1DEBA

Crystal structure of the n-terminal coiled coil domain from apc
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
54
structure length
54
Chain Sequence
AAASYDQLLKQVEALKMENSNLRQELEDNSNHLTKLETEASNMKEVLKQLQGSI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ADENOMATOUS POLYPOSIS COLI PROTEIN
publication title Crystal structure of the amino-terminal coiled-coil domain of the APC tumor suppressor.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Structural protein
total genus 22
structure length 54
sequence length 54
chains with identical sequence B
ec nomenclature
pdb deposition date 1999-11-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16689 APC_N_CC Coiled-coil N-terminus of APC, dimerisation domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.10 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1debA00
1DEBA 3V2QA 1VDFA 1FBMA 3V2NA 1MZ9A 3V2RA 3V2PA
chains in the Genus database with same CATH superfamily
5APTA 2ZVOB 3K5BA 1ZRTD 3TGUJ 2O01J 2N1TB 1NJIQ 2R32A 1S9KD 4OGQB 3M91A 1HF9A 1Q86Q 1OFCX 5KAIH 1AVYA 3L71D 2GUVA 2P58A 3A7OA 2IFMA 1S4XA 1H89A 4ASWA 1MFZA 2KIKA 1FZGA 3CI9A 2AEMA 3F89A 1LTGC 1U7MA 1L0LE 1QEXA 2OARA 3RL0C 4L76A 2B9BA 1PZQA 3SWYA 3Q5PA 1X8YA 3LIDA 2QJYB 2K9YA 2QA4P 1CI6B 2YXQB 2FXMA 1RH5B 3PHLA 4Y99C 4D6TD 3CC4P 2JO1A 1NTKJ 2R3SA 4BXLA 3CXHD 1SS1A 3HE4A 1PGPA 2NPSC 2OTKE 2WSSH 1KB9D 4I7ZB 2LXBA 2OTLP 1N2DC 4WBAA 3G4SP 2OGUA 3VMXA 1L0NJ 1FU1A 1KORA 1NU1J 3BCCJ 3MGNA 4WY4A 2QEXP 1LTIC 1M57D 2WT7B 4W7YA 1IZNB 1FBMA 3RBXA 1JY3P 2E74C 1CZQA 3AE3C 5AVYB 2WQYC 2WWWA 3CMAP 1EDJA 1ZN5A 3HD7D 5APYA 2DW3A 2W90A 3L73J 1LT9A 2V7QH 4AYCA 3CLQA 3SWFA 1QGKB 3CCRP 1AFOA 4TT3H 4HJGH 4OVNF 4KHXA 1OWAA 3HD7B 3CCJP 3CCMP 3AE5C 2HPCB 1RF0A 4HYTB 4R4MA 2Q1KA 3V4WA 3JCUE 2R3CA 5H2FH 3T97A 1SQXD 1BGYE 2OYHA 3RGUA 2ZAEB 1SQPJ 4H13B 1JEKA 3A3YB 3C1LA 5AW5B 5CCGA 2OYIC 5EFWB 2CK3H 1FZCA 1M7LA 2QM7A 2E76D 1DD3A 3ITKA 2FYZA 2R44A 2FYUE 5K5GB 1ZOYC 5AW2B 3B5ND 1SFCB 2FBWC 2Y9YA 2FY8A 3CC2P 3RK3E 1HVVA 1KILD 2BCCD 1L0LK 3H1JJ 3L74E 1KILB 1URQA 4KJMA 1HJBA 1N7SA 1W2BO 1SQQD 1J1DC 2YXRB 2KS1A 2HODB 2A45H 4L73A 3HUSC 4JPZB 3G3ZA 2JJLA 4RKUJ 3L75G 1AQ5A 1VQ8P 3C8VA 1IFJA 3GHGA 3TGUD 4LLHA 2H43A 4IL6E 4QMAA 3V5BA 3H1IE 3SFEC 3S4RA 2CPBA 1AQTA 1NTMJ 5AW3B 1RE3C 3PLNA 1OVVA 3R4YA 1FE6A 4XE5B 4K3AA 3KYQA 3P8CD 2IBZD 1P84D 2XV5A 2IYPA 3H1KE 3G6EP 1PGJA 5TISH 2JP3A 5AW6B 3EFFK 1EQ7A 3CCUP 1GL2D 3VOPA 1H88A 3O6QB 1NTKD 2Q6QA 2H8PD 2P10A 3AEDC 1KFMA 1GD2E 2KOGA 1OVRA 5L8RJ 2JWDA 2B87A 1L0ND 3FWNA 1NU1D 1PGOA 5B5EH 1BE3J 1N7LA 5AVQB 1VQ5P 3RK2B 1L4AB 2I1KA 1KD1Q 1SQVJ 2FYUK 1IFMA 1M1KQ 1EZVD 4EYYQ 1H8AA 3L73D 1RY3A 2SPZA 4W80A 3CC7P 2K88A 3HRNA 1DH3A 3GLMA 5AVUB 5KLVE 2QJKC 3H1HG 1ZV8A 4ZKUA 2YIUB 1NTZE 5KLVG 3QWOC 1PPJE 1BDCA 4WVZA 3WUUA 1USDA 3L36A 3OA7A 3CXHI 1NH4A 1PPJG 3E1IA 1KB9I 4UB8E 1VQMP 1T6AA 3U1AA 2E75D 3B5NC 1LJ2A 1UIIA 4ZNCA 1ZRTE 3RK3B 4ZMDA 1JM0A 1CI6A 1YIJP 4PJ0H 3TSIA 3L71E 1VQOP 1IK7A 1Q7YQ 2Z4EA 1BCCE 3WMM0 3GMAA 5AW0B 3RL0B 3CWBJ 1BCCG 2H89C 3H1JD 3MUDC 1Y9BA 2LKMA 3TNUA 1OW8A 2WT7A 3L70E 1ZR2A 5AW4B 4Y99B 4U3FE 4D6TE 3L70G 3B71A 4I1LA 3TYYA 2ZYAA 1N73A 2NPSB 3CXHE 2BEQD 1LTAC 4U3FG 1KB9E 4W7ZA 2UWJE 3P8MC 1PP9E 2E74D 2KP8A 5GTIH 1YTZT 4IOIH 2PRRA 3ABVC 1PP9G 2P1JA 2HPCA 1KQSO 3CX5I 2E74B 1QL1A 3O8ZA 1NTMD 1HGVA 1TU3F 1GL2C 1EDLA 1T8ZA 2B89A 2L5GB 3BRTB 1NGMB 1OIPA 4GDOA 1JUNA 2P2UA 4C7NB 1NO4A 5APQA 1XTCC 3MZWB 5KLVK 3SFDC 2KNCB 2C9LY 1NTZK 1W5CE 3USSA 2C9NY 3AEFC 2FXOA 3OAKA 4LC1A 1SFCA 1SQXE 4AQRD 5CCHA 4IFFA 3B4SA 2OYIB 1KYOI 1KC8Q 2WPQA 1X0TA 1BE3D 1PGQA 4GT1A 1PIXA 2Y9ZA 1SQVD 3CX5E 5AVRB 2FYNC 3I55P 3S1KA 4PD4I 1KZUB 4N78E 5KLIC 4JF7A 2QSIA 2HODA 1D7MA 1VQLP 2K3RA 2PAJA 5APWA 1KILE 2MKVA 2YO2A 3F5HA 5CCGC 2E75C 3NMDA 3AE9C 1FZAA 1FZCC 1SP4A 3IR9A 2M5AA 1J1DB 1SQQE 3MTUE 3WUTA 4IL6X 3HUSB 2J58A 1LP1B 4EI2A 2O1KA 3H32B 4YXWH 2QG4A 1KYOE 2J5UA 1L0LG 2IDBA 3TGUE 3IN6A 1RHZB 2W27A 1GK6A 3O6QA 4UB6H 2AXCA 4PD4E 1JTHB 2WTYA 5BU8B 1H0TB 3CWBD 3P8CE 1W2EA 2IBZE 1EDKA 1SQBE 3VMZA 3V2PA 3GHGC 1SQBG 3L72E 2WSEH 2A06D 1GTWA 1L4AA 1L2PA 1KQLA 3L72G 5AVSB 1NTKE 2OQQA 3VP8A 1QLED 1X22A 1RF1A 3Q5SA 1SQXK 1G2CB 1HWTC 4ASVA 1J1EC 1NU1E 3BCCE 4A7PA 1NKZB 1HUCA 4I2LC 2KXPB 4U7JA 2Y0CA 4Y28J 1EXIA 1IK9A 2YMYA 2MJZA 3HE5B 3L37A 2QM8A 1EZVE 2I8DA 4AUWA 1ZXGA 2L91A 5DJUB 3L73E 1BGYG 1KQGB 2QJKB 3M0AA 5B66H 1IFPA 2ZYGA 5CBNA 1QL2A 1Y8AA 3V2RA 3U1CA 2P7JA 2E43A 2FYUG 2E76B 2YO3A 1SQQK 4IFDK 1FJPA 5AW9B 1S5LX 4EOTA 3L75J 4HH2A 2PFXA 1FJKA 3B5NB 1SQPE 3KHUA 1LT1A 3RBZA 3BATA 1SLQA 3AEGC 1OXZA 1E5WA 3L74G 3H25A 3M9QA 1LTBC 1K8AQ 1IJDB 2W8ZA 2V7QJ 1NOHA 2NPSA 4H44C 1YI2P 1T2KC 1SQBK 3H1JE 2Y0DA 1GW4A 2ZT9C 3H1IG 3KQGA 4UB8H 1VF5C 1S72P 1E79H 5DJTB 4CPGA 1NTKK 4M3LA 4N6JA 1Z56A 4MN4C 3GW6A 1OZHA 5AW7B 3KZIH 2O01N 3P32A 3M0DC 1YTZI 3CL3D 1NU1K 4C7NA 3H1KG 3CD6P 1M90Q 2A45I 2KNCA 1YHQP 1NTME 1GL2B 1NAFA 1GU5A 1PV3A 3CCSP 4WY4D 4H0LD 1PL5A 1N73C 3IF4A 3D71A 1OW6A 2OYIA 4YXDC 5CBOA 2YKOA 3CXHH 3H1HJ 2KB7P 1GDTA 3Q1MA 2KLUA 1KB9H 1LWUC 2YMKA 5KLVJ 2ZXEB 2KZIA 1X79B 3MIWA 5AVWB 5TJHA 3R2PA 1FZBA 3LW5H 1OW7A 2D2CC 1FZEA 1LTJC 1MV8A 1CSBA 1YQ4C 4NPEA 2IYOA 5KJ7A 4PV1C 1SQPK 2AXTE 3CCEP 1UIXA 2N1TA 3H1LE 3D6ZA 3VMYA 1NKNA 3FWLA 1PFIA 3H1LG 3LIEA 3M9HA 1NTZG 2FYNB 1SQVE 4NPFX 4KT0J 5KLIB 2JEEA 2KI7B 5CCGD 1X9VA 2YKPA 1LP1A 2POHA 2P67A 1FS0E 1S5LE 3H32A 1RE4A 1BCCJ 3AE4C 1YJWP 2FFDC 1S9KE 2NZ2A 1M1JC 1J2JB 1YQ3C 2E75B 2QIWA 3VTPC 1FZCB 5APUA 1JY2O 2KZJA 3A0HH 3D6YA 3I56P 3L71G 1JTHA 1BSNA 1RE3A 4U3FJ 4RESB 3L75D 1IC2A 1NVOA 3GG2A 3KPEA 5TISE 1H0TA 3CX5H 2R5BA 2WPSA 1DX7A 1JOCA 1USEA 1URQD 3IAOA 2BASA 2R5DA 3SWKA 1N7SD 1PP9J 1K73Q 3II6A 1K9MQ 3AE7C 3AE6C 4JBZA 2AEFA 4D6TG 2PGDA 2QJPC 3Q2YA 3A2AA 2RN0A 5C39A 3G71P 2HLOA 3U59A 3CWBE 1ZR4A 3GF3A 2Q3IA 3NXSA 5CMZA 3Q3DA 1HH0A 3GHGB 3HD7A 3B8EB 3TK1A 3N4XA 2KUBA 1FOSF 2A06E 4N3YB 4EDFA 1YJ9P 3I5CA 1KYOH 4B86A 3TDKA 4NPDA 1S3JA 2J59M 2XKMA 3E1RA 3FX0A 5CHXA 1VQPP 1J1EB 5KKZC 2XNXA 4PD4H 2O3JA 3FXDA 1YITP 4H0LC 4WY4C 2ITAA 3OJAB 2V4HA 2AEJA 1R5LA 2PP6A 1HGZA 1U57A 1CW5A 2M3EA 1SQVK 1DIPA 4GOEA 4HKZH 5BVZA 1IO4A 3C9IA 1FC2C 4Z1MH 1SQXG 1LT9C 2I1JA 3B5NA 2Q3EA 1RF1C 2YKQA 2RKLA 1G1IA 3JSVC 2B87B 2HG5D 3H1HD 1XTGB 2O1JA 1KILA 1Y47A 5KLVD 4OWFA 4DCKA 1RF0C 1KV4A 3NTNA 1FDOA 1R8EA 4GIFA 3KDPB 4C46A 1NTZD 4GOFA 1PPJD 2IBZI 1Q82Q 2BCCE 1P84I 2LXCB 2OYHC 3BASA 3G9RA 3JCUH 3H6PA 1L0LJ 4IFMA 3MUDA 2BCCG 1YBKA 5GTHE 3A0BE 3RK3C 3EQ2A 4H44D 1T2KD 2HYNA 1LNQA 2G8YA 1SQQG 3M06A 2ZT9D 4H44B 3SSUA 3AE2C 3N7NA 2E42A 5GTIE 1BCCD 3PH0A 2M8RA 1VF5D 4BWNA 3VMAA 2ZXXA 2Y0EA 3TGUG 4YPCA 2ZT9B 1SQBJ 1HBWA 4BRYB 1T3UA 2LR2A 1JY3O 1VQKP 2NRGA 1N86A 4I6MC 1URQC 1VF5B 3V4QA 1EZVI 3L72J 1N7SC 3L70D 5APSA 4XFJA 3GF7A 4U3FD 1GL2A 1IFNA 1P84E 1VL2A 3AEEC 2WITA 1S1CX 2XDJA 3HTKB 3VYIA 2FXPA 2IBZG 3Q5RA 1VQ9P 1PP9D 5CJ0A 4IL6H 3TNUB 2KSEA 2OTJP 3WU2E 1JMBA 1NTKG 3PRJA 2IX7C 5KAFE 1OMIA 1MKMA 1L0NE 3BVHA 1N73B 1BGYJ 5E79E 1IFDA 1L0NG 1NU1G 3BCCG 2D2CD 3VN0A 1NAYA 1LWUB 2JR8A 3KXDA 1VQ6P 3UIAA 3OW2O 4PV1D 1QVFO 1JCCA 2KK7A 4WWIA 2HFED 2FYUJ 1G1JA 2D2CB 1EXJA 4GODA 4OH8B 2WZ7A 1LTJB 2IFNA 3S9OA 1EZVG 4H13D 2IZ1A 3PJSK 4PV1B 3L73G 5CJ4A 5KAIE 1DD4A 1KMIZ 4DOJA 1FDMA 3MHVA 4O9BA 3P7KA 3MD0A 3L74J 2Z5IA 2N9BA 1ZLLA 1SFCD 2KYVA 5CCHD 1GK4A 4RO0A 2WPRA 3V2QA 3CX5D 4TLFA 1YJNP 2K37A 1JCDA 2BEZF 2M0BA 3QH9A 4N78D 1MFTA 2WSEJ 3FGAD 4JQ0D 1SQPG 1HTLC 2Q5UA 2FFDB 1M1JB 1A02J 1EDIA 1GMJA 2IPPA 5KJ7C 2GA1A 2N1TC 3H1IJ 2K9JB 4UB6E 4OGQC 1Q2NA 2AXTH 1JO5A 3BRVB 1MUUA 1ZW0A 5KTBA 2ZYDA 1LTSC 5BU5A 1YYCA 1DEBA 3L75E 2VRSA 2GM4A 2XNDH 4JYBA 1L0LD 2N9YB 2YNYA 4RJTA 3W68A 3A5TA 3H1JG 3H1KJ 2RMZA 1KYOD 1RE4C 2QJYC 2K1AA 3RL0g 1VPCA 2HR3A 1S5LH 1OVUA 1R5SA 1U7JA 4ZKPA 2Q7CA 2M5AB 2QJPB 4PD4D 1AVOA 2C0XA 4DT0A 1L0NK 1FAVA 1LGHB 3AE8C 4I7ZC 2M3BA 1SQBD 2XZRA 2JWAA 5H2FE 2G3AA 3W67A 3L72D 3CCVP 1JY2N 5AVXB 1HJ0A 1NTMG 2IZ0A 3HE4B 1SVFA 1VQ4P 1KTMA 3CMEP 5KKZB 5B66E 1KN7A 3RK2D 1L4AD 1QX8A 5AVVB 4WY4B 4H0LB 2WPVB 3IFMA 3BCCD 3H1LJ 3HD7C 1RQVA 1NTZJ 1GU4A 1KFNA 3WUVA 4C7RA 2E5TA 2QVAA 3JC22 1BGYD 4EIJA 1LT9B 2KSJA 1BE3E 1RF1B 1FOSE 1WMKA 4DJGA 3CCLP 1GZLA 4H13C 2ZFCA 1BE3G 3H1HE 2C0WA 3E7KA 2E5YA 2OYOA 2H7HA 1A02F 5AW8B 1VQNP 3EWKA 2FYUD 3L4FA 5M1BA 2A45G 1SQVG 3L71J 3HUSA 3T97B 2KLVA 1RQUA 4DZOA 1SFCC 3L35A 2E76C 2OYHB 3RK3D 5CCHC 1ZP0C 3AE1C 3PTZA 2JDIH 1SQPD 3L74D 2B88A 3VP9A 2Z5HA 4BRYA 1GW3A 3L70J 1KILC 1S2EA 2W6BA 2GUSA 2WVRA 4D6TJ 3RL0D 3KZIE 4K35A 1OX3A 1NWQA 2RH0A 2W6JH 5AVTB 3HTKA 3M0DA 2ZJSE 4YTPC 1BSHA 1AA0A 3LW5J 1FZFA 3H1ID 3CPWO 2WSCH 2WSFH 1FDIA 1URQB 1N7SB 1NTMK 2NPSD 1JY2P 3V2NA 3MP7B 1KQFB 1DEEG 1NYHA 2KS1B 5B5EE 5GTHH 1NHLA 1T3JA 4R4LA 1G2CA 1M8OB 3A0BH 1WT6A 3V6IA 3M9BA 2ZVNB 3EFGA 3CWBG 3H1KD 1JNMA 5AW1B 3D70A 2W6AA 3NFQA 1MZ9A 3AEAC 5AVZB 1LWUA 2O01H 2A06G 1ZMEC 1QVGO 3HE5A 3TF5A 1EC5A 1IFIA 3AECC 1K04A 3FXEA 1LTJA 1SQXJ 5APXA 4XA4A 1JMMA 1VDFA 4JYCA 1N8RQ 2QE7H 4L75A 1WRGA 1P84H 3RK2C 1L4AC 5APVA 4WB4A 3CCQP 2WMMA 1JY3N 4GKGA 1AV1A 1Q81Q 1K05A 4L74A 4PJ0E 3PP5A 2WSCJ 2WSFJ 1VQ7P 3A0HE 1M56D 2BCCJ 3WU2H 3ZDMA 4LGDE 2FFDA 1M1JA 2Q9IA 5KAFH 2XU6A 3H1LD 1AJYA 2H88C 2K9JA 2YIUC 5E79H 4HB1A 2FKWB 2QRXA 1SQQJ 5KJ7D 1Q90D 2CPSA 2N1TD 1BDDA 1LTTC 1JB0J 3AEBC 2W83C 4OGQD 2JKVA
chains in the Genus database with same CATH topology
5APTA 2A45I 2LKMA 3TNUA 2WT7A 1ZR2A 1GL2B 2N1TB 5AW4B 1NAFA 1GU5A 5CJ4A 2R32A 4Y99B 4DOJA 1S9KD 1FDMA 3M91A 4WY4D 1N73C 4O9BA 4I1LA 3TYYA 1N73A 2NPSB 3P7KA 3MD0A 1LTAC 2Z5IA 2GUVA 2N9BA 2OYIA 3A7OA 2IFMA 1ZLLA 2YKOA 4W7ZA 1H89A 1MFZA 1SFCD 1FZGA 3CI9A 2KYVA 2KB7P 3P8MC 1GDTA 5CCHD 1GK4A 1LTGC 1LWUC 2WPRA 3V2QA 1LTJB 2ZXEB 2KP8A 1X79B 1YTZT 3MIWA 2OARA 3RL0C 1JCDA 5AVWB 2P1JA 4N78D 3R2PA 3SWYA 1X8YA 1FZBA 3LW5H 3LIDA 1FZEA 2HPCA 1HTLC 1LTJC 2Q5UA 1MV8A 1QL1A 2FFDB 3O8ZA 1M1JB 1A02J 1CI6B 1CSBA 2IPPA 1HGVA 5KJ7C 5KJ7A 2FXMA 1GL2C 1SQPK 2N1TC 2N1TA 1T8ZA 3VMYA 1NKNA 2L5GB 3BRTB 4Y99C 1PFIA 1JUNA 2P2UA 1JO5A 3BRVB 1MUUA 3HE4A 5KTBA 2NPSC 1LTSC 5BU5A 4C7NB 3LIEA 1NO4A 5APQA 1XTCC 3M9HA 1YYCA 5KLVK 1N2DC 4WBAA 3VMXA 1DEBA 2VRSA 1FU1A 2GM4A 4JYBA 3MGNA 2JEEA 4WY4A 2C9LY 1NTZK 2C9NY 1LTIC 2YNYA 5CCGD 3A5TA 1X9VA 2WT7B 2YKPA 4W7YA 2POHA 3OAKA 2P67A 4LC1A 1RE4C 3H32A 1FBMA 1SFCA 1RE4A 1JY3P 4AQRD 1VPCA 2FFDC 1S9KE 5CCHA 1CZQA 4IFFA 1M1JC 5AVYB 1J2JB 2WWWA 2OYIB 3VTPC 1FZCB 5APUA 1JY2O 2WPQA 1ZN5A 3HD7D 5APYA 4ZKPA 2Q7CA 4GT1A 1LT9A 4AYCA 3CLQA 3SWFA 2C0XA 1AFOA 1L0NK 1FAVA 1LGHB 1JTHA 1RE3A 5AVRB 4KHXA 1OWAA 3HD7B 4RESB 1KZUB 4N78E 1IC2A 2M3BA 2HPCB 1RF0A 3KPEA 2XZRA 2R5BA 4HYTB 4JF7A 2WPSA 1DX7A 2HODA 1JOCA 3V4WA 1URQD 2BASA 2PAJA 5APWA 2R5DA 2R3CA 3T97A 1N7SD 1JY2N 5AVXB 2YO2A 2OYHA 3II6A 3HE4B 1SVFA 5CCGC 3A3YB 3NMDA 5AW5B 5CCGA 2OYIC 1FZAA 1FZCC 1FZCA 1SP4A 3IR9A 1M7LA 2QM7A 1J1DB 3RK2D 3A2AA 1L4AD 5AVVB 3MTUE 4WY4B 2HLOA 2FYZA 3U59A 3IFMA 1ZR4A 3HUSB 2J58A 2Q3IA 3NXSA 5CMZA 3HD7C 1HH0A 2O1KA 3GHGB 3HD7A 3H32B 3B8EB 5AW2B 3B5ND 3TK1A 1SFCB 3N4XA 1GU4A 1KFNA 1FOSF 4N3YB 1HVVA 4C7RA 1KILD 3I5CA 4B86A 1L0LK 4EIJA 1LT9B 2KSJA 2W27A 2J59M 2XKMA 1GK6A 1RF1B 1FOSE 1GZLA 5CHXA 1KILB 1JTHB 2ZFCA 1URQA 2C0WA 1J1EB 1HJBA 2XNXA 1N7SA 2WTYA 1A02F 2H7HA 1J1DC 5BU8B 5AW8B 4WY4C 3P8CE 1W2EA 3L4FA 2HODB 2A45H 2A45G 3HUSC 3VMZA 3G3ZA 3OJAB 2JJLA 3HUSA 1AQ5A 2PP6A 3V2PA 1HGZA 3GHGC 2KLVA 1IFJA 1CW5A 4DZOA 3GHGA 1SFCC 1SQVK 3L35A 4LLHA 2WSEH 2OYHB 1GTWA 3RK3D 5CCHC 2H43A 1L4AA 5BVZA 1IO4A 3C9IA 1KQLA 3V5BA 5AVSB 1LT9C 2I1JA 3VP8A 3VP9A 3B5NA 2CPBA 1RF1C 2YKQA 2Z5HA 1RF1A 1G1IA 1SQXK 1GW3A 2HG5D 1G2CB 1HWTC 5AW3B 1XTGB 1KILC 2O1JA 1RE3C 1KILA 2W6BA 1J1EC 2GUSA 4XE5B 3KYQA 1RF0C 3P8CD 1NKZB 3RL0D 3NTNA 1HUCA 4GIFA 4I2LC 2XV5A 3KDPB 4C46A 1NWQA 5AVTB 1IK9A 2YMYA 5AW6B 3HTKA 3M0DA 2MJZA 3HE5B 3L37A 2OYHC 2QM8A 1EQ7A 3BASA 1GL2D 3VOPA 1H88A 3H6PA 1FZFA 4AUWA 2WSCH 2WSFH 4IFMA 3MUDA 1URQB 2H8PD 1N7SB 1KFMA 1NTMK 2NPSD 1JY2P 3V2NA 1GD2E 2KOGA 3RK3C 3EQ2A 3M0AA 1T2KD 1NHLA 1T3JA 2HYNA 1G2CA 1WT6A 1QL2A 3V2RA 3M9BA 1N7LA 3EFGA 3M06A 3U1CA 2P7JA 2E43A 5AVQB 3RK2B 1L4AB 2YO3A 1JNMA 5AW1B 2I1KA 3N7NA 1SQQK 2E42A 4IFDK 1FJPA 2W6AA 5AW9B 3NFQA 1MZ9A 2M8RA 2FYUK 4EOTA 1IFMA 5AVZB 1LWUA 4HH2A 2O01H 1FJKA 3B5NB 3HE5A 1HBWA 1T3UA 1IFIA 1H8AA 1JY3O 3BATA 1SLQA 1RY3A 1OXZA 4W80A 1E5WA 1N86A 4I6MC 1URQC 3V4QA 1LTJA 3M9QA 1LTBC 1N7SC 3HRNA 5APSA 1DH3A 5AVUB 5APXA 4XA4A 1JMMA 1IJDB 1GL2A 1ZV8A 1IFNA 4ZKUA 1VDFA 4JYCA 2WITA 2XDJA 1WRGA 3HTKB 3VYIA 1NOHA 2NPSA 3RK2C 1L4AC 3L36A 5APVA 3OA7A 4WB4A 1T2KC 1NH4A 1SQBK 3E1IA 1JY3N 5CJ0A 3TNUB 4GKGA 3U1AA 3B5NC 1GW4A 3RK3B 3KQGA 2IX7C 3PP5A 4LGDE 3BVHA 1N73B 2FFDA 1M1JA 1CI6A 1NTKK 2Q9IA 3TSIA 2XU6A 4M3LA 4N6JA 1IFDA 1Z56A 2Z4EA 3VN0A 5AW7B 1LWUB 3P32A 3M0DC 2FKWB 1YTZI 3WMM0 3CL3D 5AW0B 1NU1K 5KJ7D 4C7NA 3UIAA 3RL0B 2CPSA 1JCCA 2HFED 2N1TD 1LTTC 1G1JA 4OH8B 2WZ7A 2IFNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DEB A;  3V2Q A;  1VDF A;  1FBM A;  3V2N A;  1MZ9 A;  3V2R A;  3V2P A; 
#chains in the Genus database with same CATH topology
 5APT A;  2ZVO B;  3K5B A;  1ZRT D;  3TGU J;  2O01 J;  2N1T B;  1NJI Q;  2R32 A;  1S9K D;  4OGQ B;  3M91 A;  1HF9 A;  1Q86 Q;  1OFC X;  5KAI H;  1AVY A;  3L71 D;  2GUV A;  2P58 A;  3A7O A;  2IFM A;  1S4X A;  1H89 A;  4ASW A;  1MFZ A;  2KIK A;  1FZG A;  3CI9 A;  2AEM A;  3F89 A;  1LTG C;  1U7M A;  1L0L E;  1QEX A;  2OAR A;  3RL0 C;  4L76 A;  2B9B A;  1PZQ A;  3SWY A;  3Q5P A;  1X8Y A;  3LID A;  2QJY B;  2K9Y A;  2QA4 P;  1CI6 B;  2YXQ B;  2FXM A;  1RH5 B;  3PHL A;  4Y99 C;  4D6T D;  3CC4 P;  2JO1 A;  1NTK J;  2R3S A;  4BXL A;  3CXH D;  1SS1 A;  3HE4 A;  1PGP A;  2NPS C;  2OTK E;  2WSS H;  1KB9 D;  4I7Z B;  2LXB A;  2OTL P;  1N2D C;  4WBA A;  3G4S P;  2OGU A;  3VMX A;  1L0N J;  1FU1 A;  1KOR A;  1NU1 J;  3BCC J;  3MGN A;  4WY4 A;  2QEX P;  1LTI C;  1M57 D;  2WT7 B;  4W7Y A;  1IZN B;  1FBM A;  3RBX A;  1JY3 P;  2E74 C;  1CZQ A;  3AE3 C;  5AVY B;  2WQY C;  2WWW A;  3CMA P;  1EDJ A;  1ZN5 A;  3HD7 D;  5APY A;  2DW3 A;  2W90 A;  3L73 J;  1LT9 A;  2V7Q H;  4AYC A;  3CLQ A;  3SWF A;  1QGK B;  3CCR P;  1AFO A;  4TT3 H;  4HJG H;  4OVN F;  4KHX A;  1OWA A;  3HD7 B;  3CCJ P;  3CCM P;  3AE5 C;  2HPC B;  1RF0 A;  4HYT B;  4R4M A;  2Q1K A;  3V4W A;  3JCU E;  2R3C A;  5H2F H;  3T97 A;  1SQX D;  1BGY E;  2OYH A;  3RGU A;  2ZAE B;  1SQP J;  4H13 B;  1JEK A;  3A3Y B;  3C1L A;  5AW5 B;  5CCG A;  2OYI C;  5EFW B;  2CK3 H;  1FZC A;  1M7L A;  2QM7 A;  2E76 D;  1DD3 A;  3ITK A;  2FYZ A;  2R44 A;  2FYU E;  5K5G B;  1ZOY C;  5AW2 B;  3B5N D;  1SFC B;  2FBW C;  2Y9Y A;  2FY8 A;  3CC2 P;  3RK3 E;  1HVV A;  1KIL D;  2BCC D;  1L0L K;  3H1J J;  3L74 E;  1KIL B;  1URQ A;  4KJM A;  1HJB A;  1N7S A;  1W2B O;  1SQQ D;  1J1D C;  2YXR B;  2KS1 A;  2HOD B;  2A45 H;  4L73 A;  3HUS C;  4JPZ B;  3G3Z A;  2JJL A;  4RKU J;  3L75 G;  1AQ5 A;  1VQ8 P;  3C8V A;  1IFJ A;  3GHG A;  3TGU D;  4LLH A;  2H43 A;  4IL6 E;  4QMA A;  3V5B A;  3H1I E;  3SFE C;  3S4R A;  2CPB A;  1AQT A;  1NTM J;  5AW3 B;  1RE3 C;  3PLN A;  1OVV A;  3R4Y A;  1FE6 A;  4XE5 B;  4K3A A;  3KYQ A;  3P8C D;  2IBZ D;  1P84 D;  2XV5 A;  2IYP A;  3H1K E;  3G6E P;  1PGJ A;  5TIS H;  2JP3 A;  5AW6 B;  3EFF K;  1EQ7 A;  3CCU P;  1GL2 D;  3VOP A;  1H88 A;  3O6Q B;  1NTK D;  2Q6Q A;  2H8P D;  2P10 A;  3AED C;  1KFM A;  1GD2 E;  2KOG A;  1OVR A;  5L8R J;  2JWD A;  2B87 A;  1L0N D;  3FWN A;  1NU1 D;  1PGO A;  5B5E H;  1BE3 J;  1N7L A;  5AVQ B;  1VQ5 P;  3RK2 B;  1L4A B;  2I1K A;  1KD1 Q;  1SQV J;  2FYU K;  1IFM A;  1M1K Q;  1EZV D;  4EYY Q;  1H8A A;  3L73 D;  1RY3 A;  2SPZ A;  4W80 A;  3CC7 P;  2K88 A;  3HRN A;  1DH3 A;  3GLM A;  5AVU B;  5KLV E;  2QJK C;  3H1H G;  1ZV8 A;  4ZKU A;  2YIU B;  1NTZ E;  5KLV G;  3QWO C;  1PPJ E;  1BDC A;  4WVZ A;  3WUU A;  1USD A;  3L36 A;  3OA7 A;  3CXH I;  1NH4 A;  1PPJ G;  3E1I A;  1KB9 I;  4UB8 E;  1VQM P;  1T6A A;  3U1A A;  2E75 D;  3B5N C;  1LJ2 A;  1UII A;  4ZNC A;  1ZRT E;  3RK3 B;  4ZMD A;  1JM0 A;  1CI6 A;  1YIJ P;  4PJ0 H;  3TSI A;  3L71 E;  1VQO P;  1IK7 A;  1Q7Y Q;  2Z4E A;  1BCC E;  3WMM 0;  3GMA A;  5AW0 B;  3RL0 B;  3CWB J;  1BCC G;  2H89 C;  3H1J D;  3MUD C;  1Y9B A;  2LKM A;  3TNU A;  1OW8 A;  2WT7 A;  3L70 E;  1ZR2 A;  5AW4 B;  4Y99 B;  4U3F E;  4D6T E;  3L70 G;  3B71 A;  4I1L A;  3TYY A;  2ZYA A;  1N73 A;  2NPS B;  3CXH E;  2BEQ D;  1LTA C;  4U3F G;  1KB9 E;  4W7Z A;  2UWJ E;  3P8M C;  1PP9 E;  2E74 D;  2KP8 A;  5GTI H;  1YTZ T;  4IOI H;  2PRR A;  3ABV C;  1PP9 G;  2P1J A;  2HPC A;  1KQS O;  3CX5 I;  2E74 B;  1QL1 A;  3O8Z A;  1NTM D;  1HGV A;  1TU3 F;  1GL2 C;  1EDL A;  1T8Z A;  2B89 A;  2L5G B;  3BRT B;  1NGM B;  1OIP A;  4GDO A;  1JUN A;  2P2U A;  4C7N B;  1NO4 A;  5APQ A;  1XTC C;  3MZW B;  5KLV K;  3SFD C;  2KNC B;  2C9L Y;  1NTZ K;  1W5C E;  3USS A;  2C9N Y;  3AEF C;  2FXO A;  3OAK A;  4LC1 A;  1SFC A;  1SQX E;  4AQR D;  5CCH A;  4IFF A;  3B4S A;  2OYI B;  1KYO I;  1KC8 Q;  2WPQ A;  1X0T A;  1BE3 D;  1PGQ A;  4GT1 A;  1PIX A;  2Y9Z A;  1SQV D;  3CX5 E;  5AVR B;  2FYN C;  3I55 P;  3S1K A;  4PD4 I;  1KZU B;  4N78 E;  5KLI C;  4JF7 A;  2QSI A;  2HOD A;  1D7M A;  1VQL P;  2K3R A;  2PAJ A;  5APW A;  1KIL E;  2MKV A;  2YO2 A;  3F5H A;  5CCG C;  2E75 C;  3NMD A;  3AE9 C;  1FZA A;  1FZC C;  1SP4 A;  3IR9 A;  2M5A A;  1J1D B;  1SQQ E;  3MTU E;  3WUT A;  4IL6 X;  3HUS B;  2J58 A;  1LP1 B;  4EI2 A;  2O1K A;  3H32 B;  4YXW H;  2QG4 A;  1KYO E;  2J5U A;  1L0L G;  2IDB A;  3TGU E;  3IN6 A;  1RHZ B;  2W27 A;  1GK6 A;  3O6Q A;  4UB6 H;  2AXC A;  4PD4 E;  1JTH B;  2WTY A;  5BU8 B;  1H0T B;  3CWB D;  3P8C E;  1W2E A;  2IBZ E;  1EDK A;  1SQB E;  3VMZ A;  3V2P A;  3GHG C;  1SQB G;  3L72 E;  2WSE H;  2A06 D;  1GTW A;  1L4A A;  1L2P A;  1KQL A;  3L72 G;  5AVS B;  1NTK E;  2OQQ A;  3VP8 A;  1QLE D;  1X22 A;  1RF1 A;  3Q5S A;  1SQX K;  1G2C B;  1HWT C;  4ASV A;  1J1E C;  1NU1 E;  3BCC E;  4A7P A;  1NKZ B;  1HUC A;  4I2L C;  2KXP B;  4U7J A;  2Y0C A;  4Y28 J;  1EXI A;  1IK9 A;  2YMY A;  2MJZ A;  3HE5 B;  3L37 A;  2QM8 A;  1EZV E;  2I8D A;  4AUW A;  1ZXG A;  2L91 A;  5DJU B;  3L73 E;  1BGY G;  1KQG B;  2QJK B;  3M0A A;  5B66 H;  1IFP A;  2ZYG A;  5CBN A;  1QL2 A;  1Y8A A;  3V2R A;  3U1C A;  2P7J A;  2E43 A;  2FYU G;  2E76 B;  2YO3 A;  1SQQ K;  4IFD K;  1FJP A;  5AW9 B;  1S5L X;  4EOT A;  3L75 J;  4HH2 A;  2PFX A;  1FJK A;  3B5N B;  1SQP E;  3KHU A;  1LT1 A;  3RBZ A;  3BAT A;  1SLQ A;  3AEG C;  1OXZ A;  1E5W A;  3L74 G;  3H25 A;  3M9Q A;  1LTB C;  1K8A Q;  1IJD B;  2W8Z A;  2V7Q J;  1NOH A;  2NPS A;  4H44 C;  1YI2 P;  1T2K C;  1SQB K;  3H1J E;  2Y0D A;  1GW4 A;  2ZT9 C;  3H1I G;  3KQG A;  4UB8 H;  1VF5 C;  1S72 P;  1E79 H;  5DJT B;  4CPG A;  1NTK K;  4M3L A;  4N6J A;  1Z56 A;  4MN4 C;  3GW6 A;  1OZH A;  5AW7 B;  3KZI H;  2O01 N;  3P32 A;  3M0D C;  1YTZ I;  3CL3 D;  1NU1 K;  4C7N A;  3H1K G;  3CD6 P;  1M90 Q;  2A45 I;  2KNC A;  1YHQ P;  1NTM E;  1GL2 B;  1NAF A;  1GU5 A;  1PV3 A;  3CCS P;  4WY4 D;  4H0L D;  1PL5 A;  1N73 C;  3IF4 A;  3D71 A;  1OW6 A;  2OYI A;  4YXD C;  5CBO A;  2YKO A;  3CXH H;  3H1H J;  2KB7 P;  1GDT A;  3Q1M A;  2KLU A;  1KB9 H;  1LWU C;  2YMK A;  5KLV J;  2ZXE B;  2KZI A;  1X79 B;  3MIW A;  5AVW B;  5TJH A;  3R2P A;  1FZB A;  3LW5 H;  1OW7 A;  2D2C C;  1FZE A;  1LTJ C;  1MV8 A;  1CSB A;  1YQ4 C;  4NPE A;  2IYO A;  5KJ7 A;  4PV1 C;  1SQP K;  2AXT E;  3CCE P;  1UIX A;  2N1T A;  3H1L E;  3D6Z A;  3VMY A;  1NKN A;  3FWL A;  1PFI A;  3H1L G;  3LIE A;  3M9H A;  1NTZ G;  2FYN B;  1SQV E;  4NPF X;  4KT0 J;  5KLI B;  2JEE A;  2KI7 B;  5CCG D;  1X9V A;  2YKP A;  1LP1 A;  2POH A;  2P67 A;  1FS0 E;  1S5L E;  3H32 A;  1RE4 A;  1BCC J;  3AE4 C;  1YJW P;  2FFD C;  1S9K E;  2NZ2 A;  1M1J C;  1J2J B;  1YQ3 C;  2E75 B;  2QIW A;  3VTP C;  1FZC B;  5APU A;  1JY2 O;  2KZJ A;  3A0H H;  3D6Y A;  3I56 P;  3L71 G;  1JTH A;  1BSN A;  1RE3 A;  4U3F J;  4RES B;  3L75 D;  1IC2 A;  1NVO A;  3GG2 A;  3KPE A;  5TIS E;  1H0T A;  3CX5 H;  2R5B A;  2WPS A;  1DX7 A;  1JOC A;  1USE A;  1URQ D;  3IAO A;  2BAS A;  2R5D A;  3SWK A;  1N7S D;  1PP9 J;  1K73 Q;  3II6 A;  1K9M Q;  3AE7 C;  3AE6 C;  4JBZ A;  2AEF A;  4D6T G;  2PGD A;  2QJP C;  3Q2Y A;  3A2A A;  2RN0 A;  5C39 A;  3G71 P;  2HLO A;  3U59 A;  3CWB E;  1ZR4 A;  3GF3 A;  2Q3I A;  3NXS A;  5CMZ A;  3Q3D A;  1HH0 A;  3GHG B;  3HD7 A;  3B8E B;  3TK1 A;  3N4X A;  2KUB A;  1FOS F;  2A06 E;  4N3Y B;  4EDF A;  1YJ9 P;  3I5C A;  1KYO H;  4B86 A;  3TDK A;  4NPD A;  1S3J A;  2J59 M;  2XKM A;  3E1R A;  3FX0 A;  5CHX A;  1VQP P;  1J1E B;  5KKZ C;  2XNX A;  4PD4 H;  2O3J A;  3FXD A;  1YIT P;  4H0L C;  4WY4 C;  2ITA A;  3OJA B;  2V4H A;  2AEJ A;  1R5L A;  2PP6 A;  1HGZ A;  1U57 A;  1CW5 A;  2M3E A;  1SQV K;  1DIP A;  4GOE A;  4HKZ H;  5BVZ A;  1IO4 A;  3C9I A;  1FC2 C;  4Z1M H;  1SQX G;  1LT9 C;  2I1J A;  3B5N A;  2Q3E A;  1RF1 C;  2YKQ A;  2RKL A;  1G1I A;  3JSV C;  2B87 B;  2HG5 D;  3H1H D;  1XTG B;  2O1J A;  1KIL A;  1Y47 A;  5KLV D;  4OWF A;  4DCK A;  1RF0 C;  1KV4 A;  3NTN A;  1FDO A;  1R8E A;  4GIF A;  3KDP B;  4C46 A;  1NTZ D;  4GOF A;  1PPJ D;  2IBZ I;  1Q82 Q;  2BCC E;  1P84 I;  2LXC B;  2OYH C;  3BAS A;  3G9R A;  3JCU H;  3H6P A;  1L0L J;  4IFM A;  3MUD A;  2BCC G;  1YBK A;  5GTH E;  3A0B E;  3RK3 C;  3EQ2 A;  4H44 D;  1T2K D;  2HYN A;  1LNQ A;  2G8Y A;  1SQQ G;  3M06 A;  2ZT9 D;  4H44 B;  3SSU A;  3AE2 C;  3N7N A;  2E42 A;  5GTI E;  1BCC D;  3PH0 A;  2M8R A;  1VF5 D;  4BWN A;  3VMA A;  2ZXX A;  2Y0E A;  3TGU G;  4YPC A;  2ZT9 B;  1SQB J;  1HBW A;  4BRY B;  1T3U A;  2LR2 A;  1JY3 O;  1VQK P;  2NRG A;  1N86 A;  4I6M C;  1URQ C;  1VF5 B;  3V4Q A;  1EZV I;  3L72 J;  1N7S C;  3L70 D;  5APS A;  4XFJ A;  3GF7 A;  4U3F D;  1GL2 A;  1IFN A;  1P84 E;  1VL2 A;  3AEE C;  2WIT A;  1S1C X;  2XDJ A;  3HTK B;  3VYI A;  2FXP A;  2IBZ G;  3Q5R A;  1VQ9 P;  1PP9 D;  5CJ0 A;  4IL6 H;  3TNU B;  2KSE A;  2OTJ P;  3WU2 E;  1JMB A;  1NTK G;  3PRJ A;  2IX7 C;  5KAF E;  1OMI A;  1MKM A;  1L0N E;  3BVH A;  1N73 B;  1BGY J;  5E79 E;  1IFD A;  1L0N G;  1NU1 G;  3BCC G;  2D2C D;  3VN0 A;  1NAY A;  1LWU B;  2JR8 A;  3KXD A;  1VQ6 P;  3UIA A;  3OW2 O;  4PV1 D;  1QVF O;  1JCC A;  2KK7 A;  4WWI A;  2HFE D;  2FYU J;  1G1J A;  2D2C B;  1EXJ A;  4GOD A;  4OH8 B;  2WZ7 A;  1LTJ B;  2IFN A;  3S9O A;  1EZV G;  4H13 D;  2IZ1 A;  3PJS K;  4PV1 B;  3L73 G;  5CJ4 A;  5KAI E;  1DD4 A;  1KMI Z;  4DOJ A;  1FDM A;  3MHV A;  4O9B A;  3P7K A;  3MD0 A;  3L74 J;  2Z5I A;  2N9B A;  1ZLL A;  1SFC D;  2KYV A;  5CCH D;  1GK4 A;  4RO0 A;  2WPR A;  3V2Q A;  3CX5 D;  4TLF A;  1YJN P;  2K37 A;  1JCD A;  2BEZ F;  2M0B A;  3QH9 A;  4N78 D;  1MFT A;  2WSE J;  3FGA D;  4JQ0 D;  1SQP G;  1HTL C;  2Q5U A;  2FFD B;  1M1J B;  1A02 J;  1EDI A;  1GMJ A;  2IPP A;  5KJ7 C;  2GA1 A;  2N1T C;  3H1I J;  2K9J B;  4UB6 E;  4OGQ C;  1Q2N A;  2AXT H;  1JO5 A;  3BRV B;  1MUU A;  1ZW0 A;  5KTB A;  2ZYD A;  1LTS C;  5BU5 A;  1YYC A;  1DEB A;  3L75 E;  2VRS A;  2GM4 A;  2XND H;  4JYB A;  1L0L D;  2N9Y B;  2YNY A;  4RJT A;  3W68 A;  3A5T A;  3H1J G;  3H1K J;  2RMZ A;  1KYO D;  1RE4 C;  2QJY C;  2K1A A;  3RL0 g;  1VPC A;  2HR3 A;  1S5L H;  1OVU A;  1R5S A;  1U7J A;  4ZKP A;  2Q7C A;  2M5A B;  2QJP B;  4PD4 D;  1AVO A;  2C0X A;  4DT0 A;  1L0N K;  1FAV A;  1LGH B;  3AE8 C;  4I7Z C;  2M3B A;  1SQB D;  2XZR A;  2JWA A;  5H2F E;  2G3A A;  3W67 A;  3L72 D;  3CCV P;  1JY2 N;  5AVX B;  1HJ0 A;  1NTM G;  2IZ0 A;  3HE4 B;  1SVF A;  1VQ4 P;  1KTM A;  3CME P;  5KKZ B;  5B66 E;  1KN7 A;  3RK2 D;  1L4A D;  1QX8 A;  5AVV B;  4WY4 B;  4H0L B;  2WPV B;  3IFM A;  3BCC D;  3H1L J;  3HD7 C;  1RQV A;  1NTZ J;  1GU4 A;  1KFN A;  3WUV A;  4C7R A;  2E5T A;  2QVA A;  3JC2 2;  1BGY D;  4EIJ A;  1LT9 B;  2KSJ A;  1BE3 E;  1RF1 B;  1FOS E;  1WMK A;  4DJG A;  3CCL P;  1GZL A;  4H13 C;  2ZFC A;  1BE3 G;  3H1H E;  2C0W A;  3E7K A;  2E5Y A;  2OYO A;  2H7H A;  1A02 F;  5AW8 B;  1VQN P;  3EWK A;  2FYU D;  3L4F A;  5M1B A;  2A45 G;  1SQV G;  3L71 J;  3HUS A;  3T97 B;  2KLV A;  1RQU A;  4DZO A;  1SFC C;  3L35 A;  2E76 C;  2OYH B;  3RK3 D;  5CCH C;  1ZP0 C;  3AE1 C;  3PTZ A;  2JDI H;  1SQP D;  3L74 D;  2B88 A;  3VP9 A;  2Z5H A;  4BRY A;  1GW3 A;  3L70 J;  1KIL C;  1S2E A;  2W6B A;  2GUS A;  2WVR A;  4D6T J;  3RL0 D;  3KZI E;  4K35 A;  1OX3 A;  1NWQ A;  2RH0 A;  2W6J H;  5AVT B;  3HTK A;  3M0D A;  2ZJS E;  4YTP C;  1BSH A;  1AA0 A;  3LW5 J;  1FZF A;  3H1I D;  3CPW O;  2WSC H;  2WSF H;  1FDI A;  1URQ B;  1N7S B;  1NTM K;  2NPS D;  1JY2 P;  3V2N A;  3MP7 B;  1KQF B;  1DEE G;  1NYH A;  2KS1 B;  5B5E E;  5GTH H;  1NHL A;  1T3J A;  4R4L A;  1G2C A;  1M8O B;  3A0B H;  1WT6 A;  3V6I A;  3M9B A;  2ZVN B;  3EFG A;  3CWB G;  3H1K D;  1JNM A;  5AW1 B;  3D70 A;  2W6A A;  3NFQ A;  1MZ9 A;  3AEA C;  5AVZ B;  1LWU A;  2O01 H;  2A06 G;  1ZME C;  1QVG O;  3HE5 A;  3TF5 A;  1EC5 A;  1IFI A;  3AEC C;  1K04 A;  3FXE A;  1LTJ A;  1SQX J;  5APX A;  4XA4 A;  1JMM A;  1VDF A;  4JYC A;  1N8R Q;  2QE7 H;  4L75 A;  1WRG A;  1P84 H;  3RK2 C;  1L4A C;  5APV A;  4WB4 A;  3CCQ P;  2WMM A;  1JY3 N;  4GKG A;  1AV1 A;  1Q81 Q;  1K05 A;  4L74 A;  4PJ0 E;  3PP5 A;  2WSC J;  2WSF J;  1VQ7 P;  3A0H E;  1M56 D;  2BCC J;  3WU2 H;  3ZDM A;  4LGD E;  2FFD A;  1M1J A;  2Q9I A;  5KAF H;  2XU6 A;  3H1L D;  1AJY A;  2H88 C;  2K9J A;  2YIU C;  5E79 H;  4HB1 A;  2FKW B;  2QRX A;  1SQQ J;  5KJ7 D;  1Q90 D;  2CPS A;  2N1T D;  1BDD A;  1LTT C;  1JB0 J;  3AEB C;  2W83 C;  4OGQ D;  2JKV A; 
#chains in the Genus database with same CATH homology
 5APT A;  2A45 I;  2LKM A;  3TNU A;  2WT7 A;  1ZR2 A;  1GL2 B;  2N1T B;  5AW4 B;  1NAF A;  1GU5 A;  5CJ4 A;  2R32 A;  4Y99 B;  4DOJ A;  1S9K D;  1FDM A;  3M91 A;  4WY4 D;  1N73 C;  4O9B A;  4I1L A;  3TYY A;  1N73 A;  2NPS B;  3P7K A;  3MD0 A;  1LTA C;  2Z5I A;  2GUV A;  2N9B A;  2OYI A;  3A7O A;  2IFM A;  1ZLL A;  2YKO A;  4W7Z A;  1H89 A;  1MFZ A;  1SFC D;  1FZG A;  3CI9 A;  2KYV A;  2KB7 P;  3P8M C;  1GDT A;  5CCH D;  1GK4 A;  1LTG C;  1LWU C;  2WPR A;  3V2Q A;  1LTJ B;  2ZXE B;  2KP8 A;  1X79 B;  1YTZ T;  3MIW A;  2OAR A;  3RL0 C;  1JCD A;  5AVW B;  2P1J A;  4N78 D;  3R2P A;  3SWY A;  1X8Y A;  1FZB A;  3LW5 H;  3LID A;  1FZE A;  2HPC A;  1HTL C;  1LTJ C;  2Q5U A;  1MV8 A;  1QL1 A;  2FFD B;  3O8Z A;  1M1J B;  1A02 J;  1CI6 B;  1CSB A;  2IPP A;  1HGV A;  5KJ7 C;  5KJ7 A;  2FXM A;  1GL2 C;  1SQP K;  2N1T C;  2N1T A;  1T8Z A;  3VMY A;  1NKN A;  2L5G B;  3BRT B;  4Y99 C;  1PFI A;  1JUN A;  2P2U A;  1JO5 A;  3BRV B;  1MUU A;  3HE4 A;  5KTB A;  2NPS C;  1LTS C;  5BU5 A;  4C7N B;  3LIE A;  1NO4 A;  5APQ A;  1XTC C;  3M9H A;  1YYC A;  5KLV K;  1N2D C;  4WBA A;  3VMX A;  1DEB A;  2VRS A;  1FU1 A;  2GM4 A;  4JYB A;  3MGN A;  2JEE A;  4WY4 A;  2C9L Y;  1NTZ K;  2C9N Y;  1LTI C;  2YNY A;  5CCG D;  3A5T A;  1X9V A;  2WT7 B;  2YKP A;  4W7Y A;  2POH A;  3OAK A;  2P67 A;  4LC1 A;  1RE4 C;  3H32 A;  1FBM A;  1SFC A;  1RE4 A;  1JY3 P;  4AQR D;  1VPC A;  2FFD C;  1S9K E;  5CCH A;  1CZQ A;  4IFF A;  1M1J C;  5AVY B;  1J2J B;  2WWW A;  2OYI B;  3VTP C;  1FZC B;  5APU A;  1JY2 O;  2WPQ A;  1ZN5 A;  3HD7 D;  5APY A;  4ZKP A;  2Q7C A;  4GT1 A;  1LT9 A;  4AYC A;  3CLQ A;  3SWF A;  2C0X A;  1AFO A;  1L0N K;  1FAV A;  1LGH B;  1JTH A;  1RE3 A;  5AVR B;  4KHX A;  1OWA A;  3HD7 B;  4RES B;  1KZU B;  4N78 E;  1IC2 A;  2M3B A;  2HPC B;  1RF0 A;  3KPE A;  2XZR A;  2R5B A;  4HYT B;  4JF7 A;  2WPS A;  1DX7 A;  2HOD A;  1JOC A;  3V4W A;  1URQ D;  2BAS A;  2PAJ A;  5APW A;  2R5D A;  2R3C A;  3T97 A;  1N7S D;  1JY2 N;  5AVX B;  2YO2 A;  2OYH A;  3II6 A;  3HE4 B;  1SVF A;  5CCG C;  3A3Y B;  3NMD A;  5AW5 B;  5CCG A;  2OYI C;  1FZA A;  1FZC C;  1FZC A;  1SP4 A;  3IR9 A;  1M7L A;  2QM7 A;  1J1D B;  3RK2 D;  3A2A A;  1L4A D;  5AVV B;  3MTU E;  4WY4 B;  2HLO A;  2FYZ A;  3U59 A;  3IFM A;  1ZR4 A;  3HUS B;  2J58 A;  2Q3I A;  3NXS A;  5CMZ A;  3HD7 C;  1HH0 A;  2O1K A;  3GHG B;  3HD7 A;  3H32 B;  3B8E B;  5AW2 B;  3B5N D;  3TK1 A;  1SFC B;  3N4X A;  1GU4 A;  1KFN A;  1FOS F;  4N3Y B;  1HVV A;  4C7R A;  1KIL D;  3I5C A;  4B86 A;  1L0L K;  4EIJ A;  1LT9 B;  2KSJ A;  2W27 A;  2J59 M;  2XKM A;  1GK6 A;  1RF1 B;  1FOS E;  1GZL A;  5CHX A;  1KIL B;  1JTH B;  2ZFC A;  1URQ A;  2C0W A;  1J1E B;  1HJB A;  2XNX A;  1N7S A;  2WTY A;  1A02 F;  2H7H A;  1J1D C;  5BU8 B;  5AW8 B;  4WY4 C;  3P8C E;  1W2E A;  3L4F A;  2HOD B;  2A45 H;  2A45 G;  3HUS C;  3VMZ A;  3G3Z A;  3OJA B;  2JJL A;  3HUS A;  1AQ5 A;  2PP6 A;  3V2P A;  1HGZ A;  3GHG C;  2KLV A;  1IFJ A;  1CW5 A;  4DZO A;  3GHG A;  1SFC C;  1SQV K;  3L35 A;  4LLH A;  2WSE H;  2OYH B;  1GTW A;  3RK3 D;  5CCH C;  2H43 A;  1L4A A;  5BVZ A;  1IO4 A;  3C9I A;  1KQL A;  3V5B A;  5AVS B;  1LT9 C;  2I1J A;  3VP8 A;  3VP9 A;  3B5N A;  2CPB A;  1RF1 C;  2YKQ A;  2Z5H A;  1RF1 A;  1G1I A;  1SQX K;  1GW3 A;  2HG5 D;  1G2C B;  1HWT C;  5AW3 B;  1XTG B;  1KIL C;  2O1J A;  1RE3 C;  1KIL A;  2W6B A;  1J1E C;  2GUS A;  4XE5 B;  3KYQ A;  1RF0 C;  3P8C D;  1NKZ B;  3RL0 D;  3NTN A;  1HUC A;  4GIF A;  4I2L C;  2XV5 A;  3KDP B;  4C46 A;  1NWQ A;  5AVT B;  1IK9 A;  2YMY A;  5AW6 B;  3HTK A;  3M0D A;  2MJZ A;  3HE5 B;  3L37 A;  2OYH C;  2QM8 A;  1EQ7 A;  3BAS A;  1GL2 D;  3VOP A;  1H88 A;  3H6P A;  1FZF A;  4AUW A;  2WSC H;  2WSF H;  4IFM A;  3MUD A;  1URQ B;  2H8P D;  1N7S B;  1KFM A;  1NTM K;  2NPS D;  1JY2 P;  3V2N A;  1GD2 E;  2KOG A;  3RK3 C;  3EQ2 A;  3M0A A;  1T2K D;  1NHL A;  1T3J A;  2HYN A;  1G2C A;  1WT6 A;  1QL2 A;  3V2R A;  3M9B A;  1N7L A;  3EFG A;  3M06 A;  3U1C A;  2P7J A;  2E43 A;  5AVQ B;  3RK2 B;  1L4A B;  2YO3 A;  1JNM A;  5AW1 B;  2I1K A;  3N7N A;  1SQQ K;  2E42 A;  4IFD K;  1FJP A;  2W6A A;  5AW9 B;  3NFQ A;  1MZ9 A;  2M8R A;  2FYU K;  4EOT A;  1IFM A;  5AVZ B;  1LWU A;  4HH2 A;  2O01 H;  1FJK A;  3B5N B;  3HE5 A;  1HBW A;  1T3U A;  1IFI A;  1H8A A;  1JY3 O;  3BAT A;  1SLQ A;  1RY3 A;  1OXZ A;  4W80 A;  1E5W A;  1N86 A;  4I6M C;  1URQ C;  3V4Q A;  1LTJ A;  3M9Q A;  1LTB C;  1N7S C;  3HRN A;  5APS A;  1DH3 A;  5AVU B;  5APX A;  4XA4 A;  1JMM A;  1IJD B;  1GL2 A;  1ZV8 A;  1IFN A;  4ZKU A;  1VDF A;  4JYC A;  2WIT A;  2XDJ A;  1WRG A;  3HTK B;  3VYI A;  1NOH A;  2NPS A;  3RK2 C;  1L4A C;  3L36 A;  5APV A;  3OA7 A;  4WB4 A;  1T2K C;  1NH4 A;  1SQB K;  3E1I A;  1JY3 N;  5CJ0 A;  3TNU B;  4GKG A;  3U1A A;  3B5N C;  1GW4 A;  3RK3 B;  3KQG A;  2IX7 C;  3PP5 A;  4LGD E;  3BVH A;  1N73 B;  2FFD A;  1M1J A;  1CI6 A;  1NTK K;  2Q9I A;  3TSI A;  2XU6 A;  4M3L A;  4N6J A;  1IFD A;  1Z56 A;  2Z4E A;  3VN0 A;  5AW7 B;  1LWU B;  3P32 A;  3M0D C;  2FKW B;  1YTZ I;  3WMM 0;  3CL3 D;  5AW0 B;  1NU1 K;  5KJ7 D;  4C7N A;  3UIA A;  3RL0 B;  2CPS A;  1JCC A;  2HFE D;  2N1T D;  1LTT C;  1G1J A;  4OH8 B;  2WZ7 A;  2IFN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...