4HJGH

Meditope-enabled trastuzumab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
GSYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immune system
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4hjgH00
1BDDA 2K3RA 2B87A 4KJMA 2B88A 4EYYQ 2KS1B 1FC2C 1OVVA 1EDKA 2Q1KA 1BDCA 4NPDA 2P58A 5C39A 2ZAEB 1OVRA 1LP1B 2KUBA 3RGUA 2R44A 5CBOA 1EDJA 4IOIH 3QWOC 5DJTB 4GOFA 3MHVA 1Q2NA 2KZIA 4ASVA 4CPGA 2B87B 1DEEG 1S3JA 3S1KA 4K35A 2LR2A 4JBZA 1SS1A 5EFWB 2UWJE 1U7MA 4NPEA 2M0BA 1ZW0A 1NVOA 1EDIA 2HR3A 2WMMA 3MZWB 2M5AB 1LP1A 2RKLA 3FXEA 3FXDA 1H0TB 4HB1A 4MN4C 4BXLA 5CBNA 4HKZH 4GODA 4HJGH 2OTKE 5DJUB 4GOEA 4ZMDA 1JMBA 2QVAA 1EDLA 1U7JA 3ZDMA 4ASWA 2QRXA 2LXBA 5K5GB 3PH0A 1ZXGA 2SPZA 4WWIA 1LT1A 2I8DA 2KI7B 4K3AA 2KZJA 4NPFX 1MFTA 2B89A 1OVUA 2KIKA 1X0TA 4ZNCA 2M5AA 1Y47A 1JM0A 2LXCB 2JWDA 1H0TA 1EC5A
chains in the Genus database with same CATH superfamily
5AVRB 2JP3A 4KJMA 1JOCA 2E75D 2BASA 1OVVA 3AEBC 1NTKD 1YJNP 3H1ID 1M1JA 3V4QA 4DCKA 3WU2H 3CLQA 1KILB 2WZ7A 3T97A 2N1TB 1M56D 1K8AQ 1CW5A 3VP8A 1S3JA 1RE3C 5L8RJ 3M9HA 1SS1A 3HUSC 3KYQA 1HWTC 4U3FG 3BRTB 2KLVA 3P8CD 4ZKPA 1L0NE 5TISE 1KILC 2Q3IA 2K88A 1SQBK 3A3YB 4M3LA 1A02F 1XTGB 3VYIA 4OWFA 2NPSB 1ZV8A 2OQQA 2WSCH 1FOSF 1BSHA 3ZDMA 2QRXA 5KLVG 3KDPB 3H1HG 1KILD 2V7QJ 3CX5E 3H1LG 2N1TD 2IBZG 5KAIH 1IFMA 1YI2P 1NTMK 2AEMA 1JM0A 3VN0A 1SQPE 2IYOA 5AW7B 4EYYQ 3SWYA 4N78E 3I55P 3L36A 1SQBD 1ZN5A 1LTAC 4IFDK 1KN7A 5KJ7D 1OVRA 5AW8B 3A0BE 1G1JA 1BSNA 2WTYA 2RN0A 4RESB 1NTZK 3L70D 1EDJA 3L75E 3PHLA 1JNMA 3AE9C 1X79B 2Y0EA 3MHVA 2C9NY 2KZIA 5GTHE 2KK7A 1L0NJ 2JR8A 1RF0A 2QJPB 1SQQE 1X22A 3MTUE 2NPSD 3PTZA 2G8YA 2WVRA 4I2LC 4AUWA 1EDIA 2I1KA 1SFCA 3SWFA 3FXEA 2WSFJ 1HUCA 1HH0A 5KAFH 3CI9A 1L4AA 1Y8AA 5APTA 4ZMDA 2Q5UA 1JMBA 1DEBA 3LW5J 3A5TA 1R8EA 2LKMA 2CK3H 2QVAA 1SQPJ 3HE5A 1ZXGA 2Y9ZA 1FDMA 5APWA 1EQ7A 4LLHA 1LWUB 4DOJA 1KQGB 3KZIE 1KYOI 2HPCA 1GZLA 3CC4P 3GLMA 2KSEA 2WSEJ 1WT6A 4W80A 1SQQJ 3TK1A 1J2JB 2J58A 1JTHA 2MKVA 3VTPC 1L0NG 1OW7A 3AE1C 4WVZA 2WPSA 1W2EA 3GF7A 1VQKP 1IFNA 3C9IA 1IZNB 1IK7A 4L73A 2AEJA 2PFXA 2I1JA 1W5CE 1FZGA 3G9RA 3TNUB 4EOTA 1NWQA 1KB9I 3CCMP 2P67A 3M9QA 1DD3A 1OZHA 3F5HA 1HVVA 4W7ZA 1YBKA 2HLOA 1H0TB 5B66E 2WQYC 3JSVC 1LTBC 2H8PD 1VQ5P 4GODA 1SQPG 4WY4A 2YO2A 2AXTE 4UB8H 5KLVD 2P10A 1EDLA 3H1HD 5AW1B 3H1LD 4WB4A 1KFMA 1SP4A 1AVOA 2OYIB 3H6PA 1P84I 3B5NA 4B86A 4K3AA 2QSIA 2IYPA 3CXHD 3L37A 4ZNCA 4A7PA 1SQQG 4YPCA 1VQMP 1NHLA 3NTNA 3CCUP 1YITP 2AEFA 2BCCE 1FZBA 1LGHB 2L91A 4PD4D 2HFED 2R5DA 1NO4A 2GUSA 2WITA 2OYHC 4BRYA 2OYIC 1ZOYC 4I7ZB 2NRGA 1QLED 2JWAA 2G3AA 2B87B 2IDBA 1RF1B 2P7JA 3KXDA 4R4MA 1MFZA 1OX3A 1PP9J 2N9BA 3L73D 3WU2E 2IPPA 3Q3DA 5AVZB 3MZWB 1OIPA 3AEEC 3I56P 2E43A 1AJYA 3P32A 1HF9A 1Z56A 1VQNP 4I7ZC 1ZRTD 1GL2A 1JY3O 2H89C 5AW0B 2J5UA 2O1KA 1RF1C 2QJYC 1NU1E 2FYNB 4D6TD 2BCCJ 3L71E 1LTJC 4IL6H 3PLNA 1G1IA 4JF7A 1BDDA 4C7RA 2A45G 3PRJA 4U3FE 1PPJD 4UB6H 1AFOA 3MD0A 1NTMJ 4IFFA 4DJGA 2Q1KA 2BEQD 4NPDA 2FBWC 2FFDB 2KLUA 3SFDC 2R32A 1JMMA 3TDKA 1FZCB 4L76A 2KUBA 1SQXK 2R44A 5KAIE 3AE2C 2ITAA 2YIUB 2A06G 3CWBE 2KSJA 1BE3D 1YTZI 4IL6X 3RBXA 1PP9G 3E1IA 3SFEC 5AVQB 2IZ1A 1YIJP 2RH0A 4PJ0H 1ZW0A 3FX0A 3CC7P 2OTJP 3T97B 1UIIA 2XU6A 1MKMA 2M5AB 5AW4B 2FY8A 1SQVE 3II6A 1JCDA 1NU1J 1GW4A 1SQXD 3VMXA 2YIUC 3L71J 3L74E 3OJAB 2BCCG 4AQRD 3RL0C 4ASWA 2E76B 3HD7C 1NH4A 3L75D 1GDTA 2WT7A 1YYCA 2O01H 4NPFX 5CCHA 2B89A 2NZ2A 3AE4C 3BCCE 1NTMG 2W8ZA 1EC5A 3CXHI 3RL0D 4PV1B 2JKVA 5E79H 3CWBJ 4H13B 1FE6A 2YNYA 2CPSA 5C39A 3RBZA 1QL2A 1KC8Q 3TGUD 1PFIA 1KYOD 1VQ7P 2H88C 1KZUB 5AW9B 4PD4I 2OGUA 2AXCA 3FGAD 1H88A 3L72E 1KQLA 1SQVJ 2JDIH 3A7OA 3JCUH 4K35A 1HTLC 4KT0J 2QA4P 3IR9A 2E76D 1FZEA 4PV1C 1T6AA 4U7JA 3H1KD 1NU1G 3WUTA 1J1EC 1KTMA 4H13C 3L74J 2FXMA 3L71G 5AVUB 4DZOA 1KB9D 1M90Q 3RK3E 4AYCA 5H2FH 4HJGH 2YKPA 5CCGA 2V4HA 4GKGA 3BCCJ 4PV1D 4H13D 1U7JA 3AEDC 1LT9A 4WWIA 3KPEA 2BEZF 2N1TC 1RHZB 2OTLP 3BATA 1SFCB 3LIDA 3OAKA 4L74A 2HG5D 3CWBG 1ZMEC 2PRRA 5CHXA 1L4AB 2ZT9B 1S9KD 5AVXB 1AV1A 3AE5C 1P84D 4UB8E 5AVVB 2FYUE 3JC22 3L72J 2ZAEB 3H32A 5KJ7C 4EI2A 1BGYJ 1LTTC 1K73Q 3M91A 1SQVG 3HTKA 3O6QA 2FYZA 3MGNA 4JYBA 4GOFA 2P2UA 1SFCC 1L0LE 1RE3A 2VRSA 3HUSA 3L74G 4XE5B 2O1JA 2ZT9C 2NPSC 2XNXA 3PP5A 1GTWA 1EZVE 3CX5I 1RQVA 1JTHB 3BCCG 1SFCD 1BCCE 3N4XA 3P7KA 1L4AD 2ZT9D 2OTKE 2BCCD 2KS1A 4GOEA 2E5YA 2H43A 1QGKB 4XFJA 1E79H 5M1BA 3SSUA 3CXHH 2HODA 1EXIA 3E1RA 2ZJSE 2FYUJ 3NXSA 4Y28J 3D6ZA 5KKZB 3VOPA 1MFTA 3M9BA 2W90A 1VQ4P 1K04A 2JWDA 2E5TA 3L72G 1NGMB 4WY4B 5AVWB 4PD4H 1FC2C 2QJPC 1BGYG 1EDKA 2E42A 3ITKA 1M1KQ 3GG2A 1L0LJ 2P58A 1OW8A 2JEEA 5APUA 1FJPA 4GIFA 4IL6E 2JO1A 1NTKE 3H1IE 3V2RA 1KFNA 3EQ2A 5KKZC 4LC1A 2QIWA 1N7SB 1M8OB 1BCCJ 1DEEG 1J1DB 2KYVA 2K9YA 4UB6E 3WUVA 2XKMA 1NU1D 2ZYDA 1SVFA 4WY4C 1YHQP 1OFCX 2Q9IA 5KLVK 3L35A 5APXA 1Q90D 1LWUC 3G6EP 4U3FD 3CL3D 1IFPA 4WY4D 1N2DC 3FWNA 2FYUG 3P8CE 3TSIA 3M06A 2WWWA 3MUDC 4TLFA 4JQ0D 3CCVP 1N7SC 5AW5B 5APYA 4RJTA 2R3SA 1J1DC 4PJ0E 3EFFK 3IFMA 5APQA 1T8ZA 3M0DC 2A06E 1OVUA 1PP9E 1L0LG 4JYCA 2B88A 1N7SD 2M3EA 1KILE 2A45I 2Q6QA 1NTKJ 2WPRA 3H1IJ 5AW2B 2IBZD 1W2BO 3H25A 1EZVG 4YTPC 1K9MQ 3C8VA 1BCCG 2E74B 2YO3A 3QWOC 1SQBE 1G2CB 1PGOA 3L74D 1N73B 3EFGA 1VQPP 1L2PA 2O01N 2XV5A 5B5EH 5CMZA 3BASA 4JBZA 1CI6B 3L70E 5EFWB 1U7MA 1LNQA 3BCCD 1FDOA 3RK3B 2WMMA 1FU1A 2MJZA 1ZLLA 1NTME 1DIPA 4R4LA 4BWNA 4BXLA 5CBNA 2Z4EA 4HKZH 2O3JA 3RK2B 4IFMA 3JCUE 1RH5B 1N73C 4GT1A 1PGJA 3TNUA 2L5GB 2QM7A 2ZVNB 3CCSP 1FS0E 2XNDH 2LXBA 1ZR4A 5BU5A 1NTZE 1GMJA 1NTKG 3H1IG 2E74D 1L0NK 1X0TA 5GTIH 5H2FE 2O01J 1H0TA 2Z5HA 1YJWP 3M0AA 1KYOH 1SQBJ 3HE4B 3RK2C 3AECC 2W83C 3RK3D 1LP1B 2OYHA 1XTCC 2WT7B 2OYIA 3L70J 4Z1MH 2FXOA 3S9OA 4IOIH 3CD6P 3RK2D 2J59M 4ASVA 1EXJA 4C7NA 1SQPK 1L0ND 1Q7YQ 1JB0J 1IFJA 3BVHA 3NMDA 2POHA 1KB9H 2KXPB 3IF4A 2M0BA 3R4YA 1NVOA 1S1CX 2HYNA 2FYNC 3H1JE 3I5CA 2YXQB 4HB1A 3RL0g 2Y0DA 1KMIZ 1SLQA 1NTZJ 1MUUA 5KLIB 3CX5D 4OGQB 5CCHC 1URQA 1QL1A 1M1JB 4YXDC 1SQQK 3KHUA 3E7KA 1RF1A 2Y0CA 2QG4A 2FFDC 3N7NA 1SQPD 1JUNA 3OA7A 1FZCC 2XZRA 1LTJA 2N9YB 3K5BA 4N78D 3TF5A 1P84H 1SQBG 5CCHD 1VPCA 1EZVD 4YXWH 3Q5RA 3L70G 3U1AA 3AEFC 1HJBA 5BU8B 4I1LA 2WSCJ 1M1JC 2IBZI 1GU5A 4ZKUA 4GDOA 1KQFB 1SQQD 1LT9B 4RKUJ 5KAFE 5CBOA 3CC2P 3VMYA 2M8RA 3PJSK 1ZR2A 1FAVA 3H1JJ 4OGQD 3ABVC 4PD4E 2ZYAA 3C1LA 2YXRB 1D7MA 5CCGC 3HRNA 4NPEA 2E76C 1USDA 1R5LA 1U57A 2K9JA 1NTZG 1FJKA 2RKLA 3HTKB 2KNCA 3O6QB 3FXDA 3G3ZA 3MP7B 1PZQA 3CCLP 2WPQA 3Q2YA 3L73E 1LTIC 1BGYE 5CCGD 1GU4A 1S2EA 3HUSB 5AW3B 5AVTB 1FBMA 3HD7A 2Z5IA 2C0XA 2IZ0A 1JY3N 3CCJP 1RE4A 1VF5B 3CMAP 1ZRTE 5AW6B 1S4XA 1N8RQ 3IN6A 2KIKA 2M5AA 1Y47A 3GW6A 2QJKB 2KS1B 3SWKA 4D6TE 3GHGA 2OYOA 1BDCA 3VP9A 3QH9A 2H7HA 2HODB 3H1JG 1T2KC 3AEAC 1NAYA 5CJ4A 1T3UA 5TJHA 1GW3A 1PPJE 1WRGA 4HYTB 2XDJA 1VF5C 1PGQA 3G71P 3D70A 1M7LA 1RF0C 3HE5B 1NKZB 2QJKC 3W68A 1VQOP 1VL2A 1N86A 3L73J 1T2KD 2W27A 1X9VA 1OW6A 2A06D 1HGVA 1BE3E 1PP9D 2R3CA 1VF5D 2WSSH 2HR3A 3GMAA 4L75A 1JY3P 1S5LH 2JJLA 3UIAA 3CPWO 1RQUA 2HPCB 4MN4C 2YKOA 4QMAA 1OMIA 1L4AC 1H89A 5B5EE 1JCCA 3AE3C 2K1AA 1IJDB 1KILA 2QEXP 4D6TJ 1SQXE 2N1TA 2KZJA 1MZ9A 1S5LX 3AEGC 1FDIA 2FXPA 3V2QA 3MIWA 3KQGA 4N6JA 1Q82Q 3B71A 1EZVI 5KJ7A 3BRVB 1NTMD 2B9BA 1NU1K 2ZXXA 1USEA 2DW3A 5GTIE 4C46A 1BE3J 1Q86Q 3U1CA 4O9BA 3L73G 3TGUE 1AQ5A 1KYOE 2C9LY 3S1KA 2NPSA 1JY2O 1Q81Q 2UWJE 1NTZD 4HH2A 3Q5SA 3B5NB 3A0HH 1OXZA 3V2PA 2YKQA 3AE8C 1M57D 1KQSO 1SQXJ 2CPBA 4W7YA 4XA4A 1FZAA 1HJ0A 1PGPA 1VQ8P 3H1KE 1MV8A 2IFMA 4D6TG 3L71D 2W6AA 3TYYA 4H0LB 2V7QH 1X8YA 1KB9E 3L75J 2QE7H 5K5GB 1GK6A 4BRYB 3S4RA 2I8DA 2KI7B 1PPJG 3B5NC 1SQVK 2ZFCA 3VMZA 1AA0A 4Y99B 1KD1Q 2K3RA 1OWAA 1IFIA 3H1JD 3TGUJ 3CWBD 4EIJA 1BE3G 3B5ND 3CCEP 1KV4A 1QX8A 4H0LC 1S9KE 3RGUA 3B4SA 1P84E 1FOSE 2ZVOB 5TISH 5DJTB 2M3BA 3V4WA 2PP6A 1GL2B 1YJ9P 1YQ3C 2Q7CA 1DH3A 1SQVD 1AVYA 4H0LD 4Y99C 3USSA 2GM4A 3H1KJ 3LIEA 1IFDA 1SQXG 2WSFH 2C0WA 2KB7P 3AE7C 3CX5H 2OYHB 1PIXA 1RY3A 1LWUA 3LW5H 1GK4A 2R5BA 3L75G 3V5BA 2QM8A 3A2AA 5E79E 2K37A 3Q1MA 3MUDA 3B8EB 4C7NB 2IX7C 1N7SA 1VQLP 1GL2C 1NYHA 4KHXA 4RO0A 3D71A 3FWLA 3A0BH 3GF3A 2SPZA 2D2CB 5APVA 3M0DA 4WBAA 2PGDA 1NAFA 1ZP0C 1UIXA 3L4FA 1YQ4C 2E74C 2W6BA 1IO4A 4EDFA 3G4SP 1PL5A 3TGUG 1A02J 1GL2D 1YTZT 1DD4A 2WSEH 5GTHH 4N3YB 1GD2E 1URQB 1AQTA 3AE6C 5AVSB 2QJYB 1S72P 3L72D 1FZFA 2FKWB 3RK3C 2ZXEB 1JY2N 1LTJB 1BGYD 1Y9BA 4OH8B 1QVGO 3CCRP 2D2CC 2KP8A 3D6YA 3H1KG 4CPGA 1N7LA 1HGZA 4I6MC 3R2PA 2FYUK 1H8AA 1VQ9P 1URQC 3F89A 3VMAA 2D2CD 3W67A 1R5SA 2GA1A 4H44B 2PAJA 2KOGA 3KZIH 5DJUB 1G2CA 1L0LK 2ZYGA 1N73A 1URQD 1CSBA 3IAOA 3Q5PA 1CI6A 3OW2O 3EWKA 2Q3EA 1LT1A 2K9JB 1S5LE 2FYUD 2KNCB 1JY2P 1WMKA 3V2NA 2LXCB 2B87A 1CZQA 5AVYB 4H44C 1DX7A 2A45H 3RL0B 2OARA 3HD7B 1L0LD 2W6JH 5KLVE 1VDFA 3H1HE 3H1LE 2GUVA 2IBZE 1JEKA 1PV3A 1IK9A 5B66H 1QEXA 4H44D 1LTSC 1K05A 4DT0A 1Q2NA 1JO5A 1LTGC 5KLIC 1E5WA 2E75B 4OGQC 3CMEP 3WUUA 3CXHE 2AXTH 1BCCD 2LR2A 5APSA 3GHGB 3HE4A 1LJ2A 2WPVB 1NOHA 5BVZA 1KORA 1QVFO 3U59A 1LP1A 1IC2A 4U3FJ 3O8ZA 1NKNA 1RE4C 1NTKK 4OVNF 4JPZB 3P8MC 3V6IA 3H32B 3HD7D 2FFDA 4LGDE 2E75C 3A0HE 1TU3F 1J1EB 1FZCA 3PH0A 3CCQP 3WMM0 3GHGC 2IFNA 1T3JA 1LT9C 1NJIQ 1VQ6P 4TT3H 2YMKA 2Y9YA 3NFQA 2RMZA 2YMYA 5KLVJ 2P1JA 3H1HJ 5CJ0A 1HBWA 5KTBA 3H1LJ
chains in the Genus database with same CATH topology
1BDDA 2K3RA 2B87A 4KJMA 2B88A 4EYYQ 2KS1B 1FC2C 1OVVA 1EDKA 2Q1KA 1BDCA 4NPDA 2P58A 5C39A 2ZAEB 1OVRA 1LP1B 2KUBA 3RGUA 2R44A 5CBOA 1EDJA 4IOIH 3QWOC 5DJTB 4GOFA 3MHVA 1Q2NA 2KZIA 4ASVA 4CPGA 2B87B 1DEEG 1S3JA 3S1KA 4K35A 2LR2A 4JBZA 1SS1A 5EFWB 2UWJE 1U7MA 4NPEA 2M0BA 1ZW0A 1NVOA 1EDIA 2HR3A 2WMMA 3MZWB 2M5AB 1LP1A 2RKLA 3FXEA 3FXDA 1H0TB 4HB1A 4MN4C 4BXLA 5CBNA 4HKZH 4GODA 4HJGH 2OTKE 5DJUB 4GOEA 4ZMDA 1JMBA 2QVAA 1EDLA 1U7JA 3ZDMA 4ASWA 2QRXA 2LXBA 5K5GB 3PH0A 1ZXGA 2SPZA 4WWIA 1LT1A 2I8DA 2KI7B 4K3AA 2KZJA 4NPFX 1MFTA 2B89A 1OVUA 2KIKA 1X0TA 4ZNCA 2M5AA 1Y47A 1JM0A 2LXCB 2JWDA 1H0TA 1EC5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BDD A;  2K3R A;  2B87 A;  4KJM A;  2B88 A;  4EYY Q;  2KS1 B;  1FC2 C;  1OVV A;  1EDK A;  2Q1K A;  1BDC A;  4NPD A;  2P58 A;  5C39 A;  2ZAE B;  1OVR A;  1LP1 B;  2KUB A;  3RGU A;  2R44 A;  5CBO A;  1EDJ A;  4IOI H;  3QWO C;  5DJT B;  4GOF A;  3MHV A;  1Q2N A;  2KZI A;  4ASV A;  4CPG A;  2B87 B;  1DEE G;  1S3J A;  3S1K A;  4K35 A;  2LR2 A;  4JBZ A;  1SS1 A;  5EFW B;  2UWJ E;  1U7M A;  4NPE A;  2M0B A;  1ZW0 A;  1NVO A;  1EDI A;  2HR3 A;  2WMM A;  3MZW B;  2M5A B;  1LP1 A;  2RKL A;  3FXE A;  3FXD A;  1H0T B;  4HB1 A;  4MN4 C;  4BXL A;  5CBN A;  4HKZ H;  4GOD A;  4HJG H;  2OTK E;  5DJU B;  4GOE A;  4ZMD A;  1JMB A;  2QVA A;  1EDL A;  1U7J A;  3ZDM A;  4ASW A;  2QRX A;  2LXB A;  5K5G B;  3PH0 A;  1ZXG A;  2SPZ A;  4WWI A;  1LT1 A;  2I8D A;  2KI7 B;  4K3A A;  2KZJ A;  4NPF X;  1MFT A;  2B89 A;  1OVU A;  2KIK A;  1X0T A;  4ZNC A;  2M5A A;  1Y47 A;  1JM0 A;  2LXC B;  2JWD A;  1H0T A;  1EC5 A; 
#chains in the Genus database with same CATH topology
 5AVR B;  2JP3 A;  4KJM A;  1JOC A;  2E75 D;  2BAS A;  1OVV A;  3AEB C;  1NTK D;  1YJN P;  3H1I D;  1M1J A;  3V4Q A;  4DCK A;  3WU2 H;  3CLQ A;  1KIL B;  2WZ7 A;  3T97 A;  2N1T B;  1M56 D;  1K8A Q;  1CW5 A;  3VP8 A;  1S3J A;  1RE3 C;  5L8R J;  3M9H A;  1SS1 A;  3HUS C;  3KYQ A;  1HWT C;  4U3F G;  3BRT B;  2KLV A;  3P8C D;  4ZKP A;  1L0N E;  5TIS E;  1KIL C;  2Q3I A;  2K88 A;  1SQB K;  3A3Y B;  4M3L A;  1A02 F;  1XTG B;  3VYI A;  4OWF A;  2NPS B;  1ZV8 A;  2OQQ A;  2WSC H;  1FOS F;  1BSH A;  3ZDM A;  2QRX A;  5KLV G;  3KDP B;  3H1H G;  1KIL D;  2V7Q J;  3CX5 E;  3H1L G;  2N1T D;  2IBZ G;  5KAI H;  1IFM A;  1YI2 P;  1NTM K;  2AEM A;  1JM0 A;  3VN0 A;  1SQP E;  2IYO A;  5AW7 B;  4EYY Q;  3SWY A;  4N78 E;  3I55 P;  3L36 A;  1SQB D;  1ZN5 A;  1LTA C;  4IFD K;  1KN7 A;  5KJ7 D;  1OVR A;  5AW8 B;  3A0B E;  1G1J A;  1BSN A;  2WTY A;  2RN0 A;  4RES B;  1NTZ K;  3L70 D;  1EDJ A;  3L75 E;  3PHL A;  1JNM A;  3AE9 C;  1X79 B;  2Y0E A;  3MHV A;  2C9N Y;  2KZI A;  5GTH E;  2KK7 A;  1L0N J;  2JR8 A;  1RF0 A;  2QJP B;  1SQQ E;  1X22 A;  3MTU E;  2NPS D;  3PTZ A;  2G8Y A;  2WVR A;  4I2L C;  4AUW A;  1EDI A;  2I1K A;  1SFC A;  3SWF A;  3FXE A;  2WSF J;  1HUC A;  1HH0 A;  5KAF H;  3CI9 A;  1L4A A;  1Y8A A;  5APT A;  4ZMD A;  2Q5U A;  1JMB A;  1DEB A;  3LW5 J;  3A5T A;  1R8E A;  2LKM A;  2CK3 H;  2QVA A;  1SQP J;  3HE5 A;  1ZXG A;  2Y9Z A;  1FDM A;  5APW A;  1EQ7 A;  4LLH A;  1LWU B;  4DOJ A;  1KQG B;  3KZI E;  1KYO I;  2HPC A;  1GZL A;  3CC4 P;  3GLM A;  2KSE A;  2WSE J;  1WT6 A;  4W80 A;  1SQQ J;  3TK1 A;  1J2J B;  2J58 A;  1JTH A;  2MKV A;  3VTP C;  1L0N G;  1OW7 A;  3AE1 C;  4WVZ A;  2WPS A;  1W2E A;  3GF7 A;  1VQK P;  1IFN A;  3C9I A;  1IZN B;  1IK7 A;  4L73 A;  2AEJ A;  2PFX A;  2I1J A;  1W5C E;  1FZG A;  3G9R A;  3TNU B;  4EOT A;  1NWQ A;  1KB9 I;  3CCM P;  2P67 A;  3M9Q A;  1DD3 A;  1OZH A;  3F5H A;  1HVV A;  4W7Z A;  1YBK A;  2HLO A;  1H0T B;  5B66 E;  2WQY C;  3JSV C;  1LTB C;  2H8P D;  1VQ5 P;  4GOD A;  1SQP G;  4WY4 A;  2YO2 A;  2AXT E;  4UB8 H;  5KLV D;  2P10 A;  1EDL A;  3H1H D;  5AW1 B;  3H1L D;  4WB4 A;  1KFM A;  1SP4 A;  1AVO A;  2OYI B;  3H6P A;  1P84 I;  3B5N A;  4B86 A;  4K3A A;  2QSI A;  2IYP A;  3CXH D;  3L37 A;  4ZNC A;  4A7P A;  1SQQ G;  4YPC A;  1VQM P;  1NHL A;  3NTN A;  3CCU P;  1YIT P;  2AEF A;  2BCC E;  1FZB A;  1LGH B;  2L91 A;  4PD4 D;  2HFE D;  2R5D A;  1NO4 A;  2GUS A;  2WIT A;  2OYH C;  4BRY A;  2OYI C;  1ZOY C;  4I7Z B;  2NRG A;  1QLE D;  2JWA A;  2G3A A;  2B87 B;  2IDB A;  1RF1 B;  2P7J A;  3KXD A;  4R4M A;  1MFZ A;  1OX3 A;  1PP9 J;  2N9B A;  3L73 D;  3WU2 E;  2IPP A;  3Q3D A;  5AVZ B;  3MZW B;  1OIP A;  3AEE C;  3I56 P;  2E43 A;  1AJY A;  3P32 A;  1HF9 A;  1Z56 A;  1VQN P;  4I7Z C;  1ZRT D;  1GL2 A;  1JY3 O;  2H89 C;  5AW0 B;  2J5U A;  2O1K A;  1RF1 C;  2QJY C;  1NU1 E;  2FYN B;  4D6T D;  2BCC J;  3L71 E;  1LTJ C;  4IL6 H;  3PLN A;  1G1I A;  4JF7 A;  1BDD A;  4C7R A;  2A45 G;  3PRJ A;  4U3F E;  1PPJ D;  4UB6 H;  1AFO A;  3MD0 A;  1NTM J;  4IFF A;  4DJG A;  2Q1K A;  2BEQ D;  4NPD A;  2FBW C;  2FFD B;  2KLU A;  3SFD C;  2R32 A;  1JMM A;  3TDK A;  1FZC B;  4L76 A;  2KUB A;  1SQX K;  2R44 A;  5KAI E;  3AE2 C;  2ITA A;  2YIU B;  2A06 G;  3CWB E;  2KSJ A;  1BE3 D;  1YTZ I;  4IL6 X;  3RBX A;  1PP9 G;  3E1I A;  3SFE C;  5AVQ B;  2IZ1 A;  1YIJ P;  2RH0 A;  4PJ0 H;  1ZW0 A;  3FX0 A;  3CC7 P;  2OTJ P;  3T97 B;  1UII A;  2XU6 A;  1MKM A;  2M5A B;  5AW4 B;  2FY8 A;  1SQV E;  3II6 A;  1JCD A;  1NU1 J;  1GW4 A;  1SQX D;  3VMX A;  2YIU C;  3L71 J;  3L74 E;  3OJA B;  2BCC G;  4AQR D;  3RL0 C;  4ASW A;  2E76 B;  3HD7 C;  1NH4 A;  3L75 D;  1GDT A;  2WT7 A;  1YYC A;  2O01 H;  4NPF X;  5CCH A;  2B89 A;  2NZ2 A;  3AE4 C;  3BCC E;  1NTM G;  2W8Z A;  1EC5 A;  3CXH I;  3RL0 D;  4PV1 B;  2JKV A;  5E79 H;  3CWB J;  4H13 B;  1FE6 A;  2YNY A;  2CPS A;  5C39 A;  3RBZ A;  1QL2 A;  1KC8 Q;  3TGU D;  1PFI A;  1KYO D;  1VQ7 P;  2H88 C;  1KZU B;  5AW9 B;  4PD4 I;  2OGU A;  2AXC A;  3FGA D;  1H88 A;  3L72 E;  1KQL A;  1SQV J;  2JDI H;  3A7O A;  3JCU H;  4K35 A;  1HTL C;  4KT0 J;  2QA4 P;  3IR9 A;  2E76 D;  1FZE A;  4PV1 C;  1T6A A;  4U7J A;  3H1K D;  1NU1 G;  3WUT A;  1J1E C;  1KTM A;  4H13 C;  3L74 J;  2FXM A;  3L71 G;  5AVU B;  4DZO A;  1KB9 D;  1M90 Q;  3RK3 E;  4AYC A;  5H2F H;  4HJG H;  2YKP A;  5CCG A;  2V4H A;  4GKG A;  3BCC J;  4PV1 D;  4H13 D;  1U7J A;  3AED C;  1LT9 A;  4WWI A;  3KPE A;  2BEZ F;  2N1T C;  1RHZ B;  2OTL P;  3BAT A;  1SFC B;  3LID A;  3OAK A;  4L74 A;  2HG5 D;  3CWB G;  1ZME C;  2PRR A;  5CHX A;  1L4A B;  2ZT9 B;  1S9K D;  5AVX B;  1AV1 A;  3AE5 C;  1P84 D;  4UB8 E;  5AVV B;  2FYU E;  3JC2 2;  3L72 J;  2ZAE B;  3H32 A;  5KJ7 C;  4EI2 A;  1BGY J;  1LTT C;  1K73 Q;  3M91 A;  1SQV G;  3HTK A;  3O6Q A;  2FYZ A;  3MGN A;  4JYB A;  4GOF A;  2P2U A;  1SFC C;  1L0L E;  1RE3 A;  2VRS A;  3HUS A;  3L74 G;  4XE5 B;  2O1J A;  2ZT9 C;  2NPS C;  2XNX A;  3PP5 A;  1GTW A;  1EZV E;  3CX5 I;  1RQV A;  1JTH B;  3BCC G;  1SFC D;  1BCC E;  3N4X A;  3P7K A;  1L4A D;  2ZT9 D;  2OTK E;  2BCC D;  2KS1 A;  4GOE A;  2E5Y A;  2H43 A;  1QGK B;  4XFJ A;  1E79 H;  5M1B A;  3SSU A;  3CXH H;  2HOD A;  1EXI A;  3E1R A;  2ZJS E;  2FYU J;  3NXS A;  4Y28 J;  3D6Z A;  5KKZ B;  3VOP A;  1MFT A;  3M9B A;  2W90 A;  1VQ4 P;  1K04 A;  2JWD A;  2E5T A;  3L72 G;  1NGM B;  4WY4 B;  5AVW B;  4PD4 H;  1FC2 C;  2QJP C;  1BGY G;  1EDK A;  2E42 A;  3ITK A;  1M1K Q;  3GG2 A;  1L0L J;  2P58 A;  1OW8 A;  2JEE A;  5APU A;  1FJP A;  4GIF A;  4IL6 E;  2JO1 A;  1NTK E;  3H1I E;  3V2R A;  1KFN A;  3EQ2 A;  5KKZ C;  4LC1 A;  2QIW A;  1N7S B;  1M8O B;  1BCC J;  1DEE G;  1J1D B;  2KYV A;  2K9Y A;  4UB6 E;  3WUV A;  2XKM A;  1NU1 D;  2ZYD A;  1SVF A;  4WY4 C;  1YHQ P;  1OFC X;  2Q9I A;  5KLV K;  3L35 A;  5APX A;  1Q90 D;  1LWU C;  3G6E P;  4U3F D;  3CL3 D;  1IFP A;  4WY4 D;  1N2D C;  3FWN A;  2FYU G;  3P8C E;  3TSI A;  3M06 A;  2WWW A;  3MUD C;  4TLF A;  4JQ0 D;  3CCV P;  1N7S C;  5AW5 B;  5APY A;  4RJT A;  2R3S A;  1J1D C;  4PJ0 E;  3EFF K;  3IFM A;  5APQ A;  1T8Z A;  3M0D C;  2A06 E;  1OVU A;  1PP9 E;  1L0L G;  4JYC A;  2B88 A;  1N7S D;  2M3E A;  1KIL E;  2A45 I;  2Q6Q A;  1NTK J;  2WPR A;  3H1I J;  5AW2 B;  2IBZ D;  1W2B O;  3H25 A;  1EZV G;  4YTP C;  1K9M Q;  3C8V A;  1BCC G;  2E74 B;  2YO3 A;  3QWO C;  1SQB E;  1G2C B;  1PGO A;  3L74 D;  1N73 B;  3EFG A;  1VQP P;  1L2P A;  2O01 N;  2XV5 A;  5B5E H;  5CMZ A;  3BAS A;  4JBZ A;  1CI6 B;  3L70 E;  5EFW B;  1U7M A;  1LNQ A;  3BCC D;  1FDO A;  3RK3 B;  2WMM A;  1FU1 A;  2MJZ A;  1ZLL A;  1NTM E;  1DIP A;  4R4L A;  4BWN A;  4BXL A;  5CBN A;  2Z4E A;  4HKZ H;  2O3J A;  3RK2 B;  4IFM A;  3JCU E;  1RH5 B;  1N73 C;  4GT1 A;  1PGJ A;  3TNU A;  2L5G B;  2QM7 A;  2ZVN B;  3CCS P;  1FS0 E;  2XND H;  2LXB A;  1ZR4 A;  5BU5 A;  1NTZ E;  1GMJ A;  1NTK G;  3H1I G;  2E74 D;  1L0N K;  1X0T A;  5GTI H;  5H2F E;  2O01 J;  1H0T A;  2Z5H A;  1YJW P;  3M0A A;  1KYO H;  1SQB J;  3HE4 B;  3RK2 C;  3AEC C;  2W83 C;  3RK3 D;  1LP1 B;  2OYH A;  1XTC C;  2WT7 B;  2OYI A;  3L70 J;  4Z1M H;  2FXO A;  3S9O A;  4IOI H;  3CD6 P;  3RK2 D;  2J59 M;  4ASV A;  1EXJ A;  4C7N A;  1SQP K;  1L0N D;  1Q7Y Q;  1JB0 J;  1IFJ A;  3BVH A;  3NMD A;  2POH A;  1KB9 H;  2KXP B;  3IF4 A;  2M0B A;  3R4Y A;  1NVO A;  1S1C X;  2HYN A;  2FYN C;  3H1J E;  3I5C A;  2YXQ B;  4HB1 A;  3RL0 g;  2Y0D A;  1KMI Z;  1SLQ A;  1NTZ J;  1MUU A;  5KLI B;  3CX5 D;  4OGQ B;  5CCH C;  1URQ A;  1QL1 A;  1M1J B;  4YXD C;  1SQQ K;  3KHU A;  3E7K A;  1RF1 A;  2Y0C A;  2QG4 A;  2FFD C;  3N7N A;  1SQP D;  1JUN A;  3OA7 A;  1FZC C;  2XZR A;  1LTJ A;  2N9Y B;  3K5B A;  4N78 D;  3TF5 A;  1P84 H;  1SQB G;  5CCH D;  1VPC A;  1EZV D;  4YXW H;  3Q5R A;  3L70 G;  3U1A A;  3AEF C;  1HJB A;  5BU8 B;  4I1L A;  2WSC J;  1M1J C;  2IBZ I;  1GU5 A;  4ZKU A;  4GDO A;  1KQF B;  1SQQ D;  1LT9 B;  4RKU J;  5KAF E;  5CBO A;  3CC2 P;  3VMY A;  2M8R A;  3PJS K;  1ZR2 A;  1FAV A;  3H1J J;  4OGQ D;  3ABV C;  4PD4 E;  2ZYA A;  3C1L A;  2YXR B;  1D7M A;  5CCG C;  3HRN A;  4NPE A;  2E76 C;  1USD A;  1R5L A;  1U57 A;  2K9J A;  1NTZ G;  1FJK A;  2RKL A;  3HTK B;  2KNC A;  3O6Q B;  3FXD A;  3G3Z A;  3MP7 B;  1PZQ A;  3CCL P;  2WPQ A;  3Q2Y A;  3L73 E;  1LTI C;  1BGY E;  5CCG D;  1GU4 A;  1S2E A;  3HUS B;  5AW3 B;  5AVT B;  1FBM A;  3HD7 A;  2Z5I A;  2C0X A;  2IZ0 A;  1JY3 N;  3CCJ P;  1RE4 A;  1VF5 B;  3CMA P;  1ZRT E;  5AW6 B;  1S4X A;  1N8R Q;  3IN6 A;  2KIK A;  2M5A A;  1Y47 A;  3GW6 A;  2QJK B;  2KS1 B;  3SWK A;  4D6T E;  3GHG A;  2OYO A;  1BDC A;  3VP9 A;  3QH9 A;  2H7H A;  2HOD B;  3H1J G;  1T2K C;  3AEA C;  1NAY A;  5CJ4 A;  1T3U A;  5TJH A;  1GW3 A;  1PPJ E;  1WRG A;  4HYT B;  2XDJ A;  1VF5 C;  1PGQ A;  3G71 P;  3D70 A;  1M7L A;  1RF0 C;  3HE5 B;  1NKZ B;  2QJK C;  3W68 A;  1VQO P;  1VL2 A;  1N86 A;  3L73 J;  1T2K D;  2W27 A;  1X9V A;  1OW6 A;  2A06 D;  1HGV A;  1BE3 E;  1PP9 D;  2R3C A;  1VF5 D;  2WSS H;  2HR3 A;  3GMA A;  4L75 A;  1JY3 P;  1S5L H;  2JJL A;  3UIA A;  3CPW O;  1RQU A;  2HPC B;  4MN4 C;  2YKO A;  4QMA A;  1OMI A;  1L4A C;  1H89 A;  5B5E E;  1JCC A;  3AE3 C;  2K1A A;  1IJD B;  1KIL A;  2QEX P;  4D6T J;  1SQX E;  2N1T A;  2KZJ A;  1MZ9 A;  1S5L X;  3AEG C;  1FDI A;  2FXP A;  3V2Q A;  3MIW A;  3KQG A;  4N6J A;  1Q82 Q;  3B71 A;  1EZV I;  5KJ7 A;  3BRV B;  1NTM D;  2B9B A;  1NU1 K;  2ZXX A;  1USE A;  2DW3 A;  5GTI E;  4C46 A;  1BE3 J;  1Q86 Q;  3U1C A;  4O9B A;  3L73 G;  3TGU E;  1AQ5 A;  1KYO E;  2C9L Y;  3S1K A;  2NPS A;  1JY2 O;  1Q81 Q;  2UWJ E;  1NTZ D;  4HH2 A;  3Q5S A;  3B5N B;  3A0H H;  1OXZ A;  3V2P A;  2YKQ A;  3AE8 C;  1M57 D;  1KQS O;  1SQX J;  2CPB A;  4W7Y A;  4XA4 A;  1FZA A;  1HJ0 A;  1PGP A;  1VQ8 P;  3H1K E;  1MV8 A;  2IFM A;  4D6T G;  3L71 D;  2W6A A;  3TYY A;  4H0L B;  2V7Q H;  1X8Y A;  1KB9 E;  3L75 J;  2QE7 H;  5K5G B;  1GK6 A;  4BRY B;  3S4R A;  2I8D A;  2KI7 B;  1PPJ G;  3B5N C;  1SQV K;  2ZFC A;  3VMZ A;  1AA0 A;  4Y99 B;  1KD1 Q;  2K3R A;  1OWA A;  1IFI A;  3H1J D;  3TGU J;  3CWB D;  4EIJ A;  1BE3 G;  3B5N D;  3CCE P;  1KV4 A;  1QX8 A;  4H0L C;  1S9K E;  3RGU A;  3B4S A;  1P84 E;  1FOS E;  2ZVO B;  5TIS H;  5DJT B;  2M3B A;  3V4W A;  2PP6 A;  1GL2 B;  1YJ9 P;  1YQ3 C;  2Q7C A;  1DH3 A;  1SQV D;  1AVY A;  4H0L D;  4Y99 C;  3USS A;  2GM4 A;  3H1K J;  3LIE A;  1IFD A;  1SQX G;  2WSF H;  2C0W A;  2KB7 P;  3AE7 C;  3CX5 H;  2OYH B;  1PIX A;  1RY3 A;  1LWU A;  3LW5 H;  1GK4 A;  2R5B A;  3L75 G;  3V5B A;  2QM8 A;  3A2A A;  5E79 E;  2K37 A;  3Q1M A;  3MUD A;  3B8E B;  4C7N B;  2IX7 C;  1N7S A;  1VQL P;  1GL2 C;  1NYH A;  4KHX A;  4RO0 A;  3D71 A;  3FWL A;  3A0B H;  3GF3 A;  2SPZ A;  2D2C B;  5APV A;  3M0D A;  4WBA A;  2PGD A;  1NAF A;  1ZP0 C;  1UIX A;  3L4F A;  1YQ4 C;  2E74 C;  2W6B A;  1IO4 A;  4EDF A;  3G4S P;  1PL5 A;  3TGU G;  1A02 J;  1GL2 D;  1YTZ T;  1DD4 A;  2WSE H;  5GTH H;  4N3Y B;  1GD2 E;  1URQ B;  1AQT A;  3AE6 C;  5AVS B;  2QJY B;  1S72 P;  3L72 D;  1FZF A;  2FKW B;  3RK3 C;  2ZXE B;  1JY2 N;  1LTJ B;  1BGY D;  1Y9B A;  4OH8 B;  1QVG O;  3CCR P;  2D2C C;  2KP8 A;  3D6Y A;  3H1K G;  4CPG A;  1N7L A;  1HGZ A;  4I6M C;  3R2P A;  2FYU K;  1H8A A;  1VQ9 P;  1URQ C;  3F89 A;  3VMA A;  2D2C D;  3W67 A;  1R5S A;  2GA1 A;  4H44 B;  2PAJ A;  2KOG A;  3KZI H;  5DJU B;  1G2C A;  1L0L K;  2ZYG A;  1N73 A;  1URQ D;  1CSB A;  3IAO A;  3Q5P A;  1CI6 A;  3OW2 O;  3EWK A;  2Q3E A;  1LT1 A;  2K9J B;  1S5L E;  2FYU D;  2KNC B;  1JY2 P;  1WMK A;  3V2N A;  2LXC B;  2B87 A;  1CZQ A;  5AVY B;  4H44 C;  1DX7 A;  2A45 H;  3RL0 B;  2OAR A;  3HD7 B;  1L0L D;  2W6J H;  5KLV E;  1VDF A;  3H1H E;  3H1L E;  2GUV A;  2IBZ E;  1JEK A;  1PV3 A;  1IK9 A;  5B66 H;  1QEX A;  4H44 D;  1LTS C;  1K05 A;  4DT0 A;  1Q2N A;  1JO5 A;  1LTG C;  5KLI C;  1E5W A;  2E75 B;  4OGQ C;  3CME P;  3WUU A;  3CXH E;  2AXT H;  1BCC D;  2LR2 A;  5APS A;  3GHG B;  3HE4 A;  1LJ2 A;  2WPV B;  1NOH A;  5BVZ A;  1KOR A;  1QVF O;  3U59 A;  1LP1 A;  1IC2 A;  4U3F J;  3O8Z A;  1NKN A;  1RE4 C;  1NTK K;  4OVN F;  4JPZ B;  3P8M C;  3V6I A;  3H32 B;  3HD7 D;  2FFD A;  4LGD E;  2E75 C;  3A0H E;  1TU3 F;  1J1E B;  1FZC A;  3PH0 A;  3CCQ P;  3WMM 0;  3GHG C;  2IFN A;  1T3J A;  1LT9 C;  1NJI Q;  1VQ6 P;  4TT3 H;  2YMK A;  2Y9Y A;  3NFQ A;  2RMZ A;  2YMY A;  5KLV J;  2P1J A;  3H1H J;  5CJ0 A;  1HBW A;  5KTB A;  3H1L J; 
#chains in the Genus database with same CATH homology
 1BDD A;  2K3R A;  2B87 A;  4KJM A;  2B88 A;  4EYY Q;  2KS1 B;  1FC2 C;  1OVV A;  1EDK A;  2Q1K A;  1BDC A;  4NPD A;  2P58 A;  5C39 A;  2ZAE B;  1OVR A;  1LP1 B;  2KUB A;  3RGU A;  2R44 A;  5CBO A;  1EDJ A;  4IOI H;  3QWO C;  5DJT B;  4GOF A;  3MHV A;  1Q2N A;  2KZI A;  4ASV A;  4CPG A;  2B87 B;  1DEE G;  1S3J A;  3S1K A;  4K35 A;  2LR2 A;  4JBZ A;  1SS1 A;  5EFW B;  2UWJ E;  1U7M A;  4NPE A;  2M0B A;  1ZW0 A;  1NVO A;  1EDI A;  2HR3 A;  2WMM A;  3MZW B;  2M5A B;  1LP1 A;  2RKL A;  3FXE A;  3FXD A;  1H0T B;  4HB1 A;  4MN4 C;  4BXL A;  5CBN A;  4HKZ H;  4GOD A;  4HJG H;  2OTK E;  5DJU B;  4GOE A;  4ZMD A;  1JMB A;  2QVA A;  1EDL A;  1U7J A;  3ZDM A;  4ASW A;  2QRX A;  2LXB A;  5K5G B;  3PH0 A;  1ZXG A;  2SPZ A;  4WWI A;  1LT1 A;  2I8D A;  2KI7 B;  4K3A A;  2KZJ A;  4NPF X;  1MFT A;  2B89 A;  1OVU A;  2KIK A;  1X0T A;  4ZNC A;  2M5A A;  1Y47 A;  1JM0 A;  2LXC B;  2JWD A;  1H0T A;  1EC5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...