4HJGH

Meditope-enabled trastuzumab
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
GSYNKDQQSAFYEILNMPNLNEAQRNGFIQSLKDDPSQSTNVLGEAKKLNESQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Identification and grafting of a unique peptide-binding site in the Fab framework of monoclonal antibodies.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Immune system
molecule keywords Trastuzumab light chain
total genus 22
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 2012-10-12
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4hjgH00
4BXLA 1OVUA 5DJUB 2OTKE 5C39A 1BDDA 1BDCA 4JBZA 4CPGA 2B88A 1S3JA 2LR2A 2KIKA 3S1KA 4HKZH 1Q2NA 4ASVA 2RKLA 1LP1B 3MHVA 3MZWB 4HB1A 1NVOA 4WWIA 2KZJA 1OVRA 5CBNA 2M0BA 3PH0A 4GOEA 1FC2C 1EDIA 3QWOC 4NPFX 2LXCB 1LT1A 4NPEA 2KUBA 2WMMA 1LP1A 4MN4C 5EFWB 2R44A 2M5AB 1DEEG 3FXEA 2KZIA 3FXDA 4IOIH 1H0TA 2B87B 1EDLA 2Q1KA 4HJGH 3ZDMA 2QRXA 2P58A 4EYYQ 2K3RA 1Y47A 4ASWA 1EDJA 2KI7B 2B89A 4GOFA 4K3AA 2ZAEB 2HR3A 1U7JA 4NPDA 1SS1A 4GODA 1JM0A 2QVAA 2SPZA 2B87A 4KJMA 4ZNCA 5K5GB 5CBOA 2M5AA 2LXBA 4K35A 2UWJE 1ZXGA 2I8DA 2JWDA 1EDKA 1X0TA 4ZMDA 2KS1B 3RGUA 1OVVA 1H0TB 1ZW0A 1MFTA 1EC5A 1JMBA 1U7MA 5DJTB
chains in the Genus database with same CATH superfamily
4BXLA 2BEZF 2K37A 1KQGB 3CX5I 2ZFCA 3RK3C 1N7SB 2DW3A 1VPCA 4D6TE 5B5EE 1GZLA 2E76D 4TLFA 3CC4P 2V4HA 3TYYA 5TISH 2FY8A 1VQ6P 1GW4A 4JQ0D 3MUDC 2A45I 2C0XA 4AQRD 3VOPA 5H2FH 2LR2A 4GT1A 4Y99B 3S1KA 1ZRTE 1JEKA 1LTGC 3CWBJ 3E1RA 3PLNA 4H44D 5BVZA 1Q2NA 2H7HA 4IL6E 1L0ND 2RKLA 2WVRA 1YI2P 2Y0EA 1S5LX 3MHVA 4PD4E 4WY4A 1KFNA 1T8ZA 2ZT9D 2A45H 3RL0D 3O8ZA 1P84E 2KZJA 2O01H 4UB6E 5H2FE 5KLVE 4H0LD 3TNUA 1NTKJ 1LWUA 2JWAA 3VYIA 3NMDA 1SQPK 1GTWA 4U3FD 2YIUB 1EDIA 5KJ7C 1N8RQ 1LTJC 3SSUA 1GL2C 2KSEA 2E76B 1L4AD 1OIPA 3HD7C 5CHXA 1M1JA 1WT6A 2K1AA 2WT7A 2E75B 2J5UA 1L0NE 3H1JG 3H1LD 1S5LH 1DH3A 1FJKA 3TSIA 4NPEA 3H1JJ 3HTKB 2KNCA 3M9QA 4HYTB 2V7QJ 5AW0B 3CXHH 3VMYA 5CCGC 3G71P 2PP6A 4JPZB 1NJIQ 1EQ7A 2R44A 3D70A 2FYNB 1DD3A 3H1HJ 4ZKUA 2QEXP 1J1DB 5AVXB 3AE2C 3FXEA 3Q5PA 3H1HG 4I6MC 5KTBA 3TGUD 3OW2O 1LWUB 2YXQB 2KP8A 1KMIZ 3HTKA 5KLIB 1N73C 4LGDE 2QJKC 1EZVE 3OJAB 3L75G 3AEGC 4IOIH 4AYCA 3Q3DA 3PJSK 2FFDB 1QGKB 1EDLA 1USDA 1JCCA 2N1TB 2M3EA 1BE3D 2RN0A 3U1AA 4C7NA 3V4WA 2WT7B 3KQGA 1ZR2A 2P58A 1NU1D 4IL6X 5KAFE 1CZQA 2WPRA 4EYYQ 2K3RA 2WITA 1NO4A 2AXTH 4C7NB 3CC7P 3H1KE 4ASWA 5APTA 5GTIH 4RO0A 2YNYA 5APWA 3MUDA 5AVVB 1MZ9A 4PV1D 2B89A 1Y9BA 4GOFA 1M56D 3L72J 3EFFK 2ZAEB 4I7ZC 1SQXK 3WUVA 1T2KD 3S4RA 1KTMA 1MV8A 1NTZK 1SQQK 2LKMA 5AVUB 3RK2B 3FGAD 5CMZA 1N7LA 1GK6A 3CX5E 4OGQD 3VP9A 1Q82Q 2A45G 4NPDA 3V2QA 2CPSA 2WSFH 4N78D 1JM0A 3HE4B 3BCCE 3BCCJ 3CCQP 1L2PA 1VQMP 1IK7A 1HH0A 3R2PA 2FFDA 1JY3P 3AEDC 2PGDA 3B71A 1NTMD 1JTHB 3RBXA 1NAYA 2BCCD 4GIFA 3I5CA 3O6QA 4ZNCA 1YJNP 2A06D 5CCHD 2KS1A 3H6PA 1BGYE 1BGYJ 4GKGA 5KAIH 1FZEA 3NXSA 1KV4A 1IK9A 4K35A 2UWJE 2ZYAA 4L74A 4GDOA 2AXCA 2XNXA 4WVZA 1A02J 1PGPA 3FWNA 1IO4A 2KOGA 2JWDA 2E43A 2Q3EA 1EDKA 1Y8AA 4WB4A 3CCVP 5CCHA 2XDJA 3V5BA 5GTHE 3LIDA 1NTKD 1M90Q 4WY4B 2N1TC 2ZVOB 3FX0A 3GLMA 3L72D 1SFCC 1FDOA 3CCSP 2G3AA 1X22A 3CMEP 3HE4A 2NPSD 1GW3A 4R4LA 3SWKA 2HYNA 1L0NJ 3H1IG 2O01N 2BCCG 1YQ3C 3L74E 3N4XA 2YKOA 1BCCG 4QMAA 3UIAA 1KB9D 3H1LG 1PGJA 1FDMA 2XNDH 1PPJG 1PPJE 1VL2A 1KFMA 1NAFA 1YBKA 2KXPB 2NPSB 2P67A 3AE9C 1XTCC 1XTGB 1JMBA 1U7MA 1IFIA 1SQBK 5TISE 3RK2C 3A0HE 2JDIH 3CCUP 3GHGC 3C8VA 5APQA 1FJPA 2HLOA 4RJTA 3GHGB 1QL2A 3W68A 1D7MA 1ZR4A 2N9BA 1HGZA 2N1TA 1KB9E 1L0NG 3H1IJ 1SFCA 3W67A 3AE6C 2OQQA 3CX5H 2ZYGA 3R4YA 5C39A 2WSSH 1KYOH 1LT9B 1R5LA 2CPBA 4DCKA 3U59A 5BU5A 2HPCB 1KN7A 3EWKA 4XFJA 1JOCA 1RE3A 1BE3G 2OYOA 2W6AA 3LW5J 4JBZA 4CPGA 3RK2D 1H8AA 4W7YA 2FFDC 3G3ZA 2WQYC 4C7RA 1NTMG 3V2NA 2E74C 2K9JB 3VMXA 5GTHH 2C9LY 4HB1A 3PP5A 4RESB 4U3FJ 5KAIE 1VQ8P 2NPSA 5KLIC 4WWIA 1OVRA 1QL1A 2HFED 3L70E 4U7JA 5APUA 5AVYB 2P7JA 2R3CA 3KHUA 2C0WA 3USSA 3L71G 3PH0A 1FBMA 2L91A 1Q81Q 1FC2C 2A06E 2AEFA 3A0HH 4OWFA 2N1TD 1GL2A 3HD7A 1SQBJ 3L71J 2HG5D 3HRNA 4NPFX 4YTPC 5KKZC 1NGMB 1IFDA 1NKZB 4N6JA 1YJ9P 3V2PA 3WUUA 2BASA 3KZIE 1LTAC 1LT1A 3L73D 2WTYA 1L0NK 3A0BH 3A7OA 1BCCD 3H1HE 3VMZA 3H25A 3SWFA 4I7ZB 3GMAA 1HVVA 1GK4A 2YKPA 2FYUJ 3V2RA 1H0TA 2WMMA 1N7SA 3CI9A 2OYIC 4U3FG 3VN0A 2WSEH 1YQ4C 1G2CB 3L72G 2MKVA 5CCHC 1K04A 4Z1MH 3GF7A 1T3UA 3P32A 1DEEG 3M9BA 5AVQB 1PFIA 1SVFA 4JYCA 3CL3D 3H1KD 1M1KQ 2OTLP 4UB8E 3WU2E 2YMYA 4WY4C 2KZIA 2QM8A 1WRGA 1SP4A 2WSEJ 1H89A 1SQQD 2FXOA 2ITAA 3MIWA 3ABVC 1P84H 1JY2P 1T2KC 3CXHI 4OVNF 5AW5B 1EZVD 1E79H 4EIJA 1KYOE 4H0LB 3L70J 1PP9D 4YXWH 3A5TA 3CCJP 1M1JC 2W6BA 1M8OB 2YO3A 3IR9A 3RL0B 3EQ2A 1YITP 1OFCX 3IAOA 4UB8H 5CCGA 1JY2N 1RF0C 2KB7P 1IZNB 2QJKB 3G6EP 4H44B 2Y9ZA 1DIPA 1VQ4P 1ZOYC 3QH9A 3T97A 3EFGA 3KDPB 1L0LG 4BWNA 3A3YB 2D2CC 2QSIA 1OMIA 1YYCA 1Q86Q 1NTZJ 2K88A 2V7QH 2BCCE 3L74G 4JYBA 1KILC 1MKMA 1URQD 1LTIC 4BRYB 1N2DC 1G1IA 3KXDA 1ZRTD 2IPPA 1X79B 4PD4H 1RH5B 1KILD 1URQC 1JY3N 1LNQA 2NZ2A 3L70G 2IYOA 2B87A 4KJMA 1NU1G 1X8YA 2D2CD 1EZVG 2PAJA 5AW7B 5K5GB 2IYPA 2RMZA 1LTSC 2IBZE 1CSBA 1PV3A 5AW1B 1VQ9P 1KQLA 2FXPA 4L73A 3CC2P 4DT0A 3TGUJ 2Q9IA 1LTJB 1KILB 2LXBA 1IFPA 2NRGA 2PFXA 1KD1Q 1L0LJ 1RE4A 1ZXGA 5AVWB 3TGUG 4PJ0H 1S9KE 3H1HD 1GU4A 2I8DA 1VF5B 2ZJSE 1YIJP 3L74J 1HWTC 1X0TA 2XV5A 3IFMA 1QX8A 1L4AC 1NU1E 3AE8C 1GL2D 3HD7D 1CW5A 3M91A 5KJ7D 1SQBE 1SLQA 2QE7H 4ZMDA 1SQPE 3G4SP 1IFNA 5AVTB 1GDTA 2E42A 4UB6H 1M1JB 5CJ4A 3WUTA 2YO2A 4H0LC 4WY4D 2FYNC 1IFJA 2D2CB 1NHLA 5CJ0A 1HUCA 2B9BA 3HUSB 3RL0C 2Q5UA 2JR8A 4HH2A 1JNMA 2PRRA 2WSFJ 2QJPC 4H44C 4Y28J 2XU6A 3B5NA 3C1LA 1KQSO 3CWBE 2J59M 1BSNA 2O3JA 3L71D 3CPWO 3KPEA 1R8EA 2OYHC 1EXIA 2J58A 2E76C 1Z56A 1NTME 2R5DA 1OVUA 2Y9YA 5B66H 2W6JH 1VQOP 3GG2A 3BRTB 3RK3D 5DJUB 1FZBA 2H89C 1PGQA 3B5NB 3D71A 2OYIB 5KAFH 5TJHA 1K9MQ 1VQ7P 3IF4A 1L0LE 1SQVK 3CCMP 1BDDA 1BDCA 2FYUG 2W27A 2JEEA 1FZCB 2FKWB 1KQFB 5KLVK 2WPVB 1PGOA 3AEBC 3F5HA 4LC1A 2QJYB 1S3JA 3GF3A 3WU2H 2KIKA 3CMAP 1FAVA 4LLHA 4HKZH 3BRVB 5B66E 1S72P 1FZCA 3L73E 1PZQA 4EDFA 2E74D 1Q90D 3HUSC 2I1KA 2JP3A 2GUVA 2Z4EA 1DEBA 3C9IA 1L0LD 5AW9B 1NTZE 3CD6P 1AVOA 1URQA 2FYUE 2W83C 4N3YB 2E74B 1J1EC 1LTJA 3H1IE 3FWLA 4KT0J 2LXCB 2OGUA 4JF7A 3B8EB 2Z5HA 3U1CA 1RF1B 1JUNA 1RE3C 1BCCJ 1FOSF 3NTNA 2KUBA 1GD2E 3LW5H 3P7KA 1LT9C 5AW3B 2C9NY 1LP1A 1JCDA 4C46A 1SQQG 2IBZG 2Y0DA 1SQBD 1FZCC 4MN4C 1A02F 4BRYA 5EFWB 4R4MA 1RF1A 4H13B 2M5AB 1JMMA 1WMKA 2Z5IA 1BSHA 3MGNA 1QVGO 3M9HA 5APSA 4M3LA 3L75J 5GTIE 3L75E 2FXMA 2K9YA 2NPSC 1N73A 1MFZA 1PP9E 1PP9J 1SFCD 1ZV8A 2Q1KA 2WZ7A 2XZRA 3CXHE 3L71E 5AW2B 1KYOI 5M1BA 1SQPG 3ZDMA 2WWWA 3BCCG 1SQXE 2ZT9B 2AEJA 3AE7C 1LTBC 1LTTC 4YXDC 1NWQA 1FZGA 1PIXA 3GW6A 1AA0A 2QJPB 1Q7YQ 1Y47A 1M57D 3V6IA 3AE4C 1S5LE 2KYVA 3L37A 2KNCB 3VP8A 1KB9I 4WBAA 3VMAA 3L74D 3D6ZA 1FE6A 1AJYA 4B86A 4K3AA 1OX3A 2KLUA 2OARA 3M06A 5APVA 1FOSE 2N9YB 3OAKA 1U7JA 1BCCE 3E1IA 4AUWA 1SS1A 1RHZB 2KLVA 3L35A 4EI2A 1G2CA 4IFFA 3V4QA 4EOTA 3I56P 3JC22 1N73B 4PD4I 2H88C 3M0AA 3AEFC 4OGQC 3SFDC 3MTUE 1UIIA 1DD4A 1SQPD 1NTZD 1IC2A 2FBWC 1NTKK 3CWBG 3HUSA 3AE3C 3L4FA 4PV1C 4ZKPA 1HF9A 5CBOA 2M5AA 5B5EH 3HE5A 3H1LE 2QM7A 1URQB 4D6TJ 2IDBA 4I2LC 1U57A 4KHXA 1DX7A 1SQXJ 1T3JA 2IX7C 1RF0A 2Q3IA 4D6TG 1QVFO 1VQKP 1SQXG 1KYOD 5KKZB 1NTZG 1OXZA 1YTZT 2W8ZA 3TDKA 1OWAA 1BGYD 2E5YA 1NYHA 2IFNA 2JKVA 2P1JA 1JY2O 1NTMK 1PPJD 2O1JA 2L5GB 1S9KD 3PHLA 3L73G 3RK3E 2BCCJ 4DJGA 1K73Q 3H1JD 5AW8B 1MUUA 1AFOA 1VF5D 2R5BA 3H1ID 2CK3H 2G8YA 2QIWA 3JCUE 2I1JA 3CXHD 2KSJA 1EZVI 1MFTA 1OZHA 1BE3E 1EC5A 1SFCB 3H32A 3MD0A 4N78E 4W80A 5CCGD 1SQXD 1SQQE 1NTKG 2O01J 1CI6B 3HE5B 4XE5B 3Q5RA 3P8CE 1KILE 1X9VA 3BVHA 4D6TD 4IFDK 2Y0CA 1N7SD 1JB0J 1LWUC 3AEEC 3F89A 3JSVC 2WSCH 2ZYDA 5E79E 1M7LA 2POHA 3A0BE 4PD4D 1OW8A 2AXTE 3B4SA 2OTKE 3T97B 1LGHB 2MJZA 3IN6A 1SQPJ 2WPQA 1N7SC 2IZ0A 3L73J 2OYIA 1L4AA 3AE5C 3CWBD 4IFMA 1W2EA 2A06G 1N86A 1G1JA 1NU1J 3MP7B 3WMM0 2R32A 3II6A 2B88A 4I1LA 4A7PA 1YJWP 2IFMA 2GM4A 2ZT9C 1FZAA 1GL2B 2Q6QA 3HD7B 4L76A 3PRJA 1VF5C 4PV1B 5AVSB 4ASVA 3RL0g 1VQNP 1LP1B 1HGVA 1W5CE 3H32B 3M0DC 3MZWB 1EXJA 1FU1A 3SWYA 1NVOA 2P2UA 1NOHA 1JTHA 4OGQB 1KC8Q 5CBNA 2M0BA 1AQ5A 1J2JB 1SQBG 4GOEA 2IBZD 3CCEP 2OYHA 3QWOC 4OH8B 2HPCA 1P84D 5KJ7A 1AV1A 1S4XA 2YIUC 1NKNA 4IL6H 2P10A 1RQUA 1S1CX 3G9RA 1NTMJ 1KB9H 2Q7CA 3Q1MA 3AECC 1LT9A 1KZUB 2XKMA 2YMKA 3P8CD 3BCCD 1BGYG 2RH0A 2KK7A 2ZXXA 3L72E 1HBWA 3BATA 4U3FE 2BEQD 3B5ND 1SQVD 1J1EB 3L75D 1YTZI 1KILA 1H88A 1R5SA 3RK3B 2IZ1A 1K05A 3H1JE 2GA1A 3CCLP 1HJ0A 1J1DC 1VQPP 1QLED 1S2EA 1LJ2A 3FXDA 4YPCA 1NU1K 1ZMEC 3Q2YA 2B87B 2YKQA 5AVRB 1IJDB 4HJGH 3P8MC 1FZFA 2QRXA 4TT3H 5BU8B 2E5TA 1FDIA 1RQVA 4DOJA 1RE4C 3OA7A 1CI6A 3LIEA 3L70D 3N7NA 3PTZA 2E75C 5AW4B 3KYQA 5E79H 3S9OA 4DZOA 5APXA 1EDJA 1ZLLA 2KI7B 5APYA 2QA4P 3E7KA 1SQQJ 3SFEC 3AE1C 2IBZI 2HR3A 1OW7A 1P84I 1HTLC 1VDFA 1ZP0C 3H1KJ 4H13C 2WPSA 4GODA 4Y99C 1RF1C 3VTPC 3CLQA 2QVAA 3JCUH 2OYHB 1UIXA 1AVYA 1HJBA 3K5BA 3CX5D 2QG4A 2SPZA 1PP9G 3AEAC 3H1LJ 3O6QB 4H13D 2JJLA 3CCRP 5KLVD 2FYUD 1KORA 2H43A 1IFMA 3M0DA 1FS0E 3I55P 1QEXA 3D6YA 2H8PD 4W7ZA 2M3BA 2E75D 4RKUJ 4XA4A 2HODA 3H1KG 2VRSA 3NFQA 3KZIH 1L4AB 1RY3A 3TNUB 1T6AA 1VQ5P 2WSCJ 1K8AQ 2AEMA 1SQVG 2HODB 2FYUK 4L75A 1L0LK 1SQVE 1SQVJ 1OW6A 1AQTA 5KLVG 3Q5SA 2OTJP 1BE3J 2QJYC 2FYZA 2W90A 5KLVJ 1NH4A 5AW6B 1NTKE 2R3SA 1ZN5A 4PJ0E 5AVZB 3RBZA 2KS1B 2JO1A 2O1KA 3ITKA 4O9BA 3RGUA 1OVVA 1VQLP 1E5WA 2M8RA 1TU3F 3TGUE 1GU5A 2GUSA 2YXRB 3BASA 3B5NC 1PL5A 2ZXEB 1H0TB 3A2AA 1ZW0A 1GMJA 3L36A 2ZVNB 5L8RJ 1JO5A 1JY3O 1USEA 1YHQP 5DJTB 3TF5A 2K9JA 3GHGA 1W2BO 3TK1A
chains in the Genus database with same CATH topology
4BXLA 1OVUA 5DJUB 2OTKE 5C39A 1BDDA 1BDCA 4JBZA 4CPGA 2B88A 1S3JA 2LR2A 2KIKA 3S1KA 4HKZH 1Q2NA 4ASVA 2RKLA 1LP1B 3MHVA 3MZWB 4HB1A 1NVOA 4WWIA 2KZJA 1OVRA 5CBNA 2M0BA 3PH0A 4GOEA 1FC2C 1EDIA 3QWOC 4NPFX 2LXCB 1LT1A 4NPEA 2KUBA 2WMMA 1LP1A 4MN4C 5EFWB 2R44A 2M5AB 1DEEG 3FXEA 2KZIA 3FXDA 4IOIH 1H0TA 2B87B 1EDLA 2Q1KA 4HJGH 3ZDMA 2QRXA 2P58A 4EYYQ 2K3RA 1Y47A 4ASWA 1EDJA 2KI7B 2B89A 4GOFA 4K3AA 2ZAEB 2HR3A 1U7JA 4NPDA 1SS1A 4GODA 1JM0A 2QVAA 2SPZA 2B87A 4KJMA 4ZNCA 5K5GB 5CBOA 2M5AA 2LXBA 4K35A 2UWJE 1ZXGA 2I8DA 2JWDA 1EDKA 1X0TA 4ZMDA 2KS1B 3RGUA 1OVVA 1H0TB 1ZW0A 1MFTA 1EC5A 1JMBA 1U7MA 5DJTB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4BXL A;  1OVU A;  5DJU B;  2OTK E;  5C39 A;  1BDD A;  1BDC A;  4JBZ A;  4CPG A;  2B88 A;  1S3J A;  2LR2 A;  2KIK A;  3S1K A;  4HKZ H;  1Q2N A;  4ASV A;  2RKL A;  1LP1 B;  3MHV A;  3MZW B;  4HB1 A;  1NVO A;  4WWI A;  2KZJ A;  1OVR A;  5CBN A;  2M0B A;  3PH0 A;  4GOE A;  1FC2 C;  1EDI A;  3QWO C;  4NPF X;  2LXC B;  1LT1 A;  4NPE A;  2KUB A;  2WMM A;  1LP1 A;  4MN4 C;  5EFW B;  2R44 A;  2M5A B;  1DEE G;  3FXE A;  2KZI A;  3FXD A;  4IOI H;  1H0T A;  2B87 B;  1EDL A;  2Q1K A;  4HJG H;  3ZDM A;  2QRX A;  2P58 A;  4EYY Q;  2K3R A;  1Y47 A;  4ASW A;  1EDJ A;  2KI7 B;  2B89 A;  4GOF A;  4K3A A;  2ZAE B;  2HR3 A;  1U7J A;  4NPD A;  1SS1 A;  4GOD A;  1JM0 A;  2QVA A;  2SPZ A;  2B87 A;  4KJM A;  4ZNC A;  5K5G B;  5CBO A;  2M5A A;  2LXB A;  4K35 A;  2UWJ E;  1ZXG A;  2I8D A;  2JWD A;  1EDK A;  1X0T A;  4ZMD A;  2KS1 B;  3RGU A;  1OVV A;  1H0T B;  1ZW0 A;  1MFT A;  1EC5 A;  1JMB A;  1U7M A;  5DJT B; 
#chains in the Genus database with same CATH topology
 4BXL A;  2BEZ F;  2K37 A;  1KQG B;  3CX5 I;  2ZFC A;  3RK3 C;  1N7S B;  2DW3 A;  1VPC A;  4D6T E;  5B5E E;  1GZL A;  2E76 D;  4TLF A;  3CC4 P;  2V4H A;  3TYY A;  5TIS H;  2FY8 A;  1VQ6 P;  1GW4 A;  4JQ0 D;  3MUD C;  2A45 I;  2C0X A;  4AQR D;  3VOP A;  5H2F H;  2LR2 A;  4GT1 A;  4Y99 B;  3S1K A;  1ZRT E;  1JEK A;  1LTG C;  3CWB J;  3E1R A;  3PLN A;  4H44 D;  5BVZ A;  1Q2N A;  2H7H A;  4IL6 E;  1L0N D;  2RKL A;  2WVR A;  1YI2 P;  2Y0E A;  1S5L X;  3MHV A;  4PD4 E;  4WY4 A;  1KFN A;  1T8Z A;  2ZT9 D;  2A45 H;  3RL0 D;  3O8Z A;  1P84 E;  2KZJ A;  2O01 H;  4UB6 E;  5H2F E;  5KLV E;  4H0L D;  3TNU A;  1NTK J;  1LWU A;  2JWA A;  3VYI A;  3NMD A;  1SQP K;  1GTW A;  4U3F D;  2YIU B;  1EDI A;  5KJ7 C;  1N8R Q;  1LTJ C;  3SSU A;  1GL2 C;  2KSE A;  2E76 B;  1L4A D;  1OIP A;  3HD7 C;  5CHX A;  1M1J A;  1WT6 A;  2K1A A;  2WT7 A;  2E75 B;  2J5U A;  1L0N E;  3H1J G;  3H1L D;  1S5L H;  1DH3 A;  1FJK A;  3TSI A;  4NPE A;  3H1J J;  3HTK B;  2KNC A;  3M9Q A;  4HYT B;  2V7Q J;  5AW0 B;  3CXH H;  3VMY A;  5CCG C;  3G71 P;  2PP6 A;  4JPZ B;  1NJI Q;  1EQ7 A;  2R44 A;  3D70 A;  2FYN B;  1DD3 A;  3H1H J;  4ZKU A;  2QEX P;  1J1D B;  5AVX B;  3AE2 C;  3FXE A;  3Q5P A;  3H1H G;  4I6M C;  5KTB A;  3TGU D;  3OW2 O;  1LWU B;  2YXQ B;  2KP8 A;  1KMI Z;  3HTK A;  5KLI B;  1N73 C;  4LGD E;  2QJK C;  1EZV E;  3OJA B;  3L75 G;  3AEG C;  4IOI H;  4AYC A;  3Q3D A;  3PJS K;  2FFD B;  1QGK B;  1EDL A;  1USD A;  1JCC A;  2N1T B;  2M3E A;  1BE3 D;  2RN0 A;  3U1A A;  4C7N A;  3V4W A;  2WT7 B;  3KQG A;  1ZR2 A;  2P58 A;  1NU1 D;  4IL6 X;  5KAF E;  1CZQ A;  2WPR A;  4EYY Q;  2K3R A;  2WIT A;  1NO4 A;  2AXT H;  4C7N B;  3CC7 P;  3H1K E;  4ASW A;  5APT A;  5GTI H;  4RO0 A;  2YNY A;  5APW A;  3MUD A;  5AVV B;  1MZ9 A;  4PV1 D;  2B89 A;  1Y9B A;  4GOF A;  1M56 D;  3L72 J;  3EFF K;  2ZAE B;  4I7Z C;  1SQX K;  3WUV A;  1T2K D;  3S4R A;  1KTM A;  1MV8 A;  1NTZ K;  1SQQ K;  2LKM A;  5AVU B;  3RK2 B;  3FGA D;  5CMZ A;  1N7L A;  1GK6 A;  3CX5 E;  4OGQ D;  3VP9 A;  1Q82 Q;  2A45 G;  4NPD A;  3V2Q A;  2CPS A;  2WSF H;  4N78 D;  1JM0 A;  3HE4 B;  3BCC E;  3BCC J;  3CCQ P;  1L2P A;  1VQM P;  1IK7 A;  1HH0 A;  3R2P A;  2FFD A;  1JY3 P;  3AED C;  2PGD A;  3B71 A;  1NTM D;  1JTH B;  3RBX A;  1NAY A;  2BCC D;  4GIF A;  3I5C A;  3O6Q A;  4ZNC A;  1YJN P;  2A06 D;  5CCH D;  2KS1 A;  3H6P A;  1BGY E;  1BGY J;  4GKG A;  5KAI H;  1FZE A;  3NXS A;  1KV4 A;  1IK9 A;  4K35 A;  2UWJ E;  2ZYA A;  4L74 A;  4GDO A;  2AXC A;  2XNX A;  4WVZ A;  1A02 J;  1PGP A;  3FWN A;  1IO4 A;  2KOG A;  2JWD A;  2E43 A;  2Q3E A;  1EDK A;  1Y8A A;  4WB4 A;  3CCV P;  5CCH A;  2XDJ A;  3V5B A;  5GTH E;  3LID A;  1NTK D;  1M90 Q;  4WY4 B;  2N1T C;  2ZVO B;  3FX0 A;  3GLM A;  3L72 D;  1SFC C;  1FDO A;  3CCS P;  2G3A A;  1X22 A;  3CME P;  3HE4 A;  2NPS D;  1GW3 A;  4R4L A;  3SWK A;  2HYN A;  1L0N J;  3H1I G;  2O01 N;  2BCC G;  1YQ3 C;  3L74 E;  3N4X A;  2YKO A;  1BCC G;  4QMA A;  3UIA A;  1KB9 D;  3H1L G;  1PGJ A;  1FDM A;  2XND H;  1PPJ G;  1PPJ E;  1VL2 A;  1KFM A;  1NAF A;  1YBK A;  2KXP B;  2NPS B;  2P67 A;  3AE9 C;  1XTC C;  1XTG B;  1JMB A;  1U7M A;  1IFI A;  1SQB K;  5TIS E;  3RK2 C;  3A0H E;  2JDI H;  3CCU P;  3GHG C;  3C8V A;  5APQ A;  1FJP A;  2HLO A;  4RJT A;  3GHG B;  1QL2 A;  3W68 A;  1D7M A;  1ZR4 A;  2N9B A;  1HGZ A;  2N1T A;  1KB9 E;  1L0N G;  3H1I J;  1SFC A;  3W67 A;  3AE6 C;  2OQQ A;  3CX5 H;  2ZYG A;  3R4Y A;  5C39 A;  2WSS H;  1KYO H;  1LT9 B;  1R5L A;  2CPB A;  4DCK A;  3U59 A;  5BU5 A;  2HPC B;  1KN7 A;  3EWK A;  4XFJ A;  1JOC A;  1RE3 A;  1BE3 G;  2OYO A;  2W6A A;  3LW5 J;  4JBZ A;  4CPG A;  3RK2 D;  1H8A A;  4W7Y A;  2FFD C;  3G3Z A;  2WQY C;  4C7R A;  1NTM G;  3V2N A;  2E74 C;  2K9J B;  3VMX A;  5GTH H;  2C9L Y;  4HB1 A;  3PP5 A;  4RES B;  4U3F J;  5KAI E;  1VQ8 P;  2NPS A;  5KLI C;  4WWI A;  1OVR A;  1QL1 A;  2HFE D;  3L70 E;  4U7J A;  5APU A;  5AVY B;  2P7J A;  2R3C A;  3KHU A;  2C0W A;  3USS A;  3L71 G;  3PH0 A;  1FBM A;  2L91 A;  1Q81 Q;  1FC2 C;  2A06 E;  2AEF A;  3A0H H;  4OWF A;  2N1T D;  1GL2 A;  3HD7 A;  1SQB J;  3L71 J;  2HG5 D;  3HRN A;  4NPF X;  4YTP C;  5KKZ C;  1NGM B;  1IFD A;  1NKZ B;  4N6J A;  1YJ9 P;  3V2P A;  3WUU A;  2BAS A;  3KZI E;  1LTA C;  1LT1 A;  3L73 D;  2WTY A;  1L0N K;  3A0B H;  3A7O A;  1BCC D;  3H1H E;  3VMZ A;  3H25 A;  3SWF A;  4I7Z B;  3GMA A;  1HVV A;  1GK4 A;  2YKP A;  2FYU J;  3V2R A;  1H0T A;  2WMM A;  1N7S A;  3CI9 A;  2OYI C;  4U3F G;  3VN0 A;  2WSE H;  1YQ4 C;  1G2C B;  3L72 G;  2MKV A;  5CCH C;  1K04 A;  4Z1M H;  3GF7 A;  1T3U A;  3P32 A;  1DEE G;  3M9B A;  5AVQ B;  1PFI A;  1SVF A;  4JYC A;  3CL3 D;  3H1K D;  1M1K Q;  2OTL P;  4UB8 E;  3WU2 E;  2YMY A;  4WY4 C;  2KZI A;  2QM8 A;  1WRG A;  1SP4 A;  2WSE J;  1H89 A;  1SQQ D;  2FXO A;  2ITA A;  3MIW A;  3ABV C;  1P84 H;  1JY2 P;  1T2K C;  3CXH I;  4OVN F;  5AW5 B;  1EZV D;  1E79 H;  4EIJ A;  1KYO E;  4H0L B;  3L70 J;  1PP9 D;  4YXW H;  3A5T A;  3CCJ P;  1M1J C;  2W6B A;  1M8O B;  2YO3 A;  3IR9 A;  3RL0 B;  3EQ2 A;  1YIT P;  1OFC X;  3IAO A;  4UB8 H;  5CCG A;  1JY2 N;  1RF0 C;  2KB7 P;  1IZN B;  2QJK B;  3G6E P;  4H44 B;  2Y9Z A;  1DIP A;  1VQ4 P;  1ZOY C;  3QH9 A;  3T97 A;  3EFG A;  3KDP B;  1L0L G;  4BWN A;  3A3Y B;  2D2C C;  2QSI A;  1OMI A;  1YYC A;  1Q86 Q;  1NTZ J;  2K88 A;  2V7Q H;  2BCC E;  3L74 G;  4JYB A;  1KIL C;  1MKM A;  1URQ D;  1LTI C;  4BRY B;  1N2D C;  1G1I A;  3KXD A;  1ZRT D;  2IPP A;  1X79 B;  4PD4 H;  1RH5 B;  1KIL D;  1URQ C;  1JY3 N;  1LNQ A;  2NZ2 A;  3L70 G;  2IYO A;  2B87 A;  4KJM A;  1NU1 G;  1X8Y A;  2D2C D;  1EZV G;  2PAJ A;  5AW7 B;  5K5G B;  2IYP A;  2RMZ A;  1LTS C;  2IBZ E;  1CSB A;  1PV3 A;  5AW1 B;  1VQ9 P;  1KQL A;  2FXP A;  4L73 A;  3CC2 P;  4DT0 A;  3TGU J;  2Q9I A;  1LTJ B;  1KIL B;  2LXB A;  1IFP A;  2NRG A;  2PFX A;  1KD1 Q;  1L0L J;  1RE4 A;  1ZXG A;  5AVW B;  3TGU G;  4PJ0 H;  1S9K E;  3H1H D;  1GU4 A;  2I8D A;  1VF5 B;  2ZJS E;  1YIJ P;  3L74 J;  1HWT C;  1X0T A;  2XV5 A;  3IFM A;  1QX8 A;  1L4A C;  1NU1 E;  3AE8 C;  1GL2 D;  3HD7 D;  1CW5 A;  3M91 A;  5KJ7 D;  1SQB E;  1SLQ A;  2QE7 H;  4ZMD A;  1SQP E;  3G4S P;  1IFN A;  5AVT B;  1GDT A;  2E42 A;  4UB6 H;  1M1J B;  5CJ4 A;  3WUT A;  2YO2 A;  4H0L C;  4WY4 D;  2FYN C;  1IFJ A;  2D2C B;  1NHL A;  5CJ0 A;  1HUC A;  2B9B A;  3HUS B;  3RL0 C;  2Q5U A;  2JR8 A;  4HH2 A;  1JNM A;  2PRR A;  2WSF J;  2QJP C;  4H44 C;  4Y28 J;  2XU6 A;  3B5N A;  3C1L A;  1KQS O;  3CWB E;  2J59 M;  1BSN A;  2O3J A;  3L71 D;  3CPW O;  3KPE A;  1R8E A;  2OYH C;  1EXI A;  2J58 A;  2E76 C;  1Z56 A;  1NTM E;  2R5D A;  1OVU A;  2Y9Y A;  5B66 H;  2W6J H;  1VQO P;  3GG2 A;  3BRT B;  3RK3 D;  5DJU B;  1FZB A;  2H89 C;  1PGQ A;  3B5N B;  3D71 A;  2OYI B;  5KAF H;  5TJH A;  1K9M Q;  1VQ7 P;  3IF4 A;  1L0L E;  1SQV K;  3CCM P;  1BDD A;  1BDC A;  2FYU G;  2W27 A;  2JEE A;  1FZC B;  2FKW B;  1KQF B;  5KLV K;  2WPV B;  1PGO A;  3AEB C;  3F5H A;  4LC1 A;  2QJY B;  1S3J A;  3GF3 A;  3WU2 H;  2KIK A;  3CMA P;  1FAV A;  4LLH A;  4HKZ H;  3BRV B;  5B66 E;  1S72 P;  1FZC A;  3L73 E;  1PZQ A;  4EDF A;  2E74 D;  1Q90 D;  3HUS C;  2I1K A;  2JP3 A;  2GUV A;  2Z4E A;  1DEB A;  3C9I A;  1L0L D;  5AW9 B;  1NTZ E;  3CD6 P;  1AVO A;  1URQ A;  2FYU E;  2W83 C;  4N3Y B;  2E74 B;  1J1E C;  1LTJ A;  3H1I E;  3FWL A;  4KT0 J;  2LXC B;  2OGU A;  4JF7 A;  3B8E B;  2Z5H A;  3U1C A;  1RF1 B;  1JUN A;  1RE3 C;  1BCC J;  1FOS F;  3NTN A;  2KUB A;  1GD2 E;  3LW5 H;  3P7K A;  1LT9 C;  5AW3 B;  2C9N Y;  1LP1 A;  1JCD A;  4C46 A;  1SQQ G;  2IBZ G;  2Y0D A;  1SQB D;  1FZC C;  4MN4 C;  1A02 F;  4BRY A;  5EFW B;  4R4M A;  1RF1 A;  4H13 B;  2M5A B;  1JMM A;  1WMK A;  2Z5I A;  1BSH A;  3MGN A;  1QVG O;  3M9H A;  5APS A;  4M3L A;  3L75 J;  5GTI E;  3L75 E;  2FXM A;  2K9Y A;  2NPS C;  1N73 A;  1MFZ A;  1PP9 E;  1PP9 J;  1SFC D;  1ZV8 A;  2Q1K A;  2WZ7 A;  2XZR A;  3CXH E;  3L71 E;  5AW2 B;  1KYO I;  5M1B A;  1SQP G;  3ZDM A;  2WWW A;  3BCC G;  1SQX E;  2ZT9 B;  2AEJ A;  3AE7 C;  1LTB C;  1LTT C;  4YXD C;  1NWQ A;  1FZG A;  1PIX A;  3GW6 A;  1AA0 A;  2QJP B;  1Q7Y Q;  1Y47 A;  1M57 D;  3V6I A;  3AE4 C;  1S5L E;  2KYV A;  3L37 A;  2KNC B;  3VP8 A;  1KB9 I;  4WBA A;  3VMA A;  3L74 D;  3D6Z A;  1FE6 A;  1AJY A;  4B86 A;  4K3A A;  1OX3 A;  2KLU A;  2OAR A;  3M06 A;  5APV A;  1FOS E;  2N9Y B;  3OAK A;  1U7J A;  1BCC E;  3E1I A;  4AUW A;  1SS1 A;  1RHZ B;  2KLV A;  3L35 A;  4EI2 A;  1G2C A;  4IFF A;  3V4Q A;  4EOT A;  3I56 P;  3JC2 2;  1N73 B;  4PD4 I;  2H88 C;  3M0A A;  3AEF C;  4OGQ C;  3SFD C;  3MTU E;  1UII A;  1DD4 A;  1SQP D;  1NTZ D;  1IC2 A;  2FBW C;  1NTK K;  3CWB G;  3HUS A;  3AE3 C;  3L4F A;  4PV1 C;  4ZKP A;  1HF9 A;  5CBO A;  2M5A A;  5B5E H;  3HE5 A;  3H1L E;  2QM7 A;  1URQ B;  4D6T J;  2IDB A;  4I2L C;  1U57 A;  4KHX A;  1DX7 A;  1SQX J;  1T3J A;  2IX7 C;  1RF0 A;  2Q3I A;  4D6T G;  1QVF O;  1VQK P;  1SQX G;  1KYO D;  5KKZ B;  1NTZ G;  1OXZ A;  1YTZ T;  2W8Z A;  3TDK A;  1OWA A;  1BGY D;  2E5Y A;  1NYH A;  2IFN A;  2JKV A;  2P1J A;  1JY2 O;  1NTM K;  1PPJ D;  2O1J A;  2L5G B;  1S9K D;  3PHL A;  3L73 G;  3RK3 E;  2BCC J;  4DJG A;  1K73 Q;  3H1J D;  5AW8 B;  1MUU A;  1AFO A;  1VF5 D;  2R5B A;  3H1I D;  2CK3 H;  2G8Y A;  2QIW A;  3JCU E;  2I1J A;  3CXH D;  2KSJ A;  1EZV I;  1MFT A;  1OZH A;  1BE3 E;  1EC5 A;  1SFC B;  3H32 A;  3MD0 A;  4N78 E;  4W80 A;  5CCG D;  1SQX D;  1SQQ E;  1NTK G;  2O01 J;  1CI6 B;  3HE5 B;  4XE5 B;  3Q5R A;  3P8C E;  1KIL E;  1X9V A;  3BVH A;  4D6T D;  4IFD K;  2Y0C A;  1N7S D;  1JB0 J;  1LWU C;  3AEE C;  3F89 A;  3JSV C;  2WSC H;  2ZYD A;  5E79 E;  1M7L A;  2POH A;  3A0B E;  4PD4 D;  1OW8 A;  2AXT E;  3B4S A;  2OTK E;  3T97 B;  1LGH B;  2MJZ A;  3IN6 A;  1SQP J;  2WPQ A;  1N7S C;  2IZ0 A;  3L73 J;  2OYI A;  1L4A A;  3AE5 C;  3CWB D;  4IFM A;  1W2E A;  2A06 G;  1N86 A;  1G1J A;  1NU1 J;  3MP7 B;  3WMM 0;  2R32 A;  3II6 A;  2B88 A;  4I1L A;  4A7P A;  1YJW P;  2IFM A;  2GM4 A;  2ZT9 C;  1FZA A;  1GL2 B;  2Q6Q A;  3HD7 B;  4L76 A;  3PRJ A;  1VF5 C;  4PV1 B;  5AVS B;  4ASV A;  3RL0 g;  1VQN P;  1LP1 B;  1HGV A;  1W5C E;  3H32 B;  3M0D C;  3MZW B;  1EXJ A;  1FU1 A;  3SWY A;  1NVO A;  2P2U A;  1NOH A;  1JTH A;  4OGQ B;  1KC8 Q;  5CBN A;  2M0B A;  1AQ5 A;  1J2J B;  1SQB G;  4GOE A;  2IBZ D;  3CCE P;  2OYH A;  3QWO C;  4OH8 B;  2HPC A;  1P84 D;  5KJ7 A;  1AV1 A;  1S4X A;  2YIU C;  1NKN A;  4IL6 H;  2P10 A;  1RQU A;  1S1C X;  3G9R A;  1NTM J;  1KB9 H;  2Q7C A;  3Q1M A;  3AEC C;  1LT9 A;  1KZU B;  2XKM A;  2YMK A;  3P8C D;  3BCC D;  1BGY G;  2RH0 A;  2KK7 A;  2ZXX A;  3L72 E;  1HBW A;  3BAT A;  4U3F E;  2BEQ D;  3B5N D;  1SQV D;  1J1E B;  3L75 D;  1YTZ I;  1KIL A;  1H88 A;  1R5S A;  3RK3 B;  2IZ1 A;  1K05 A;  3H1J E;  2GA1 A;  3CCL P;  1HJ0 A;  1J1D C;  1VQP P;  1QLE D;  1S2E A;  1LJ2 A;  3FXD A;  4YPC A;  1NU1 K;  1ZME C;  3Q2Y A;  2B87 B;  2YKQ A;  5AVR B;  1IJD B;  4HJG H;  3P8M C;  1FZF A;  2QRX A;  4TT3 H;  5BU8 B;  2E5T A;  1FDI A;  1RQV A;  4DOJ A;  1RE4 C;  3OA7 A;  1CI6 A;  3LIE A;  3L70 D;  3N7N A;  3PTZ A;  2E75 C;  5AW4 B;  3KYQ A;  5E79 H;  3S9O A;  4DZO A;  5APX A;  1EDJ A;  1ZLL A;  2KI7 B;  5APY A;  2QA4 P;  3E7K A;  1SQQ J;  3SFE C;  3AE1 C;  2IBZ I;  2HR3 A;  1OW7 A;  1P84 I;  1HTL C;  1VDF A;  1ZP0 C;  3H1K J;  4H13 C;  2WPS A;  4GOD A;  4Y99 C;  1RF1 C;  3VTP C;  3CLQ A;  2QVA A;  3JCU H;  2OYH B;  1UIX A;  1AVY A;  1HJB A;  3K5B A;  3CX5 D;  2QG4 A;  2SPZ A;  1PP9 G;  3AEA C;  3H1L J;  3O6Q B;  4H13 D;  2JJL A;  3CCR P;  5KLV D;  2FYU D;  1KOR A;  2H43 A;  1IFM A;  3M0D A;  1FS0 E;  3I55 P;  1QEX A;  3D6Y A;  2H8P D;  4W7Z A;  2M3B A;  2E75 D;  4RKU J;  4XA4 A;  2HOD A;  3H1K G;  2VRS A;  3NFQ A;  3KZI H;  1L4A B;  1RY3 A;  3TNU B;  1T6A A;  1VQ5 P;  2WSC J;  1K8A Q;  2AEM A;  1SQV G;  2HOD B;  2FYU K;  4L75 A;  1L0L K;  1SQV E;  1SQV J;  1OW6 A;  1AQT A;  5KLV G;  3Q5S A;  2OTJ P;  1BE3 J;  2QJY C;  2FYZ A;  2W90 A;  5KLV J;  1NH4 A;  5AW6 B;  1NTK E;  2R3S A;  1ZN5 A;  4PJ0 E;  5AVZ B;  3RBZ A;  2KS1 B;  2JO1 A;  2O1K A;  3ITK A;  4O9B A;  3RGU A;  1OVV A;  1VQL P;  1E5W A;  2M8R A;  1TU3 F;  3TGU E;  1GU5 A;  2GUS A;  2YXR B;  3BAS A;  3B5N C;  1PL5 A;  2ZXE B;  1H0T B;  3A2A A;  1ZW0 A;  1GMJ A;  3L36 A;  2ZVN B;  5L8R J;  1JO5 A;  1JY3 O;  1USE A;  1YHQ P;  5DJT B;  3TF5 A;  2K9J A;  3GHG A;  1W2B O;  3TK1 A; 
#chains in the Genus database with same CATH homology
 4BXL A;  1OVU A;  5DJU B;  2OTK E;  5C39 A;  1BDD A;  1BDC A;  4JBZ A;  4CPG A;  2B88 A;  1S3J A;  2LR2 A;  2KIK A;  3S1K A;  4HKZ H;  1Q2N A;  4ASV A;  2RKL A;  1LP1 B;  3MHV A;  3MZW B;  4HB1 A;  1NVO A;  4WWI A;  2KZJ A;  1OVR A;  5CBN A;  2M0B A;  3PH0 A;  4GOE A;  1FC2 C;  1EDI A;  3QWO C;  4NPF X;  2LXC B;  1LT1 A;  4NPE A;  2KUB A;  2WMM A;  1LP1 A;  4MN4 C;  5EFW B;  2R44 A;  2M5A B;  1DEE G;  3FXE A;  2KZI A;  3FXD A;  4IOI H;  1H0T A;  2B87 B;  1EDL A;  2Q1K A;  4HJG H;  3ZDM A;  2QRX A;  2P58 A;  4EYY Q;  2K3R A;  1Y47 A;  4ASW A;  1EDJ A;  2KI7 B;  2B89 A;  4GOF A;  4K3A A;  2ZAE B;  2HR3 A;  1U7J A;  4NPD A;  1SS1 A;  4GOD A;  1JM0 A;  2QVA A;  2SPZ A;  2B87 A;  4KJM A;  4ZNC A;  5K5G B;  5CBO A;  2M5A A;  2LXB A;  4K35 A;  2UWJ E;  1ZXG A;  2I8D A;  2JWD A;  1EDK A;  1X0T A;  4ZMD A;  2KS1 B;  3RGU A;  1OVV A;  1H0T B;  1ZW0 A;  1MFT A;  1EC5 A;  1JMB A;  1U7M A;  5DJT B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...