1DEBA

Crystal structure of the n-terminal coiled coil domain from apc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
b'AAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSI'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOMATOUS POLYPOSIS COLI PROTEIN
publication title Crystal structure of the amino-terminal coiled-coil domain of the APC tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16689 APC_N_CC Coiled-coil N-terminus of APC, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1debA00
1DEBA 1MZ9A 3V2QA 3V2PA 1FBMA 3V2NA 1VDFA 3V2RA
chains in the Genus database with same CATH superfamily
2KNCA 5KKZC 1JMBA 3F89A 3M9QA 1JY3O 1JOCA 3R2PA 1JUNA 1NU1J 2RN0A 2I1KA 1MZ9A 1VQ9P 1RF0C 1K8AQ 2H89C 3CCLP 4H0LB 2ZYDA 3KQGA 3BCCD 4DJGA 3RBXA 1SQVG 1EXJA 3L73G 1H89A 1NTZK 1EXIA 3SWFA 2B89A 1NH4A 5AW1B 1RE3C 1NTME 3IR9A 2NRGA 1M57D 1BGYD 5APTA 2G8YA 2HODB 1Q86Q 1CW5A 4UB6H 1BGYG 2CPSA 1VF5B 2ZVOB 1H8AA 2QSIA 3D6YA 2FBWC 2QJKB 2WSEJ 2A45I 1PGPA 2IYPA 3I5CA 1OVVA 3BATA 4UB8H 1G1IA 4I2LC 4HH2A 5KLVG 4U3FD 4JQ0D 2YO2A 4AUWA 3L72D 3NMDA 1SQQE 3KDPB 3L72G 2D2CC 3MTUE 2O3JA 1KQSO 4NPEA 2MJZA 2N1TC 1CI6A 3VMAA 1LT9A 1KILB 2Y0CA 3MUDC 3CCRP 1FS0E 2FYUD 4O9BA 4PD4H 2Q5UA 5B5EH 1VQLP 3KXDA 1OVUA 2JEEA 2A06E 3G3ZA 3L36A 1CSBA 1W5CE 3VTPC 1GTWA 2A45G 5CCHD 2PAJA 3H1JE 5AW2B 1IFJA 1VL2A 2NPSC 1EZVE 2E5YA 1DD3A 4BRYB 3WMM0 1RE4A 1SQVJ 1L4AA 2J58A 1R8EA 1N8RQ 3L73J 1LNQA 4Y28J 1H0TA 3AE9C 4WY4A 1M1KQ 2OYHC 1EDLA 1OWAA 1RF1B 2KLUA 4OGQB 4DOJA 1EDKA 3V2RA 1BGYJ 2FYUK 3SWYA 2WTYA 2IBZI 1AJYA 1PGQA 2FXPA 5AW5B 4PD4I 1VQNP 1P84E 2NZ2A 3VMZA 1E5WA 1VQ8P 1PP9E 1FZCA 3B71A 1R5SA 2JDIH 5KLVJ 1JEKA 2ZXEB 4PV1C 1BE3D 1URQA 3L72J 5KLIC 2FFDC 4ZKUA 1R5LA 3CCMP 1GK6A 3CX5H 3N7NA 2C0WA 1VQMP 2P58A 2P10A 3LW5H 3C1LA 4JYCA 2Q9IA 4EI2A 3MZWB 3TYYA 2RH0A 1OIPA 5B66H 1PV3A 2GA1A 5CCGA 1GMJA 3M9HA 1JY3P 3JSVC 3EQ2A 3BRTB 1USDA 3HD7C 1L0LE 3D70A 3VOPA 3RL0B 2M5AA 1HH0A 4PD4D 5CMZA 1S5LE 1JNMA 1SQPD 4R4LA 1GL2B 1SQPG 4C7RA 1SFCC 2QEXP 2E75D 1G1JA 1PL5A 3Q5PA 4LGDE 4A7PA 2KSJA 1LWUC 3M91A 3HRNA 5APQA 3PTZA 2H7HA 2BCCD 2LKMA 2BCCG 3CX5I 2V7QH 1LTAC 3M06A 3CWBE 4I1LA 3AE4C 3D6ZA 2JR8A 3AE1C 1BSHA 1KQGB 2QJPB 1LTJA 3H1HE 1S3JA 3B5NC 3L74E 3GF3A 2ZT9B 1SQPK 3AE3C 2WWWA 1JMMA 4H13D 4GODA 1S72P 2XNXA 2QG4A 2IZ1A 1G2CA 2LXCB 2QVAA 2ZJSE 5CHXA 1KN7A 3CXHH 3RK2B 1USEA 3USSA 2KZJA 2HODA 1N7SB 1IZNB 3H1IE 4I7ZC 1KB9E 3KYQA 1GU5A 4GOEA 3CD6P 3T97A 3BVHA 3L70D 2QE7H 1SQPJ 3RK3C 4ASWA 5AVWB 1SP4A 2AXTH 4ZNCA 1ZLLA 1JO5A 1SQXD 1SQXG 1X22A 5E79H 3HUSC 1OW6A 3S4RA 3AEGC 3SWKA 1BSNA 2RMZA 2R3SA 2BCCJ 3H1KE 1NO4A 5K5GB 2W83C 4WY4D 3WU2H 1CZQA 2LR2A 1M1JA 3M9BA 1YYCA 5KKZB 1YI2P 4Y99B 1FDMA 1QVGO 5CBNA 4UB6E 1YJNP 2O1JA 3ZDMA 2OTJP 2Q3IA 3RL0g 1YTZI 2XZRA 5KAFH 5CBOA 1SQXK 3CL3D 4IFDK 3PHLA 3TGUD 1SQBD 5AW3B 1NYHA 4BRYA 2WITA 2HYNA 3TGUG 1SQBG 2IFMA 2JP3A 1L2PA 2M0BA 1QL1A 1X79B 4H44D 1EZVG 5APXA 1NGMB 3A0BH 1RF1A 1JM0A 4L74A 4PJ0H 4XA4A 3LW5J 2IBZE 5CCGD 1OX3A 4D6TE 3RK3E 1QLED 5AVSB 3L75D 2K9JA 2KLVA 1GD2E 5AVZB 1JY2N 2KOGA 1LT9C 3KPEA 3L75G 2E76D 5GTHE 4K35A 3AE5C 4CPGA 1OZHA 3HE4A 1FU1A 2QM7A 2D2CB 1SQXJ 3I56P 1D7MA 2N1TB 5APUA 1FOSE 1SQBK 1NHLA 2FYNC 3IAOA 3P8CE 2M3BA 5AW9B 4M3LA 4KJMA 4YTPC 5AVTB 2P2UA 5AVQB 1FJKA 1YTZT 1RE4C 2E74D 1OVRA 2A45H 1L4AC 3A2AA 4JBZA 4RKUJ 3AE2C 4C7NB 1Y9BA 3C9IA 1T2KD 1BCCE 1GW4A 3U59A 1GW3A 4QMAA 1AVOA 2NPSB 2YKOA 1HVVA 3KZIE 2WT7A 4Z1MH 1GL2A 1DD4A 4GOFA 2KK7A 1DX7A 3D71A 1YBKA 3TDKA 1SQVD 5M1BA 2OYHB 3L73D 3TGUJ 3UIAA 1U7JA 1SQBJ 1K73Q 1LP1B 2WQYC 4H0LD 3NTNA 4HJGH 1LTGC 1J1EC 3P8MC 2YNYA 3VP8A 2W27A 3OW2O 2IPPA 4L73A 1KC8Q 4BWNA 2XDJA 2YXRB 3CX5E 1URQC 2AXCA 3KHUA 2FXMA 1KTMA 2WPVB 4GDOA 2E43A 2C0XA 2Y0DA 4TLFA 2ZVNB 1EDJA 1VF5D 3L75J 3VMXA 2XKMA 4PV1B 2MKVA 5APSA 5KLVD 3CWBG 3I55P 4N3YB 2QM8A 4XE5B 2FFDB 5APYA 2OGUA 1PFIA 3CCSP 2WSFJ 2R44A 1SQVK 4ASVA 1NTKE 1A02F 2K1AA 2OYOA 4B86A 1KZUB 2CK3H 3RGUA 1LGHB 3SSUA 3HD7B 1JTHB 3HE5A 1KILD 2XU6A 2YIUC 1S1CX 1NU1E 1N7SA 1SFCB 2P67A 4OVNF 1KYOH 3HTKB 2E5TA 2Y9ZA 5KLVK 1X9VA 1IK7A 1N7LA 3G9RA 2GM4A 1L0ND 5KAIH 1LWUB 5CJ4A 1Q82Q 1L0NG 4JF7A 3H1IG 3BRVB 3CCQP 3AEEC 1LTJC 2B87B 4NPDA 3AEDC 1FJPA 2KUBA 2P7JA 3FWLA 5KJ7A 3GHGA 1TU3F 3Q5RA 3OA7A 2I1JA 2KP8A 1S4XA 1W2EA 2N9BA 3EFGA 3B5NB 4OGQD 3CXHE 3H1KG 2WSCH 3CWBJ 1OMIA 1VPCA 2POHA 2O1KA 1JCDA 3L71D 5APVA 1KYOI 4DT0A 1VF5C 2WSSH 1FE6A 1N73A 3L71G 1L0NK 5H2FH 4C46A 1S9KD 2AXTE 2R5BA 1NTZE 5DJTB 4N78E 2CPBA 5TISE 4ZMDA 5E79E 1IFIA 1DH3A 1U57A 1Y8AA 3FXDA 4YPCA 2M8RA 2IDBA 3OJAB 1IC2A 4I7ZB 1IO4A 2KYVA 2OYIA 2HPCB 3RK3B 2W6AA 1K04A 1ZV8A 2IFNA 2DW3A 1M1JC 3RL0D 1GDTA 1ZXGA 1PIXA 3HUSB 3E1RA 3H1LD 1T3UA 1QL2A 3BCCE 1PZQA 1L0NJ 1KYOD 2IZ0A 3H1IJ 3H1LG 1GL2D 2R3CA 5CCHC 3LIEA 3L73E 1ZR4A 5AW6B 5KAFE 3JCUH 1T6AA 5EFWB 1PPJD 2KZIA 1NAYA 1PPJG 1VDFA 1BGYE 1Q7YQ 3S1KA 2L5GB 3H6PA 2B88A 4KT0J 4HKZH 4EDFA 4C7NA 3CMAP 3H1KJ 2K9YA 5L8RJ 1RQUA 3CI9A 4PJ0E 1GU4A 3C8VA 4U3FE 3CC4P 2M3EA 1T8ZA 2O01N 1E79H 3L72E 3L71J 4HB1A 2ZT9D 1FZFA 1Q81Q 4NPFX 3Q3DA 1J1DC 1GK4A 1YJ9P 3V2PA 3NXSA 2FYUE 2J59M 5AVXB 3F5HA 5AW4B 2KXPB 2PRRA 2Q3EA 2K3RA 2RKLA 1PGOA 5APWA 3EFFK 1NTMD 4DZOA 3RK2D 4YXWH 1NTMG 2WSFH 4DCKA 2N9YB 1N7SD 1P84H 3W68A 1JY2O 2ITAA 1OXZA 1MKMA 2BEQD 5C39A 2WPRA 3A0HH 2HR3A 1KD1Q 2O01J 3CCJP 3H1LJ 5AW8B 3U1AA 2FYNB 3TNUB 2JO1A 1YHQP 1UIXA 4EYYQ 2E75C 3M0DA 4LLHA 1QVFO 1EZVI 2WPSA 1L4AB 5KJ7D 3QWOC 1SQQD 1KILA 5BU8B 1SQQG 1S2EA 3AEAC 3AE7C 2ZFCA 1JTHA 1Q90D 2ZAEB 2YKPA 1NTMK 1KQFB 1NVOA 3H25A 1MUUA 2L91A 1FZEA 1N86A 3Q1MA 2JWAA 1BE3E 4UB8E 1P84I 2A06D 2WSCJ 2PGDA 4IL6X 1J1EB 1EC5A 2A06G 3TSIA 1LWUA 1MFTA 3FGAD 1DIPA 1M90Q 1JB0J 1VQ4P 1AQTA 1URQB 3H1JD 2GUSA 4H13C 3H1JG 1EZVD 4OWFA 1N2DC 5CJ0A 1LT1A 1SQQK 3OAKA 3PLNA 4TT3H 1IFMA 4KHXA 1NTMJ 4PD4E 3GMAA 3E7KA 5B5EE 1SQPE 1VQPP 3MGNA 1FOSF 2Q6QA 3M0AA 4MN4C 1KORA 3MHVA 4XFJA 4WVZA 1P84D 2Z5HA 1NKZB 1PP9D 1BDCA 2HG5D 2AEMA 4I6MC 1AQ5A 2D2CD 3L35A 1PP9G 1IJDB 1VQKP 1AV1A 2BCCE 1H88A 2OQQA 5AW0B 2N1TD 1LJ2A 3E1IA 1DEEG 2YIUB 2YMYA 1SQQJ 1M7LA 1QX8A 1WT6A 2QA4P 4N6JA 1NTZG 4ZKPA 1Z56A 4WY4C 3B4SA 1J2JB 1KQLA 3GHGC 4IOIH 2YKQA 2HPCA 1KB9H 2W6BA 4IFFA 1A02J 3B8EB 3CCUP 1JCCA 3ITKA 2IYOA 3ABVC 4BXLA 2ZYAA 1LTJB 3CMEP 3RBZA 3CC7P 2NPSD 4W7ZA 3JC22 1L0LG 4AQRD 1ZRTD 2GUVA 3HUSA 4Y99C 1BDDA 1XTCC 1FZCC 2UWJE 2JKVA 3IF4A 3CC2P 1X0TA 3H1JJ 3GW6A 1ZP0C 1QEXA 2KIKA 5H2FE 4JPZB 3CLQA 3CCEP 2XNDH 3H32B 1N73C 1HJBA 3BCCG 1G2CB 1ZW0A 4OH8B 3GF7A 2C9NY 3IFMA 2FXOA 1MV8A 1FZGA 4H44C 1OW8A 5B66E 1JY2P 3PP5A 3V4QA 2QRXA 2IX7C 3CWBD 3L70E 5CCGC 3EWKA 3W67A 3IN6A 5KLIB 1Q2NA 1X8YA 2JWDA 3Q2YA 2WMMA 2KI7B 1KB9I 3T97B 1SQXE 4PV1D 1L0LK 1GZLA 2E76C 2OYIC 3K5BA 3H1HD 1DEBA 2K88A 3P32A 2WVRA 3H1HG 3L74D 1PP9J 4GT1A 1SVFA 3L74G 4U3FG 3V5BA 2QJYC 1YQ3C 3L4FA 4EOTA 1IFNA 1M8OB 3WUVA 4LC1A 3JCUE 3SFDC 1VQ5P 1NTZJ 3A5TA 2BASA 3HD7D 1M56D 2O01H 2E74C 2YMKA 1M1JB 3CPWO 3O6QB 2FYUG 5GTHH 1JY3N 5GTIH 1UIIA 1T2KC 1SFCD 3H1ID 1IK9A 1L0LJ 1KB9D 3AEBC 2E42A 3TGUE 1SQBE 4WB4A 3L37A 3TNUA 3BASA 3AEFC 1SLQA 1HJ0A 3PH0A 1S5LX 1EDIA 2FKWB 3BCCJ 1ZMEC 4H0LC 1OW7A 3GG2A 1FZAA 1WRGA 4IL6H 3H1KD 1VQ7P 2Y0EA 3L75E 1AFOA 1RF0A 3V6IA 1NJIQ 3B5ND 2OTKE 3FWNA 1NKNA 1KFMA 2FY8A 5AVVB 2PP6A 2K9JB 3VP9A 3QH9A 3KZIH 3AECC 2H8PD 3A7OA 1AA0A 1J1DB 3A3YB 3H1HJ 2QJKC 3HE4B 1T3JA 3L74J 1FDOA 3A0HE 1RE3A 2R32A 4U3FJ 4IFMA 1HGZA 2R5DA 1EQ7A 2JJLA 1BE3G 4K3AA 2PFXA 1PGJA 3V2NA 3WU2E 2QIWA 3M0DC 3NFQA 2V4HA 2FYZA 2KS1B 1ZR2A 1FC2C 4WBAA 1HBWA 2FYUJ 1KILC 2YXQB 2IBZD 2KNCB 4D6TD 3RK3D 2HFED 2IBZG 4YXDC 4D6TG 1LTSC 1SQVE 1ZRTE 2E75B 1RH5B 1SS1A 1AVYA 2H88C 1LTBC 1HUCA 2WT7B 2N1TA 3MUDA 2W8ZA 3V4WA 3MP7B 1FZBA 2W90A 4RESB 4RJTA 2KSEA 1FDIA 3P8CD 5BVZA 4HYTB 3R4YA 2WZ7A 3A0BE 1IFPA 4L75A 1HWTC 1YIJP 5KLVE 2BEZF 4GKGA 1RF1C 4OGQC 2NPSA 3CCVP 3U1CA 1BCCD 1VQ6P 1KFNA 2AEJA 1BCCG 4H13B 2OARA 1MFZA 5KTBA 5AVRB 3S9OA 2OYHA 1RHZB 1LP1A 2OTLP 4JYBA 1BE3J 3PRJA 5AVYB 2Z5IA 3MD0A 2H43A 1XTGB 3H32A 1CI6B 1FBMA 1KILE 2K37A 1LT9B 2LXBA 2Y9YA 3VYIA 2WSEH 3CX5D 2ZXXA 2G3AA 3HE5B 1Y47A 1OFCX 3G4SP 4D6TJ 1L0NE 2FFDA 4GIFA 4L76A 3WUUA 1HTLC 4WWIA 1W2BO 2J5UA 3L70G 3RL0C 1RY3A 3P7KA 1GL2C 2Q1KA 5TISH 1H0TB 2ZYGA 1WMKA 4WY4B 1NTKD 1NTKG 3GHGB 5AVUB 1L4AD 3HD7A 2B9BA 3Q5SA 2Q7CA 5DJUB 1RQVA 1YITP 1HF9A 4AYCA 1U7MA 3G71P 1SFCA 1NWQA 1S5LH 3HTKA 3CXHI 3O6QA 3L71E 3TK1A 1NOHA 1FZCB 3II6A 1NU1D 3O8ZA 1BCCJ 5CCHA 1K05A 1LTTC 1NU1G 3GLMA 1S9KE 1LTIC 1NAFA 2QJPC 4U7JA 1YQ4C 3TF5A 1FAVA 1ZOYC 2B87A 1N73B 1KV4A 1K9MQ 4W80A 2ZT9C 2I8DA 2Z4EA 3V2QA 3MIWA 1VQOP 1URQD 5BU5A 4H44B 5TJHA 1NTKK 2KB7P 3VMYA 3AE6C 3SFEC 3B5NA 3FXEA 2HLOA 4EIJA 2OYIB 2E76B 3G6EP 2M5AB 3RK2C 2C9LY 3CXHD 1HGVA 3H1LE 2AEFA 4RO0A 1KYOE 1NU1K 4R4MA 1N7SC 2YO3A 5GTIE 3L70J 2QJYB 5KAIE 2WPQA 3AE8C 2VRSA 1PPJE 2XV5A 2W6JH 1KMIZ 2P1JA 2SPZA 1NTZD 1NTKJ 2E74B 4N78D 5KJ7C 3VN0A 1ZN5A 1QGKB 3PJSK 2KS1A 4IL6E 1IFDA 3FX0A 3WUTA 3N4XA 5AW7B 1YJWP 2V7QJ 1L0LD 3LIDA 4W7YA
chains in the Genus database with same CATH topology
1M1JA 3L37A 3TNUA 3M9BA 1YYCA 3M9QA 1JY3O 1JOCA 3R2PA 1JUNA 3BASA 1VDFA 4Y99B 2I1KA 1MZ9A 1SLQA 2L5GB 3H6PA 1FDMA 1RF0C 2FKWB 2O1JA 4C7NA 3KQGA 2Q3IA 3CI9A 1YTZI 2XZRA 1FZAA 1WRGA 1GU4A 1AFOA 1SQXK 1H89A 1NTZK 3CL3D 4IFDK 3SWFA 1RF0A 5AW3B 1NH4A 5AW1B 1T8ZA 2WITA 1RE3C 2HYNA 3B5ND 2IFMA 3IR9A 1NKNA 1FZFA 1KFMA 5AVVB 2PP6A 5APTA 3VP9A 2HODB 1CW5A 2H8PD 2CPSA 1QL1A 1X79B 3A7OA 1J1DC 1J1DB 1GK4A 1H8AA 5APXA 3A3YB 3HE4B 1RF1A 1T3JA 2A45I 4XA4A 3V2PA 3I5CA 5CCGD 3BATA 3NXSA 1RE3A 2J59M 5AVXB 2R32A 4IFMA 1HGZA 1G1IA 5AVSB 5AW4B 4I2LC 2R5DA 2KLVA 4HH2A 1GD2E 1EQ7A 2JJLA 1JY2N 5AVZB 2KOGA 2YO2A 1LT9C 3KPEA 5APWA 4AUWA 4DZOA 3RK2D 3V2NA 3NMDA 3HE4A 3KDPB 2WSFH 1FU1A 2QM7A 3M0DC 3MTUE 3NFQA 1N7SD 2FYZA 1JY2O 1ZR2A 4WBAA 2MJZA 2N1TC 2N1TB 1OXZA 5APUA 1CI6A 1HBWA 2WPRA 1FOSE 1SQBK 1NHLA 1KILC 1LT9A 1KILB 5AW8B 3U1AA 3TNUB 3RK3D 2HFED 3P8CE 4O9BA 2M3BA 5AW9B 4M3LA 1LTSC 5AVTB 2Q5UA 2P2UA 3M0DA 5AVQB 1FJKA 1YTZT 4LLHA 1RE4C 2JEEA 1LTBC 1HUCA 2A45H 1L4AC 2WPSA 3A2AA 3G3ZA 1L4AB 3L36A 2WT7B 2N1TA 1CSBA 5KJ7D 4C7NB 3VTPC 1GTWA 1KILA 5BU8B 3C9IA 3MUDA 2A45G 1T2KD 5CCHD 3V4WA 2PAJA 5AW2B 1GW4A 3U59A 1GW3A 1IFJA 2ZFCA 1JTHA 2NPSC 1FZBA 2NPSB 2YKOA 2YKPA 1HVVA 1NTMK 3WMM0 1RE4A 4RESB 1MUUA 2WT7A 3P8CD 1L4AA 2J58A 5BVZA 1GL2A 4HYTB 1DX7A 2WZ7A 1FZEA 1N86A 4WY4A 1HWTC 2OYHC 2OYHB 3UIAA 1OWAA 3NTNA 1RF1C 1LTGC 4GKGA 1RF1B 1J1EC 3P8MC 2YNYA 1J1EB 2NPSA 3VP8A 2W27A 4DOJA 2IPPA 3TSIA 3V2RA 1LWUA 3U1CA 2FYUK 3SWYA 2WTYA 1KFNA 2XDJA 1URQC 1URQB 2FXMA 2GUSA 2OARA 1MFZA 5KTBA 5AW5B 5AVRB 3VMZA 2OYHA 1N2DC 5CJ0A 1E5WA 1SQQK 1FZCA 2E43A 2C0XA 3OAKA 4JYBA 3VMXA 2ZXEB 2XKMA 2Z5IA 5AVYB 1IFMA 3MD0A 2H43A 5APSA 4KHXA 1URQA 1XTGB 3H32A 2QM8A 4N3YB 1CI6B 1FBMA 2FFDC 4XE5B 2FFDB 5APYA 1LT9B 4ZKUA 1GK6A 1PFIA 3MGNA 3N7NA 1FOSF 2C0WA 3VYIA 2WSEH 3M0AA 3HE5B 3LW5H 1SQVK 4JYCA 2Q9IA 1A02F 3TYYA 2Z5HA 1NKZB 5CCGA 4B86A 1KZUB 2HG5D 4I6MC 1AQ5A 3M9HA 2FFDA 3L35A 1JY3P 4GIFA 1LGHB 1IJDB 3EQ2A 3BRTB 1H88A 1HTLC 3HD7C 3HD7B 5AW0B 1JTHB 2N1TD 3HE5A 3RL0C 3VOPA 3RL0B 1HH0A 1KILD 2XU6A 3E1IA 5CMZA 2YMYA 1RY3A 3P7KA 1JNMA 1M7LA 1WT6A 1GL2C 1N7SA 1GL2B 4N6JA 4C7RA 1SFCC 4ZKPA 1SFCB 1Z56A 1G1JA 2P67A 4WY4C 3HTKB 4WY4B 1J2JB 5KLVK 1KQLA 3GHGC 3GHGB 2YKQA 1L4AD 1X9VA 3HD7A 5AVUB 4LGDE 1N7LA 2HPCA 2Q7CA 2GM4A 2W6BA 2KSJA 4IFFA 1LWUC 1LWUB 3M91A 3HRNA 1A02J 5CJ4A 5APQA 2H7HA 4JF7A 2LKMA 3B8EB 3BRVB 1JCCA 4AYCA 1LTJC 1LTJB 1SFCA 2NPSD 1NWQA 4W7ZA 1FJPA 1LTAC 3M06A 4AQRD 2P7JA 2GUVA 3HTKA 3HUSA 4Y99C 1XTCC 5KJ7A 4I1LA 3TK1A 3GHGA 1FZCC 1NOHA 1FZCB 3II6A 3O8ZA 5CCHA 3OA7A 1LTTC 2I1JA 2KP8A 1S9KE 1LTIC 1NAFA 1W2EA 3CLQA 1FAVA 1LTJA 3H32B 2N9BA 1N73C 1N73B 3EFGA 3B5NC 1HJBA 1G2CB 3B5NB 4OH8B 4W80A 2Z4EA 3V2QA 1SQPK 2C9NY 3IFMA 3MIWA 2WSCH 1MV8A 1URQD 2WWWA 1FZGA 5BU5A 1JMMA 1JY2P 1VPCA 1NTKK 3PP5A 3V4QA 2KB7P 2POHA 2O1KA 3VMYA 2IX7C 2XNXA 1JCDA 5APVA 5CCGC 1N73A 1L0NK 1G2CA 3B5NA 1X8YA 2HLOA 4C46A 1S9KD 4EIJA 2R5BA 5CHXA 1L0LK 1GZLA 2OYIC 2OYIB 4N78E 1DEBA 3RK2C 2C9LY 3P32A 2CPBA 3RK2B 1HGVA 4GT1A 1IFIA 1SVFA 1DH3A 2HODA 1NU1K 1N7SC 2YO3A 1N7SB 2M8RA 3OJAB 1IC2A 3V5BA 1IO4A 3KYQA 1GU5A 3L4FA 4EOTA 3T97A 3BVHA 2WPQA 1IFNA 2VRSA 2XV5A 4LC1A 2KYVA 2OYIA 2HPCB 2P1JA 3RK3C 3RK3B 5AVWB 1SP4A 1ZLLA 2W6AA 3A5TA 1JO5A 1ZV8A 2BASA 3HD7D 2IFNA 2O01H 1M1JC 3RL0D 1M1JB 4N78D 1GDTA 3HUSC 3HUSB 5KJ7C 1T3UA 1QL2A 3VN0A 1GL2D 1JY3N 1ZN5A 1T2KC 2R3CA 5CCHC 3LIEA 1NO4A 1ZR4A 1SFCD 5AW6B 1IK9A 4WY4D 1IFDA 1CZQA 3N4XA 2E42A 5AW7B 3LIDA 4W7YA 4WB4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEB A;  1MZ9 A;  3V2Q A;  3V2P A;  1FBM A;  3V2N A;  1VDF A;  3V2R A; 
#chains in the Genus database with same CATH topology
 2KNC A;  5KKZ C;  1JMB A;  3F89 A;  3M9Q A;  1JY3 O;  1JOC A;  3R2P A;  1JUN A;  1NU1 J;  2RN0 A;  2I1K A;  1MZ9 A;  1VQ9 P;  1RF0 C;  1K8A Q;  2H89 C;  3CCL P;  4H0L B;  2ZYD A;  3KQG A;  3BCC D;  4DJG A;  3RBX A;  1SQV G;  1EXJ A;  3L73 G;  1H89 A;  1NTZ K;  1EXI A;  3SWF A;  2B89 A;  1NH4 A;  5AW1 B;  1RE3 C;  1NTM E;  3IR9 A;  2NRG A;  1M57 D;  1BGY D;  5APT A;  2G8Y A;  2HOD B;  1Q86 Q;  1CW5 A;  4UB6 H;  1BGY G;  2CPS A;  1VF5 B;  2ZVO B;  1H8A A;  2QSI A;  3D6Y A;  2FBW C;  2QJK B;  2WSE J;  2A45 I;  1PGP A;  2IYP A;  3I5C A;  1OVV A;  3BAT A;  4UB8 H;  1G1I A;  4I2L C;  4HH2 A;  5KLV G;  4U3F D;  4JQ0 D;  2YO2 A;  4AUW A;  3L72 D;  3NMD A;  1SQQ E;  3KDP B;  3L72 G;  2D2C C;  3MTU E;  2O3J A;  1KQS O;  4NPE A;  2MJZ A;  2N1T C;  1CI6 A;  3VMA A;  1LT9 A;  1KIL B;  2Y0C A;  3MUD C;  3CCR P;  1FS0 E;  2FYU D;  4O9B A;  4PD4 H;  2Q5U A;  5B5E H;  1VQL P;  3KXD A;  1OVU A;  2JEE A;  2A06 E;  3G3Z A;  3L36 A;  1CSB A;  1W5C E;  3VTP C;  1GTW A;  2A45 G;  5CCH D;  2PAJ A;  3H1J E;  5AW2 B;  1IFJ A;  1VL2 A;  2NPS C;  1EZV E;  2E5Y A;  1DD3 A;  4BRY B;  3WMM 0;  1RE4 A;  1SQV J;  1L4A A;  2J58 A;  1R8E A;  1N8R Q;  3L73 J;  1LNQ A;  4Y28 J;  1H0T A;  3AE9 C;  4WY4 A;  1M1K Q;  2OYH C;  1EDL A;  1OWA A;  1RF1 B;  2KLU A;  4OGQ B;  4DOJ A;  1EDK A;  3V2R A;  1BGY J;  2FYU K;  3SWY A;  2WTY A;  2IBZ I;  1AJY A;  1PGQ A;  2FXP A;  5AW5 B;  4PD4 I;  1VQN P;  1P84 E;  2NZ2 A;  3VMZ A;  1E5W A;  1VQ8 P;  1PP9 E;  1FZC A;  3B71 A;  1R5S A;  2JDI H;  5KLV J;  1JEK A;  2ZXE B;  4PV1 C;  1BE3 D;  1URQ A;  3L72 J;  5KLI C;  2FFD C;  4ZKU A;  1R5L A;  3CCM P;  1GK6 A;  3CX5 H;  3N7N A;  2C0W A;  1VQM P;  2P58 A;  2P10 A;  3LW5 H;  3C1L A;  4JYC A;  2Q9I A;  4EI2 A;  3MZW B;  3TYY A;  2RH0 A;  1OIP A;  5B66 H;  1PV3 A;  2GA1 A;  5CCG A;  1GMJ A;  3M9H A;  1JY3 P;  3JSV C;  3EQ2 A;  3BRT B;  1USD A;  3HD7 C;  1L0L E;  3D70 A;  3VOP A;  3RL0 B;  2M5A A;  1HH0 A;  4PD4 D;  5CMZ A;  1S5L E;  1JNM A;  1SQP D;  4R4L A;  1GL2 B;  1SQP G;  4C7R A;  1SFC C;  2QEX P;  2E75 D;  1G1J A;  1PL5 A;  3Q5P A;  4LGD E;  4A7P A;  2KSJ A;  1LWU C;  3M91 A;  3HRN A;  5APQ A;  3PTZ A;  2H7H A;  2BCC D;  2LKM A;  2BCC G;  3CX5 I;  2V7Q H;  1LTA C;  3M06 A;  3CWB E;  4I1L A;  3AE4 C;  3D6Z A;  2JR8 A;  3AE1 C;  1BSH A;  1KQG B;  2QJP B;  1LTJ A;  3H1H E;  1S3J A;  3B5N C;  3L74 E;  3GF3 A;  2ZT9 B;  1SQP K;  3AE3 C;  2WWW A;  1JMM A;  4H13 D;  4GOD A;  1S72 P;  2XNX A;  2QG4 A;  2IZ1 A;  1G2C A;  2LXC B;  2QVA A;  2ZJS E;  5CHX A;  1KN7 A;  3CXH H;  3RK2 B;  1USE A;  3USS A;  2KZJ A;  2HOD A;  1N7S B;  1IZN B;  3H1I E;  4I7Z C;  1KB9 E;  3KYQ A;  1GU5 A;  4GOE A;  3CD6 P;  3T97 A;  3BVH A;  3L70 D;  2QE7 H;  1SQP J;  3RK3 C;  4ASW A;  5AVW B;  1SP4 A;  2AXT H;  4ZNC A;  1ZLL A;  1JO5 A;  1SQX D;  1SQX G;  1X22 A;  5E79 H;  3HUS C;  1OW6 A;  3S4R A;  3AEG C;  3SWK A;  1BSN A;  2RMZ A;  2R3S A;  2BCC J;  3H1K E;  1NO4 A;  5K5G B;  2W83 C;  4WY4 D;  3WU2 H;  1CZQ A;  2LR2 A;  1M1J A;  3M9B A;  1YYC A;  5KKZ B;  1YI2 P;  4Y99 B;  1FDM A;  1QVG O;  5CBN A;  4UB6 E;  1YJN P;  2O1J A;  3ZDM A;  2OTJ P;  2Q3I A;  3RL0 g;  1YTZ I;  2XZR A;  5KAF H;  5CBO A;  1SQX K;  3CL3 D;  4IFD K;  3PHL A;  3TGU D;  1SQB D;  5AW3 B;  1NYH A;  4BRY A;  2WIT A;  2HYN A;  3TGU G;  1SQB G;  2IFM A;  2JP3 A;  1L2P A;  2M0B A;  1QL1 A;  1X79 B;  4H44 D;  1EZV G;  5APX A;  1NGM B;  3A0B H;  1RF1 A;  1JM0 A;  4L74 A;  4PJ0 H;  4XA4 A;  3LW5 J;  2IBZ E;  5CCG D;  1OX3 A;  4D6T E;  3RK3 E;  1QLE D;  5AVS B;  3L75 D;  2K9J A;  2KLV A;  1GD2 E;  5AVZ B;  1JY2 N;  2KOG A;  1LT9 C;  3KPE A;  3L75 G;  2E76 D;  5GTH E;  4K35 A;  3AE5 C;  4CPG A;  1OZH A;  3HE4 A;  1FU1 A;  2QM7 A;  2D2C B;  1SQX J;  3I56 P;  1D7M A;  2N1T B;  5APU A;  1FOS E;  1SQB K;  1NHL A;  2FYN C;  3IAO A;  3P8C E;  2M3B A;  5AW9 B;  4M3L A;  4KJM A;  4YTP C;  5AVT B;  2P2U A;  5AVQ B;  1FJK A;  1YTZ T;  1RE4 C;  2E74 D;  1OVR A;  2A45 H;  1L4A C;  3A2A A;  4JBZ A;  4RKU J;  3AE2 C;  4C7N B;  1Y9B A;  3C9I A;  1T2K D;  1BCC E;  1GW4 A;  3U59 A;  1GW3 A;  4QMA A;  1AVO A;  2NPS B;  2YKO A;  1HVV A;  3KZI E;  2WT7 A;  4Z1M H;  1GL2 A;  1DD4 A;  4GOF A;  2KK7 A;  1DX7 A;  3D71 A;  1YBK A;  3TDK A;  1SQV D;  5M1B A;  2OYH B;  3L73 D;  3TGU J;  3UIA A;  1U7J A;  1SQB J;  1K73 Q;  1LP1 B;  2WQY C;  4H0L D;  3NTN A;  4HJG H;  1LTG C;  1J1E C;  3P8M C;  2YNY A;  3VP8 A;  2W27 A;  3OW2 O;  2IPP A;  4L73 A;  1KC8 Q;  4BWN A;  2XDJ A;  2YXR B;  3CX5 E;  1URQ C;  2AXC A;  3KHU A;  2FXM A;  1KTM A;  2WPV B;  4GDO A;  2E43 A;  2C0X A;  2Y0D A;  4TLF A;  2ZVN B;  1EDJ A;  1VF5 D;  3L75 J;  3VMX A;  2XKM A;  4PV1 B;  2MKV A;  5APS A;  5KLV D;  3CWB G;  3I55 P;  4N3Y B;  2QM8 A;  4XE5 B;  2FFD B;  5APY A;  2OGU A;  1PFI A;  3CCS P;  2WSF J;  2R44 A;  1SQV K;  4ASV A;  1NTK E;  1A02 F;  2K1A A;  2OYO A;  4B86 A;  1KZU B;  2CK3 H;  3RGU A;  1LGH B;  3SSU A;  3HD7 B;  1JTH B;  3HE5 A;  1KIL D;  2XU6 A;  2YIU C;  1S1C X;  1NU1 E;  1N7S A;  1SFC B;  2P67 A;  4OVN F;  1KYO H;  3HTK B;  2E5T A;  2Y9Z A;  5KLV K;  1X9V A;  1IK7 A;  1N7L A;  3G9R A;  2GM4 A;  1L0N D;  5KAI H;  1LWU B;  5CJ4 A;  1Q82 Q;  1L0N G;  4JF7 A;  3H1I G;  3BRV B;  3CCQ P;  3AEE C;  1LTJ C;  2B87 B;  4NPD A;  3AED C;  1FJP A;  2KUB A;  2P7J A;  3FWL A;  5KJ7 A;  3GHG A;  1TU3 F;  3Q5R A;  3OA7 A;  2I1J A;  2KP8 A;  1S4X A;  1W2E A;  2N9B A;  3EFG A;  3B5N B;  4OGQ D;  3CXH E;  3H1K G;  2WSC H;  3CWB J;  1OMI A;  1VPC A;  2POH A;  2O1K A;  1JCD A;  3L71 D;  5APV A;  1KYO I;  4DT0 A;  1VF5 C;  2WSS H;  1FE6 A;  1N73 A;  3L71 G;  1L0N K;  5H2F H;  4C46 A;  1S9K D;  2AXT E;  2R5B A;  1NTZ E;  5DJT B;  4N78 E;  2CPB A;  5TIS E;  4ZMD A;  5E79 E;  1IFI A;  1DH3 A;  1U57 A;  1Y8A A;  3FXD A;  4YPC A;  2M8R A;  2IDB A;  3OJA B;  1IC2 A;  4I7Z B;  1IO4 A;  2KYV A;  2OYI A;  2HPC B;  3RK3 B;  2W6A A;  1K04 A;  1ZV8 A;  2IFN A;  2DW3 A;  1M1J C;  3RL0 D;  1GDT A;  1ZXG A;  1PIX A;  3HUS B;  3E1R A;  3H1L D;  1T3U A;  1QL2 A;  3BCC E;  1PZQ A;  1L0N J;  1KYO D;  2IZ0 A;  3H1I J;  3H1L G;  1GL2 D;  2R3C A;  5CCH C;  3LIE A;  3L73 E;  1ZR4 A;  5AW6 B;  5KAF E;  3JCU H;  1T6A A;  5EFW B;  1PPJ D;  2KZI A;  1NAY A;  1PPJ G;  1VDF A;  1BGY E;  1Q7Y Q;  3S1K A;  2L5G B;  3H6P A;  2B88 A;  4KT0 J;  4HKZ H;  4EDF A;  4C7N A;  3CMA P;  3H1K J;  2K9Y A;  5L8R J;  1RQU A;  3CI9 A;  4PJ0 E;  1GU4 A;  3C8V A;  4U3F E;  3CC4 P;  2M3E A;  1T8Z A;  2O01 N;  1E79 H;  3L72 E;  3L71 J;  4HB1 A;  2ZT9 D;  1FZF A;  1Q81 Q;  4NPF X;  3Q3D A;  1J1D C;  1GK4 A;  1YJ9 P;  3V2P A;  3NXS A;  2FYU E;  2J59 M;  5AVX B;  3F5H A;  5AW4 B;  2KXP B;  2PRR A;  2Q3E A;  2K3R A;  2RKL A;  1PGO A;  5APW A;  3EFF K;  1NTM D;  4DZO A;  3RK2 D;  4YXW H;  1NTM G;  2WSF H;  4DCK A;  2N9Y B;  1N7S D;  1P84 H;  3W68 A;  1JY2 O;  2ITA A;  1OXZ A;  1MKM A;  2BEQ D;  5C39 A;  2WPR A;  3A0H H;  2HR3 A;  1KD1 Q;  2O01 J;  3CCJ P;  3H1L J;  5AW8 B;  3U1A A;  2FYN B;  3TNU B;  2JO1 A;  1YHQ P;  1UIX A;  4EYY Q;  2E75 C;  3M0D A;  4LLH A;  1QVF O;  1EZV I;  2WPS A;  1L4A B;  5KJ7 D;  3QWO C;  1SQQ D;  1KIL A;  5BU8 B;  1SQQ G;  1S2E A;  3AEA C;  3AE7 C;  2ZFC A;  1JTH A;  1Q90 D;  2ZAE B;  2YKP A;  1NTM K;  1KQF B;  1NVO A;  3H25 A;  1MUU A;  2L91 A;  1FZE A;  1N86 A;  3Q1M A;  2JWA A;  1BE3 E;  4UB8 E;  1P84 I;  2A06 D;  2WSC J;  2PGD A;  4IL6 X;  1J1E B;  1EC5 A;  2A06 G;  3TSI A;  1LWU A;  1MFT A;  3FGA D;  1DIP A;  1M90 Q;  1JB0 J;  1VQ4 P;  1AQT A;  1URQ B;  3H1J D;  2GUS A;  4H13 C;  3H1J G;  1EZV D;  4OWF A;  1N2D C;  5CJ0 A;  1LT1 A;  1SQQ K;  3OAK A;  3PLN A;  4TT3 H;  1IFM A;  4KHX A;  1NTM J;  4PD4 E;  3GMA A;  3E7K A;  5B5E E;  1SQP E;  1VQP P;  3MGN A;  1FOS F;  2Q6Q A;  3M0A A;  4MN4 C;  1KOR A;  3MHV A;  4XFJ A;  4WVZ A;  1P84 D;  2Z5H A;  1NKZ B;  1PP9 D;  1BDC A;  2HG5 D;  2AEM A;  4I6M C;  1AQ5 A;  2D2C D;  3L35 A;  1PP9 G;  1IJD B;  1VQK P;  1AV1 A;  2BCC E;  1H88 A;  2OQQ A;  5AW0 B;  2N1T D;  1LJ2 A;  3E1I A;  1DEE G;  2YIU B;  2YMY A;  1SQQ J;  1M7L A;  1QX8 A;  1WT6 A;  2QA4 P;  4N6J A;  1NTZ G;  4ZKP A;  1Z56 A;  4WY4 C;  3B4S A;  1J2J B;  1KQL A;  3GHG C;  4IOI H;  2YKQ A;  2HPC A;  1KB9 H;  2W6B A;  4IFF A;  1A02 J;  3B8E B;  3CCU P;  1JCC A;  3ITK A;  2IYO A;  3ABV C;  4BXL A;  2ZYA A;  1LTJ B;  3CME P;  3RBZ A;  3CC7 P;  2NPS D;  4W7Z A;  3JC2 2;  1L0L G;  4AQR D;  1ZRT D;  2GUV A;  3HUS A;  4Y99 C;  1BDD A;  1XTC C;  1FZC C;  2UWJ E;  2JKV A;  3IF4 A;  3CC2 P;  1X0T A;  3H1J J;  3GW6 A;  1ZP0 C;  1QEX A;  2KIK A;  5H2F E;  4JPZ B;  3CLQ A;  3CCE P;  2XND H;  3H32 B;  1N73 C;  1HJB A;  3BCC G;  1G2C B;  1ZW0 A;  4OH8 B;  3GF7 A;  2C9N Y;  3IFM A;  2FXO A;  1MV8 A;  1FZG A;  4H44 C;  1OW8 A;  5B66 E;  1JY2 P;  3PP5 A;  3V4Q A;  2QRX A;  2IX7 C;  3CWB D;  3L70 E;  5CCG C;  3EWK A;  3W67 A;  3IN6 A;  5KLI B;  1Q2N A;  1X8Y A;  2JWD A;  3Q2Y A;  2WMM A;  2KI7 B;  1KB9 I;  3T97 B;  1SQX E;  4PV1 D;  1L0L K;  1GZL A;  2E76 C;  2OYI C;  3K5B A;  3H1H D;  1DEB A;  2K88 A;  3P32 A;  2WVR A;  3H1H G;  3L74 D;  1PP9 J;  4GT1 A;  1SVF A;  3L74 G;  4U3F G;  3V5B A;  2QJY C;  1YQ3 C;  3L4F A;  4EOT A;  1IFN A;  1M8O B;  3WUV A;  4LC1 A;  3JCU E;  3SFD C;  1VQ5 P;  1NTZ J;  3A5T A;  2BAS A;  3HD7 D;  1M56 D;  2O01 H;  2E74 C;  2YMK A;  1M1J B;  3CPW O;  3O6Q B;  2FYU G;  5GTH H;  1JY3 N;  5GTI H;  1UII A;  1T2K C;  1SFC D;  3H1I D;  1IK9 A;  1L0L J;  1KB9 D;  3AEB C;  2E42 A;  3TGU E;  1SQB E;  4WB4 A;  3L37 A;  3TNU A;  3BAS A;  3AEF C;  1SLQ A;  1HJ0 A;  3PH0 A;  1S5L X;  1EDI A;  2FKW B;  3BCC J;  1ZME C;  4H0L C;  1OW7 A;  3GG2 A;  1FZA A;  1WRG A;  4IL6 H;  3H1K D;  1VQ7 P;  2Y0E A;  3L75 E;  1AFO A;  1RF0 A;  3V6I A;  1NJI Q;  3B5N D;  2OTK E;  3FWN A;  1NKN A;  1KFM A;  2FY8 A;  5AVV B;  2PP6 A;  2K9J B;  3VP9 A;  3QH9 A;  3KZI H;  3AEC C;  2H8P D;  3A7O A;  1AA0 A;  1J1D B;  3A3Y B;  3H1H J;  2QJK C;  3HE4 B;  1T3J A;  3L74 J;  1FDO A;  3A0H E;  1RE3 A;  2R32 A;  4U3F J;  4IFM A;  1HGZ A;  2R5D A;  1EQ7 A;  2JJL A;  1BE3 G;  4K3A A;  2PFX A;  1PGJ A;  3V2N A;  3WU2 E;  2QIW A;  3M0D C;  3NFQ A;  2V4H A;  2FYZ A;  2KS1 B;  1ZR2 A;  1FC2 C;  4WBA A;  1HBW A;  2FYU J;  1KIL C;  2YXQ B;  2IBZ D;  2KNC B;  4D6T D;  3RK3 D;  2HFE D;  2IBZ G;  4YXD C;  4D6T G;  1LTS C;  1SQV E;  1ZRT E;  2E75 B;  1RH5 B;  1SS1 A;  1AVY A;  2H88 C;  1LTB C;  1HUC A;  2WT7 B;  2N1T A;  3MUD A;  2W8Z A;  3V4W A;  3MP7 B;  1FZB A;  2W90 A;  4RES B;  4RJT A;  2KSE A;  1FDI A;  3P8C D;  5BVZ A;  4HYT B;  3R4Y A;  2WZ7 A;  3A0B E;  1IFP A;  4L75 A;  1HWT C;  1YIJ P;  5KLV E;  2BEZ F;  4GKG A;  1RF1 C;  4OGQ C;  2NPS A;  3CCV P;  3U1C A;  1BCC D;  1VQ6 P;  1KFN A;  2AEJ A;  1BCC G;  4H13 B;  2OAR A;  1MFZ A;  5KTB A;  5AVR B;  3S9O A;  2OYH A;  1RHZ B;  1LP1 A;  2OTL P;  4JYB A;  1BE3 J;  3PRJ A;  5AVY B;  2Z5I A;  3MD0 A;  2H43 A;  1XTG B;  3H32 A;  1CI6 B;  1FBM A;  1KIL E;  2K37 A;  1LT9 B;  2LXB A;  2Y9Y A;  3VYI A;  2WSE H;  3CX5 D;  2ZXX A;  2G3A A;  3HE5 B;  1Y47 A;  1OFC X;  3G4S P;  4D6T J;  1L0N E;  2FFD A;  4GIF A;  4L76 A;  3WUU A;  1HTL C;  4WWI A;  1W2B O;  2J5U A;  3L70 G;  3RL0 C;  1RY3 A;  3P7K A;  1GL2 C;  2Q1K A;  5TIS H;  1H0T B;  2ZYG A;  1WMK A;  4WY4 B;  1NTK D;  1NTK G;  3GHG B;  5AVU B;  1L4A D;  3HD7 A;  2B9B A;  3Q5S A;  2Q7C A;  5DJU B;  1RQV A;  1YIT P;  1HF9 A;  4AYC A;  1U7M A;  3G71 P;  1SFC A;  1NWQ A;  1S5L H;  3HTK A;  3CXH I;  3O6Q A;  3L71 E;  3TK1 A;  1NOH A;  1FZC B;  3II6 A;  1NU1 D;  3O8Z A;  1BCC J;  5CCH A;  1K05 A;  1LTT C;  1NU1 G;  3GLM A;  1S9K E;  1LTI C;  1NAF A;  2QJP C;  4U7J A;  1YQ4 C;  3TF5 A;  1FAV A;  1ZOY C;  2B87 A;  1N73 B;  1KV4 A;  1K9M Q;  4W80 A;  2ZT9 C;  2I8D A;  2Z4E A;  3V2Q A;  3MIW A;  1VQO P;  1URQ D;  5BU5 A;  4H44 B;  5TJH A;  1NTK K;  2KB7 P;  3VMY A;  3AE6 C;  3SFE C;  3B5N A;  3FXE A;  2HLO A;  4EIJ A;  2OYI B;  2E76 B;  3G6E P;  2M5A B;  3RK2 C;  2C9L Y;  3CXH D;  1HGV A;  3H1L E;  2AEF A;  4RO0 A;  1KYO E;  1NU1 K;  4R4M A;  1N7S C;  2YO3 A;  5GTI E;  3L70 J;  2QJY B;  5KAI E;  2WPQ A;  3AE8 C;  2VRS A;  1PPJ E;  2XV5 A;  2W6J H;  1KMI Z;  2P1J A;  2SPZ A;  1NTZ D;  1NTK J;  2E74 B;  4N78 D;  5KJ7 C;  3VN0 A;  1ZN5 A;  1QGK B;  3PJS K;  2KS1 A;  4IL6 E;  1IFD A;  3FX0 A;  3WUT A;  3N4X A;  5AW7 B;  1YJW P;  2V7Q J;  1L0L D;  3LID A;  4W7Y A; 
#chains in the Genus database with same CATH homology
 1M1J A;  3L37 A;  3TNU A;  3M9B A;  1YYC A;  3M9Q A;  1JY3 O;  1JOC A;  3R2P A;  1JUN A;  3BAS A;  1VDF A;  4Y99 B;  2I1K A;  1MZ9 A;  1SLQ A;  2L5G B;  3H6P A;  1FDM A;  1RF0 C;  2FKW B;  2O1J A;  4C7N A;  3KQG A;  2Q3I A;  3CI9 A;  1YTZ I;  2XZR A;  1FZA A;  1WRG A;  1GU4 A;  1AFO A;  1SQX K;  1H89 A;  1NTZ K;  3CL3 D;  4IFD K;  3SWF A;  1RF0 A;  5AW3 B;  1NH4 A;  5AW1 B;  1T8Z A;  2WIT A;  1RE3 C;  2HYN A;  3B5N D;  2IFM A;  3IR9 A;  1NKN A;  1FZF A;  1KFM A;  5AVV B;  2PP6 A;  5APT A;  3VP9 A;  2HOD B;  1CW5 A;  2H8P D;  2CPS A;  1QL1 A;  1X79 B;  3A7O A;  1J1D C;  1J1D B;  1GK4 A;  1H8A A;  5APX A;  3A3Y B;  3HE4 B;  1RF1 A;  1T3J A;  2A45 I;  4XA4 A;  3V2P A;  3I5C A;  5CCG D;  3BAT A;  3NXS A;  1RE3 A;  2J59 M;  5AVX B;  2R32 A;  4IFM A;  1HGZ A;  1G1I A;  5AVS B;  5AW4 B;  4I2L C;  2R5D A;  2KLV A;  4HH2 A;  1GD2 E;  1EQ7 A;  2JJL A;  1JY2 N;  5AVZ B;  2KOG A;  2YO2 A;  1LT9 C;  3KPE A;  5APW A;  4AUW A;  4DZO A;  3RK2 D;  3V2N A;  3NMD A;  3HE4 A;  3KDP B;  2WSF H;  1FU1 A;  2QM7 A;  3M0D C;  3MTU E;  3NFQ A;  1N7S D;  2FYZ A;  1JY2 O;  1ZR2 A;  4WBA A;  2MJZ A;  2N1T C;  2N1T B;  1OXZ A;  5APU A;  1CI6 A;  1HBW A;  2WPR A;  1FOS E;  1SQB K;  1NHL A;  1KIL C;  1LT9 A;  1KIL B;  5AW8 B;  3U1A A;  3TNU B;  3RK3 D;  2HFE D;  3P8C E;  4O9B A;  2M3B A;  5AW9 B;  4M3L A;  1LTS C;  5AVT B;  2Q5U A;  2P2U A;  3M0D A;  5AVQ B;  1FJK A;  1YTZ T;  4LLH A;  1RE4 C;  2JEE A;  1LTB C;  1HUC A;  2A45 H;  1L4A C;  2WPS A;  3A2A A;  3G3Z A;  1L4A B;  3L36 A;  2WT7 B;  2N1T A;  1CSB A;  5KJ7 D;  4C7N B;  3VTP C;  1GTW A;  1KIL A;  5BU8 B;  3C9I A;  3MUD A;  2A45 G;  1T2K D;  5CCH D;  3V4W A;  2PAJ A;  5AW2 B;  1GW4 A;  3U59 A;  1GW3 A;  1IFJ A;  2ZFC A;  1JTH A;  2NPS C;  1FZB A;  2NPS B;  2YKO A;  2YKP A;  1HVV A;  1NTM K;  3WMM 0;  1RE4 A;  4RES B;  1MUU A;  2WT7 A;  3P8C D;  1L4A A;  2J58 A;  5BVZ A;  1GL2 A;  4HYT B;  1DX7 A;  2WZ7 A;  1FZE A;  1N86 A;  4WY4 A;  1HWT C;  2OYH C;  2OYH B;  3UIA A;  1OWA A;  3NTN A;  1RF1 C;  1LTG C;  4GKG A;  1RF1 B;  1J1E C;  3P8M C;  2YNY A;  1J1E B;  2NPS A;  3VP8 A;  2W27 A;  4DOJ A;  2IPP A;  3TSI A;  3V2R A;  1LWU A;  3U1C A;  2FYU K;  3SWY A;  2WTY A;  1KFN A;  2XDJ A;  1URQ C;  1URQ B;  2FXM A;  2GUS A;  2OAR A;  1MFZ A;  5KTB A;  5AW5 B;  5AVR B;  3VMZ A;  2OYH A;  1N2D C;  5CJ0 A;  1E5W A;  1SQQ K;  1FZC A;  2E43 A;  2C0X A;  3OAK A;  4JYB A;  3VMX A;  2ZXE B;  2XKM A;  2Z5I A;  5AVY B;  1IFM A;  3MD0 A;  2H43 A;  5APS A;  4KHX A;  1URQ A;  1XTG B;  3H32 A;  2QM8 A;  4N3Y B;  1CI6 B;  1FBM A;  2FFD C;  4XE5 B;  2FFD B;  5APY A;  1LT9 B;  4ZKU A;  1GK6 A;  1PFI A;  3MGN A;  3N7N A;  1FOS F;  2C0W A;  3VYI A;  2WSE H;  3M0A A;  3HE5 B;  3LW5 H;  1SQV K;  4JYC A;  2Q9I A;  1A02 F;  3TYY A;  2Z5H A;  1NKZ B;  5CCG A;  4B86 A;  1KZU B;  2HG5 D;  4I6M C;  1AQ5 A;  3M9H A;  2FFD A;  3L35 A;  1JY3 P;  4GIF A;  1LGH B;  1IJD B;  3EQ2 A;  3BRT B;  1H88 A;  1HTL C;  3HD7 C;  3HD7 B;  5AW0 B;  1JTH B;  2N1T D;  3HE5 A;  3RL0 C;  3VOP A;  3RL0 B;  1HH0 A;  1KIL D;  2XU6 A;  3E1I A;  5CMZ A;  2YMY A;  1RY3 A;  3P7K A;  1JNM A;  1M7L A;  1WT6 A;  1GL2 C;  1N7S A;  1GL2 B;  4N6J A;  4C7R A;  1SFC C;  4ZKP A;  1SFC B;  1Z56 A;  1G1J A;  2P67 A;  4WY4 C;  3HTK B;  4WY4 B;  1J2J B;  5KLV K;  1KQL A;  3GHG C;  3GHG B;  2YKQ A;  1L4A D;  1X9V A;  3HD7 A;  5AVU B;  4LGD E;  1N7L A;  2HPC A;  2Q7C A;  2GM4 A;  2W6B A;  2KSJ A;  4IFF A;  1LWU C;  1LWU B;  3M91 A;  3HRN A;  1A02 J;  5CJ4 A;  5APQ A;  2H7H A;  4JF7 A;  2LKM A;  3B8E B;  3BRV B;  1JCC A;  4AYC A;  1LTJ C;  1LTJ B;  1SFC A;  2NPS D;  1NWQ A;  4W7Z A;  1FJP A;  1LTA C;  3M06 A;  4AQR D;  2P7J A;  2GUV A;  3HTK A;  3HUS A;  4Y99 C;  1XTC C;  5KJ7 A;  4I1L A;  3TK1 A;  3GHG A;  1FZC C;  1NOH A;  1FZC B;  3II6 A;  3O8Z A;  5CCH A;  3OA7 A;  1LTT C;  2I1J A;  2KP8 A;  1S9K E;  1LTI C;  1NAF A;  1W2E A;  3CLQ A;  1FAV A;  1LTJ A;  3H32 B;  2N9B A;  1N73 C;  1N73 B;  3EFG A;  3B5N C;  1HJB A;  1G2C B;  3B5N B;  4OH8 B;  4W80 A;  2Z4E A;  3V2Q A;  1SQP K;  2C9N Y;  3IFM A;  3MIW A;  2WSC H;  1MV8 A;  1URQ D;  2WWW A;  1FZG A;  5BU5 A;  1JMM A;  1JY2 P;  1VPC A;  1NTK K;  3PP5 A;  3V4Q A;  2KB7 P;  2POH A;  2O1K A;  3VMY A;  2IX7 C;  2XNX A;  1JCD A;  5APV A;  5CCG C;  1N73 A;  1L0N K;  1G2C A;  3B5N A;  1X8Y A;  2HLO A;  4C46 A;  1S9K D;  4EIJ A;  2R5B A;  5CHX A;  1L0L K;  1GZL A;  2OYI C;  2OYI B;  4N78 E;  1DEB A;  3RK2 C;  2C9L Y;  3P32 A;  2CPB A;  3RK2 B;  1HGV A;  4GT1 A;  1IFI A;  1SVF A;  1DH3 A;  2HOD A;  1NU1 K;  1N7S C;  2YO3 A;  1N7S B;  2M8R A;  3OJA B;  1IC2 A;  3V5B A;  1IO4 A;  3KYQ A;  1GU5 A;  3L4F A;  4EOT A;  3T97 A;  3BVH A;  2WPQ A;  1IFN A;  2VRS A;  2XV5 A;  4LC1 A;  2KYV A;  2OYI A;  2HPC B;  2P1J A;  3RK3 C;  3RK3 B;  5AVW B;  1SP4 A;  1ZLL A;  2W6A A;  3A5T A;  1JO5 A;  1ZV8 A;  2BAS A;  3HD7 D;  2IFN A;  2O01 H;  1M1J C;  3RL0 D;  1M1J B;  4N78 D;  1GDT A;  3HUS C;  3HUS B;  5KJ7 C;  1T3U A;  1QL2 A;  3VN0 A;  1GL2 D;  1JY3 N;  1ZN5 A;  1T2K C;  2R3C A;  5CCH C;  3LIE A;  1NO4 A;  1ZR4 A;  1SFC D;  5AW6 B;  1IK9 A;  4WY4 D;  1IFD A;  1CZQ A;  3N4X A;  2E42 A;  5AW7 B;  3LID A;  4W7Y A;  4WB4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...