1DEBA

Crystal structure of the n-terminal coiled coil domain from apc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
AAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Structural protein
molecule keywords ADENOMATOUS POLYPOSIS COLI PROTEIN
publication title Crystal structure of the amino-terminal coiled-coil domain of the APC tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16689 APC_N_CC Coiled-coil N-terminus of APC, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1debA00
3V2NA 1DEBA 1FBMA 3V2RA 1MZ9A 1VDFA 3V2QA 3V2PA
chains in the Genus database with same CATH superfamily
2IBZD 1H8AA 3LW5H 1J1DC 1SFCA 1BE3J 3CXHD 2O01J 1KYOI 1FZCA 1U7MA 3Q5PA 2OQQA 1L0LJ 1GTWA 1GK4A 1VF5B 1KQFB 1NTMG 1SFCB 2PAJA 1T3UA 3H1LD 2N1TD 1FZCB 1RF0A 1FS0E 2HYNA 1EZVE 2KZJA 3RGUA 1YQ4C 2IYPA 1SQXK 1RQVA 3L70G 2RKLA 3RK2B 5AVTB 1JOCA 2Z5IA 3MTUE 1NTKD 2M3BA 2VRSA 1NO4A 2W6AA 2GA1A 5CCGD 1PFIA 3MP7B 3L71J 4C46A 1RE3A 1SLQA 4EI2A 1KB9I 3KQGA 2I8DA 4C7RA 1URQC 2YO3A 1JMBA 5AVXB 1Y8AA 2FXPA 2M8RA 4M3LA 3V2NA 1L4AA 2K3RA 3FGAD 4JBZA 1BCCG 4GDOA 5CMZA 2OTJP 1EC5A 2WQYC 1L0ND 2BCCG 2QEXP 1WMKA 1WRGA 1EZVD 5AW4B 1L4AB 3L70E 3A0BE 3F89A 2A06G 1ZRTE 1G2CA 2QG4A 1NTMJ 1NAYA 3ABVC 4KHXA 5APVA 5CBNA 3AE7C 1G2CB 2LR2A 3MD0A 4HH2A 2RH0A 2WPSA 1NJIQ 1NGMB 4NPFX 1BGYG 3RL0g 1U57A 1DX7A 2PGDA 3Q5SA 2E42A 4UB8H 3BCCG 1JM0A 2FYUE 1PP9E 1BCCE 2FBWC 2QA4P 1P84I 2Y9ZA 4XFJA 2BCCE 4L76A 1KYOE 1SQBG 1RH5B 4I7ZC 3M9QA 2KLUA 3H1HG 3L70D 2IPPA 1BCCJ 3L75G 3M0DC 1ZRTD 1VQ6P 5DJTB 2E74D 2HG5D 5H2FE 4ZKUA 1QL1A 4KJMA 2YO2A 3HD7C 2R44A 2FYNC 3RL0B 3CCQP 1EDKA 5B66E 2P2UA 4W80A 5KLVG 2K1AA 1OMIA 1JB0J 2QJKC 3L74E 1A02F 3WMM0 1VPCA 1DEBA 4B86A 3W67A 3AEEC 4UB6H 2ZYGA 1KB9E 1HH0A 2W6JH 3B5NC 3CD6P 2FYUD 2KNCA 1PP9D 3CCEP 3V2PA 1YYCA 1BGYJ 3AE3C 4W7ZA 4RO0A 2BCCD 1RE4A 1KYOD 3LW5J 1NYHA 1ZMEC 3MUDC 3BCCJ 3H1HE 1SQQG 3EFFK 2KNCB 2M5AB 5KTBA 3L75E 1T3JA 2QM7A 3M9HA 1JCCA 3CCLP 1NVOA 1Q82Q 3JCUE 3AEFC 3CXHH 2NPSD 1X22A 5B5EE 2JEEA 3D6ZA 1SQBJ 3H1HJ 1FOSF 1G1IA 1PGQA 4ASWA 2O01N 2WSSH 4N78D 2WITA 2KSEA 4JPZB 4D6TE 1ZXGA 1SP4A 4U3FG 2AEMA 1IZNB 5KLVE 2QM8A 1SQXD 3MGNA 3FXDA 3L74D 5AVQB 2DW3A 3JC22 4DT0A 2WT7A 1SQPG 4AYCA 2ZXXA 2AEJA 3L35A 1KB9D 3GG2A 2IYOA 1T2KD 2KOGA 5KLVJ 2XNXA 1H0TA 5CCHD 2WT7B 2IBZI 1PV3A 5KLIC 4BWNA 2O1KA 1P84E 2H88C 1ZLLA 3SWYA 2C0WA 3L75D 3CCMP 3BRTB 1CSBA 3P7KA 1HWTC 3RK3B 1EQ7A 3HTKA 5CJ0A 1SQQJ 2YMKA 2O3JA 2H8PD 4IFMA 1HGVA 4H13B 4RKUJ 3O8ZA 1OVRA 3RBZA 1M1KQ 3HTKB 4RJTA 2KSJA 4D6TD 2LKMA 1X0TA 1ZW0A 1SQPE 3VP8A 3L73D 4UB8E 5AW5B 1BSHA 2ZT9B 1LTJC 1KILC 4U3FJ 4H0LB 5TJHA 3V4WA 4YTPC 5APUA 5AW2B 1L0LK 4NPEA 4L74A 3NTNA 2KB7P 1ZV8A 4EDFA 4R4LA 1P84D 2WPVB 2ZAEB 5C39A 3CCSP 2CPBA 2C0XA 2YIUB 2WPRA 3A0HE 4H44C 2IBZG 4GOEA 5BU5A 1LGHB 3E1IA 2N1TA 2JR8A 5AW7B 2MKVA 5KKZC 1AQ5A 1GDTA 1NU1K 3H1KE 2KK7A 3C8VA 1M1JC 2Z5HA 3A0BH 3E1RA 3AE2C 1SQPD 3W68A 5AVZB 5CCGA 2HFED 1XTGB 5AVYB 3QWOC 1FDIA 4HB1A 1NTKG 3HE4A 3M9BA 3G9RA 5K5GB 2IZ1A 1SQVE 1PIXA 1S4XA 3HE4B 4YPCA 2JWDA 3A5TA 1NTMK 2WMMA 2HODA 2W27A 1LT1A 1YI2P 3V6IA 1NKNA 3VYIA 3S4RA 2WSFH 4OH8B 1IFPA 4I1LA 1UIXA 3D71A 2HODB 1KFNA 1KYOH 1KQLA 5KJ7D 1L0NG 3H1KD 4JYBA 2D2CC 1YITP 1EZVG 4GODA 2ZVOB 4IFFA 2QRXA 2K9JA 1QLED 2B88A 1HJ0A 2QSIA 3ZDMA 1FAVA 1M56D 4AUWA 3H1LJ 3O6QA 1N7SD 2K9JB 2GM4A 1VF5C 1SFCC 2FKWB 3BATA 1SQVD 3V5BA 1FZCC 3KPEA 1N8RQ 2AXTE 3PHLA 1OXZA 1X9VA 4MN4C 2GUVA 3I55P 1NTKJ 1OVVA 1JUNA 3O6QB 2E5YA 1VQ7P 2N9BA 1R5SA 2O1JA 1KB9H 3RK2C 1UIIA 4LLHA 1BDDA 1J2JB 1HJBA 1AVOA 1L0NE 1KFMA 3CX5D 1N73A 1JY2P 4IL6E 1TU3F 3CC4P 3D70A 1NH4A 2E74B 3HE5A 3JCUH 2G8YA 1L0NJ 1RE3C 5B5EH 4WWIA 1YJWP 1N73B 1GL2D 1BDCA 1J1DB 3IF4A 3HE5B 1JY3P 3E7KA 5GTHE 1L4AC 2OTKE 2Y0DA 2KZIA 1ZP0C 4OGQD 4Z1MH 3L72E 1SQBK 3AEDC 1OW6A 2J59M 2FYUG 1PP9G 3TNUA 4JQ0D 1VDFA 1GMJA 1P84H 2NPSA 2PP6A 1LTBC 2A45I 2H89C 3GMAA 3ITKA 1IJDB 3WU2H 1AFOA 2YNYA 4ASVA 2PFXA 2BEQD 1X79B 2NPSB 3N4XA 1OWAA 2IFNA 3L70J 1NU1D 2OYOA 4PV1D 1FZFA 3C9IA 4ZNCA 2W8ZA 3HUSA 1KTMA 1YJ9P 3EFGA 1ZR2A 3CWBE 1SQXG 5CCHA 3L36A 3L74G 3H1JE 1JCDA 1SQQK 3HUSB 1N86A 3L72D 5AW9B 1FZAA 1VQ9P 2D2CD 1R8EA 1G1JA 2HLOA 1NOHA 3PLNA 2BASA 3K5BA 4U7JA 3GHGA 1JMMA 3RL0C 3HRNA 3T97A 4EOTA 1IK7A 3VMXA 4WY4D 5AW0B 1OIPA 1M90Q 2FYUJ 1PP9J 3GF7A 1RF1A 2WSFJ 2Q6QA 3AECC 3GHGB 3A0HH 4DCKA 4WVZA 1DD4A 3TGUE 5EFWB 2BCCJ 3T97B 2JWAA 4GKGA 2QJPB 2W83C 2ZXEB 1RF1B 4N78E 3Q5RA 2L5GB 2ZFCA 1DEEG 2C9NY 3AE9C 3RK2D 4D6TG 1SQXE 3VMAA 3EQ2A 3CWBD 3OW2O 1YIJP 4XA4A 3R2PA 3CCUP 3C1LA 1JY2N 3L73G 4Y99B 3KZIE 3H1JD 2G3AA 3IFMA 3H1IG 1Q90D 1M7LA 1GZLA 1SQXJ 2JKVA 4WB4A 4L73A 3L74J 1E79H 1XTCC 2JO1A 1AV1A 3KYQA 3LIEA 5KAFE 1GU5A 2FY8A 1LWUA 5E79H 1JY3N 1VQNP 2YMYA 3TGUD 1IFJA 2QJYB 5KAIE 1LWUB 3L75J 4I2LC 1S5LX 1URQD 1W5CE 3CL3D 5AVRB 3GF3A 3CX5H 1HTLC 1LTSC 1VQ4P 3A7OA 2OGUA 3L73E 1FJPA 3RK3C 1VQKP 1FDMA 3H1IE 2KUBA 3U1AA 2NZ2A 1PL5A 4D6TJ 2E43A 4H13C 1MFZA 2V7QH 3L73J 1PGJA 2WSEH 4NPDA 3TDKA 2AXTH 1IC2A 1H0TB 3H32A 1MV8A 3B4SA 3WU2E 1FZGA 1T6AA 1OW8A 4N6JA 1FC2C 1K05A 1KC8Q 5KJ7A 2ZT9C 1NTZK 3V2QA 4H0LC 2SPZA 3CX5I 3H32B 2E76B 4DJGA 3IR9A 3CC2P 5AVUB 1FU1A 1OVUA 3EWKA 3H1KG 3PRJA 4IL6H 5AVSB 1NTKK 3GLMA 5AW3B 2YIUC 1N7SA 1M8OB 3H1ID 2JP3A 3VMZA 1GW4A 1LT9A 2FFDA 1LP1A 1K9MQ 4YXWH 1JEKA 1N2DC 1LTTC 1N7SB 2CK3H 1K8AQ 3Q2YA 2Y9YA 1SQPJ 4DOJA 1LNQA 3AE8C 4K35A 1LT9B 5GTHH 2FFDB 1SQVG 1LP1B 3CPWO 2FXMA 3HD7D 2FXOA 3NMDA 1U7JA 3WUTA 3P32A 5AW6B 2WSCH 1L0NK 2R32A 1HVVA 1NAFA 1S72P 2OYIA 2E5TA 5CCGC 1AA0A 4HYTB 5AW8B 1DD3A 2N1TB 1MFTA 5DJUB 3B5ND 3AEGC 2PRRA 1GL2A 1PPJD 1H88A 2OYIB 2P58A 3UIAA 3L37A 1SVFA 2P1JA 2AEFA 1FDOA 3PP5A 2K88A 3H1KJ 4TT3H 1GL2B 5CHXA 3I56P 2UWJE 1S5LE 2E75C 3S9OA 3Q3DA 2N9YB 1YTZT 1PZQA 2WVRA 1JTHA 2C9LY 1EDLA 3FXEA 1DH3A 5E79E 1X8YA 3PJSK 2OYHA 2KP8A 1VL2A 2QIWA 4OGQB 2KS1A 1GU4A 1SQVJ 1Y47A 3VMYA 1JTHB 1K73Q 1VQ8P 3CCVP 2OYHB 3PTZA 1WT6A 1OX3A 2KS1B 3CX5E 3WUVA 2YXRB 2LXBA 1KILE 3B8EB 3G4SP 5AW1B 4PD4D 3WUUA 1T8ZA 2H43A 3R4YA 3SWKA 5GTIE 2ZYAA 2XU6A 2CPSA 4PJ0E 3OJAB 4XE5B 1USDA 1K04A 4HKZH 4PV1B 3BVHA 5APXA 1NU1G 1LJ2A 3IAOA 4C7NA 4H0LD 2FYUK 2YKQA 2IZ0A 2V7QJ 3RBXA 1BE3E 3KHUA 2E74C 2B87A 1EDIA 3KZIH 4RESB 1JO5A 1S1CX 1IFDA 1RF0C 2Q5UA 4WY4A 1N73C 4C7NB 2D2CB 3L72G 2WSEJ 1L0LE 3H6PA 4ZMDA 2ZVNB 3II6A 2XDJA 2B87B 1VQLP 1CI6A 1J1EB 2KLVA 4WY4B 3TSIA 1KILD 5KAFH 1LTGC 3G71P 4KT0J 1ZR4A 2JJLA 2BEZF 5AVVB 4Y28J 1CI6B 4TLFA 1NTZD 1KQGB 2A45H 3QH9A 2QVAA 4HJGH 5KAIH 4EYYQ 2P67A 1AVYA 1NU1E 4H44D 5TISH 3L71E 2WWWA 1ZN5A 1L2PA 2FYZA 1S9KD 1GK6A 4A7PA 3TK1A 3F5HA 3CWBG 1BE3D 1NU1J 3KDPB 2NPSC 3H1JG 2R5DA 1RHZB 1OFCX 1RQUA 2J5UA 2IDBA 1L0LD 5APQA 3NFQA 1QL2A 2IFMA 1MZ9A 1QGKB 1GW3A 2WSCJ 3N7NA 1KZUB 1PGPA 5APTA 2Q3IA 3L72J 1IK9A 3TNUB 1HUCA 1URQA 1NTME 3CMEP 3G6EP 2E75D 4LGDE 4JF7A 1IFNA 3TGUG 3HUSC 3V4QA 1T2KC 5KLVK 1DIPA 2B9BA 2W6BA 2V4HA 3A2AA 4GT1A 5CCHC 1W2EA 1URQB 3CC7P 3L71D 4IFDK 4ZKPA 3Q1MA 2J58A 2ZJSE 1Q81Q 3CCRP 3TYYA 1OW7A 2Q7CA 3GHGC 5M1BA 5APWA 1YHQP 1LTAC 3FWLA 2QE7H 2Y0EA 2YKOA 1CZQA 1QEXA 1NHLA 1OZHA 2QJPC 4W7YA 1RF1C 1CW5A 5BVZA 3CWBJ 1VQ5P 2OARA 3VTPC 4K3AA 5APSA 3H1JJ 1LTIC 2ZYDA 2KI7B 1NTMD 2YKPA 1VF5D 1SFCD 4Y99C 2H7HA 1FBMA 3M91A 1Z56A 3S1KA 1H89A 1IFMA 2A06E 2A45G 2RN0A 1NKZB 1SQPK 2XV5A 2WTYA 3TGUJ 2K37A 4L75A 4PD4H 3AEBC 3M0DA 3CMAP 1QVFO 1RE4C 2WZ7A 2QJYC 1BGYE 2XKMA 3SFDC 4I7ZB 1LWUC 1KQSO 3HD7A 2B89A 1S5LH 1EXJA 3V2RA 3BCCE 4O9BA 2M5AA 1BCCD 3HD7B 1NWQA 1Q2NA 5AVWB 2FYNB 3CI9A 4GIFA 3U59A 1SQBE 3MZWB 3B5NA 4QMAA 1JNMA 1L4AD 3VOPA 2A06D 3SSUA 2QJKB 3AE5C 1KMIZ 1YJNP 1ZOYC 4PD4I 1FJKA 5TISE 3MUDA 3B5NB 3NXSA 1KD1Q 1PPJG 1YTZI 2WPQA 2Q1KA 1EDJA 3AE6C 2P7JA 4I6MC 1A02J 1SQVK 1BGYD 5GTIH 3A3YB 3PH0A 4PJ0H 1YQ3C 2I1KA 3USSA 2E76C 3VP9A 2NRGA 3BCCD 1VQPP 1S3JA 5KJ7C 4GOFA 2RMZA 2HPCA 3FWNA 3H1IJ 2Q3EA 2KIKA 4BXLA 1MKMA 2YXQB 4LC1A 2Z4EA 1AQTA 1VQOP 1FOSE 1FE6A 2O01H 1SQQE 2KXPB 1SQBD 1KV4A 3GW6A 3H1HD 2HPCB 1SS1A 4JYCA 1JY2O 2I1JA 3CXHI 3CCJP 1HGZA 1W2BO 2MJZA 2GUSA 1N7SC 5CJ4A 4R4MA 3BASA 1Y9BA 1LT9C 2FFDC 2OTLP 1PPJE 2Q9IA 2M0BA 1E5WA 1R5LA 2K9YA 3RL0D 1JY3O 5KLIB 2L91A 4U3FE 1BSNA 2XZRA 4OWFA 5KLVD 3SFEC 1IFIA 2XNDH 1Q7YQ 2N1TC 2JDIH 1MUUA 1QX8A 2Y0CA 2OYIC 4OVNF 3I5CA 3TF5A 4EIJA 1S2EA 2W90A 3B71A 1SQQD 3M06A 2R3CA 3BRVB 2R3SA 3OAKA 1LTJA 4WBAA 1KILA 1GL2C 4IL6X 4CPGA 3RK3E 3FX0A 1LTJB 1KILB 3LIDA 5CBOA 1KORA 1USEA 4PD4E 1EZVI 3AEAC 1FZEA 1FZBA 1PGOA 1HBWA 1AJYA 4U3FD 1VQMP 4OGQC 1NTZG 3H1LG 1QVGO 3AE4C 2OYHC 2KYVA 4H44B 4DZOA 4UB6E 1D7MA 1M57D 5L8RJ 1M1JA 5KKZB 1IO4A 3SWFA 1BE3G 3D6YA 2AXCA 1M1JB 3P8CE 4YXDC 3CLQA 1L0LG 2IBZE 4PV1C 3RK3D 3H25A 1N7LA 3CXHE 3OA7A 2P10A 4BRYA 3P8MC 1Q86Q 4H13D 3VN0A 3M0AA 1RY3A 2E75B 2E76D 2POHA 3G3ZA 1NTZE 1KN7A 4BRYB 3H1LE 2ITAA 3JSVC 1GD2E 4AQRD 2M3EA 2R5BA 1HF9A 5BU8B 2HR3A 5H2FH 2IX7C 3L71G 1J1EC 3MIWA 2ZT9D 1S9KE 3KXDA 4WY4C 1NTZJ 1NTKE 3MHVA 2LXCB 3IN6A 3L4FA 4N3YB 3AE1C 4IOIH 5APYA 1EXIA 3U1CA 1YBKA 3P8CD 5B66H
chains in the Genus database with same CATH topology
5AW7B 1HTLC 1H8AA 1AQ5A 3LW5H 1J1DC 1LTSC 2YKOA 1CZQA 3A7OA 1NHLA 1SFCA 1GDTA 1NU1K 4W7YA 1FZCA 1RF1C 1CW5A 1FJPA 3RK3C 5BVZA 1FDMA 1M1JC 2Z5HA 2OARA 3U1AA 1GTWA 3VTPC 1GK4A 2E43A 5APSA 1MFZA 1SFCB 2PAJA 1T3UA 5AVZB 1LTIC 5CCGA 2N1TD 1FZCB 1RF0A 2HFED 2HYNA 1XTGB 5AVYB 1SQXK 2YKPA 1SFCD 4Y99C 2H7HA 2WSEH 1FBMA 3M91A 3HE4A 1IC2A 1Z56A 3M9BA 1H89A 1IFMA 3H32A 1MV8A 3RK2B 2A45G 5AVTB 1NKZB 1JOCA 1FZGA 4N6JA 2Z5IA 3MTUE 2M3BA 2VRSA 5KJ7A 1NO4A 1SQPK 1NTZK 2W6AA 2XV5A 2WTYA 3V2QA 3HE4B 5CCGD 1PFIA 3A5TA 3H32B 4C46A 1NTMK 1RE3A 2HODA 2W27A 1SLQA 3IR9A 5AVUB 1FU1A 3KQGA 3M0DA 1NKNA 3VYIA 1RE4C 2WZ7A 4C7RA 1URQC 2WSFH 2YO3A 4OH8B 5AVXB 4I1LA 2XKMA 5AVSB 1NTKK 1KFNA 2HODB 2M8RA 4M3LA 5AW3B 1KQLA 5KJ7D 1LWUC 1N7SA 3V2NA 3HD7A 1L4AA 4JYBA 3VMZA 5CMZA 1GW4A 3V2RA 1LT9A 2FFDA 4IFFA 1N2DC 4O9BA 1LTTC 1WRGA 1N7SB 3HD7B 5AW4B 1NWQA 1L4AB 5AVWB 4DOJA 1FAVA 3CI9A 4AUWA 4GIFA 1LT9B 1G2CA 2FFDB 3U59A 1N7SD 2FXMA 3B5NA 3HD7D 1JNMA 2GM4A 1L4AD 3VOPA 1SFCC 2FKWB 3BATA 3NMDA 4KHXA 3P32A 5APVA 5AW6B 3V5BA 2WSCH 1FZCC 1L0NK 2R32A 3KPEA 1HVVA 1FJKA 1NAFA 1G2CB 1OXZA 1X9VA 2GUVA 3MUDA 3MD0A 1JUNA 3B5NB 2OYIA 4HH2A 3NXSA 2N9BA 2O1JA 2WPSA 1YTZI 2WPQA 5CCGC 3RK2C 4LLHA 4HYTB 5AW8B 2N1TB 1DX7A 3B5ND 2E42A 2P7JA 4I6MC 1GL2A 1J2JB 1H88A 1HJBA 1SQVK 2OYIB 1A02J 3UIAA 3A3YB 3L37A 1KFMA 1SVFA 2I1KA 2P1JA 3PP5A 3VP9A 1N73A 1JY2P 5KJ7C 1GL2B 2HPCA 5CHXA 1NH4A 3HE5A 4LC1A 2Z4EA 3M9QA 1RE3C 1FOSE 1N73B 1YTZT 2IPPA 1GL2D 3M0DC 2O01H 1JTHA 2C9LY 2HPCB 2HG5D 1DH3A 4JYCA 4ZKUA 1J1DB 1JY2O 2I1JA 1X8YA 3HE5B 2OYHA 1QL1A 1HGZA 2MJZA 1JY3P 2GUSA 2KP8A 2YO2A 1N7SC 5CJ4A 3HD7C 1L4AC 1GU4A 3BASA 3VMYA 1JTHB 1LT9C 2FFDC 3RL0B 2OYHB 2Q9IA 1WT6A 1E5WA 2P2UA 1SQBK 4W80A 2J59M 1A02F 3WMM0 1VPCA 1DEBA 1JY3O 3RL0D 4B86A 3B8EB 3TNUA 5AW1B 2XZRA 1HH0A 3B5NC 1T8ZA 2H43A 1VDFA 3V2PA 1IFIA 1YYCA 2NPSA 2PP6A 4W7ZA 1LTBC 2A45I 2N1TC 1RE4A 2XU6A 2CPSA 1IJDB 1MUUA 1AFOA 3OJAB 4XE5B 2YNYA 2OYIC 3BVHA 5KTBA 1X79B 5APXA 2NPSB 3I5CA 3N4XA 1OWAA 4EIJA 1T3JA 2QM7A 3M9HA 1JCCA 3M06A 2IFNA 3BRVB 2R3CA 4C7NA 2FYUK 3OAKA 1LTJA 2YKQA 1KILA 4WBAA 1GL2C 2NPSD 2JEEA 1FZFA 3C9IA 3HUSA 1FOSF 4RESB 1JO5A 1G1IA 1IFDA 1RF0C 2Q5UA 4N78D 3EFGA 1ZR2A 4WY4A 2WITA 1N73C 4C7NB 5CCHA 1LTJB 1KILB 3LIDA 3L36A 3H6PA 3II6A 1SP4A 1JCDA 1SQQK 2QM8A 2XDJA 3HUSB 1FZEA 1N86A 1FZBA 3MGNA 5AW9B 1HBWA 1FZAA 1CI6A 1J1EB 2KLVA 1G1JA 5AVQB 2HLOA 4WY4B 3TSIA 1KILD 1NOHA 2WT7A 2BASA 4AYCA 1LTGC 3GHGA 1JMMA 3L35A 1ZR4A 3RL0C 2JJLA 3HRNA 2OYHC 3T97A 4EOTA 5AVVB 3VMXA 1T2KD 4WY4D 1CI6B 2KYVA 2KOGA 5AW0B 2XNXA 4DZOA 5CCHD 2A45H 1RF1A 2WT7B 3GHGB 2P67A 2O1KA 1M1JA 1IO4A 1ZLLA 3SWYA 2C0WA 2WWWA 3SWFA 3BRTB 4GKGA 1ZN5A 1CSBA 2FYZA 3P7KA 1S9KD 1HWTC 1GK6A 2ZXEB 1RF1B 3RK3B 3TK1A 4N78E 1EQ7A 3HTKA 2L5GB 2ZFCA 1M1JB 5CJ0A 2C9NY 3P8CE 2H8PD 4IFMA 3CLQA 1HGVA 3RK2D 3KDPB 3RK3D 2NPSC 1N7LA 3O8ZA 2R5DA 3EQ2A 3OA7A 3P8MC 4XA4A 3HTKB 3R2PA 5APQA 2KSJA 3NFQA 1JY2N 4Y99B 3VN0A 3M0AA 1QL2A 1RY3A 2IFMA 2LKMA 1MZ9A 3IFMA 2POHA 1GW3A 3G3ZA 3N7NA 1M7LA 3VP8A 1KZUB 1GZLA 5APTA 2Q3IA 5AW5B 1IK9A 4WB4A 3TNUB 1GD2E 4AQRD 1HUCA 1XTCC 1LTJC 1URQA 1KILC 2R5BA 3V4WA 3KYQA 3LIEA 4LGDE 5APUA 5AW2B 4JF7A 5BU8B 1IFNA 1GU5A 1L0LK 3HUSC 3V4QA 3NTNA 1LWUA 2IX7C 1J1EC 2KB7P 1JY3N 3MIWA 1S9KE 1T2KC 1ZV8A 4WY4C 5KLVK 2YMYA 2W6BA 3A2AA 4GT1A 5CCHC 1W2EA 1URQB 1IFJA 3L4FA 4IFDK 4N3YB 4ZKPA 2CPBA 2C0XA 2J58A 1LWUB 2WPRA 4I2LC 5APYA 5BU5A 3U1CA 1URQD 3TYYA 3CL3D 1LGHB 3GHGC 3E1IA 3P8CD 2N1TA 5APWA 2Q7CA 5AVRB 1LTAC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V2N A;  1DEB A;  1FBM A;  3V2R A;  1MZ9 A;  1VDF A;  3V2Q A;  3V2P A; 
#chains in the Genus database with same CATH topology
 2IBZ D;  1H8A A;  3LW5 H;  1J1D C;  1SFC A;  1BE3 J;  3CXH D;  2O01 J;  1KYO I;  1FZC A;  1U7M A;  3Q5P A;  2OQQ A;  1L0L J;  1GTW A;  1GK4 A;  1VF5 B;  1KQF B;  1NTM G;  1SFC B;  2PAJ A;  1T3U A;  3H1L D;  2N1T D;  1FZC B;  1RF0 A;  1FS0 E;  2HYN A;  1EZV E;  2KZJ A;  3RGU A;  1YQ4 C;  2IYP A;  1SQX K;  1RQV A;  3L70 G;  2RKL A;  3RK2 B;  5AVT B;  1JOC A;  2Z5I A;  3MTU E;  1NTK D;  2M3B A;  2VRS A;  1NO4 A;  2W6A A;  2GA1 A;  5CCG D;  1PFI A;  3MP7 B;  3L71 J;  4C46 A;  1RE3 A;  1SLQ A;  4EI2 A;  1KB9 I;  3KQG A;  2I8D A;  4C7R A;  1URQ C;  2YO3 A;  1JMB A;  5AVX B;  1Y8A A;  2FXP A;  2M8R A;  4M3L A;  3V2N A;  1L4A A;  2K3R A;  3FGA D;  4JBZ A;  1BCC G;  4GDO A;  5CMZ A;  2OTJ P;  1EC5 A;  2WQY C;  1L0N D;  2BCC G;  2QEX P;  1WMK A;  1WRG A;  1EZV D;  5AW4 B;  1L4A B;  3L70 E;  3A0B E;  3F89 A;  2A06 G;  1ZRT E;  1G2C A;  2QG4 A;  1NTM J;  1NAY A;  3ABV C;  4KHX A;  5APV A;  5CBN A;  3AE7 C;  1G2C B;  2LR2 A;  3MD0 A;  4HH2 A;  2RH0 A;  2WPS A;  1NJI Q;  1NGM B;  4NPF X;  1BGY G;  3RL0 g;  1U57 A;  1DX7 A;  2PGD A;  3Q5S A;  2E42 A;  4UB8 H;  3BCC G;  1JM0 A;  2FYU E;  1PP9 E;  1BCC E;  2FBW C;  2QA4 P;  1P84 I;  2Y9Z A;  4XFJ A;  2BCC E;  4L76 A;  1KYO E;  1SQB G;  1RH5 B;  4I7Z C;  3M9Q A;  2KLU A;  3H1H G;  3L70 D;  2IPP A;  1BCC J;  3L75 G;  3M0D C;  1ZRT D;  1VQ6 P;  5DJT B;  2E74 D;  2HG5 D;  5H2F E;  4ZKU A;  1QL1 A;  4KJM A;  2YO2 A;  3HD7 C;  2R44 A;  2FYN C;  3RL0 B;  3CCQ P;  1EDK A;  5B66 E;  2P2U A;  4W80 A;  5KLV G;  2K1A A;  1OMI A;  1JB0 J;  2QJK C;  3L74 E;  1A02 F;  3WMM 0;  1VPC A;  1DEB A;  4B86 A;  3W67 A;  3AEE C;  4UB6 H;  2ZYG A;  1KB9 E;  1HH0 A;  2W6J H;  3B5N C;  3CD6 P;  2FYU D;  2KNC A;  1PP9 D;  3CCE P;  3V2P A;  1YYC A;  1BGY J;  3AE3 C;  4W7Z A;  4RO0 A;  2BCC D;  1RE4 A;  1KYO D;  3LW5 J;  1NYH A;  1ZME C;  3MUD C;  3BCC J;  3H1H E;  1SQQ G;  3EFF K;  2KNC B;  2M5A B;  5KTB A;  3L75 E;  1T3J A;  2QM7 A;  3M9H A;  1JCC A;  3CCL P;  1NVO A;  1Q82 Q;  3JCU E;  3AEF C;  3CXH H;  2NPS D;  1X22 A;  5B5E E;  2JEE A;  3D6Z A;  1SQB J;  3H1H J;  1FOS F;  1G1I A;  1PGQ A;  4ASW A;  2O01 N;  2WSS H;  4N78 D;  2WIT A;  2KSE A;  4JPZ B;  4D6T E;  1ZXG A;  1SP4 A;  4U3F G;  2AEM A;  1IZN B;  5KLV E;  2QM8 A;  1SQX D;  3MGN A;  3FXD A;  3L74 D;  5AVQ B;  2DW3 A;  3JC2 2;  4DT0 A;  2WT7 A;  1SQP G;  4AYC A;  2ZXX A;  2AEJ A;  3L35 A;  1KB9 D;  3GG2 A;  2IYO A;  1T2K D;  2KOG A;  5KLV J;  2XNX A;  1H0T A;  5CCH D;  2WT7 B;  2IBZ I;  1PV3 A;  5KLI C;  4BWN A;  2O1K A;  1P84 E;  2H88 C;  1ZLL A;  3SWY A;  2C0W A;  3L75 D;  3CCM P;  3BRT B;  1CSB A;  3P7K A;  1HWT C;  3RK3 B;  1EQ7 A;  3HTK A;  5CJ0 A;  1SQQ J;  2YMK A;  2O3J A;  2H8P D;  4IFM A;  1HGV A;  4H13 B;  4RKU J;  3O8Z A;  1OVR A;  3RBZ A;  1M1K Q;  3HTK B;  4RJT A;  2KSJ A;  4D6T D;  2LKM A;  1X0T A;  1ZW0 A;  1SQP E;  3VP8 A;  3L73 D;  4UB8 E;  5AW5 B;  1BSH A;  2ZT9 B;  1LTJ C;  1KIL C;  4U3F J;  4H0L B;  5TJH A;  3V4W A;  4YTP C;  5APU A;  5AW2 B;  1L0L K;  4NPE A;  4L74 A;  3NTN A;  2KB7 P;  1ZV8 A;  4EDF A;  4R4L A;  1P84 D;  2WPV B;  2ZAE B;  5C39 A;  3CCS P;  2CPB A;  2C0X A;  2YIU B;  2WPR A;  3A0H E;  4H44 C;  2IBZ G;  4GOE A;  5BU5 A;  1LGH B;  3E1I A;  2N1T A;  2JR8 A;  5AW7 B;  2MKV A;  5KKZ C;  1AQ5 A;  1GDT A;  1NU1 K;  3H1K E;  2KK7 A;  3C8V A;  1M1J C;  2Z5H A;  3A0B H;  3E1R A;  3AE2 C;  1SQP D;  3W68 A;  5AVZ B;  5CCG A;  2HFE D;  1XTG B;  5AVY B;  3QWO C;  1FDI A;  4HB1 A;  1NTK G;  3HE4 A;  3M9B A;  3G9R A;  5K5G B;  2IZ1 A;  1SQV E;  1PIX A;  1S4X A;  3HE4 B;  4YPC A;  2JWD A;  3A5T A;  1NTM K;  2WMM A;  2HOD A;  2W27 A;  1LT1 A;  1YI2 P;  3V6I A;  1NKN A;  3VYI A;  3S4R A;  2WSF H;  4OH8 B;  1IFP A;  4I1L A;  1UIX A;  3D71 A;  2HOD B;  1KFN A;  1KYO H;  1KQL A;  5KJ7 D;  1L0N G;  3H1K D;  4JYB A;  2D2C C;  1YIT P;  1EZV G;  4GOD A;  2ZVO B;  4IFF A;  2QRX A;  2K9J A;  1QLE D;  2B88 A;  1HJ0 A;  2QSI A;  3ZDM A;  1FAV A;  1M56 D;  4AUW A;  3H1L J;  3O6Q A;  1N7S D;  2K9J B;  2GM4 A;  1VF5 C;  1SFC C;  2FKW B;  3BAT A;  1SQV D;  3V5B A;  1FZC C;  3KPE A;  1N8R Q;  2AXT E;  3PHL A;  1OXZ A;  1X9V A;  4MN4 C;  2GUV A;  3I55 P;  1NTK J;  1OVV A;  1JUN A;  3O6Q B;  2E5Y A;  1VQ7 P;  2N9B A;  1R5S A;  2O1J A;  1KB9 H;  3RK2 C;  1UII A;  4LLH A;  1BDD A;  1J2J B;  1HJB A;  1AVO A;  1L0N E;  1KFM A;  3CX5 D;  1N73 A;  1JY2 P;  4IL6 E;  1TU3 F;  3CC4 P;  3D70 A;  1NH4 A;  2E74 B;  3HE5 A;  3JCU H;  2G8Y A;  1L0N J;  1RE3 C;  5B5E H;  4WWI A;  1YJW P;  1N73 B;  1GL2 D;  1BDC A;  1J1D B;  3IF4 A;  3HE5 B;  1JY3 P;  3E7K A;  5GTH E;  1L4A C;  2OTK E;  2Y0D A;  2KZI A;  1ZP0 C;  4OGQ D;  4Z1M H;  3L72 E;  1SQB K;  3AED C;  1OW6 A;  2J59 M;  2FYU G;  1PP9 G;  3TNU A;  4JQ0 D;  1VDF A;  1GMJ A;  1P84 H;  2NPS A;  2PP6 A;  1LTB C;  2A45 I;  2H89 C;  3GMA A;  3ITK A;  1IJD B;  3WU2 H;  1AFO A;  2YNY A;  4ASV A;  2PFX A;  2BEQ D;  1X79 B;  2NPS B;  3N4X A;  1OWA A;  2IFN A;  3L70 J;  1NU1 D;  2OYO A;  4PV1 D;  1FZF A;  3C9I A;  4ZNC A;  2W8Z A;  3HUS A;  1KTM A;  1YJ9 P;  3EFG A;  1ZR2 A;  3CWB E;  1SQX G;  5CCH A;  3L36 A;  3L74 G;  3H1J E;  1JCD A;  1SQQ K;  3HUS B;  1N86 A;  3L72 D;  5AW9 B;  1FZA A;  1VQ9 P;  2D2C D;  1R8E A;  1G1J A;  2HLO A;  1NOH A;  3PLN A;  2BAS A;  3K5B A;  4U7J A;  3GHG A;  1JMM A;  3RL0 C;  3HRN A;  3T97 A;  4EOT A;  1IK7 A;  3VMX A;  4WY4 D;  5AW0 B;  1OIP A;  1M90 Q;  2FYU J;  1PP9 J;  3GF7 A;  1RF1 A;  2WSF J;  2Q6Q A;  3AEC C;  3GHG B;  3A0H H;  4DCK A;  4WVZ A;  1DD4 A;  3TGU E;  5EFW B;  2BCC J;  3T97 B;  2JWA A;  4GKG A;  2QJP B;  2W83 C;  2ZXE B;  1RF1 B;  4N78 E;  3Q5R A;  2L5G B;  2ZFC A;  1DEE G;  2C9N Y;  3AE9 C;  3RK2 D;  4D6T G;  1SQX E;  3VMA A;  3EQ2 A;  3CWB D;  3OW2 O;  1YIJ P;  4XA4 A;  3R2P A;  3CCU P;  3C1L A;  1JY2 N;  3L73 G;  4Y99 B;  3KZI E;  3H1J D;  2G3A A;  3IFM A;  3H1I G;  1Q90 D;  1M7L A;  1GZL A;  1SQX J;  2JKV A;  4WB4 A;  4L73 A;  3L74 J;  1E79 H;  1XTC C;  2JO1 A;  1AV1 A;  3KYQ A;  3LIE A;  5KAF E;  1GU5 A;  2FY8 A;  1LWU A;  5E79 H;  1JY3 N;  1VQN P;  2YMY A;  3TGU D;  1IFJ A;  2QJY B;  5KAI E;  1LWU B;  3L75 J;  4I2L C;  1S5L X;  1URQ D;  1W5C E;  3CL3 D;  5AVR B;  3GF3 A;  3CX5 H;  1HTL C;  1LTS C;  1VQ4 P;  3A7O A;  2OGU A;  3L73 E;  1FJP A;  3RK3 C;  1VQK P;  1FDM A;  3H1I E;  2KUB A;  3U1A A;  2NZ2 A;  1PL5 A;  4D6T J;  2E43 A;  4H13 C;  1MFZ A;  2V7Q H;  3L73 J;  1PGJ A;  2WSE H;  4NPD A;  3TDK A;  2AXT H;  1IC2 A;  1H0T B;  3H32 A;  1MV8 A;  3B4S A;  3WU2 E;  1FZG A;  1T6A A;  1OW8 A;  4N6J A;  1FC2 C;  1K05 A;  1KC8 Q;  5KJ7 A;  2ZT9 C;  1NTZ K;  3V2Q A;  4H0L C;  2SPZ A;  3CX5 I;  3H32 B;  2E76 B;  4DJG A;  3IR9 A;  3CC2 P;  5AVU B;  1FU1 A;  1OVU A;  3EWK A;  3H1K G;  3PRJ A;  4IL6 H;  5AVS B;  1NTK K;  3GLM A;  5AW3 B;  2YIU C;  1N7S A;  1M8O B;  3H1I D;  2JP3 A;  3VMZ A;  1GW4 A;  1LT9 A;  2FFD A;  1LP1 A;  1K9M Q;  4YXW H;  1JEK A;  1N2D C;  1LTT C;  1N7S B;  2CK3 H;  1K8A Q;  3Q2Y A;  2Y9Y A;  1SQP J;  4DOJ A;  1LNQ A;  3AE8 C;  4K35 A;  1LT9 B;  5GTH H;  2FFD B;  1SQV G;  1LP1 B;  3CPW O;  2FXM A;  3HD7 D;  2FXO A;  3NMD A;  1U7J A;  3WUT A;  3P32 A;  5AW6 B;  2WSC H;  1L0N K;  2R32 A;  1HVV A;  1NAF A;  1S72 P;  2OYI A;  2E5T A;  5CCG C;  1AA0 A;  4HYT B;  5AW8 B;  1DD3 A;  2N1T B;  1MFT A;  5DJU B;  3B5N D;  3AEG C;  2PRR A;  1GL2 A;  1PPJ D;  1H88 A;  2OYI B;  2P58 A;  3UIA A;  3L37 A;  1SVF A;  2P1J A;  2AEF A;  1FDO A;  3PP5 A;  2K88 A;  3H1K J;  4TT3 H;  1GL2 B;  5CHX A;  3I56 P;  2UWJ E;  1S5L E;  2E75 C;  3S9O A;  3Q3D A;  2N9Y B;  1YTZ T;  1PZQ A;  2WVR A;  1JTH A;  2C9L Y;  1EDL A;  3FXE A;  1DH3 A;  5E79 E;  1X8Y A;  3PJS K;  2OYH A;  2KP8 A;  1VL2 A;  2QIW A;  4OGQ B;  2KS1 A;  1GU4 A;  1SQV J;  1Y47 A;  3VMY A;  1JTH B;  1K73 Q;  1VQ8 P;  3CCV P;  2OYH B;  3PTZ A;  1WT6 A;  1OX3 A;  2KS1 B;  3CX5 E;  3WUV A;  2YXR B;  2LXB A;  1KIL E;  3B8E B;  3G4S P;  5AW1 B;  4PD4 D;  3WUU A;  1T8Z A;  2H43 A;  3R4Y A;  3SWK A;  5GTI E;  2ZYA A;  2XU6 A;  2CPS A;  4PJ0 E;  3OJA B;  4XE5 B;  1USD A;  1K04 A;  4HKZ H;  4PV1 B;  3BVH A;  5APX A;  1NU1 G;  1LJ2 A;  3IAO A;  4C7N A;  4H0L D;  2FYU K;  2YKQ A;  2IZ0 A;  2V7Q J;  3RBX A;  1BE3 E;  3KHU A;  2E74 C;  2B87 A;  1EDI A;  3KZI H;  4RES B;  1JO5 A;  1S1C X;  1IFD A;  1RF0 C;  2Q5U A;  4WY4 A;  1N73 C;  4C7N B;  2D2C B;  3L72 G;  2WSE J;  1L0L E;  3H6P A;  4ZMD A;  2ZVN B;  3II6 A;  2XDJ A;  2B87 B;  1VQL P;  1CI6 A;  1J1E B;  2KLV A;  4WY4 B;  3TSI A;  1KIL D;  5KAF H;  1LTG C;  3G71 P;  4KT0 J;  1ZR4 A;  2JJL A;  2BEZ F;  5AVV B;  4Y28 J;  1CI6 B;  4TLF A;  1NTZ D;  1KQG B;  2A45 H;  3QH9 A;  2QVA A;  4HJG H;  5KAI H;  4EYY Q;  2P67 A;  1AVY A;  1NU1 E;  4H44 D;  5TIS H;  3L71 E;  2WWW A;  1ZN5 A;  1L2P A;  2FYZ A;  1S9K D;  1GK6 A;  4A7P A;  3TK1 A;  3F5H A;  3CWB G;  1BE3 D;  1NU1 J;  3KDP B;  2NPS C;  3H1J G;  2R5D A;  1RHZ B;  1OFC X;  1RQU A;  2J5U A;  2IDB A;  1L0L D;  5APQ A;  3NFQ A;  1QL2 A;  2IFM A;  1MZ9 A;  1QGK B;  1GW3 A;  2WSC J;  3N7N A;  1KZU B;  1PGP A;  5APT A;  2Q3I A;  3L72 J;  1IK9 A;  3TNU B;  1HUC A;  1URQ A;  1NTM E;  3CME P;  3G6E P;  2E75 D;  4LGD E;  4JF7 A;  1IFN A;  3TGU G;  3HUS C;  3V4Q A;  1T2K C;  5KLV K;  1DIP A;  2B9B A;  2W6B A;  2V4H A;  3A2A A;  4GT1 A;  5CCH C;  1W2E A;  1URQ B;  3CC7 P;  3L71 D;  4IFD K;  4ZKP A;  3Q1M A;  2J58 A;  2ZJS E;  1Q81 Q;  3CCR P;  3TYY A;  1OW7 A;  2Q7C A;  3GHG C;  5M1B A;  5APW A;  1YHQ P;  1LTA C;  3FWL A;  2QE7 H;  2Y0E A;  2YKO A;  1CZQ A;  1QEX A;  1NHL A;  1OZH A;  2QJP C;  4W7Y A;  1RF1 C;  1CW5 A;  5BVZ A;  3CWB J;  1VQ5 P;  2OAR A;  3VTP C;  4K3A A;  5APS A;  3H1J J;  1LTI C;  2ZYD A;  2KI7 B;  1NTM D;  2YKP A;  1VF5 D;  1SFC D;  4Y99 C;  2H7H A;  1FBM A;  3M91 A;  1Z56 A;  3S1K A;  1H89 A;  1IFM A;  2A06 E;  2A45 G;  2RN0 A;  1NKZ B;  1SQP K;  2XV5 A;  2WTY A;  3TGU J;  2K37 A;  4L75 A;  4PD4 H;  3AEB C;  3M0D A;  3CMA P;  1QVF O;  1RE4 C;  2WZ7 A;  2QJY C;  1BGY E;  2XKM A;  3SFD C;  4I7Z B;  1LWU C;  1KQS O;  3HD7 A;  2B89 A;  1S5L H;  1EXJ A;  3V2R A;  3BCC E;  4O9B A;  2M5A A;  1BCC D;  3HD7 B;  1NWQ A;  1Q2N A;  5AVW B;  2FYN B;  3CI9 A;  4GIF A;  3U59 A;  1SQB E;  3MZW B;  3B5N A;  4QMA A;  1JNM A;  1L4A D;  3VOP A;  2A06 D;  3SSU A;  2QJK B;  3AE5 C;  1KMI Z;  1YJN P;  1ZOY C;  4PD4 I;  1FJK A;  5TIS E;  3MUD A;  3B5N B;  3NXS A;  1KD1 Q;  1PPJ G;  1YTZ I;  2WPQ A;  2Q1K A;  1EDJ A;  3AE6 C;  2P7J A;  4I6M C;  1A02 J;  1SQV K;  1BGY D;  5GTI H;  3A3Y B;  3PH0 A;  4PJ0 H;  1YQ3 C;  2I1K A;  3USS A;  2E76 C;  3VP9 A;  2NRG A;  3BCC D;  1VQP P;  1S3J A;  5KJ7 C;  4GOF A;  2RMZ A;  2HPC A;  3FWN A;  3H1I J;  2Q3E A;  2KIK A;  4BXL A;  1MKM A;  2YXQ B;  4LC1 A;  2Z4E A;  1AQT A;  1VQO P;  1FOS E;  1FE6 A;  2O01 H;  1SQQ E;  2KXP B;  1SQB D;  1KV4 A;  3GW6 A;  3H1H D;  2HPC B;  1SS1 A;  4JYC A;  1JY2 O;  2I1J A;  3CXH I;  3CCJ P;  1HGZ A;  1W2B O;  2MJZ A;  2GUS A;  1N7S C;  5CJ4 A;  4R4M A;  3BAS A;  1Y9B A;  1LT9 C;  2FFD C;  2OTL P;  1PPJ E;  2Q9I A;  2M0B A;  1E5W A;  1R5L A;  2K9Y A;  3RL0 D;  1JY3 O;  5KLI B;  2L91 A;  4U3F E;  1BSN A;  2XZR A;  4OWF A;  5KLV D;  3SFE C;  1IFI A;  2XND H;  1Q7Y Q;  2N1T C;  2JDI H;  1MUU A;  1QX8 A;  2Y0C A;  2OYI C;  4OVN F;  3I5C A;  3TF5 A;  4EIJ A;  1S2E A;  2W90 A;  3B71 A;  1SQQ D;  3M06 A;  2R3C A;  3BRV B;  2R3S A;  3OAK A;  1LTJ A;  4WBA A;  1KIL A;  1GL2 C;  4IL6 X;  4CPG A;  3RK3 E;  3FX0 A;  1LTJ B;  1KIL B;  3LID A;  5CBO A;  1KOR A;  1USE A;  4PD4 E;  1EZV I;  3AEA C;  1FZE A;  1FZB A;  1PGO A;  1HBW A;  1AJY A;  4U3F D;  1VQM P;  4OGQ C;  1NTZ G;  3H1L G;  1QVG O;  3AE4 C;  2OYH C;  2KYV A;  4H44 B;  4DZO A;  4UB6 E;  1D7M A;  1M57 D;  5L8R J;  1M1J A;  5KKZ B;  1IO4 A;  3SWF A;  1BE3 G;  3D6Y A;  2AXC A;  1M1J B;  3P8C E;  4YXD C;  3CLQ A;  1L0L G;  2IBZ E;  4PV1 C;  3RK3 D;  3H25 A;  1N7L A;  3CXH E;  3OA7 A;  2P10 A;  4BRY A;  3P8M C;  1Q86 Q;  4H13 D;  3VN0 A;  3M0A A;  1RY3 A;  2E75 B;  2E76 D;  2POH A;  3G3Z A;  1NTZ E;  1KN7 A;  4BRY B;  3H1L E;  2ITA A;  3JSV C;  1GD2 E;  4AQR D;  2M3E A;  2R5B A;  1HF9 A;  5BU8 B;  2HR3 A;  5H2F H;  2IX7 C;  3L71 G;  1J1E C;  3MIW A;  2ZT9 D;  1S9K E;  3KXD A;  4WY4 C;  1NTZ J;  1NTK E;  3MHV A;  2LXC B;  3IN6 A;  3L4F A;  4N3Y B;  3AE1 C;  4IOI H;  5APY A;  1EXI A;  3U1C A;  1YBK A;  3P8C D;  5B66 H; 
#chains in the Genus database with same CATH homology
 5AW7 B;  1HTL C;  1H8A A;  1AQ5 A;  3LW5 H;  1J1D C;  1LTS C;  2YKO A;  1CZQ A;  3A7O A;  1NHL A;  1SFC A;  1GDT A;  1NU1 K;  4W7Y A;  1FZC A;  1RF1 C;  1CW5 A;  1FJP A;  3RK3 C;  5BVZ A;  1FDM A;  1M1J C;  2Z5H A;  2OAR A;  3U1A A;  1GTW A;  3VTP C;  1GK4 A;  2E43 A;  5APS A;  1MFZ A;  1SFC B;  2PAJ A;  1T3U A;  5AVZ B;  1LTI C;  5CCG A;  2N1T D;  1FZC B;  1RF0 A;  2HFE D;  2HYN A;  1XTG B;  5AVY B;  1SQX K;  2YKP A;  1SFC D;  4Y99 C;  2H7H A;  2WSE H;  1FBM A;  3M91 A;  3HE4 A;  1IC2 A;  1Z56 A;  3M9B A;  1H89 A;  1IFM A;  3H32 A;  1MV8 A;  3RK2 B;  2A45 G;  5AVT B;  1NKZ B;  1JOC A;  1FZG A;  4N6J A;  2Z5I A;  3MTU E;  2M3B A;  2VRS A;  5KJ7 A;  1NO4 A;  1SQP K;  1NTZ K;  2W6A A;  2XV5 A;  2WTY A;  3V2Q A;  3HE4 B;  5CCG D;  1PFI A;  3A5T A;  3H32 B;  4C46 A;  1NTM K;  1RE3 A;  2HOD A;  2W27 A;  1SLQ A;  3IR9 A;  5AVU B;  1FU1 A;  3KQG A;  3M0D A;  1NKN A;  3VYI A;  1RE4 C;  2WZ7 A;  4C7R A;  1URQ C;  2WSF H;  2YO3 A;  4OH8 B;  5AVX B;  4I1L A;  2XKM A;  5AVS B;  1NTK K;  1KFN A;  2HOD B;  2M8R A;  4M3L A;  5AW3 B;  1KQL A;  5KJ7 D;  1LWU C;  1N7S A;  3V2N A;  3HD7 A;  1L4A A;  4JYB A;  3VMZ A;  5CMZ A;  1GW4 A;  3V2R A;  1LT9 A;  2FFD A;  4IFF A;  1N2D C;  4O9B A;  1LTT C;  1WRG A;  1N7S B;  3HD7 B;  5AW4 B;  1NWQ A;  1L4A B;  5AVW B;  4DOJ A;  1FAV A;  3CI9 A;  4AUW A;  4GIF A;  1LT9 B;  1G2C A;  2FFD B;  3U59 A;  1N7S D;  2FXM A;  3B5N A;  3HD7 D;  1JNM A;  2GM4 A;  1L4A D;  3VOP A;  1SFC C;  2FKW B;  3BAT A;  3NMD A;  4KHX A;  3P32 A;  5APV A;  5AW6 B;  3V5B A;  2WSC H;  1FZC C;  1L0N K;  2R32 A;  3KPE A;  1HVV A;  1FJK A;  1NAF A;  1G2C B;  1OXZ A;  1X9V A;  2GUV A;  3MUD A;  3MD0 A;  1JUN A;  3B5N B;  2OYI A;  4HH2 A;  3NXS A;  2N9B A;  2O1J A;  2WPS A;  1YTZ I;  2WPQ A;  5CCG C;  3RK2 C;  4LLH A;  4HYT B;  5AW8 B;  2N1T B;  1DX7 A;  3B5N D;  2E42 A;  2P7J A;  4I6M C;  1GL2 A;  1J2J B;  1H88 A;  1HJB A;  1SQV K;  2OYI B;  1A02 J;  3UIA A;  3A3Y B;  3L37 A;  1KFM A;  1SVF A;  2I1K A;  2P1J A;  3PP5 A;  3VP9 A;  1N73 A;  1JY2 P;  5KJ7 C;  1GL2 B;  2HPC A;  5CHX A;  1NH4 A;  3HE5 A;  4LC1 A;  2Z4E A;  3M9Q A;  1RE3 C;  1FOS E;  1N73 B;  1YTZ T;  2IPP A;  1GL2 D;  3M0D C;  2O01 H;  1JTH A;  2C9L Y;  2HPC B;  2HG5 D;  1DH3 A;  4JYC A;  4ZKU A;  1J1D B;  1JY2 O;  2I1J A;  1X8Y A;  3HE5 B;  2OYH A;  1QL1 A;  1HGZ A;  2MJZ A;  1JY3 P;  2GUS A;  2KP8 A;  2YO2 A;  1N7S C;  5CJ4 A;  3HD7 C;  1L4A C;  1GU4 A;  3BAS A;  3VMY A;  1JTH B;  1LT9 C;  2FFD C;  3RL0 B;  2OYH B;  2Q9I A;  1WT6 A;  1E5W A;  2P2U A;  1SQB K;  4W80 A;  2J59 M;  1A02 F;  3WMM 0;  1VPC A;  1DEB A;  1JY3 O;  3RL0 D;  4B86 A;  3B8E B;  3TNU A;  5AW1 B;  2XZR A;  1HH0 A;  3B5N C;  1T8Z A;  2H43 A;  1VDF A;  3V2P A;  1IFI A;  1YYC A;  2NPS A;  2PP6 A;  4W7Z A;  1LTB C;  2A45 I;  2N1T C;  1RE4 A;  2XU6 A;  2CPS A;  1IJD B;  1MUU A;  1AFO A;  3OJA B;  4XE5 B;  2YNY A;  2OYI C;  3BVH A;  5KTB A;  1X79 B;  5APX A;  2NPS B;  3I5C A;  3N4X A;  1OWA A;  4EIJ A;  1T3J A;  2QM7 A;  3M9H A;  1JCC A;  3M06 A;  2IFN A;  3BRV B;  2R3C A;  4C7N A;  2FYU K;  3OAK A;  1LTJ A;  2YKQ A;  1KIL A;  4WBA A;  1GL2 C;  2NPS D;  2JEE A;  1FZF A;  3C9I A;  3HUS A;  1FOS F;  4RES B;  1JO5 A;  1G1I A;  1IFD A;  1RF0 C;  2Q5U A;  4N78 D;  3EFG A;  1ZR2 A;  4WY4 A;  2WIT A;  1N73 C;  4C7N B;  5CCH A;  1LTJ B;  1KIL B;  3LID A;  3L36 A;  3H6P A;  3II6 A;  1SP4 A;  1JCD A;  1SQQ K;  2QM8 A;  2XDJ A;  3HUS B;  1FZE A;  1N86 A;  1FZB A;  3MGN A;  5AW9 B;  1HBW A;  1FZA A;  1CI6 A;  1J1E B;  2KLV A;  1G1J A;  5AVQ B;  2HLO A;  4WY4 B;  3TSI A;  1KIL D;  1NOH A;  2WT7 A;  2BAS A;  4AYC A;  1LTG C;  3GHG A;  1JMM A;  3L35 A;  1ZR4 A;  3RL0 C;  2JJL A;  3HRN A;  2OYH C;  3T97 A;  4EOT A;  5AVV B;  3VMX A;  1T2K D;  4WY4 D;  1CI6 B;  2KYV A;  2KOG A;  5AW0 B;  2XNX A;  4DZO A;  5CCH D;  2A45 H;  1RF1 A;  2WT7 B;  3GHG B;  2P67 A;  2O1K A;  1M1J A;  1IO4 A;  1ZLL A;  3SWY A;  2C0W A;  2WWW A;  3SWF A;  3BRT B;  4GKG A;  1ZN5 A;  1CSB A;  2FYZ A;  3P7K A;  1S9K D;  1HWT C;  1GK6 A;  2ZXE B;  1RF1 B;  3RK3 B;  3TK1 A;  4N78 E;  1EQ7 A;  3HTK A;  2L5G B;  2ZFC A;  1M1J B;  5CJ0 A;  2C9N Y;  3P8C E;  2H8P D;  4IFM A;  3CLQ A;  1HGV A;  3RK2 D;  3KDP B;  3RK3 D;  2NPS C;  1N7L A;  3O8Z A;  2R5D A;  3EQ2 A;  3OA7 A;  3P8M C;  4XA4 A;  3HTK B;  3R2P A;  5APQ A;  2KSJ A;  3NFQ A;  1JY2 N;  4Y99 B;  3VN0 A;  3M0A A;  1QL2 A;  1RY3 A;  2IFM A;  2LKM A;  1MZ9 A;  3IFM A;  2POH A;  1GW3 A;  3G3Z A;  3N7N A;  1M7L A;  3VP8 A;  1KZU B;  1GZL A;  5APT A;  2Q3I A;  5AW5 B;  1IK9 A;  4WB4 A;  3TNU B;  1GD2 E;  4AQR D;  1HUC A;  1XTC C;  1LTJ C;  1URQ A;  1KIL C;  2R5B A;  3V4W A;  3KYQ A;  3LIE A;  4LGD E;  5APU A;  5AW2 B;  4JF7 A;  5BU8 B;  1IFN A;  1GU5 A;  1L0L K;  3HUS C;  3V4Q A;  3NTN A;  1LWU A;  2IX7 C;  1J1E C;  2KB7 P;  1JY3 N;  3MIW A;  1S9K E;  1T2K C;  1ZV8 A;  4WY4 C;  5KLV K;  2YMY A;  2W6B A;  3A2A A;  4GT1 A;  5CCH C;  1W2E A;  1URQ B;  1IFJ A;  3L4F A;  4IFD K;  4N3Y B;  4ZKP A;  2CPB A;  2C0X A;  2J58 A;  1LWU B;  2WPR A;  4I2L C;  5APY A;  5BU5 A;  3U1C A;  1URQ D;  3TYY A;  3CL3 D;  1LGH B;  3GHG C;  3E1I A;  3P8C D;  2N1T A;  5APW A;  2Q7C A;  5AVR B;  1LTA C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...