1M7LA

Solution structure of the coiled-coil trimerization domain from lung surfactant protein d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
40
structure length
40
Chain Sequence
GLPDVASLRQQVEALQGQVQHLQAAFSQYKKVELFPNGGI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Pulmonary surfactant-associated protein D
publication title Solution structure of the coiled-coil trimerization domain from lung surfactant protein D
pubmed doi rcsb
source organism Homo sapiens
molecule tags Sugar binding protein
total genus 12
structure length 40
sequence length 40
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2002-07-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.360 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1m7lA00
1M7LA
chains in the Genus database with same CATH superfamily
1VQOP 3R2PA 2R5DA 5APXA 1IFPA 1SQQJ 3IR9A 1VQPP 1ZR4A 3L73E 1MZ9A 3H1KJ 4LGDE 3RBXA 2WPSA 1JO5A 2Q3EA 2KUBA 3BCCJ 4U3FG 2C0XA 5APSA 3FWNA 1FJKA 3CWBG 4H0LC 3P32A 1G1JA 4ASVA 2W90A 4JQ0D 1KYOH 3EWKA 1IO4A 2D2CC 3A2AA 3HE4A 1AQTA 2B87B 5BU5A 1YJNP 1URQC 4PD4E 1DEEG 3AE7C 3VOPA 4L76A 4UB6E 1LTTC 1NTKK 3VMXA 1FOSE 1PPJE 1M1JA 1NKNA 2N9BA 1HBWA 1E79H 1NTZG 5AW0B 2YIUB 4B86A 3L71E 3RK3E 1GL2A 2W6JH 4ASWA 1NAYA 1JTHA 1VQ8P 2E74C 3TNUA 2WPVB 3I55P 3WUUA 1IJDB 5KAIE 3H1LE 1MFZA 2YNYA 3GHGC 5KJ7C 2ZYAA 1SQPG 4H44C 1PGOA 5BU8B 3HE5A 1IFDA 4JF7A 3H1JG 2E75B 1GW4A 1VQ7P 3A0BE 2QJPB 1NVOA 1VQ6P 2FYNB 3Q3DA 1OWAA 1PIXA 2Z5HA 2PRRA 2WQYC 5CBOA 1Y47A 1FZEA 1RE4A 3VMAA 1FE6A 2P7JA 2BASA 3CXHI 4RJTA 1JNMA 1K04A 4OH8B 1VL2A 1LWUB 5CCHA 2QSIA 1ZXGA 5APUA 2FYUD 1NTME 1QLED 1L0LK 3Q2YA 2HODA 4GT1A 2O1KA 1J1EB 2M3EA 1BGYE 1LNQA 4GKGA 2R44A 1SQQG 5E79E 1DH3A 3CMAP 1N7SD 3H1KG 3V4QA 5CHXA 3L72J 2OYIB 5CCGD 3BCCG 3F5HA 3AE4C 5AVQB 2P10A 1KILD 1OW6A 3H32B 5KLVK 2H8PD 1GW3A 3AEBC 1CI6A 3MTUE 1NH4A 3C1LA 1H0TA 2JJLA 1SQXK 2KXPB 2FYUJ 4CPGA 2M8RA 2GUVA 3WUTA 1FZAA 4GIFA 2PFXA 4IFFA 2QJKC 1GU5A 4PV1D 1IFMA 5GTHH 1NOHA 2Q3IA 2FY8A 1M1JC 1J1DB 2QA4P 5AVUB 3SWYA 1JCCA 1S3JA 1NHLA 1SQXJ 3MHVA 1GL2C 2Q7CA 3IAOA 1SLQA 4H0LD 1N73A 2BCCE 1EXIA 1G2CB 3CMEP 2L91A 2D2CD 1YQ3C 3TGUD 4GODA 1SS1A 1URQD 3JCUE 1PV3A 2YKQA 1BDCA 3CX5D 1OW7A 1AA0A 3L75J 2N1TA 4YXWH 1YYCA 3CCQP 1H89A 4R4MA 4HYTB 2O3JA 3CCMP 2GM4A 4TT3H 2WVRA 1L0ND 2E74D 2WSEJ 3A0HE 3Q1MA 2BEQD 4HKZH 1RE4C 1VQNP 2M5AA 1NTKE 4D6TD 5AW4B 5KJ7D 3TGUJ 3L74J 3EFGA 5AVYB 3RK2B 1N7SB 4H44D 2P1JA 1P84E 5AVXB 4IOIH 5C39A 5CCHC 2OYHA 3M06A 1FJPA 2E76C 4GOFA 1KILB 4DCKA 1YQ4C 1FZCB 2YKPA 3A5TA 1Q2NA 1NU1D 3M91A 1QVFO 5B66H 1U7JA 1KB9E 1JY2N 1L0NJ 2A45I 2HLOA 1PFIA 2G3AA 2E5YA 2POHA 2OTKE 4D6TJ 1X9VA 1KC8Q 2R3CA 2I1JA 4GOEA 2FYUG 1BCCE 2NZ2A 1EDKA 2LKMA 1EZVE 1JOCA 3AEEC 3Q5RA 1AQ5A 4IL6H 2WSSH 3L70E 2YMYA 4H0LB 1PP9D 3CCUP 2V7QJ 2D2CB 1DD4A 2AEFA 2HPCB 4XFJA 4JBZA 1CW5A 1URQB 1NTZK 1Z56A 1ZLLA 3P8CE 3CC4P 3CXHH 3IN6A 3WUVA 1JCDA 2VRSA 1KYOE 3GF7A 1TU3F 1Q82Q 3TK1A 1FZBA 1LP1B 3CWBJ 3USSA 3VP8A 1L0LE 3P7KA 2K9JB 2QE7H 2J58A 1N73C 3N7NA 1OX3A 1S9KE 1FC2C 1M7LA 2OTLP 3IFMA 1SQPK 1HWTC 1Q90D 1PP9J 2ZJSE 2HYNA 3TSIA 1HGZA 1FDOA 1GDTA 1UIIA 1LTJA 5KLVE 3GHGB 3H1IE 2N1TC 4H44B 1R8EA 3NXSA 1SQXE 1M1KQ 3TF5A 1EXJA 2QJYC 1GL2D 1M90Q 4NPEA 3AE9C 3WU2H 2QM8A 3TGUG 2H7HA 2H88C 1RQVA 2QG4A 3AE6C 1GU4A 4C46A 1NAFA 2OYHC 3L35A 2FYZA 3CL3D 4Y99B 1L2PA 2N9YB 2KNCA 2UWJE 3T97B 1DIPA 3PTZA 1VPCA 1WMKA 1L0NG 1IK9A 1SQQK 3A3YB 1JMBA 3I56P 2O01H 4I7ZC 1RF1A 1CZQA 2Y0DA 4D6TG 4N78D 2XNXA 2NPSA 5CCHD 1FBMA 4L74A 1N8RQ 1BE3E 2AXCA 2E76D 3SFDC 4NPDA 1OVRA 1OVUA 4PJ0H 2RN0A 2BCCD 1NU1G 1K05A 4U7JA 3L36A 1JY2P 2PAJA 3Q5PA 2LXBA 3W67A 1T8ZA 1JM0A 3HE4B 4YPCA 3VN0A 3GMAA 1M1JB 2B9BA 2ZT9D 5BVZA 2ZVOB 3RL0g 5GTHE 2Q9IA 2MKVA 3AECC 1YITP 1FAVA 1GL2B 1PP9G 2AXTH 1JTHB 2RH0A 2IX7C 3TNUB 1JY2O 1MV8A 3LW5J 3B8EB 3SWFA 1LTJC 4U3FE 1FU1A 3FXEA 3F89A 3CC2P 2L5GB 4OGQB 1D7MA 3HE5B 5EFWB 1S5LH 4N6JA 4Y28J 1YIJP 2ZFCA 2A06D 1KQLA 2KK7A 5L8RJ 3W68A 1EDJA 1NTZE 1YTZI 1AVOA 3CCSP 2N1TD 2O01J 3M9QA 2OQQA 1HUCA 1MKMA 2E76B 2W6BA 1VQ5P 4RO0A 4I1LA 5APWA 1LTSC 3NMDA 1ZN5A 1RF1C 2HODB 2WSEH 2B88A 1SQPE 1HJ0A 5KTBA 1FDIA 1SQBD 3RK3C 2NPSC 2WMMA 3H1JE 2SPZA 3FXDA 2IPPA 3VP9A 2IZ0A 3O8ZA 2FYUK 2Y0EA 5AW1B 3CX5H 1H8AA 2WSCJ 2JKVA 5KLIB 1GZLA 3JSVC 2ZT9B 1GK4A 1CI6B 2B89A 3PJSK 1S9KD 4LC1A 3S9OA 1H0TB 3Q5SA 3SWKA 3P8MC 4L73A 4OVNF 3U59A 5CJ4A 2FFDB 3VTPC 2YMKA 1LGHB 5KLVD 1SQBJ 5AVWB 2JR8A 3M9BA 4IL6E 3AE1C 3S1KA 5AVVB 2BCCG 1SQQE 2CPBA 3CXHE 3H1KE 3HTKA 1ZRTE 4H13C 1N73B 1AVYA 3RL0C 3BCCE 3L4FA 5AW7B 1RF0A 2WZ7A 1S1CX 1N2DC 2V7QH 3H1HD 1L4AA 1R5SA 3BRVB 4KJMA 1KD1Q 5AW5B 1BDDA 5H2FH 2I8DA 2W8ZA 3D71A 3KZIE 2N1TB 3HD7A 4IL6X 3V2NA 4KHXA 3CCEP 2QJYB 1KB9I 3R4YA 2E43A 2G8YA 2ZVNB 1BSHA 1KN7A 1W2EA 3N4XA 3G6EP 3H1HJ 1G2CA 1Y8AA 3B5NA 3WU2E 1SQVD 2JO1A 1MUUA 2IBZD 2Z5IA 2OYHB 4IFMA 1OXZA 3UIAA 3CLQA 1L0NK 3L73D 1GTWA 2A06G 3PLNA 2RKLA 2YXRB 1PZQA 1Q81Q 4W7ZA 3HRNA 2WTYA 2P2UA 2C9NY 1RE3A 2KSEA 1XTGB 1FDMA 3VMYA 2CPSA 1KYOI 2ZXXA 4PD4D 1SQVJ 3G9RA 1NU1K 2KI7B 1LTIC 3V5BA 1PPJD 3FX0A 4PV1B 4WY4A 2QIWA 1GD2E 2M0BA 1SQBG 1FZCA 3ZDMA 2ZAEB 3L71D 2WPQA 3RK3D 4PJ0E 2NPSD 3KQGA 2FXMA 3EQ2A 1W2BO 4KT0J 3BRTB 3QH9A 1LTAC 2A45G 3AE8C 1NU1J 1ZV8A 3H1LD 1W5CE 1ZMEC 1YJWP 3L72E 3SFEC 4YXDC 3CCLP 3PP5A 2E5TA 1RF0C 1FZFA 1LTBC 1L4AC 2J5UA 4AQRD 2M3BA 1M57D 5KLVG 2FYUE 3B4SA 4WBAA 3O6QA 3C8VA 1LTJB 4EOTA 1DX7A 3L37A 2AXTE 1OW8A 2KS1B 3HD7C 4XA4A 2E74B 1LT9A 1YTZT 5KAFH 2PGDA 3MZWB 2V4HA 1K73Q 2CK3H 1GMJA 2IFNA 2GUSA 4H13D 2GA1A 2XV5A 2KZJA 1KQFB 1NTMD 3RL0D 4DOJA 1KILE 1NGMB 3H1HG 2E42A 3RGUA 1SVFA 1QEXA 1LT1A 1S5LE 3LW5H 5CMZA 1USDA 3TDKA 3VYIA 3B5NC 1BGYD 2J59M 3AE2C 1VQKP 2R5BA 3D6YA 2FBWC 5M1BA 1Q86Q 1RY3A 2IBZI 3OAKA 2Q5UA 1SFCA 2LR2A 4OWFA 2KNCB 1KZUB 1AFOA 1X8YA 3L75E 4C7NA 1T2KC 2KSJA 2AEJA 3QWOC 1RF1B 1RE3C 1X22A 1NTMJ 2C9LY 1DD3A 4N3YB 3E1IA 3RK3B 5AW3B 1SQVG 4YTPC 2NPSB 2IBZG 1BGYJ 1OFCX 3CCRP 2P67A 3M9HA 4PD4I 5CBNA 3V6IA 3RK2C 2WPRA 2KIKA 3L73G 3TGUE 3L74E 3V2RA 1EQ7A 4WY4C 1QVGO 4QMAA 2C0WA 2WT7A 3CX5E 5KKZC 1FZCC 3FWLA 2XU6A 5AVRB 1JY3N 1KV4A 1RH5B 2JDIH 4BRYA 2W83C 3GW6A 4RESB 1RQUA 1L0NE 2WSCH 2P58A 1PPJG 2K3RA 4AUWA 5AVTB 2WSFJ 3HUSA 2Y0CA 4D6TE 1EC5A 2QJKB 3G4SP 4L75A 1T3UA 2KOGA 5APQA 2YO3A 3U1AA 3L71G 4W80A 4H13B 3CC7P 1WT6A 1K9MQ 3RL0B 3A7OA 3GLMA 3GG2A 1NKZB 2BCCJ 2O1JA 1NU1E 3ABVC 2KB7P 3V2QA 4DZOA 3H1LG 4AYCA 2R3SA 1LT9C 1NTKD 2A45H 1U57A 4MN4C 1P84D 3ITKA 5H2FE 2QM7A 1G1IA 1NO4A 5B5EH 3KPEA 5TISH 3CWBE 2B87A 3C9IA 1S72P 1L4AD 2O01N 1IC2A 2OTJP 1T3JA 1QL2A 3KXDA 3MP7B 3WMM0 5AVSB 1KB9D 4JPZB 1HF9A 3II6A 5AVZB 1SFCC 3HD7D 4ZMDA 1PP9E 4Z1MH 1E5WA 2JWAA 1VQMP 1NTKJ 2QRXA 3KYQA 3M0DA 1LTGC 2W27A 3CCVP 2HFED 1NTMG 1FS0E 1BCCD 1KQGB 1UIXA 1EZVD 3OJAB 1SP4A 4WB4A 1PGJA 1HJBA 1BGYG 2K1AA 3V2PA 3B5ND 1AJYA 2XZRA 1VQLP 3L70D 2ZYDA 4K3AA 3BATA 4I2LC 4UB8H 3L72D 3PHLA 5GTIH 1OZHA 3CCJP 3BASA 1CSBA 3V4WA 3P8CD 4NPFX 4Y99C 1KYOD 1NYHA 2OGUA 3AEFC 2NRGA 5AW6B 1SQBK 5B66E 1L0LD 3KHUA 1T2KD 1Q7YQ 4WWIA 2RMZA 1AV1A 4EDFA 3LIEA 2W6AA 3E1RA 1BCCJ 3B71A 2ITAA 1S4XA 1MFTA 1LWUA 4EIJA 1VDFA 3L70J 1YI2P 3RK2D 3HUSC 1XTCC 1HH0A 1NWQA 4DJGA 3H1ID 4WY4D 4I6MC 3AEGC 1M56D 5APYA 2K88A 1JY3P 1VF5C 3HTKB 1SQXD 1L0LJ 1HTLC 2OYIA 3D6ZA 1L4AB 1T6AA 2Q6QA 3M0AA 1QL1A 2Z4EA 3H32A 3G3ZA 2FFDA 3U1CA 1ZR2A 4PD4H 1X0TA 1ZW0A 3HD7B 4BWNA 4N78E 5AW8B 1R5LA 1P84I 4RKUJ 2PP6A 3L75D 4UB6H 3AE3C 3AE5C 2XNDH 5APVA 5KLVJ 3H1IJ 4ZKUA 1OVVA 2KLUA 1U7MA 5TJHA 4IFDK 1FZGA 1ZOYC 3NTNA 3MUDA 1JY3O 1Y9BA 4TLFA 5KAFE 3B5NB 2YIUC 1RHZB 1NTKG 2HR3A 1ZP0C 3L74D 1HVVA 5KAIH 3M0DC 2M5AB 2Q1KA 1JUNA 1KFNA 3G71P 4OGQC 1YBKA 1BE3D 5AW9B 2JEEA 1OMIA 4GDOA 2ZXEB 1EZVI 3H25A 1SQVK 3VMZA 3A0BH 2OARA 4ZNCA 2XKMA 2IYOA 2Y9YA 2E75C 2DW3A 2QJPC 2KYVA 1SFCD 2FYNC 4HH2A 3NFQA 4LLHA 3MGNA 4I7ZB 4JYCA 3RBZA 2H43A 4HB1A 4EI2A 3OW2O 1M8OB 4WY4B 1BCCG 2WITA 1EZVG 1BE3J 1IK7A 5KKZB 2FKWB 1N7SA 1NJIQ 3L70G 1LWUC 1N7LA 1GK6A 5CCGA 3D70A 3L73J 2JP3A 2A06E 3AEAC 3BVHA 1VQ4P 1KILA 2BEZF 2QVAA 3L72G 2I1KA 5E79H 4HJGH 2KP8A 4U3FD 1K8AQ 3E7KA 1J1EC 2KLVA 2QEXP 1JEKA 2Y9ZA 3CWBD 1L0LG 2MJZA 5KLIC 1KTMA 4DT0A 3FGAD 5CJ0A 3EFFK 2ZT9C 2AEMA 1J2JB 2OYIC 1KMIZ 2XDJA 2K9YA 4R4LA 3CI9A 1QX8A 4JYBA 2FFDC 1VQ9P 4EYYQ 3O6QB 2JWDA 2H89C 2ZYGA 1S2EA 1JMMA 1NTZD 1YJ9P 2LXCB 1A02J 2YO2A 5DJTB 1LT9B 1SQBE 3H1IG 2WSFH 2YKOA 3AEDC 4U3FJ 3L71J 4XE5B 1SQXG 5K5GB 1VF5D 3MUDC 1LJ2A 3H6PA 3MD0A 1IFNA 2HPCA 1J1DC 1N86A 1URQA 1EDIA 3H1LJ 1USEA 2K37A 2KZIA 2YXQB 3I5CA 1SQPD 2OYOA 1LP1A 5B5EE 2IYPA 5TISE 3KZIH 3CPWO 1WRGA 3TYYA 3PRJA 3CD6P 2K9JA 3H1JD 3JCUH 1NTZJ 1SFCB 3L75G 1KORA 2FXPA 1NTMK 3K5BA 3CX5I 1HGVA 3S4RA 2KS1A 3GF3A 2WWWA 4C7NB 1H88A 1KFMA 3PH0A 1IFIA 3MIWA 1DEBA 1PGQA 1IZNB 4C7RA 3GHGA 5KJ7A 3JC22 1QGKB 3A0HH 1SQPJ 3L74G 2IZ1A 4BXLA 4M3LA 3H1HE 2IDBA 3H1JJ 3LIDA 1BE3G 1P84H 1PL5A 4OGQD 1X79B 3OA7A 3KDPB 2WT7B 4A7PA 1S5LX 4UB8E 5GTIE 1SQQD 1N7SC 4WVZA 1YHQP 1FOSF 1EDLA 3CXHD 4K35A 3H1KD 4ZKPA 5CCGC 1KQSO 1ZRTD 5DJUB 4W7YA 1KILC 3BCCD 4BRYB 2E75D 1A02F 1OIPA 1KB9H 3SSUA 3T97A 1BSNA 1JB0J 2FXOA 1PGPA 4O9BA 2HG5D 2R32A 3HUSB 1IFJA 2IFMA 5AW2B 1SQVE 3IF4A 2IBZE 5APTA 4PV1C 1VF5B
chains in the Genus database with same CATH topology
1CSBA 3V4WA 3R2PA 3P8CD 2R5DA 1W2EA 5APXA 2J58A 3N4XA 4Y99C 3IR9A 1N73C 1G2CA 1ZR4A 3B5NA 1MZ9A 3N7NA 1S9KE 5AW6B 1SQBK 1MUUA 4LGDE 2WPSA 1T2KD 2Z5IA 2OYHB 1JO5A 4IFMA 2C0XA 1M7LA 5APSA 3IFMA 1SQPK 1OXZA 3LIEA 2W6AA 1HWTC 1FJKA 3UIAA 3CLQA 1L0NK 1GTWA 2HYNA 3TSIA 1HGZA 1GDTA 1LTJA 3P32A 1G1JA 1LWUA 4EIJA 3GHGB 2N1TC 1VDFA 1IO4A 4W7ZA 3A2AA 3HE4A 3HRNA 5BU5A 2WTYA 3NXSA 1URQC 2P2UA 2C9NY 3RK2D 1RE3A 3HUSC 1XTGB 1XTCC 1GL2D 1HH0A 1FDMA 1NWQA 3VOPA 2CPSA 4WY4D 3VMYA 1LTTC 1NTKK 3VMXA 1FOSE 4I6MC 1M1JA 5APYA 1NKNA 2N9BA 2QM8A 1JY3P 3HTKB 1HBWA 5AW0B 2H7HA 1NU1K 1HTLC 1LTIC 2OYIA 3V5BA 4B86A 1L4AB 1GU4A 1GL2A 3M0AA 1NAFA 4C46A 1QL1A 2Z4EA 2OYHC 4WY4A 3L35A 2FYZA 1JTHA 3H32A 3G3ZA 2FFDA 3CL3D 4Y99B 3TNUA 1GD2E 3U1CA 1ZR2A 1FZCA 1IJDB 2WPQA 1MFZA 3RK3D 2YNYA 3GHGC 5KJ7C 3HD7B 2NPSD 4N78E 5AW8B 2PP6A 1VPCA 3KQGA 1IK9A 1SQQK 3A3YB 5BU8B 2FXMA 3EQ2A 5APVA 2O01H 3BRTB 1LTAC 3HE5A 1IFDA 2A45G 4ZKUA 1CZQA 1RF1A 1ZV8A 4JF7A 4IFDK 1FZGA 1GW4A 3NTNA 3MUDA 4N78D 2XNXA 1JY3O 2NPSA 1OWAA 5CCHD 3B5NB 1FBMA 2Z5HA 3PP5A 1RF0C 1FZFA 1LTBC 1L4AC 1HVVA 1FZEA 4AQRD 1RE4A 2M3BA 2P7JA 3M0DC 2BASA 4WBAA 1JUNA 1KFNA 1JNMA 3L36A 4OH8B 1JY2P 1LTJB 4EOTA 2PAJA 1DX7A 1LWUB 3L37A 5AW9B 5CCHA 2JEEA 3HD7C 4XA4A 5APUA 1T8ZA 1LT9A 2ZXEB 3HE4B 1SQVK 3VN0A 3VMZA 1YTZT 1L0LK 2OARA 2XKMA 2HODA 4GT1A 2O1KA 2IFNA 1J1EB 2GUSA 4GKGA 1M1JB 2XV5A 3RL0D 4DOJA 2KYVA 1SFCD 1DH3A 4HH2A 2E42A 1SVFA 3NFQA 4LLHA 3MGNA 3LW5H 5BVZA 1N7SD 5CMZA 2Q9IA 3V4QA 4JYCA 5CHXA 3VYIA 2H43A 3B5NC 2OYIB 2J59M 5CCGD 2R5BA 5AVQB 1FAVA 1GL2B 1KILD 4WY4B 1JTHB 3H32B 5KLVK 2H8PD 1RY3A 2WITA 3OAKA 1GW3A 2IX7C 3TNUB 2Q5UA 1JY2O 1MV8A 1CI6A 1SFCA 3MTUE 3B8EB 1KZUB 1NH4A 2FKWB 3SWFA 1LTJC 1N7SA 1AFOA 1X8YA 2JJLA 1LWUC 1SQXK 1FU1A 1N7LA 2M8RA 2GUVA 1GK6A 5CCGA 4C7NA 1FZAA 3BVHA 4GIFA 1T2KC 1KILA 2L5GB 2KSJA 2I1KA 3HE5B 1RF1B 1RE3C 2KP8A 4IFFA 4N6JA 1GU5A 1IFMA 1J1EC 2KLVA 2C9LY 1NOHA 4N3YB 2Q3IA 2ZFCA 3E1IA 1M1JC 3RK3B 5AW3B 1J1DB 2NPSB 2MJZA 1KQLA 5AVUB 5CJ0A 2P67A 3M9HA 3SWYA 1J2JB 1JCCA 2OYIC 3RK2C 2WPRA 1NHLA 1YTZI 3V2RA 1GL2C 2Q7CA 2XDJA 1EQ7A 4WY4C 3CI9A 1SLQA 4JYBA 2FFDC 2C0WA 1N73A 1G2CB 2WT7A 2N1TD 1FZCC 3M9QA 2XU6A 1JMMA 5AVRB 1HUCA 1JY3N 1URQD 1A02J 2YKQA 2YO2A 1LT9B 2WSFH 2W6BA 2YKOA 4I1LA 5APWA 4XE5B 1LTSC 3NMDA 1ZN5A 1RF1C 2HODB 2WSEH 4RESB 2N1TA 2WSCH 1YYCA 3H6PA 3MD0A 5KTBA 1IFNA 1H89A 2HPCA 3RK3C 1J1DC 1N86A 1URQA 2NPSC 4AUWA 4HYTB 5AVTB 3HUSA 2GM4A 3I5CA 2IPPA 3VP9A 3O8ZA 1T3UA 2FYUK 5AW1B 1WRGA 2KOGA 3TYYA 5APQA 1H8AA 2YO3A 1RE4C 1GZLA 4W80A 3U1AA 1WT6A 3RL0B 1GK4A 1CI6B 1SFCB 5AW4B 3A7OA 5KJ7D 1S9KD 3EFGA 4LC1A 5AVYB 1NTMK 3RK2B 1N7SB 2P1JA 1HGVA 5AVXB 1NKZB 5CCHC 2OYHA 3M06A 2O1JA 2KB7P 3P8MC 3V2QA 4DZOA 3U59A 1FJPA 2WWWA 4C7NB 5CJ4A 4AYCA 2FFDB 1LT9C 1H88A 1KILB 1KFMA 3VTPC 1IFIA 1FZCB 2A45H 3MIWA 2YKPA 1DEBA 1LGHB 4C7RA 3GHGA 5KJ7A 2QM7A 5AVWB 3A5TA 1G1IA 3M9BA 3M91A 1NO4A 3KPEA 3C9IA 1JY2N 2A45I 1L4AD 2HLOA 5AVVB 1PFIA 1IC2A 4M3LA 2POHA 1T3JA 1QL2A 2CPBA 3LIDA 3HTKA 1X9VA 3WMM0 2R3CA 1X79B 3OA7A 5AVSB 3II6A 1N73B 3KDPB 5AVZB 2I1JA 3RL0C 2WT7B 1SFCC 3HD7D 3L4FA 5AW7B 1RF0A 2WZ7A 1N2DC 1N7SC 1L4AA 1FOSF 1E5WA 2LKMA 3BRVB 5AW5B 4ZKPA 5CCGC 1JOCA 3KYQA 3M0DA 1LTGC 2W27A 4W7YA 1KILC 1AQ5A 2HFED 1A02F 2YMYA 3T97A 2N1TB 3HD7A 3OJAB 1SP4A 4WB4A 1HJBA 2HPCB 1CW5A 3V2PA 3B5ND 2XZRA 1URQB 1NTZK 1Z56A 1ZLLA 3P8CE 4O9BA 2HG5D 1JCDA 3V2NA 4KHXA 2R32A 2VRSA 3HUSB 1IFJA 2IFMA 5AW2B 3BATA 1FZBA 3TK1A 4I2LC 3VP8A 2E43A 3P7KA 5APTA 3BASA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M7L A; 
#chains in the Genus database with same CATH topology
 1VQO P;  3R2P A;  2R5D A;  5APX A;  1IFP A;  1SQQ J;  3IR9 A;  1VQP P;  1ZR4 A;  3L73 E;  1MZ9 A;  3H1K J;  4LGD E;  3RBX A;  2WPS A;  1JO5 A;  2Q3E A;  2KUB A;  3BCC J;  4U3F G;  2C0X A;  5APS A;  3FWN A;  1FJK A;  3CWB G;  4H0L C;  3P32 A;  1G1J A;  4ASV A;  2W90 A;  4JQ0 D;  1KYO H;  3EWK A;  1IO4 A;  2D2C C;  3A2A A;  3HE4 A;  1AQT A;  2B87 B;  5BU5 A;  1YJN P;  1URQ C;  4PD4 E;  1DEE G;  3AE7 C;  3VOP A;  4L76 A;  4UB6 E;  1LTT C;  1NTK K;  3VMX A;  1FOS E;  1PPJ E;  1M1J A;  1NKN A;  2N9B A;  1HBW A;  1E79 H;  1NTZ G;  5AW0 B;  2YIU B;  4B86 A;  3L71 E;  3RK3 E;  1GL2 A;  2W6J H;  4ASW A;  1NAY A;  1JTH A;  1VQ8 P;  2E74 C;  3TNU A;  2WPV B;  3I55 P;  3WUU A;  1IJD B;  5KAI E;  3H1L E;  1MFZ A;  2YNY A;  3GHG C;  5KJ7 C;  2ZYA A;  1SQP G;  4H44 C;  1PGO A;  5BU8 B;  3HE5 A;  1IFD A;  4JF7 A;  3H1J G;  2E75 B;  1GW4 A;  1VQ7 P;  3A0B E;  2QJP B;  1NVO A;  1VQ6 P;  2FYN B;  3Q3D A;  1OWA A;  1PIX A;  2Z5H A;  2PRR A;  2WQY C;  5CBO A;  1Y47 A;  1FZE A;  1RE4 A;  3VMA A;  1FE6 A;  2P7J A;  2BAS A;  3CXH I;  4RJT A;  1JNM A;  1K04 A;  4OH8 B;  1VL2 A;  1LWU B;  5CCH A;  2QSI A;  1ZXG A;  5APU A;  2FYU D;  1NTM E;  1QLE D;  1L0L K;  3Q2Y A;  2HOD A;  4GT1 A;  2O1K A;  1J1E B;  2M3E A;  1BGY E;  1LNQ A;  4GKG A;  2R44 A;  1SQQ G;  5E79 E;  1DH3 A;  3CMA P;  1N7S D;  3H1K G;  3V4Q A;  5CHX A;  3L72 J;  2OYI B;  5CCG D;  3BCC G;  3F5H A;  3AE4 C;  5AVQ B;  2P10 A;  1KIL D;  1OW6 A;  3H32 B;  5KLV K;  2H8P D;  1GW3 A;  3AEB C;  1CI6 A;  3MTU E;  1NH4 A;  3C1L A;  1H0T A;  2JJL A;  1SQX K;  2KXP B;  2FYU J;  4CPG A;  2M8R A;  2GUV A;  3WUT A;  1FZA A;  4GIF A;  2PFX A;  4IFF A;  2QJK C;  1GU5 A;  4PV1 D;  1IFM A;  5GTH H;  1NOH A;  2Q3I A;  2FY8 A;  1M1J C;  1J1D B;  2QA4 P;  5AVU B;  3SWY A;  1JCC A;  1S3J A;  1NHL A;  1SQX J;  3MHV A;  1GL2 C;  2Q7C A;  3IAO A;  1SLQ A;  4H0L D;  1N73 A;  2BCC E;  1EXI A;  1G2C B;  3CME P;  2L91 A;  2D2C D;  1YQ3 C;  3TGU D;  4GOD A;  1SS1 A;  1URQ D;  3JCU E;  1PV3 A;  2YKQ A;  1BDC A;  3CX5 D;  1OW7 A;  1AA0 A;  3L75 J;  2N1T A;  4YXW H;  1YYC A;  3CCQ P;  1H89 A;  4R4M A;  4HYT B;  2O3J A;  3CCM P;  2GM4 A;  4TT3 H;  2WVR A;  1L0N D;  2E74 D;  2WSE J;  3A0H E;  3Q1M A;  2BEQ D;  4HKZ H;  1RE4 C;  1VQN P;  2M5A A;  1NTK E;  4D6T D;  5AW4 B;  5KJ7 D;  3TGU J;  3L74 J;  3EFG A;  5AVY B;  3RK2 B;  1N7S B;  4H44 D;  2P1J A;  1P84 E;  5AVX B;  4IOI H;  5C39 A;  5CCH C;  2OYH A;  3M06 A;  1FJP A;  2E76 C;  4GOF A;  1KIL B;  4DCK A;  1YQ4 C;  1FZC B;  2YKP A;  3A5T A;  1Q2N A;  1NU1 D;  3M91 A;  1QVF O;  5B66 H;  1U7J A;  1KB9 E;  1JY2 N;  1L0N J;  2A45 I;  2HLO A;  1PFI A;  2G3A A;  2E5Y A;  2POH A;  2OTK E;  4D6T J;  1X9V A;  1KC8 Q;  2R3C A;  2I1J A;  4GOE A;  2FYU G;  1BCC E;  2NZ2 A;  1EDK A;  2LKM A;  1EZV E;  1JOC A;  3AEE C;  3Q5R A;  1AQ5 A;  4IL6 H;  2WSS H;  3L70 E;  2YMY A;  4H0L B;  1PP9 D;  3CCU P;  2V7Q J;  2D2C B;  1DD4 A;  2AEF A;  2HPC B;  4XFJ A;  4JBZ A;  1CW5 A;  1URQ B;  1NTZ K;  1Z56 A;  1ZLL A;  3P8C E;  3CC4 P;  3CXH H;  3IN6 A;  3WUV A;  1JCD A;  2VRS A;  1KYO E;  3GF7 A;  1TU3 F;  1Q82 Q;  3TK1 A;  1FZB A;  1LP1 B;  3CWB J;  3USS A;  3VP8 A;  1L0L E;  3P7K A;  2K9J B;  2QE7 H;  2J58 A;  1N73 C;  3N7N A;  1OX3 A;  1S9K E;  1FC2 C;  1M7L A;  2OTL P;  3IFM A;  1SQP K;  1HWT C;  1Q90 D;  1PP9 J;  2ZJS E;  2HYN A;  3TSI A;  1HGZ A;  1FDO A;  1GDT A;  1UII A;  1LTJ A;  5KLV E;  3GHG B;  3H1I E;  2N1T C;  4H44 B;  1R8E A;  3NXS A;  1SQX E;  1M1K Q;  3TF5 A;  1EXJ A;  2QJY C;  1GL2 D;  1M90 Q;  4NPE A;  3AE9 C;  3WU2 H;  2QM8 A;  3TGU G;  2H7H A;  2H88 C;  1RQV A;  2QG4 A;  3AE6 C;  1GU4 A;  4C46 A;  1NAF A;  2OYH C;  3L35 A;  2FYZ A;  3CL3 D;  4Y99 B;  1L2P A;  2N9Y B;  2KNC A;  2UWJ E;  3T97 B;  1DIP A;  3PTZ A;  1VPC A;  1WMK A;  1L0N G;  1IK9 A;  1SQQ K;  3A3Y B;  1JMB A;  3I56 P;  2O01 H;  4I7Z C;  1RF1 A;  1CZQ A;  2Y0D A;  4D6T G;  4N78 D;  2XNX A;  2NPS A;  5CCH D;  1FBM A;  4L74 A;  1N8R Q;  1BE3 E;  2AXC A;  2E76 D;  3SFD C;  4NPD A;  1OVR A;  1OVU A;  4PJ0 H;  2RN0 A;  2BCC D;  1NU1 G;  1K05 A;  4U7J A;  3L36 A;  1JY2 P;  2PAJ A;  3Q5P A;  2LXB A;  3W67 A;  1T8Z A;  1JM0 A;  3HE4 B;  4YPC A;  3VN0 A;  3GMA A;  1M1J B;  2B9B A;  2ZT9 D;  5BVZ A;  2ZVO B;  3RL0 g;  5GTH E;  2Q9I A;  2MKV A;  3AEC C;  1YIT P;  1FAV A;  1GL2 B;  1PP9 G;  2AXT H;  1JTH B;  2RH0 A;  2IX7 C;  3TNU B;  1JY2 O;  1MV8 A;  3LW5 J;  3B8E B;  3SWF A;  1LTJ C;  4U3F E;  1FU1 A;  3FXE A;  3F89 A;  3CC2 P;  2L5G B;  4OGQ B;  1D7M A;  3HE5 B;  5EFW B;  1S5L H;  4N6J A;  4Y28 J;  1YIJ P;  2ZFC A;  2A06 D;  1KQL A;  2KK7 A;  5L8R J;  3W68 A;  1EDJ A;  1NTZ E;  1YTZ I;  1AVO A;  3CCS P;  2N1T D;  2O01 J;  3M9Q A;  2OQQ A;  1HUC A;  1MKM A;  2E76 B;  2W6B A;  1VQ5 P;  4RO0 A;  4I1L A;  5APW A;  1LTS C;  3NMD A;  1ZN5 A;  1RF1 C;  2HOD B;  2WSE H;  2B88 A;  1SQP E;  1HJ0 A;  5KTB A;  1FDI A;  1SQB D;  3RK3 C;  2NPS C;  2WMM A;  3H1J E;  2SPZ A;  3FXD A;  2IPP A;  3VP9 A;  2IZ0 A;  3O8Z A;  2FYU K;  2Y0E A;  5AW1 B;  3CX5 H;  1H8A A;  2WSC J;  2JKV A;  5KLI B;  1GZL A;  3JSV C;  2ZT9 B;  1GK4 A;  1CI6 B;  2B89 A;  3PJS K;  1S9K D;  4LC1 A;  3S9O A;  1H0T B;  3Q5S A;  3SWK A;  3P8M C;  4L73 A;  4OVN F;  3U59 A;  5CJ4 A;  2FFD B;  3VTP C;  2YMK A;  1LGH B;  5KLV D;  1SQB J;  5AVW B;  2JR8 A;  3M9B A;  4IL6 E;  3AE1 C;  3S1K A;  5AVV B;  2BCC G;  1SQQ E;  2CPB A;  3CXH E;  3H1K E;  3HTK A;  1ZRT E;  4H13 C;  1N73 B;  1AVY A;  3RL0 C;  3BCC E;  3L4F A;  5AW7 B;  1RF0 A;  2WZ7 A;  1S1C X;  1N2D C;  2V7Q H;  3H1H D;  1L4A A;  1R5S A;  3BRV B;  4KJM A;  1KD1 Q;  5AW5 B;  1BDD A;  5H2F H;  2I8D A;  2W8Z A;  3D71 A;  3KZI E;  2N1T B;  3HD7 A;  4IL6 X;  3V2N A;  4KHX A;  3CCE P;  2QJY B;  1KB9 I;  3R4Y A;  2E43 A;  2G8Y A;  2ZVN B;  1BSH A;  1KN7 A;  1W2E A;  3N4X A;  3G6E P;  3H1H J;  1G2C A;  1Y8A A;  3B5N A;  3WU2 E;  1SQV D;  2JO1 A;  1MUU A;  2IBZ D;  2Z5I A;  2OYH B;  4IFM A;  1OXZ A;  3UIA A;  3CLQ A;  1L0N K;  3L73 D;  1GTW A;  2A06 G;  3PLN A;  2RKL A;  2YXR B;  1PZQ A;  1Q81 Q;  4W7Z A;  3HRN A;  2WTY A;  2P2U A;  2C9N Y;  1RE3 A;  2KSE A;  1XTG B;  1FDM A;  3VMY A;  2CPS A;  1KYO I;  2ZXX A;  4PD4 D;  1SQV J;  3G9R A;  1NU1 K;  2KI7 B;  1LTI C;  3V5B A;  1PPJ D;  3FX0 A;  4PV1 B;  4WY4 A;  2QIW A;  1GD2 E;  2M0B A;  1SQB G;  1FZC A;  3ZDM A;  2ZAE B;  3L71 D;  2WPQ A;  3RK3 D;  4PJ0 E;  2NPS D;  3KQG A;  2FXM A;  3EQ2 A;  1W2B O;  4KT0 J;  3BRT B;  3QH9 A;  1LTA C;  2A45 G;  3AE8 C;  1NU1 J;  1ZV8 A;  3H1L D;  1W5C E;  1ZME C;  1YJW P;  3L72 E;  3SFE C;  4YXD C;  3CCL P;  3PP5 A;  2E5T A;  1RF0 C;  1FZF A;  1LTB C;  1L4A C;  2J5U A;  4AQR D;  2M3B A;  1M57 D;  5KLV G;  2FYU E;  3B4S A;  4WBA A;  3O6Q A;  3C8V A;  1LTJ B;  4EOT A;  1DX7 A;  3L37 A;  2AXT E;  1OW8 A;  2KS1 B;  3HD7 C;  4XA4 A;  2E74 B;  1LT9 A;  1YTZ T;  5KAF H;  2PGD A;  3MZW B;  2V4H A;  1K73 Q;  2CK3 H;  1GMJ A;  2IFN A;  2GUS A;  4H13 D;  2GA1 A;  2XV5 A;  2KZJ A;  1KQF B;  1NTM D;  3RL0 D;  4DOJ A;  1KIL E;  1NGM B;  3H1H G;  2E42 A;  3RGU A;  1SVF A;  1QEX A;  1LT1 A;  1S5L E;  3LW5 H;  5CMZ A;  1USD A;  3TDK A;  3VYI A;  3B5N C;  1BGY D;  2J59 M;  3AE2 C;  1VQK P;  2R5B A;  3D6Y A;  2FBW C;  5M1B A;  1Q86 Q;  1RY3 A;  2IBZ I;  3OAK A;  2Q5U A;  1SFC A;  2LR2 A;  4OWF A;  2KNC B;  1KZU B;  1AFO A;  1X8Y A;  3L75 E;  4C7N A;  1T2K C;  2KSJ A;  2AEJ A;  3QWO C;  1RF1 B;  1RE3 C;  1X22 A;  1NTM J;  2C9L Y;  1DD3 A;  4N3Y B;  3E1I A;  3RK3 B;  5AW3 B;  1SQV G;  4YTP C;  2NPS B;  2IBZ G;  1BGY J;  1OFC X;  3CCR P;  2P67 A;  3M9H A;  4PD4 I;  5CBN A;  3V6I A;  3RK2 C;  2WPR A;  2KIK A;  3L73 G;  3TGU E;  3L74 E;  3V2R A;  1EQ7 A;  4WY4 C;  1QVG O;  4QMA A;  2C0W A;  2WT7 A;  3CX5 E;  5KKZ C;  1FZC C;  3FWL A;  2XU6 A;  5AVR B;  1JY3 N;  1KV4 A;  1RH5 B;  2JDI H;  4BRY A;  2W83 C;  3GW6 A;  4RES B;  1RQU A;  1L0N E;  2WSC H;  2P58 A;  1PPJ G;  2K3R A;  4AUW A;  5AVT B;  2WSF J;  3HUS A;  2Y0C A;  4D6T E;  1EC5 A;  2QJK B;  3G4S P;  4L75 A;  1T3U A;  2KOG A;  5APQ A;  2YO3 A;  3U1A A;  3L71 G;  4W80 A;  4H13 B;  3CC7 P;  1WT6 A;  1K9M Q;  3RL0 B;  3A7O A;  3GLM A;  3GG2 A;  1NKZ B;  2BCC J;  2O1J A;  1NU1 E;  3ABV C;  2KB7 P;  3V2Q A;  4DZO A;  3H1L G;  4AYC A;  2R3S A;  1LT9 C;  1NTK D;  2A45 H;  1U57 A;  4MN4 C;  1P84 D;  3ITK A;  5H2F E;  2QM7 A;  1G1I A;  1NO4 A;  5B5E H;  3KPE A;  5TIS H;  3CWB E;  2B87 A;  3C9I A;  1S72 P;  1L4A D;  2O01 N;  1IC2 A;  2OTJ P;  1T3J A;  1QL2 A;  3KXD A;  3MP7 B;  3WMM 0;  5AVS B;  1KB9 D;  4JPZ B;  1HF9 A;  3II6 A;  5AVZ B;  1SFC C;  3HD7 D;  4ZMD A;  1PP9 E;  4Z1M H;  1E5W A;  2JWA A;  1VQM P;  1NTK J;  2QRX A;  3KYQ A;  3M0D A;  1LTG C;  2W27 A;  3CCV P;  2HFE D;  1NTM G;  1FS0 E;  1BCC D;  1KQG B;  1UIX A;  1EZV D;  3OJA B;  1SP4 A;  4WB4 A;  1PGJ A;  1HJB A;  1BGY G;  2K1A A;  3V2P A;  3B5N D;  1AJY A;  2XZR A;  1VQL P;  3L70 D;  2ZYD A;  4K3A A;  3BAT A;  4I2L C;  4UB8 H;  3L72 D;  3PHL A;  5GTI H;  1OZH A;  3CCJ P;  3BAS A;  1CSB A;  3V4W A;  3P8C D;  4NPF X;  4Y99 C;  1KYO D;  1NYH A;  2OGU A;  3AEF C;  2NRG A;  5AW6 B;  1SQB K;  5B66 E;  1L0L D;  3KHU A;  1T2K D;  1Q7Y Q;  4WWI A;  2RMZ A;  1AV1 A;  4EDF A;  3LIE A;  2W6A A;  3E1R A;  1BCC J;  3B71 A;  2ITA A;  1S4X A;  1MFT A;  1LWU A;  4EIJ A;  1VDF A;  3L70 J;  1YI2 P;  3RK2 D;  3HUS C;  1XTC C;  1HH0 A;  1NWQ A;  4DJG A;  3H1I D;  4WY4 D;  4I6M C;  3AEG C;  1M56 D;  5APY A;  2K88 A;  1JY3 P;  1VF5 C;  3HTK B;  1SQX D;  1L0L J;  1HTL C;  2OYI A;  3D6Z A;  1L4A B;  1T6A A;  2Q6Q A;  3M0A A;  1QL1 A;  2Z4E A;  3H32 A;  3G3Z A;  2FFD A;  3U1C A;  1ZR2 A;  4PD4 H;  1X0T A;  1ZW0 A;  3HD7 B;  4BWN A;  4N78 E;  5AW8 B;  1R5L A;  1P84 I;  4RKU J;  2PP6 A;  3L75 D;  4UB6 H;  3AE3 C;  3AE5 C;  2XND H;  5APV A;  5KLV J;  3H1I J;  4ZKU A;  1OVV A;  2KLU A;  1U7M A;  5TJH A;  4IFD K;  1FZG A;  1ZOY C;  3NTN A;  3MUD A;  1JY3 O;  1Y9B A;  4TLF A;  5KAF E;  3B5N B;  2YIU C;  1RHZ B;  1NTK G;  2HR3 A;  1ZP0 C;  3L74 D;  1HVV A;  5KAI H;  3M0D C;  2M5A B;  2Q1K A;  1JUN A;  1KFN A;  3G71 P;  4OGQ C;  1YBK A;  1BE3 D;  5AW9 B;  2JEE A;  1OMI A;  4GDO A;  2ZXE B;  1EZV I;  3H25 A;  1SQV K;  3VMZ A;  3A0B H;  2OAR A;  4ZNC A;  2XKM A;  2IYO A;  2Y9Y A;  2E75 C;  2DW3 A;  2QJP C;  2KYV A;  1SFC D;  2FYN C;  4HH2 A;  3NFQ A;  4LLH A;  3MGN A;  4I7Z B;  4JYC A;  3RBZ A;  2H43 A;  4HB1 A;  4EI2 A;  3OW2 O;  1M8O B;  4WY4 B;  1BCC G;  2WIT A;  1EZV G;  1BE3 J;  1IK7 A;  5KKZ B;  2FKW B;  1N7S A;  1NJI Q;  3L70 G;  1LWU C;  1N7L A;  1GK6 A;  5CCG A;  3D70 A;  3L73 J;  2JP3 A;  2A06 E;  3AEA C;  3BVH A;  1VQ4 P;  1KIL A;  2BEZ F;  2QVA A;  3L72 G;  2I1K A;  5E79 H;  4HJG H;  2KP8 A;  4U3F D;  1K8A Q;  3E7K A;  1J1E C;  2KLV A;  2QEX P;  1JEK A;  2Y9Z A;  3CWB D;  1L0L G;  2MJZ A;  5KLI C;  1KTM A;  4DT0 A;  3FGA D;  5CJ0 A;  3EFF K;  2ZT9 C;  2AEM A;  1J2J B;  2OYI C;  1KMI Z;  2XDJ A;  2K9Y A;  4R4L A;  3CI9 A;  1QX8 A;  4JYB A;  2FFD C;  1VQ9 P;  4EYY Q;  3O6Q B;  2JWD A;  2H89 C;  2ZYG A;  1S2E A;  1JMM A;  1NTZ D;  1YJ9 P;  2LXC B;  1A02 J;  2YO2 A;  5DJT B;  1LT9 B;  1SQB E;  3H1I G;  2WSF H;  2YKO A;  3AED C;  4U3F J;  3L71 J;  4XE5 B;  1SQX G;  5K5G B;  1VF5 D;  3MUD C;  1LJ2 A;  3H6P A;  3MD0 A;  1IFN A;  2HPC A;  1J1D C;  1N86 A;  1URQ A;  1EDI A;  3H1L J;  1USE A;  2K37 A;  2KZI A;  2YXQ B;  3I5C A;  1SQP D;  2OYO A;  1LP1 A;  5B5E E;  2IYP A;  5TIS E;  3KZI H;  3CPW O;  1WRG A;  3TYY A;  3PRJ A;  3CD6 P;  2K9J A;  3H1J D;  3JCU H;  1NTZ J;  1SFC B;  3L75 G;  1KOR A;  2FXP A;  1NTM K;  3K5B A;  3CX5 I;  1HGV A;  3S4R A;  2KS1 A;  3GF3 A;  2WWW A;  4C7N B;  1H88 A;  1KFM A;  3PH0 A;  1IFI A;  3MIW A;  1DEB A;  1PGQ A;  1IZN B;  4C7R A;  3GHG A;  5KJ7 A;  3JC2 2;  1QGK B;  3A0H H;  1SQP J;  3L74 G;  2IZ1 A;  4BXL A;  4M3L A;  3H1H E;  2IDB A;  3H1J J;  3LID A;  1BE3 G;  1P84 H;  1PL5 A;  4OGQ D;  1X79 B;  3OA7 A;  3KDP B;  2WT7 B;  4A7P A;  1S5L X;  4UB8 E;  5GTI E;  1SQQ D;  1N7S C;  4WVZ A;  1YHQ P;  1FOS F;  1EDL A;  3CXH D;  4K35 A;  3H1K D;  4ZKP A;  5CCG C;  1KQS O;  1ZRT D;  5DJU B;  4W7Y A;  1KIL C;  3BCC D;  4BRY B;  2E75 D;  1A02 F;  1OIP A;  1KB9 H;  3SSU A;  3T97 A;  1BSN A;  1JB0 J;  2FXO A;  1PGP A;  4O9B A;  2HG5 D;  2R32 A;  3HUS B;  1IFJ A;  2IFM A;  5AW2 B;  1SQV E;  3IF4 A;  2IBZ E;  5APT A;  4PV1 C;  1VF5 B; 
#chains in the Genus database with same CATH homology
 1CSB A;  3V4W A;  3R2P A;  3P8C D;  2R5D A;  1W2E A;  5APX A;  2J58 A;  3N4X A;  4Y99 C;  3IR9 A;  1N73 C;  1G2C A;  1ZR4 A;  3B5N A;  1MZ9 A;  3N7N A;  1S9K E;  5AW6 B;  1SQB K;  1MUU A;  4LGD E;  2WPS A;  1T2K D;  2Z5I A;  2OYH B;  1JO5 A;  4IFM A;  2C0X A;  1M7L A;  5APS A;  3IFM A;  1SQP K;  1OXZ A;  3LIE A;  2W6A A;  1HWT C;  1FJK A;  3UIA A;  3CLQ A;  1L0N K;  1GTW A;  2HYN A;  3TSI A;  1HGZ A;  1GDT A;  1LTJ A;  3P32 A;  1G1J A;  1LWU A;  4EIJ A;  3GHG B;  2N1T C;  1VDF A;  1IO4 A;  4W7Z A;  3A2A A;  3HE4 A;  3HRN A;  5BU5 A;  2WTY A;  3NXS A;  1URQ C;  2P2U A;  2C9N Y;  3RK2 D;  1RE3 A;  3HUS C;  1XTG B;  1XTC C;  1GL2 D;  1HH0 A;  1FDM A;  1NWQ A;  3VOP A;  2CPS A;  4WY4 D;  3VMY A;  1LTT C;  1NTK K;  3VMX A;  1FOS E;  4I6M C;  1M1J A;  5APY A;  1NKN A;  2N9B A;  2QM8 A;  1JY3 P;  3HTK B;  1HBW A;  5AW0 B;  2H7H A;  1NU1 K;  1HTL C;  1LTI C;  2OYI A;  3V5B A;  4B86 A;  1L4A B;  1GU4 A;  1GL2 A;  3M0A A;  1NAF A;  4C46 A;  1QL1 A;  2Z4E A;  2OYH C;  4WY4 A;  3L35 A;  2FYZ A;  1JTH A;  3H32 A;  3G3Z A;  2FFD A;  3CL3 D;  4Y99 B;  3TNU A;  1GD2 E;  3U1C A;  1ZR2 A;  1FZC A;  1IJD B;  2WPQ A;  1MFZ A;  3RK3 D;  2YNY A;  3GHG C;  5KJ7 C;  3HD7 B;  2NPS D;  4N78 E;  5AW8 B;  2PP6 A;  1VPC A;  3KQG A;  1IK9 A;  1SQQ K;  3A3Y B;  5BU8 B;  2FXM A;  3EQ2 A;  5APV A;  2O01 H;  3BRT B;  1LTA C;  3HE5 A;  1IFD A;  2A45 G;  4ZKU A;  1CZQ A;  1RF1 A;  1ZV8 A;  4JF7 A;  4IFD K;  1FZG A;  1GW4 A;  3NTN A;  3MUD A;  4N78 D;  2XNX A;  1JY3 O;  2NPS A;  1OWA A;  5CCH D;  3B5N B;  1FBM A;  2Z5H A;  3PP5 A;  1RF0 C;  1FZF A;  1LTB C;  1L4A C;  1HVV A;  1FZE A;  4AQR D;  1RE4 A;  2M3B A;  2P7J A;  3M0D C;  2BAS A;  4WBA A;  1JUN A;  1KFN A;  1JNM A;  3L36 A;  4OH8 B;  1JY2 P;  1LTJ B;  4EOT A;  2PAJ A;  1DX7 A;  1LWU B;  3L37 A;  5AW9 B;  5CCH A;  2JEE A;  3HD7 C;  4XA4 A;  5APU A;  1T8Z A;  1LT9 A;  2ZXE B;  3HE4 B;  1SQV K;  3VN0 A;  3VMZ A;  1YTZ T;  1L0L K;  2OAR A;  2XKM A;  2HOD A;  4GT1 A;  2O1K A;  2IFN A;  1J1E B;  2GUS A;  4GKG A;  1M1J B;  2XV5 A;  3RL0 D;  4DOJ A;  2KYV A;  1SFC D;  1DH3 A;  4HH2 A;  2E42 A;  1SVF A;  3NFQ A;  4LLH A;  3MGN A;  3LW5 H;  5BVZ A;  1N7S D;  5CMZ A;  2Q9I A;  3V4Q A;  4JYC A;  5CHX A;  3VYI A;  2H43 A;  3B5N C;  2OYI B;  2J59 M;  5CCG D;  2R5B A;  5AVQ B;  1FAV A;  1GL2 B;  1KIL D;  4WY4 B;  1JTH B;  3H32 B;  5KLV K;  2H8P D;  1RY3 A;  2WIT A;  3OAK A;  1GW3 A;  2IX7 C;  3TNU B;  2Q5U A;  1JY2 O;  1MV8 A;  1CI6 A;  1SFC A;  3MTU E;  3B8E B;  1KZU B;  1NH4 A;  2FKW B;  3SWF A;  1LTJ C;  1N7S A;  1AFO A;  1X8Y A;  2JJL A;  1LWU C;  1SQX K;  1FU1 A;  1N7L A;  2M8R A;  2GUV A;  1GK6 A;  5CCG A;  4C7N A;  1FZA A;  3BVH A;  4GIF A;  1T2K C;  1KIL A;  2L5G B;  2KSJ A;  2I1K A;  3HE5 B;  1RF1 B;  1RE3 C;  2KP8 A;  4IFF A;  4N6J A;  1GU5 A;  1IFM A;  1J1E C;  2KLV A;  2C9L Y;  1NOH A;  4N3Y B;  2Q3I A;  2ZFC A;  3E1I A;  1M1J C;  3RK3 B;  5AW3 B;  1J1D B;  2NPS B;  2MJZ A;  1KQL A;  5AVU B;  5CJ0 A;  2P67 A;  3M9H A;  3SWY A;  1J2J B;  1JCC A;  2OYI C;  3RK2 C;  2WPR A;  1NHL A;  1YTZ I;  3V2R A;  1GL2 C;  2Q7C A;  2XDJ A;  1EQ7 A;  4WY4 C;  3CI9 A;  1SLQ A;  4JYB A;  2FFD C;  2C0W A;  1N73 A;  1G2C B;  2WT7 A;  2N1T D;  1FZC C;  3M9Q A;  2XU6 A;  1JMM A;  5AVR B;  1HUC A;  1JY3 N;  1URQ D;  1A02 J;  2YKQ A;  2YO2 A;  1LT9 B;  2WSF H;  2W6B A;  2YKO A;  4I1L A;  5APW A;  4XE5 B;  1LTS C;  3NMD A;  1ZN5 A;  1RF1 C;  2HOD B;  2WSE H;  4RES B;  2N1T A;  2WSC H;  1YYC A;  3H6P A;  3MD0 A;  5KTB A;  1IFN A;  1H89 A;  2HPC A;  3RK3 C;  1J1D C;  1N86 A;  1URQ A;  2NPS C;  4AUW A;  4HYT B;  5AVT B;  3HUS A;  2GM4 A;  3I5C A;  2IPP A;  3VP9 A;  3O8Z A;  1T3U A;  2FYU K;  5AW1 B;  1WRG A;  2KOG A;  3TYY A;  5APQ A;  1H8A A;  2YO3 A;  1RE4 C;  1GZL A;  4W80 A;  3U1A A;  1WT6 A;  3RL0 B;  1GK4 A;  1CI6 B;  1SFC B;  5AW4 B;  3A7O A;  5KJ7 D;  1S9K D;  3EFG A;  4LC1 A;  5AVY B;  1NTM K;  3RK2 B;  1N7S B;  2P1J A;  1HGV A;  5AVX B;  1NKZ B;  5CCH C;  2OYH A;  3M06 A;  2O1J A;  2KB7 P;  3P8M C;  3V2Q A;  4DZO A;  3U59 A;  1FJP A;  2WWW A;  4C7N B;  5CJ4 A;  4AYC A;  2FFD B;  1LT9 C;  1H88 A;  1KIL B;  1KFM A;  3VTP C;  1IFI A;  1FZC B;  2A45 H;  3MIW A;  2YKP A;  1DEB A;  1LGH B;  4C7R A;  3GHG A;  5KJ7 A;  2QM7 A;  5AVW B;  3A5T A;  1G1I A;  3M9B A;  3M91 A;  1NO4 A;  3KPE A;  3C9I A;  1JY2 N;  2A45 I;  1L4A D;  2HLO A;  5AVV B;  1PFI A;  1IC2 A;  4M3L A;  2POH A;  1T3J A;  1QL2 A;  2CPB A;  3LID A;  3HTK A;  1X9V A;  3WMM 0;  2R3C A;  1X79 B;  3OA7 A;  5AVS B;  3II6 A;  1N73 B;  3KDP B;  5AVZ B;  2I1J A;  3RL0 C;  2WT7 B;  1SFC C;  3HD7 D;  3L4F A;  5AW7 B;  1RF0 A;  2WZ7 A;  1N2D C;  1N7S C;  1L4A A;  1FOS F;  1E5W A;  2LKM A;  3BRV B;  5AW5 B;  4ZKP A;  5CCG C;  1JOC A;  3KYQ A;  3M0D A;  1LTG C;  2W27 A;  4W7Y A;  1KIL C;  1AQ5 A;  2HFE D;  1A02 F;  2YMY A;  3T97 A;  2N1T B;  3HD7 A;  3OJA B;  1SP4 A;  4WB4 A;  1HJB A;  2HPC B;  1CW5 A;  3V2P A;  3B5N D;  2XZR A;  1URQ B;  1NTZ K;  1Z56 A;  1ZLL A;  3P8C E;  4O9B A;  2HG5 D;  1JCD A;  3V2N A;  4KHX A;  2R32 A;  2VRS A;  3HUS B;  1IFJ A;  2IFM A;  5AW2 B;  3BAT A;  1FZB A;  3TK1 A;  4I2L C;  3VP8 A;  2E43 A;  3P7K A;  5APT A;  3BAS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...