2ZJSE

Crystal structure of secye translocon from thermus thermophilus with a fab fragment
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
46
structure length
46
Chain Sequence
ARAELARVTWPTREQVVEGTQAILLFTLAFMVILGLYDTVFRFLIG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Conformational transition of Sec machinery inferred from bacterial SecYE structures
pubmed doi rcsb
source organism Thermus thermophilus
molecule tags Protein transport/immune system
molecule keywords Preprotein translocase SecY subunit
total genus 13
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 2008-03-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00584 SecE SecE/Sec61-gamma subunits of protein translocation complex
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1030 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Preprotein translocase secy subunit 2zjsE00
2ZJSE
chains in the Genus database with same CATH superfamily
1VF5B 1EDJA 1CI6B 4D6TG 1EXIA 2WVRA 1PL5A 3CXHI 5AW1B 3AE9C 1E79H 1LTJB 2NRGA 2NPSB 2QE7H 2FYUJ 3BATA 4H0LB 3AE5C 2OTJP 2YIUC 3OW2O 3Q5SA 3M06A 1SFCA 3L36A 3A5TA 1BGYD 1JY2N 1GMJA 2KP8A 2IYPA 4IOIH 1J1DB 3CXHE 2R3SA 4WBAA 3VYIA 3L72J 1NTKE 3O8ZA 3ZDMA 5E79H 1SQVJ 2RMZA 3D71A 5APXA 1OVUA 3N4XA 2O3JA 3B4SA 1DH3A 2POHA 5APYA 3H25A 3CC4P 3OAKA 3TF5A 1H0TA 3L70E 1AA0A 2BCCD 3H1LE 3K5BA 4ZKUA 2HPCA 2BEQD 3H6PA 1KYOD 4U3FG 5KAIH 1PPJE 2G8YA 3PTZA 4GDOA 2HODB 4OGQB 1KV4A 3GHGA 3HUSA 4HH2A 2KOGA 2WPQA 2KSEA 1NTZK 2P7JA 1CZQA 3CPWO 3CCVP 2WSCJ 2GA1A 1OWAA 4LC1A 3AE1C 5APSA 1YQ4C 3VMAA 1KB9H 3GF7A 5APUA 4DZOA 1BGYJ 2A45H 2IZ0A 2Y0DA 3HD7D 1MFZA 4WY4C 5CCGC 5KJ7C 2B87A 3SSUA 1VF5C 3L72D 1N7SC 3L37A 2YO3A 1S4XA 1PPJD 1SQQG 2DW3A 2L91A 4XE5B 1JTHA 5B66E 5AVUB 2D2CD 1KILB 1N7LA 1NTMJ 1OXZA 1PGOA 1YTZI 2E74B 3L70G 3QWOC 4H13C 3RL0B 5AVXB 2C9LY 4RO0A 4H0LD 5APVA 4RKUJ 1EZVE 4C7NB 3CC2P 3LIEA 2V7QJ 1T6AA 1SQVK 3P8MC 1MZ9A 1NTZD 3H32B 4IFFA 3V2NA 3BVHA 2NZ2A 1VQ6P 1KQFB 3H1KE 2KS1A 3JC22 3RK3E 1XTGB 5KAFE 1P84E 2WTYA 3CC7P 1E5WA 1QL2A 3MGNA 2E74D 1JY3P 1S9KD 1JCDA 3L75G 5BVZA 1JO5A 1OW8A 3MZWB 4DT0A 3Q5RA 1L4AD 4WB4A 1R8EA 4BRYB 1U7JA 2PGDA 1CW5A 1PIXA 1IK7A 2FYUD 1SS1A 2QJKB 5K5GB 4DOJA 3CCUP 2IZ1A 1EQ7A 1LTBC 2ZVOB 2P67A 3BRTB 2L5GB 2BEZF 1HBWA 1D7MA 2FYUG 2OYHA 1VL2A 4PJ0H 4EOTA 1N7SB 1NTMK 2IBZG 2AEFA 3R4YA 4AQRD 3CCQP 2GM4A 2FYNB 4C7NA 5AW2B 3Q1MA 1RF1B 4QMAA 3H1LG 3HRNA 1YITP 3P32A 2I1JA 1AJYA 1CSBA 1M1JC 1KB9I 1FE6A 1HJBA 3G3ZA 1N8RQ 1GW3A 3CMEP 3A0HE 1S5LE 2W27A 1JEKA 2FYUK 2WSEJ 5APQA 1AVYA 1L0NJ 5APTA 3L73J 5APWA 3RK2B 3TSIA 1FZBA 1N7SA 1NU1J 1GU5A 4XA4A 1URQA 2JJLA 3BASA 2FY8A 3W68A 5CBOA 5TISH 4OGQD 2WSEH 1EDKA 4CPGA 1Q90D 1N7SD 3E1IA 1ZR2A 2R5DA 2KI7B 5DJUB 1FZFA 2G3AA 2FFDC 1L4AC 4R4MA 1K05A 5AW8B 2NPSD 3A3YB 1L0LE 3L71J 3V4WA 1BE3D 1A02J 3PJSK 2M0BA 1NH4A 4KJMA 1M1KQ 4NPDA 3U59A 3H1JE 2E74C 4H13B 3V2PA 1EZVG 2J5UA 2HFED 2JWDA 2M8RA 2P58A 4PV1D 4TLFA 3H1ID 4ZMDA 1N2DC 4H0LC 1VQOP 3HTKA 1JY2O 2H88C 3TK1A 2HYNA 3V6IA 2QJPC 1OFCX 4D6TD 1VQ8P 1IK9A 4UB8E 3JSVC 5GTIH 1IZNB 1JY3O 2CPSA 1FAVA 2XU6A 4PD4I 2QM8A 2W6AA 3B5ND 2E42A 4ASVA 5KAIE 1G2CA 1M1JB 1SQXJ 1J2JB 2C0WA 1BCCE 3V5BA 1JY3N 3M9QA 2QJYB 1FZCB 1HGVA 2OGUA 5CMZA 1KTMA 1X9VA 3PHLA 3H1HJ 1USDA 1JMMA 1W5CE 2E76C 3PH0A 1Q7YQ 1Q82Q 1WMKA 2IFMA 2H8PD 3GF3A 1LWUA 5AW5B 5CCHC 5AVVB 2YKPA 3CCSP 1SQQK 2O01N 1NO4A 4OWFA 5CJ4A 5GTHE 2ZYGA 1M1JA 1M56D 2Y0EA 4EYYQ 2FKWB 4IL6H 3RGUA 1FU1A 4Y28J 4ZKPA 1FZGA 1RF1A 1U57A 3AE6C 2XNXA 2M3EA 4U3FE 1L4AA 1QX8A 2IBZE 5EFWB 2ZYDA 3ITKA 3IAOA 1NTMD 5B66H 3RL0D 4D6TJ 4YXWH 4I2LC 1IJDB 3GG2A 5AW4B 1KILD 1LTTC 1YQ3C 2C9NY 4B86A 3NMDA 2ZXEB 1EDIA 5AW0B 1LTSC 1P84I 4PV1B 1L0LK 2FXPA 1PFIA 1PP9D 1NOHA 1EZVD 2O01J 4WVZA 1G1IA 1OZHA 1SQQD 1X8YA 3WUTA 2N1TB 1SQPE 5CBNA 1AV1A 3IR9A 1OVRA 1EDLA 1ZN5A 3L73G 4W80A 1L0NG 3D70A 2KSJA 2QG4A 3SWYA 1QEXA 4I1LA 1KILC 1L0LG 3NTNA 1IFPA 4MN4C 4N6JA 4N78D 5M1BA 1BE3J 3AEDC 4I6MC 1BE3G 2O1KA 3U1CA 1NTKK 2YO2A 1VQPP 3CX5H 3HE5B 1HVVA 2LR2A 2LXCB 3TNUB 3MD0A 5KLIC 3C9IA 3H1JG 3L4FA 2ZAEB 1Q81Q 1KYOI 1L0LD 1VQ4P 2K9YA 3V2QA 2OYIB 1VQ7P 1RQVA 4WY4A 4GT1A 3M0AA 3SFEC 2QA4P 4DJGA 2Z4EA 3TNUA 3VP9A 1KC8Q 4TT3H 1LTGC 2Y9YA 3L75E 1ZMEC 2WMMA 3L70J 4LLHA 1OX3A 2MJZA 1HUCA 3BCCE 1LT9B 1LT9A 2SPZA 3EWKA 4GOEA 4N78E 3RK2C 2WSSH 1SQQJ 1ZRTD 1SVFA 2I1KA 3H1KD 2Z5HA 2K9JB 2M3BA 3FXEA 1DD4A 5KAFH 3A0HH 2OYIA 2AEJA 2A45I 4U7JA 1FDOA 1T8ZA 1RF1C 1K73Q 1H8AA 5KKZB 3FWLA 2LKMA 1VQNP 3V2RA 1ZP0C 2Y0CA 2YMYA 3T97A 3KQGA 3V4QA 1BGYE 2OTKE 3BCCD 4HJGH 3CLQA 1FC2C 1GL2D 2XZRA 2WITA 3G71P 1SQBK 4C46A 4N3YB 2OYOA 3L72E 2ZFCA 4PV1C 5H2FH 3AEAC 4JPZB 3II6A 4ZNCA 1FOSE 1NWQA 1GK4A 1MV8A 1GU4A 3M0DA 4IFDK 4JYBA 1YTZT 3AEBC 1LT9C 3VN0A 1OMIA 1VQKP 1RQUA 2QIWA 2KLUA 1KFMA 1NU1E 5AVZB 2BCCJ 1J1EB 3JCUE 1FJPA 2JDIH 2WSFJ 2Y9ZA 2E75D 1IC2A 2R3CA 1L0NK 3MTUE 4HKZH 3KZIE 2O1JA 2WPRA 4I7ZB 5AW7B 2N9BA 3TGUG 3D6YA 1U7MA 1RE3C 3TGUD 3G6EP 1SQVE 1YI2P 1K8AQ 1T3JA 2R5BA 1AQ5A 4BWNA 2B87B 4GIFA 2FYZA 2KZJA 1SQBJ 2KLVA 3WUUA 2WT7A 1VQMP 1LTIC 1NTZE 3L74E 4Y99B 3L70D 1KYOH 1SLQA 4H44C 1J1DC 1PP9E 1LP1A 3CL3D 4RJTA 3QH9A 1K9MQ 1URQD 1RH5B 1SFCC 2Q5UA 3IN6A 1NGMB 1J1EC 1ZXGA 2R32A 2OQQA 2MKVA 1M8OB 1NTKD 1LJ2A 2YKOA 1R5SA 1LGHB 3B5NC 1NTME 3GLMA 1DEBA 1SQPK 3L74D 4L73A 5CHXA 1A02F 2FBWC 4K35A 3W67A 1RE4A 5AVWB 3ABVC 4BXLA 1H0TB 5KTBA 1G2CB 2HPCB 3H1IG 1X22A 3L75D 1HWTC 2K3RA 3SWFA 1MFTA 1Q86Q 1QVFO 2VRSA 3AE8C 3EQ2A 1BCCG 2AXTH 3CWBE 2Q3EA 1RF0C 1TU3F 1WRGA 1X79B 3MP7B 2A06G 3KXDA 3GHGC 3H1HE 3HUSC 4U3FD 3VMZA 3VMXA 3CX5E 4JQ0D 5KKZC 3CCRP 1DX7A 3NFQA 4KT0J 2CK3H 4GODA 2HODA 2IYOA 3KYQA 1BCCD 2JKVA 3C8VA 4OVNF 4XFJA 1YJNP 2KK7A 5KLVJ 3CMAP 1Y8AA 1GL2C 1NAFA 5AW3B 2QJKC 1EC5A 2E76B 3H1KG 2W6JH 3BRVB 3TGUJ 2W90A 3L72G 4UB6E 4D6TE 4EI2A 5CCHA 1AVOA 3L35A 2OTLP 1SQBD 2P2UA 1FDMA 2PRRA 4L74A 4H13D 1Z56A 4JF7A 2QSIA 4L76A 2YXRB 1KFNA 1QVGO 2QVAA 3CWBG 5B5EE 4IL6E 2FYNC 2Q1KA 1GTWA 4UB8H 2K37A 5GTIE 3RK3C 3CCLP 3AEEC 4JYCA 5AVSB 1NJIQ 1PGQA 1ZV8A 4R4LA 4JBZA 4WY4D 1KMIZ 5KJ7D 3WUVA 1H89A 2JR8A 3CD6P 2P10A 1RE4C 1L0ND 2M5AB 1L0NE 3L73E 1IFJA 1JY2P 4Y99C 5KJ7A 1Y9BA 2FYUE 1ZOYC 2QRXA 4LGDE 2YMKA 3Q5PA 1KQSO 1FS0E 2WPVB 1KQGB 3RBXA 1JB0J 2XNDH 3H1IJ 1AQTA 1NTZG 1VPCA 3PRJA 1JM0A 2ZXXA 3I5CA 2H7HA 2N9YB 2FFDB 3A2AA 3MUDA 1LWUC 2D2CB 2KZIA 1PGPA 3KZIH 1SP4A 5DJTB 2K1AA 1FJKA 2B9BA 3H1LJ 1YHQP 1GL2A 3T97B 2XDJA 3RL0g 1S1CX 1T3UA 1NAYA 3LW5H 1SQPD 2WSCH 1SQQE 5AVRB 1LT1A 2ZYAA 3FX0A 2K9JA 1KQLA 2Q3IA 3UIAA 5BU5A 4ASWA 2OARA 4H44D 4AYCA 3VP8A 1FDIA 2KXPB 4PD4D 4A7PA 2YKQA 3N7NA 1KILE 3H1HG 1RF0A 2KS1B 4HYTB 2ITAA 1HGZA 3RK3B 3JCUH 3VMYA 1JCCA 1HTLC 3P8CD 2CPBA 3H1JJ 4GKGA 3S9OA 1BGYG 2ZVNB 2QJYC 4WY4B 2AXCA 2WQYC 1FZCC 1AFOA 1YBKA 1X0TA 1M57D 3IFMA 3L71G 4EIJA 4YTPC 1QLED 2H43A 2KB7P 3HE5A 1S5LX 2AXTE 5C39A 3S1KA 1USEA 2XV5A 3Q3DA 3B5NB 3A0BH 1S3JA 3B71A 1ZLLA 1IFNA 1MKMA 3M9BA 3MIWA 1HJ0A 1RY3A 3D6ZA 1T2KC 3RK3D 3P7KA 1FBMA 1QL1A 1SQXG 3MUDC 3KDPB 3M0DC 1NTKJ 2N1TA 3OJAB 4PD4E 2BASA 3CCJP 1VQLP 3AECC 1SQVG 2PFXA 4Z1MH 2IBZI 3E7KA 3VTPC 1UIXA 2JO1A 3GHGB 3HUSB 1R5LA 2YXQB 3I56P 4HB1A 1NHLA 3L75J 2JEEA 2W6BA 1NKZB 3RL0C 3H1JD 3L74G 4C7RA 1KB9D 1PGJA 2Q6QA 1PP9G 1YJ9P 1T2KD 1K04A 1YYCA 2I8DA 2YIUB 5CCGA 1RE3A 1VDFA 1OVVA 3Q2YA 3F89A 3WU2E 2KIKA 1PZQA 2KNCB 2E5TA 2FXMA 2QJPB 2E5YA 3L73D 3LW5J 3HE4A 2KYVA 2O01H 3AE4C 3FWNA 5TJHA 2HLOA 5KLVD 3AE3C 1L2PA 2HR3A 2PP6A 1SQXE 1KYOE 1SFCB 3P8CE 1LWUB 3LIDA 3I55P 1IFDA 3H1LD 2E75B 2XKMA 1NTKG 1LTJA 2N1TD 1JTHB 3B5NA 3CCMP 2NPSA 2A06D 4UB6H 1SQPG 5AVQB 2IX7C 4OGQC 1HF9A 2GUVA 1OW7A 2GUSA 4RESB 1SQBE 3GMAA 1LTAC 1GD2E 1L4AB 1KB9E 3L74J 1BSHA 2ZT9D 2K88A 3CI9A 3OA7A 1UIIA 3PLNA 5B5EH 4AUWA 1BDCA 1NYHA 2RN0A 3CX5I 1DIPA 1LP1B 3A7OA 1MUUA 2N1TC 1ZRTE 4W7ZA 3CXHD 3G9RA 1BDDA 1G1JA 3H1KJ 5AW6B 2A45G 1BSNA 3R2PA 4WWIA 2OYHB 2KNCA 4IFMA 5E79E 1W2BO 1S72P 1FZEA 1L0LJ 2E75C 3L71E 5L8RJ 2WPSA 3HD7C 2V4HA 2ZJSE 3CX5D 1DD3A 3S4RA 5H2FE 2E43A 1NTZJ 2NPSC 1SQXD 2W83C 3CWBD 2QEXP 1BCCJ 3BCCG 3PP5A 5KLIB 1M90Q 3USSA 4YPCA 1P84H 1EZVI 1SQBG 3AEFC 5CJ0A 1KN7A 3FXDA 4K3AA 1P84D 3M91A 4DCKA 1M7LA 3SWKA 1N86A 2C0XA 2WWWA 1PV3A 2IPPA 1XTCC 3CXHH 2Q7CA 5CCHD 5KLVG 3CCEP 1S9KE 2BCCE 1FZAA 1KD1Q 2E76D 1GZLA 1NKNA 2J58A 3EFFK 4YXDC 3H32A 1URQC 1CI6A 1NU1K 3HD7A 1ZW0A 1JOCA 3GW6A 1GW4A 4I7ZC 2RH0A 3G4SP 1N73B 1SQXK 2H89C 1DEEG 2IFNA 3B8EB 1N73A 1KILA 3EFGA 2OYIC 2B89A 3O6QA 2D2CC 4W7YA 2LXBA 3HD7B 1LTJC 3FGAD 4PJ0E 1GDTA 1IFIA 1PP9J 1NU1G 3E1RA 2OYHC 1URQB 1LNQA 1NVOA 4U3FJ 1S2EA 1QGKB 3AEGC 5BU8B 2IBZD 2UWJE 1VQ9P 2YNYA 4M3LA 5KLVK 3WMM0 3VOPA 3TGUE 1JNMA 3O6QB 3U1AA 2Q9IA 3AE7C 5CCGD 2BCCG 3H1HD 4L75A 1NU1D 1GK6A 1Y47A 1JUNA 1ZR4A 3A0BE 4BRYA 1BE3E 1H88A 5TISE 3SFDC 4KHXA 1KZUB 1FOSF 2JWAA 1SQPJ 3L71D 2QM7A 1W2EA 2FFDA 1YIJP 1VQ5P 2WSFH 1WT6A 1NTMG 2AEMA 2J59M 3C1LA 4O9BA 2WT7B 2FXOA 4OH8B 2W8ZA 3MHVA 3TDKA 5AVTB 1GL2B 1HH0A 1SFCD 2PAJA 3H1IE 4NPEA 2KUBA 3RBZA 1VF5D 1JMBA 3NXSA 4EDFA 5GTHH 1N73C 3WU2H 3CWBJ 2Z5IA 2JP3A 4H44B 2HG5D 5AVYB 2A06E 2ZT9C 3RK2D 1SQVD 1RHZB 3F5HA 1S5LH 4IL6X 1IO4A 1FZCA 4GOFA 1EXJA 1OIPA 2WZ7A 1KORA 2ZT9B 1Q2NA 2V7QH 3IF4A 3KHUA 3M9HA 3BCCJ 5AW9B 1YJWP 2RKLA 5KLVE 4NPFX 3HE4B 2IDBA 1IFMA 2M5AA 3AE2C 2R44A 2B88A 3KPEA 2P1JA 1PPJG 4PD4H 3TYYA 3HTKB 1OW6A
chains in the Genus database with same CATH topology
2ZJSE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZJS E; 
#chains in the Genus database with same CATH topology
 1VF5 B;  1EDJ A;  1CI6 B;  4D6T G;  1EXI A;  2WVR A;  1PL5 A;  3CXH I;  5AW1 B;  3AE9 C;  1E79 H;  1LTJ B;  2NRG A;  2NPS B;  2QE7 H;  2FYU J;  3BAT A;  4H0L B;  3AE5 C;  2OTJ P;  2YIU C;  3OW2 O;  3Q5S A;  3M06 A;  1SFC A;  3L36 A;  3A5T A;  1BGY D;  1JY2 N;  1GMJ A;  2KP8 A;  2IYP A;  4IOI H;  1J1D B;  3CXH E;  2R3S A;  4WBA A;  3VYI A;  3L72 J;  1NTK E;  3O8Z A;  3ZDM A;  5E79 H;  1SQV J;  2RMZ A;  3D71 A;  5APX A;  1OVU A;  3N4X A;  2O3J A;  3B4S A;  1DH3 A;  2POH A;  5APY A;  3H25 A;  3CC4 P;  3OAK A;  3TF5 A;  1H0T A;  3L70 E;  1AA0 A;  2BCC D;  3H1L E;  3K5B A;  4ZKU A;  2HPC A;  2BEQ D;  3H6P A;  1KYO D;  4U3F G;  5KAI H;  1PPJ E;  2G8Y A;  3PTZ A;  4GDO A;  2HOD B;  4OGQ B;  1KV4 A;  3GHG A;  3HUS A;  4HH2 A;  2KOG A;  2WPQ A;  2KSE A;  1NTZ K;  2P7J A;  1CZQ A;  3CPW O;  3CCV P;  2WSC J;  2GA1 A;  1OWA A;  4LC1 A;  3AE1 C;  5APS A;  1YQ4 C;  3VMA A;  1KB9 H;  3GF7 A;  5APU A;  4DZO A;  1BGY J;  2A45 H;  2IZ0 A;  2Y0D A;  3HD7 D;  1MFZ A;  4WY4 C;  5CCG C;  5KJ7 C;  2B87 A;  3SSU A;  1VF5 C;  3L72 D;  1N7S C;  3L37 A;  2YO3 A;  1S4X A;  1PPJ D;  1SQQ G;  2DW3 A;  2L91 A;  4XE5 B;  1JTH A;  5B66 E;  5AVU B;  2D2C D;  1KIL B;  1N7L A;  1NTM J;  1OXZ A;  1PGO A;  1YTZ I;  2E74 B;  3L70 G;  3QWO C;  4H13 C;  3RL0 B;  5AVX B;  2C9L Y;  4RO0 A;  4H0L D;  5APV A;  4RKU J;  1EZV E;  4C7N B;  3CC2 P;  3LIE A;  2V7Q J;  1T6A A;  1SQV K;  3P8M C;  1MZ9 A;  1NTZ D;  3H32 B;  4IFF A;  3V2N A;  3BVH A;  2NZ2 A;  1VQ6 P;  1KQF B;  3H1K E;  2KS1 A;  3JC2 2;  3RK3 E;  1XTG B;  5KAF E;  1P84 E;  2WTY A;  3CC7 P;  1E5W A;  1QL2 A;  3MGN A;  2E74 D;  1JY3 P;  1S9K D;  1JCD A;  3L75 G;  5BVZ A;  1JO5 A;  1OW8 A;  3MZW B;  4DT0 A;  3Q5R A;  1L4A D;  4WB4 A;  1R8E A;  4BRY B;  1U7J A;  2PGD A;  1CW5 A;  1PIX A;  1IK7 A;  2FYU D;  1SS1 A;  2QJK B;  5K5G B;  4DOJ A;  3CCU P;  2IZ1 A;  1EQ7 A;  1LTB C;  2ZVO B;  2P67 A;  3BRT B;  2L5G B;  2BEZ F;  1HBW A;  1D7M A;  2FYU G;  2OYH A;  1VL2 A;  4PJ0 H;  4EOT A;  1N7S B;  1NTM K;  2IBZ G;  2AEF A;  3R4Y A;  4AQR D;  3CCQ P;  2GM4 A;  2FYN B;  4C7N A;  5AW2 B;  3Q1M A;  1RF1 B;  4QMA A;  3H1L G;  3HRN A;  1YIT P;  3P32 A;  2I1J A;  1AJY A;  1CSB A;  1M1J C;  1KB9 I;  1FE6 A;  1HJB A;  3G3Z A;  1N8R Q;  1GW3 A;  3CME P;  3A0H E;  1S5L E;  2W27 A;  1JEK A;  2FYU K;  2WSE J;  5APQ A;  1AVY A;  1L0N J;  5APT A;  3L73 J;  5APW A;  3RK2 B;  3TSI A;  1FZB A;  1N7S A;  1NU1 J;  1GU5 A;  4XA4 A;  1URQ A;  2JJL A;  3BAS A;  2FY8 A;  3W68 A;  5CBO A;  5TIS H;  4OGQ D;  2WSE H;  1EDK A;  4CPG A;  1Q90 D;  1N7S D;  3E1I A;  1ZR2 A;  2R5D A;  2KI7 B;  5DJU B;  1FZF A;  2G3A A;  2FFD C;  1L4A C;  4R4M A;  1K05 A;  5AW8 B;  2NPS D;  3A3Y B;  1L0L E;  3L71 J;  3V4W A;  1BE3 D;  1A02 J;  3PJS K;  2M0B A;  1NH4 A;  4KJM A;  1M1K Q;  4NPD A;  3U59 A;  3H1J E;  2E74 C;  4H13 B;  3V2P A;  1EZV G;  2J5U A;  2HFE D;  2JWD A;  2M8R A;  2P58 A;  4PV1 D;  4TLF A;  3H1I D;  4ZMD A;  1N2D C;  4H0L C;  1VQO P;  3HTK A;  1JY2 O;  2H88 C;  3TK1 A;  2HYN A;  3V6I A;  2QJP C;  1OFC X;  4D6T D;  1VQ8 P;  1IK9 A;  4UB8 E;  3JSV C;  5GTI H;  1IZN B;  1JY3 O;  2CPS A;  1FAV A;  2XU6 A;  4PD4 I;  2QM8 A;  2W6A A;  3B5N D;  2E42 A;  4ASV A;  5KAI E;  1G2C A;  1M1J B;  1SQX J;  1J2J B;  2C0W A;  1BCC E;  3V5B A;  1JY3 N;  3M9Q A;  2QJY B;  1FZC B;  1HGV A;  2OGU A;  5CMZ A;  1KTM A;  1X9V A;  3PHL A;  3H1H J;  1USD A;  1JMM A;  1W5C E;  2E76 C;  3PH0 A;  1Q7Y Q;  1Q82 Q;  1WMK A;  2IFM A;  2H8P D;  3GF3 A;  1LWU A;  5AW5 B;  5CCH C;  5AVV B;  2YKP A;  3CCS P;  1SQQ K;  2O01 N;  1NO4 A;  4OWF A;  5CJ4 A;  5GTH E;  2ZYG A;  1M1J A;  1M56 D;  2Y0E A;  4EYY Q;  2FKW B;  4IL6 H;  3RGU A;  1FU1 A;  4Y28 J;  4ZKP A;  1FZG A;  1RF1 A;  1U57 A;  3AE6 C;  2XNX A;  2M3E A;  4U3F E;  1L4A A;  1QX8 A;  2IBZ E;  5EFW B;  2ZYD A;  3ITK A;  3IAO A;  1NTM D;  5B66 H;  3RL0 D;  4D6T J;  4YXW H;  4I2L C;  1IJD B;  3GG2 A;  5AW4 B;  1KIL D;  1LTT C;  1YQ3 C;  2C9N Y;  4B86 A;  3NMD A;  2ZXE B;  1EDI A;  5AW0 B;  1LTS C;  1P84 I;  4PV1 B;  1L0L K;  2FXP A;  1PFI A;  1PP9 D;  1NOH A;  1EZV D;  2O01 J;  4WVZ A;  1G1I A;  1OZH A;  1SQQ D;  1X8Y A;  3WUT A;  2N1T B;  1SQP E;  5CBN A;  1AV1 A;  3IR9 A;  1OVR A;  1EDL A;  1ZN5 A;  3L73 G;  4W80 A;  1L0N G;  3D70 A;  2KSJ A;  2QG4 A;  3SWY A;  1QEX A;  4I1L A;  1KIL C;  1L0L G;  3NTN A;  1IFP A;  4MN4 C;  4N6J A;  4N78 D;  5M1B A;  1BE3 J;  3AED C;  4I6M C;  1BE3 G;  2O1K A;  3U1C A;  1NTK K;  2YO2 A;  1VQP P;  3CX5 H;  3HE5 B;  1HVV A;  2LR2 A;  2LXC B;  3TNU B;  3MD0 A;  5KLI C;  3C9I A;  3H1J G;  3L4F A;  2ZAE B;  1Q81 Q;  1KYO I;  1L0L D;  1VQ4 P;  2K9Y A;  3V2Q A;  2OYI B;  1VQ7 P;  1RQV A;  4WY4 A;  4GT1 A;  3M0A A;  3SFE C;  2QA4 P;  4DJG A;  2Z4E A;  3TNU A;  3VP9 A;  1KC8 Q;  4TT3 H;  1LTG C;  2Y9Y A;  3L75 E;  1ZME C;  2WMM A;  3L70 J;  4LLH A;  1OX3 A;  2MJZ A;  1HUC A;  3BCC E;  1LT9 B;  1LT9 A;  2SPZ A;  3EWK A;  4GOE A;  4N78 E;  3RK2 C;  2WSS H;  1SQQ J;  1ZRT D;  1SVF A;  2I1K A;  3H1K D;  2Z5H A;  2K9J B;  2M3B A;  3FXE A;  1DD4 A;  5KAF H;  3A0H H;  2OYI A;  2AEJ A;  2A45 I;  4U7J A;  1FDO A;  1T8Z A;  1RF1 C;  1K73 Q;  1H8A A;  5KKZ B;  3FWL A;  2LKM A;  1VQN P;  3V2R A;  1ZP0 C;  2Y0C A;  2YMY A;  3T97 A;  3KQG A;  3V4Q A;  1BGY E;  2OTK E;  3BCC D;  4HJG H;  3CLQ A;  1FC2 C;  1GL2 D;  2XZR A;  2WIT A;  3G71 P;  1SQB K;  4C46 A;  4N3Y B;  2OYO A;  3L72 E;  2ZFC A;  4PV1 C;  5H2F H;  3AEA C;  4JPZ B;  3II6 A;  4ZNC A;  1FOS E;  1NWQ A;  1GK4 A;  1MV8 A;  1GU4 A;  3M0D A;  4IFD K;  4JYB A;  1YTZ T;  3AEB C;  1LT9 C;  3VN0 A;  1OMI A;  1VQK P;  1RQU A;  2QIW A;  2KLU A;  1KFM A;  1NU1 E;  5AVZ B;  2BCC J;  1J1E B;  3JCU E;  1FJP A;  2JDI H;  2WSF J;  2Y9Z A;  2E75 D;  1IC2 A;  2R3C A;  1L0N K;  3MTU E;  4HKZ H;  3KZI E;  2O1J A;  2WPR A;  4I7Z B;  5AW7 B;  2N9B A;  3TGU G;  3D6Y A;  1U7M A;  1RE3 C;  3TGU D;  3G6E P;  1SQV E;  1YI2 P;  1K8A Q;  1T3J A;  2R5B A;  1AQ5 A;  4BWN A;  2B87 B;  4GIF A;  2FYZ A;  2KZJ A;  1SQB J;  2KLV A;  3WUU A;  2WT7 A;  1VQM P;  1LTI C;  1NTZ E;  3L74 E;  4Y99 B;  3L70 D;  1KYO H;  1SLQ A;  4H44 C;  1J1D C;  1PP9 E;  1LP1 A;  3CL3 D;  4RJT A;  3QH9 A;  1K9M Q;  1URQ D;  1RH5 B;  1SFC C;  2Q5U A;  3IN6 A;  1NGM B;  1J1E C;  1ZXG A;  2R32 A;  2OQQ A;  2MKV A;  1M8O B;  1NTK D;  1LJ2 A;  2YKO A;  1R5S A;  1LGH B;  3B5N C;  1NTM E;  3GLM A;  1DEB A;  1SQP K;  3L74 D;  4L73 A;  5CHX A;  1A02 F;  2FBW C;  4K35 A;  3W67 A;  1RE4 A;  5AVW B;  3ABV C;  4BXL A;  1H0T B;  5KTB A;  1G2C B;  2HPC B;  3H1I G;  1X22 A;  3L75 D;  1HWT C;  2K3R A;  3SWF A;  1MFT A;  1Q86 Q;  1QVF O;  2VRS A;  3AE8 C;  3EQ2 A;  1BCC G;  2AXT H;  3CWB E;  2Q3E A;  1RF0 C;  1TU3 F;  1WRG A;  1X79 B;  3MP7 B;  2A06 G;  3KXD A;  3GHG C;  3H1H E;  3HUS C;  4U3F D;  3VMZ A;  3VMX A;  3CX5 E;  4JQ0 D;  5KKZ C;  3CCR P;  1DX7 A;  3NFQ A;  4KT0 J;  2CK3 H;  4GOD A;  2HOD A;  2IYO A;  3KYQ A;  1BCC D;  2JKV A;  3C8V A;  4OVN F;  4XFJ A;  1YJN P;  2KK7 A;  5KLV J;  3CMA P;  1Y8A A;  1GL2 C;  1NAF A;  5AW3 B;  2QJK C;  1EC5 A;  2E76 B;  3H1K G;  2W6J H;  3BRV B;  3TGU J;  2W90 A;  3L72 G;  4UB6 E;  4D6T E;  4EI2 A;  5CCH A;  1AVO A;  3L35 A;  2OTL P;  1SQB D;  2P2U A;  1FDM A;  2PRR A;  4L74 A;  4H13 D;  1Z56 A;  4JF7 A;  2QSI A;  4L76 A;  2YXR B;  1KFN A;  1QVG O;  2QVA A;  3CWB G;  5B5E E;  4IL6 E;  2FYN C;  2Q1K A;  1GTW A;  4UB8 H;  2K37 A;  5GTI E;  3RK3 C;  3CCL P;  3AEE C;  4JYC A;  5AVS B;  1NJI Q;  1PGQ A;  1ZV8 A;  4R4L A;  4JBZ A;  4WY4 D;  1KMI Z;  5KJ7 D;  3WUV A;  1H89 A;  2JR8 A;  3CD6 P;  2P10 A;  1RE4 C;  1L0N D;  2M5A B;  1L0N E;  3L73 E;  1IFJ A;  1JY2 P;  4Y99 C;  5KJ7 A;  1Y9B A;  2FYU E;  1ZOY C;  2QRX A;  4LGD E;  2YMK A;  3Q5P A;  1KQS O;  1FS0 E;  2WPV B;  1KQG B;  3RBX A;  1JB0 J;  2XND H;  3H1I J;  1AQT A;  1NTZ G;  1VPC A;  3PRJ A;  1JM0 A;  2ZXX A;  3I5C A;  2H7H A;  2N9Y B;  2FFD B;  3A2A A;  3MUD A;  1LWU C;  2D2C B;  2KZI A;  1PGP A;  3KZI H;  1SP4 A;  5DJT B;  2K1A A;  1FJK A;  2B9B A;  3H1L J;  1YHQ P;  1GL2 A;  3T97 B;  2XDJ A;  3RL0 g;  1S1C X;  1T3U A;  1NAY A;  3LW5 H;  1SQP D;  2WSC H;  1SQQ E;  5AVR B;  1LT1 A;  2ZYA A;  3FX0 A;  2K9J A;  1KQL A;  2Q3I A;  3UIA A;  5BU5 A;  4ASW A;  2OAR A;  4H44 D;  4AYC A;  3VP8 A;  1FDI A;  2KXP B;  4PD4 D;  4A7P A;  2YKQ A;  3N7N A;  1KIL E;  3H1H G;  1RF0 A;  2KS1 B;  4HYT B;  2ITA A;  1HGZ A;  3RK3 B;  3JCU H;  3VMY A;  1JCC A;  1HTL C;  3P8C D;  2CPB A;  3H1J J;  4GKG A;  3S9O A;  1BGY G;  2ZVN B;  2QJY C;  4WY4 B;  2AXC A;  2WQY C;  1FZC C;  1AFO A;  1YBK A;  1X0T A;  1M57 D;  3IFM A;  3L71 G;  4EIJ A;  4YTP C;  1QLE D;  2H43 A;  2KB7 P;  3HE5 A;  1S5L X;  2AXT E;  5C39 A;  3S1K A;  1USE A;  2XV5 A;  3Q3D A;  3B5N B;  3A0B H;  1S3J A;  3B71 A;  1ZLL A;  1IFN A;  1MKM A;  3M9B A;  3MIW A;  1HJ0 A;  1RY3 A;  3D6Z A;  1T2K C;  3RK3 D;  3P7K A;  1FBM A;  1QL1 A;  1SQX G;  3MUD C;  3KDP B;  3M0D C;  1NTK J;  2N1T A;  3OJA B;  4PD4 E;  2BAS A;  3CCJ P;  1VQL P;  3AEC C;  1SQV G;  2PFX A;  4Z1M H;  2IBZ I;  3E7K A;  3VTP C;  1UIX A;  2JO1 A;  3GHG B;  3HUS B;  1R5L A;  2YXQ B;  3I56 P;  4HB1 A;  1NHL A;  3L75 J;  2JEE A;  2W6B A;  1NKZ B;  3RL0 C;  3H1J D;  3L74 G;  4C7R A;  1KB9 D;  1PGJ A;  2Q6Q A;  1PP9 G;  1YJ9 P;  1T2K D;  1K04 A;  1YYC A;  2I8D A;  2YIU B;  5CCG A;  1RE3 A;  1VDF A;  1OVV A;  3Q2Y A;  3F89 A;  3WU2 E;  2KIK A;  1PZQ A;  2KNC B;  2E5T A;  2FXM A;  2QJP B;  2E5Y A;  3L73 D;  3LW5 J;  3HE4 A;  2KYV A;  2O01 H;  3AE4 C;  3FWN A;  5TJH A;  2HLO A;  5KLV D;  3AE3 C;  1L2P A;  2HR3 A;  2PP6 A;  1SQX E;  1KYO E;  1SFC B;  3P8C E;  1LWU B;  3LID A;  3I55 P;  1IFD A;  3H1L D;  2E75 B;  2XKM A;  1NTK G;  1LTJ A;  2N1T D;  1JTH B;  3B5N A;  3CCM P;  2NPS A;  2A06 D;  4UB6 H;  1SQP G;  5AVQ B;  2IX7 C;  4OGQ C;  1HF9 A;  2GUV A;  1OW7 A;  2GUS A;  4RES B;  1SQB E;  3GMA A;  1LTA C;  1GD2 E;  1L4A B;  1KB9 E;  3L74 J;  1BSH A;  2ZT9 D;  2K88 A;  3CI9 A;  3OA7 A;  1UII A;  3PLN A;  5B5E H;  4AUW A;  1BDC A;  1NYH A;  2RN0 A;  3CX5 I;  1DIP A;  1LP1 B;  3A7O A;  1MUU A;  2N1T C;  1ZRT E;  4W7Z A;  3CXH D;  3G9R A;  1BDD A;  1G1J A;  3H1K J;  5AW6 B;  2A45 G;  1BSN A;  3R2P A;  4WWI A;  2OYH B;  2KNC A;  4IFM A;  5E79 E;  1W2B O;  1S72 P;  1FZE A;  1L0L J;  2E75 C;  3L71 E;  5L8R J;  2WPS A;  3HD7 C;  2V4H A;  2ZJS E;  3CX5 D;  1DD3 A;  3S4R A;  5H2F E;  2E43 A;  1NTZ J;  2NPS C;  1SQX D;  2W83 C;  3CWB D;  2QEX P;  1BCC J;  3BCC G;  3PP5 A;  5KLI B;  1M90 Q;  3USS A;  4YPC A;  1P84 H;  1EZV I;  1SQB G;  3AEF C;  5CJ0 A;  1KN7 A;  3FXD A;  4K3A A;  1P84 D;  3M91 A;  4DCK A;  1M7L A;  3SWK A;  1N86 A;  2C0X A;  2WWW A;  1PV3 A;  2IPP A;  1XTC C;  3CXH H;  2Q7C A;  5CCH D;  5KLV G;  3CCE P;  1S9K E;  2BCC E;  1FZA A;  1KD1 Q;  2E76 D;  1GZL A;  1NKN A;  2J58 A;  3EFF K;  4YXD C;  3H32 A;  1URQ C;  1CI6 A;  1NU1 K;  3HD7 A;  1ZW0 A;  1JOC A;  3GW6 A;  1GW4 A;  4I7Z C;  2RH0 A;  3G4S P;  1N73 B;  1SQX K;  2H89 C;  1DEE G;  2IFN A;  3B8E B;  1N73 A;  1KIL A;  3EFG A;  2OYI C;  2B89 A;  3O6Q A;  2D2C C;  4W7Y A;  2LXB A;  3HD7 B;  1LTJ C;  3FGA D;  4PJ0 E;  1GDT A;  1IFI A;  1PP9 J;  1NU1 G;  3E1R A;  2OYH C;  1URQ B;  1LNQ A;  1NVO A;  4U3F J;  1S2E A;  1QGK B;  3AEG C;  5BU8 B;  2IBZ D;  2UWJ E;  1VQ9 P;  2YNY A;  4M3L A;  5KLV K;  3WMM 0;  3VOP A;  3TGU E;  1JNM A;  3O6Q B;  3U1A A;  2Q9I A;  3AE7 C;  5CCG D;  2BCC G;  3H1H D;  4L75 A;  1NU1 D;  1GK6 A;  1Y47 A;  1JUN A;  1ZR4 A;  3A0B E;  4BRY A;  1BE3 E;  1H88 A;  5TIS E;  3SFD C;  4KHX A;  1KZU B;  1FOS F;  2JWA A;  1SQP J;  3L71 D;  2QM7 A;  1W2E A;  2FFD A;  1YIJ P;  1VQ5 P;  2WSF H;  1WT6 A;  1NTM G;  2AEM A;  2J59 M;  3C1L A;  4O9B A;  2WT7 B;  2FXO A;  4OH8 B;  2W8Z A;  3MHV A;  3TDK A;  5AVT B;  1GL2 B;  1HH0 A;  1SFC D;  2PAJ A;  3H1I E;  4NPE A;  2KUB A;  3RBZ A;  1VF5 D;  1JMB A;  3NXS A;  4EDF A;  5GTH H;  1N73 C;  3WU2 H;  3CWB J;  2Z5I A;  2JP3 A;  4H44 B;  2HG5 D;  5AVY B;  2A06 E;  2ZT9 C;  3RK2 D;  1SQV D;  1RHZ B;  3F5H A;  1S5L H;  4IL6 X;  1IO4 A;  1FZC A;  4GOF A;  1EXJ A;  1OIP A;  2WZ7 A;  1KOR A;  2ZT9 B;  1Q2N A;  2V7Q H;  3IF4 A;  3KHU A;  3M9H A;  3BCC J;  5AW9 B;  1YJW P;  2RKL A;  5KLV E;  4NPF X;  3HE4 B;  2IDB A;  1IFM A;  2M5A A;  3AE2 C;  2R44 A;  2B88 A;  3KPE A;  2P1J A;  1PPJ G;  4PD4 H;  3TYY A;  3HTK B;  1OW6 A; 
#chains in the Genus database with same CATH homology
 2ZJS E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...