2ZJSE

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
ARAELARVTWPTREQVVEGTQAILLFTLAFMVILGLYDTVFRFLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein transport/immune system
molecule keywords Preprotein translocase SecY subunit
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1030 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase secy subunit 2zjsE00
2ZJSE
chains in the Genus database with same CATH superfamily
2QJKB 5KAFE 1L0ND 2IBZE 2V7QJ 2E74B 2QIWA 2WSEH 2Q6QA 2R32A 2ZVNB 1AJYA 3E1RA 5CJ0A 1KD1Q 3CLQA 1U7MA 5KLIB 1GTWA 3V4WA 3LW5J 1BE3D 3VN0A 3VMAA 5B66E 1IJDB 1ZV8A 1Y8AA 1K05A 1KYOD 2R5DA 2OTLP 1Z56A 3IFMA 1ZMEC 3RK2B 1AVYA 1P84H 2WTYA 2M3BA 2YO3A 3AECC 1JMMA 1KILD 2HPCB 3CD6P 1SQPG 3MHVA 1JY3N 5APYA 1L2PA 4N3YB 4DZOA 1SQQD 2W90A 2H89C 3GHGC 3CXHE 1L4AC 1M57D 4AUWA 1BSHA 1AVOA 3GHGA 2ZVOB 3TSIA 1NTKJ 1L4AA 1KB9E 1GW4A 2W6JH 4PD4D 1SQXG 5E79E 3KDPB 1J1EB 3L72J 3VP8A 3CCRP 1IFMA 2KIKA 1N7SB 1UIXA 3V6IA 3WUTA 4XFJA 2HYNA 2PRRA 2YO2A 3H1ID 1L0LJ 3L73G 1FJKA 3G3ZA 1MV8A 1EZVG 1NTMK 2WPQA 2K9YA 1YYCA 1FZFA 1FS0E 1SQPE 2WSSH 4L75A 1HGZA 4ASVA 1IK9A 2M5AB 3E7KA 4GIFA 1G2CA 1PGJA 2I1KA 2KP8A 4KJMA 3S9OA 1VQ6P 2VRSA 1SQBD 3H1KJ 3L70D 5M1BA 3GW6A 2E43A 1SQXE 5CBNA 4TT3H 2IDBA 1OMIA 3I56P 1SQXK 2O1KA 3TNUB 3FXDA 2YIUB 1K04A 2FYUG 1KC8Q 3OJAB 3ABVC 1L0NG 2XZRA 3L73E 3TNUA 1NAYA 3FWLA 2WWWA 3KQGA 3B5ND 1EZVE 2N1TB 1LGHB 5AVQB 4H44C 3G9RA 2N1TC 1BE3G 3OA7A 3CX5I 3AE4C 4WBAA 2N1TA 3Q1MA 1FE6A 2PAJA 4H13B 2K9JA 4N78E 3RK3B 1URQD 1BCCD 4LLHA 1LTAC 1Y47A 1VQMP 3H1HJ 4OGQB 1KN7A 1JTHB 2E76D 4WY4C 2KZJA 3L72E 1JCDA 1EC5A 1SQQG 3AE3C 1LJ2A 3VMYA 4WY4A 3Q5PA 2ZT9D 4EIJA 4JYBA 5KAFH 1S9KD 1RQUA 2FYUE 2IFNA 3MUDC 3U1CA 4U3FD 1H8AA 3GF7A 2FY8A 1L0NE 4WVZA 4K35A 3UIAA 5APTA 3MUDA 5AW9B 1L0NK 1NTZJ 4EYYQ 1NU1D 2OGUA 1Q86Q 1FDMA 3CMEP 3CL3D 3M9QA 1DEEG 3TYYA 2KXPB 4NPEA 1FOSF 1S1CX 3L75D 2FYZA 1BGYJ 1ZXGA 1EDIA 3M9HA 1QLED 2Z4EA 1KYOE 3KPEA 3M91A 5CHXA 4I1LA 3WU2E 2OQQA 3T97B 1SFCD 2HLOA 2E5YA 1FAVA 1RE4C 4H0LB 2H88C 3BCCJ 3CXHH 2AXCA 5BVZA 1OIPA 1HTLC 1MUUA 3TGUG 3T97A 1SQQE 4NPFX 1T2KD 1YJNP 1SQQK 2QJPB 1RE3C 1M1JC 3EWKA 3MIWA 3KZIE 1N73B 3KHUA 1SQBG 3L70G 1QVFO 1RE3A 5E79H 1M1JA 1N73C 1K9MQ 3EFGA 1VF5D 3RL0B 1N73A 1IC2A 3RBXA 2Z5IA 1GU5A 2JWDA 4W7ZA 1D7MA 4L73A 1NWQA 1VQ8P 1KFMA 2Q9IA 1PGPA 2YMKA 3MD0A 1OZHA 5KKZB 1MZ9A 1FZBA 2GA1A 2A45I 4IL6X 2BCCD 1RF1B 2I1JA 4PV1B 1E79H 2Y9YA 4ZKPA 1DH3A 5AVVB 4N6JA 2FFDB 1EXJA 3AEDC 4JQ0D 2L91A 1SP4A 3JCUE 1RF1A 5TJHA 1GU4A 5AW2B 1SQVD 3TGUE 2D2CC 1VF5B 2V7QH 1FU1A 4YXWH 2YKOA 1JCCA 2J58A 4UB8E 1BCCG 3CCMP 4Z1MH 2H8PD 1AQ5A 3FXEA 5EFWB 2XDJA 1SQBE 1NJIQ 2B87A 4ZKUA 3L74D 1RQVA 1DIPA 4RKUJ 3LW5H 3CWBG 1MKMA 1SQBK 2RKLA 4R4LA 3M0AA 2JKVA 2E75D 5CCGD 3KYQA 3WUUA 2P67A 1S5LX 2WMMA 1BGYE 4L76A 3CCQP 3H1LD 4U3FG 2OYIC 4IFDK 1KQFB 1NKNA 3HRNA 3PH0A 2OYIA 1J1DB 2OYHC 1AA0A 1YJWP 3HE5B 4C7RA 3ZDMA 2OYHA 3TDKA 3L75G 4OWFA 1DX7A 3L71G 1LT9B 3S1KA 3HE5A 1BCCE 2QVAA 2JWAA 3H32B 2WITA 3CCJP 3IN6A 1LT9A 2G8YA 3AE7C 1NTKD 1YBKA 3CWBE 1SQPJ 1FZCB 3IF4A 4Y99C 4BXLA 2XV5A 2JO1A 3NMDA 3C1LA 3HD7C 3GMAA 3AEBC 3V2PA 1OFCX 2QJKC 4U3FE 1H0TA 3HD7A 3U59A 1NKZB 2NPSB 1JY2P 1L0LD 2E74C 3CI9A 1SQXJ 5B5EE 1VQKP 4ZNCA 2RH0A 5KLIC 1L4AD 3A0HE 1FZEA 1USDA 1NU1K 3JC22 2W6AA 1FBMA 1OW8A 5AW7B 3QWOC 2IFMA 3FWNA 1NTMG 3L71E 1ZW0A 3L73J 3WU2H 3BVHA 2BCCG 4MN4C 1PZQA 2H43A 1OVRA 5CMZA 1HUCA 3V4QA 1M7LA 3RK2C 3H1KD 2AXTE 1SLQA 2OYOA 2WPSA 1M56D 2LKMA 2WZ7A 5TISE 4XA4A 4KT0J 3OAKA 1P84D 1YI2P 4EDFA 3VOPA 2HPCA 1HGVA 1GK4A 3KZIH 1VQ5P 2G3AA 1MFTA 2E5TA 4IL6E 5KLVD 1BDDA 1VQOP 3L74G 1RH5B 3IAOA 1HWTC 2W8ZA 3I55P 1J1EC 2FKWB 2FXMA 2YXQB 2FXPA 2CPSA 2KOGA 1K73Q 1KILB 2O01J 4PJ0E 1N7SC 2Q3EA 2FYUJ 3D6ZA 3H1LG 2Z5HA 3CPWO 1GL2D 1L0NJ 1NTME 3G4SP 1N7SA 1LWUB 1DD4A 4JBZA 4UB6E 1FZAA 1A02J 4U7JA 2WT7B 2OTJP 3H1HD 1IO4A 3EFFK 2KZIA 1BE3J 2N9YB 1S5LE 2AEMA 4UB8H 3P8CD 3CX5E 4A7PA 1HVVA 1IFJA 2ZYGA 1VQPP 1SQVK 4GDOA 2M5AA 4D6TD 1PGQA 4H44D 4IFMA 3SFDC 2LXCB 5AVZB 4WWIA 3L74E 2XNXA 1PP9G 1LTJB 1GL2B 3M06A 1SQQJ 3AE2C 1NTZD 2YIUC 1LTGC 1IK7A 3B8EB 1WRGA 1KQSO 2GUSA 3H1LE 3P8MC 4JF7A 4KHXA 1MFZA 4WY4D 5APWA 3SWFA 2KS1B 1BDCA 1RHZB 4DJGA 5AVSB 2KLUA 2PP6A 2QM7A 1NOHA 4GODA 3U1AA 3A3YB 3CCUP 2ZXEB 5AVWB 3F89A 1JUNA 3BCCD 2C0XA 4H13C 3RK3C 1VDFA 2A45G 5L8RJ 4QMAA 4OGQC 2K3RA 1ZOYC 1X79B 3PTZA 1T3JA 2V4HA 3PLNA 1PP9E 2H7HA 1JTHA 3B5NB 1EQ7A 1PPJD 2I8DA 4AQRD 1NTKK 3MP7B 3TGUJ 4ASWA 3CMAP 2OTKE 5KLVG 3CC4P 3Q2YA 1SQBJ 3L70J 2QJYB 5B5EH 1OXZA 5AW3B 3EQ2A 1URQB 1T6AA 1QEXA 5B66H 3BRTB 3KXDA 3A0HH 1L0LK 1BE3E 3PRJA 4JPZB 1RF0C 2K1AA 2E76B 2QE7H 3H1IG 2C9NY 4BRYB 1RF0A 4IFFA 5KJ7D 1JMBA 1GW3A 1N8RQ 2QRXA 2ZT9B 2L5GB 1YITP 2RMZA 4EOTA 1XTGB 1EDKA 3I5CA 3GG2A 1KILE 2WPRA 5TISH 3LIEA 5AW6B 3A2AA 5AVYB 3D70A 1FC2C 4H0LC 1X8YA 1R8EA 1TU3F 1KB9H 4IL6H 3FGAD 3AEFC 2BEQD 1QX8A 2QJPC 3IR9A 1BCCJ 3CXHD 3CC2P 3SWKA 3N4XA 4D6TG 2J59M 4WB4A 2SPZA 4PD4E 5KLVK 1K8AQ 5APXA 3CWBJ 1W5CE 3RL0C 1Q82Q 2JEEA 2JJLA 1RY3A 1NVOA 2D2CD 1SFCB 1JOCA 1VQLP 1CI6B 4YTPC 2Y0EA 3H1JD 4RO0A 5APQA 1QL2A 2KYVA 3H1IE 2POHA 4U3FJ 1U57A 4UB6H 3HUSB 3NFQA 5KKZC 2Q1KA 1KQGB 1VQ7P 2B89A 1RF1C 4PV1C 2IZ0A 1T2KC 1G1IA 1S5LH 3Q5SA 3HE4B 2FFDC 1W2BO 1P84I 3CX5H 3L75J 2A06D 2J5UA 2FFDA 3L71J 1SQPD 3P8CE 1X0TA 1VF5C 2WSCJ 2WSFJ 2KSEA 2KSJA 3AEEC 4YPCA 3L70E 2JDIH 1LTSC 4EI2A 3VYIA 1PIXA 4RJTA 1VPCA 3O8ZA 1LP1B 1T8ZA 1U7JA 4GKGA 3AE1C 1CSBA 4IOIH 4LGDE 1NTZK 2LR2A 4AYCA 4ZMDA 2IX7C 1UIIA 1USEA 2ZFCA 4DCKA 1N86A 1N2DC 4W7YA 4C7NB 5CCHC 2HODB 2MKVA 1NU1G 1X9VA 4TLFA 1EDJA 2FYNB 1J1DC 2O3JA 2AEJA 3WMM0 4W80A 5CCHA 1S4XA 2Q7CA 3F5HA 1GD2E 3HD7D 2HODA 1JY3P 2N9BA 4I7ZB 3CCLP 2O1JA 2E75B 1NTMJ 1LT9C 3USSA 2YKQA 3D6YA 2KUBA 2E74D 2BCCJ 4N78D 1KORA 4XE5B 3BRVB 5AW0B 3A7OA 3V5BA 5CCGA 1GZLA 2YNYA 2W6BA 3O6QB 4I6MC 3H32A 2O01H 2M0BA 1FZCC 1ZR4A 1IFDA 3B4SA 1NO4A 1PGOA 1PFIA 3L72D 3VMXA 1S9KE 2M3EA 1FZCA 2Y0DA 3O6QA 3CCSP 1JY2O 1Q81Q 2XKMA 2FYUD 3RK2D 1OVVA 3W67A 3V2QA 2NPSC 3L74J 3QH9A 1NU1E 5H2FE 1NYHA 5GTHE 1OW7A 3Q5RA 1GMJA 2NPSA 2IYOA 2YKPA 3D71A 5BU8B 3H1JG 1S72P 3L75E 1KYOH 2HFED 1CW5A 3R4YA 4GOEA 3H1LJ 3B71A 1YJ9P 1IFPA 2A45H 2P7JA 1ZRTD 3SFEC 3AE6C 2C0WA 2WQYC 1M90Q 3TK1A 4CPGA 1PL5A 3AE5C 3L35A 2CK3H 2M8RA 5KAIE 2OARA 1FJPA 1N7SD 1S3JA 1SQVG 1YTZT 2A06G 4BWNA 2FBWC 1OWAA 3GHGB 2IYPA 2W27A 3PHLA 1L4AB 3MGNA 4R4MA 2ZJSE 4PD4H 3GLMA 2Y0CA 2IBZI 1WMKA 1IZNB 5AW8B 2ZYDA 2GUVA 1QGKB 1PP9J 2R44A 3S4RA 3PJSK 1SS1A 5AW1B 3V2NA 1NH4A 5CBOA 3G6EP 3H1JE 1KILC 1X22A 2C9LY 3VMZA 3L36A 2BCCE 1KILA 3TF5A 1YQ4C 2IZ1A 4L74A 3RGUA 3SSUA 1LWUC 1JY2N 3H25A 3JCUH 2RN0A 1ZN5A 1LWUA 4Y28J 2WSEJ 1Q7YQ 5KTBA 1SQVE 2WT7A 1G2CB 2XNDH 1IFNA 2A06E 3CXHI 2Q3IA 4HB1A 2QEXP 3TGUD 1SQPK 3II6A 2N1TD 1KB9I 1OW6A 1NTKG 1M1KQ 1IFIA 1VQ4P 2O01N 2R5BA 3W68A 5AVRB 4M3LA 1AV1A 3G71P 1LTJC 1GL2C 4HJGH 3L72G 1LTJA 4H13D 3RK3D 1GL2A 5DJTB 1GK6A 3RBZA 4OGQD 5KLVJ 1BGYD 1L0LG 1VQNP 2HG5D 4GOFA 1J2JB 2K37A 1M8OB 3HTKB 4O9BA 2UWJE 1H88A 2HR3A 3WUVA 4H44B 1QL1A 2BASA 1HBWA 2GM4A 2KS1A 1EDLA 1S2EA 3A0BE 2K9JB 3H1IJ 5GTIE 1FZGA 5AVXB 3HTKA 4GT1A 1LTIC 1NAFA 3SWYA 1NGMB 5APVA 2KNCB 2P1JA 3JSVC 4HKZH 2IPPA 2P10A 2ZYAA 1T3UA 3H1KG 2MJZA 1NTKE 1Q90D 1G1JA 1LTBC 4WY4B 2R3CA 2KNCA 1ZR2A 4DT0A 1CZQA 3B5NC 1KMIZ 2CPBA 3CWBD 5BU5A 4OH8B 3P7KA 1KZUB 3B5NA 1N7LA 4C46A 4D6TJ 5H2FH 2IBZD 1L0LE 5AW4B 1A02F 2QJYC 1BSNA 5AVUB 5GTHH 1EZVI 4H0LD 1URQC 2FYUK 2NRGA 4I2LC 1AQTA 3C8VA 3MTUE 1URQA 2XU6A 2WSCH 2WSFH 2E76C 1KQLA 5C39A 2QA4P 3FX0A 3AE9C 3VP9A 1FOSE 1QVGO 1YTZI 3ITKA 1WT6A 3CCEP 2AEFA 1YQ3C 2ZT9C 4BRYA 3L71D 2AXTH 3RL0D 1ZRTE 5KAIH 3H1HG 3OW2O 2ITAA 3H1KE 5APUA 1DD3A 1P84E 1YHQP 1W2EA 3NTNA 4K3AA 1XTCC 3PP5A 3L37A 2QG4A 4HYTB 2JR8A 4HH2A 1LT1A 5KLVE 1RE4A 3LIDA 1M1JB 1ZP0C 1KV4A 4PV1D 2YXRB 3BASA 2FXOA 3MZWB 2R3SA 1KB9D 1Y9BA 3V2RA 5KJ7C 1NTZG 4PJ0H 2B88A 2W83C 3H6PA 1VL2A 1ZLLA 3A5TA 5K5GB 4LC1A 1SFCC 2JP3A 5KJ7A 5DJUB 1E5WA 3AE8C 2NZ2A 1SFCA 3L4FA 2KB7P 1BGYG 1CI6A 2KI7B 4YXDC 1KYOI 3HUSC 2BEZF 3VTPC 1NTMD 1OVUA 1NU1J 5AVTB 3P32A 1JM0A 3GF3A 3HUSA 3H1HE 1Q2NA 1H89A 5APSA 4JYCA 3BCCG 4B86A 3HE4A 2D2CB 5CCHD 3CX5D 2B87B 4D6TE 2ZXXA 2P58A 1JB0J 2B9BA 1EXIA 2ZAEB 2LXBA 1PV3A 5AW5B 4PD4I 1FDOA 2WPVB 1PPJG 1SQXD 1LNQA 1NTZE 1HH0A 2YMYA 1LP1A 3K5BA 3M9BA 3RK3E 2E42A 1JO5A 2DW3A 3AEGC 3CC7P 2OYIB 1JEKA 2IBZG 2PGDA 3L73D 1HF9A 2QM8A 1SVFA 3BATA 2FYNC 3N7NA 1EZVD 1GDTA 2OYHB 3E1IA 1JY3O 4C7NA 1LTTC 4NPDA 3A0BH 2QSIA 3M0DC 3AEAC 5GTIH 1VQ9P 3H1JJ 1FDIA 4I7ZC 3BCCE 3M0DA 1JNMA 1R5SA 1YIJP 2E75C 5CCGC 2NPSD 2PFXA 2K88A 2WVRA 4RESB 1R5LA 4DOJA 1KTMA 4OVNF 2Q5UA 1NHLA 3NXSA 1PPJE 2KLVA 5CJ4A 2KK7A 1SQVJ 3Q3DA 1HJBA 4Y99B 1PP9D 2Y9ZA 1KFNA 1DEBA 2P2UA 1H0TB 3HD7B 3C9IA 1AFOA 1OX3A 3CCVP 3R2PA 3RL0g 1HJ0A
chains in the Genus database with same CATH topology
2ZJSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJS E; 
#chains in the Genus database with same CATH topology
 2QJK B;  5KAF E;  1L0N D;  2IBZ E;  2V7Q J;  2E74 B;  2QIW A;  2WSE H;  2Q6Q A;  2R32 A;  2ZVN B;  1AJY A;  3E1R A;  5CJ0 A;  1KD1 Q;  3CLQ A;  1U7M A;  5KLI B;  1GTW A;  3V4W A;  3LW5 J;  1BE3 D;  3VN0 A;  3VMA A;  5B66 E;  1IJD B;  1ZV8 A;  1Y8A A;  1K05 A;  1KYO D;  2R5D A;  2OTL P;  1Z56 A;  3IFM A;  1ZME C;  3RK2 B;  1AVY A;  1P84 H;  2WTY A;  2M3B A;  2YO3 A;  3AEC C;  1JMM A;  1KIL D;  2HPC B;  3CD6 P;  1SQP G;  3MHV A;  1JY3 N;  5APY A;  1L2P A;  4N3Y B;  4DZO A;  1SQQ D;  2W90 A;  2H89 C;  3GHG C;  3CXH E;  1L4A C;  1M57 D;  4AUW A;  1BSH A;  1AVO A;  3GHG A;  2ZVO B;  3TSI A;  1NTK J;  1L4A A;  1KB9 E;  1GW4 A;  2W6J H;  4PD4 D;  1SQX G;  5E79 E;  3KDP B;  1J1E B;  3L72 J;  3VP8 A;  3CCR P;  1IFM A;  2KIK A;  1N7S B;  1UIX A;  3V6I A;  3WUT A;  4XFJ A;  2HYN A;  2PRR A;  2YO2 A;  3H1I D;  1L0L J;  3L73 G;  1FJK A;  3G3Z A;  1MV8 A;  1EZV G;  1NTM K;  2WPQ A;  2K9Y A;  1YYC A;  1FZF A;  1FS0 E;  1SQP E;  2WSS H;  4L75 A;  1HGZ A;  4ASV A;  1IK9 A;  2M5A B;  3E7K A;  4GIF A;  1G2C A;  1PGJ A;  2I1K A;  2KP8 A;  4KJM A;  3S9O A;  1VQ6 P;  2VRS A;  1SQB D;  3H1K J;  3L70 D;  5M1B A;  3GW6 A;  2E43 A;  1SQX E;  5CBN A;  4TT3 H;  2IDB A;  1OMI A;  3I56 P;  1SQX K;  2O1K A;  3TNU B;  3FXD A;  2YIU B;  1K04 A;  2FYU G;  1KC8 Q;  3OJA B;  3ABV C;  1L0N G;  2XZR A;  3L73 E;  3TNU A;  1NAY A;  3FWL A;  2WWW A;  3KQG A;  3B5N D;  1EZV E;  2N1T B;  1LGH B;  5AVQ B;  4H44 C;  3G9R A;  2N1T C;  1BE3 G;  3OA7 A;  3CX5 I;  3AE4 C;  4WBA A;  2N1T A;  3Q1M A;  1FE6 A;  2PAJ A;  4H13 B;  2K9J A;  4N78 E;  3RK3 B;  1URQ D;  1BCC D;  4LLH A;  1LTA C;  1Y47 A;  1VQM P;  3H1H J;  4OGQ B;  1KN7 A;  1JTH B;  2E76 D;  4WY4 C;  2KZJ A;  3L72 E;  1JCD A;  1EC5 A;  1SQQ G;  3AE3 C;  1LJ2 A;  3VMY A;  4WY4 A;  3Q5P A;  2ZT9 D;  4EIJ A;  4JYB A;  5KAF H;  1S9K D;  1RQU A;  2FYU E;  2IFN A;  3MUD C;  3U1C A;  4U3F D;  1H8A A;  3GF7 A;  2FY8 A;  1L0N E;  4WVZ A;  4K35 A;  3UIA A;  5APT A;  3MUD A;  5AW9 B;  1L0N K;  1NTZ J;  4EYY Q;  1NU1 D;  2OGU A;  1Q86 Q;  1FDM A;  3CME P;  3CL3 D;  3M9Q A;  1DEE G;  3TYY A;  2KXP B;  4NPE A;  1FOS F;  1S1C X;  3L75 D;  2FYZ A;  1BGY J;  1ZXG A;  1EDI A;  3M9H A;  1QLE D;  2Z4E A;  1KYO E;  3KPE A;  3M91 A;  5CHX A;  4I1L A;  3WU2 E;  2OQQ A;  3T97 B;  1SFC D;  2HLO A;  2E5Y A;  1FAV A;  1RE4 C;  4H0L B;  2H88 C;  3BCC J;  3CXH H;  2AXC A;  5BVZ A;  1OIP A;  1HTL C;  1MUU A;  3TGU G;  3T97 A;  1SQQ E;  4NPF X;  1T2K D;  1YJN P;  1SQQ K;  2QJP B;  1RE3 C;  1M1J C;  3EWK A;  3MIW A;  3KZI E;  1N73 B;  3KHU A;  1SQB G;  3L70 G;  1QVF O;  1RE3 A;  5E79 H;  1M1J A;  1N73 C;  1K9M Q;  3EFG A;  1VF5 D;  3RL0 B;  1N73 A;  1IC2 A;  3RBX A;  2Z5I A;  1GU5 A;  2JWD A;  4W7Z A;  1D7M A;  4L73 A;  1NWQ A;  1VQ8 P;  1KFM A;  2Q9I A;  1PGP A;  2YMK A;  3MD0 A;  1OZH A;  5KKZ B;  1MZ9 A;  1FZB A;  2GA1 A;  2A45 I;  4IL6 X;  2BCC D;  1RF1 B;  2I1J A;  4PV1 B;  1E79 H;  2Y9Y A;  4ZKP A;  1DH3 A;  5AVV B;  4N6J A;  2FFD B;  1EXJ A;  3AED C;  4JQ0 D;  2L91 A;  1SP4 A;  3JCU E;  1RF1 A;  5TJH A;  1GU4 A;  5AW2 B;  1SQV D;  3TGU E;  2D2C C;  1VF5 B;  2V7Q H;  1FU1 A;  4YXW H;  2YKO A;  1JCC A;  2J58 A;  4UB8 E;  1BCC G;  3CCM P;  4Z1M H;  2H8P D;  1AQ5 A;  3FXE A;  5EFW B;  2XDJ A;  1SQB E;  1NJI Q;  2B87 A;  4ZKU A;  3L74 D;  1RQV A;  1DIP A;  4RKU J;  3LW5 H;  3CWB G;  1MKM A;  1SQB K;  2RKL A;  4R4L A;  3M0A A;  2JKV A;  2E75 D;  5CCG D;  3KYQ A;  3WUU A;  2P67 A;  1S5L X;  2WMM A;  1BGY E;  4L76 A;  3CCQ P;  3H1L D;  4U3F G;  2OYI C;  4IFD K;  1KQF B;  1NKN A;  3HRN A;  3PH0 A;  2OYI A;  1J1D B;  2OYH C;  1AA0 A;  1YJW P;  3HE5 B;  4C7R A;  3ZDM A;  2OYH A;  3TDK A;  3L75 G;  4OWF A;  1DX7 A;  3L71 G;  1LT9 B;  3S1K A;  3HE5 A;  1BCC E;  2QVA A;  2JWA A;  3H32 B;  2WIT A;  3CCJ P;  3IN6 A;  1LT9 A;  2G8Y A;  3AE7 C;  1NTK D;  1YBK A;  3CWB E;  1SQP J;  1FZC B;  3IF4 A;  4Y99 C;  4BXL A;  2XV5 A;  2JO1 A;  3NMD A;  3C1L A;  3HD7 C;  3GMA A;  3AEB C;  3V2P A;  1OFC X;  2QJK C;  4U3F E;  1H0T A;  3HD7 A;  3U59 A;  1NKZ B;  2NPS B;  1JY2 P;  1L0L D;  2E74 C;  3CI9 A;  1SQX J;  5B5E E;  1VQK P;  4ZNC A;  2RH0 A;  5KLI C;  1L4A D;  3A0H E;  1FZE A;  1USD A;  1NU1 K;  3JC2 2;  2W6A A;  1FBM A;  1OW8 A;  5AW7 B;  3QWO C;  2IFM A;  3FWN A;  1NTM G;  3L71 E;  1ZW0 A;  3L73 J;  3WU2 H;  3BVH A;  2BCC G;  4MN4 C;  1PZQ A;  2H43 A;  1OVR A;  5CMZ A;  1HUC A;  3V4Q A;  1M7L A;  3RK2 C;  3H1K D;  2AXT E;  1SLQ A;  2OYO A;  2WPS A;  1M56 D;  2LKM A;  2WZ7 A;  5TIS E;  4XA4 A;  4KT0 J;  3OAK A;  1P84 D;  1YI2 P;  4EDF A;  3VOP A;  2HPC A;  1HGV A;  1GK4 A;  3KZI H;  1VQ5 P;  2G3A A;  1MFT A;  2E5T A;  4IL6 E;  5KLV D;  1BDD A;  1VQO P;  3L74 G;  1RH5 B;  3IAO A;  1HWT C;  2W8Z A;  3I55 P;  1J1E C;  2FKW B;  2FXM A;  2YXQ B;  2FXP A;  2CPS A;  2KOG A;  1K73 Q;  1KIL B;  2O01 J;  4PJ0 E;  1N7S C;  2Q3E A;  2FYU J;  3D6Z A;  3H1L G;  2Z5H A;  3CPW O;  1GL2 D;  1L0N J;  1NTM E;  3G4S P;  1N7S A;  1LWU B;  1DD4 A;  4JBZ A;  4UB6 E;  1FZA A;  1A02 J;  4U7J A;  2WT7 B;  2OTJ P;  3H1H D;  1IO4 A;  3EFF K;  2KZI A;  1BE3 J;  2N9Y B;  1S5L E;  2AEM A;  4UB8 H;  3P8C D;  3CX5 E;  4A7P A;  1HVV A;  1IFJ A;  2ZYG A;  1VQP P;  1SQV K;  4GDO A;  2M5A A;  4D6T D;  1PGQ A;  4H44 D;  4IFM A;  3SFD C;  2LXC B;  5AVZ B;  4WWI A;  3L74 E;  2XNX A;  1PP9 G;  1LTJ B;  1GL2 B;  3M06 A;  1SQQ J;  3AE2 C;  1NTZ D;  2YIU C;  1LTG C;  1IK7 A;  3B8E B;  1WRG A;  1KQS O;  2GUS A;  3H1L E;  3P8M C;  4JF7 A;  4KHX A;  1MFZ A;  4WY4 D;  5APW A;  3SWF A;  2KS1 B;  1BDC A;  1RHZ B;  4DJG A;  5AVS B;  2KLU A;  2PP6 A;  2QM7 A;  1NOH A;  4GOD A;  3U1A A;  3A3Y B;  3CCU P;  2ZXE B;  5AVW B;  3F89 A;  1JUN A;  3BCC D;  2C0X A;  4H13 C;  3RK3 C;  1VDF A;  2A45 G;  5L8R J;  4QMA A;  4OGQ C;  2K3R A;  1ZOY C;  1X79 B;  3PTZ A;  1T3J A;  2V4H A;  3PLN A;  1PP9 E;  2H7H A;  1JTH A;  3B5N B;  1EQ7 A;  1PPJ D;  2I8D A;  4AQR D;  1NTK K;  3MP7 B;  3TGU J;  4ASW A;  3CMA P;  2OTK E;  5KLV G;  3CC4 P;  3Q2Y A;  1SQB J;  3L70 J;  2QJY B;  5B5E H;  1OXZ A;  5AW3 B;  3EQ2 A;  1URQ B;  1T6A A;  1QEX A;  5B66 H;  3BRT B;  3KXD A;  3A0H H;  1L0L K;  1BE3 E;  3PRJ A;  4JPZ B;  1RF0 C;  2K1A A;  2E76 B;  2QE7 H;  3H1I G;  2C9N Y;  4BRY B;  1RF0 A;  4IFF A;  5KJ7 D;  1JMB A;  1GW3 A;  1N8R Q;  2QRX A;  2ZT9 B;  2L5G B;  1YIT P;  2RMZ A;  4EOT A;  1XTG B;  1EDK A;  3I5C A;  3GG2 A;  1KIL E;  2WPR A;  5TIS H;  3LIE A;  5AW6 B;  3A2A A;  5AVY B;  3D70 A;  1FC2 C;  4H0L C;  1X8Y A;  1R8E A;  1TU3 F;  1KB9 H;  4IL6 H;  3FGA D;  3AEF C;  2BEQ D;  1QX8 A;  2QJP C;  3IR9 A;  1BCC J;  3CXH D;  3CC2 P;  3SWK A;  3N4X A;  4D6T G;  2J59 M;  4WB4 A;  2SPZ A;  4PD4 E;  5KLV K;  1K8A Q;  5APX A;  3CWB J;  1W5C E;  3RL0 C;  1Q82 Q;  2JEE A;  2JJL A;  1RY3 A;  1NVO A;  2D2C D;  1SFC B;  1JOC A;  1VQL P;  1CI6 B;  4YTP C;  2Y0E A;  3H1J D;  4RO0 A;  5APQ A;  1QL2 A;  2KYV A;  3H1I E;  2POH A;  4U3F J;  1U57 A;  4UB6 H;  3HUS B;  3NFQ A;  5KKZ C;  2Q1K A;  1KQG B;  1VQ7 P;  2B89 A;  1RF1 C;  4PV1 C;  2IZ0 A;  1T2K C;  1G1I A;  1S5L H;  3Q5S A;  3HE4 B;  2FFD C;  1W2B O;  1P84 I;  3CX5 H;  3L75 J;  2A06 D;  2J5U A;  2FFD A;  3L71 J;  1SQP D;  3P8C E;  1X0T A;  1VF5 C;  2WSC J;  2WSF J;  2KSE A;  2KSJ A;  3AEE C;  4YPC A;  3L70 E;  2JDI H;  1LTS C;  4EI2 A;  3VYI A;  1PIX A;  4RJT A;  1VPC A;  3O8Z A;  1LP1 B;  1T8Z A;  1U7J A;  4GKG A;  3AE1 C;  1CSB A;  4IOI H;  4LGD E;  1NTZ K;  2LR2 A;  4AYC A;  4ZMD A;  2IX7 C;  1UII A;  1USE A;  2ZFC A;  4DCK A;  1N86 A;  1N2D C;  4W7Y A;  4C7N B;  5CCH C;  2HOD B;  2MKV A;  1NU1 G;  1X9V A;  4TLF A;  1EDJ A;  2FYN B;  1J1D C;  2O3J A;  2AEJ A;  3WMM 0;  4W80 A;  5CCH A;  1S4X A;  2Q7C A;  3F5H A;  1GD2 E;  3HD7 D;  2HOD A;  1JY3 P;  2N9B A;  4I7Z B;  3CCL P;  2O1J A;  2E75 B;  1NTM J;  1LT9 C;  3USS A;  2YKQ A;  3D6Y A;  2KUB A;  2E74 D;  2BCC J;  4N78 D;  1KOR A;  4XE5 B;  3BRV B;  5AW0 B;  3A7O A;  3V5B A;  5CCG A;  1GZL A;  2YNY A;  2W6B A;  3O6Q B;  4I6M C;  3H32 A;  2O01 H;  2M0B A;  1FZC C;  1ZR4 A;  1IFD A;  3B4S A;  1NO4 A;  1PGO A;  1PFI A;  3L72 D;  3VMX A;  1S9K E;  2M3E A;  1FZC A;  2Y0D A;  3O6Q A;  3CCS P;  1JY2 O;  1Q81 Q;  2XKM A;  2FYU D;  3RK2 D;  1OVV A;  3W67 A;  3V2Q A;  2NPS C;  3L74 J;  3QH9 A;  1NU1 E;  5H2F E;  1NYH A;  5GTH E;  1OW7 A;  3Q5R A;  1GMJ A;  2NPS A;  2IYO A;  2YKP A;  3D71 A;  5BU8 B;  3H1J G;  1S72 P;  3L75 E;  1KYO H;  2HFE D;  1CW5 A;  3R4Y A;  4GOE A;  3H1L J;  3B71 A;  1YJ9 P;  1IFP A;  2A45 H;  2P7J A;  1ZRT D;  3SFE C;  3AE6 C;  2C0W A;  2WQY C;  1M90 Q;  3TK1 A;  4CPG A;  1PL5 A;  3AE5 C;  3L35 A;  2CK3 H;  2M8R A;  5KAI E;  2OAR A;  1FJP A;  1N7S D;  1S3J A;  1SQV G;  1YTZ T;  2A06 G;  4BWN A;  2FBW C;  1OWA A;  3GHG B;  2IYP A;  2W27 A;  3PHL A;  1L4A B;  3MGN A;  4R4M A;  2ZJS E;  4PD4 H;  3GLM A;  2Y0C A;  2IBZ I;  1WMK A;  1IZN B;  5AW8 B;  2ZYD A;  2GUV A;  1QGK B;  1PP9 J;  2R44 A;  3S4R A;  3PJS K;  1SS1 A;  5AW1 B;  3V2N A;  1NH4 A;  5CBO A;  3G6E P;  3H1J E;  1KIL C;  1X22 A;  2C9L Y;  3VMZ A;  3L36 A;  2BCC E;  1KIL A;  3TF5 A;  1YQ4 C;  2IZ1 A;  4L74 A;  3RGU A;  3SSU A;  1LWU C;  1JY2 N;  3H25 A;  3JCU H;  2RN0 A;  1ZN5 A;  1LWU A;  4Y28 J;  2WSE J;  1Q7Y Q;  5KTB A;  1SQV E;  2WT7 A;  1G2C B;  2XND H;  1IFN A;  2A06 E;  3CXH I;  2Q3I A;  4HB1 A;  2QEX P;  3TGU D;  1SQP K;  3II6 A;  2N1T D;  1KB9 I;  1OW6 A;  1NTK G;  1M1K Q;  1IFI A;  1VQ4 P;  2O01 N;  2R5B A;  3W68 A;  5AVR B;  4M3L A;  1AV1 A;  3G71 P;  1LTJ C;  1GL2 C;  4HJG H;  3L72 G;  1LTJ A;  4H13 D;  3RK3 D;  1GL2 A;  5DJT B;  1GK6 A;  3RBZ A;  4OGQ D;  5KLV J;  1BGY D;  1L0L G;  1VQN P;  2HG5 D;  4GOF A;  1J2J B;  2K37 A;  1M8O B;  3HTK B;  4O9B A;  2UWJ E;  1H88 A;  2HR3 A;  3WUV A;  4H44 B;  1QL1 A;  2BAS A;  1HBW A;  2GM4 A;  2KS1 A;  1EDL A;  1S2E A;  3A0B E;  2K9J B;  3H1I J;  5GTI E;  1FZG A;  5AVX B;  3HTK A;  4GT1 A;  1LTI C;  1NAF A;  3SWY A;  1NGM B;  5APV A;  2KNC B;  2P1J A;  3JSV C;  4HKZ H;  2IPP A;  2P10 A;  2ZYA A;  1T3U A;  3H1K G;  2MJZ A;  1NTK E;  1Q90 D;  1G1J A;  1LTB C;  4WY4 B;  2R3C A;  2KNC A;  1ZR2 A;  4DT0 A;  1CZQ A;  3B5N C;  1KMI Z;  2CPB A;  3CWB D;  5BU5 A;  4OH8 B;  3P7K A;  1KZU B;  3B5N A;  1N7L A;  4C46 A;  4D6T J;  5H2F H;  2IBZ D;  1L0L E;  5AW4 B;  1A02 F;  2QJY C;  1BSN A;  5AVU B;  5GTH H;  1EZV I;  4H0L D;  1URQ C;  2FYU K;  2NRG A;  4I2L C;  1AQT A;  3C8V A;  3MTU E;  1URQ A;  2XU6 A;  2WSC H;  2WSF H;  2E76 C;  1KQL A;  5C39 A;  2QA4 P;  3FX0 A;  3AE9 C;  3VP9 A;  1FOS E;  1QVG O;  1YTZ I;  3ITK A;  1WT6 A;  3CCE P;  2AEF A;  1YQ3 C;  2ZT9 C;  4BRY A;  3L71 D;  2AXT H;  3RL0 D;  1ZRT E;  5KAI H;  3H1H G;  3OW2 O;  2ITA A;  3H1K E;  5APU A;  1DD3 A;  1P84 E;  1YHQ P;  1W2E A;  3NTN A;  4K3A A;  1XTC C;  3PP5 A;  3L37 A;  2QG4 A;  4HYT B;  2JR8 A;  4HH2 A;  1LT1 A;  5KLV E;  1RE4 A;  3LID A;  1M1J B;  1ZP0 C;  1KV4 A;  4PV1 D;  2YXR B;  3BAS A;  2FXO A;  3MZW B;  2R3S A;  1KB9 D;  1Y9B A;  3V2R A;  5KJ7 C;  1NTZ G;  4PJ0 H;  2B88 A;  2W83 C;  3H6P A;  1VL2 A;  1ZLL A;  3A5T A;  5K5G B;  4LC1 A;  1SFC C;  2JP3 A;  5KJ7 A;  5DJU B;  1E5W A;  3AE8 C;  2NZ2 A;  1SFC A;  3L4F A;  2KB7 P;  1BGY G;  1CI6 A;  2KI7 B;  4YXD C;  1KYO I;  3HUS C;  2BEZ F;  3VTP C;  1NTM D;  1OVU A;  1NU1 J;  5AVT B;  3P32 A;  1JM0 A;  3GF3 A;  3HUS A;  3H1H E;  1Q2N A;  1H89 A;  5APS A;  4JYC A;  3BCC G;  4B86 A;  3HE4 A;  2D2C B;  5CCH D;  3CX5 D;  2B87 B;  4D6T E;  2ZXX A;  2P58 A;  1JB0 J;  2B9B A;  1EXI A;  2ZAE B;  2LXB A;  1PV3 A;  5AW5 B;  4PD4 I;  1FDO A;  2WPV B;  1PPJ G;  1SQX D;  1LNQ A;  1NTZ E;  1HH0 A;  2YMY A;  1LP1 A;  3K5B A;  3M9B A;  3RK3 E;  2E42 A;  1JO5 A;  2DW3 A;  3AEG C;  3CC7 P;  2OYI B;  1JEK A;  2IBZ G;  2PGD A;  3L73 D;  1HF9 A;  2QM8 A;  1SVF A;  3BAT A;  2FYN C;  3N7N A;  1EZV D;  1GDT A;  2OYH B;  3E1I A;  1JY3 O;  4C7N A;  1LTT C;  4NPD A;  3A0B H;  2QSI A;  3M0D C;  3AEA C;  5GTI H;  1VQ9 P;  3H1J J;  1FDI A;  4I7Z C;  3BCC E;  3M0D A;  1JNM A;  1R5S A;  1YIJ P;  2E75 C;  5CCG C;  2NPS D;  2PFX A;  2K88 A;  2WVR A;  4RES B;  1R5L A;  4DOJ A;  1KTM A;  4OVN F;  2Q5U A;  1NHL A;  3NXS A;  1PPJ E;  2KLV A;  5CJ4 A;  2KK7 A;  1SQV J;  3Q3D A;  1HJB A;  4Y99 B;  1PP9 D;  2Y9Z A;  1KFN A;  1DEB A;  2P2U A;  1H0T B;  3HD7 B;  3C9I A;  1AFO A;  1OX3 A;  3CCV P;  3R2P A;  3RL0 g;  1HJ0 A; 
#chains in the Genus database with same CATH homology
 2ZJS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...