4HJGH

Meditope-enabled trastuzumab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
GSYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Trastuzumab light chain
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
total genus 22
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4hjgH00
2KS1B 4BXLA 1H0TA 1OVRA 2M0BA 1LT1A 2KZJA 1S3JA 2K3RA 1DEEG 4WWIA 2OTKE 2B87A 3FXEA 1ZXGA 5K5GB 1EDIA 1JMBA 1OVVA 4HKZH 1LP1B 1ZW0A 1FC2C 3MHVA 4NPFX 4NPDA 2M5AA 2RKLA 3QWOC 3FXDA 4ZNCA 4ZMDA 2SPZA 2LXCB 1X0TA 4IOIH 2LR2A 1EDJA 2QVAA 3S1KA 1MFTA 1LP1A 1U7MA 5CBNA 2B88A 4GOEA 2KUBA 2WMMA 4MN4C 4NPEA 2KZIA 4EYYQ 1OVUA 2B89A 4HJGH 2LXBA 5DJUB 1H0TB 4ASVA 4ASWA 1Q2NA 2ZAEB 4JBZA 2R44A 1EDLA 2KI7B 2HR3A 1NVOA 1EDKA 4HB1A 5C39A 1U7JA 2P58A 4K3AA 2Q1KA 2KIKA 2M5AB 3ZDMA 3RGUA 1JM0A 5CBOA 1SS1A 1BDCA 4CPGA 4GOFA 5DJTB 1BDDA 1Y47A 2B87B 3MZWB 5EFWB 2I8DA 4KJMA 2UWJE 2QRXA 4K35A 4GODA 1EC5A 2JWDA 3PH0A
chains in the Genus database with same CATH superfamily
2MKVA 5TJHA 1JO5A 2WTYA 1PP9J 5E79E 3RK2B 2M0BA 1S3JA 2IFNA 2QEXP 1R5LA 1SP4A 3USSA 1HUCA 2R5DA 1LTBC 1Q90D 2FYUD 1GL2D 1JY2O 2K9JA 2O01J 3TSIA 1Q7YQ 4UB8H 1L0LE 2FFDA 2FFDC 1P84E 2A06D 1FS0E 2AEJA 1RE4A 2OYHA 1RE4C 2WPRA 2OYHC 5KLVJ 4I1LA 1NTZE 2IYOA 4GOEA 1QL1A 4BWNA 2FYNC 3G3ZA 3JSVC 4Y99C 2AEMA 1GL2A 3HUSB 1GL2C 2O1JA 1JY3O 4YXWH 5KJ7D 1SQQK 4O9BA 3L35A 4JF7A 5H2FE 2WQYC 4K3AA 4U3FJ 1VDFA 1NO4A 5CHXA 1PGPA 3OJAB 4XA4A 1M57D 1NAYA 3TNUA 1ZR4A 1K8AQ 4GIFA 1PZQA 1SQXE 2Q7CA 3CXHI 1LTSC 4BXLA 4C46A 4RESB 4R4LA 3HE4A 1NTZD 1PGQA 4WY4B 3U1AA 3H1HJ 1L4AB 3JCUH 1LTGC 3WMM0 2FXMA 3CX5I 2JEEA 2BCCE 1HWTC 3D70A 5AW1B 1SQVK 1R5SA 1SQXG 1BCCD 3VP9A 4NPDA 4PJ0E 3L70J 2OTLP 2PP6A 5KAIE 3G6EP 2G3AA 3L71E 3CC2P 1MFTA 1FU1A 3Q5PA 4L74A 2O01N 1JB0J 2KS1A 4EI2A 1QVFO 1BGYD 1SQQJ 2JDIH 1FDIA 1RF1A 2HG5D 1RF1C 4I7ZC 2WT7B 1QL2A 4GDOA 2DW3A 2IBZD 2KI7B 1FOSE 1KN7A 2XU6A 1FDOA 3OA7A 2KNCB 1FZGA 3ZDMA 1KTMA 1SS1A 2Z4EA 2OYOA 2E74D 3SWYA 1IFJA 1Y8AA 1NKZB 3IF4A 5EFWB 2XV5A 1VF5B 1YJNP 4C7NA 4Y28J 1URQB 2KYVA 3L71D 5CJ0A 1SQVJ 1AV1A 1JEKA 2QM7A 2IX7C 1EDIA 2BEQD 1FZAA 1RHZB 4UB8E 1A02F 1USDA 1JY3P 2E74C 3L73E 3PJSK 1EZVE 3GF3A 5KAFH 3U59A 1AVYA 2KK7A 3E7KA 3KQGA 1NTME 4LLHA 1HBWA 4XE5B 2JKVA 2IYPA 3VTPC 1SQBG 3L74D 2ZYAA 3M91A 1N7SD 1FZFA 4HJGH 2LXBA 1HVVA 2A45I 3B8EB 3TK1A 1Q2NA 3P32A 4JBZA 4XFJA 1M7LA 1PGOA 2Y0CA 1S5LX 2R44A 1H89A 5APUA 3CMEP 1GK6A 1AFOA 1NTKE 3SWFA 3B5NB 1U7JA 2Q1KA 2NZ2A 4RO0A 2G8YA 2C9LY 3RGUA 2WSCJ 5AVXB 1EQ7A 1HGZA 4GOFA 1BDDA 2B9BA 4JQ0D 1EZVD 3NXSA 1YITP 3QH9A 1N7SA 3M9HA 1BSNA 1N7SC 3M9QA 2Z5IA 1NTMD 3FX0A 3RK3B 2P2UA 3GW6A 5K5GB 3H1IE 3GHGB 5BVZA 1LP1B 2NRGA 1JOCA 3TGUG 3A7OA 1X8YA 1NTKD 1YI2P 1NAFA 4DOJA 2SPZA 2RH0A 3H1IG 2AXCA 2QE7H 3OAKA 1NJIQ 5M1BA 3L72J 1NU1K 1YQ3C 1DX7A 3VYIA 2XKMA 2KZIA 2J5UA 3BASA 1UIXA 1ZLLA 3SSUA 4ASVA 1SQPE 3IR9A 1T8ZA 3Q5SA 2YMKA 2W8ZA 1KILE 4IFMA 2QM8A 1EDKA 1PIXA 2OYIA 1JTHA 4N3YB 2OYIC 1BE3G 1S2EA 3D6YA 4PD4H 3BCCD 1SQPG 1IJDB 2J59M 3HD7D 2FY8A 5CCGD 2B87B 1ZN5A 1M1KQ 4GODA 4I2LC 2OYHB 2FKWB 2OGUA 1H0TA 3TGUJ 2H8PD 2K3RA 5CJ4A 3C9IA 2KSEA 2OTKE 4WWIA 1LT9A 4IL6X 1LT9C 1U57A 1IFDA 3L36A 4BRYB 2M3EA 2QJKB 1S1CX 1W5CE 2Y0EA 2YMYA 3RL0D 1PP9E 3EFFK 5KAFE 1KILD 1NU1J 3HD7A 3H1KG 3HD7C 5CCGA 5CCGC 2POHA 3EWKA 2GUSA 2P10A 2ZT9D 1Q81Q 3S1KA 3H32A 2A45G 3JC22 1L0NK 2E5YA 2Q3IA 2Q3EA 5AW5B 3NMDA 1KC8Q 4TT3H 2B89A 1L0ND 3W67A 3NFQA 2ZAEB 1T3JA 1LGHB 4OGQB 1OW7A 2N9BA 3RL0C 3HRNA 4H13B 1GTWA 1KILA 1KILC 5C39A 2WPSA 4RJTA 1KB9D 2P1JA 2C0WA 2O1KA 2KLUA 3H1JG 2ZT9C 1IK7A 2N1TB 2C9NY 5APVA 3AE2C 5KLVG 3VOPA 3L75D 1GD2E 2IBZI 4U3FE 2KS1B 1R8EA 3CMAP 3OW2O 3CCUP 1RQUA 3F89A 2VRSA 3PTZA 2E75D 1FZEA 1LTAC 4D6TD 3H1KJ 2WSEH 1KQLA 1LWUA 3II6A 1LWUC 1OVVA 2WPQA 4W80A 1CI6A 3UIAA 5AVUB 2FYUK 1DEBA 1JY2N 1CSBA 4HYTB 1NWQA 1JCDA 5GTHH 1X79B 3PLNA 4C7NB 2A06G 3CLQA 2CPBA 3A0BH 3AE8C 1YBKA 1GDTA 5BU5A 3H1HG 1S9KE 3H6PA 2E75C 1DIPA 2PRRA 5APWA 3Q2YA 3H1JJ 2HFED 1FZBA 3U1CA 1HF9A 1HJ0A 2JO1A 3ABVC 4PD4E 1GW3A 3H25A 1Q86Q 1N73B 3L70G 1SQQE 2L5GB 3CWBD 1JY3N 4WVZA 1SFCD 1FZCA 2E74B 3R4YA 1FZCC 1AVOA 3AE1C 2HPCB 4LC1A 2GUVA 2R3SA 3MP7B 3Q1MA 3CXHH 5KLIC 1SQQG 1L0LK 1MV8A 2YIUC 3CX5H 2FYUJ 4L75A 1L0LD 1ZP0C 1WMKA 1ZRTE 3AEGC 1P84D 1QEXA 3AEAC 1JUNA 1NTZK 2HLOA 1ZOYC 1S5LH 2GA1A 1SFCA 4PD4D 1SFCC 3T97A 4KHXA 2ZYGA 4H44D 3I55P 3NTNA 2WSSH 4DZOA 1OX3A 2WZ7A 3CI9A 3VP8A 3O6QA 1H88A 1SQVG 2QJYB 2L91A 1N7SB 4OWFA 1E5WA 3V4QA 1W2EA 1EXIA 5AW7B 2ZYDA 2Y9ZA 3B71A 1BGYG 1VQ7P 1EXJA 3L4FA 3N4XA 1JCCA 1KQGB 2KB7P 2JWAA 3VMYA 1X9VA 2KIKA 3V2QA 1JM0A 4H44C 3V2RA 5CBOA 4ZKUA 1PPJG 2E5TA 1SQXD 3IN6A 1M1JA 1M1JC 5AVYB 2E76D 4DJGA 3RL0g 1IO4A 4KT0J 1J1DC 1IFNA 1KQFB 2BCCD 2ZVNB 5B66H 2W6BA 4LGDE 3G4SP 1LT1A 1DEEG 1NH4A 1JY2P 2PFXA 3W68A 2I1KA 5AW9B 1KZUB 1BCCJ 1AJYA 1NOHA 1HH0A 2IPPA 2Q9IA 4JYCA 4H0LB 3AE9C 2IZ0A 3IAOA 2K37A 4ZMDA 5GTHE 2H88C 1W2BO 3A0BE 2E76C 3CC7P 2XDJA 2V7QJ 1BGYJ 2PGDA 2K1AA 2B88A 4JYBA 1AA0A 2KUBA 2WMMA 2A45H 1SQBE 4NPEA 1DH3A 1H0TB 3HTKB 3GLMA 1K9MQ 3L74G 1T2KD 4AYCA 4GKGA 3L72E 1LTIC 4IL6H 3V2PA 2P58A 1PL5A 5AW6B 3CCVP 1FAVA 2O01H 4WY4D 4PV1D 3CXHE 4CPGA 4KJMA 1NGMB 3H32B 3L72G 1XTCC 3D71A 1KD1Q 3SWKA 2P67A 2LKMA 3H1LG 3CX5E 4OH8B 1LTTC 3CCMP 1KB9I 3C8VA 1SQBD 1T2KC 1S5LE 1NTMK 1VQNP 4L76A 3L73D 3C1LA 1WT6A 3RL0B 4N6JA 1LTJA 4N78E 1ZR2A 1LTJC 1KILB 2QIWA 2C0XA 1GZLA 2M5AA 3TGUE 4WY4A 4WY4C 3D6ZA 4PV1C 1YJ9P 3FGAD 2ZT9B 5APTA 1KFMA 1NTKK 5CBNA 3L74J 1RE3A 2E42A 1NU1E 1RE3C 1HJBA 1KYOI 1H8AA 4UB6H 1N2DC 3MGNA 5AW8B 1EDLA 1N86A 5TISH 1LWUB 1Q82Q 1URQD 1NU1G 3SFDC 3A3YB 2WT7A 1BE3E 2YO3A 2BASA 3H1LJ 2FXPA 5DJTB 3MUDA 3PHLA 1HGVA 3MZWB 3MUDC 3GG2A 3WUTA 5GTIH 1K05A 1OWAA 5B66E 2Y0DA 5AW4B 2PAJA 4K35A 3E1IA 1VQ8P 1NTMJ 1OFCX 3AECC 3H1ID 3KHUA 2KNCA 4B86A 2K9JB 1OVRA 2FFDB 1FDMA 1FBMA 1URQA 3CCEP 1URQC 3B4SA 3RK3E 3MHVA 2NPSD 1DD3A 2FYNB 2RMZA 3AE7C 3H1KE 2W90A 1S4XA 1BE3D 3N7NA 4Y99B 5BU8B 1SQPD 3O8ZA 1GL2B 1KFNA 3A5TA 1PFIA 1IC2A 1CW5A 2WSFJ 1P84I 5AVTB 1GK4A 4OVNF 2D2CD 1HTLC 2JJLA 4EYYQ 1T6AA 2YIUB 4IL6E 5APYA 1M56D 5B5EH 3MTUE 5KKZC 3TNUB 1L0NG 3GMAA 3PRJA 2KXPB 1AQ5A 1IK9A 2V7QH 3BCCJ 2NPSA 2NPSC 4I6MC 1SFCB 3RK3D 3H1JE 1BDCA 3HE4B 2KLVA 4Z1MH 5KLVE 3O6QB 1EC5A 2D2CC 3PH0A 1KORA 2CK3H 1QLED 2KZJA 1PP9D 3L75G 3MD0A 5AVRB 3SFEC 3RK3C 3RBXA 3V2NA 4ZNCA 1VQPP 4H44B 1RF1B 4I7ZB 2FYUE 5CCHD 3GHGA 1USEA 1NYHA 3GHGC 3S9OA 2WSCH 3WUUA 3FWLA 1LP1A 1IFPA 4UB6E 3BATA 1J1DB 3Q5RA 2A06E 1KMIZ 1L0NJ 4EOTA 1T3UA 4MN4C 3KPEA 5KLVD 3CCJP 4TLFA 5TISE 5KTBA 1QGKB 3HE5A 3H1HE 2M3BA 4M3LA 2FYUG 1YQ4C 3L70E 1G2CA 1JMMA 1J1EC 3CCLP 5GTIE 5CCHA 2AXTH 3AE4C 5CCHC 4U3FD 1G1IA 1KV4A 2W6AA 1ZMEC 2E76B 5AW2B 5AW0B 2I8DA 3CWBG 3CCSP 3L75J 2HYNA 2HODA 4WBAA 2R32A 1YHQP 1Y9BA 4D6TJ 1OW8A 2GM4A 2B87A 3FXEA 3H1HD 2R5BA 5AVSB 3K5BA 3F5HA 3AE6C 1L0LG 2K88A 1RY3A 4W7ZA 2MJZA 3V6IA 1VQ5P 2BEZF 2LXCB 3L70D 1X0TA 2XNDH 2W83C 1S9KD 1JNMA 1BCCE 4BRYA 4OGQD 1WRGA 2QJKC 3RBZA 4H13D 1NTZG 1GU4A 1EZVI 1VL2A 2YXRB 1SQVE 2OTJP 5B5EE 2O3JA 4ASWA 1YTZI 3VMZA 1SQQD 4WB4A 2N1TD 1BCCG 5APSA 1BGYE 2I1JA 2QJPC 1IFMA 1VQ9P 3CWBJ 4HB1A 5CMZA 1LTJB 2YXQB 1X22A 3KZIH 2M5AB 2WSFH 2KSJA 2KOGA 2P7JA 1N7LA 4PV1B 2IBZE 1PPJE 4OGQC 2FBWC 3CD6P 2V4HA 5KJ7A 5KJ7C 4H13C 5AW3B 3LIEA 2YNYA 1SQXK 1LNQA 1YJWP 1ZRTD 3RK2D 2IBZG 3M06A 2N1TA 1L0LJ 1MZ9A 3AEEC 1SQVD 2N1TC 1ZXGA 2BCCG 2ZFCA 2YKQA 1SLQA 1NTZJ 3QWOC 3FXDA 1VQMP 2IFMA 1NHLA 2ZJSE 3L71G 2OQQA 4DCKA 3G71P 3S4RA 2YO2A 1PPJD 3ITKA 2Q6QA 2E43A 2H89C 2H43A 2FYZA 1MUUA 2OYIB 3RK2C 1JTHB 2Z5HA 3AEBC 1VQ4P 1L2PA 1M8OB 2IZ1A 3L74E 3GF7A 2HR3A 2AXTE 1NVOA 1PV3A 2YKOA 3L37A 1SQXJ 3P7KA 1E79H 1NKNA 3BRTB 3P8CE 1LT9B 1VQKP 1N73A 1N73C 3A0HH 3KYQA 2BCCJ 1RH5B 4U7JA 2JWDA 2WVRA 5L8RJ 1IFIA 3VMAA 3Q3DA 1KB9H 1QX8A 3H1LE 3LIDA 2HPCA 2QG4A 1FE6A 3HD7B 2XZRA 1L4AD 3HUSA 3HUSC 3LW5J 1RQVA 3L71J 1VQ6P 5KKZB 1MFZA 4HKZH 1ZW0A 1SQBK 2NPSB 3IFMA 3L73G 1MKMA 1EZVG 1M90Q 2ZXEB 1VPCA 3CL3D 2LR2A 3CC4P 2QVAA 4AQRD 1NTMG 1AQTA 3P8CD 2RN0A 2D2CB 1KYOH 2OARA 2N9YB 2YKPA 3L72D 3P8MC 1J2JB 1OVUA 4IFFA 2WSEJ 1G1JA 1L4AA 5APQA 4A7PA 1L4AC 1FJPA 2FXOA 5AVVB 3H1LD 2CPSA 4C7RA 1YTZT 3KZIE 1NTKG 3CXHD 2QJYC 1QVGO 3JCUE 4YPCA 2IDBA 1OMIA 1VQLP 1K73Q 4EIJA 3CX5D 2M8RA 2WWWA 3WU2H 2UWJE 1VF5D 3KXDA 2Y9YA 3TYYA 3BCCE 2ZXXA 1CI6B 4H0LD 3I56P 2JP3A 1SQBJ 4N78D 1FJKA 3HE5B 3AE3C 3L73J 3TGUD 5E79H 1JMBA 1UIIA 3VN0A 5APXA 1GW4A 1N8RQ 3BCCG 1GMJA 1FC2C 3M0DA 4NPFX 3M0DC 2Q5UA 1G2CB 1J1EB 1IZNB 1KQSO 2E75B 4IOIH 1NU1D 3BVHA 2QA4P 1VF5C 4IFDK 2K9YA 1P84H 1U7MA 2HODB 3AEFC 4H0LC 4GT1A 1NTKJ 1RF0A 4YTPC 1RF0C 1D7MA 1SQPK 3V4WA 3KDPB 1FZCB 2WITA 1SVFA 4JPZB 1L0NE 5KLIB 1GU5A 3B5ND 1OZHA 4R4MA 3M0AA 3HTKA 1TU3F 4L73A 3EQ2A 4AUWA 4PD4I 1ZV8A 4ZKPA 3A0HE 5H2FH 2ZVOB 3A2AA 4HH2A 3G9RA 1KB9E 3H1IJ 3AE5C 3BRVB 1DD4A 3M9BA 3WUVA 3PP5A 2WPVB 2W27A 3T97B 1OW6A 2JR8A 1Z56A 3L75E 3MIWA 2AEFA 2QJPB 3R2PA 3H1KD 2XNXA 1PP9G 3B5NA 3E1RA 3B5NC 4QMAA 3AEDC 4D6TE 2RKLA 3V5BA 3FWNA 3CCQP 3CPWO 2QSIA 1BE3J 1YYCA 1LJ2A 1K04A 1EDJA 1SQPJ 4PJ0H 1OIPA 1KYOE 3TDKA 1CZQA 5KAIH 4W7YA 2ITAA 3LW5H 4YXDC 4D6TG 4RKUJ 5DJUB 1S72P 1YIJP 2R3CA 1BSHA 1M1JB 4EDFA 5KLVK 2J58A 3H1JD 5AVWB 4DT0A 3CCRP 1A02J 2H7HA 1PGJA 3WU2E 5AVQB 5AVZB 3I5CA 1Y47A 3EFGA 1OXZA 3VMXA 3TF5A 2W6JH 2QRXA 3CWBE 1XTGB 1FOSF 1VQOP 4U3FG 1KYOD 2KP8A
chains in the Genus database with same CATH topology
2KS1B 4BXLA 1H0TA 1OVRA 2M0BA 1LT1A 2KZJA 1S3JA 2K3RA 1DEEG 4WWIA 2OTKE 2B87A 3FXEA 1ZXGA 5K5GB 1EDIA 1JMBA 1OVVA 4HKZH 1LP1B 1ZW0A 1FC2C 3MHVA 4NPFX 4NPDA 2M5AA 2RKLA 3QWOC 3FXDA 4ZNCA 4ZMDA 2SPZA 2LXCB 1X0TA 4IOIH 2LR2A 1EDJA 2QVAA 3S1KA 1MFTA 1LP1A 1U7MA 5CBNA 2B88A 4GOEA 2KUBA 2WMMA 4MN4C 4NPEA 2KZIA 4EYYQ 1OVUA 2B89A 4HJGH 2LXBA 5DJUB 1H0TB 4ASVA 4ASWA 1Q2NA 2ZAEB 4JBZA 2R44A 1EDLA 2KI7B 2HR3A 1NVOA 1EDKA 4HB1A 5C39A 1U7JA 2P58A 4K3AA 2Q1KA 2KIKA 2M5AB 3ZDMA 3RGUA 1JM0A 5CBOA 1SS1A 1BDCA 4CPGA 4GOFA 5DJTB 1BDDA 1Y47A 2B87B 3MZWB 5EFWB 2I8DA 4KJMA 2UWJE 2QRXA 4K35A 4GODA 1EC5A 2JWDA 3PH0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KS1 B;  4BXL A;  1H0T A;  1OVR A;  2M0B A;  1LT1 A;  2KZJ A;  1S3J A;  2K3R A;  1DEE G;  4WWI A;  2OTK E;  2B87 A;  3FXE A;  1ZXG A;  5K5G B;  1EDI A;  1JMB A;  1OVV A;  4HKZ H;  1LP1 B;  1ZW0 A;  1FC2 C;  3MHV A;  4NPF X;  4NPD A;  2M5A A;  2RKL A;  3QWO C;  3FXD A;  4ZNC A;  4ZMD A;  2SPZ A;  2LXC B;  1X0T A;  4IOI H;  2LR2 A;  1EDJ A;  2QVA A;  3S1K A;  1MFT A;  1LP1 A;  1U7M A;  5CBN A;  2B88 A;  4GOE A;  2KUB A;  2WMM A;  4MN4 C;  4NPE A;  2KZI A;  4EYY Q;  1OVU A;  2B89 A;  4HJG H;  2LXB A;  5DJU B;  1H0T B;  4ASV A;  4ASW A;  1Q2N A;  2ZAE B;  4JBZ A;  2R44 A;  1EDL A;  2KI7 B;  2HR3 A;  1NVO A;  1EDK A;  4HB1 A;  5C39 A;  1U7J A;  2P58 A;  4K3A A;  2Q1K A;  2KIK A;  2M5A B;  3ZDM A;  3RGU A;  1JM0 A;  5CBO A;  1SS1 A;  1BDC A;  4CPG A;  4GOF A;  5DJT B;  1BDD A;  1Y47 A;  2B87 B;  3MZW B;  5EFW B;  2I8D A;  4KJM A;  2UWJ E;  2QRX A;  4K35 A;  4GOD A;  1EC5 A;  2JWD A;  3PH0 A; 
#chains in the Genus database with same CATH topology
 2MKV A;  5TJH A;  1JO5 A;  2WTY A;  1PP9 J;  5E79 E;  3RK2 B;  2M0B A;  1S3J A;  2IFN A;  2QEX P;  1R5L A;  1SP4 A;  3USS A;  1HUC A;  2R5D A;  1LTB C;  1Q90 D;  2FYU D;  1GL2 D;  1JY2 O;  2K9J A;  2O01 J;  3TSI A;  1Q7Y Q;  4UB8 H;  1L0L E;  2FFD A;  2FFD C;  1P84 E;  2A06 D;  1FS0 E;  2AEJ A;  1RE4 A;  2OYH A;  1RE4 C;  2WPR A;  2OYH C;  5KLV J;  4I1L A;  1NTZ E;  2IYO A;  4GOE A;  1QL1 A;  4BWN A;  2FYN C;  3G3Z A;  3JSV C;  4Y99 C;  2AEM A;  1GL2 A;  3HUS B;  1GL2 C;  2O1J A;  1JY3 O;  4YXW H;  5KJ7 D;  1SQQ K;  4O9B A;  3L35 A;  4JF7 A;  5H2F E;  2WQY C;  4K3A A;  4U3F J;  1VDF A;  1NO4 A;  5CHX A;  1PGP A;  3OJA B;  4XA4 A;  1M57 D;  1NAY A;  3TNU A;  1ZR4 A;  1K8A Q;  4GIF A;  1PZQ A;  1SQX E;  2Q7C A;  3CXH I;  1LTS C;  4BXL A;  4C46 A;  4RES B;  4R4L A;  3HE4 A;  1NTZ D;  1PGQ A;  4WY4 B;  3U1A A;  3H1H J;  1L4A B;  3JCU H;  1LTG C;  3WMM 0;  2FXM A;  3CX5 I;  2JEE A;  2BCC E;  1HWT C;  3D70 A;  5AW1 B;  1SQV K;  1R5S A;  1SQX G;  1BCC D;  3VP9 A;  4NPD A;  4PJ0 E;  3L70 J;  2OTL P;  2PP6 A;  5KAI E;  3G6E P;  2G3A A;  3L71 E;  3CC2 P;  1MFT A;  1FU1 A;  3Q5P A;  4L74 A;  2O01 N;  1JB0 J;  2KS1 A;  4EI2 A;  1QVF O;  1BGY D;  1SQQ J;  2JDI H;  1FDI A;  1RF1 A;  2HG5 D;  1RF1 C;  4I7Z C;  2WT7 B;  1QL2 A;  4GDO A;  2DW3 A;  2IBZ D;  2KI7 B;  1FOS E;  1KN7 A;  2XU6 A;  1FDO A;  3OA7 A;  2KNC B;  1FZG A;  3ZDM A;  1KTM A;  1SS1 A;  2Z4E A;  2OYO A;  2E74 D;  3SWY A;  1IFJ A;  1Y8A A;  1NKZ B;  3IF4 A;  5EFW B;  2XV5 A;  1VF5 B;  1YJN P;  4C7N A;  4Y28 J;  1URQ B;  2KYV A;  3L71 D;  5CJ0 A;  1SQV J;  1AV1 A;  1JEK A;  2QM7 A;  2IX7 C;  1EDI A;  2BEQ D;  1FZA A;  1RHZ B;  4UB8 E;  1A02 F;  1USD A;  1JY3 P;  2E74 C;  3L73 E;  3PJS K;  1EZV E;  3GF3 A;  5KAF H;  3U59 A;  1AVY A;  2KK7 A;  3E7K A;  3KQG A;  1NTM E;  4LLH A;  1HBW A;  4XE5 B;  2JKV A;  2IYP A;  3VTP C;  1SQB G;  3L74 D;  2ZYA A;  3M91 A;  1N7S D;  1FZF A;  4HJG H;  2LXB A;  1HVV A;  2A45 I;  3B8E B;  3TK1 A;  1Q2N A;  3P32 A;  4JBZ A;  4XFJ A;  1M7L A;  1PGO A;  2Y0C A;  1S5L X;  2R44 A;  1H89 A;  5APU A;  3CME P;  1GK6 A;  1AFO A;  1NTK E;  3SWF A;  3B5N B;  1U7J A;  2Q1K A;  2NZ2 A;  4RO0 A;  2G8Y A;  2C9L Y;  3RGU A;  2WSC J;  5AVX B;  1EQ7 A;  1HGZ A;  4GOF A;  1BDD A;  2B9B A;  4JQ0 D;  1EZV D;  3NXS A;  1YIT P;  3QH9 A;  1N7S A;  3M9H A;  1BSN A;  1N7S C;  3M9Q A;  2Z5I A;  1NTM D;  3FX0 A;  3RK3 B;  2P2U A;  3GW6 A;  5K5G B;  3H1I E;  3GHG B;  5BVZ A;  1LP1 B;  2NRG A;  1JOC A;  3TGU G;  3A7O A;  1X8Y A;  1NTK D;  1YI2 P;  1NAF A;  4DOJ A;  2SPZ A;  2RH0 A;  3H1I G;  2AXC A;  2QE7 H;  3OAK A;  1NJI Q;  5M1B A;  3L72 J;  1NU1 K;  1YQ3 C;  1DX7 A;  3VYI A;  2XKM A;  2KZI A;  2J5U A;  3BAS A;  1UIX A;  1ZLL A;  3SSU A;  4ASV A;  1SQP E;  3IR9 A;  1T8Z A;  3Q5S A;  2YMK A;  2W8Z A;  1KIL E;  4IFM A;  2QM8 A;  1EDK A;  1PIX A;  2OYI A;  1JTH A;  4N3Y B;  2OYI C;  1BE3 G;  1S2E A;  3D6Y A;  4PD4 H;  3BCC D;  1SQP G;  1IJD B;  2J59 M;  3HD7 D;  2FY8 A;  5CCG D;  2B87 B;  1ZN5 A;  1M1K Q;  4GOD A;  4I2L C;  2OYH B;  2FKW B;  2OGU A;  1H0T A;  3TGU J;  2H8P D;  2K3R A;  5CJ4 A;  3C9I A;  2KSE A;  2OTK E;  4WWI A;  1LT9 A;  4IL6 X;  1LT9 C;  1U57 A;  1IFD A;  3L36 A;  4BRY B;  2M3E A;  2QJK B;  1S1C X;  1W5C E;  2Y0E A;  2YMY A;  3RL0 D;  1PP9 E;  3EFF K;  5KAF E;  1KIL D;  1NU1 J;  3HD7 A;  3H1K G;  3HD7 C;  5CCG A;  5CCG C;  2POH A;  3EWK A;  2GUS A;  2P10 A;  2ZT9 D;  1Q81 Q;  3S1K A;  3H32 A;  2A45 G;  3JC2 2;  1L0N K;  2E5Y A;  2Q3I A;  2Q3E A;  5AW5 B;  3NMD A;  1KC8 Q;  4TT3 H;  2B89 A;  1L0N D;  3W67 A;  3NFQ A;  2ZAE B;  1T3J A;  1LGH B;  4OGQ B;  1OW7 A;  2N9B A;  3RL0 C;  3HRN A;  4H13 B;  1GTW A;  1KIL A;  1KIL C;  5C39 A;  2WPS A;  4RJT A;  1KB9 D;  2P1J A;  2C0W A;  2O1K A;  2KLU A;  3H1J G;  2ZT9 C;  1IK7 A;  2N1T B;  2C9N Y;  5APV A;  3AE2 C;  5KLV G;  3VOP A;  3L75 D;  1GD2 E;  2IBZ I;  4U3F E;  2KS1 B;  1R8E A;  3CMA P;  3OW2 O;  3CCU P;  1RQU A;  3F89 A;  2VRS A;  3PTZ A;  2E75 D;  1FZE A;  1LTA C;  4D6T D;  3H1K J;  2WSE H;  1KQL A;  1LWU A;  3II6 A;  1LWU C;  1OVV A;  2WPQ A;  4W80 A;  1CI6 A;  3UIA A;  5AVU B;  2FYU K;  1DEB A;  1JY2 N;  1CSB A;  4HYT B;  1NWQ A;  1JCD A;  5GTH H;  1X79 B;  3PLN A;  4C7N B;  2A06 G;  3CLQ A;  2CPB A;  3A0B H;  3AE8 C;  1YBK A;  1GDT A;  5BU5 A;  3H1H G;  1S9K E;  3H6P A;  2E75 C;  1DIP A;  2PRR A;  5APW A;  3Q2Y A;  3H1J J;  2HFE D;  1FZB A;  3U1C A;  1HF9 A;  1HJ0 A;  2JO1 A;  3ABV C;  4PD4 E;  1GW3 A;  3H25 A;  1Q86 Q;  1N73 B;  3L70 G;  1SQQ E;  2L5G B;  3CWB D;  1JY3 N;  4WVZ A;  1SFC D;  1FZC A;  2E74 B;  3R4Y A;  1FZC C;  1AVO A;  3AE1 C;  2HPC B;  4LC1 A;  2GUV A;  2R3S A;  3MP7 B;  3Q1M A;  3CXH H;  5KLI C;  1SQQ G;  1L0L K;  1MV8 A;  2YIU C;  3CX5 H;  2FYU J;  4L75 A;  1L0L D;  1ZP0 C;  1WMK A;  1ZRT E;  3AEG C;  1P84 D;  1QEX A;  3AEA C;  1JUN A;  1NTZ K;  2HLO A;  1ZOY C;  1S5L H;  2GA1 A;  1SFC A;  4PD4 D;  1SFC C;  3T97 A;  4KHX A;  2ZYG A;  4H44 D;  3I55 P;  3NTN A;  2WSS H;  4DZO A;  1OX3 A;  2WZ7 A;  3CI9 A;  3VP8 A;  3O6Q A;  1H88 A;  1SQV G;  2QJY B;  2L91 A;  1N7S B;  4OWF A;  1E5W A;  3V4Q A;  1W2E A;  1EXI A;  5AW7 B;  2ZYD A;  2Y9Z A;  3B71 A;  1BGY G;  1VQ7 P;  1EXJ A;  3L4F A;  3N4X A;  1JCC A;  1KQG B;  2KB7 P;  2JWA A;  3VMY A;  1X9V A;  2KIK A;  3V2Q A;  1JM0 A;  4H44 C;  3V2R A;  5CBO A;  4ZKU A;  1PPJ G;  2E5T A;  1SQX D;  3IN6 A;  1M1J A;  1M1J C;  5AVY B;  2E76 D;  4DJG A;  3RL0 g;  1IO4 A;  4KT0 J;  1J1D C;  1IFN A;  1KQF B;  2BCC D;  2ZVN B;  5B66 H;  2W6B A;  4LGD E;  3G4S P;  1LT1 A;  1DEE G;  1NH4 A;  1JY2 P;  2PFX A;  3W68 A;  2I1K A;  5AW9 B;  1KZU B;  1BCC J;  1AJY A;  1NOH A;  1HH0 A;  2IPP A;  2Q9I A;  4JYC A;  4H0L B;  3AE9 C;  2IZ0 A;  3IAO A;  2K37 A;  4ZMD A;  5GTH E;  2H88 C;  1W2B O;  3A0B E;  2E76 C;  3CC7 P;  2XDJ A;  2V7Q J;  1BGY J;  2PGD A;  2K1A A;  2B88 A;  4JYB A;  1AA0 A;  2KUB A;  2WMM A;  2A45 H;  1SQB E;  4NPE A;  1DH3 A;  1H0T B;  3HTK B;  3GLM A;  1K9M Q;  3L74 G;  1T2K D;  4AYC A;  4GKG A;  3L72 E;  1LTI C;  4IL6 H;  3V2P A;  2P58 A;  1PL5 A;  5AW6 B;  3CCV P;  1FAV A;  2O01 H;  4WY4 D;  4PV1 D;  3CXH E;  4CPG A;  4KJM A;  1NGM B;  3H32 B;  3L72 G;  1XTC C;  3D71 A;  1KD1 Q;  3SWK A;  2P67 A;  2LKM A;  3H1L G;  3CX5 E;  4OH8 B;  1LTT C;  3CCM P;  1KB9 I;  3C8V A;  1SQB D;  1T2K C;  1S5L E;  1NTM K;  1VQN P;  4L76 A;  3L73 D;  3C1L A;  1WT6 A;  3RL0 B;  4N6J A;  1LTJ A;  4N78 E;  1ZR2 A;  1LTJ C;  1KIL B;  2QIW A;  2C0X A;  1GZL A;  2M5A A;  3TGU E;  4WY4 A;  4WY4 C;  3D6Z A;  4PV1 C;  1YJ9 P;  3FGA D;  2ZT9 B;  5APT A;  1KFM A;  1NTK K;  5CBN A;  3L74 J;  1RE3 A;  2E42 A;  1NU1 E;  1RE3 C;  1HJB A;  1KYO I;  1H8A A;  4UB6 H;  1N2D C;  3MGN A;  5AW8 B;  1EDL A;  1N86 A;  5TIS H;  1LWU B;  1Q82 Q;  1URQ D;  1NU1 G;  3SFD C;  3A3Y B;  2WT7 A;  1BE3 E;  2YO3 A;  2BAS A;  3H1L J;  2FXP A;  5DJT B;  3MUD A;  3PHL A;  1HGV A;  3MZW B;  3MUD C;  3GG2 A;  3WUT A;  5GTI H;  1K05 A;  1OWA A;  5B66 E;  2Y0D A;  5AW4 B;  2PAJ A;  4K35 A;  3E1I A;  1VQ8 P;  1NTM J;  1OFC X;  3AEC C;  3H1I D;  3KHU A;  2KNC A;  4B86 A;  2K9J B;  1OVR A;  2FFD B;  1FDM A;  1FBM A;  1URQ A;  3CCE P;  1URQ C;  3B4S A;  3RK3 E;  3MHV A;  2NPS D;  1DD3 A;  2FYN B;  2RMZ A;  3AE7 C;  3H1K E;  2W90 A;  1S4X A;  1BE3 D;  3N7N A;  4Y99 B;  5BU8 B;  1SQP D;  3O8Z A;  1GL2 B;  1KFN A;  3A5T A;  1PFI A;  1IC2 A;  1CW5 A;  2WSF J;  1P84 I;  5AVT B;  1GK4 A;  4OVN F;  2D2C D;  1HTL C;  2JJL A;  4EYY Q;  1T6A A;  2YIU B;  4IL6 E;  5APY A;  1M56 D;  5B5E H;  3MTU E;  5KKZ C;  3TNU B;  1L0N G;  3GMA A;  3PRJ A;  2KXP B;  1AQ5 A;  1IK9 A;  2V7Q H;  3BCC J;  2NPS A;  2NPS C;  4I6M C;  1SFC B;  3RK3 D;  3H1J E;  1BDC A;  3HE4 B;  2KLV A;  4Z1M H;  5KLV E;  3O6Q B;  1EC5 A;  2D2C C;  3PH0 A;  1KOR A;  2CK3 H;  1QLE D;  2KZJ A;  1PP9 D;  3L75 G;  3MD0 A;  5AVR B;  3SFE C;  3RK3 C;  3RBX A;  3V2N A;  4ZNC A;  1VQP P;  4H44 B;  1RF1 B;  4I7Z B;  2FYU E;  5CCH D;  3GHG A;  1USE A;  1NYH A;  3GHG C;  3S9O A;  2WSC H;  3WUU A;  3FWL A;  1LP1 A;  1IFP A;  4UB6 E;  3BAT A;  1J1D B;  3Q5R A;  2A06 E;  1KMI Z;  1L0N J;  4EOT A;  1T3U A;  4MN4 C;  3KPE A;  5KLV D;  3CCJ P;  4TLF A;  5TIS E;  5KTB A;  1QGK B;  3HE5 A;  3H1H E;  2M3B A;  4M3L A;  2FYU G;  1YQ4 C;  3L70 E;  1G2C A;  1JMM A;  1J1E C;  3CCL P;  5GTI E;  5CCH A;  2AXT H;  3AE4 C;  5CCH C;  4U3F D;  1G1I A;  1KV4 A;  2W6A A;  1ZME C;  2E76 B;  5AW2 B;  5AW0 B;  2I8D A;  3CWB G;  3CCS P;  3L75 J;  2HYN A;  2HOD A;  4WBA A;  2R32 A;  1YHQ P;  1Y9B A;  4D6T J;  1OW8 A;  2GM4 A;  2B87 A;  3FXE A;  3H1H D;  2R5B A;  5AVS B;  3K5B A;  3F5H A;  3AE6 C;  1L0L G;  2K88 A;  1RY3 A;  4W7Z A;  2MJZ A;  3V6I A;  1VQ5 P;  2BEZ F;  2LXC B;  3L70 D;  1X0T A;  2XND H;  2W83 C;  1S9K D;  1JNM A;  1BCC E;  4BRY A;  4OGQ D;  1WRG A;  2QJK C;  3RBZ A;  4H13 D;  1NTZ G;  1GU4 A;  1EZV I;  1VL2 A;  2YXR B;  1SQV E;  2OTJ P;  5B5E E;  2O3J A;  4ASW A;  1YTZ I;  3VMZ A;  1SQQ D;  4WB4 A;  2N1T D;  1BCC G;  5APS A;  1BGY E;  2I1J A;  2QJP C;  1IFM A;  1VQ9 P;  3CWB J;  4HB1 A;  5CMZ A;  1LTJ B;  2YXQ B;  1X22 A;  3KZI H;  2M5A B;  2WSF H;  2KSJ A;  2KOG A;  2P7J A;  1N7L A;  4PV1 B;  2IBZ E;  1PPJ E;  4OGQ C;  2FBW C;  3CD6 P;  2V4H A;  5KJ7 A;  5KJ7 C;  4H13 C;  5AW3 B;  3LIE A;  2YNY A;  1SQX K;  1LNQ A;  1YJW P;  1ZRT D;  3RK2 D;  2IBZ G;  3M06 A;  2N1T A;  1L0L J;  1MZ9 A;  3AEE C;  1SQV D;  2N1T C;  1ZXG A;  2BCC G;  2ZFC A;  2YKQ A;  1SLQ A;  1NTZ J;  3QWO C;  3FXD A;  1VQM P;  2IFM A;  1NHL A;  2ZJS E;  3L71 G;  2OQQ A;  4DCK A;  3G71 P;  3S4R A;  2YO2 A;  1PPJ D;  3ITK A;  2Q6Q A;  2E43 A;  2H89 C;  2H43 A;  2FYZ A;  1MUU A;  2OYI B;  3RK2 C;  1JTH B;  2Z5H A;  3AEB C;  1VQ4 P;  1L2P A;  1M8O B;  2IZ1 A;  3L74 E;  3GF7 A;  2HR3 A;  2AXT E;  1NVO A;  1PV3 A;  2YKO A;  3L37 A;  1SQX J;  3P7K A;  1E79 H;  1NKN A;  3BRT B;  3P8C E;  1LT9 B;  1VQK P;  1N73 A;  1N73 C;  3A0H H;  3KYQ A;  2BCC J;  1RH5 B;  4U7J A;  2JWD A;  2WVR A;  5L8R J;  1IFI A;  3VMA A;  3Q3D A;  1KB9 H;  1QX8 A;  3H1L E;  3LID A;  2HPC A;  2QG4 A;  1FE6 A;  3HD7 B;  2XZR A;  1L4A D;  3HUS A;  3HUS C;  3LW5 J;  1RQV A;  3L71 J;  1VQ6 P;  5KKZ B;  1MFZ A;  4HKZ H;  1ZW0 A;  1SQB K;  2NPS B;  3IFM A;  3L73 G;  1MKM A;  1EZV G;  1M90 Q;  2ZXE B;  1VPC A;  3CL3 D;  2LR2 A;  3CC4 P;  2QVA A;  4AQR D;  1NTM G;  1AQT A;  3P8C D;  2RN0 A;  2D2C B;  1KYO H;  2OAR A;  2N9Y B;  2YKP A;  3L72 D;  3P8M C;  1J2J B;  1OVU A;  4IFF A;  2WSE J;  1G1J A;  1L4A A;  5APQ A;  4A7P A;  1L4A C;  1FJP A;  2FXO A;  5AVV B;  3H1L D;  2CPS A;  4C7R A;  1YTZ T;  3KZI E;  1NTK G;  3CXH D;  2QJY C;  1QVG O;  3JCU E;  4YPC A;  2IDB A;  1OMI A;  1VQL P;  1K73 Q;  4EIJ A;  3CX5 D;  2M8R A;  2WWW A;  3WU2 H;  2UWJ E;  1VF5 D;  3KXD A;  2Y9Y A;  3TYY A;  3BCC E;  2ZXX A;  1CI6 B;  4H0L D;  3I56 P;  2JP3 A;  1SQB J;  4N78 D;  1FJK A;  3HE5 B;  3AE3 C;  3L73 J;  3TGU D;  5E79 H;  1JMB A;  1UII A;  3VN0 A;  5APX A;  1GW4 A;  1N8R Q;  3BCC G;  1GMJ A;  1FC2 C;  3M0D A;  4NPF X;  3M0D C;  2Q5U A;  1G2C B;  1J1E B;  1IZN B;  1KQS O;  2E75 B;  4IOI H;  1NU1 D;  3BVH A;  2QA4 P;  1VF5 C;  4IFD K;  2K9Y A;  1P84 H;  1U7M A;  2HOD B;  3AEF C;  4H0L C;  4GT1 A;  1NTK J;  1RF0 A;  4YTP C;  1RF0 C;  1D7M A;  1SQP K;  3V4W A;  3KDP B;  1FZC B;  2WIT A;  1SVF A;  4JPZ B;  1L0N E;  5KLI B;  1GU5 A;  3B5N D;  1OZH A;  4R4M A;  3M0A A;  3HTK A;  1TU3 F;  4L73 A;  3EQ2 A;  4AUW A;  4PD4 I;  1ZV8 A;  4ZKP A;  3A0H E;  5H2F H;  2ZVO B;  3A2A A;  4HH2 A;  3G9R A;  1KB9 E;  3H1I J;  3AE5 C;  3BRV B;  1DD4 A;  3M9B A;  3WUV A;  3PP5 A;  2WPV B;  2W27 A;  3T97 B;  1OW6 A;  2JR8 A;  1Z56 A;  3L75 E;  3MIW A;  2AEF A;  2QJP B;  3R2P A;  3H1K D;  2XNX A;  1PP9 G;  3B5N A;  3E1R A;  3B5N C;  4QMA A;  3AED C;  4D6T E;  2RKL A;  3V5B A;  3FWN A;  3CCQ P;  3CPW O;  2QSI A;  1BE3 J;  1YYC A;  1LJ2 A;  1K04 A;  1EDJ A;  1SQP J;  4PJ0 H;  1OIP A;  1KYO E;  3TDK A;  1CZQ A;  5KAI H;  4W7Y A;  2ITA A;  3LW5 H;  4YXD C;  4D6T G;  4RKU J;  5DJU B;  1S72 P;  1YIJ P;  2R3C A;  1BSH A;  1M1J B;  4EDF A;  5KLV K;  2J58 A;  3H1J D;  5AVW B;  4DT0 A;  3CCR P;  1A02 J;  2H7H A;  1PGJ A;  3WU2 E;  5AVQ B;  5AVZ B;  3I5C A;  1Y47 A;  3EFG A;  1OXZ A;  3VMX A;  3TF5 A;  2W6J H;  2QRX A;  3CWB E;  1XTG B;  1FOS F;  1VQO P;  4U3F G;  1KYO D;  2KP8 A; 
#chains in the Genus database with same CATH homology
 2KS1 B;  4BXL A;  1H0T A;  1OVR A;  2M0B A;  1LT1 A;  2KZJ A;  1S3J A;  2K3R A;  1DEE G;  4WWI A;  2OTK E;  2B87 A;  3FXE A;  1ZXG A;  5K5G B;  1EDI A;  1JMB A;  1OVV A;  4HKZ H;  1LP1 B;  1ZW0 A;  1FC2 C;  3MHV A;  4NPF X;  4NPD A;  2M5A A;  2RKL A;  3QWO C;  3FXD A;  4ZNC A;  4ZMD A;  2SPZ A;  2LXC B;  1X0T A;  4IOI H;  2LR2 A;  1EDJ A;  2QVA A;  3S1K A;  1MFT A;  1LP1 A;  1U7M A;  5CBN A;  2B88 A;  4GOE A;  2KUB A;  2WMM A;  4MN4 C;  4NPE A;  2KZI A;  4EYY Q;  1OVU A;  2B89 A;  4HJG H;  2LXB A;  5DJU B;  1H0T B;  4ASV A;  4ASW A;  1Q2N A;  2ZAE B;  4JBZ A;  2R44 A;  1EDL A;  2KI7 B;  2HR3 A;  1NVO A;  1EDK A;  4HB1 A;  5C39 A;  1U7J A;  2P58 A;  4K3A A;  2Q1K A;  2KIK A;  2M5A B;  3ZDM A;  3RGU A;  1JM0 A;  5CBO A;  1SS1 A;  1BDC A;  4CPG A;  4GOF A;  5DJT B;  1BDD A;  1Y47 A;  2B87 B;  3MZW B;  5EFW B;  2I8D A;  4KJM A;  2UWJ E;  2QRX A;  4K35 A;  4GOD A;  1EC5 A;  2JWD A;  3PH0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...