1DEBA

Crystal structure of the n-terminal coiled coil domain from apc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
AAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of the amino-terminal coiled-coil domain of the APC tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
molecule keywords ADENOMATOUS POLYPOSIS COLI PROTEIN
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16689 APC_N_CC Coiled-coil N-terminus of APC, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1debA00
1MZ9A 3V2QA 1VDFA 3V2PA 3V2RA 1FBMA 1DEBA 3V2NA
chains in the Genus database with same CATH superfamily
4WBAA 4C46A 2QEXP 1Q81Q 1U57A 3L71D 1LTAC 1VPCA 2KUBA 5KLIB 5KJ7D 2A06E 3CXHD 3GG2A 3CCVP 1HVVA 1RQUA 2QJPB 1HUCA 4PD4E 1IJDB 4PJ0H 2WWWA 4BXLA 1URQB 3HUSB 2KB7P 2R5DA 5AW8B 3AEGC 3L70J 2A45G 1Q86Q 5H2FE 1N7SA 3ITKA 2J5UA 3KYQA 1VQ6P 2HPCB 3L73D 5KLVD 1CSBA 3L73E 5KLVE 3M9BA 2E42A 2M8RA 3R4YA 3L70E 4GIFA 2C9LY 1LTGC 1QEXA 3CD6P 5K5GB 1AFOA 3CMAP 3CMEP 2N9BA 1SQXJ 1LT9B 2B87B 2E5TA 1G2CB 3H1JG 1RE3A 3V4QA 4GOFA 2WVRA 2YKPA 5M1BA 2O3JA 1LT1A 3RK2B 1EZVD 2FFDC 3D71A 3TNUB 2IFNA 2NPSD 1AVYA 3H1JE 3H1LD 3PP5A 2AEJA 2GUVA 1SQPE 5CJ0A 1FZAA 2Y0EA 2W6BA 3GHGC 4O9BA 1FZBA 2CPBA 4Y28J 5CJ4A 1GU5A 1NWQA 3JCUH 3L75E 3NTNA 4UB8E 3FGAD 1KC8Q 1BCCG 3RL0D 3FX0A 4L73A 2D2CC 2OYHB 1SFCB 1PGJA 3E1IA 4H0LC 1LP1A 3L75D 3RBZA 1RF1C 1GL2B 1TU3F 5CCHD 3AE1C 3CXHI 3F89A 1L4AA 3HUSC 1H0TA 2FXMA 2NZ2A 1NTKD 4ASVA 3H1JD 3M0DC 4AQRD 1HF9A 5KKZB 1JB0J 2ZXEB 1W2BO 1VL2A 2WQYC 4UB8H 1IFPA 2ITAA 1SQQJ 4R4LA 4RKUJ 2KNCA 4U7JA 5L8RJ 1BGYG 3B5ND 2H43A 1SQQG 1N73A 3GW6A 1Q82Q 1OVUA 3GMAA 2ZT9B 3CWBG 2QA4P 3S1KA 1JY3O 1LWUA 1OIPA 1P84E 2FFDB 2OQQA 1JY2P 1WT6A 2B9BA 3H1KG 4IL6X 3RL0C 2QJYB 1CW5A 1GTWA 5EFWB 1P84D 3FWNA 1SQBG 4D6TD 3NMDA 4N3YB 3SWYA 4WVZA 1N73C 1D7MA 4PD4I 3RBXA 1EXJA 3GHGB 3AE6C 1L2PA 5AW1B 1W2EA 1KILA 5AVZB 1A02F 1QX8A 2QIWA 2FYNB 4DCKA 2OYHC 2UWJE 2A06D 3CXHE 4OGQB 4GOEA 5TISH 3B4SA 3L71E 3L74E 4I7ZC 4JQ0D 1DD3A 2WITA 2Y0DA 3CCQP 3SFEC 2FYUJ 2YO3A 4LC1A 3QH9A 1SS1A 2ZYGA 4HJGH 1FZCB 4BRYA 4GODA 3MD0A 1FBMA 3B5NB 2YXQB 1NAYA 4IL6H 5E79H 5GTHH 1SQVG 1L0LD 4H13B 3H1ID 3HE4B 4OWFA 5AVYB 2OYOA 2VRSA 2PRRA 5APUA 3C1LA 2WZ7A 5APVA 1N7SC 1FC2C 2JJLA 4C7RA 1GZLA 2XNDH 3PTZA 4U3FD 2WPSA 3VOPA 3IAOA 4U3FE 1OX3A 2A06G 2M5AB 4KT0J 4GKGA 1EDKA 1DEBA 1NTMD 4WY4B 2E74C 4YXWH 3CCSP 2CK3H 4L76A 2ZAEB 1L0NJ 2IX7C 2WMMA 5APQA 3AECC 1NTKE 1RF0A 2D2CD 2IYOA 5AW3B 1UIXA 1L0LE 3BASA 3EFFK 2R3SA 1RHZB 1RF1A 3HD7D 1KILC 3HTKB 2WSEH 3LIDA 1SQPK 2PFXA 3HD7B 4BWNA 3L72D 5CBNA 1SQVD 1NYHA 1RF0C 1RQVA 2JKVA 1YTZI 2W8ZA 3O6QA 4IFFA 1GW3A 5APSA 5AVTB 4I2LC 4PD4D 1S5LH 3USSA 1YJWP 3L74D 3S9OA 3L37A 1VQ4P 1EDJA 1SQPD 1FJPA 1IFMA 1J1EC 2POHA 4TLFA 5TISE 5DJUB 1YITP 2KOGA 1BDDA 1SQVK 2IBZE 1HH0A 1Q90D 2JEEA 2WSSH 3H1LE 4PV1C 2W27A 1X22A 3IFMA 1KYOE 3VTPC 1FU1A 3WU2E 1VQ7P 2AXCA 1S2EA 2KI7B 3TDKA 3AE9C 3P7KA 3O8ZA 1UIIA 4JYCA 2MJZA 2LXBA 1LTBC 1Q2NA 2YMYA 3S4RA 5APTA 3R2PA 4I1LA 2BEZF 3G6EP 1KB9D 3RK2C 3CC2P 4ASWA 3H1KJ 1ZR2A 1YBKA 3AEFC 3GF3A 4IOIH 2RMZA 4MN4C 2BCCG 4KHXA 1PZQA 1L0LJ 4ZMDA 3T97A 1SQXK 2KZJA 1VQ5P 1AQTA 1NTKJ 1BGYJ 1KMIZ 4JYBA 3RK3E 1L0NE 1OW6A 1KORA 2B89A 3AE7C 1AVOA 1Y9BA 1ZW0A 2O01N 3M0DA 4L75A 3CCUP 3B71A 2K3RA 1EZVG 1RY3A 3VN0A 4YXDC 3CX5D 3TYYA 1SQQD 4YPCA 3CX5H 1SFCC 1SQXD 3U1CA 4H0LB 2J58A 3OW2O 3P8CD 4GDOA 1SQBJ 2WPQA 3U1AA 2OGUA 3RK3B 4D6TJ 5CHXA 3MGNA 3SSUA 5CCGC 5B66H 3G4SP 4RJTA 1NH4A 1T2KC 1S5LE 2Y0CA 4N78E 3VP9A 3VMYA 4ZKPA 1HJBA 2FYUE 2ZVNB 4EI2A 1SP4A 3L75G 4DOJA 2WT7B 3L74J 5DJTB 3A0BH 2AXTH 3HE4A 1JMMA 3VP8A 2Y9ZA 2OYIA 3C9IA 2P1JA 2FBWC 1WRGA 2P58A 1NU1K 2XDJA 2RH0A 3A3YB 1VQPP 5AW0B 2XZRA 3V2PA 2QJYC 1WMKA 1FJKA 2WSFJ 2OARA 3L70D 1VQMP 1DX7A 3CLQA 2K88A 1YJ9P 1JNMA 1N8RQ 1XTCC 2E75D 3AEEC 1FOSF 1PGQA 3U59A 1VF5B 3MUDC 1L0LG 2HODA 1EQ7A 2Z4EA 1H89A 1IFDA 4OGQC 1SFCD 1BE3J 3O6QB 2HFED 3L73J 5KLVJ 1YHQP 1Q7YQ 1QVFO 3CX5I 1VQNP 2YNYA 2HODB 1J2JB 3HD7A 3IN6A 3OA7A 1AA0A 3PHLA 1NKZB 2O01H 5AW5B 1JCCA 1ZV8A 1USEA 3I5CA 2WTYA 1S9KE 1GW4A 1QLED 2RKLA 4W80A 2Q7CA 1X9VA 5KKZC 5B66E 2C9NY 5AVXB 1M56D 3H1LJ 3RK2D 1ZP0C 2CPSA 3KPEA 1NHLA 1VQ9P 1EC5A 1KQSO 4DZOA 1Y47A 2I1JA 2OYIB 3JSVC 3AE5C 4I6MC 2OTKE 2P2UA 2ZYDA 3NFQA 4RO0A 3A2AA 1IFJA 1U7JA 1FDIA 2P10A 2E75B 4K35A 4LLHA 4WY4C 4XA4A 2WT7A 3WUTA 3I56P 2WSCJ 1H0TB 1S72P 5KLVK 5CBOA 1LTTC 3V4WA 4EIJA 1GMJA 4XE5B 1VF5C 2IZ0A 3L36A 1FDMA 1FZCA 4JBZA 1OVVA 2GM4A 3HTKA 1JM0A 3V2NA 1FS0E 1RF1B 1JMBA 1NTZD 3KXDA 5CCHC 2QE7H 2BCCE 4W7YA 1X79B 1KB9H 1NU1D 1FE6A 4R4MA 4U3FJ 4A7PA 3A5TA 4I7ZB 5AVRB 1KILD 2FYZA 3TGUE 1KD1Q 2R5BA 1MFZA 3AEDC 1MZ9A 1NTZK 2M5AA 4WY4A 1J1EB 2QM7A 3N4XA 2IYPA 3FWLA 3GHGA 2YKOA 1OXZA 3H1IG 3IF4A 3T97B 3W67A 1U7MA 1K8AQ 1X0TA 2ZT9D 1NAFA 1NTZJ 1JY2O 2NPSC 3H1HG 1JY3P 3H1HD 1BE3E 1NKNA 3KHUA 3LW5J 5AW9B 2R44A 1ZR4A 3H1HE 2FFDA 1MUUA 4W7ZA 1N7SB 4TT3H 3UIAA 3B5NA 2OTJP 1R5LA 1BE3G 2JR8A 1N73B 2IFMA 2Z5IA 1IZNB 2QJKB 4ZNCA 2KNCB 2E76C 1Z56A 2AEMA 1NU1G 2K1AA 3BCCE 5AW7B 1LNQA 3W68A 2E74B 1FZEA 1JOCA 2KK7A 2L91A 3FXDA 3CI9A 2Q1KA 3H1KE 1BCCE 4OGQD 3BCCJ 2K37A 1YYCA 1L0NK 1L4AD 2BEQD 3L72G 1BDCA 1L4AB 2BCCD 4RESB 1KB9I 2IZ1A 1OMIA 3TK1A 3CCRP 1KILB 1GL2A 1OW8A 3CWBE 3M0AA 1PP9E 3JC22 2KP8A 2FKWB 2HLOA 3L71G 3A7OA 1E5WA 4YTPC 1S1CX 1EXIA 1M1JC 3E1RA 1BGYD 1KQFB 1IO4A 4UB6E 2QVAA 3L75J 5KJ7C 1PPJG 3VMXA 3WMM0 4GT1A 3CPWO 1K73Q 4WWIA 1PPJD 1EZVI 2Y9YA 4N6JA 4OVNF 2O01J 3EWKA 1SQBD 1ZRTE 5AW6B 1LT9A 1PPJE 4D6TG 4Y99B 2WPRA 1KILE 5AVSB 4AYCA 2P67A 3D6YA 3RL0g 1P84I 2E76B 1HBWA 1NVOA 1OVRA 3GLMA 2E76D 4L74A 5CCGA 2KYVA 2W6AA 1QL2A 4H44D 3KZIH 1BCCJ 1KYOH 1EDIA 5CMZA 3BATA 3WU2H 2IBZG 3GF7A 5GTIE 1K05A 1NOHA 1LTIC 1SFCA 3JCUE 4BRYB 2OYHA 4AUWA 1KV4A 1L4AC 3HUSA 1N7LA 1NO4A 1SQPJ 3L70G 3CWBD 1PIXA 3MZWB 1J1DC 1RE4C 1S3JA 2Q6QA 1T6AA 2G8YA 2KSJA 1XTGB 3CXHH 3H25A 4Z1MH 1KN7A 1KB9E 4NPFX 1NTMK 2QJPC 3HRNA 1N7SD 3H1KD 1PL5A 3WUUA 1PFIA 3RK3C 4PV1B 1SQQK 3BCCD 3EFGA 1M8OB 1G2CA 2Z5HA 2B87A 1IK7A 2L5GB 3E7KA 3AE2C 3MP7B 5KAIH 1CI6A 1GL2D 2PAJA 2YMKA 3D70A 5APWA 3A0HH 1L0NG 5CCGD 1JEKA 2JDIH 3G9RA 1T3UA 2H88C 1LWUB 2Q3EA 2WSFH 1E79H 3M9HA 2NPSA 4DJGA 1R5SA 1M1JA 2V4HA 4ZKUA 1G1JA 3CCMP 3KQGA 2H7HA 2M3EA 1YQ4C 2WPVB 4PD4H 3V2QA 1MKMA 2M0BA 1A02J 2E43A 2E75C 3AE3C 5AVQB 3TGUG 1ZXGA 1YJNP 5BU5A 4KJMA 1S5LX 3AEAC 1W5CE 2V7QH 3PJSK 1SLQA 2SPZA 1SQQE 1VF5D 1GD2E 3WUVA 1NTZE 4XFJA 3TF5A 2C0WA 3CCJP 2HG5D 5AVUB 4OH8B 1LP1B 3LIEA 3P32A 1NTME 2LXCB 2YKQA 4IFDK 3RGUA 3IR9A 2W90A 3G71P 1URQD 1PP9D 2E74D 4HH2A 4WB4A 2XNXA 1S4XA 2K9JB 3QWOC 1JTHA 4HKZH 4QMAA 1JY2N 3I55P 5E79E 5GTHE 1M7LA 2ZXXA 1SQVJ 3N7NA 3AE8C 4CPGA 2YIUC 4UB6H 1GK6A 2JWDA 3TNUA 1FZGA 3AEBC 1LJ2A 1MV8A 4HB1A 1SQBE 1T3JA 1ZRTD 1LTSC 2I8DA 2N1TB 2W6JH 5AW4B 5KAIE 3V5BA 5B5EH 3CC4P 4H44C 3TSIA 2R3CA 1NGMB 3BRVB 1USDA 2ZYAA 5H2FH 5KAFE 1YIJP 2OYIC 1DD4A 3AE4C 1ZOYC 3B8EB 3EQ2A 1N2DC 1OWAA 3P8CE 2QJKC 1SQBK 3L74G 4B86A 1S9KD 1BGYE 2GA1A 4DT0A 1OFCX 4U3FG 4JPZB 2HPCA 1BSHA 4H0LD 1PV3A 5CCHA 3M9QA 1DEEG 3H32A 3RK3D 1YI2P 1URQA 4WY4D 1VDFA 2I1KA 5KLIC 3CCEP 1NTKK 2E5YA 1VQ8P 5BU8B 3II6A 1GL2C 4IL6E 1FZFA 1EDLA 1VQKP 2WSCH 2LR2A 2Q9IA 1LGHB 2QSIA 1URQC 1NU1E 1IK9A 1H88A 2Q3IA 3ABVC 1YQ3C 3OAKA 1NJIQ 1YTZT 1PGPA 1NTKG 2V7QJ 2ZJSE 2A45H 1T8ZA 4JF7A 2BCCJ 2N1TA 1SQPG 1IC2A 2R32A 1KYOD 2IBZI 3H1LG 3HE5A 4C7NB 4EYYQ 3Q5SA 2FYUK 2ZT9C 3MTUE 4K3AA 4NPEA 3Q5PA 1HGZA 2OTLP 1LTJA 3PRJA 1LT9C 4H13D 2HR3A 1BE3D 3A0BE 2KIKA 2G3AA 2KS1A 2YO2A 1LTJB 1SQXG 3H1JJ 3NXSA 2KLUA 3SWFA 3Q1MA 3HE5B 2MKVA 4N78D 2KLVA 3ZDMA 1DIPA 3L73G 5KLVG 1KQGB 5AVWB 3LW5H 3PLNA 2XV5A 5KAFH 3D6ZA 3CL3D 2FYNC 1QGKB 3MUDA 1KQLA 2RN0A 1GK4A 1QVGO 1T2KD 1X8YA 1SQXE 4HYTB 2KZIA 2D2CB 3CC7P 3CX5E 1RE4A 1MFTA 3M06A 1FAVA 1HJ0A 3CCLP 2K9YA 1ZLLA 3KDPB 1BSNA 4PJ0E 1EZVE 2N1TD 2ZVOB 1KFNA 2HYNA 1JY3N 1AV1A 2FXOA 1Y8AA 2NRGA 3A0HE 3B5NC 1OW7A 3F5HA 2DW3A 2KS1B 1M1JB 2FY8A 2KXPB 2NPSB 1KFMA 1OZHA 2ZFCA 1M1KQ 3H1IE 3L72J 1VQLP 1BCCD 3MIWA 3V2RA 1H8AA 1JUNA 2W83C 1KTMA 1IFNA 2P7JA 2J59M 3BCCG 5APYA 5AVVB 3MHVA 5AW2B 1NU1J 1LTJC 1LWUC 3RL0B 1JCDA 1CZQA 2IDBA 1FOSE 2JP3A 3H6PA 3K5BA 3L35A 1K9MQ 5KJ7A 3L71J 2O1KA 3OJAB 3VYIA 1KYOI 2IBZD 1P84H 1PP9G 2B88A 2QM8A 1SVFA 3M91A 4IFMA 1JO5A 1ZN5A 1AJYA 1N86A 1JTHB 3FXEA 3HD7C 2FYUD 2Q5UA 3Q2YA 3H1HJ 1SQVE 3VMZA 3Q5RA 2FYUG 3L72E 2LKMA 3H1IJ 5TJHA 3H32B 4M3LA 2QG4A 2FXPA 3C8VA 3BRTB 4D6TE 3TGUD 1J1DB 1IFIA 1K04A 4EDFA 3G3ZA 4NPDA 1AQ5A 1VQOP 3P8MC 1FZCC 2AXTE 1NTMJ 3KZIE 5GTIH 1QL1A 2GUSA 5BVZA 4PV1D 1DH3A 2BASA 5B5EE 1HWTC 2N9YB 2QRXA 2A45I 1PGOA 1L0ND 2C0XA 3L4FA 1L0LK 4H13C 1M57D 2YIUB 1NTZG 1PP9J 1GDTA 1KZUB 1HGVA 2H89C 2M3BA 3TGUJ 1R8EA 1NTMG 2XKMA 3PH0A 4Y99C 1GU4A 1RE3C 2O1JA 3V6IA 2N1TC 2YXRB 3SWKA 1M90Q 2AEFA 2PGDA 3CWBJ 4H44B 5APXA 4LGDE 2PP6A 2JWAA 2K9JA 2JO1A 4C7NA 2XU6A 1RH5B 3BVHA 1ZMEC 2KSEA 3SFDC 1CI6B 3Q3DA 5C39A 5KTBA 1HTLC 2IPPA 3VMAA 1G1IA 2WSEJ 2H8PD 4EOTA 1FDOA
chains in the Genus database with same CATH topology
4WBAA 4C46A 1LTAC 1VPCA 5KJ7D 1HVVA 1HUCA 1IJDB 2WWWA 1URQB 3HUSB 2KB7P 2R5DA 5AW8B 2A45G 1N7SA 3KYQA 2HPCB 1CSBA 2E42A 3M9BA 2M8RA 2C9LY 4GIFA 1LTGC 1AFOA 2N9BA 1LT9B 1G2CB 3V4QA 1RE3A 2FFDC 3RK2B 2YKPA 3TNUB 2IFNA 2NPSD 3PP5A 2GUVA 5CJ0A 1FZAA 2W6BA 3GHGC 4O9BA 1FZBA 2CPBA 5CJ4A 1GU5A 1NWQA 3NTNA 3RL0D 2OYHB 1SFCB 3E1IA 1RF1C 1GL2B 5CCHD 1L4AA 3HUSC 2FXMA 4AQRD 3M0DC 2ZXEB 3B5ND 2H43A 1N73A 1JY3O 1LWUA 2FFDB 1JY2P 1WT6A 3RL0C 1CW5A 1GTWA 3NMDA 4N3YB 3SWYA 1N73C 3GHGB 5AW1B 1W2EA 1KILA 5AVZB 1A02F 2OYHC 2WITA 2YO3A 4LC1A 1FZCB 3MD0A 1FBMA 3B5NB 5AVYB 3HE4B 2VRSA 5APUA 2WZ7A 5APVA 1N7SC 4C7RA 2JJLA 1GZLA 2WPSA 3VOPA 4WY4B 4GKGA 1DEBA 2IX7C 5APQA 1RF0A 5AW3B 3BASA 1RF1A 3HD7D 3LIDA 3HTKB 1KILC 2WSEH 1SQPK 3HD7B 1RF0C 4IFFA 1YTZI 5APSA 5AVTB 1GW3A 4I2LC 3L37A 1FJPA 1IFMA 1J1EC 2POHA 2KOGA 1SQVK 1HH0A 2JEEA 2W27A 3IFMA 3VTPC 1FU1A 3P7KA 3O8ZA 4JYCA 2MJZA 1LTBC 2YMYA 5APTA 3R2PA 4I1LA 3RK2C 1ZR2A 4KHXA 3T97A 1SQXK 4JYBA 3M0DA 1RY3A 3VN0A 3TYYA 1SFCC 3U1CA 2J58A 3P8CD 3U1AA 2WPQA 3RK3B 5CHXA 3MGNA 5CCGC 1NH4A 1T2KC 4N78E 3VP9A 3VMYA 4ZKPA 1HJBA 1SP4A 4DOJA 2WT7B 3HE4A 1JMMA 3VP8A 2OYIA 3C9IA 2P1JA 1WRGA 1NU1K 2XDJA 3A3YB 5AW0B 2XZRA 3V2PA 1FJKA 2OARA 1DX7A 3CLQA 1JNMA 1XTCC 1FOSF 3U59A 2HODA 1EQ7A 2Z4EA 1H89A 1IFDA 1SFCD 2HFED 2YNYA 2HODB 1J2JB 3HD7A 4HH2A 3OA7A 5AW5B 1NKZB 2O01H 2WTYA 1JCCA 1ZV8A 3I5CA 1S9KE 1GW4A 4W80A 2Q7CA 1X9VA 2C9NY 5AVXB 3RK2D 2CPSA 3KPEA 1NHLA 4DZOA 2I1JA 2OYIB 4I6MC 2P2UA 3NFQA 3A2AA 1IFJA 4WY4C 2WT7A 4XA4A 4LLHA 5KLVK 1LTTC 3V4WA 4EIJA 4XE5B 3L36A 1FDMA 1FZCA 2GM4A 3HTKA 3V2NA 1RF1B 5CCHC 4W7YA 1X79B 3A5TA 5AVRB 1KILD 2FYZA 2R5BA 1MFZA 1MZ9A 1NTZK 4WY4A 1J1EB 2QM7A 3N4XA 3GHGA 2YKOA 1OXZA 1NAFA 2NPSC 1JY2O 1JY3P 1NKNA 5AW9B 1ZR4A 2FFDA 1JUNA 1MUUA 4W7ZA 1N7SB 3UIAA 3B5NA 1N73B 2IFMA 2Z5IA 1Z56A 5AW7B 1FZEA 1JOCA 3CI9A 1YYCA 1L0NK 1L4AD 1L4AB 3TK1A 4RESB 1KILB 1GL2A 3M0AA 2KP8A 2FKWB 2HLOA 3A7OA 1E5WA 1M1JC 1IO4A 5KJ7C 3VMXA 3WMM0 4GT1A 4N6JA 5AW6B 1LT9A 4Y99B 2WPRA 5AVSB 4AYCA 2P67A 1HBWA 5CCGA 2KYVA 2W6AA 1QL2A 5CMZA 3BATA 1NOHA 1LTIC 1SFCA 4AUWA 2OYHA 1L4AC 3HUSA 1N7LA 1NO4A 1J1DC 1RE4C 2KSJA 1XTGB 1NTMK 3HRNA 1N7SD 1PFIA 3RK3C 1SQQK 3EFGA 1G2CA 2Z5HA 2L5GB 1CI6A 1GL2D 2PAJA 5APWA 5CCGD 1T3UA 1LWUB 3M9HA 2WSFH 2NPSA 1M1JA 4ZKUA 1G1JA 3KQGA 2H7HA 3V2QA 1A02J 2E43A 5AVQB 5BU5A 1SLQA 1GD2E 2C0WA 5AVUB 4OH8B 3LIEA 3P32A 2YKQA 4IFDK 3IR9A 1URQD 4WB4A 2XNXA 1JTHA 1JY2N 1M7LA 3N7NA 1FZGA 1GK6A 3TNUA 1MV8A 1T3JA 3V5BA 1LTSC 5AW4B 2N1TB 3TSIA 2R3CA 3BRVB 2OYIC 3P8CE 3B8EB 3EQ2A 4B86A 1N2DC 1OWAA 1SQBK 1S9KD 2HPCA 5CCHA 3M9QA 3H32A 3RK3D 1URQA 4WY4D 1VDFA 2I1KA 1NTKK 5BU8B 3II6A 1GL2C 1FZFA 2WSCH 2Q9IA 1LGHB 1URQC 1IK9A 1H88A 2Q3IA 3OAKA 1YTZT 2A45H 1T8ZA 4JF7A 2N1TA 1IC2A 2R32A 3HE5A 4C7NB 2FYUK 3MTUE 1HGZA 1LTJA 1LT9C 2YO2A 1LTJB 3NXSA 3SWFA 3HE5B 4N78D 2KLVA 5AVWB 3LW5H 2XV5A 3CL3D 3MUDA 1KQLA 1GK4A 1T2KD 1X8YA 4HYTB 1RE4A 3M06A 1FAVA 1ZLLA 3KDPB 2N1TD 1KFNA 2HYNA 1JY3N 3B5NC 1M1JB 2NPSB 2ZFCA 1KFMA 3MIWA 3V2RA 1H8AA 1IFNA 2P7JA 2J59M 5APYA 5AVVB 5AW2B 1LTJC 1LWUC 3RL0B 1JCDA 1CZQA 1FOSE 3H6PA 3L35A 5KJ7A 2O1KA 3OJAB 3VYIA 2QM8A 3M91A 1JO5A 4IFMA 1SVFA 1ZN5A 1N86A 1JTHB 3HD7C 2Q5UA 3VMZA 2LKMA 3H32B 4M3LA 3BRTB 1J1DB 1IFIA 3G3ZA 1AQ5A 3P8MC 1FZCC 1QL1A 2GUSA 5BVZA 1DH3A 2BASA 1HWTC 3L4FA 2A45I 2C0XA 1L0LK 1GDTA 1KZUB 1HGVA 2M3BA 2XKMA 1GU4A 4Y99C 1RE3C 2O1JA 2N1TC 5APXA 4LGDE 2PP6A 3BVHA 4C7NA 2XU6A 1G1IA 1CI6B 5KTBA 1HTLC 2IPPA 2HG5D 2H8PD 4EOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZ9 A;  3V2Q A;  1VDF A;  3V2P A;  3V2R A;  1FBM A;  1DEB A;  3V2N A; 
#chains in the Genus database with same CATH topology
 4WBA A;  4C46 A;  2QEX P;  1Q81 Q;  1U57 A;  3L71 D;  1LTA C;  1VPC A;  2KUB A;  5KLI B;  5KJ7 D;  2A06 E;  3CXH D;  3GG2 A;  3CCV P;  1HVV A;  1RQU A;  2QJP B;  1HUC A;  4PD4 E;  1IJD B;  4PJ0 H;  2WWW A;  4BXL A;  1URQ B;  3HUS B;  2KB7 P;  2R5D A;  5AW8 B;  3AEG C;  3L70 J;  2A45 G;  1Q86 Q;  5H2F E;  1N7S A;  3ITK A;  2J5U A;  3KYQ A;  1VQ6 P;  2HPC B;  3L73 D;  5KLV D;  1CSB A;  3L73 E;  5KLV E;  3M9B A;  2E42 A;  2M8R A;  3R4Y A;  3L70 E;  4GIF A;  2C9L Y;  1LTG C;  1QEX A;  3CD6 P;  5K5G B;  1AFO A;  3CMA P;  3CME P;  2N9B A;  1SQX J;  1LT9 B;  2B87 B;  2E5T A;  1G2C B;  3H1J G;  1RE3 A;  3V4Q A;  4GOF A;  2WVR A;  2YKP A;  5M1B A;  2O3J A;  1LT1 A;  3RK2 B;  1EZV D;  2FFD C;  3D71 A;  3TNU B;  2IFN A;  2NPS D;  1AVY A;  3H1J E;  3H1L D;  3PP5 A;  2AEJ A;  2GUV A;  1SQP E;  5CJ0 A;  1FZA A;  2Y0E A;  2W6B A;  3GHG C;  4O9B A;  1FZB A;  2CPB A;  4Y28 J;  5CJ4 A;  1GU5 A;  1NWQ A;  3JCU H;  3L75 E;  3NTN A;  4UB8 E;  3FGA D;  1KC8 Q;  1BCC G;  3RL0 D;  3FX0 A;  4L73 A;  2D2C C;  2OYH B;  1SFC B;  1PGJ A;  3E1I A;  4H0L C;  1LP1 A;  3L75 D;  3RBZ A;  1RF1 C;  1GL2 B;  1TU3 F;  5CCH D;  3AE1 C;  3CXH I;  3F89 A;  1L4A A;  3HUS C;  1H0T A;  2FXM A;  2NZ2 A;  1NTK D;  4ASV A;  3H1J D;  3M0D C;  4AQR D;  1HF9 A;  5KKZ B;  1JB0 J;  2ZXE B;  1W2B O;  1VL2 A;  2WQY C;  4UB8 H;  1IFP A;  2ITA A;  1SQQ J;  4R4L A;  4RKU J;  2KNC A;  4U7J A;  5L8R J;  1BGY G;  3B5N D;  2H43 A;  1SQQ G;  1N73 A;  3GW6 A;  1Q82 Q;  1OVU A;  3GMA A;  2ZT9 B;  3CWB G;  2QA4 P;  3S1K A;  1JY3 O;  1LWU A;  1OIP A;  1P84 E;  2FFD B;  2OQQ A;  1JY2 P;  1WT6 A;  2B9B A;  3H1K G;  4IL6 X;  3RL0 C;  2QJY B;  1CW5 A;  1GTW A;  5EFW B;  1P84 D;  3FWN A;  1SQB G;  4D6T D;  3NMD A;  4N3Y B;  3SWY A;  4WVZ A;  1N73 C;  1D7M A;  4PD4 I;  3RBX A;  1EXJ A;  3GHG B;  3AE6 C;  1L2P A;  5AW1 B;  1W2E A;  1KIL A;  5AVZ B;  1A02 F;  1QX8 A;  2QIW A;  2FYN B;  4DCK A;  2OYH C;  2UWJ E;  2A06 D;  3CXH E;  4OGQ B;  4GOE A;  5TIS H;  3B4S A;  3L71 E;  3L74 E;  4I7Z C;  4JQ0 D;  1DD3 A;  2WIT A;  2Y0D A;  3CCQ P;  3SFE C;  2FYU J;  2YO3 A;  4LC1 A;  3QH9 A;  1SS1 A;  2ZYG A;  4HJG H;  1FZC B;  4BRY A;  4GOD A;  3MD0 A;  1FBM A;  3B5N B;  2YXQ B;  1NAY A;  4IL6 H;  5E79 H;  5GTH H;  1SQV G;  1L0L D;  4H13 B;  3H1I D;  3HE4 B;  4OWF A;  5AVY B;  2OYO A;  2VRS A;  2PRR A;  5APU A;  3C1L A;  2WZ7 A;  5APV A;  1N7S C;  1FC2 C;  2JJL A;  4C7R A;  1GZL A;  2XND H;  3PTZ A;  4U3F D;  2WPS A;  3VOP A;  3IAO A;  4U3F E;  1OX3 A;  2A06 G;  2M5A B;  4KT0 J;  4GKG A;  1EDK A;  1DEB A;  1NTM D;  4WY4 B;  2E74 C;  4YXW H;  3CCS P;  2CK3 H;  4L76 A;  2ZAE B;  1L0N J;  2IX7 C;  2WMM A;  5APQ A;  3AEC C;  1NTK E;  1RF0 A;  2D2C D;  2IYO A;  5AW3 B;  1UIX A;  1L0L E;  3BAS A;  3EFF K;  2R3S A;  1RHZ B;  1RF1 A;  3HD7 D;  1KIL C;  3HTK B;  2WSE H;  3LID A;  1SQP K;  2PFX A;  3HD7 B;  4BWN A;  3L72 D;  5CBN A;  1SQV D;  1NYH A;  1RF0 C;  1RQV A;  2JKV A;  1YTZ I;  2W8Z A;  3O6Q A;  4IFF A;  1GW3 A;  5APS A;  5AVT B;  4I2L C;  4PD4 D;  1S5L H;  3USS A;  1YJW P;  3L74 D;  3S9O A;  3L37 A;  1VQ4 P;  1EDJ A;  1SQP D;  1FJP A;  1IFM A;  1J1E C;  2POH A;  4TLF A;  5TIS E;  5DJU B;  1YIT P;  2KOG A;  1BDD A;  1SQV K;  2IBZ E;  1HH0 A;  1Q90 D;  2JEE A;  2WSS H;  3H1L E;  4PV1 C;  2W27 A;  1X22 A;  3IFM A;  1KYO E;  3VTP C;  1FU1 A;  3WU2 E;  1VQ7 P;  2AXC A;  1S2E A;  2KI7 B;  3TDK A;  3AE9 C;  3P7K A;  3O8Z A;  1UII A;  4JYC A;  2MJZ A;  2LXB A;  1LTB C;  1Q2N A;  2YMY A;  3S4R A;  5APT A;  3R2P A;  4I1L A;  2BEZ F;  3G6E P;  1KB9 D;  3RK2 C;  3CC2 P;  4ASW A;  3H1K J;  1ZR2 A;  1YBK A;  3AEF C;  3GF3 A;  4IOI H;  2RMZ A;  4MN4 C;  2BCC G;  4KHX A;  1PZQ A;  1L0L J;  4ZMD A;  3T97 A;  1SQX K;  2KZJ A;  1VQ5 P;  1AQT A;  1NTK J;  1BGY J;  1KMI Z;  4JYB A;  3RK3 E;  1L0N E;  1OW6 A;  1KOR A;  2B89 A;  3AE7 C;  1AVO A;  1Y9B A;  1ZW0 A;  2O01 N;  3M0D A;  4L75 A;  3CCU P;  3B71 A;  2K3R A;  1EZV G;  1RY3 A;  3VN0 A;  4YXD C;  3CX5 D;  3TYY A;  1SQQ D;  4YPC A;  3CX5 H;  1SFC C;  1SQX D;  3U1C A;  4H0L B;  2J58 A;  3OW2 O;  3P8C D;  4GDO A;  1SQB J;  2WPQ A;  3U1A A;  2OGU A;  3RK3 B;  4D6T J;  5CHX A;  3MGN A;  3SSU A;  5CCG C;  5B66 H;  3G4S P;  4RJT A;  1NH4 A;  1T2K C;  1S5L E;  2Y0C A;  4N78 E;  3VP9 A;  3VMY A;  4ZKP A;  1HJB A;  2FYU E;  2ZVN B;  4EI2 A;  1SP4 A;  3L75 G;  4DOJ A;  2WT7 B;  3L74 J;  5DJT B;  3A0B H;  2AXT H;  3HE4 A;  1JMM A;  3VP8 A;  2Y9Z A;  2OYI A;  3C9I A;  2P1J A;  2FBW C;  1WRG A;  2P58 A;  1NU1 K;  2XDJ A;  2RH0 A;  3A3Y B;  1VQP P;  5AW0 B;  2XZR A;  3V2P A;  2QJY C;  1WMK A;  1FJK A;  2WSF J;  2OAR A;  3L70 D;  1VQM P;  1DX7 A;  3CLQ A;  2K88 A;  1YJ9 P;  1JNM A;  1N8R Q;  1XTC C;  2E75 D;  3AEE C;  1FOS F;  1PGQ A;  3U59 A;  1VF5 B;  3MUD C;  1L0L G;  2HOD A;  1EQ7 A;  2Z4E A;  1H89 A;  1IFD A;  4OGQ C;  1SFC D;  1BE3 J;  3O6Q B;  2HFE D;  3L73 J;  5KLV J;  1YHQ P;  1Q7Y Q;  1QVF O;  3CX5 I;  1VQN P;  2YNY A;  2HOD B;  1J2J B;  3HD7 A;  3IN6 A;  3OA7 A;  1AA0 A;  3PHL A;  1NKZ B;  2O01 H;  5AW5 B;  1JCC A;  1ZV8 A;  1USE A;  3I5C A;  2WTY A;  1S9K E;  1GW4 A;  1QLE D;  2RKL A;  4W80 A;  2Q7C A;  1X9V A;  5KKZ C;  5B66 E;  2C9N Y;  5AVX B;  1M56 D;  3H1L J;  3RK2 D;  1ZP0 C;  2CPS A;  3KPE A;  1NHL A;  1VQ9 P;  1EC5 A;  1KQS O;  4DZO A;  1Y47 A;  2I1J A;  2OYI B;  3JSV C;  3AE5 C;  4I6M C;  2OTK E;  2P2U A;  2ZYD A;  3NFQ A;  4RO0 A;  3A2A A;  1IFJ A;  1U7J A;  1FDI A;  2P10 A;  2E75 B;  4K35 A;  4LLH A;  4WY4 C;  4XA4 A;  2WT7 A;  3WUT A;  3I56 P;  2WSC J;  1H0T B;  1S72 P;  5KLV K;  5CBO A;  1LTT C;  3V4W A;  4EIJ A;  1GMJ A;  4XE5 B;  1VF5 C;  2IZ0 A;  3L36 A;  1FDM A;  1FZC A;  4JBZ A;  1OVV A;  2GM4 A;  3HTK A;  1JM0 A;  3V2N A;  1FS0 E;  1RF1 B;  1JMB A;  1NTZ D;  3KXD A;  5CCH C;  2QE7 H;  2BCC E;  4W7Y A;  1X79 B;  1KB9 H;  1NU1 D;  1FE6 A;  4R4M A;  4U3F J;  4A7P A;  3A5T A;  4I7Z B;  5AVR B;  1KIL D;  2FYZ A;  3TGU E;  1KD1 Q;  2R5B A;  1MFZ A;  3AED C;  1MZ9 A;  1NTZ K;  2M5A A;  4WY4 A;  1J1E B;  2QM7 A;  3N4X A;  2IYP A;  3FWL A;  3GHG A;  2YKO A;  1OXZ A;  3H1I G;  3IF4 A;  3T97 B;  3W67 A;  1U7M A;  1K8A Q;  1X0T A;  2ZT9 D;  1NAF A;  1NTZ J;  1JY2 O;  2NPS C;  3H1H G;  1JY3 P;  3H1H D;  1BE3 E;  1NKN A;  3KHU A;  3LW5 J;  5AW9 B;  2R44 A;  1ZR4 A;  3H1H E;  2FFD A;  1MUU A;  4W7Z A;  1N7S B;  4TT3 H;  3UIA A;  3B5N A;  2OTJ P;  1R5L A;  1BE3 G;  2JR8 A;  1N73 B;  2IFM A;  2Z5I A;  1IZN B;  2QJK B;  4ZNC A;  2KNC B;  2E76 C;  1Z56 A;  2AEM A;  1NU1 G;  2K1A A;  3BCC E;  5AW7 B;  1LNQ A;  3W68 A;  2E74 B;  1FZE A;  1JOC A;  2KK7 A;  2L91 A;  3FXD A;  3CI9 A;  2Q1K A;  3H1K E;  1BCC E;  4OGQ D;  3BCC J;  2K37 A;  1YYC A;  1L0N K;  1L4A D;  2BEQ D;  3L72 G;  1BDC A;  1L4A B;  2BCC D;  4RES B;  1KB9 I;  2IZ1 A;  1OMI A;  3TK1 A;  3CCR P;  1KIL B;  1GL2 A;  1OW8 A;  3CWB E;  3M0A A;  1PP9 E;  3JC2 2;  2KP8 A;  2FKW B;  2HLO A;  3L71 G;  3A7O A;  1E5W A;  4YTP C;  1S1C X;  1EXI A;  1M1J C;  3E1R A;  1BGY D;  1KQF B;  1IO4 A;  4UB6 E;  2QVA A;  3L75 J;  5KJ7 C;  1PPJ G;  3VMX A;  3WMM 0;  4GT1 A;  3CPW O;  1K73 Q;  4WWI A;  1PPJ D;  1EZV I;  2Y9Y A;  4N6J A;  4OVN F;  2O01 J;  3EWK A;  1SQB D;  1ZRT E;  5AW6 B;  1LT9 A;  1PPJ E;  4D6T G;  4Y99 B;  2WPR A;  1KIL E;  5AVS B;  4AYC A;  2P67 A;  3D6Y A;  3RL0 g;  1P84 I;  2E76 B;  1HBW A;  1NVO A;  1OVR A;  3GLM A;  2E76 D;  4L74 A;  5CCG A;  2KYV A;  2W6A A;  1QL2 A;  4H44 D;  3KZI H;  1BCC J;  1KYO H;  1EDI A;  5CMZ A;  3BAT A;  3WU2 H;  2IBZ G;  3GF7 A;  5GTI E;  1K05 A;  1NOH A;  1LTI C;  1SFC A;  3JCU E;  4BRY B;  2OYH A;  4AUW A;  1KV4 A;  1L4A C;  3HUS A;  1N7L A;  1NO4 A;  1SQP J;  3L70 G;  3CWB D;  1PIX A;  3MZW B;  1J1D C;  1RE4 C;  1S3J A;  2Q6Q A;  1T6A A;  2G8Y A;  2KSJ A;  1XTG B;  3CXH H;  3H25 A;  4Z1M H;  1KN7 A;  1KB9 E;  4NPF X;  1NTM K;  2QJP C;  3HRN A;  1N7S D;  3H1K D;  1PL5 A;  3WUU A;  1PFI A;  3RK3 C;  4PV1 B;  1SQQ K;  3BCC D;  3EFG A;  1M8O B;  1G2C A;  2Z5H A;  2B87 A;  1IK7 A;  2L5G B;  3E7K A;  3AE2 C;  3MP7 B;  5KAI H;  1CI6 A;  1GL2 D;  2PAJ A;  2YMK A;  3D70 A;  5APW A;  3A0H H;  1L0N G;  5CCG D;  1JEK A;  2JDI H;  3G9R A;  1T3U A;  2H88 C;  1LWU B;  2Q3E A;  2WSF H;  1E79 H;  3M9H A;  2NPS A;  4DJG A;  1R5S A;  1M1J A;  2V4H A;  4ZKU A;  1G1J A;  3CCM P;  3KQG A;  2H7H A;  2M3E A;  1YQ4 C;  2WPV B;  4PD4 H;  3V2Q A;  1MKM A;  2M0B A;  1A02 J;  2E43 A;  2E75 C;  3AE3 C;  5AVQ B;  3TGU G;  1ZXG A;  1YJN P;  5BU5 A;  4KJM A;  1S5L X;  3AEA C;  1W5C E;  2V7Q H;  3PJS K;  1SLQ A;  2SPZ A;  1SQQ E;  1VF5 D;  1GD2 E;  3WUV A;  1NTZ E;  4XFJ A;  3TF5 A;  2C0W A;  3CCJ P;  2HG5 D;  5AVU B;  4OH8 B;  1LP1 B;  3LIE A;  3P32 A;  1NTM E;  2LXC B;  2YKQ A;  4IFD K;  3RGU A;  3IR9 A;  2W90 A;  3G71 P;  1URQ D;  1PP9 D;  2E74 D;  4HH2 A;  4WB4 A;  2XNX A;  1S4X A;  2K9J B;  3QWO C;  1JTH A;  4HKZ H;  4QMA A;  1JY2 N;  3I55 P;  5E79 E;  5GTH E;  1M7L A;  2ZXX A;  1SQV J;  3N7N A;  3AE8 C;  4CPG A;  2YIU C;  4UB6 H;  1GK6 A;  2JWD A;  3TNU A;  1FZG A;  3AEB C;  1LJ2 A;  1MV8 A;  4HB1 A;  1SQB E;  1T3J A;  1ZRT D;  1LTS C;  2I8D A;  2N1T B;  2W6J H;  5AW4 B;  5KAI E;  3V5B A;  5B5E H;  3CC4 P;  4H44 C;  3TSI A;  2R3C A;  1NGM B;  3BRV B;  1USD A;  2ZYA A;  5H2F H;  5KAF E;  1YIJ P;  2OYI C;  1DD4 A;  3AE4 C;  1ZOY C;  3B8E B;  3EQ2 A;  1N2D C;  1OWA A;  3P8C E;  2QJK C;  1SQB K;  3L74 G;  4B86 A;  1S9K D;  1BGY E;  2GA1 A;  4DT0 A;  1OFC X;  4U3F G;  4JPZ B;  2HPC A;  1BSH A;  4H0L D;  1PV3 A;  5CCH A;  3M9Q A;  1DEE G;  3H32 A;  3RK3 D;  1YI2 P;  1URQ A;  4WY4 D;  1VDF A;  2I1K A;  5KLI C;  3CCE P;  1NTK K;  2E5Y A;  1VQ8 P;  5BU8 B;  3II6 A;  1GL2 C;  4IL6 E;  1FZF A;  1EDL A;  1VQK P;  2WSC H;  2LR2 A;  2Q9I A;  1LGH B;  2QSI A;  1URQ C;  1NU1 E;  1IK9 A;  1H88 A;  2Q3I A;  3ABV C;  1YQ3 C;  3OAK A;  1NJI Q;  1YTZ T;  1PGP A;  1NTK G;  2V7Q J;  2ZJS E;  2A45 H;  1T8Z A;  4JF7 A;  2BCC J;  2N1T A;  1SQP G;  1IC2 A;  2R32 A;  1KYO D;  2IBZ I;  3H1L G;  3HE5 A;  4C7N B;  4EYY Q;  3Q5S A;  2FYU K;  2ZT9 C;  3MTU E;  4K3A A;  4NPE A;  3Q5P A;  1HGZ A;  2OTL P;  1LTJ A;  3PRJ A;  1LT9 C;  4H13 D;  2HR3 A;  1BE3 D;  3A0B E;  2KIK A;  2G3A A;  2KS1 A;  2YO2 A;  1LTJ B;  1SQX G;  3H1J J;  3NXS A;  2KLU A;  3SWF A;  3Q1M A;  3HE5 B;  2MKV A;  4N78 D;  2KLV A;  3ZDM A;  1DIP A;  3L73 G;  5KLV G;  1KQG B;  5AVW B;  3LW5 H;  3PLN A;  2XV5 A;  5KAF H;  3D6Z A;  3CL3 D;  2FYN C;  1QGK B;  3MUD A;  1KQL A;  2RN0 A;  1GK4 A;  1QVG O;  1T2K D;  1X8Y A;  1SQX E;  4HYT B;  2KZI A;  2D2C B;  3CC7 P;  3CX5 E;  1RE4 A;  1MFT A;  3M06 A;  1FAV A;  1HJ0 A;  3CCL P;  2K9Y A;  1ZLL A;  3KDP B;  1BSN A;  4PJ0 E;  1EZV E;  2N1T D;  2ZVO B;  1KFN A;  2HYN A;  1JY3 N;  1AV1 A;  2FXO A;  1Y8A A;  2NRG A;  3A0H E;  3B5N C;  1OW7 A;  3F5H A;  2DW3 A;  2KS1 B;  1M1J B;  2FY8 A;  2KXP B;  2NPS B;  1KFM A;  1OZH A;  2ZFC A;  1M1K Q;  3H1I E;  3L72 J;  1VQL P;  1BCC D;  3MIW A;  3V2R A;  1H8A A;  1JUN A;  2W83 C;  1KTM A;  1IFN A;  2P7J A;  2J59 M;  3BCC G;  5APY A;  5AVV B;  3MHV A;  5AW2 B;  1NU1 J;  1LTJ C;  1LWU C;  3RL0 B;  1JCD A;  1CZQ A;  2IDB A;  1FOS E;  2JP3 A;  3H6P A;  3K5B A;  3L35 A;  1K9M Q;  5KJ7 A;  3L71 J;  2O1K A;  3OJA B;  3VYI A;  1KYO I;  2IBZ D;  1P84 H;  1PP9 G;  2B88 A;  2QM8 A;  1SVF A;  3M91 A;  4IFM A;  1JO5 A;  1ZN5 A;  1AJY A;  1N86 A;  1JTH B;  3FXE A;  3HD7 C;  2FYU D;  2Q5U A;  3Q2Y A;  3H1H J;  1SQV E;  3VMZ A;  3Q5R A;  2FYU G;  3L72 E;  2LKM A;  3H1I J;  5TJH A;  3H32 B;  4M3L A;  2QG4 A;  2FXP A;  3C8V A;  3BRT B;  4D6T E;  3TGU D;  1J1D B;  1IFI A;  1K04 A;  4EDF A;  3G3Z A;  4NPD A;  1AQ5 A;  1VQO P;  3P8M C;  1FZC C;  2AXT E;  1NTM J;  3KZI E;  5GTI H;  1QL1 A;  2GUS A;  5BVZ A;  4PV1 D;  1DH3 A;  2BAS A;  5B5E E;  1HWT C;  2N9Y B;  2QRX A;  2A45 I;  1PGO A;  1L0N D;  2C0X A;  3L4F A;  1L0L K;  4H13 C;  1M57 D;  2YIU B;  1NTZ G;  1PP9 J;  1GDT A;  1KZU B;  1HGV A;  2H89 C;  2M3B A;  3TGU J;  1R8E A;  1NTM G;  2XKM A;  3PH0 A;  4Y99 C;  1GU4 A;  1RE3 C;  2O1J A;  3V6I A;  2N1T C;  2YXR B;  3SWK A;  1M90 Q;  2AEF A;  2PGD A;  3CWB J;  4H44 B;  5APX A;  4LGD E;  2PP6 A;  2JWA A;  2K9J A;  2JO1 A;  4C7N A;  2XU6 A;  1RH5 B;  3BVH A;  1ZME C;  2KSE A;  3SFD C;  1CI6 B;  3Q3D A;  5C39 A;  5KTB A;  1HTL C;  2IPP A;  3VMA A;  1G1I A;  2WSE J;  2H8P D;  4EOT A;  1FDO A; 
#chains in the Genus database with same CATH homology
 4WBA A;  4C46 A;  1LTA C;  1VPC A;  5KJ7 D;  1HVV A;  1HUC A;  1IJD B;  2WWW A;  1URQ B;  3HUS B;  2KB7 P;  2R5D A;  5AW8 B;  2A45 G;  1N7S A;  3KYQ A;  2HPC B;  1CSB A;  2E42 A;  3M9B A;  2M8R A;  2C9L Y;  4GIF A;  1LTG C;  1AFO A;  2N9B A;  1LT9 B;  1G2C B;  3V4Q A;  1RE3 A;  2FFD C;  3RK2 B;  2YKP A;  3TNU B;  2IFN A;  2NPS D;  3PP5 A;  2GUV A;  5CJ0 A;  1FZA A;  2W6B A;  3GHG C;  4O9B A;  1FZB A;  2CPB A;  5CJ4 A;  1GU5 A;  1NWQ A;  3NTN A;  3RL0 D;  2OYH B;  1SFC B;  3E1I A;  1RF1 C;  1GL2 B;  5CCH D;  1L4A A;  3HUS C;  2FXM A;  4AQR D;  3M0D C;  2ZXE B;  3B5N D;  2H43 A;  1N73 A;  1JY3 O;  1LWU A;  2FFD B;  1JY2 P;  1WT6 A;  3RL0 C;  1CW5 A;  1GTW A;  3NMD A;  4N3Y B;  3SWY A;  1N73 C;  3GHG B;  5AW1 B;  1W2E A;  1KIL A;  5AVZ B;  1A02 F;  2OYH C;  2WIT A;  2YO3 A;  4LC1 A;  1FZC B;  3MD0 A;  1FBM A;  3B5N B;  5AVY B;  3HE4 B;  2VRS A;  5APU A;  2WZ7 A;  5APV A;  1N7S C;  4C7R A;  2JJL A;  1GZL A;  2WPS A;  3VOP A;  4WY4 B;  4GKG A;  1DEB A;  2IX7 C;  5APQ A;  1RF0 A;  5AW3 B;  3BAS A;  1RF1 A;  3HD7 D;  3LID A;  3HTK B;  1KIL C;  2WSE H;  1SQP K;  3HD7 B;  1RF0 C;  4IFF A;  1YTZ I;  5APS A;  5AVT B;  1GW3 A;  4I2L C;  3L37 A;  1FJP A;  1IFM A;  1J1E C;  2POH A;  2KOG A;  1SQV K;  1HH0 A;  2JEE A;  2W27 A;  3IFM A;  3VTP C;  1FU1 A;  3P7K A;  3O8Z A;  4JYC A;  2MJZ A;  1LTB C;  2YMY A;  5APT A;  3R2P A;  4I1L A;  3RK2 C;  1ZR2 A;  4KHX A;  3T97 A;  1SQX K;  4JYB A;  3M0D A;  1RY3 A;  3VN0 A;  3TYY A;  1SFC C;  3U1C A;  2J58 A;  3P8C D;  3U1A A;  2WPQ A;  3RK3 B;  5CHX A;  3MGN A;  5CCG C;  1NH4 A;  1T2K C;  4N78 E;  3VP9 A;  3VMY A;  4ZKP A;  1HJB A;  1SP4 A;  4DOJ A;  2WT7 B;  3HE4 A;  1JMM A;  3VP8 A;  2OYI A;  3C9I A;  2P1J A;  1WRG A;  1NU1 K;  2XDJ A;  3A3Y B;  5AW0 B;  2XZR A;  3V2P A;  1FJK A;  2OAR A;  1DX7 A;  3CLQ A;  1JNM A;  1XTC C;  1FOS F;  3U59 A;  2HOD A;  1EQ7 A;  2Z4E A;  1H89 A;  1IFD A;  1SFC D;  2HFE D;  2YNY A;  2HOD B;  1J2J B;  3HD7 A;  4HH2 A;  3OA7 A;  5AW5 B;  1NKZ B;  2O01 H;  2WTY A;  1JCC A;  1ZV8 A;  3I5C A;  1S9K E;  1GW4 A;  4W80 A;  2Q7C A;  1X9V A;  2C9N Y;  5AVX B;  3RK2 D;  2CPS A;  3KPE A;  1NHL A;  4DZO A;  2I1J A;  2OYI B;  4I6M C;  2P2U A;  3NFQ A;  3A2A A;  1IFJ A;  4WY4 C;  2WT7 A;  4XA4 A;  4LLH A;  5KLV K;  1LTT C;  3V4W A;  4EIJ A;  4XE5 B;  3L36 A;  1FDM A;  1FZC A;  2GM4 A;  3HTK A;  3V2N A;  1RF1 B;  5CCH C;  4W7Y A;  1X79 B;  3A5T A;  5AVR B;  1KIL D;  2FYZ A;  2R5B A;  1MFZ A;  1MZ9 A;  1NTZ K;  4WY4 A;  1J1E B;  2QM7 A;  3N4X A;  3GHG A;  2YKO A;  1OXZ A;  1NAF A;  2NPS C;  1JY2 O;  1JY3 P;  1NKN A;  5AW9 B;  1ZR4 A;  2FFD A;  1JUN A;  1MUU A;  4W7Z A;  1N7S B;  3UIA A;  3B5N A;  1N73 B;  2IFM A;  2Z5I A;  1Z56 A;  5AW7 B;  1FZE A;  1JOC A;  3CI9 A;  1YYC A;  1L0N K;  1L4A D;  1L4A B;  3TK1 A;  4RES B;  1KIL B;  1GL2 A;  3M0A A;  2KP8 A;  2FKW B;  2HLO A;  3A7O A;  1E5W A;  1M1J C;  1IO4 A;  5KJ7 C;  3VMX A;  3WMM 0;  4GT1 A;  4N6J A;  5AW6 B;  1LT9 A;  4Y99 B;  2WPR A;  5AVS B;  4AYC A;  2P67 A;  1HBW A;  5CCG A;  2KYV A;  2W6A A;  1QL2 A;  5CMZ A;  3BAT A;  1NOH A;  1LTI C;  1SFC A;  4AUW A;  2OYH A;  1L4A C;  3HUS A;  1N7L A;  1NO4 A;  1J1D C;  1RE4 C;  2KSJ A;  1XTG B;  1NTM K;  3HRN A;  1N7S D;  1PFI A;  3RK3 C;  1SQQ K;  3EFG A;  1G2C A;  2Z5H A;  2L5G B;  1CI6 A;  1GL2 D;  2PAJ A;  5APW A;  5CCG D;  1T3U A;  1LWU B;  3M9H A;  2WSF H;  2NPS A;  1M1J A;  4ZKU A;  1G1J A;  3KQG A;  2H7H A;  3V2Q A;  1A02 J;  2E43 A;  5AVQ B;  5BU5 A;  1SLQ A;  1GD2 E;  2C0W A;  5AVU B;  4OH8 B;  3LIE A;  3P32 A;  2YKQ A;  4IFD K;  3IR9 A;  1URQ D;  4WB4 A;  2XNX A;  1JTH A;  1JY2 N;  1M7L A;  3N7N A;  1FZG A;  1GK6 A;  3TNU A;  1MV8 A;  1T3J A;  3V5B A;  1LTS C;  5AW4 B;  2N1T B;  3TSI A;  2R3C A;  3BRV B;  2OYI C;  3P8C E;  3B8E B;  3EQ2 A;  4B86 A;  1N2D C;  1OWA A;  1SQB K;  1S9K D;  2HPC A;  5CCH A;  3M9Q A;  3H32 A;  3RK3 D;  1URQ A;  4WY4 D;  1VDF A;  2I1K A;  1NTK K;  5BU8 B;  3II6 A;  1GL2 C;  1FZF A;  2WSC H;  2Q9I A;  1LGH B;  1URQ C;  1IK9 A;  1H88 A;  2Q3I A;  3OAK A;  1YTZ T;  2A45 H;  1T8Z A;  4JF7 A;  2N1T A;  1IC2 A;  2R32 A;  3HE5 A;  4C7N B;  2FYU K;  3MTU E;  1HGZ A;  1LTJ A;  1LT9 C;  2YO2 A;  1LTJ B;  3NXS A;  3SWF A;  3HE5 B;  4N78 D;  2KLV A;  5AVW B;  3LW5 H;  2XV5 A;  3CL3 D;  3MUD A;  1KQL A;  1GK4 A;  1T2K D;  1X8Y A;  4HYT B;  1RE4 A;  3M06 A;  1FAV A;  1ZLL A;  3KDP B;  2N1T D;  1KFN A;  2HYN A;  1JY3 N;  3B5N C;  1M1J B;  2NPS B;  2ZFC A;  1KFM A;  3MIW A;  3V2R A;  1H8A A;  1IFN A;  2P7J A;  2J59 M;  5APY A;  5AVV B;  5AW2 B;  1LTJ C;  1LWU C;  3RL0 B;  1JCD A;  1CZQ A;  1FOS E;  3H6P A;  3L35 A;  5KJ7 A;  2O1K A;  3OJA B;  3VYI A;  2QM8 A;  3M91 A;  1JO5 A;  4IFM A;  1SVF A;  1ZN5 A;  1N86 A;  1JTH B;  3HD7 C;  2Q5U A;  3VMZ A;  2LKM A;  3H32 B;  4M3L A;  3BRT B;  1J1D B;  1IFI A;  3G3Z A;  1AQ5 A;  3P8M C;  1FZC C;  1QL1 A;  2GUS A;  5BVZ A;  1DH3 A;  2BAS A;  1HWT C;  3L4F A;  2A45 I;  2C0X A;  1L0L K;  1GDT A;  1KZU B;  1HGV A;  2M3B A;  2XKM A;  1GU4 A;  4Y99 C;  1RE3 C;  2O1J A;  2N1T C;  5APX A;  4LGD E;  2PP6 A;  3BVH A;  4C7N A;  2XU6 A;  1G1I A;  1CI6 B;  5KTB A;  1HTL C;  2IPP A;  2HG5 D;  2H8P D;  4EOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...