1FJK A;  1Q2N A;  2WT7 B;  2Z5H A;  5L8R J;  2BCC E;  3W67 A;  4BXL A;  2FXO A;  2FBW C;  2KSJ A;  3CCJ P;  3G4S P;  3TF5 A;  1NTK D;  3H1I D;  1KQF B;  4WBA A;  5EFW B;  1P84 E;  2IFM A;  4D6T G;  3H1H D;  4JYC A;  4I2L C;  1MUU A;  1JTH B;  3MP7 B;  4PD4 I;  2G3A A;  3H1L E;  2KLU A;  2FXM A;  1PPJ D;  5CMZ A;  3LW5 J;  5H2F H;  1SFC A;  1XTC C;  2B89 A;  3H1I G;  3KQG A;  4IL6 X;  1VL2 A;  1OVV A;  2QM7 A;  3H1J J;  2ZYD A;  1RQU A;  3MUD C;  2M8R A;  1CI6 A;  3H1H G;  1ZR2 A;  1AVY A;  1JMM A;  4ZMD A;  3CMA P;  1NAY A;  3CD6 P;  1NGM B;  3D6Z A;  1LT9 A;  1QLE D;  3IR9 A;  4OGQ D;  1FE6 A;  1KQG B;  3E1I A;  3H6P A;  3SSU A;  1FZE A;  1JEK A;  1PGQ A;  3CLQ A;  1IZN B;  1S3J A;  1BSH A;  3EFG A;  2I8D A;  1OW6 A;  4QMA A;  5AW9 B;  5H2F E;  4UB6 E;  1EDJ A;  1KIL C;  2AXC A;  5AW8 B;  1U57 A;  1EDL A;  3GHG A;  2K9Y A;  3T97 B;  3JCU E;  1IJD B;  1KYO E;  3HD7 C;  5C39 A;  2P58 A;  2O3J A;  1PGJ A;  5DJU B;  3FXE A;  1S9K E;  3PRJ A;  1KIL B;  4EIJ A;  2AEF A;  3JSV C;  5CJ4 A;  1FDM A;  3KHU A;  3C9I A;  2OYO A;  1JY2 N;  3HE5 A;  1EZV I;  2ZT9 D;  5AVV B;  3KXD A;  2B87 A;  1S5L E;  2HFE D;  3HD7 B;  4OH8 B;  1LT1 A;  1RE4 C;  2KS1 A;  4ZKU A;  4OWF A;  1OVU A;  1KMI Z;  2JO1 A;  1DX7 A;  3PH0 A;  3GF3 A;  1K73 Q;  4EI2 A;  3PLN A;  1X22 A;  2E42 A;  1OW7 A;  1RHZ B;  3H1K J;  2XKM A;  3M91 A;  4BRY B;  1L4A D;  1OW8 A;  3H32 A;  3TYY A;  3AE3 C;  2R32 A;  4AUW A;  5GTI E;  2D2C D;  4PD4 E;  3B5N A;  3L75 G;  3BRV B;  3OAK A;  2W8Z A;  3ABV C;  1FAV A;  2A45 G;  1S72 P;  3M0D C;  1W2E A;  1NOH A;  2HOD B;  2IBZ G;  3CCU P;  3CWB D;  1VQ5 P;  1BE3 J;  5KAI H;  1GL2 C;  2A06 G;  1SQV J;  1OMI A;  4IFD K;  3JC2 2;  2I1K A;  3CX5 D;  1JOC A;  1NTM K;  5KAF H;  3L71 D;  1L0N K;  4N78 D;  1LTJ C;  2BEZ F;  4C7N A;  2OTL P;  1RE3 C;  3AE8 C;  1GL2 B;  3SWY A;  2PAJ A;  5AW4 B;  3A0B H;  4HB1 A;  3BCC D;  5KLV J;  3HUS A;  1UIX A;  1L4A A;  1SQQ D;  1CW5 A;  3L71 G;  1L0L D;  1GMJ A;  1VPC A;  5M1B A;  1LTJ B;  2KIK A;  2IFN A;  3L72 D;  1USD A;  4GDO A;  2KNC B;  1M56 D;  4AQR D;  3G71 P;  3G3Z A;  4HKZ H;  5KAF E;  4XFJ A;  1M1K Q;  1L0N E;  1N8R Q;  3BCC G;  4U7J A;  1PP9 G;  5AVQ B;  1N73 C;  1EZV E;  5E79 H;  3A2A A;  3AEE C;  1QX8 A;  4N6J A;  4YTP C;  2B88 A;  1L0L G;  5KTB A;  1Y47 A;  2IPP A;  1NTK K;  1QVF O;  3L72 G;  1LWU A;  2AXT H;  1D7M A;  3CCV P;  1JY3 N;  2N1T C;  2KSE A;  3P8C D;  3BRT B;  1N73 B;  1WRG A;  1NU1 G;  2ZXX A;  1KB9 I;  1HGV A;  1BCC D;  2YKO A;  3II6 A;  5CCG D;  1NTZ J;  1QVG O;  3N4X A;  3V2P A;  1T3J A;  2AEM A;  2YO3 A;  5B5E H;  1GTW A;  3VP9 A;  2WSF J;  4NPE A;  3WUU A;  2WSE H;  2YKQ A;  1JCC A;  1NTK E;  1OWA A;  5APT A;  1LP1 A;  2E74 C;  2W90 A;  3TGU G;  3HE4 A;  2C9L Y;  2G8Y A;  1VF5 D;  3SWF A;  1ZP0 C;  1X79 B;  1PPJ E;  3NFQ A;  2OYI C;  1JNM A;  1VQL P;  1E5W A;  2E74 B;  3P7K A;  1LTS C;  1GDT A;  4MN4 C;  5B5E E;  2OQQ A;  2ZVO B;  1SQP D;  4WY4 C;  2P2U A;  2KP8 A;  2XDJ A;  4U3F J;  1LGH B;  4HYT B;  1URQ C;  2YMY A;  1IFP A;  2OYI B;  1SQB D;  5CCG A;  4KJM A;  1UII A;  1AQ5 A;  3LID A;  1SQP G;  2E75 C;  3C8V A;  4WY4 B;  3A3Y B;  3A7O A;  4IFF A;  1H0T B;  1URQ B;  1IK7 A;  2UWJ E;  3IAO A;  1SQB G;  2Q9I A;  4PV1 D;  1T2K C;  2K9J A;  4N3Y B;  2PP6 A;  5CCH A;  2E75 B;  2WPS A;  3AEB C;  1N86 A;  1RF1 C;  2XV5 A;  4I1L A;  1J1E C;  4LC1 A;  1FZB A;  1TU3 F;  2ZYG A;  1NKZ B;  1KB9 E;  2O1J A;  1SS1 A;  1BDC A;  1SQX D;  1NTZ E;  2WPR A;  5AW0 B;  1RF1 B;  1DIP A;  5AW2 B;  5AVS B;  4H44 C;  4YXD C;  1J1E B;  4L74 A;  1NO4 A;  1H8A A;  3CX5 H;  2RMZ A;  1SP4 A;  3L73 D;  5AVU B;  2WSC H;  1SQX G;  3B71 A;  2FYU D;  4H44 B;  4GOD A;  3H1J G;  2VRS A;  1QGK B;  3L70 D;  2R3C A;  1SFC C;  2W83 C;  1GU4 A;  2NPS C;  1N7S D;  1BDD A;  1FU1 A;  2BAS A;  1HTL C;  4W7Z A;  2E76 D;  1YIT P;  3CWB E;  4R4L A;  3V4W A;  1SQQ K;  1YI2 P;  3OW2 O;  3VOP A;  2Z5I A;  1L0L K;  1JO5 A;  2IDB A;  1LT9 C;  1CSB A;  4YXW H;  1KN7 A;  1SFC B;  3CX5 E;  3CCL P;  3AE9 C;  2SPZ A;  1JY3 O;  3IF4 A;  1RF0 A;  1Y8A A;  4ASW A;  1M8O B;  2MKV A;  2H7H A;  4N78 E;  1CI6 B;  5APY A;  1RH5 B;  2FXP A;  1KV4 A;  1S5L X;  4D6T D;  3VYI A;  3FWL A;  3WU2 H;  1LT9 B;  3MTU E;  4EOT A;  3WUT A;  1J2J B;  1M7L A;  3N7N A;  1U7J A;  4KT0 J;  3GHG C;  3CC7 P;  3D71 A;  5CBN A;  1X8Y A;  3KPE A;  1Q7Y Q;  1ZW0 A;  4L75 A;  2JEE A;  1USE A;  3L74 D;  2Q3E A;  3VMZ A;  3Q5S A;  1N7S A;  3GHG B;  1AQT A;  1Y9B A;  1N7L A;  3GW6 A;  3O8Z A;  3H1K G;  1Q81 Q;  1YJN P;  3L74 G;  2O01 H;  2H8P D;  1LNQ A;  4OGQ C;  1PIX A;  1FZG A;  3CCR P;  2W6B A;  2P1J A;  1ZRT D;  1YYC A;  2YIU C;  3P8C E;  3HE5 B;  2QJY C;  1IFI A;  1BE3 D;  2QE7 H;  1BCC E;  2QIW A;  3BVH A;  1SQV D;  1AFO A;  3FX0 A;  2Q1K A;  4JQ0 D;  3D70 A;  2KS1 B;  2R5B A;  1OX3 A;  2CPS A;  3RGU A;  3P8M C;  2LXC B;  3AEA C;  1IK9 A;  4OGQ B;  2HPC A;  1K8A Q;  2YIU B;  1VQP P;  1IFJ A;  5CJ0 A;  3RK2 D;  2QJY B;  1SQP K;  1BE3 G;  3CCM P;  1M1J A;  1FS0 E;  2IYO A;  1SQV G;  3B5N D;  1KD1 Q;  2QRX A;  3H32 B;  1SQB K;  2JKV A;  3O6Q A;  3RK3 D;  1NTM J;  4DJG A;  1GW3 A;  4RJT A;  1VQ4 P;  1L0N J;  4EYY Q;  2ZT9 C;  3H25 A;  1Q86 Q;  5K5G B;  3P32 A;  1PZQ A;  5KLV G;  3Q5R A;  4WWI A;  3HRN A;  3MHV A;  1BGY D;  3U1A A;  2ZT9 B;  1MV8 A;  3SWK A;  3HUS C;  3L75 D;  4Z1M H;  4IL6 H;  5GTH H;  5AW6 B;  2K88 A;  2E5Y A;  2HG5 D;  1EDK A;  4IOI H;  4C7N B;  2D2C C;  1HH0 A;  3M9H A;  3QWO C;  1BGY G;  2IBZ D;  3CC2 P;  1NTK J;  2XNX A;  3H1I J;  4DZO A;  3HTK A;  1SQX K;  3OA7 A;  1AA0 A;  2A06 D;  3HUS B;  3SFE C;  2N9Y B;  3A5T A;  2I1J A;  3H1H J;  3E1R A;  2OTK E;  1FOS E;  2W27 A;  2D2C B;  2YO2 A;  1LWU C;  4H0L D;  4GIF A;  4IL6 E;  1YQ4 C;  4RO0 A;  2FYU K;  5AW1 B;  1JM0 A;  3R2P A;  3TNU B;  2WSE J;  2LR2 A;  2JDI H;  1LWU B;  2WVR A;  4I6M C;  2IZ0 A;  3U59 A;  2C0X A;  2L5G B;  1YHQ P;  3LIE A;  5CBO A;  3CME P;  3L73 E;  1PP9 D;  1FZC A;  3PHL A;  2FYU E;  5KAI E;  3AEG C;  4Y28 J;  3L70 E;  1NTM E;  3CPW O;  1HVV A;  2BCC D;  1VQ7 P;  3TSI A;  3HE4 B;  4U3F G;  2JJL A;  1IC2 A;  3NXS A;  1NU1 D;  3CCE P;  4GOE A;  1LTG C;  2KZI A;  1P84 D;  3B4S A;  4JF7 A;  2HOD A;  1VQ9 P;  4M3L A;  1NKN A;  3A0B E;  5AW3 B;  1OVR A;  2BCC G;  3OJA B;  2XND H;  1HGZ A;  2M5A A;  3H1L D;  5DJT B;  1GK4 A;  5CCG C;  1YTZ I;  1K04 A;  3C1L A;  1KTM A;  3TGU D;  2JR8 A;  1RQV A;  4D6T E;  4K35 A;  3CXH D;  3V2N A;  3M0D A;  2KXP B;  1S4X A;  2ZJS E;  3NTN A;  5BU5 A;  3W68 A;  1OZH A;  3H1L G;  1YJ9 P;  4XA4 A;  5E79 E;  1WMK A;  3H1I E;  4R4M A;  3VP8 A;  1NH4 A;  1VF5 C;  3FXD A;  3CCQ P;  2KOG A;  1LTA C;  2N1T D;  3I55 P;  3WUV A;  2XU6 A;  1H89 A;  3MD0 A;  3H1H E;  1T3U A;  1SLQ A;  1M90 Q;  1SQV K;  2OYH A;  2L91 A;  2AXT E;  1RE3 A;  5CCH D;  1NHL A;  2BEQ D;  1JB0 J;  2WSS H;  5TJH A;  2O1K A;  1K9M Q;  3MIW A;  1VF5 B;  2K9J B;  4L73 A;  3TK1 A;  2IYP A;  1G2C A;  3CWB J;  3L35 A;  2B9B A;  1VQK P;  1KYO D;  1KOR A;  1HJ0 A;  3ITK A;  2JWA A;  1S9K D;  1M57 D;  5AVR B;  2CPB A;  2R3S A;  2NZ2 A;  1DEB A;  3L71 J;  3CX5 I;  5APU A;  2WSC J;  4O9B A;  1AVO A;  3EFF K;  1IO4 A;  1FZF A;  2ZXE B;  2QVA A;  3NMD A;  1ZXG A;  4UB8 H;  1XTG B;  5KLI C;  3L4F A;  3BCC J;  2R5D A;  4PV1 C;  1SQQ J;  2V4H A;  3I5C A;  2N1T A;  5CHX A;  3V5B A;  2POH A;  1YBK A;  3L72 J;  5AW5 B;  2J5U A;  3RK3 E;  3K5B A;  2IZ1 A;  3AE5 C;  2A45 H;  3S9O A;  5KLI B;  2GM4 A;  2YXQ B;  3IFM A;  4H13 D;  4PV1 B;  2R44 A;  4PD4 D;  1KQS O;  2KI7 B;  3USS A;  4IFM A;  3RL0 D;  1RF0 C;  3AE2 C;  3V2Q A;  1NYH A;  3WMM 0;  2FY8 A;  2OTJ P;  3MZW B;  3BAT A;  1OIP A;  2DW3 A;  3H1J D;  1MKM A;  5AVY B;  3L75 E;  5KJ7 D;  2KUB A;  2RH0 A;  2Z4E A;  1BCC J;  2KZJ A;  2PRR A;  1S2E A;  3IN6 A;  4HJG H;  1R5L A;  3A0H H;  1PL5 A;  4RES B;  4NPD A;  2KB7 P;  1W2B O;  2XZR A;  2FFD A;  4JBZ A;  2A06 E;  1HUC A;  1N7S C;  4RKU J;  1PGO A;  2KLV A;  2E76 C;  2O01 J;  3UIA A;  2JP3 A;  2WWW A;  3MGN A;  2Y0D A;  2QG4 A;  3PJS K;  1N7S B;  1CZQ A;  5APQ A;  3TDK A;  2E76 B;  1A02 J;  1IFD A;  1SQP J;  3L71 E;  1OFC X;  1EZV D;  2KK7 A;  2NPS D;  4AYC A;  1HJB A;  1U7M A;  3GLM A;  1N2D C;  1R8E A;  1SQB J;  2PFX A;  1NU1 K;  1P84 H;  5KJ7 A;  2YNY A;  4ASV A;  1FOS F;  1M1J C;  4B86 A;  3BCC E;  1SQQ E;  1L0N G;  1ZR4 A;  1EZV G;  3RL0 g;  1L0L E;  2WPQ A;  3SFD C;  2HPC B;  3L72 E;  1AJY A;  1Q90 D;  3CXH H;  4A7P A;  4W80 A;  1NWQ A;  3H1K D;  4DCK A;  2K1A A;  2Y9Y A;  1JY2 P;  1M1J B;  1KZU B;  2ZVN B;  3L36 A;  2P67 A;  1JCD A;  1NU1 E;  3O6Q B;  3M0A A;  3WU2 E;  4CPG A;  2HR3 A;  2QM8 A;  4L76 A;  1PV3 A;  2Y0C A;  3PTZ A;  1YIJ P;  4UB6 H;  1NTK G;  3AE4 C;  1VQ6 P;  2JWD A;  1GU5 A;  2NPS A;  3TGU E;  2ZYA A;  1SQX J;  2B87 B;  3CXH E;  2QSI A;  3PP5 A;  3JCU H;  4TLF A;  2LXB A;  2HLO A;  1NJI Q;  1G1J A;  1KYO H;  3RK2 C;  3Q3D A;  3Q2Y A;  2GUS A;  2WT7 A;  1EXI A;  1WT6 A;  3B5N C;  2N9B A;  3ZDM A;  5TIS H;  1PPJ G;  3L73 J;  2LKM A;  3RK3 C;  2YKP A;  2WMM A;  2FYU J;  2W6J H;  1S5L H;  5KLV D;  3L70 J;  3RK2 B;  1VQN P;  3RBZ A;  3HTK B;  3B5N B;  2FYZ A;  1JTH A;  3E7K A;  3VN0 A;  5AW7 B;  3RK3 B;  1KIL D;  2V7Q J;  3VTP C;  3B8E B;  1SQP E;  2NRG A;  2M0B A;  1BSN A;  5TIS E;  3HD7 D;  1SQB E;  5GTI H;  2Q5U A;  4PD4 H;  3FWN A;  1L4A C;  4D6T J;  1ZOY C;  1FZC C;  1G1I A;  3GG2 A;  1KB9 D;  1FJP A;  2Q6Q A;  3LW5 H;  3MUD A;  1NTZ D;  2Y9Z A;  2AEJ A;  1DH3 A;  4WVZ A;  3M9Q A;  3F5H A;  3GF7 A;  1L4A B;  2W6A A;  1YTZ T;  1FZC B;  3L74 J;  2FKW B;  3KDP B;  2QJP C;  3T97 A;  1DD4 A;  4H0L C;  3G9R A;  1IFN A;  2CK3 H;  2KYV A;  5APW A;  1NTZ G;  2QA4 P;  1JY3 P;  3S1K A;  4LGD E;  1EQ7 A;  1L2P A;  3AE1 C;  1KIL A;  5GTH E;  2QJP B;  1ZV8 A;  4H0L B;  1SQX E;  4KHX A;  2OGU A;  3HD7 A;  5APX A;  3H1J E;  2O01 N;  3VMY A;  1VQM P;  5APV A;  2J59 M;  2M5A B;  2V7Q H;  3Q1M A;  2M3B A;  4LLH A;  4OVN F;  2QJK C;  3F89 A;  1MZ9 A;  2C0W A;  5BVZ A;  2WPV B;  1GL2 D;  1MFT A;  4U3F D;  3AED C;  2OYH C;  2PGD A;  2YMK A;  1RE4 A;  2FYN C;  4BRY A;  1W5C E;  3CWB G;  1VQO P;  1QL2 A;  4JYB A;  2ZAE B;  4ZNC A;  2QJK B;  4WB4 A;  1LP1 B;  1QL1 A;  1MFZ A;  3U1C A;  1GZL A;  1X9V A;  1KFN A;  4C46 A;  2OYH B;  1KC8 Q;  1QEX A;  2FYN B;  1HF9 A;  5APS A;  2H89 C;  1DEE G;  1JMB A;  2YXR B;  2M3E A;  1Z56 A;  2P7J A;  3VMA A;  1SQQ G;  1G2C B;  2Q3I A;  4DOJ A;  3TNU A;  1BGY J;  2E5T A;  4GKG A;  1X0T A;  2WTY A;  3CL3 D;  1K05 A;  3L75 J;  4W7Y A;  2WQY C;  2OAR A;  1Q82 Q;  2H88 C;  1GL2 A;  1E79 H;  4YPC A;  1NVO A;  2A45 I;  5AVX B;  3H1K E;  4K3A A;  5CCH C;  3L74 E;  2Q7C A;  1ZN5 A;  2IBZ I;  3R4Y A;  4Y99 C;  1HBW A;  3BAS A;  1LTJ A;  5KKZ C;  1RY3 A;  2N1T B;  2KNC A;  5BU8 B;  3S4R A;  1DD3 A;  1KQL A;  1BCC G;  4GOF A;  2RN0 A;  3V6I A;  2E74 D;  3CC4 P;  2E43 A;  1LTI C;  4Y99 B;  1ZME C;  1ZRT E;  1GW4 A;  5KKZ B;  4GT1 A;  3CCS P;  5KLV K; 
#chains in the Genus database with same CATH homology
 1LP1 A;  2JWD A;  2B87 B;  5EFW B;  4K35 A;  2QRX A;  2LXB A;  1H0T A;  2B87 A;  1DEE G;  1JMB A;  1LT1 A;  1JM0 A;  4HB1 A;  1U7J A;  1SS1 A;  1OVU A;  1BDC A;  3ZDM A;  2LR2 A;  3FXD A;  4EYY Q;  3PH0 A;  1U7M A;  2B89 A;  5CBN A;  1ZW0 A;  2R44 A;  3S1K A;  2KIK A;  1X0T A;  1OVV A;  2KI7 B;  4MN4 C;  2WMM A;  5K5G B;  4ASV A;  2K3R A;  5CBO A;  4HKZ H;  4ZMD A;  4WWI A;  1EC5 A;  3MHV A;  3MZW B;  1EDI A;  1NVO A;  2B88 A;  4GOD A;  1Y47 A;  2M5A B;  2KUB A;  4KJM A;  4K3A A;  2KZJ A;  4NPF X;  1S3J A;  4HJG H;  1EDK A;  2M0B A;  2I8D A;  1MFT A;  4IOI H;  1BDD A;  1EDJ A;  4NPD A;  3QWO C;  1H0T B;  2UWJ E;  1FC2 C;  1EDL A;  4GOE A;  4JBZ A;  2KZI A;  2Q1K A;  4GOF A;  2KS1 B;  2RKL A;  1Q2N A;  4CPG A;  2HR3 A;  2ZAE B;  3RGU A;  4ZNC A;  2QVA A;  1ZXG A;  4NPE A;  1OVR A;  2LXC B;  1LP1 B;  5C39 A;  4BXL A;  2P58 A;  2M5A A;  2OTK E;  5DJT B;  2SPZ A;  5DJU B;  3FXE A;  4ASW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...