1Z56A

Co-crystal structure of lif1p-lig4p
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
ADKLYKDICCVNDSYRNIKESDSSNRNRVEQLARERELLDKLLETRDERTRAMMVTLLNEKKKKIRELHEILRQNNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Ligase
molecule keywords Ligase interacting factor 1
publication title Structure of an Xrcc4-DNA ligase IV yeast ortholog complex reveals a novel BRCT interaction mode.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 25
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.370 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1z56A00
1Z56A 5CHXA 1FU1A 5CJ4A 3II6A 5CJ0A 4XA4A 3MUDA 1IK9A
chains in the Genus database with same CATH superfamily
1PGPA 2B9BA 4WVZA 2CPBA 3RK3E 3L71G 5CCHA 2RKLA 3VMZA 1FZBA 1AJYA 1NAYA 3K5BA 3M9HA 1S4XA 2WVRA 1OX3A 3H6PA 2KNCA 3HUSA 4HJGH 1VPCA 3T97B 1T3UA 1S9KE 1H89A 5AW7B 3A5TA 1DH3A 4I1LA 1G1JA 2XDJA 3H1JE 3BCCG 3IAOA 3B5NC 1SQPG 3NMDA 2A06D 2FYNB 3D6ZA 3L74E 4PV1B 5C39A 2OGUA 4I2LC 5AW6B 4WY4A 1NTKK 3M0DC 3HD7B 1N2DC 2WSEJ 4CPGA 3B4SA 3FXEA 1OIPA 2YO2A 1IFIA 1N73C 3AE6C 3RK3B 3LW5J 4JPZB 2OYHB 1L0LJ 3UIAA 4H0LC 4YXWH 5DJUB 1SQQJ 1L4AA 4NPEA 2YIUB 4H13D 1KV4A 1BDCA 3P8CE 2AEJA 4Y99B 2E42A 3G6EP 2RMZA 1GL2A 1QVFO 1Q82Q 2QSIA 1LJ2A 4ASVA 5GTIE 3RL0g 1ZN5A 1FZCB 2QJYB 1JOCA 3W67A 4MN4C 2KP8A 5GTHE 3OW2O 4Z1MH 4GOEA 2QIWA 4HKZH 3AE1C 2LXBA 1NWQA 2POHA 1GU4A 5AVWB 3RL0C 1NTZG 1MV8A 3V5BA 4BWNA 3H32B 4BRYB 2G3AA 2FYUJ 1J1DC 5AW3B 3H1IE 1YYCA 2QJKB 3GHGC 1LGHB 1J2JB 2A45I 2LKMA 3H1LE 1YBKA 2WT7B 3NXSA 1NTKE 2CPSA 1M57D 2E75D 1KFNA 1OMIA 2P10A 3AE3C 4GT1A 1L0NK 5CCGD 4ASWA 4RKUJ 3D70A 1QL1A 4IFDK 2XNDH 5AW0B 1H0TA 1EQ7A 2IYPA 4L74A 5CHXA 1BCCE 4OH8B 3H1KJ 3SFEC 1Q7YQ 1X22A 1AVOA 4HB1A 1YITP 4KT0J 2P7JA 1LTGC 1R5SA 1BGYJ 1EZVD 1NGMB 1S5LH 2HYNA 3L71J 1WT6A 1LTIC 1HGZA 2D2CD 1CZQA 3Q2YA 4PD4H 4Y28J 4EYYQ 3VMYA 3CC7P 3CCQP 3OAKA 3SWYA 1KYOE 2HG5D 1PP9E 4L76A 1OW7A 4XFJA 1KILD 1ZP0C 1USDA 2GA1A 4QMAA 4ZKPA 3Q1MA 1BE3J 3BCCJ 2N1TD 2I1KA 3EWKA 1IJDB 5KAIE 1JNMA 1SQPJ 3A0BE 2XZRA 3E1IA 3BVHA 3QWOC 1JY3N 2WITA 3EFFK 2OYIB 1L0NE 3TDKA 1RF1B 1MFTA 1MFZA 2ZXEB 2AXTH 1Z56A 4OGQB 5AVXB 1VL2A 3JCUE 4RO0A 3B71A 2QJPB 2OQQA 2IZ1A 1T6AA 4A7PA 1NU1G 5KAFH 1G2CA 3L73J 5KLIC 3TF5A 2NRGA 3HRNA 3GHGA 2M0BA 2P2UA 3U59A 2FBWC 3KZIH 1SFCC 3L72E 3CD6P 3V4QA 2E76C 4D6TD 3IFMA 3AEDC 1RE4A 2KNCB 2JO1A 5B5EH 1L2PA 1GZLA 4W80A 4NPDA 1IFDA 2FYUK 3E1RA 3JSVC 1PZQA 1KQGB 3WMM0 1S1CX 1HUCA 3A0HE 3I55P 2QEXP 3U1CA 3ABVC 3CX5H 1LT1A 3EFGA 2YKOA 1NTZJ 4NPFX 4W7YA 1A02J 4OVNF 1QLED 3HE5A 2IPPA 1JO5A 4WBAA 1SQVG 2W6BA 1IFJA 2E74D 2Q5UA 1SQQE 3L70E 1AQTA 1IC2A 2FFDC 3TNUA 1LWUC 1HTLC 3BRVB 1CI6A 4AUWA 2BCCJ 3WU2E 2ZT9C 1LT9A 1ZR4A 4IFFA 2AXCA 4H44C 1OVVA 1SQBG 1FOSF 2J58A 5AVTB 5TISH 1J1EB 2H43A 5CCHC 5M1BA 3P8MC 5APXA 1FU1A 2NPSA 1MZ9A 3USSA 1URQA 2KOGA 3FX0A 2K1AA 5KKZC 3H1HD 3HUSC 3CCUP 1KYOI 2FYUE 1T3JA 3V2QA 4TT3H 2E5YA 2IZ0A 4XA4A 4PV1D 1IK9A 1JY2O 3VYIA 2LR2A 1KQLA 1NTMK 3MIWA 5AVVB 3CWBD 3HD7D 1QVGO 1K04A 1FOSE 1JMMA 3PTZA 1N7SC 1SFCA 1FZAA 2KI7B 4WY4C 2OYOA 1VQOP 3RK3D 2Y0CA 2GM4A 3MUDA 3H1KE 4WWIA 3CLQA 2BASA 1FJKA 3AE7C 1PL5A 3PJSK 1EDKA 5AW8B 1BGYE 2JKVA 3C8VA 3B5NB 4I6MC 1S9KD 1L4AC 1LTSC 1DD4A 2I8DA 3AECC 4R4LA 3L71E 2WPRA 1DX7A 1Q81Q 1NU1J 1D7MA 2WTYA 3H1JD 4GKGA 2Q3IA 1GL2C 4DJGA 1RF0A 1FDIA 3FGAD 3L74D 2KK7A 1N73B 4DT0A 1K9MQ 2JEEA 5KLVK 1JTHA 1MKMA 1JB0J 4N78E 2QM7A 4H0LB 3L75G 4DZOA 2FFDA 1LNQA 3VP9A 3CCSP 1FE6A 1BE3E 2R3SA 4U7JA 5APYA 5AVUB 1SQPE 1CSBA 2WSCJ 4I7ZC 1P84E 2KS1B 5CBOA 1HWTC 1DD3A 1NTME 2LXCB 2H8PD 1SQXG 4C7RA 3CMEP 1GD2E 1FC2C 1IFMA 3TGUE 3P8CD 2IDBA 3O8ZA 4W7ZA 3LIEA 2KLUA 2K9JA 2O01N 1XTGB 5H2FE 3HE4A 3L36A 1SQVJ 1ZW0A 5DJTB 4IL6X 1S5LX 3RK2C 1T2KD 1RQVA 3G4SP 3L73E 4EI2A 4EOTA 1DIPA 3RL0B 3OJAB 3KPEA 2ZYGA 1G2CB 2A45G 1J1DB 1ZMEC 5AVRB 1MUUA 2YMKA 3KDPB 3H1HG 4ZKUA 2O1KA 4KJMA 5APVA 3C9IA 3GMAA 3PP5A 1SQBJ 1N7SA 1HBWA 1NYHA 1S3JA 2W6AA 3H1ID 1K8AQ 2C9LY 3CC2P 2M3BA 1LP1A 3H1LD 1OFCX 5KLVE 1NTKD 3AEFC 1M56D 4IL6E 2HPCA 1S5LE 5AW2B 1NTZE 4HYTB 3G9RA 3RGUA 1DEEG 1KQFB 2W90A 4PD4E 1PPJG 1QGKB 5CMZA 3HE5B 1RQUA 1BCCD 2YO3A 2ITAA 1HVVA 4K3AA 3WUVA 1R5LA 2A45H 1EDIA 3E7KA 3H25A 4EIJA 2Q9IA 4M3LA 4OGQD 3TK1A 2BCCE 4UB6H 1SVFA 1S2EA 4ZMDA 5CJ0A 1LTJA 3VMAA 1U7MA 1AFOA 1KILA 5APUA 2UWJE 1EDJA 3L74G 2WPQA 1PIXA 1VF5C 1KYOD 2ZVOB 4O9BA 1PP9D 1JY3P 3VMXA 2AXTE 2N1TA 4LLHA 2Q7CA 3S9OA 2BEQD 1YIJP 2L91A 1KB9H 3V2NA 4N6JA 4U3FJ 3W68A 1DEBA 1VQ5P 4PJ0H 1VQ6P 3O6QB 3WUUA 1RE4C 2IFMA 1E5WA 2PAJA 3ZDMA 2P67A 4XE5B 3KZIE 2J59M 3KHUA 1NH4A 4IFMA 2M5AA 1L0ND 2IBZE 3L75J 1KZUB 2JWDA 5B5EE 3P7KA 5KLIB 2RH0A 4K35A 3U1AA 2YNYA 1P84I 4JYCA 1JM0A 1SFCB 2E76B 2Y9YA 2B89A 1SQXJ 3CCMP 4R4MA 1VQ9P 2G8YA 4UB8E 3CX5E 3L72D 2B87A 1AA0A 2KUBA 2A06G 1Q2NA 1JEKA 2Y0DA 3HTKA 1EC5A 3H1IG 1NU1E 3SWFA 2ZJSE 1LT9C 4AQRD 1NTKG 3R2PA 4AYCA 3CMAP 4DCKA 2KB7P 3IN6A 1EXJA 1SLQA 3D6YA 2NPSC 1L0LK 2FFDB 2HODA 1URQC 1BCCG 1SQQK 1LWUB 4GIFA 1JCDA 3SWKA 3F5HA 2ZT9B 3CCVP 3AEEC 3AEBC 2KSJA 1SQQD 3L70D 1M1JC 4H44B 2QRXA 1GDTA 5KJ7C 3V2RA 2QG4A 4PD4I 3D71A 3CCRP 1SQVE 1YQ3C 3T97A 2M8RA 3CC4P 5KKZB 2FXMA 1KC8Q 1PP9G 3HUSB 1NJIQ 3MD0A 5AVZB 1U57A 2K3RA 1NAFA 3MUDC 1NVOA 3B5ND 2N9YB 2OTJP 2KSEA 1GW3A 1RY3A 1SQBE 5L8RJ 2FYUD 3HD7A 1X0TA 2C9NY 3L74J 1M1KQ 1N7SB 2P1JA 2YXRB 1KQSO 1FS0E 4WY4B 1YHQP 5AVQB 1L0NG 1H8AA 1RF0C 1UIXA 4H0LD 2OYHA 2J5UA 1L0LE 3G3ZA 3TSIA 1OVRA 5AW1B 2HPCB 4B86A 1OVUA 2R5DA 1EZVG 1L4AB 2IBZI 3H1KD 2V4HA 4H13C 5K5GB 3L72G 3L37A 3QH9A 4RESB 1FZCA 1BGYD 1GL2B 5BU5A 2HFED 1JY2N 3Q5SA 2FYZA 1OWAA 2IFNA 3L71D 3A3YB 3CXHE 1PGQA 5CJ4A 1FBMA 2QJPC 3CX5I 2JWAA 2ZAEB 3RL0D 1ZXGA 3A7OA 2AEMA 2GUSA 5B66H 1Y9BA 3PLNA 2JDIH 2O3JA 3H32A 1PGOA 1OW6A 2FXPA 2BEZF 4BRYA 2ZFCA 1M1JA 4I7ZB 1KN7A 4N78D 5KJ7A 4C7NA 1SQPK 2Y9ZA 4U3FE 2WT7A 1BE3D 2HR3A 5E79H 1SQPD 1P84D 3L70G 4YXDC 1OW8A 1NTMD 3AE2C 1FJPA 3IF4A 2E75C 1M7LA 1OXZA 5APSA 2WPSA 2OTKE 3RK2B 3L75E 5CCGC 3CCEP 3TGUD 3PRJA 4LC1A 1VQ8P 3PHLA 1H0TB 2CK3H 1M90Q 1ZRTE 1YJNP 1BCCJ 1YJ9P 1IZNB 2YMYA 4D6TG 2MKVA 3ITKA 2E43A 5APWA 4BXLA 1SQXE 3L73D 3A0HH 2XNXA 5BU8B 1FZGA 2N9BA 1LTAC 3LIDA 2WSEH 2GUVA 3BRTB 3KYQA 1GMJA 1NKNA 1IO4A 2D2CC 2FYUG 3FXDA 2FXOA 1VQPP 1FDMA 3L35A 1LTJC 5KLVD 1AQ5A 1NTZK 4L75A 1KILC 3BCCE 1OZHA 4JQ0D 1FZEA 1H88A 1VQ4P 5KTBA 1NTZD 2C0XA 1W5CE 1HJ0A 2N1TC 2ZYAA 4GOFA 4PD4D 2OYIA 1BSHA 3M9BA 1RF1A 1AV1A 3MZWB 3GF7A 1VQKP 3AE9C 3IR9A 2YKQA 1Q86Q 1LTBC 1KB9E 2H88C 1HGVA 1VF5B 3VN0A 2BCCD 4WB4A 2PRRA 3Q3DA 4PJ0E 1PPJE 1SFCD 1A02F 1N86A 2E76D 1IFNA 1QEXA 2M3EA 3GHGB 1RE3C 3L72J 2Z5HA 3Q5RA 1T8ZA 3BATA 3CXHI 2O01H 1G1IA 2WWWA 1BE3G 2KIKA 5CCGA 1VDFA 1YTZT 3CWBG 2XU6A 1NTMG 2ZYDA 3TGUG 3S1KA 2H7HA 2IBZD 3CCLP 1R8EA 2Z4EA 2ZVNB 1AVYA 3I56P 2YKPA 2E74C 3L70J 2MJZA 3L73G 2ZT9D 1GTWA 1IK7A 1GW4A 4C46A 1LTTC 4H44D 4JYBA 3TNUB 1JMBA 1CI6B 3H1JG 3CX5D 1WMKA 1LT9B 1NU1K 5CCHD 1PV3A 1N8RQ 1VQMP 3BASA 4D6TJ 2B88A 2E5TA 1NU1D 1P84H 1X9VA 2PGDA 5CBNA 1KMIZ 3V4WA 2OTLP 5KLVG 2NPSB 1URQB 4JBZA 1YQ4C 3C1LA 4DOJA 2A06E 5KAFE 3V6IA 3AE4C 1ZLLA 5H2FH 1XTCC 2FY8A 1M1JB 4GODA 2AEFA 2NZ2A 2IX7C 4C7NB 3CI9A 1N7SD 2FYNC 4PV1C 4HH2A 1RHZB 4WY4D 3S4RA 3RBXA 1JUNA 3HD7C 1RE3A 3VP8A 3KXDA 2O01J 1GU5A 2BCCG 1SQVK 2W27A 3SFDC 2WMMA 1ZR2A 2HLOA 2Q1KA 3RK3C 1SQVD 2PP6A 2OYHC 1USEA 1EXIA 4JF7A 2QE7H 1L4AD 3B5NA 1YI2P 3VOPA 1KB9I 3VTPC 2YIUC 1TU3F 3WUTA 4IL6H 3M0DA 4Y99C 3AE8C 1GL2D 3KQGA 1SQBK 4L73A 3H1LG 3I5CA 2SPZA 5TJHA 2KYVA 2K9YA 1N73A 1SQBD 1FZCC 2QJYC 1N7LA 3H1HJ 3M06A 1JTHB 4RJTA 3M91A 2IBZG 5GTIH 3P32A 2KS1A 5TISE 3M9QA 1L0LD 3CWBJ 5GTHH 4H13B 1JY2P 2YXQB 2OARA 1NTMJ 2QJKC 1NKZB 5B66E 3TGUJ 1NO4A 3MP7B 2WSFH 3AEAC 3RK2D 3B8EB 2K9JB 3HE4B 1YJWP 1Q90D 1ZV8A 3CCJP 1EZVE 5E79E 3MTUE 3NFQA 3CXHD 3RBZA 1BSNA 1T2KC 2O1JA 3MGNA 1CW5A 4ZNCA 2JJLA 2P58A 2W6JH 4TLFA 2JP3A 1JY3O 2WPVB 2RN0A 1KORA 3H1JJ 3GF3A 2R5BA 5AW5B 2WZ7A 2V7QH 2C0WA 4KHXA 2Z5IA 1PGJA 3F89A 4OWFA 2E75B 1KILE 4U3FD 1FZFA 3V2PA 1IFPA 1FAVA 3NTNA 1LP1B 5KLVJ 3L4FA 4UB8H 2FKWB 1QL2A 5APQA 3L75D 2XKMA 1KYOH 2VRSA 1QX8A 1WRGA 3CL3D 2Q6QA 2QM8A 3M0AA 1S72P 2PFXA 1ZRTD 1VQLP 1SQXK 1ZOYC 2L5GB 1YTZI 2DW3A 3EQ2A 1SS1A 1SQXD 5AVSB 2D2CB 2OYIC 1RF1C 5AW4B 5KAIH 2Y0EA 2Q3EA 4OGQC 3A0BH 1NOHA 1PFIA 1VF5D 2KZJA 1LTJB 4D6TE 1KILB 2KXPB 2WSCH 1KFMA 2KLVA 3CPWO 4YTPC 3PH0A 2R32A 3Q5PA 2WQYC 2WSFJ 2I1JA 3JCUH 1VQNP 2WSSH 2N1TB 3A2AA 2QVAA 3FWLA 3AE5C 3H1IJ 2R3CA 2KZIA 3GG2A 3BCCD 3O6QA 1L0LG 5BVZA 3H1LJ 1NTKJ 4EDFA 1SQQG 2QA4P 2K88A 1E79H 4IOIH 1JCCA 3GW6A 2W8ZA 5AVYB 2ZXXA 1NHLA 2M5AB 4N3YB 3N4XA 2V7QJ 1RH5B 2K37A 1Y8AA 1Y47A 1X79B 1KB9D 3TYYA 1SP4A 2H89C 2JR8A 2W83C 4YPCA 1PPJD 1HF9A 1HH0A 2R44A 1HJBA 2B87B 5EFWB 1K73Q 3SSUA 3LW5H 1EZVI 3G71P 1U7JA 1X8YA 1PP9J 4U3FG 3HTKB 3MHVA 3R4YA 1FDOA 3JC22 1EDLA 2IYOA 1UIIA 1KTMA 4GDOA 1J1EC 3H1HE 5AW9B 4UB6E 1GK4A 3WU2H 1KD1Q 1W2EA 2NPSD 1URQD 1M8OB 3OA7A 4LGDE 2E74B 1LWUA 3II6A 1W2BO 5APTA 2XV5A 1K05A 3FWNA 2HODB 3GLMA 3H1KG 3CWBE 1BDDA 1L0NJ 3CXHH 1GK6A 1VQ7P 5KJ7D 1BGYG 3AEGC 3N7NA
chains in the Genus database with same CATH topology
2KOGA 2NPSB 1GDTA 5KJ7C 3V2RA 1URQB 2CPBA 5CCHA 3VMZA 3HUSC 1FZBA 4DOJA 1ZLLA 1T3JA 3V2QA 1XTCC 1M1JB 3M9HA 4XA4A 3H6PA 3T97A 2M8RA 1IK9A 1JY2O 2IX7C 3VYIA 3HUSA 4C7NB 2FXMA 1VPCA 1KQLA 1NTMK 3MIWA 5AVVB 3CI9A 1T3UA 1N7SD 1S9KE 1H89A 3HUSB 3HD7D 5AW7B 3MD0A 5AVZB 4HH2A 3A5TA 4WY4D 1FOSE 1DH3A 4I1LA 1JMMA 1N7SC 1SFCA 1JUNA 1NAFA 1G1JA 3HD7C 3B5ND 1RE3A 2XDJA 3VP8A 1FZAA 4WY4C 1GU5A 1SQVK 1GW3A 3RK3D 3B5NC 2W27A 1RY3A 3NMDA 1ZR2A 2HLOA 4I2LC 2GM4A 3HD7A 3MUDA 3RK3C 2C9NY 2PP6A 5AW6B 2OYHC 1N7SB 4WY4A 1NTKK 3M0DC 3HD7B 2P1JA 4JF7A 3CLQA 2BASA 1FJKA 1L4AD 1N2DC 4WY4B 3B5NA 5AVQB 5AW8B 3VOPA 1H8AA 3VTPC 3B5NB 4I6MC 1S9KD 1L4AC 1LTSC 2YO2A 1IFIA 1RF0C 1N73C 2OYHA 3M0DA 4Y99C 3G3ZA 2WPRA 3RK3B 3TSIA 1DX7A 1GL2D 3KQGA 2OYHB 5AW1B 1SQBK 3UIAA 2HPCB 4B86A 3I5CA 2WTYA 4GKGA 2Q3IA 2R5DA 1GL2C 1L4AA 2KYVA 1RF0A 1N73A 1FZCC 1L4AB 3P8CE 1N73B 4Y99B 1N7LA 2JEEA 5KLVK 1JTHA 2E42A 3M06A 1GL2A 4N78E 1JTHB 2QM7A 3L37A 4DZOA 2FFDA 3VP9A 4RESB 1FZCA 3M91A 1GL2B 5BU5A 2HFED 1JY2N 3P32A 1ZN5A 1FZCB 5APYA 5AVUB 2FYZA 1JOCA 1OWAA 2IFNA 3M9QA 1CSBA 2KP8A 3A3YB 5CJ4A 1JY2P 1HWTC 1FBMA 2OARA 2H8PD 1NKZB 3RL0D 4C7RA 1GD2E 1NWQA 3A7OA 2GUSA 2POHA 1GU4A 5AVWB 1IFMA 3P8CD 3RL0C 1NO4A 3H32A 3O8ZA 4W7ZA 1MV8A 2WSFH 2ZFCA 3LIEA 3V5BA 1M1JA 3H32B 3RK2D 1XTGB 4N78D 3HE4A 1J1DC 5AW3B 3L36A 5KJ7A 3B8EB 4C7NA 1SQPK 1YYCA 3GHGC 3HE4B 1LGHB 1J2JB 2WT7A 3RK2C 2A45I 2LKMA 1ZV8A 2WT7B 1T2KD 3NXSA 4EOTA 3RL0B 2CPSA 3MTUE 3OJAB 3NFQA 3KPEA 1KFNA 1T2KC 1G2CB 2A45G 4GT1A 1L0NK 2O1JA 5CCGD 1FJPA 1J1DB 3MGNA 1CW5A 5AVRB 1M7LA 2JJLA 1MUUA 1OXZA 5APSA 1JY3O 2WPSA 3KDPB 1QL1A 3RK2B 4IFDK 5CCGC 4ZKUA 2O1KA 5AW0B 1EQ7A 2R5BA 5APVA 4LC1A 3C9IA 3PP5A 5AW5B 2WZ7A 1N7SA 1HBWA 2C0WA 5CHXA 4KHXA 2Z5IA 2W6AA 4OH8B 2C9LY 2YMYA 1FZFA 2M3BA 3V2PA 1FAVA 3NTNA 2E43A 2P7JA 5APWA 1LTGC 2XNXA 3L4FA 5BU8B 1FZGA 2N9BA 2HPCA 1LTAC 2FKWB 3LIDA 2HYNA 5AW2B 1WT6A 1LTIC 2WSEH 1HGZA 4HYTB 1QL2A 1CZQA 2GUVA 3BRTB 5APQA 3KYQA 1NKNA 1IO4A 3VMYA 3OAKA 3SWYA 2XKMA 2VRSA 5CMZA 3HE5B 1WRGA 2HG5D 2QM8A 2YO3A 3CL3D 3M0AA 1HVVA 1SQXK 1KILD 1FDMA 2L5GB 2A45H 3L35A 1LTJC 1AQ5A 1YTZI 4EIJA 2Q9IA 1NTZK 4M3LA 3EQ2A 1KILC 5AVSB 4ZKPA 2OYIC 3TK1A 1RF1C 5AW4B 1FZEA 1SVFA 2N1TD 2I1KA 1H88A 1IJDB 5KTBA 1JNMA 2C0XA 5CJ0A 1NOHA 1LTJA 1PFIA 2XZRA 2N1TC 3E1IA 3BVHA 1AFOA 1JY3N 1KILA 1LTJB 5APUA 2OYIA 3M9BA 1RF1A 2WITA 2WPQA 1KILB 2OYIB 1RF1B 2WSCH 1MFZA 1KFMA 2ZXEB 4O9BA 2KLVA 1JY3P 3VMXA 2N1TA 2R32A 3IR9A 2YKQA 1Z56A 4LLHA 5AVXB 2Q7CA 2I1JA 2N1TB 3A2AA 2R3CA 1LTBC 3V2NA 4N6JA 1HGVA 1DEBA 3VN0A 5BVZA 4WB4A 1G2CA 1SFCD 1A02F 1RE4C 2IFMA 1N86A 3HRNA 1E5WA 1IFNA 3GHGA 2P2UA 2PAJA 3U59A 2P67A 4XE5B 2J59M 1SFCC 1NH4A 3GHGB 3V4QA 1RE3C 1JCCA 3IFMA 4IFMA 2Z5HA 1T8ZA 3BATA 1RE4A 5AVYB 1NHLA 1KZUB 3P7KA 4N3YB 1GZLA 3N4XA 4W80A 3U1AA 2O01H 2YNYA 1G1IA 2WWWA 1IFDA 4JYCA 5CCGA 1X79B 1SFCB 1VDFA 2FYUK 1YTZT 3TYYA 1SP4A 3WMM0 1HUCA 2XU6A 1HH0A 3U1CA 3EFGA 2YKOA 4W7YA 1HJBA 1A02J 2H7HA 3HE5A 2IPPA 1JO5A 4WBAA 3LW5H 2W6BA 2Z4EA 1IFJA 3HTKA 1X8YA 3SWFA 2Q5UA 3HTKB 2YKPA 1LT9C 4AQRD 2MJZA 1IC2A 2FFDC 3R2PA 1GTWA 1GW4A 4AYCA 3TNUA 1LWUC 1HTLC 3BRVB 1CI6A 1J1EC 5AW9B 4AUWA 1GK4A 2KB7P 1LTTC 4JYBA 3TNUB 4C46A 1W2EA 2NPSD 1CI6B 1LT9A 1ZR4A 4IFFA 1URQD 1SLQA 3OA7A 1LT9B 4LGDE 2NPSC 1L0LK 1NU1K 1LWUA 2FFDB 2HODA 1URQC 3II6A 5CCHD 1FOSF 5APTA 2J58A 2XV5A 1SQQK 3BASA 1LWUB 4GIFA 5AVTB 2HODB 1JCDA 1J1EB 2H43A 5CCHC 1GK6A 3P8MC 5APXA 1X9VA 1FU1A 5KJ7D 2NPSA 2KSJA 3V4WA 1MZ9A 1M1JC 3N7NA 1URQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Z56 A;  5CHX A;  1FU1 A;  5CJ4 A;  3II6 A;  5CJ0 A;  4XA4 A;  3MUD A;  1IK9 A; 
#chains in the Genus database with same CATH topology
 1PGP A;  2B9B A;  4WVZ A;  2CPB A;  3RK3 E;  3L71 G;  5CCH A;  2RKL A;  3VMZ A;  1FZB A;  1AJY A;  1NAY A;  3K5B A;  3M9H A;  1S4X A;  2WVR A;  1OX3 A;  3H6P A;  2KNC A;  3HUS A;  4HJG H;  1VPC A;  3T97 B;  1T3U A;  1S9K E;  1H89 A;  5AW7 B;  3A5T A;  1DH3 A;  4I1L A;  1G1J A;  2XDJ A;  3H1J E;  3BCC G;  3IAO A;  3B5N C;  1SQP G;  3NMD A;  2A06 D;  2FYN B;  3D6Z A;  3L74 E;  4PV1 B;  5C39 A;  2OGU A;  4I2L C;  5AW6 B;  4WY4 A;  1NTK K;  3M0D C;  3HD7 B;  1N2D C;  2WSE J;  4CPG A;  3B4S A;  3FXE A;  1OIP A;  2YO2 A;  1IFI A;  1N73 C;  3AE6 C;  3RK3 B;  3LW5 J;  4JPZ B;  2OYH B;  1L0L J;  3UIA A;  4H0L C;  4YXW H;  5DJU B;  1SQQ J;  1L4A A;  4NPE A;  2YIU B;  4H13 D;  1KV4 A;  1BDC A;  3P8C E;  2AEJ A;  4Y99 B;  2E42 A;  3G6E P;  2RMZ A;  1GL2 A;  1QVF O;  1Q82 Q;  2QSI A;  1LJ2 A;  4ASV A;  5GTI E;  3RL0 g;  1ZN5 A;  1FZC B;  2QJY B;  1JOC A;  3W67 A;  4MN4 C;  2KP8 A;  5GTH E;  3OW2 O;  4Z1M H;  4GOE A;  2QIW A;  4HKZ H;  3AE1 C;  2LXB A;  1NWQ A;  2POH A;  1GU4 A;  5AVW B;  3RL0 C;  1NTZ G;  1MV8 A;  3V5B A;  4BWN A;  3H32 B;  4BRY B;  2G3A A;  2FYU J;  1J1D C;  5AW3 B;  3H1I E;  1YYC A;  2QJK B;  3GHG C;  1LGH B;  1J2J B;  2A45 I;  2LKM A;  3H1L E;  1YBK A;  2WT7 B;  3NXS A;  1NTK E;  2CPS A;  1M57 D;  2E75 D;  1KFN A;  1OMI A;  2P10 A;  3AE3 C;  4GT1 A;  1L0N K;  5CCG D;  4ASW A;  4RKU J;  3D70 A;  1QL1 A;  4IFD K;  2XND H;  5AW0 B;  1H0T A;  1EQ7 A;  2IYP A;  4L74 A;  5CHX A;  1BCC E;  4OH8 B;  3H1K J;  3SFE C;  1Q7Y Q;  1X22 A;  1AVO A;  4HB1 A;  1YIT P;  4KT0 J;  2P7J A;  1LTG C;  1R5S A;  1BGY J;  1EZV D;  1NGM B;  1S5L H;  2HYN A;  3L71 J;  1WT6 A;  1LTI C;  1HGZ A;  2D2C D;  1CZQ A;  3Q2Y A;  4PD4 H;  4Y28 J;  4EYY Q;  3VMY A;  3CC7 P;  3CCQ P;  3OAK A;  3SWY A;  1KYO E;  2HG5 D;  1PP9 E;  4L76 A;  1OW7 A;  4XFJ A;  1KIL D;  1ZP0 C;  1USD A;  2GA1 A;  4QMA A;  4ZKP A;  3Q1M A;  1BE3 J;  3BCC J;  2N1T D;  2I1K A;  3EWK A;  1IJD B;  5KAI E;  1JNM A;  1SQP J;  3A0B E;  2XZR A;  3E1I A;  3BVH A;  3QWO C;  1JY3 N;  2WIT A;  3EFF K;  2OYI B;  1L0N E;  3TDK A;  1RF1 B;  1MFT A;  1MFZ A;  2ZXE B;  2AXT H;  1Z56 A;  4OGQ B;  5AVX B;  1VL2 A;  3JCU E;  4RO0 A;  3B71 A;  2QJP B;  2OQQ A;  2IZ1 A;  1T6A A;  4A7P A;  1NU1 G;  5KAF H;  1G2C A;  3L73 J;  5KLI C;  3TF5 A;  2NRG A;  3HRN A;  3GHG A;  2M0B A;  2P2U A;  3U59 A;  2FBW C;  3KZI H;  1SFC C;  3L72 E;  3CD6 P;  3V4Q A;  2E76 C;  4D6T D;  3IFM A;  3AED C;  1RE4 A;  2KNC B;  2JO1 A;  5B5E H;  1L2P A;  1GZL A;  4W80 A;  4NPD A;  1IFD A;  2FYU K;  3E1R A;  3JSV C;  1PZQ A;  1KQG B;  3WMM 0;  1S1C X;  1HUC A;  3A0H E;  3I55 P;  2QEX P;  3U1C A;  3ABV C;  3CX5 H;  1LT1 A;  3EFG A;  2YKO A;  1NTZ J;  4NPF X;  4W7Y A;  1A02 J;  4OVN F;  1QLE D;  3HE5 A;  2IPP A;  1JO5 A;  4WBA A;  1SQV G;  2W6B A;  1IFJ A;  2E74 D;  2Q5U A;  1SQQ E;  3L70 E;  1AQT A;  1IC2 A;  2FFD C;  3TNU A;  1LWU C;  1HTL C;  3BRV B;  1CI6 A;  4AUW A;  2BCC J;  3WU2 E;  2ZT9 C;  1LT9 A;  1ZR4 A;  4IFF A;  2AXC A;  4H44 C;  1OVV A;  1SQB G;  1FOS F;  2J58 A;  5AVT B;  5TIS H;  1J1E B;  2H43 A;  5CCH C;  5M1B A;  3P8M C;  5APX A;  1FU1 A;  2NPS A;  1MZ9 A;  3USS A;  1URQ A;  2KOG A;  3FX0 A;  2K1A A;  5KKZ C;  3H1H D;  3HUS C;  3CCU P;  1KYO I;  2FYU E;  1T3J A;  3V2Q A;  4TT3 H;  2E5Y A;  2IZ0 A;  4XA4 A;  4PV1 D;  1IK9 A;  1JY2 O;  3VYI A;  2LR2 A;  1KQL A;  1NTM K;  3MIW A;  5AVV B;  3CWB D;  3HD7 D;  1QVG O;  1K04 A;  1FOS E;  1JMM A;  3PTZ A;  1N7S C;  1SFC A;  1FZA A;  2KI7 B;  4WY4 C;  2OYO A;  1VQO P;  3RK3 D;  2Y0C A;  2GM4 A;  3MUD A;  3H1K E;  4WWI A;  3CLQ A;  2BAS A;  1FJK A;  3AE7 C;  1PL5 A;  3PJS K;  1EDK A;  5AW8 B;  1BGY E;  2JKV A;  3C8V A;  3B5N B;  4I6M C;  1S9K D;  1L4A C;  1LTS C;  1DD4 A;  2I8D A;  3AEC C;  4R4L A;  3L71 E;  2WPR A;  1DX7 A;  1Q81 Q;  1NU1 J;  1D7M A;  2WTY A;  3H1J D;  4GKG A;  2Q3I A;  1GL2 C;  4DJG A;  1RF0 A;  1FDI A;  3FGA D;  3L74 D;  2KK7 A;  1N73 B;  4DT0 A;  1K9M Q;  2JEE A;  5KLV K;  1JTH A;  1MKM A;  1JB0 J;  4N78 E;  2QM7 A;  4H0L B;  3L75 G;  4DZO A;  2FFD A;  1LNQ A;  3VP9 A;  3CCS P;  1FE6 A;  1BE3 E;  2R3S A;  4U7J A;  5APY A;  5AVU B;  1SQP E;  1CSB A;  2WSC J;  4I7Z C;  1P84 E;  2KS1 B;  5CBO A;  1HWT C;  1DD3 A;  1NTM E;  2LXC B;  2H8P D;  1SQX G;  4C7R A;  3CME P;  1GD2 E;  1FC2 C;  1IFM A;  3TGU E;  3P8C D;  2IDB A;  3O8Z A;  4W7Z A;  3LIE A;  2KLU A;  2K9J A;  2O01 N;  1XTG B;  5H2F E;  3HE4 A;  3L36 A;  1SQV J;  1ZW0 A;  5DJT B;  4IL6 X;  1S5L X;  3RK2 C;  1T2K D;  1RQV A;  3G4S P;  3L73 E;  4EI2 A;  4EOT A;  1DIP A;  3RL0 B;  3OJA B;  3KPE A;  2ZYG A;  1G2C B;  2A45 G;  1J1D B;  1ZME C;  5AVR B;  1MUU A;  2YMK A;  3KDP B;  3H1H G;  4ZKU A;  2O1K A;  4KJM A;  5APV A;  3C9I A;  3GMA A;  3PP5 A;  1SQB J;  1N7S A;  1HBW A;  1NYH A;  1S3J A;  2W6A A;  3H1I D;  1K8A Q;  2C9L Y;  3CC2 P;  2M3B A;  1LP1 A;  3H1L D;  1OFC X;  5KLV E;  1NTK D;  3AEF C;  1M56 D;  4IL6 E;  2HPC A;  1S5L E;  5AW2 B;  1NTZ E;  4HYT B;  3G9R A;  3RGU A;  1DEE G;  1KQF B;  2W90 A;  4PD4 E;  1PPJ G;  1QGK B;  5CMZ A;  3HE5 B;  1RQU A;  1BCC D;  2YO3 A;  2ITA A;  1HVV A;  4K3A A;  3WUV A;  1R5L A;  2A45 H;  1EDI A;  3E7K A;  3H25 A;  4EIJ A;  2Q9I A;  4M3L A;  4OGQ D;  3TK1 A;  2BCC E;  4UB6 H;  1SVF A;  1S2E A;  4ZMD A;  5CJ0 A;  1LTJ A;  3VMA A;  1U7M A;  1AFO A;  1KIL A;  5APU A;  2UWJ E;  1EDJ A;  3L74 G;  2WPQ A;  1PIX A;  1VF5 C;  1KYO D;  2ZVO B;  4O9B A;  1PP9 D;  1JY3 P;  3VMX A;  2AXT E;  2N1T A;  4LLH A;  2Q7C A;  3S9O A;  2BEQ D;  1YIJ P;  2L91 A;  1KB9 H;  3V2N A;  4N6J A;  4U3F J;  3W68 A;  1DEB A;  1VQ5 P;  4PJ0 H;  1VQ6 P;  3O6Q B;  3WUU A;  1RE4 C;  2IFM A;  1E5W A;  2PAJ A;  3ZDM A;  2P67 A;  4XE5 B;  3KZI E;  2J59 M;  3KHU A;  1NH4 A;  4IFM A;  2M5A A;  1L0N D;  2IBZ E;  3L75 J;  1KZU B;  2JWD A;  5B5E E;  3P7K A;  5KLI B;  2RH0 A;  4K35 A;  3U1A A;  2YNY A;  1P84 I;  4JYC A;  1JM0 A;  1SFC B;  2E76 B;  2Y9Y A;  2B89 A;  1SQX J;  3CCM P;  4R4M A;  1VQ9 P;  2G8Y A;  4UB8 E;  3CX5 E;  3L72 D;  2B87 A;  1AA0 A;  2KUB A;  2A06 G;  1Q2N A;  1JEK A;  2Y0D A;  3HTK A;  1EC5 A;  3H1I G;  1NU1 E;  3SWF A;  2ZJS E;  1LT9 C;  4AQR D;  1NTK G;  3R2P A;  4AYC A;  3CMA P;  4DCK A;  2KB7 P;  3IN6 A;  1EXJ A;  1SLQ A;  3D6Y A;  2NPS C;  1L0L K;  2FFD B;  2HOD A;  1URQ C;  1BCC G;  1SQQ K;  1LWU B;  4GIF A;  1JCD A;  3SWK A;  3F5H A;  2ZT9 B;  3CCV P;  3AEE C;  3AEB C;  2KSJ A;  1SQQ D;  3L70 D;  1M1J C;  4H44 B;  2QRX A;  1GDT A;  5KJ7 C;  3V2R A;  2QG4 A;  4PD4 I;  3D71 A;  3CCR P;  1SQV E;  1YQ3 C;  3T97 A;  2M8R A;  3CC4 P;  5KKZ B;  2FXM A;  1KC8 Q;  1PP9 G;  3HUS B;  1NJI Q;  3MD0 A;  5AVZ B;  1U57 A;  2K3R A;  1NAF A;  3MUD C;  1NVO A;  3B5N D;  2N9Y B;  2OTJ P;  2KSE A;  1GW3 A;  1RY3 A;  1SQB E;  5L8R J;  2FYU D;  3HD7 A;  1X0T A;  2C9N Y;  3L74 J;  1M1K Q;  1N7S B;  2P1J A;  2YXR B;  1KQS O;  1FS0 E;  4WY4 B;  1YHQ P;  5AVQ B;  1L0N G;  1H8A A;  1RF0 C;  1UIX A;  4H0L D;  2OYH A;  2J5U A;  1L0L E;  3G3Z A;  3TSI A;  1OVR A;  5AW1 B;  2HPC B;  4B86 A;  1OVU A;  2R5D A;  1EZV G;  1L4A B;  2IBZ I;  3H1K D;  2V4H A;  4H13 C;  5K5G B;  3L72 G;  3L37 A;  3QH9 A;  4RES B;  1FZC A;  1BGY D;  1GL2 B;  5BU5 A;  2HFE D;  1JY2 N;  3Q5S A;  2FYZ A;  1OWA A;  2IFN A;  3L71 D;  3A3Y B;  3CXH E;  1PGQ A;  5CJ4 A;  1FBM A;  2QJP C;  3CX5 I;  2JWA A;  2ZAE B;  3RL0 D;  1ZXG A;  3A7O A;  2AEM A;  2GUS A;  5B66 H;  1Y9B A;  3PLN A;  2JDI H;  2O3J A;  3H32 A;  1PGO A;  1OW6 A;  2FXP A;  2BEZ F;  4BRY A;  2ZFC A;  1M1J A;  4I7Z B;  1KN7 A;  4N78 D;  5KJ7 A;  4C7N A;  1SQP K;  2Y9Z A;  4U3F E;  2WT7 A;  1BE3 D;  2HR3 A;  5E79 H;  1SQP D;  1P84 D;  3L70 G;  4YXD C;  1OW8 A;  1NTM D;  3AE2 C;  1FJP A;  3IF4 A;  2E75 C;  1M7L A;  1OXZ A;  5APS A;  2WPS A;  2OTK E;  3RK2 B;  3L75 E;  5CCG C;  3CCE P;  3TGU D;  3PRJ A;  4LC1 A;  1VQ8 P;  3PHL A;  1H0T B;  2CK3 H;  1M90 Q;  1ZRT E;  1YJN P;  1BCC J;  1YJ9 P;  1IZN B;  2YMY A;  4D6T G;  2MKV A;  3ITK A;  2E43 A;  5APW A;  4BXL A;  1SQX E;  3L73 D;  3A0H H;  2XNX A;  5BU8 B;  1FZG A;  2N9B A;  1LTA C;  3LID A;  2WSE H;  2GUV A;  3BRT B;  3KYQ A;  1GMJ A;  1NKN A;  1IO4 A;  2D2C C;  2FYU G;  3FXD A;  2FXO A;  1VQP P;  1FDM A;  3L35 A;  1LTJ C;  5KLV D;  1AQ5 A;  1NTZ K;  4L75 A;  1KIL C;  3BCC E;  1OZH A;  4JQ0 D;  1FZE A;  1H88 A;  1VQ4 P;  5KTB A;  1NTZ D;  2C0X A;  1W5C E;  1HJ0 A;  2N1T C;  2ZYA A;  4GOF A;  4PD4 D;  2OYI A;  1BSH A;  3M9B A;  1RF1 A;  1AV1 A;  3MZW B;  3GF7 A;  1VQK P;  3AE9 C;  3IR9 A;  2YKQ A;  1Q86 Q;  1LTB C;  1KB9 E;  2H88 C;  1HGV A;  1VF5 B;  3VN0 A;  2BCC D;  4WB4 A;  2PRR A;  3Q3D A;  4PJ0 E;  1PPJ E;  1SFC D;  1A02 F;  1N86 A;  2E76 D;  1IFN A;  1QEX A;  2M3E A;  3GHG B;  1RE3 C;  3L72 J;  2Z5H A;  3Q5R A;  1T8Z A;  3BAT A;  3CXH I;  2O01 H;  1G1I A;  2WWW A;  1BE3 G;  2KIK A;  5CCG A;  1VDF A;  1YTZ T;  3CWB G;  2XU6 A;  1NTM G;  2ZYD A;  3TGU G;  3S1K A;  2H7H A;  2IBZ D;  3CCL P;  1R8E A;  2Z4E A;  2ZVN B;  1AVY A;  3I56 P;  2YKP A;  2E74 C;  3L70 J;  2MJZ A;  3L73 G;  2ZT9 D;  1GTW A;  1IK7 A;  1GW4 A;  4C46 A;  1LTT C;  4H44 D;  4JYB A;  3TNU B;  1JMB A;  1CI6 B;  3H1J G;  3CX5 D;  1WMK A;  1LT9 B;  1NU1 K;  5CCH D;  1PV3 A;  1N8R Q;  1VQM P;  3BAS A;  4D6T J;  2B88 A;  2E5T A;  1NU1 D;  1P84 H;  1X9V A;  2PGD A;  5CBN A;  1KMI Z;  3V4W A;  2OTL P;  5KLV G;  2NPS B;  1URQ B;  4JBZ A;  1YQ4 C;  3C1L A;  4DOJ A;  2A06 E;  5KAF E;  3V6I A;  3AE4 C;  1ZLL A;  5H2F H;  1XTC C;  2FY8 A;  1M1J B;  4GOD A;  2AEF A;  2NZ2 A;  2IX7 C;  4C7N B;  3CI9 A;  1N7S D;  2FYN C;  4PV1 C;  4HH2 A;  1RHZ B;  4WY4 D;  3S4R A;  3RBX A;  1JUN A;  3HD7 C;  1RE3 A;  3VP8 A;  3KXD A;  2O01 J;  1GU5 A;  2BCC G;  1SQV K;  2W27 A;  3SFD C;  2WMM A;  1ZR2 A;  2HLO A;  2Q1K A;  3RK3 C;  1SQV D;  2PP6 A;  2OYH C;  1USE A;  1EXI A;  4JF7 A;  2QE7 H;  1L4A D;  3B5N A;  1YI2 P;  3VOP A;  1KB9 I;  3VTP C;  2YIU C;  1TU3 F;  3WUT A;  4IL6 H;  3M0D A;  4Y99 C;  3AE8 C;  1GL2 D;  3KQG A;  1SQB K;  4L73 A;  3H1L G;  3I5C A;  2SPZ A;  5TJH A;  2KYV A;  2K9Y A;  1N73 A;  1SQB D;  1FZC C;  2QJY C;  1N7L A;  3H1H J;  3M06 A;  1JTH B;  4RJT A;  3M91 A;  2IBZ G;  5GTI H;  3P32 A;  2KS1 A;  5TIS E;  3M9Q A;  1L0L D;  3CWB J;  5GTH H;  4H13 B;  1JY2 P;  2YXQ B;  2OAR A;  1NTM J;  2QJK C;  1NKZ B;  5B66 E;  3TGU J;  1NO4 A;  3MP7 B;  2WSF H;  3AEA C;  3RK2 D;  3B8E B;  2K9J B;  3HE4 B;  1YJW P;  1Q90 D;  1ZV8 A;  3CCJ P;  1EZV E;  5E79 E;  3MTU E;  3NFQ A;  3CXH D;  3RBZ A;  1BSN A;  1T2K C;  2O1J A;  3MGN A;  1CW5 A;  4ZNC A;  2JJL A;  2P58 A;  2W6J H;  4TLF A;  2JP3 A;  1JY3 O;  2WPV B;  2RN0 A;  1KOR A;  3H1J J;  3GF3 A;  2R5B A;  5AW5 B;  2WZ7 A;  2V7Q H;  2C0W A;  4KHX A;  2Z5I A;  1PGJ A;  3F89 A;  4OWF A;  2E75 B;  1KIL E;  4U3F D;  1FZF A;  3V2P A;  1IFP A;  1FAV A;  3NTN A;  1LP1 B;  5KLV J;  3L4F A;  4UB8 H;  2FKW B;  1QL2 A;  5APQ A;  3L75 D;  2XKM A;  1KYO H;  2VRS A;  1QX8 A;  1WRG A;  3CL3 D;  2Q6Q A;  2QM8 A;  3M0A A;  1S72 P;  2PFX A;  1ZRT D;  1VQL P;  1SQX K;  1ZOY C;  2L5G B;  1YTZ I;  2DW3 A;  3EQ2 A;  1SS1 A;  1SQX D;  5AVS B;  2D2C B;  2OYI C;  1RF1 C;  5AW4 B;  5KAI H;  2Y0E A;  2Q3E A;  4OGQ C;  3A0B H;  1NOH A;  1PFI A;  1VF5 D;  2KZJ A;  1LTJ B;  4D6T E;  1KIL B;  2KXP B;  2WSC H;  1KFM A;  2KLV A;  3CPW O;  4YTP C;  3PH0 A;  2R32 A;  3Q5P A;  2WQY C;  2WSF J;  2I1J A;  3JCU H;  1VQN P;  2WSS H;  2N1T B;  3A2A A;  2QVA A;  3FWL A;  3AE5 C;  3H1I J;  2R3C A;  2KZI A;  3GG2 A;  3BCC D;  3O6Q A;  1L0L G;  5BVZ A;  3H1L J;  1NTK J;  4EDF A;  1SQQ G;  2QA4 P;  2K88 A;  1E79 H;  4IOI H;  1JCC A;  3GW6 A;  2W8Z A;  5AVY B;  2ZXX A;  1NHL A;  2M5A B;  4N3Y B;  3N4X A;  2V7Q J;  1RH5 B;  2K37 A;  1Y8A A;  1Y47 A;  1X79 B;  1KB9 D;  3TYY A;  1SP4 A;  2H89 C;  2JR8 A;  2W83 C;  4YPC A;  1PPJ D;  1HF9 A;  1HH0 A;  2R44 A;  1HJB A;  2B87 B;  5EFW B;  1K73 Q;  3SSU A;  3LW5 H;  1EZV I;  3G71 P;  1U7J A;  1X8Y A;  1PP9 J;  4U3F G;  3HTK B;  3MHV A;  3R4Y A;  1FDO A;  3JC2 2;  1EDL A;  2IYO A;  1UII A;  1KTM A;  4GDO A;  1J1E C;  3H1H E;  5AW9 B;  4UB6 E;  1GK4 A;  3WU2 H;  1KD1 Q;  1W2E A;  2NPS D;  1URQ D;  1M8O B;  3OA7 A;  4LGD E;  2E74 B;  1LWU A;  3II6 A;  1W2B O;  5APT A;  2XV5 A;  1K05 A;  3FWN A;  2HOD B;  3GLM A;  3H1K G;  3CWB E;  1BDD A;  1L0N J;  3CXH H;  1GK6 A;  1VQ7 P;  5KJ7 D;  1BGY G;  3AEG C;  3N7N A; 
#chains in the Genus database with same CATH homology
 2KOG A;  2NPS B;  1GDT A;  5KJ7 C;  3V2R A;  1URQ B;  2CPB A;  5CCH A;  3VMZ A;  3HUS C;  1FZB A;  4DOJ A;  1ZLL A;  1T3J A;  3V2Q A;  1XTC C;  1M1J B;  3M9H A;  4XA4 A;  3H6P A;  3T97 A;  2M8R A;  1IK9 A;  1JY2 O;  2IX7 C;  3VYI A;  3HUS A;  4C7N B;  2FXM A;  1VPC A;  1KQL A;  1NTM K;  3MIW A;  5AVV B;  3CI9 A;  1T3U A;  1N7S D;  1S9K E;  1H89 A;  3HUS B;  3HD7 D;  5AW7 B;  3MD0 A;  5AVZ B;  4HH2 A;  3A5T A;  4WY4 D;  1FOS E;  1DH3 A;  4I1L A;  1JMM A;  1N7S C;  1SFC A;  1JUN A;  1NAF A;  1G1J A;  3HD7 C;  3B5N D;  1RE3 A;  2XDJ A;  3VP8 A;  1FZA A;  4WY4 C;  1GU5 A;  1SQV K;  1GW3 A;  3RK3 D;  3B5N C;  2W27 A;  1RY3 A;  3NMD A;  1ZR2 A;  2HLO A;  4I2L C;  2GM4 A;  3HD7 A;  3MUD A;  3RK3 C;  2C9N Y;  2PP6 A;  5AW6 B;  2OYH C;  1N7S B;  4WY4 A;  1NTK K;  3M0D C;  3HD7 B;  2P1J A;  4JF7 A;  3CLQ A;  2BAS A;  1FJK A;  1L4A D;  1N2D C;  4WY4 B;  3B5N A;  5AVQ B;  5AW8 B;  3VOP A;  1H8A A;  3VTP C;  3B5N B;  4I6M C;  1S9K D;  1L4A C;  1LTS C;  2YO2 A;  1IFI A;  1RF0 C;  1N73 C;  2OYH A;  3M0D A;  4Y99 C;  3G3Z A;  2WPR A;  3RK3 B;  3TSI A;  1DX7 A;  1GL2 D;  3KQG A;  2OYH B;  5AW1 B;  1SQB K;  3UIA A;  2HPC B;  4B86 A;  3I5C A;  2WTY A;  4GKG A;  2Q3I A;  2R5D A;  1GL2 C;  1L4A A;  2KYV A;  1RF0 A;  1N73 A;  1FZC C;  1L4A B;  3P8C E;  1N73 B;  4Y99 B;  1N7L A;  2JEE A;  5KLV K;  1JTH A;  2E42 A;  3M06 A;  1GL2 A;  4N78 E;  1JTH B;  2QM7 A;  3L37 A;  4DZO A;  2FFD A;  3VP9 A;  4RES B;  1FZC A;  3M91 A;  1GL2 B;  5BU5 A;  2HFE D;  1JY2 N;  3P32 A;  1ZN5 A;  1FZC B;  5APY A;  5AVU B;  2FYZ A;  1JOC A;  1OWA A;  2IFN A;  3M9Q A;  1CSB A;  2KP8 A;  3A3Y B;  5CJ4 A;  1JY2 P;  1HWT C;  1FBM A;  2OAR A;  2H8P D;  1NKZ B;  3RL0 D;  4C7R A;  1GD2 E;  1NWQ A;  3A7O A;  2GUS A;  2POH A;  1GU4 A;  5AVW B;  1IFM A;  3P8C D;  3RL0 C;  1NO4 A;  3H32 A;  3O8Z A;  4W7Z A;  1MV8 A;  2WSF H;  2ZFC A;  3LIE A;  3V5B A;  1M1J A;  3H32 B;  3RK2 D;  1XTG B;  4N78 D;  3HE4 A;  1J1D C;  5AW3 B;  3L36 A;  5KJ7 A;  3B8E B;  4C7N A;  1SQP K;  1YYC A;  3GHG C;  3HE4 B;  1LGH B;  1J2J B;  2WT7 A;  3RK2 C;  2A45 I;  2LKM A;  1ZV8 A;  2WT7 B;  1T2K D;  3NXS A;  4EOT A;  3RL0 B;  2CPS A;  3MTU E;  3OJA B;  3NFQ A;  3KPE A;  1KFN A;  1T2K C;  1G2C B;  2A45 G;  4GT1 A;  1L0N K;  2O1J A;  5CCG D;  1FJP A;  1J1D B;  3MGN A;  1CW5 A;  5AVR B;  1M7L A;  2JJL A;  1MUU A;  1OXZ A;  5APS A;  1JY3 O;  2WPS A;  3KDP B;  1QL1 A;  3RK2 B;  4IFD K;  5CCG C;  4ZKU A;  2O1K A;  5AW0 B;  1EQ7 A;  2R5B A;  5APV A;  4LC1 A;  3C9I A;  3PP5 A;  5AW5 B;  2WZ7 A;  1N7S A;  1HBW A;  2C0W A;  5CHX A;  4KHX A;  2Z5I A;  2W6A A;  4OH8 B;  2C9L Y;  2YMY A;  1FZF A;  2M3B A;  3V2P A;  1FAV A;  3NTN A;  2E43 A;  2P7J A;  5APW A;  1LTG C;  2XNX A;  3L4F A;  5BU8 B;  1FZG A;  2N9B A;  2HPC A;  1LTA C;  2FKW B;  3LID A;  2HYN A;  5AW2 B;  1WT6 A;  1LTI C;  2WSE H;  1HGZ A;  4HYT B;  1QL2 A;  1CZQ A;  2GUV A;  3BRT B;  5APQ A;  3KYQ A;  1NKN A;  1IO4 A;  3VMY A;  3OAK A;  3SWY A;  2XKM A;  2VRS A;  5CMZ A;  3HE5 B;  1WRG A;  2HG5 D;  2QM8 A;  2YO3 A;  3CL3 D;  3M0A A;  1HVV A;  1SQX K;  1KIL D;  1FDM A;  2L5G B;  2A45 H;  3L35 A;  1LTJ C;  1AQ5 A;  1YTZ I;  4EIJ A;  2Q9I A;  1NTZ K;  4M3L A;  3EQ2 A;  1KIL C;  5AVS B;  4ZKP A;  2OYI C;  3TK1 A;  1RF1 C;  5AW4 B;  1FZE A;  1SVF A;  2N1T D;  2I1K A;  1H88 A;  1IJD B;  5KTB A;  1JNM A;  2C0X A;  5CJ0 A;  1NOH A;  1LTJ A;  1PFI A;  2XZR A;  2N1T C;  3E1I A;  3BVH A;  1AFO A;  1JY3 N;  1KIL A;  1LTJ B;  5APU A;  2OYI A;  3M9B A;  1RF1 A;  2WIT A;  2WPQ A;  1KIL B;  2OYI B;  1RF1 B;  2WSC H;  1MFZ A;  1KFM A;  2ZXE B;  4O9B A;  2KLV A;  1JY3 P;  3VMX A;  2N1T A;  2R32 A;  3IR9 A;  2YKQ A;  1Z56 A;  4LLH A;  5AVX B;  2Q7C A;  2I1J A;  2N1T B;  3A2A A;  2R3C A;  1LTB C;  3V2N A;  4N6J A;  1HGV A;  1DEB A;  3VN0 A;  5BVZ A;  4WB4 A;  1G2C A;  1SFC D;  1A02 F;  1RE4 C;  2IFM A;  1N86 A;  3HRN A;  1E5W A;  1IFN A;  3GHG A;  2P2U A;  2PAJ A;  3U59 A;  2P67 A;  4XE5 B;  2J59 M;  1SFC C;  1NH4 A;  3GHG B;  3V4Q A;  1RE3 C;  1JCC A;  3IFM A;  4IFM A;  2Z5H A;  1T8Z A;  3BAT A;  1RE4 A;  5AVY B;  1NHL A;  1KZU B;  3P7K A;  4N3Y B;  1GZL A;  3N4X A;  4W80 A;  3U1A A;  2O01 H;  2YNY A;  1G1I A;  2WWW A;  1IFD A;  4JYC A;  5CCG A;  1X79 B;  1SFC B;  1VDF A;  2FYU K;  1YTZ T;  3TYY A;  1SP4 A;  3WMM 0;  1HUC A;  2XU6 A;  1HH0 A;  3U1C A;  3EFG A;  2YKO A;  4W7Y A;  1HJB A;  1A02 J;  2H7H A;  3HE5 A;  2IPP A;  1JO5 A;  4WBA A;  3LW5 H;  2W6B A;  2Z4E A;  1IFJ A;  3HTK A;  1X8Y A;  3SWF A;  2Q5U A;  3HTK B;  2YKP A;  1LT9 C;  4AQR D;  2MJZ A;  1IC2 A;  2FFD C;  3R2P A;  1GTW A;  1GW4 A;  4AYC A;  3TNU A;  1LWU C;  1HTL C;  3BRV B;  1CI6 A;  1J1E C;  5AW9 B;  4AUW A;  1GK4 A;  2KB7 P;  1LTT C;  4JYB A;  3TNU B;  4C46 A;  1W2E A;  2NPS D;  1CI6 B;  1LT9 A;  1ZR4 A;  4IFF A;  1URQ D;  1SLQ A;  3OA7 A;  1LT9 B;  4LGD E;  2NPS C;  1L0L K;  1NU1 K;  1LWU A;  2FFD B;  2HOD A;  1URQ C;  3II6 A;  5CCH D;  1FOS F;  5APT A;  2J58 A;  2XV5 A;  1SQQ K;  3BAS A;  1LWU B;  4GIF A;  5AVT B;  2HOD B;  1JCD A;  1J1E B;  2H43 A;  5CCH C;  1GK6 A;  3P8M C;  5APX A;  1X9V A;  1FU1 A;  5KJ7 D;  2NPS A;  2KSJ A;  3V4W A;  1MZ9 A;  1M1J C;  3N7N A;  1URQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...