1Z56A

Co-crystal structure of lif1p-lig4p
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
77
structure length
77
Chain Sequence
ADKLYKDICCVNDSYRNIKESDSSNRNRVEQLARERELLDKLLETRDERTRAMMVTLLNEKKKKIRELHEILRQNNI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Ligase interacting factor 1
publication title Structure of an Xrcc4-DNA ligase IV yeast ortholog complex reveals a novel BRCT interaction mode.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Ligase
total genus 25
structure length 77
sequence length 77
chains with identical sequence B
ec nomenclature
pdb deposition date 2005-03-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.370 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1z56A00
1FU1A 5CJ0A 3MUDA 1IK9A 1Z56A 5CHXA 5CJ4A 3II6A 4XA4A
chains in the Genus database with same CATH superfamily
2QJYC 1PPJE 2R3SA 3ABVC 1JY3O 3B5NC 1HTLC 1VQLP 1SQXK 2FYUG 2WTYA 2K9YA 2WSFJ 3VP8A 2Y0CA 2E5YA 2VRSA 3L71E 2W6AA 2Y9ZA 2YXRB 2BCCD 3H1HJ 1ZLLA 1JY3N 1H0TA 5BU8B 1RE4C 2PGDA 1ZRTE 3CC7P 4I7ZC 2QJYB 3AE5C 3S1KA 1AQTA 1KYOH 3AEBC 4GKGA 1NTKG 3HUSC 3B5NB 1HF9A 4JYBA 1M1KQ 3OW2O 1X8YA 4NPEA 3H32B 1N8RQ 5B5EE 1S5LX 2E76B 3R4YA 2NRGA 2V4HA 3L75G 1JY2N 1LT9C 3TF5A 1G2CA 4PD4D 4W7YA 4U3FG 1LTAC 2AXCA 1K8AQ 3EWKA 4IL6X 2KK7A 1SQQK 2WSFH 1PP9G 1NTZJ 1ZOYC 2N1TB 2W6BA 2LKMA 2GUSA 1SQBD 4D6TJ 2IYOA 1RE3A 3Q5PA 3M06A 3PTZA 1UIXA 3M9QA 4I2LC 4DCKA 1LT9B 4RKUJ 3MZWB 1BE3E 4HJGH 3SFDC 3KDPB 3FXDA 1SQVG 3WUTA 1S9KD 2Q3IA 1LGHB 2XU6A 2C9LY 4H44B 3NXSA 1BDDA 2M8RA 2KSJA 4U7JA 2E43A 3BCCE 1UIIA 5E79E 1NYHA 1GU5A 4OVNF 1M1JA 3IR9A 5KAFH 2ZYGA 2AEFA 3B8EB 2R32A 2FXPA 4PD4I 1L0LD 1SS1A 1LTJB 1PL5A 1URQD 1W2EA 3T97B 2HG5D 1YJWP 3ZDMA 3GF3A 2B88A 3A0HH 3AE6C 2FYUE 3H1LG 1VQPP 5GTHE 5APTA 2XKMA 4YXWH 5CMZA 2P7JA 3AE2C 2HR3A 5APVA 4ZKPA 5AVSB 1FDIA 2B9BA 3VYIA 3L72J 5TJHA 1GW3A 2WPSA 2JO1A 1HUCA 3KQGA 1HJBA 2D2CB 2OYHC 1VQKP 4C7NB 2YO2A 3CWBD 4PV1C 1PIXA 2QG4A 1SQXJ 3L73G 3CXHD 4Y99C 1NTKE 1NAFA 4GIFA 3H1KD 3C8VA 4KT0J 5B66H 3CCMP 1EDLA 1SQBK 2WQYC 4H13C 5TISE 1FZGA 2NPSD 1JEKA 2XNDH 5APXA 3CCVP 1YJ9P 3L75E 1BCCG 1L4AA 2JJLA 2Q9IA 1OWAA 3JSVC 1K05A 4U3FE 1KTMA 2YNYA 2HPCA 2O01J 1L0ND 3M0DA 1SFCA 3L70D 3IN6A 1N7SA 2IFMA 2H8PD 1PP9E 2L91A 1LTIC 3K5BA 3NFQA 2PRRA 1KILA 4ZNCA 1OVUA 1FOSE 2MJZA 2KNCB 1VQOP 3H1JJ 1M56D 1IFPA 2Z4EA 5CCGD 3G4SP 1JO5A 5AW2B 3W68A 2IX7C 3KZIE 1LWUA 3MUDA 3B71A 1FOSF 1L0LK 1PPJD 1SQQJ 4WY4A 1SQVE 1SQPG 2OYIC 1BDCA 3CMAP 5CJ0A 1VPCA 4ZKUA 3CXHI 2OQQA 3L71D 2QJPC 3PHLA 3WMM0 1URQC 1WRGA 3AE7C 2E74B 3HTKB 4GOEA 1YJNP 1GTWA 1HWTC 2I1KA 4XA4A 1KQSO 2QM7A 2K1AA 2O01H 5AW3B 3V4WA 1ZRTD 1KORA 5AVZB 1GL2B 1KFNA 4L75A 1KB9E 1NAYA 1RF0A 2IYPA 1IFJA 2ZT9D 1IFDA 3H1LE 3MD0A 1ZMEC 2B89A 2BCCJ 1H8AA 1N2DC 3QH9A 2ZVNB 1VQMP 3A3YB 2P10A 2WZ7A 3D6ZA 1URQB 1BGYG 3B5NA 5AVUB 3RL0D 1EDKA 2AEMA 1IFNA 1L0NK 2NPSC 2WSCJ 3H32A 3TNUB 1H89A 2FY8A 3L73E 1U7JA 1IFMA 1DX7A 2OARA 2OTJP 2KS1B 3AEAC 2PP6A 1M8OB 1OW7A 5GTIH 1ZR2A 2N1TA 1JCDA 1YYCA 1YITP 3PLNA 4DJGA 3G3ZA 1BCCE 3AE8C 1BE3D 1PZQA 2ZJSE 4GOFA 2UWJE 5CCGC 5TISH 1FZBA 2Y9YA 1NO4A 2NPSB 2V7QH 1PGPA 4HH2A 2FKWB 4H0LD 1SQBJ 5AW6B 2GM4A 1LT9A 3EQ2A 3SFEC 3BCCD 5CBOA 1GW4A 1SFCB 1K9MQ 3TGUG 1VQ9P 2H88C 1KQFB 1IJDB 3SSUA 3A0BE 2WSCH 3JC22 2YO3A 1FZAA 3RK3E 1RH5B 1JMMA 1U7MA 4AQRD 1LTBC 3L37A 1SQPE 4A7PA 1M57D 1K73Q 3CL3D 3I56P 2FYUD 1NJIQ 1GK6A 3PP5A 5KLVG 2AXTE 2WITA 3L74G 1FDOA 4PD4H 4PJ0E 3T97A 3OA7A 2JWAA 2HYNA 2ZT9C 3BASA 4BWNA 1OX3A 1L0LJ 2AEJA 3AEGC 1USDA 3H1IG 2QJKC 2NZ2A 2KOGA 2HLOA 3GHGC 2Y0EA 1GU4A 1NTMK 4I1LA 1A02F 3TSIA 1DD3A 3AEDC 3CX5I 1VQ6P 4L74A 3RL0C 1NTKD 2YKPA 1S3JA 5H2FE 4N78E 1X22A 5EFWB 3FX0A 4KJMA 4C7NA 5AVVB 1VQ7P 4OGQC 4HKZH 4UB6E 3AEFC 1DH3A 1QEXA 1BGYE 4EYYQ 3S9OA 3TYYA 2ITAA 3HE5B 3L75D 1KZUB 1ZW0A 4C7RA 1BCCJ 3BATA 2FFDC 2ZT9B 2CPBA 4GT1A 1JUNA 3CWBJ 4U3FD 1N73C 2QJKB 3W67A 1RY3A 2P58A 3H1KJ 1OVVA 1PP9D 4XFJA 3R2PA 1GMJA 2KLUA 3AECC 2LXBA 5APSA 1U57A 5AW7B 1Q81Q 3LW5J 1FJPA 4PV1D 4WVZA 4OWFA 2ZYDA 4H0LC 1LP1A 1R5SA 2IPPA 2QIWA 3V6IA 4UB8H 5KAIE 1NU1G 3N7NA 3Q5SA 5KJ7A 1L0NJ 3PRJA 3GMAA 3L70J 4H13D 1Z56A 2KNCA 1J1EC 1SQVD 4GODA 1CW5A 3NTNA 4I7ZB 1NTME 2QSIA 2FYUK 3HUSB 4HB1A 1Y9BA 4CPGA 4ASVA 1AJYA 3TGUE 4ASWA 3A2AA 3B4SA 4B86A 2KI7B 3RK2D 4H0LB 3CXHH 3HD7D 1E79H 1N86A 2QVAA 2YKOA 1HVVA 1P84I 3CX5E 3HTKA 3O6QB 1KB9D 1NTKK 1Q2NA 5KLIC 1J1DC 3L71J 3LW5H 3H1LD 1OMIA 3A0BH 1VF5D 5KLVE 3VMYA 3L74E 1EQ7A 1GD2E 1GL2A 2OTKE 3FWLA 3CCLP 1G1JA 3F89A 3G9RA 3H1IE 2ZVOB 3AEEC 2L5GB 4N6JA 1URQA 1X79B 2I8DA 3L35A 1NGMB 2G3AA 3WU2E 1KC8Q 3L73D 2YMKA 4TLFA 1FU1A 2W8ZA 5AVRB 2J59M 2POHA 3KPEA 2XNXA 4JBZA 4IFFA 3TNUA 3GLMA 2XV5A 3A7OA 4N3YB 4I6MC 1Q82Q 1BCCD 3MGNA 1NWQA 5BVZA 1SQVK 2KS1A 1NTMJ 4Y28J 5AVXB 3LIEA 1CI6B 3H6PA 1N7LA 4YTPC 1BSHA 1KB9I 1OXZA 3RL0g 3PH0A 5C39A 1EZVG 3V5BA 2IFNA 2JEEA 5APWA 1M90Q 3S4RA 3HE4A 2NPSA 1X0TA 2IZ1A 1BE3J 3E7KA 1AA0A 2J58A 1NU1E 1PV3A 1P84E 3RK3D 2OYHB 2WPQA 2RN0A 1PFIA 1SQPD 4MN4C 3P7KA 4PV1B 3H1HG 1LP1B 5B5EH 3RK2C 3HD7C 4Y99B 3BCCJ 3TK1A 1FC2C 1S1CX 4H13B 1EZVI 5AW8B 3MHVA 2YKQA 5CCGA 1USEA 1KD1Q 1EXIA 2KXPB 1SVFA 1VF5C 3MIWA 3WUVA 2CPSA 3M0AA 3C1LA 1JB0J 5CCHA 1LTTC 1D7MA 1LJ2A 2OGUA 2RH0A 2IBZG 2FYUJ 1DD4A 4N78D 2JDIH 3RK2B 2HFED 4WY4D 1M1JC 3HD7B 3A5TA 1X9VA 2BASA 4RO0A 2B87B 1ZN5A 1YIJP 2Q6QA 4EOTA 1NTZG 2QE7H 1BGYD 1S72P 5CBNA 3CD6P 2H43A 1PGJA 1RQUA 1NH4A 4GDOA 1IFIA 4K35A 1VF5B 4WBAA 3VTPC 1HGVA 1FJKA 2ZXEB 4D6TG 1FBMA 4R4MA 1KV4A 5E79H 1NTKJ 2OYIB 1SP4A 1WT6A 2IBZI 1DEEG 3VMXA 1PGQA 3HE5A 3RGUA 2C0XA 3V2QA 1MZ9A 2V7QJ 2H89C 2QJPB 3CCSP 2A06G 1AQ5A 1YHQP 1JY3P 3L75J 1Y47A 5CJ4A 3D71A 4U3FJ 3WU2H 1OFCX 2ZFCA 1KYOE 3V4QA 3OJAB 5GTHH 5APYA 3P8CE 2SPZA 1PP9J 1SQPK 4OGQD 3I55P 1NTMD 3V2NA 1NHLA 1CZQA 1T6AA 4L73A 2K3RA 3F5HA 3RK3C 5KTBA 1EZVE 2FFDA 1RE4A 1YTZT 2E76D 3TGUD 1JY2P 1HGZA 1L4AC 3CLQA 3AE9C 3IFMA 4DZOA 1IZNB 3HUSA 2BEZF 1ZV8A 2KSEA 1SQVJ 1GDTA 1VL2A 3CCJP 2Q3EA 3HE4B 3CX5D 2N1TD 3L72G 2O3JA 4JYCA 3H1HE 2WVRA 3P32A 5AW1B 4LC1A 4NPFX 3CCRP 1SLQA 2KLVA 2RMZA 3MP7B 5KLVD 3L74D 3RK3B 2Q1KA 1CSBA 1QL1A 1P84H 3QWOC 3O6QA 3Q5RA 4LGDE 1SQXG 2FXMA 1FE6A 3KXDA 4WY4C 5BU5A 2WT7B 3AE3C 3H1ID 2PFXA 1R8EA 4H44D 3CCQP 1T8ZA 2IBZE 3SWYA 3H1LJ 3O8ZA 5AVYB 2IZ0A 3UIAA 2M5AB 1YI2P 3KZIH 2R3CA 2O1JA 1S4XA 5KAFE 2E75D 2FYZA 4RJTA 3G71P 1NTZE 1KILE 1MUUA 3BRTB 2WSEJ 1OIPA 1JNMA 3PJSK 1JM0A 4TT3H 3A0HE 3H1JG 4D6TE 2XDJA 3L73J 1RF0C 1FDMA 2ZXXA 2A45G 3E1RA 4HYTB 5AVWB 2I1JA 4EI2A 3WUUA 1SQQG 1EXJA 1GK4A 2K37A 3M9BA 2A06E 3EFGA 1CI6A 2D2CD 1KB9H 1NU1D 1P84D 2P2UA 2E76C 3JCUE 2QRXA 3GHGB 1RF1C 1Y8AA 4YPCA 5B66E 2E5TA 1HJ0A 1KFMA 3EFFK 3RL0B 2E42A 2A45I 5KLVK 2CK3H 4DOJA 2OYHA 2WSEH 3V2RA 1IC2A 2N1TC 1JY2O 4OGQB 1AVOA 5DJTB 2QM8A 2K88A 2C0WA 1FS0E 3RBXA 3FWNA 3FGAD 2M3EA 1W2BO 2FFDB 5AW4B 1SQPJ 2BCCG 2JR8A 4BRYB 4QMAA 2QEXP 1N73B 3L72E 3N4XA 1RF1B 5DJUB 1G1IA 5KJ7D 1T2KC 4H44C 5APQA 1EDJA 1A02J 1JTHB 3M91A 1XTGB 1SQXE 1NKZB 2JWDA 3HD7A 2WMMA 3V2PA 4JQ0D 1JMBA 2E75C 2P67A 1J1EB 2B87A 3IF4A 3KHUA 3OAKA 2K9JB 1IK9A 1LTJC 4DT0A 3U1AA 2HODB 2E74D 1FAVA 4NPDA 1FZCC 1KN7A 1BGYJ 4K3AA 3RBZA 2ZYAA 2OYIA 1KQLA 4YXDC 1SQBG 1NU1K 2FBWC 1MFTA 1KYOD 1GL2D 2WWWA 3P8CD 2W83C 1DIPA 2AXTH 3GF7A 3H1JE 2E75B 4PJ0H 2D2CC 3AE4C 1RHZB 1MFZA 2N9YB 3GW6A 5KLIB 1J1DB 3VOPA 3P8MC 2ZAEB 1EZVD 2LXCB 1L2PA 1NOHA 4WWIA 1SQQE 1FZCB 1RQVA 1NVOA 1R5LA 4EDFA 1BSNA 5H2FH 1FZEA 1QL2A 3VP9A 1OVRA 4BXLA 3CCEP 4UB6H 1K04A 2IDBA 3SWFA 3H1HD 3H25A 2M0BA 5AW9B 1L0LG 2KYVA 1YBKA 1AVYA 1EDIA 1YTZI 3BRVB 5GTIE 2KUBA 3D70A 3TGUJ 1S5LE 1Q86Q 1GZLA 3JCUH 1H0TB 1YQ3C 3TDKA 2WSSH 5KJ7C 2MKVA 5KKZC 1VQ8P 3LIDA 2KIKA 5K5GB 4AUWA 1QVGO 3BVHA 5AVQB 1T3JA 4IL6E 3I5CA 1KYOI 4M3LA 2BCCE 2IBZD 1L4AD 1FZFA 3CCUP 2N9BA 5KLVJ 1TU3F 3L74J 2WT7A 1RE3C 1ZR4A 5KAIH 3CWBG 2C9NY 1KQGB 1SFCD 1N7SD 4OH8B 2OTLP 2R44A 3H1KG 1NTZD 2KB7P 2WPVB 1KILD 3ITKA 3VMZA 1G2CB 2LR2A 2FYNC 3H1IJ 5KKZB 1J2JB 4O9BA 1LT1A 2BEQD 1QGKB 2E74C 2P1JA 2M5AA 1QLED 1VQNP 3CMEP 3CC4P 1AV1A 3L4FA 2R5DA 4D6TD 1IO4A 5L8RJ 4LLHA 1VDFA 4PD4E 2RKLA 3Q2YA 1GL2C 5CCHD 1E5WA 1L0NG 4WB4A 4JPZB 3L70G 2XZRA 1Q7YQ 2A06D 2WPRA 3CX5H 1H88A 5CHXA 1SQBE 2JP3A 2FYNB 1OZHA 3C9IA 1AFOA 4W7ZA 3GG2A 3Q3DA 1IK7A 5APUA 2FXOA 3IAOA 4W80A 1PPJG 4C46A 1ZXGA 3FXEA 1S9KE 1HH0A 1M1JB 1MKMA 3HRNA 3GHGA 2Z5IA 3AE1C 1ZP0C 1M7LA 4L76A 4EIJA 3U1CA 3L71G 1NU1J 3VMAA 2GUVA 2YIUC 1YQ4C 2A45H 2M3BA 2W6JH 4IOIH 3B5ND 2J5UA 2G8YA 3L72D 3MTUE 2Z5HA 1LTSC 4JF7A 4R4LA 1L0LE 2W27A 2R5BA 2OYOA 5AVTB 4BRYA 1N73A 4KHXA 1NTZK 4UB8E 2DW3A 1T3UA 1RF1A 1SQXD 2Q5UA 1JOCA 2QA4P 1VQ5P 1DEBA 3M0DC 1HBWA 1SFCC 1N7SC 2YIUB 1JTHA 1QX8A 1KILC 2KZIA 1S5LH 1LNQA 3VN0A 4RESB 1EC5A 4AYCA 3L36A 4XE5B 3SWKA 3KYQA 2YMYA 4IFDK 3CWBE 1NTMG 3CPWO 1PGOA 4IL6H 1NKNA 3CXHE 1OW8A 1LWUC 3MUDC 1XTCC 3H1KE 1QVFO 1W5CE 1S2EA 2H7HA 1L4AB 2K9JA 1OW6A 5CCHC 1JCCA 1T2KD 2HPCB 2HODA 2O1KA 1KMIZ 1N7SB 2YXQB 3Q1MA 2KP8A 3H1JD 2Q7CA 3CI9A 1KILB 1LTGC 1BE3G 3G6EP 4ZMDA 1WMKA 2GA1A 5M1BA 3NMDA 1L0NE 3E1IA 3L70E 1SQQD 5AW0B 5AW5B 4Z1MH 2PAJA 2Y0DA 1VQ4P 2O01N 1LWUB 2W90A 3U59A 3BCCG 3D6YA 4WY4B 1LTJA 3II6A 3M9HA 2KZJA 3CC2P 3USSA 1FZCA 1Q90D 1MV8A 4IFMA 2JKVA
chains in the Genus database with same CATH topology
1PFIA 1L0NK 2NPSC 3H32A 3P7KA 3OAKA 3TNUB 1H89A 1IK9A 1LTJC 3RK2C 1JY3O 3HD7C 4Y99B 3U1AA 2HODB 3B5NC 3TK1A 1HTLC 1FAVA 1FZCC 1IFMA 1SQXK 2WTYA 1DX7A 3VP8A 2OARA 2OYIA 5AW8B 2VRSA 1KQLA 2YKQA 2W6AA 5CCGA 2PP6A 1NU1K 1ZR2A 1GL2D 2N1TA 1SVFA 1JCDA 1YYCA 2WWWA 3MIWA 2CPSA 3P8CD 3M0AA 1ZLLA 1JY3N 5CCHA 1LTTC 3G3ZA 5BU8B 1RE4C 1MFZA 5CCGC 1J1DB 3VOPA 1FZBA 1NO4A 2NPSB 3P8MC 4N78D 4HH2A 3RK2B 2HFED 2FKWB 4WY4D 1M1JC 3HD7B 1NOHA 3HUSC 4GKGA 3A5TA 3B5NB 4JYBA 5AW6B 2GM4A 1FZCB 1LT9A 3EQ2A 1X9VA 2BASA 1X8YA 1ZN5A 4EOTA 1GW4A 1SFCB 3H32B 1IJDB 2H43A 1FZEA 1QL2A 2WSCH 3VP9A 1NH4A 1IFIA 2YO3A 4WBAA 3VTPC 1HGVA 1FJKA 1JY2N 1LT9C 1FZAA 2ZXEB 1FBMA 1G2CA 3SWFA 4W7YA 1JMMA 1LTAC 5AW9B 2OYIB 1SP4A 4AQRD 1LTBC 1WT6A 3L37A 3VMXA 2KYVA 1SQQK 2WSFH 3HE5A 2C0XA 1YTZI 3V2QA 3BRVB 3CL3D 1MZ9A 2N1TB 1GK6A 2W6BA 2LKMA 3PP5A 1GZLA 2GUSA 2WITA 1AQ5A 1JY3P 5KJ7C 3LIDA 5CJ4A 4AUWA 3T97A 3OA7A 3BVHA 5AVQB 2HYNA 1RE3A 1T3JA 3BASA 3I5CA 2ZFCA 3V4QA 3M06A 3OJAB 4M3LA 5APYA 3P8CE 3M9QA 4I2LC 1SQPK 2KOGA 3GHGC 2HLOA 1LT9B 1GU4A 3V2NA 3KDPB 1L4AD 1FZFA 1NHLA 1NTMK 2N9BA 4I1LA 1A02F 1CZQA 3TSIA 1S9KD 2WT7A 1RE3C 1ZR4A 2Q3IA 1LGHB 2XU6A 3RL0C 2C9LY 2YKPA 2C9NY 1SFCD 1N7SD 3RK3C 4N78E 5KTBA 3NXSA 4OH8B 2FFDA 1RE4A 1YTZT 2M8RA 4C7NA 2KSJA 5AVVB 2E43A 2KB7P 1KILD 3VMZA 1JY2P 1G2CB 1HGZA 1DH3A 1L4AC 1GU5A 3CLQA 1J2JB 4O9BA 3IFMA 2P1JA 4DZOA 1M1JA 3HUSA 1ZV8A 3TYYA 3HE5B 1KZUB 4C7RA 3BATA 3L4FA 1GDTA 2R5DA 2FFDC 3IR9A 2CPBA 4GT1A 1IO4A 1JUNA 4LLHA 1VDFA 3HE4B 3B8EB 1N73C 2N1TD 2R32A 4JYCA 1RY3A 1GL2C 1LTJB 3P32A 5CCHD 1E5WA 5AW1B 1URQD 1W2EA 4LC1A 3R2PA 2HG5D 4WB4A 1SLQA 2KLVA 2XZRA 5APSA 2WPRA 3RK3B 5APTA 2XKMA 1CSBA 5AW7B 1QL1A 5CMZA 2P7JA 1H88A 4LGDE 5CHXA 1FJPA 2FXMA 5APVA 4ZKPA 5AVSB 3VYIA 4WY4C 3C9IA 1GW3A 5BU5A 4W7ZA 1AFOA 2IPPA 2WT7B 2WPSA 3N7NA 5KJ7A 1HUCA 3KQGA 1HJBA 1Z56A 1T8ZA 2OYHC 4C7NB 1J1EC 5APUA 2YO2A 1CW5A 3NTNA 3SWYA 3O8ZA 4W80A 4C46A 5AVYB 2FYUK 1S9KE 1HH0A 3UIAA 1M1JB 3HUSB 4Y99C 1NAFA 2R3CA 3HRNA 3GHGA 2Z5IA 4GIFA 1M7LA 2O1JA 1SQBK 2FYZA 4EIJA 3U1CA 1MUUA 2GUVA 3BRTB 1JNMA 2A45H 2M3BA 1FZGA 2NPSD 3A2AA 4B86A 5APXA 3RK2D 3HD7D 1N86A 3B5ND 3MTUE 2XDJA 1L4AA 1RF0C 2JJLA 2Z5HA 2YKOA 2Q9IA 1OWAA 1FDMA 1HVVA 1LTSC 4JF7A 2YNYA 2A45G 3HTKA 2HPCA 4HYTB 5AVWB 2I1JA 1NTKK 3M0DA 1SFCA 1J1DC 1N7SA 2IFMA 2W27A 2H8PD 2R5BA 3LW5H 5AVTB 1N73A 1LTIC 4KHXA 1GK4A 1NTZK 3NFQA 1KILA 3M9BA 3VMYA 1T3UA 1EQ7A 1RF1A 1GD2E 1GL2A 2Q5UA 3EFGA 1CI6A 1FOSE 1JOCA 2MJZA 1DEBA 3M0DC 1G1JA 1HBWA 1SFCC 2Z4EA 1N7SC 5CCGD 1JO5A 5AW2B 2IX7C 2P2UA 1JTHA 1KILC 1LWUA 3MUDA 3GHGB 1RF1C 3VN0A 4RESB 1FOSF 1L0LK 4AYCA 2L5GB 3L36A 4N6JA 4XE5B 3KYQA 1URQA 4WY4A 1KFMA 2YMYA 1X79B 3L35A 2OYIC 3RL0B 2E42A 1FU1A 4IFDK 2A45I 5KLVK 4DOJA 5AVRB 2OYHA 5CJ0A 1VPCA 4ZKUA 2WSEH 3V2RA 1IC2A 1NKNA 2J59M 2N1TC 1LWUC 2POHA 2XNXA 3KPEA 1JY2O 1XTCC 4IFFA 2H7HA 2QM8A 1L4AB 3WMM0 5CCHC 1URQC 1JCCA 3TNUA 1WRGA 2C0WA 1T2KD 2XV5A 3HTKB 2HPCB 2HODA 1GTWA 1HWTC 2O1KA 2I1KA 3A7OA 4XA4A 2FFDB 4N3YB 2QM7A 1N7SB 5AW4B 2KP8A 2O01H 4I6MC 3MGNA 1NWQA 5BVZA 1SQVK 2Q7CA 1N73B 5AW3B 3V4WA 3CI9A 5AVXB 1KILB 1LTGC 3LIEA 3N4XA 5AVZB 1RF1B 1GL2B 1CI6B 1G1IA 1KFNA 5KJ7D 3H6PA 1T2KC 1N7LA 3NMDA 3E1IA 1OXZA 5AW0B 1RF0A 3V5BA 5APQA 5AW5B 1IFJA 2IFNA 1IFDA 2PAJA 1A02J 1JTHB 3M91A 2JEEA 3MD0A 5APWA 1LWUB 1XTGB 3HE4A 1H8AA 3U59A 1N2DC 1NKZB 2NPSA 3A3YB 2WZ7A 1URQB 4WY4B 1LTJA 3II6A 3M9HA 3HD7A 3B5NA 3V2PA 5AVUB 3RL0D 2J58A 1FZCA 3RK3D 2OYHB 1IFNA 2P67A 1J1EB 1MV8A 2WPQA 4IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FU1 A;  5CJ0 A;  3MUD A;  1IK9 A;  1Z56 A;  5CHX A;  5CJ4 A;  3II6 A;  4XA4 A; 
#chains in the Genus database with same CATH topology
 2QJY C;  1PPJ E;  2R3S A;  3ABV C;  1JY3 O;  3B5N C;  1HTL C;  1VQL P;  1SQX K;  2FYU G;  2WTY A;  2K9Y A;  2WSF J;  3VP8 A;  2Y0C A;  2E5Y A;  2VRS A;  3L71 E;  2W6A A;  2Y9Z A;  2YXR B;  2BCC D;  3H1H J;  1ZLL A;  1JY3 N;  1H0T A;  5BU8 B;  1RE4 C;  2PGD A;  1ZRT E;  3CC7 P;  4I7Z C;  2QJY B;  3AE5 C;  3S1K A;  1AQT A;  1KYO H;  3AEB C;  4GKG A;  1NTK G;  3HUS C;  3B5N B;  1HF9 A;  4JYB A;  1M1K Q;  3OW2 O;  1X8Y A;  4NPE A;  3H32 B;  1N8R Q;  5B5E E;  1S5L X;  2E76 B;  3R4Y A;  2NRG A;  2V4H A;  3L75 G;  1JY2 N;  1LT9 C;  3TF5 A;  1G2C A;  4PD4 D;  4W7Y A;  4U3F G;  1LTA C;  2AXC A;  1K8A Q;  3EWK A;  4IL6 X;  2KK7 A;  1SQQ K;  2WSF H;  1PP9 G;  1NTZ J;  1ZOY C;  2N1T B;  2W6B A;  2LKM A;  2GUS A;  1SQB D;  4D6T J;  2IYO A;  1RE3 A;  3Q5P A;  3M06 A;  3PTZ A;  1UIX A;  3M9Q A;  4I2L C;  4DCK A;  1LT9 B;  4RKU J;  3MZW B;  1BE3 E;  4HJG H;  3SFD C;  3KDP B;  3FXD A;  1SQV G;  3WUT A;  1S9K D;  2Q3I A;  1LGH B;  2XU6 A;  2C9L Y;  4H44 B;  3NXS A;  1BDD A;  2M8R A;  2KSJ A;  4U7J A;  2E43 A;  3BCC E;  1UII A;  5E79 E;  1NYH A;  1GU5 A;  4OVN F;  1M1J A;  3IR9 A;  5KAF H;  2ZYG A;  2AEF A;  3B8E B;  2R32 A;  2FXP A;  4PD4 I;  1L0L D;  1SS1 A;  1LTJ B;  1PL5 A;  1URQ D;  1W2E A;  3T97 B;  2HG5 D;  1YJW P;  3ZDM A;  3GF3 A;  2B88 A;  3A0H H;  3AE6 C;  2FYU E;  3H1L G;  1VQP P;  5GTH E;  5APT A;  2XKM A;  4YXW H;  5CMZ A;  2P7J A;  3AE2 C;  2HR3 A;  5APV A;  4ZKP A;  5AVS B;  1FDI A;  2B9B A;  3VYI A;  3L72 J;  5TJH A;  1GW3 A;  2WPS A;  2JO1 A;  1HUC A;  3KQG A;  1HJB A;  2D2C B;  2OYH C;  1VQK P;  4C7N B;  2YO2 A;  3CWB D;  4PV1 C;  1PIX A;  2QG4 A;  1SQX J;  3L73 G;  3CXH D;  4Y99 C;  1NTK E;  1NAF A;  4GIF A;  3H1K D;  3C8V A;  4KT0 J;  5B66 H;  3CCM P;  1EDL A;  1SQB K;  2WQY C;  4H13 C;  5TIS E;  1FZG A;  2NPS D;  1JEK A;  2XND H;  5APX A;  3CCV P;  1YJ9 P;  3L75 E;  1BCC G;  1L4A A;  2JJL A;  2Q9I A;  1OWA A;  3JSV C;  1K05 A;  4U3F E;  1KTM A;  2YNY A;  2HPC A;  2O01 J;  1L0N D;  3M0D A;  1SFC A;  3L70 D;  3IN6 A;  1N7S A;  2IFM A;  2H8P D;  1PP9 E;  2L91 A;  1LTI C;  3K5B A;  3NFQ A;  2PRR A;  1KIL A;  4ZNC A;  1OVU A;  1FOS E;  2MJZ A;  2KNC B;  1VQO P;  3H1J J;  1M56 D;  1IFP A;  2Z4E A;  5CCG D;  3G4S P;  1JO5 A;  5AW2 B;  3W68 A;  2IX7 C;  3KZI E;  1LWU A;  3MUD A;  3B71 A;  1FOS F;  1L0L K;  1PPJ D;  1SQQ J;  4WY4 A;  1SQV E;  1SQP G;  2OYI C;  1BDC A;  3CMA P;  5CJ0 A;  1VPC A;  4ZKU A;  3CXH I;  2OQQ A;  3L71 D;  2QJP C;  3PHL A;  3WMM 0;  1URQ C;  1WRG A;  3AE7 C;  2E74 B;  3HTK B;  4GOE A;  1YJN P;  1GTW A;  1HWT C;  2I1K A;  4XA4 A;  1KQS O;  2QM7 A;  2K1A A;  2O01 H;  5AW3 B;  3V4W A;  1ZRT D;  1KOR A;  5AVZ B;  1GL2 B;  1KFN A;  4L75 A;  1KB9 E;  1NAY A;  1RF0 A;  2IYP A;  1IFJ A;  2ZT9 D;  1IFD A;  3H1L E;  3MD0 A;  1ZME C;  2B89 A;  2BCC J;  1H8A A;  1N2D C;  3QH9 A;  2ZVN B;  1VQM P;  3A3Y B;  2P10 A;  2WZ7 A;  3D6Z A;  1URQ B;  1BGY G;  3B5N A;  5AVU B;  3RL0 D;  1EDK A;  2AEM A;  1IFN A;  1L0N K;  2NPS C;  2WSC J;  3H32 A;  3TNU B;  1H89 A;  2FY8 A;  3L73 E;  1U7J A;  1IFM A;  1DX7 A;  2OAR A;  2OTJ P;  2KS1 B;  3AEA C;  2PP6 A;  1M8O B;  1OW7 A;  5GTI H;  1ZR2 A;  2N1T A;  1JCD A;  1YYC A;  1YIT P;  3PLN A;  4DJG A;  3G3Z A;  1BCC E;  3AE8 C;  1BE3 D;  1PZQ A;  2ZJS E;  4GOF A;  2UWJ E;  5CCG C;  5TIS H;  1FZB A;  2Y9Y A;  1NO4 A;  2NPS B;  2V7Q H;  1PGP A;  4HH2 A;  2FKW B;  4H0L D;  1SQB J;  5AW6 B;  2GM4 A;  1LT9 A;  3EQ2 A;  3SFE C;  3BCC D;  5CBO A;  1GW4 A;  1SFC B;  1K9M Q;  3TGU G;  1VQ9 P;  2H88 C;  1KQF B;  1IJD B;  3SSU A;  3A0B E;  2WSC H;  3JC2 2;  2YO3 A;  1FZA A;  3RK3 E;  1RH5 B;  1JMM A;  1U7M A;  4AQR D;  1LTB C;  3L37 A;  1SQP E;  4A7P A;  1M57 D;  1K73 Q;  3CL3 D;  3I56 P;  2FYU D;  1NJI Q;  1GK6 A;  3PP5 A;  5KLV G;  2AXT E;  2WIT A;  3L74 G;  1FDO A;  4PD4 H;  4PJ0 E;  3T97 A;  3OA7 A;  2JWA A;  2HYN A;  2ZT9 C;  3BAS A;  4BWN A;  1OX3 A;  1L0L J;  2AEJ A;  3AEG C;  1USD A;  3H1I G;  2QJK C;  2NZ2 A;  2KOG A;  2HLO A;  3GHG C;  2Y0E A;  1GU4 A;  1NTM K;  4I1L A;  1A02 F;  3TSI A;  1DD3 A;  3AED C;  3CX5 I;  1VQ6 P;  4L74 A;  3RL0 C;  1NTK D;  2YKP A;  1S3J A;  5H2F E;  4N78 E;  1X22 A;  5EFW B;  3FX0 A;  4KJM A;  4C7N A;  5AVV B;  1VQ7 P;  4OGQ C;  4HKZ H;  4UB6 E;  3AEF C;  1DH3 A;  1QEX A;  1BGY E;  4EYY Q;  3S9O A;  3TYY A;  2ITA A;  3HE5 B;  3L75 D;  1KZU B;  1ZW0 A;  4C7R A;  1BCC J;  3BAT A;  2FFD C;  2ZT9 B;  2CPB A;  4GT1 A;  1JUN A;  3CWB J;  4U3F D;  1N73 C;  2QJK B;  3W67 A;  1RY3 A;  2P58 A;  3H1K J;  1OVV A;  1PP9 D;  4XFJ A;  3R2P A;  1GMJ A;  2KLU A;  3AEC C;  2LXB A;  5APS A;  1U57 A;  5AW7 B;  1Q81 Q;  3LW5 J;  1FJP A;  4PV1 D;  4WVZ A;  4OWF A;  2ZYD A;  4H0L C;  1LP1 A;  1R5S A;  2IPP A;  2QIW A;  3V6I A;  4UB8 H;  5KAI E;  1NU1 G;  3N7N A;  3Q5S A;  5KJ7 A;  1L0N J;  3PRJ A;  3GMA A;  3L70 J;  4H13 D;  1Z56 A;  2KNC A;  1J1E C;  1SQV D;  4GOD A;  1CW5 A;  3NTN A;  4I7Z B;  1NTM E;  2QSI A;  2FYU K;  3HUS B;  4HB1 A;  1Y9B A;  4CPG A;  4ASV A;  1AJY A;  3TGU E;  4ASW A;  3A2A A;  3B4S A;  4B86 A;  2KI7 B;  3RK2 D;  4H0L B;  3CXH H;  3HD7 D;  1E79 H;  1N86 A;  2QVA A;  2YKO A;  1HVV A;  1P84 I;  3CX5 E;  3HTK A;  3O6Q B;  1KB9 D;  1NTK K;  1Q2N A;  5KLI C;  1J1D C;  3L71 J;  3LW5 H;  3H1L D;  1OMI A;  3A0B H;  1VF5 D;  5KLV E;  3VMY A;  3L74 E;  1EQ7 A;  1GD2 E;  1GL2 A;  2OTK E;  3FWL A;  3CCL P;  1G1J A;  3F89 A;  3G9R A;  3H1I E;  2ZVO B;  3AEE C;  2L5G B;  4N6J A;  1URQ A;  1X79 B;  2I8D A;  3L35 A;  1NGM B;  2G3A A;  3WU2 E;  1KC8 Q;  3L73 D;  2YMK A;  4TLF A;  1FU1 A;  2W8Z A;  5AVR B;  2J59 M;  2POH A;  3KPE A;  2XNX A;  4JBZ A;  4IFF A;  3TNU A;  3GLM A;  2XV5 A;  3A7O A;  4N3Y B;  4I6M C;  1Q82 Q;  1BCC D;  3MGN A;  1NWQ A;  5BVZ A;  1SQV K;  2KS1 A;  1NTM J;  4Y28 J;  5AVX B;  3LIE A;  1CI6 B;  3H6P A;  1N7L A;  4YTP C;  1BSH A;  1KB9 I;  1OXZ A;  3RL0 g;  3PH0 A;  5C39 A;  1EZV G;  3V5B A;  2IFN A;  2JEE A;  5APW A;  1M90 Q;  3S4R A;  3HE4 A;  2NPS A;  1X0T A;  2IZ1 A;  1BE3 J;  3E7K A;  1AA0 A;  2J58 A;  1NU1 E;  1PV3 A;  1P84 E;  3RK3 D;  2OYH B;  2WPQ A;  2RN0 A;  1PFI A;  1SQP D;  4MN4 C;  3P7K A;  4PV1 B;  3H1H G;  1LP1 B;  5B5E H;  3RK2 C;  3HD7 C;  4Y99 B;  3BCC J;  3TK1 A;  1FC2 C;  1S1C X;  4H13 B;  1EZV I;  5AW8 B;  3MHV A;  2YKQ A;  5CCG A;  1USE A;  1KD1 Q;  1EXI A;  2KXP B;  1SVF A;  1VF5 C;  3MIW A;  3WUV A;  2CPS A;  3M0A A;  3C1L A;  1JB0 J;  5CCH A;  1LTT C;  1D7M A;  1LJ2 A;  2OGU A;  2RH0 A;  2IBZ G;  2FYU J;  1DD4 A;  4N78 D;  2JDI H;  3RK2 B;  2HFE D;  4WY4 D;  1M1J C;  3HD7 B;  3A5T A;  1X9V A;  2BAS A;  4RO0 A;  2B87 B;  1ZN5 A;  1YIJ P;  2Q6Q A;  4EOT A;  1NTZ G;  2QE7 H;  1BGY D;  1S72 P;  5CBN A;  3CD6 P;  2H43 A;  1PGJ A;  1RQU A;  1NH4 A;  4GDO A;  1IFI A;  4K35 A;  1VF5 B;  4WBA A;  3VTP C;  1HGV A;  1FJK A;  2ZXE B;  4D6T G;  1FBM A;  4R4M A;  1KV4 A;  5E79 H;  1NTK J;  2OYI B;  1SP4 A;  1WT6 A;  2IBZ I;  1DEE G;  3VMX A;  1PGQ A;  3HE5 A;  3RGU A;  2C0X A;  3V2Q A;  1MZ9 A;  2V7Q J;  2H89 C;  2QJP B;  3CCS P;  2A06 G;  1AQ5 A;  1YHQ P;  1JY3 P;  3L75 J;  1Y47 A;  5CJ4 A;  3D71 A;  4U3F J;  3WU2 H;  1OFC X;  2ZFC A;  1KYO E;  3V4Q A;  3OJA B;  5GTH H;  5APY A;  3P8C E;  2SPZ A;  1PP9 J;  1SQP K;  4OGQ D;  3I55 P;  1NTM D;  3V2N A;  1NHL A;  1CZQ A;  1T6A A;  4L73 A;  2K3R A;  3F5H A;  3RK3 C;  5KTB A;  1EZV E;  2FFD A;  1RE4 A;  1YTZ T;  2E76 D;  3TGU D;  1JY2 P;  1HGZ A;  1L4A C;  3CLQ A;  3AE9 C;  3IFM A;  4DZO A;  1IZN B;  3HUS A;  2BEZ F;  1ZV8 A;  2KSE A;  1SQV J;  1GDT A;  1VL2 A;  3CCJ P;  2Q3E A;  3HE4 B;  3CX5 D;  2N1T D;  3L72 G;  2O3J A;  4JYC A;  3H1H E;  2WVR A;  3P32 A;  5AW1 B;  4LC1 A;  4NPF X;  3CCR P;  1SLQ A;  2KLV A;  2RMZ A;  3MP7 B;  5KLV D;  3L74 D;  3RK3 B;  2Q1K A;  1CSB A;  1QL1 A;  1P84 H;  3QWO C;  3O6Q A;  3Q5R A;  4LGD E;  1SQX G;  2FXM A;  1FE6 A;  3KXD A;  4WY4 C;  5BU5 A;  2WT7 B;  3AE3 C;  3H1I D;  2PFX A;  1R8E A;  4H44 D;  3CCQ P;  1T8Z A;  2IBZ E;  3SWY A;  3H1L J;  3O8Z A;  5AVY B;  2IZ0 A;  3UIA A;  2M5A B;  1YI2 P;  3KZI H;  2R3C A;  2O1J A;  1S4X A;  5KAF E;  2E75 D;  2FYZ A;  4RJT A;  3G71 P;  1NTZ E;  1KIL E;  1MUU A;  3BRT B;  2WSE J;  1OIP A;  1JNM A;  3PJS K;  1JM0 A;  4TT3 H;  3A0H E;  3H1J G;  4D6T E;  2XDJ A;  3L73 J;  1RF0 C;  1FDM A;  2ZXX A;  2A45 G;  3E1R A;  4HYT B;  5AVW B;  2I1J A;  4EI2 A;  3WUU A;  1SQQ G;  1EXJ A;  1GK4 A;  2K37 A;  3M9B A;  2A06 E;  3EFG A;  1CI6 A;  2D2C D;  1KB9 H;  1NU1 D;  1P84 D;  2P2U A;  2E76 C;  3JCU E;  2QRX A;  3GHG B;  1RF1 C;  1Y8A A;  4YPC A;  5B66 E;  2E5T A;  1HJ0 A;  1KFM A;  3EFF K;  3RL0 B;  2E42 A;  2A45 I;  5KLV K;  2CK3 H;  4DOJ A;  2OYH A;  2WSE H;  3V2R A;  1IC2 A;  2N1T C;  1JY2 O;  4OGQ B;  1AVO A;  5DJT B;  2QM8 A;  2K88 A;  2C0W A;  1FS0 E;  3RBX A;  3FWN A;  3FGA D;  2M3E A;  1W2B O;  2FFD B;  5AW4 B;  1SQP J;  2BCC G;  2JR8 A;  4BRY B;  4QMA A;  2QEX P;  1N73 B;  3L72 E;  3N4X A;  1RF1 B;  5DJU B;  1G1I A;  5KJ7 D;  1T2K C;  4H44 C;  5APQ A;  1EDJ A;  1A02 J;  1JTH B;  3M91 A;  1XTG B;  1SQX E;  1NKZ B;  2JWD A;  3HD7 A;  2WMM A;  3V2P A;  4JQ0 D;  1JMB A;  2E75 C;  2P67 A;  1J1E B;  2B87 A;  3IF4 A;  3KHU A;  3OAK A;  2K9J B;  1IK9 A;  1LTJ C;  4DT0 A;  3U1A A;  2HOD B;  2E74 D;  1FAV A;  4NPD A;  1FZC C;  1KN7 A;  1BGY J;  4K3A A;  3RBZ A;  2ZYA A;  2OYI A;  1KQL A;  4YXD C;  1SQB G;  1NU1 K;  2FBW C;  1MFT A;  1KYO D;  1GL2 D;  2WWW A;  3P8C D;  2W83 C;  1DIP A;  2AXT H;  3GF7 A;  3H1J E;  2E75 B;  4PJ0 H;  2D2C C;  3AE4 C;  1RHZ B;  1MFZ A;  2N9Y B;  3GW6 A;  5KLI B;  1J1D B;  3VOP A;  3P8M C;  2ZAE B;  1EZV D;  2LXC B;  1L2P A;  1NOH A;  4WWI A;  1SQQ E;  1FZC B;  1RQV A;  1NVO A;  1R5L A;  4EDF A;  1BSN A;  5H2F H;  1FZE A;  1QL2 A;  3VP9 A;  1OVR A;  4BXL A;  3CCE P;  4UB6 H;  1K04 A;  2IDB A;  3SWF A;  3H1H D;  3H25 A;  2M0B A;  5AW9 B;  1L0L G;  2KYV A;  1YBK A;  1AVY A;  1EDI A;  1YTZ I;  3BRV B;  5GTI E;  2KUB A;  3D70 A;  3TGU J;  1S5L E;  1Q86 Q;  1GZL A;  3JCU H;  1H0T B;  1YQ3 C;  3TDK A;  2WSS H;  5KJ7 C;  2MKV A;  5KKZ C;  1VQ8 P;  3LID A;  2KIK A;  5K5G B;  4AUW A;  1QVG O;  3BVH A;  5AVQ B;  1T3J A;  4IL6 E;  3I5C A;  1KYO I;  4M3L A;  2BCC E;  2IBZ D;  1L4A D;  1FZF A;  3CCU P;  2N9B A;  5KLV J;  1TU3 F;  3L74 J;  2WT7 A;  1RE3 C;  1ZR4 A;  5KAI H;  3CWB G;  2C9N Y;  1KQG B;  1SFC D;  1N7S D;  4OH8 B;  2OTL P;  2R44 A;  3H1K G;  1NTZ D;  2KB7 P;  2WPV B;  1KIL D;  3ITK A;  3VMZ A;  1G2C B;  2LR2 A;  2FYN C;  3H1I J;  5KKZ B;  1J2J B;  4O9B A;  1LT1 A;  2BEQ D;  1QGK B;  2E74 C;  2P1J A;  2M5A A;  1QLE D;  1VQN P;  3CME P;  3CC4 P;  1AV1 A;  3L4F A;  2R5D A;  4D6T D;  1IO4 A;  5L8R J;  4LLH A;  1VDF A;  4PD4 E;  2RKL A;  3Q2Y A;  1GL2 C;  5CCH D;  1E5W A;  1L0N G;  4WB4 A;  4JPZ B;  3L70 G;  2XZR A;  1Q7Y Q;  2A06 D;  2WPR A;  3CX5 H;  1H88 A;  5CHX A;  1SQB E;  2JP3 A;  2FYN B;  1OZH A;  3C9I A;  1AFO A;  4W7Z A;  3GG2 A;  3Q3D A;  1IK7 A;  5APU A;  2FXO A;  3IAO A;  4W80 A;  1PPJ G;  4C46 A;  1ZXG A;  3FXE A;  1S9K E;  1HH0 A;  1M1J B;  1MKM A;  3HRN A;  3GHG A;  2Z5I A;  3AE1 C;  1ZP0 C;  1M7L A;  4L76 A;  4EIJ A;  3U1C A;  3L71 G;  1NU1 J;  3VMA A;  2GUV A;  2YIU C;  1YQ4 C;  2A45 H;  2M3B A;  2W6J H;  4IOI H;  3B5N D;  2J5U A;  2G8Y A;  3L72 D;  3MTU E;  2Z5H A;  1LTS C;  4JF7 A;  4R4L A;  1L0L E;  2W27 A;  2R5B A;  2OYO A;  5AVT B;  4BRY A;  1N73 A;  4KHX A;  1NTZ K;  4UB8 E;  2DW3 A;  1T3U A;  1RF1 A;  1SQX D;  2Q5U A;  1JOC A;  2QA4 P;  1VQ5 P;  1DEB A;  3M0D C;  1HBW A;  1SFC C;  1N7S C;  2YIU B;  1JTH A;  1QX8 A;  1KIL C;  2KZI A;  1S5L H;  1LNQ A;  3VN0 A;  4RES B;  1EC5 A;  4AYC A;  3L36 A;  4XE5 B;  3SWK A;  3KYQ A;  2YMY A;  4IFD K;  3CWB E;  1NTM G;  3CPW O;  1PGO A;  4IL6 H;  1NKN A;  3CXH E;  1OW8 A;  1LWU C;  3MUD C;  1XTC C;  3H1K E;  1QVF O;  1W5C E;  1S2E A;  2H7H A;  1L4A B;  2K9J A;  1OW6 A;  5CCH C;  1JCC A;  1T2K D;  2HPC B;  2HOD A;  2O1K A;  1KMI Z;  1N7S B;  2YXQ B;  3Q1M A;  2KP8 A;  3H1J D;  2Q7C A;  3CI9 A;  1KIL B;  1LTG C;  1BE3 G;  3G6E P;  4ZMD A;  1WMK A;  2GA1 A;  5M1B A;  3NMD A;  1L0N E;  3E1I A;  3L70 E;  1SQQ D;  5AW0 B;  5AW5 B;  4Z1M H;  2PAJ A;  2Y0D A;  1VQ4 P;  2O01 N;  1LWU B;  2W90 A;  3U59 A;  3BCC G;  3D6Y A;  4WY4 B;  1LTJ A;  3II6 A;  3M9H A;  2KZJ A;  3CC2 P;  3USS A;  1FZC A;  1Q90 D;  1MV8 A;  4IFM A;  2JKV A; 
#chains in the Genus database with same CATH homology
 1PFI A;  1L0N K;  2NPS C;  3H32 A;  3P7K A;  3OAK A;  3TNU B;  1H89 A;  1IK9 A;  1LTJ C;  3RK2 C;  1JY3 O;  3HD7 C;  4Y99 B;  3U1A A;  2HOD B;  3B5N C;  3TK1 A;  1HTL C;  1FAV A;  1FZC C;  1IFM A;  1SQX K;  2WTY A;  1DX7 A;  3VP8 A;  2OAR A;  2OYI A;  5AW8 B;  2VRS A;  1KQL A;  2YKQ A;  2W6A A;  5CCG A;  2PP6 A;  1NU1 K;  1ZR2 A;  1GL2 D;  2N1T A;  1SVF A;  1JCD A;  1YYC A;  2WWW A;  3MIW A;  2CPS A;  3P8C D;  3M0A A;  1ZLL A;  1JY3 N;  5CCH A;  1LTT C;  3G3Z A;  5BU8 B;  1RE4 C;  1MFZ A;  5CCG C;  1J1D B;  3VOP A;  1FZB A;  1NO4 A;  2NPS B;  3P8M C;  4N78 D;  4HH2 A;  3RK2 B;  2HFE D;  2FKW B;  4WY4 D;  1M1J C;  3HD7 B;  1NOH A;  3HUS C;  4GKG A;  3A5T A;  3B5N B;  4JYB A;  5AW6 B;  2GM4 A;  1FZC B;  1LT9 A;  3EQ2 A;  1X9V A;  2BAS A;  1X8Y A;  1ZN5 A;  4EOT A;  1GW4 A;  1SFC B;  3H32 B;  1IJD B;  2H43 A;  1FZE A;  1QL2 A;  2WSC H;  3VP9 A;  1NH4 A;  1IFI A;  2YO3 A;  4WBA A;  3VTP C;  1HGV A;  1FJK A;  1JY2 N;  1LT9 C;  1FZA A;  2ZXE B;  1FBM A;  1G2C A;  3SWF A;  4W7Y A;  1JMM A;  1LTA C;  5AW9 B;  2OYI B;  1SP4 A;  4AQR D;  1LTB C;  1WT6 A;  3L37 A;  3VMX A;  2KYV A;  1SQQ K;  2WSF H;  3HE5 A;  2C0X A;  1YTZ I;  3V2Q A;  3BRV B;  3CL3 D;  1MZ9 A;  2N1T B;  1GK6 A;  2W6B A;  2LKM A;  3PP5 A;  1GZL A;  2GUS A;  2WIT A;  1AQ5 A;  1JY3 P;  5KJ7 C;  3LID A;  5CJ4 A;  4AUW A;  3T97 A;  3OA7 A;  3BVH A;  5AVQ B;  2HYN A;  1RE3 A;  1T3J A;  3BAS A;  3I5C A;  2ZFC A;  3V4Q A;  3M06 A;  3OJA B;  4M3L A;  5APY A;  3P8C E;  3M9Q A;  4I2L C;  1SQP K;  2KOG A;  3GHG C;  2HLO A;  1LT9 B;  1GU4 A;  3V2N A;  3KDP B;  1L4A D;  1FZF A;  1NHL A;  1NTM K;  2N9B A;  4I1L A;  1A02 F;  1CZQ A;  3TSI A;  1S9K D;  2WT7 A;  1RE3 C;  1ZR4 A;  2Q3I A;  1LGH B;  2XU6 A;  3RL0 C;  2C9L Y;  2YKP A;  2C9N Y;  1SFC D;  1N7S D;  3RK3 C;  4N78 E;  5KTB A;  3NXS A;  4OH8 B;  2FFD A;  1RE4 A;  1YTZ T;  2M8R A;  4C7N A;  2KSJ A;  5AVV B;  2E43 A;  2KB7 P;  1KIL D;  3VMZ A;  1JY2 P;  1G2C B;  1HGZ A;  1DH3 A;  1L4A C;  1GU5 A;  3CLQ A;  1J2J B;  4O9B A;  3IFM A;  2P1J A;  4DZO A;  1M1J A;  3HUS A;  1ZV8 A;  3TYY A;  3HE5 B;  1KZU B;  4C7R A;  3BAT A;  3L4F A;  1GDT A;  2R5D A;  2FFD C;  3IR9 A;  2CPB A;  4GT1 A;  1IO4 A;  1JUN A;  4LLH A;  1VDF A;  3HE4 B;  3B8E B;  1N73 C;  2N1T D;  2R32 A;  4JYC A;  1RY3 A;  1GL2 C;  1LTJ B;  3P32 A;  5CCH D;  1E5W A;  5AW1 B;  1URQ D;  1W2E A;  4LC1 A;  3R2P A;  2HG5 D;  4WB4 A;  1SLQ A;  2KLV A;  2XZR A;  5APS A;  2WPR A;  3RK3 B;  5APT A;  2XKM A;  1CSB A;  5AW7 B;  1QL1 A;  5CMZ A;  2P7J A;  1H88 A;  4LGD E;  5CHX A;  1FJP A;  2FXM A;  5APV A;  4ZKP A;  5AVS B;  3VYI A;  4WY4 C;  3C9I A;  1GW3 A;  5BU5 A;  4W7Z A;  1AFO A;  2IPP A;  2WT7 B;  2WPS A;  3N7N A;  5KJ7 A;  1HUC A;  3KQG A;  1HJB A;  1Z56 A;  1T8Z A;  2OYH C;  4C7N B;  1J1E C;  5APU A;  2YO2 A;  1CW5 A;  3NTN A;  3SWY A;  3O8Z A;  4W80 A;  4C46 A;  5AVY B;  2FYU K;  1S9K E;  1HH0 A;  3UIA A;  1M1J B;  3HUS B;  4Y99 C;  1NAF A;  2R3C A;  3HRN A;  3GHG A;  2Z5I A;  4GIF A;  1M7L A;  2O1J A;  1SQB K;  2FYZ A;  4EIJ A;  3U1C A;  1MUU A;  2GUV A;  3BRT B;  1JNM A;  2A45 H;  2M3B A;  1FZG A;  2NPS D;  3A2A A;  4B86 A;  5APX A;  3RK2 D;  3HD7 D;  1N86 A;  3B5N D;  3MTU E;  2XDJ A;  1L4A A;  1RF0 C;  2JJL A;  2Z5H A;  2YKO A;  2Q9I A;  1OWA A;  1FDM A;  1HVV A;  1LTS C;  4JF7 A;  2YNY A;  2A45 G;  3HTK A;  2HPC A;  4HYT B;  5AVW B;  2I1J A;  1NTK K;  3M0D A;  1SFC A;  1J1D C;  1N7S A;  2IFM A;  2W27 A;  2H8P D;  2R5B A;  3LW5 H;  5AVT B;  1N73 A;  1LTI C;  4KHX A;  1GK4 A;  1NTZ K;  3NFQ A;  1KIL A;  3M9B A;  3VMY A;  1T3U A;  1EQ7 A;  1RF1 A;  1GD2 E;  1GL2 A;  2Q5U A;  3EFG A;  1CI6 A;  1FOS E;  1JOC A;  2MJZ A;  1DEB A;  3M0D C;  1G1J A;  1HBW A;  1SFC C;  2Z4E A;  1N7S C;  5CCG D;  1JO5 A;  5AW2 B;  2IX7 C;  2P2U A;  1JTH A;  1KIL C;  1LWU A;  3MUD A;  3GHG B;  1RF1 C;  3VN0 A;  4RES B;  1FOS F;  1L0L K;  4AYC A;  2L5G B;  3L36 A;  4N6J A;  4XE5 B;  3KYQ A;  1URQ A;  4WY4 A;  1KFM A;  2YMY A;  1X79 B;  3L35 A;  2OYI C;  3RL0 B;  2E42 A;  1FU1 A;  4IFD K;  2A45 I;  5KLV K;  4DOJ A;  5AVR B;  2OYH A;  5CJ0 A;  1VPC A;  4ZKU A;  2WSE H;  3V2R A;  1IC2 A;  1NKN A;  2J59 M;  2N1T C;  1LWU C;  2POH A;  2XNX A;  3KPE A;  1JY2 O;  1XTC C;  4IFF A;  2H7H A;  2QM8 A;  1L4A B;  3WMM 0;  5CCH C;  1URQ C;  1JCC A;  3TNU A;  1WRG A;  2C0W A;  1T2K D;  2XV5 A;  3HTK B;  2HPC B;  2HOD A;  1GTW A;  1HWT C;  2O1K A;  2I1K A;  3A7O A;  4XA4 A;  2FFD B;  4N3Y B;  2QM7 A;  1N7S B;  5AW4 B;  2KP8 A;  2O01 H;  4I6M C;  3MGN A;  1NWQ A;  5BVZ A;  1SQV K;  2Q7C A;  1N73 B;  5AW3 B;  3V4W A;  3CI9 A;  5AVX B;  1KIL B;  1LTG C;  3LIE A;  3N4X A;  5AVZ B;  1RF1 B;  1GL2 B;  1CI6 B;  1G1I A;  1KFN A;  5KJ7 D;  3H6P A;  1T2K C;  1N7L A;  3NMD A;  3E1I A;  1OXZ A;  5AW0 B;  1RF0 A;  3V5B A;  5APQ A;  5AW5 B;  1IFJ A;  2IFN A;  1IFD A;  2PAJ A;  1A02 J;  1JTH B;  3M91 A;  2JEE A;  3MD0 A;  5APW A;  1LWU B;  1XTG B;  3HE4 A;  1H8A A;  3U59 A;  1N2D C;  1NKZ B;  2NPS A;  3A3Y B;  2WZ7 A;  1URQ B;  4WY4 B;  1LTJ A;  3II6 A;  3M9H A;  3HD7 A;  3B5N A;  3V2P A;  5AVU B;  3RL0 D;  2J58 A;  1FZC A;  3RK3 D;  2OYH B;  1IFN A;  2P67 A;  1J1E B;  1MV8 A;  2WPQ A;  4IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...