3B5NA

Structure of the yeast plasma membrane snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
61
structure length
61
Chain Sequence
GSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
molecule keywords Synaptobrevin homolog 1
total genus 28
structure length 61
sequence length 61
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nA00
4JF7A 5KJ7A 1GL2C 4WY4C 2N1TA 3RK3D 1SFCC 1N7SB 3RL0D 4LGDE 3RK3B 1JTHA 1GL2B 4WY4B 1N7SD 1T3JA 4W7ZA 1GL2A 2XDJA 4WY4D 2WZ7A 3HD7D 1SFCB 3RK3C 4W7YA 2N1TC 1KILD 1JTHB 3B5ND 5CCHA 1KILB 2PP6A 4OH8B 3PP5A 1GL2D 2N1TB 3HD7A 1URQB 2NPSB 3RK2B 1L4AD 3RL0C 1KILC 5CCHD 3B5NC 2M8RA 3HTKB 1KILA 1XTGB 3VOPA 1URQC 2NPSC 4N78E 3TSIA 3RK2C 1L4AA 3HD7C 3RL0B 3B5NB 2YMYA 5CCHC 2KOGA 3KYQA 3HD7B 3RK2D 3P8CE 1SFCD 1L4AC 4WY4A 5KJ7C 2H8PD 2HG5D 1N7SA 1NHLA 5CCGD 1SFCA 1URQD 2NPSD 3B5NA 4W80A 3M0DC 1HVVA 1L4AB 2HFED 1URQA 2NPSA 2N1TD 5CCGA 5KJ7D 1N7SC 5CCGC
chains in the Genus database with same CATH superfamily
1JNMA 3FX0A 2WTYA 2E76D 2WSEJ 1PGOA 1SQPG 1NKZB 1FDIA 2YIUB 2W6BA 1PP9D 2LXCB 2R3CA 1KB9H 2ZVOB 3PHLA 4OGQB 3PRJA 4R4MA 5APUA 1KD1Q 1KYOH 1NAYA 2B87B 3BCCJ 4ZKPA 5B5EE 1KTMA 3F89A 3HUSB 4H13B 1D7MA 4JQ0D 1AQ5A 1KMIZ 3L71D 1BE3J 4DOJA 1KYOI 1YQ3C 2ZT9C 1LP1A 4KT0J 1KFNA 4EYYQ 1KYOD 2G8YA 3AE9C 1KB9D 1NU1E 2JP3A 2XU6A 1QVGO 1PP9E 1ZW0A 1ZXGA 1FZCA 1GL2A 2O01J 5KTBA 1S1CX 4DCKA 1QEXA 1NTZE 3A0HH 2RH0A 1WT6A 3MUDC 2FYUE 3C1LA 1R5SA 2FFDB 2GM4A 1RE3A 5TJHA 1KYOE 2KZJA 1HGZA 3R4YA 1UIIA 5B5EH 2YXQB 1SQBE 4LLHA 1G1IA 1NU1J 4H44C 5AW6B 3CPWO 4XFJA 1H88A 2OTJP 1IFPA 1T2KD 2JWAA 1L0LG 2P58A 4HKZH 2Z4EA 3L72J 3KQGA 4XA4A 2C0XA 3B5ND 5CHXA 4ASVA 4I7ZB 4C7NA 1SQXD 3L73J 1MKMA 2OYOA 3H1LG 3RL0g 2ZAEB 2H89C 1YJWP 3V2RA 5B66H 1G2CB 5DJTB 2WSFH 3PP5A 5CBOA 1L0LK 1J1DB 1SQPD 2BCCJ 2W27A 3CL3D 1BDDA 4GKGA 5H2FE 3SSUA 3WU2E 1FJPA 2FYUK 2HODB 1NU1G 2AXCA 2FXOA 2JR8A 2NPSB 1LTIC 3F5HA 1LWUC 3PLNA 4GIFA 3H1IE 2JO1A 1EXIA 2QIWA 1EZVE 1L4AD 2R3SA 1KILC 4U3FE 3H25A 1BE3E 3CCRP 1KFMA 1LTJC 1OVRA 1SQVG 2QSIA 4HH2A 1FZFA 3II6A 4L76A 1OWAA 3H1KG 1PL5A 1VF5C 1XTGB 1YQ4C 2OYHA 2QJYB 2YO2A 4L75A 2HPCA 2KUBA 2D2CC 5H2FH 3D70A 1L4AA 4EOTA 3UIAA 3FWLA 1TU3F 3OA7A 3V2PA 4D6TD 1SQXJ 3L73D 3L75D 3L35A 3B5NB 1K73Q 1EZVI 2YMYA 3WUUA 1EC5A 1KQLA 2WPRA 5KLVE 3H1HG 3SWKA 3CMEP 1QLED 2KOGA 2PRRA 3AECC 2Q3EA 1JOCA 1ZV8A 2JJLA 4GOEA 1M1JB 1CZQA 1ZP0C 3JCUH 1MV8A 3VN0A 3CCUP 1VQKP 1L0NE 1VQNP 1W5CE 2KB7P 1Q86Q 2DW3A 4GT1A 1RH5B 2M5AA 2Y9ZA 1RE3C 2A45I 3U1CA 1NTZG 3AE6C 3N4XA 2RN0A 3VMAA 4I6MC 3Q3DA 1FZAA 2QJPB 4PV1B 2KSJA 3L71J 2KP8A 1FZCC 1VQ7P 2E75C 2ITAA 3CCVP 4WY4A 5KLIB 1MZ9A 3BCCE 2WMMA 2YO3A 3IFMA 3M9QA 3L74G 3WUVA 2WQYC 5AW4B 4OGQD 1RQVA 1SQXE 5TISH 1VQLP 1NHLA 1N7LA 2M5AB 3SWYA 3W67A 5CCGD 2OTLP 2NPSD 2RMZA 4YPCA 3CXHE 3M0DC 1NAFA 1HJBA 3JCUE 1DIPA 3S1KA 2P10A 1LWUA 2HFED 3GW6A 1MFZA 2KZIA 2NPSA 2WITA 1HTLC 1Q90D 4OVNF 2YIUC 1JUNA 1FC2C 3H1KE 3MIWA 4U3FD 4B86A 1QL2A 5CCGA 1K8AQ 4KHXA 2P2UA 5KJ7D 1A02F 1DD4A 3GG2A 3HTKA 3AEAC 3L75E 3WU2H 4IFMA 2OYIA 1N7SC 2OTKE 2IYPA 2LR2A 5AW0B 2BEZF 2KIKA 4H0LB 1EZVG 1PGQA 4N78D 5KJ7A 2HPCB 2KSEA 3AEBC 3H1HJ 1GW3A 2E42A 1SQBK 1W2BO 3H1KJ 3N7NA 1J1EC 2WSEH 1YITP 2Q3IA 1AFOA 2K9YA 2YNYA 1SQXG 1S9KD 2J59M 2BCCE 3AEDC 2QJKC 3CXHH 3A7OA 4JYBA 2FFDC 2ZYGA 3L71E 3H1ID 5BVZA 1VQ5P 3RK3B 1KB9I 1T2KC 1Q7YQ 1NTKJ 3H1IJ 1GL2B 4WY4B 1KN7A 1N86A 1Z56A 2Z5IA 1BGYJ 3H1JE 5KLVK 4YXWH 1YI2P 3L72D 1HGVA 1NTZD 4M3LA 5B66E 1YHQP 3E7KA 1VDFA 1SQQJ 1G2CA 2ZJSE 3BRTB 3E1IA 4NPDA 4O9BA 5AVRB 5KAIH 3H1LJ 2QG4A 2KI7B 1YJ9P 1AA0A 1KC8Q 1M57D 3M91A 1AQTA 1HH0A 5APTA 1T6AA 3L70J 3IF4A 4OWFA 5AVUB 2Y0CA 2KNCB 3Q1MA 2J5UA 5AVWB 2FYZA 3V4WA 3CCEP 2O1KA 2IBZD 1KILB 3V2QA 3MD0A 3QWOC 1DX7A 2W90A 4IFFA 1QGKB 2YXRB 3AE7C 4AYCA 2E76C 5L8RJ 1N73A 3JSVC 4EI2A 3B4SA 3RK3E 3HD7A 3CX5H 5E79E 3G4SP 4PD4I 3NFQA 1GU5A 1RF1A 3M9HA 2OYHB 3RK2B 1HJ0A 2M3BA 3Q5SA 1PV3A 1LGHB 1SQQD 3RL0C 3PTZA 4QMAA 1SQVE 2OARA 3B5NC 2M8RA 3PJSK 3CC7P 3ZDMA 4L74A 2I8DA 3ABVC 3KZIH 2B88A 3HE5B 2P1JA 3G71P 5KKZB 2KLUA 2C9LY 1RE4C 1URQC 4RO0A 1SQPJ 3CWBD 3TSIA 2XV5A 1YIJP 1SQQE 4Y28J 2PGDA 2W8ZA 3EQ2A 5E79H 4TT3H 3G9RA 1EDIA 3TF5A 3L72E 1H0TA 1GTWA 1LT1A 5GTIH 1IC2A 1SLQA 1E79H 2JKVA 2IYOA 3CWBE 4C7NB 2E75D 1NTME 2QJPC 2RKLA 1IJDB 2FBWC 3TGUJ 1SQBD 3H1JG 1SVFA 2E74B 2FY8A 1RF0A 2R32A 4Y99C 5CJ4A 1VQ6P 3GF7A 1YTZI 3LIDA 4NPFX 2FYUD 3AE4C 1NJIQ 2WSCJ 4XE5B 1YYCA 3M0AA 1NTMD 2V4HA 1SFCD 1NTKD 3GHGC 4JYCA 2PAJA 1FE6A 2WT7B 2WPVB 1LJ2A 3CI9A 1HF9A 1S3JA 2I1KA 2O1JA 1E5WA 4NPEA 3HE4B 5KJ7C 2H8PD 1SQVK 5CJ0A 3MP7B 2N9BA 5KAIE 3V4QA 2Q9IA 1LTAC 2V7QH 3FGAD 1S2EA 3D6YA 2K3RA 1SFCA 2AEJA 1X8YA 1JM0A 1NTKE 2M0BA 4GDOA 1USEA 4UB6H 2VRSA 4IOIH 1BCCD 3KHUA 3A0BH 3D6ZA 1HVVA 2W6JH 4BRYB 3CXHD 1Y9BA 1Q81Q 3H1LD 1VPCA 4H0LC 1S9KE 3CC2P 4BWNA 1Y8AA 1SQQG 2OGUA 3GLMA 1NKNA 1AVOA 1KORA 5K5GB 5APXA 3TGUE 5KLVG 1VQ9P 2N1TD 4BRYA 3V6IA 2FYUJ 1IK7A 1J1EB 2POHA 1P84I 1BSNA 2Q6QA 3TYYA 3TDKA 1PGPA 3L72G 1M8OB 1DD3A 1NTMK 1CW5A 2E5YA 1K04A 5APQA 1IK9A 2ZT9B 1X0TA 3GF3A 2E43A 1ZOYC 4JF7A 1IFJA 1OX3A 1P84E 1FZGA 1GK4A 1EDLA 1GL2C 4WY4C 5BU8B 2IZ1A 3H1IG 2N1TA 3T97B 4EIJA 3ITKA 3P8CD 1RF1B 1T8ZA 1KQGB 3GHGA 2P67A 4R4LA 4CPGA 5AVVB 1FU1A 3KZIE 1JB0J 3RK3D 3S4RA 4D6TJ 2KK7A 3A0BE 2MKVA 3RL0D 1OMIA 3BRVB 5AW8B 1Q82Q 1GDTA 1OZHA 1JY2O 3BCCG 3SFDC 3C8VA 3Q5PA 2V7QJ 1X9VA 2IBZE 2I1JA 1JTHA 1N7SD 2YKOA 3H6PA 4N6JA 1OW8A 1VQMP 4W7ZA 1LTGC 5AW5B 4WVZA 3AE5C 1USDA 4OGQC 2HLOA 5APSA 4PD4E 2OYIC 2XNDH 2QA4P 1R5LA 2B9BA 2WZ7A 3HD7D 4JPZB 1SFCB 3L70D 4I7ZC 3PH0A 4PV1D 3TNUA 4ASWA 1AJYA 3CX5D 1YBKA 3A0HE 3AEGC 1N2DC 3AE1C 3EFFK 4UB8H 2ZXEB 2ZFCA 3FXEA 3VP8A 1RY3A 3WUTA 4GODA 1NWQA 4W7YA 2FXMA 2NZ2A 1JTHB 3L74J 5AVTB 1KILE 1CI6A 1RE4A 3LIEA 5CMZA 3CWBG 1BGYD 3CCQP 4YTPC 2LXBA 1S5LE 2FXPA 1LTJB 2PP6A 5CBNA 3MUDA 4OH8B 5C39A 1N8RQ 2XKMA 2WPQA 3MZWB 1PFIA 1GW4A 1OVVA 3A5TA 5KAFE 1NTZK 1FDOA 3IR9A 3MHVA 5KKZC 2N1TB 3T97A 1URQB 1ZLLA 2KS1B 2AXTE 1JY3N 1L0NK 1Q2NA 3B8EB 1OW6A 3E1RA 5GTIE 1JY2N 3KXDA 3L71G 2E74D 1FAVA 3VP9A 1FS0E 1NVOA 1SS1A 2G3AA 2QE7H 5CCHD 1JO5A 2WSSH 3HTKB 1IFNA 4U7JA 1KILA 2A45G 1H0TB 1QX8A 2Y0EA 2ZYAA 3RBXA 2HYNA 1U7JA 3AE8C 1FOSE 1AVYA 3VOPA 2AEFA 4Z1MH 1P84D 4DZOA 1H8AA 1BSHA 3U1AA 1BE3D 3L37A 5AVSB 1NH4A 3BATA 3WMM0 3HE5A 1PPJE 1IFIA 1ZMEC 3L75G 1SQBJ 2MJZA 4LC1A 3H1HD 5APVA 1M90Q 1PIXA 2A06E 2FYNB 3CX5E 3VYIA 1VF5B 2AXTH 2YMKA 3G3ZA 1EQ7A 1BGYG 1IZNB 2D2CB 2AEMA 3KYQA 1JMMA 3HD7B 4C7RA 1VQPP 3VTPC 3L73E 3BASA 4MN4C 1NTKK 5AW9B 5GTHH 5AW7B 3RK2D 2K9JB 3VMYA 1YJNP 3AE2C 3H32A 3O6QA 1NU1K 3RGUA 1MUUA 5KLVJ 2XNXA 1LTBC 2BCCG 1YTZT 2M3EA 1K05A 1RQUA 2XZRA 3FXDA 1SQQK 3I5CA 3P8CE 1U7MA 3P8MC 3AEEC 5BU5A 1W2EA 3M9BA 5AVXB 1M1JC 2IZ0A 3CX5I 4RKUJ 4U3FJ 5DJUB 4HJGH 2OQQA 1LT9C 2HG5D 2JWDA 3OAKA 2W83C 3CCLP 1L0LJ 1N7SA 2YKQA 2A06G 3H1KD 1KB9E 3C9IA 4ZNCA 2Y9YA 1GK6A 3H32B 3O6QB 1S5LX 1URQD 2K9JA 3B5NA 3B71A 4PV1C 1EDJA 1EXJA 3I55P 1VL2A 2O01H 3NMDA 3I56P 2C9NY 1QVFO 2E75B 2IBZI 1BGYE 1L4AB 2FKWB 3LW5J 5KLIC 1URQA 2KS1A 2J58A 1RF1C 2QRXA 1EDKA 1XTCC 2KYVA 3EWKA 2ZXXA 2WVRA 4I1LA 3SWFA 5APYA 1GU4A 1KZUB 1T3UA 2Q7CA 1PPJD 3K5BA 1NTKG 2IPPA 5AVQB 5KAFH 1BDCA 3AE3C 3KDPB 2ZYDA 5AW1B 2ZVNB 1BE3G 4IL6X 1DEEG 3L70E 3KPEA 2K88A 1CI6B 3L74E 1BCCJ 1SQXK 1EZVD 1U57A 3U59A 2H7HA 3CD6P 4TLFA 1ZN5A 3JC22 3G6EP 4YXDC 2R5BA 3CCSP 2Q1KA 3H1JJ 1OXZA 2QM7A 4KJMA 1L0LD 1SQPK 1Y47A 1N73B 2OYIB 4UB6E 1JY2P 1SFCC 1GMJA 1N7SB 3CXHI 3MGNA 4PJ0H 4UB8E 3TK1A 3TNUB 3MTUE 4BXLA 4LGDE 1UIXA 2JDIH 1M1KQ 1M7LA 1T3JA 2PFXA 2R5DA 5AVZB 3SFEC 4DJGA 1DH3A 2O01N 3RBZA 2B89A 5AVYB 1VF5D 1L0LE 2QVAA 3M0DA 2XDJA 1S5LH 1RHZB 4WY4D 2HR3A 4C46A 1KQFB 1IO4A 4PD4D 1MFTA 3HUSC 1X79B 4H13C 1LTJA 2QJKB 4H13D 1HUCA 1P84H 3TGUD 1L0NG 3RK3C 4H0LD 3CCMP 1FZBA 4WBAA 2IFMA 1NYHA 2KLVA 2ZT9D 2BEQD 1GZLA 1KQSO 2N1TC 5GTHE 1NOHA 1BCCE 1KILD 1NTMG 1PP9G 3OJAB 5M1BA 1FZEA 3H1HE 4H44B 1R8EA 2H43A 2OYHC 5CCHA 1HBWA 3CMAP 2IBZG 4PJ0E 5EFWB 1OIPA 2Z5HA 2O3JA 4K35A 1LTSC 3HUSA 1SQVJ 3W68A 3EFGA 2B87A 4IL6E 4ZMDA 1RF0C 1GL2D 1S4XA 1G1JA 1SQVD 3NTNA 2D2CD 2N9YB 1FBMA 1M1JA 3A2AA 3QH9A 4N3YB 4U3FG 3O8ZA 4H44D 2L91A 1S72P 2CPSA 1VQOP 3VMZA 4RJTA 3L70G 2IFNA 2SPZA 2QEXP 1NO4A 1JMBA 1J2JB 2A45H 2BASA 2WSCH 3P32A 3AEFC 2E76B 4D6TG 4DT0A 1PZQA 4EDFA 1J1DC 1VQ4P 1OFCX 2BCCD 3H1LE 4HYTB 1FOSF 3M06A 2FYNC 2CPBA 4JBZA 3L4FA 1ZRTE 2NPSC 3HE4A 1NTMJ 4N78E 1LWUB 3Q5RA 4A7PA 3RK2C 1SP4A 1BCCG 3HD7C 3BVHA 2KXPB 3NXSA 4AQRD 2IX7C 3RL0B 2W6AA 3CLQA 1VQ8P 2CK3H 1M56D 1PGJA 3A3YB 2Y0DA 2K1AA 4IL6H 2WPSA 3L74D 1NGMB 3CCJP 2FFDA 2C0WA 3OW2O 5TISE 5CCHC 1ZRTD 4RESB 2A06D 3D71A 4GOFA 4K3AA 1WRGA 1WMKA 1NU1D 2QJYC 4I2LC 3Q2YA 3CC4P 2KNCA 2LKMA 1LTTC 2HODA 3USSA 1OVUA 1SQBG 1L0ND 2E5TA 3H1JD 3R2PA 3V2NA 3L75J 4L73A 1LT9B 1LP1B 4ZKUA 2NRGA 2FYUG 2P7JA 1KV4A 3HRNA 2L5GB 1IFMA 4WB4A 1OW7A 4Y99B 3P7KA 1LT9A 1LNQA 5AW3B 1AV1A 1DEBA 1HWTC 1JCDA 2YKPA 3L73G 2E74C 1L4AC 1SQPE 3BCCD 3IN6A 3FWNA 3LW5H 4PD4H 3V5BA 2WT7A 1ZR2A 4IFDK 2H88C 1PP9J 1L2PA 2JEEA 2Q5UA 4HB1A 1X22A 1JY3P 3GMAA 4WWIA 3S9OA 1FDMA 1FJKA 1A02J 2WWWA 1CSBA 5APWA 1JCCA 3GHGB 2IDBA 4W80A 1PPJG 2UWJE 1IFDA 1FZCB 2QM8A 5KLVD 3VMXA 2WSFJ 2GUVA 3L36A 1NTZJ 3IAOA 2K37A 1ZR4A 1K9MQ 5AW2B 4AUWA 1JY3O 2R44A 3CWBJ 1N73C 1L0NJ 4D6TE 1H89A 2GUSA 1GD2E 1QL1A 1JEKA 2GA1A 3TGUG 5CCGC
chains in the Genus database with same CATH topology
1JNMA 2WTYA 1NKZB 2W6BA 2R3CA 5APUA 4ZKPA 3HUSB 1AQ5A 4DOJA 1KFNA 2XU6A 1FZCA 1GL2A 5KTBA 1WT6A 2FFDB 2GM4A 1RE3A 1HGZA 4LLHA 1G1IA 5AW6B 1H88A 1T2KD 2Z4EA 3KQGA 4XA4A 2C0XA 3B5ND 5CHXA 4C7NA 3V2RA 1G2CB 2WSFH 3PP5A 1L0LK 1J1DB 3CL3D 2W27A 4GKGA 1FJPA 2FYUK 2HODB 4GIFA 2NPSB 1LTIC 1LWUC 1L4AD 1KILC 1KFMA 1LTJC 4HH2A 1FZFA 3II6A 1OWAA 1XTGB 2OYHA 2YO2A 2HPCA 1L4AA 4EOTA 3UIAA 3OA7A 3V2PA 3L35A 3B5NB 2YMYA 1KQLA 2WPRA 2KOGA 1JOCA 1ZV8A 2JJLA 1M1JB 1CZQA 3VN0A 1MV8A 2KB7P 4GT1A 1RE3C 2A45I 3U1CA 3N4XA 4I6MC 1FZAA 2KSJA 2KP8A 1FZCC 4WY4A 1MZ9A 2YO3A 3IFMA 3M9QA 5AW4B 1NHLA 1N7LA 3SWYA 5CCGD 2NPSD 3M0DC 1NAFA 1HJBA 1LWUA 2HFED 1MFZA 2NPSA 2WITA 1HTLC 1JUNA 3MIWA 4B86A 5CCGA 1QL2A 4KHXA 2P2UA 5KJ7D 1A02F 3HTKA 4IFMA 2OYIA 1N7SC 5AW0B 4N78D 5KJ7A 2HPCB 1GW3A 2E42A 1SQBK 3N7NA 1J1EC 2WSEH 2Q3IA 1AFOA 2YNYA 1S9KD 2J59M 3A7OA 4JYBA 2FFDC 5BVZA 1T2KC 3RK3B 1GL2B 4WY4B 1N86A 1Z56A 2Z5IA 5KLVK 1HGVA 4M3LA 5AW1B 1VDFA 3BRTB 1G2CA 3E1IA 4O9BA 5AVRB 3M91A 1HH0A 5APTA 5AVUB 5AVWB 2FYZA 3V4WA 2O1KA 1KILB 3V2QA 3MD0A 1DX7A 4IFFA 1N73A 4AYCA 3HD7A 3NFQA 1GU5A 1RF1A 3M9HA 2OYHB 3RK2B 2M3BA 1LGHB 3RL0C 2OARA 3B5NC 2M8RA 3HE5B 2P1JA 2C9LY 1RE4C 1URQC 3TSIA 2XV5A 3EQ2A 1GTWA 1IC2A 1SLQA 4C7NB 1IJDB 1SVFA 2R32A 5CJ4A 1RF0A 3LIDA 1YTZI 4XE5B 1YYCA 3M0AA 1SFCD 3GHGC 4JYCA 2PAJA 2WT7B 3CI9A 2I1KA 2O1JA 1E5WA 3HE4B 5KJ7C 2H8PD 1SQVK 5CJ0A 3V4QA 2N9BA 2Q9IA 1LTAC 1SFCA 1X8YA 4Y99C 2VRSA 1HVVA 1VPCA 1S9KE 1NKNA 5APXA 2N1TD 1J1EB 2POHA 3TYYA 1CW5A 1NTMK 5APQA 1IK9A 2E43A 1FZGA 4JF7A 1IFJA 1GK4A 1GL2C 4WY4C 5BU8B 4EIJA 1RF1B 2N1TA 1FDMA 3P8CD 1T8ZA 3GHGA 2P67A 5AVVB 1FU1A 3RK3D 3RL0D 3BRVB 5AW8B 1GDTA 1JY2O 1X9VA 2I1JA 1JTHA 1N7SD 2YKOA 3H6PA 4N6JA 4W7ZA 1LTGC 5AW5B 2HLOA 5APSA 2OYIC 2WZ7A 3HD7D 1SFCB 3TNUA 1N2DC 2ZXEB 2ZFCA 3VP8A 1RY3A 1NWQA 4W7YA 2FXMA 1JTHB 5AVTB 3LIEA 1CI6A 1RE4A 5CMZA 2PP6A 1LTJB 3MUDA 4OH8B 2XKMA 2WPQA 1PFIA 1GW4A 3A5TA 1NTZK 3IR9A 2N1TB 3T97A 1URQB 1ZLLA 1JY3N 1L0NK 3B8EB 1JY2N 1FAVA 3VP9A 5CCHD 1JO5A 3HTKB 1IFNA 1KILA 2A45G 2HYNA 1FOSE 3VOPA 4DZOA 1H8AA 3U1AA 3L37A 5AVSB 1NH4A 3BATA 3WMM0 3HE5A 1IFIA 2MJZA 4LC1A 5APVA 3VYIA 3G3ZA 1EQ7A 3KYQA 1JMMA 3HD7B 4C7RA 3VTPC 3BASA 1NTKK 5AW9B 5AW7B 3RK2D 3VMYA 3H32A 1NU1K 1MUUA 2XNXA 1LTBC 1YTZT 2XZRA 3I5CA 3P8CE 1SQQK 3P8MC 5BU5A 1W2EA 3M9BA 5AVXB 1M1JC 1LT9C 2HG5D 3OAKA 1N7SA 2YKQA 3C9IA 1GK6A 3H32B 1URQD 3B5NA 2O01H 3NMDA 2C9NY 1L4AB 2FKWB 1URQA 1RF1C 3SWFA 1XTCC 2KYVA 4I1LA 5APYA 1GU4A 1KZUB 1T3UA 2Q7CA 5AVQB 2IPPA 3KDPB 3KPEA 1CI6B 2H7HA 1SQXK 3U59A 1ZN5A 2R5BA 1OXZA 2QM7A 1SQPK 1N73B 2OYIB 1JY2P 1SFCC 1N7SB 3TK1A 3MGNA 3TNUB 3MTUE 4LGDE 1M7LA 1T3JA 2R5DA 5AVZB 1DH3A 5AVYB 3M0DA 2XDJA 4C46A 4WY4D 1IO4A 3HUSC 1X79B 1LTJA 1HUCA 3RK3C 1FZBA 4WBAA 2IFMA 2KLVA 1GZLA 2N1TC 1NOHA 1KILD 3OJAB 1FZEA 2OYHC 2H43A 1HBWA 5CCHA 2Z5HA 1LTSC 3HUSA 3EFGA 1RF0C 1GL2D 3NTNA 1G1JA 3A2AA 4N3YB 1FBMA 1M1JA 3O8ZA 2CPSA 3VMZA 2IFNA 1NO4A 3P32A 1J2JB 2A45H 2BASA 2WSCH 1J1DC 4HYTB 1FOSF 3M06A 2CPBA 3L4FA 2NPSC 3HE4A 4N78E 1LWUB 3RK2C 1SP4A 3HD7C 3BVHA 3NXSA 4AQRD 2IX7C 3RL0B 2W6AA 3CLQA 3A3YB 2WPSA 2FFDA 2C0WA 5CCHC 4RESB 1WRGA 4I2LC 2LKMA 1LTTC 2HODA 3R2PA 3V2NA 1LT9B 4ZKUA 2P7JA 3HRNA 2L5GB 1IFMA 4WB4A 4Y99B 3P7KA 1LT9A 5AW3B 1DEBA 1HWTC 1JCDA 2YKPA 3V5BA 1L4AC 3LW5H 4IFDK 2WT7A 1ZR2A 2JEEA 2Q5UA 1JY3P 1FJKA 1A02J 2WWWA 1CSBA 5APWA 1JCCA 3GHGB 4W80A 1FZCB 1IFDA 2QM8A 3VMXA 3L36A 2GUVA 1ZR4A 5AW2B 4AUWA 1JY3O 1N73C 1H89A 2GUSA 1GD2E 1QL1A 2J58A 5CCGC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF7 A;  5KJ7 A;  1GL2 C;  4WY4 C;  2N1T A;  3RK3 D;  1SFC C;  1N7S B;  3RL0 D;  4LGD E;  3RK3 B;  1JTH A;  1GL2 B;  4WY4 B;  1N7S D;  1T3J A;  4W7Z A;  1GL2 A;  2XDJ A;  4WY4 D;  2WZ7 A;  3HD7 D;  1SFC B;  3RK3 C;  4W7Y A;  2N1T C;  1KIL D;  1JTH B;  3B5N D;  5CCH A;  1KIL B;  2PP6 A;  4OH8 B;  3PP5 A;  1GL2 D;  2N1T B;  3HD7 A;  1URQ B;  2NPS B;  3RK2 B;  1L4A D;  3RL0 C;  1KIL C;  5CCH D;  3B5N C;  2M8R A;  3HTK B;  1KIL A;  1XTG B;  3VOP A;  1URQ C;  2NPS C;  4N78 E;  3TSI A;  3RK2 C;  1L4A A;  3HD7 C;  3RL0 B;  3B5N B;  2YMY A;  5CCH C;  2KOG A;  3KYQ A;  3HD7 B;  3RK2 D;  3P8C E;  1SFC D;  1L4A C;  4WY4 A;  5KJ7 C;  2H8P D;  2HG5 D;  1N7S A;  1NHL A;  5CCG D;  1SFC A;  1URQ D;  2NPS D;  3B5N A;  4W80 A;  3M0D C;  1HVV A;  1L4A B;  2HFE D;  1URQ A;  2NPS A;  2N1T D;  5CCG A;  5KJ7 D;  1N7S C;  5CCG C; 
#chains in the Genus database with same CATH topology
 1JNM A;  3FX0 A;  2WTY A;  2E76 D;  2WSE J;  1PGO A;  1SQP G;  1NKZ B;  1FDI A;  2YIU B;  2W6B A;  1PP9 D;  2LXC B;  2R3C A;  1KB9 H;  2ZVO B;  3PHL A;  4OGQ B;  3PRJ A;  4R4M A;  5APU A;  1KD1 Q;  1KYO H;  1NAY A;  2B87 B;  3BCC J;  4ZKP A;  5B5E E;  1KTM A;  3F89 A;  3HUS B;  4H13 B;  1D7M A;  4JQ0 D;  1AQ5 A;  1KMI Z;  3L71 D;  1BE3 J;  4DOJ A;  1KYO I;  1YQ3 C;  2ZT9 C;  1LP1 A;  4KT0 J;  1KFN A;  4EYY Q;  1KYO D;  2G8Y A;  3AE9 C;  1KB9 D;  1NU1 E;  2JP3 A;  2XU6 A;  1QVG O;  1PP9 E;  1ZW0 A;  1ZXG A;  1FZC A;  1GL2 A;  2O01 J;  5KTB A;  1S1C X;  4DCK A;  1QEX A;  1NTZ E;  3A0H H;  2RH0 A;  1WT6 A;  3MUD C;  2FYU E;  3C1L A;  1R5S A;  2FFD B;  2GM4 A;  1RE3 A;  5TJH A;  1KYO E;  2KZJ A;  1HGZ A;  3R4Y A;  1UII A;  5B5E H;  2YXQ B;  1SQB E;  4LLH A;  1G1I A;  1NU1 J;  4H44 C;  5AW6 B;  3CPW O;  4XFJ A;  1H88 A;  2OTJ P;  1IFP A;  1T2K D;  2JWA A;  1L0L G;  2P58 A;  4HKZ H;  2Z4E A;  3L72 J;  3KQG A;  4XA4 A;  2C0X A;  3B5N D;  5CHX A;  4ASV A;  4I7Z B;  4C7N A;  1SQX D;  3L73 J;  1MKM A;  2OYO A;  3H1L G;  3RL0 g;  2ZAE B;  2H89 C;  1YJW P;  3V2R A;  5B66 H;  1G2C B;  5DJT B;  2WSF H;  3PP5 A;  5CBO A;  1L0L K;  1J1D B;  1SQP D;  2BCC J;  2W27 A;  3CL3 D;  1BDD A;  4GKG A;  5H2F E;  3SSU A;  3WU2 E;  1FJP A;  2FYU K;  2HOD B;  1NU1 G;  2AXC A;  2FXO A;  2JR8 A;  2NPS B;  1LTI C;  3F5H A;  1LWU C;  3PLN A;  4GIF A;  3H1I E;  2JO1 A;  1EXI A;  2QIW A;  1EZV E;  1L4A D;  2R3S A;  1KIL C;  4U3F E;  3H25 A;  1BE3 E;  3CCR P;  1KFM A;  1LTJ C;  1OVR A;  1SQV G;  2QSI A;  4HH2 A;  1FZF A;  3II6 A;  4L76 A;  1OWA A;  3H1K G;  1PL5 A;  1VF5 C;  1XTG B;  1YQ4 C;  2OYH A;  2QJY B;  2YO2 A;  4L75 A;  2HPC A;  2KUB A;  2D2C C;  5H2F H;  3D70 A;  1L4A A;  4EOT A;  3UIA A;  3FWL A;  1TU3 F;  3OA7 A;  3V2P A;  4D6T D;  1SQX J;  3L73 D;  3L75 D;  3L35 A;  3B5N B;  1K73 Q;  1EZV I;  2YMY A;  3WUU A;  1EC5 A;  1KQL A;  2WPR A;  5KLV E;  3H1H G;  3SWK A;  3CME P;  1QLE D;  2KOG A;  2PRR A;  3AEC C;  2Q3E A;  1JOC A;  1ZV8 A;  2JJL A;  4GOE A;  1M1J B;  1CZQ A;  1ZP0 C;  3JCU H;  1MV8 A;  3VN0 A;  3CCU P;  1VQK P;  1L0N E;  1VQN P;  1W5C E;  2KB7 P;  1Q86 Q;  2DW3 A;  4GT1 A;  1RH5 B;  2M5A A;  2Y9Z A;  1RE3 C;  2A45 I;  3U1C A;  1NTZ G;  3AE6 C;  3N4X A;  2RN0 A;  3VMA A;  4I6M C;  3Q3D A;  1FZA A;  2QJP B;  4PV1 B;  2KSJ A;  3L71 J;  2KP8 A;  1FZC C;  1VQ7 P;  2E75 C;  2ITA A;  3CCV P;  4WY4 A;  5KLI B;  1MZ9 A;  3BCC E;  2WMM A;  2YO3 A;  3IFM A;  3M9Q A;  3L74 G;  3WUV A;  2WQY C;  5AW4 B;  4OGQ D;  1RQV A;  1SQX E;  5TIS H;  1VQL P;  1NHL A;  1N7L A;  2M5A B;  3SWY A;  3W67 A;  5CCG D;  2OTL P;  2NPS D;  2RMZ A;  4YPC A;  3CXH E;  3M0D C;  1NAF A;  1HJB A;  3JCU E;  1DIP A;  3S1K A;  2P10 A;  1LWU A;  2HFE D;  3GW6 A;  1MFZ A;  2KZI A;  2NPS A;  2WIT A;  1HTL C;  1Q90 D;  4OVN F;  2YIU C;  1JUN A;  1FC2 C;  3H1K E;  3MIW A;  4U3F D;  4B86 A;  1QL2 A;  5CCG A;  1K8A Q;  4KHX A;  2P2U A;  5KJ7 D;  1A02 F;  1DD4 A;  3GG2 A;  3HTK A;  3AEA C;  3L75 E;  3WU2 H;  4IFM A;  2OYI A;  1N7S C;  2OTK E;  2IYP A;  2LR2 A;  5AW0 B;  2BEZ F;  2KIK A;  4H0L B;  1EZV G;  1PGQ A;  4N78 D;  5KJ7 A;  2HPC B;  2KSE A;  3AEB C;  3H1H J;  1GW3 A;  2E42 A;  1SQB K;  1W2B O;  3H1K J;  3N7N A;  1J1E C;  2WSE H;  1YIT P;  2Q3I A;  1AFO A;  2K9Y A;  2YNY A;  1SQX G;  1S9K D;  2J59 M;  2BCC E;  3AED C;  2QJK C;  3CXH H;  3A7O A;  4JYB A;  2FFD C;  2ZYG A;  3L71 E;  3H1I D;  5BVZ A;  1VQ5 P;  3RK3 B;  1KB9 I;  1T2K C;  1Q7Y Q;  1NTK J;  3H1I J;  1GL2 B;  4WY4 B;  1KN7 A;  1N86 A;  1Z56 A;  2Z5I A;  1BGY J;  3H1J E;  5KLV K;  4YXW H;  1YI2 P;  3L72 D;  1HGV A;  1NTZ D;  4M3L A;  5B66 E;  1YHQ P;  3E7K A;  1VDF A;  1SQQ J;  1G2C A;  2ZJS E;  3BRT B;  3E1I A;  4NPD A;  4O9B A;  5AVR B;  5KAI H;  3H1L J;  2QG4 A;  2KI7 B;  1YJ9 P;  1AA0 A;  1KC8 Q;  1M57 D;  3M91 A;  1AQT A;  1HH0 A;  5APT A;  1T6A A;  3L70 J;  3IF4 A;  4OWF A;  5AVU B;  2Y0C A;  2KNC B;  3Q1M A;  2J5U A;  5AVW B;  2FYZ A;  3V4W A;  3CCE P;  2O1K A;  2IBZ D;  1KIL B;  3V2Q A;  3MD0 A;  3QWO C;  1DX7 A;  2W90 A;  4IFF A;  1QGK B;  2YXR B;  3AE7 C;  4AYC A;  2E76 C;  5L8R J;  1N73 A;  3JSV C;  4EI2 A;  3B4S A;  3RK3 E;  3HD7 A;  3CX5 H;  5E79 E;  3G4S P;  4PD4 I;  3NFQ A;  1GU5 A;  1RF1 A;  3M9H A;  2OYH B;  3RK2 B;  1HJ0 A;  2M3B A;  3Q5S A;  1PV3 A;  1LGH B;  1SQQ D;  3RL0 C;  3PTZ A;  4QMA A;  1SQV E;  2OAR A;  3B5N C;  2M8R A;  3PJS K;  3CC7 P;  3ZDM A;  4L74 A;  2I8D A;  3ABV C;  3KZI H;  2B88 A;  3HE5 B;  2P1J A;  3G71 P;  5KKZ B;  2KLU A;  2C9L Y;  1RE4 C;  1URQ C;  4RO0 A;  1SQP J;  3CWB D;  3TSI A;  2XV5 A;  1YIJ P;  1SQQ E;  4Y28 J;  2PGD A;  2W8Z A;  3EQ2 A;  5E79 H;  4TT3 H;  3G9R A;  1EDI A;  3TF5 A;  3L72 E;  1H0T A;  1GTW A;  1LT1 A;  5GTI H;  1IC2 A;  1SLQ A;  1E79 H;  2JKV A;  2IYO A;  3CWB E;  4C7N B;  2E75 D;  1NTM E;  2QJP C;  2RKL A;  1IJD B;  2FBW C;  3TGU J;  1SQB D;  3H1J G;  1SVF A;  2E74 B;  2FY8 A;  1RF0 A;  2R32 A;  4Y99 C;  5CJ4 A;  1VQ6 P;  3GF7 A;  1YTZ I;  3LID A;  4NPF X;  2FYU D;  3AE4 C;  1NJI Q;  2WSC J;  4XE5 B;  1YYC A;  3M0A A;  1NTM D;  2V4H A;  1SFC D;  1NTK D;  3GHG C;  4JYC A;  2PAJ A;  1FE6 A;  2WT7 B;  2WPV B;  1LJ2 A;  3CI9 A;  1HF9 A;  1S3J A;  2I1K A;  2O1J A;  1E5W A;  4NPE A;  3HE4 B;  5KJ7 C;  2H8P D;  1SQV K;  5CJ0 A;  3MP7 B;  2N9B A;  5KAI E;  3V4Q A;  2Q9I A;  1LTA C;  2V7Q H;  3FGA D;  1S2E A;  3D6Y A;  2K3R A;  1SFC A;  2AEJ A;  1X8Y A;  1JM0 A;  1NTK E;  2M0B A;  4GDO A;  1USE A;  4UB6 H;  2VRS A;  4IOI H;  1BCC D;  3KHU A;  3A0B H;  3D6Z A;  1HVV A;  2W6J H;  4BRY B;  3CXH D;  1Y9B A;  1Q81 Q;  3H1L D;  1VPC A;  4H0L C;  1S9K E;  3CC2 P;  4BWN A;  1Y8A A;  1SQQ G;  2OGU A;  3GLM A;  1NKN A;  1AVO A;  1KOR A;  5K5G B;  5APX A;  3TGU E;  5KLV G;  1VQ9 P;  2N1T D;  4BRY A;  3V6I A;  2FYU J;  1IK7 A;  1J1E B;  2POH A;  1P84 I;  1BSN A;  2Q6Q A;  3TYY A;  3TDK A;  1PGP A;  3L72 G;  1M8O B;  1DD3 A;  1NTM K;  1CW5 A;  2E5Y A;  1K04 A;  5APQ A;  1IK9 A;  2ZT9 B;  1X0T A;  3GF3 A;  2E43 A;  1ZOY C;  4JF7 A;  1IFJ A;  1OX3 A;  1P84 E;  1FZG A;  1GK4 A;  1EDL A;  1GL2 C;  4WY4 C;  5BU8 B;  2IZ1 A;  3H1I G;  2N1T A;  3T97 B;  4EIJ A;  3ITK A;  3P8C D;  1RF1 B;  1T8Z A;  1KQG B;  3GHG A;  2P67 A;  4R4L A;  4CPG A;  5AVV B;  1FU1 A;  3KZI E;  1JB0 J;  3RK3 D;  3S4R A;  4D6T J;  2KK7 A;  3A0B E;  2MKV A;  3RL0 D;  1OMI A;  3BRV B;  5AW8 B;  1Q82 Q;  1GDT A;  1OZH A;  1JY2 O;  3BCC G;  3SFD C;  3C8V A;  3Q5P A;  2V7Q J;  1X9V A;  2IBZ E;  2I1J A;  1JTH A;  1N7S D;  2YKO A;  3H6P A;  4N6J A;  1OW8 A;  1VQM P;  4W7Z A;  1LTG C;  5AW5 B;  4WVZ A;  3AE5 C;  1USD A;  4OGQ C;  2HLO A;  5APS A;  4PD4 E;  2OYI C;  2XND H;  2QA4 P;  1R5L A;  2B9B A;  2WZ7 A;  3HD7 D;  4JPZ B;  1SFC B;  3L70 D;  4I7Z C;  3PH0 A;  4PV1 D;  3TNU A;  4ASW A;  1AJY A;  3CX5 D;  1YBK A;  3A0H E;  3AEG C;  1N2D C;  3AE1 C;  3EFF K;  4UB8 H;  2ZXE B;  2ZFC A;  3FXE A;  3VP8 A;  1RY3 A;  3WUT A;  4GOD A;  1NWQ A;  4W7Y A;  2FXM A;  2NZ2 A;  1JTH B;  3L74 J;  5AVT B;  1KIL E;  1CI6 A;  1RE4 A;  3LIE A;  5CMZ A;  3CWB G;  1BGY D;  3CCQ P;  4YTP C;  2LXB A;  1S5L E;  2FXP A;  1LTJ B;  2PP6 A;  5CBN A;  3MUD A;  4OH8 B;  5C39 A;  1N8R Q;  2XKM A;  2WPQ A;  3MZW B;  1PFI A;  1GW4 A;  1OVV A;  3A5T A;  5KAF E;  1NTZ K;  1FDO A;  3IR9 A;  3MHV A;  5KKZ C;  2N1T B;  3T97 A;  1URQ B;  1ZLL A;  2KS1 B;  2AXT E;  1JY3 N;  1L0N K;  1Q2N A;  3B8E B;  1OW6 A;  3E1R A;  5GTI E;  1JY2 N;  3KXD A;  3L71 G;  2E74 D;  1FAV A;  3VP9 A;  1FS0 E;  1NVO A;  1SS1 A;  2G3A A;  2QE7 H;  5CCH D;  1JO5 A;  2WSS H;  3HTK B;  1IFN A;  4U7J A;  1KIL A;  2A45 G;  1H0T B;  1QX8 A;  2Y0E A;  2ZYA A;  3RBX A;  2HYN A;  1U7J A;  3AE8 C;  1FOS E;  1AVY A;  3VOP A;  2AEF A;  4Z1M H;  1P84 D;  4DZO A;  1H8A A;  1BSH A;  3U1A A;  1BE3 D;  3L37 A;  5AVS B;  1NH4 A;  3BAT A;  3WMM 0;  3HE5 A;  1PPJ E;  1IFI A;  1ZME C;  3L75 G;  1SQB J;  2MJZ A;  4LC1 A;  3H1H D;  5APV A;  1M90 Q;  1PIX A;  2A06 E;  2FYN B;  3CX5 E;  3VYI A;  1VF5 B;  2AXT H;  2YMK A;  3G3Z A;  1EQ7 A;  1BGY G;  1IZN B;  2D2C B;  2AEM A;  3KYQ A;  1JMM A;  3HD7 B;  4C7R A;  1VQP P;  3VTP C;  3L73 E;  3BAS A;  4MN4 C;  1NTK K;  5AW9 B;  5GTH H;  5AW7 B;  3RK2 D;  2K9J B;  3VMY A;  1YJN P;  3AE2 C;  3H32 A;  3O6Q A;  1NU1 K;  3RGU A;  1MUU A;  5KLV J;  2XNX A;  1LTB C;  2BCC G;  1YTZ T;  2M3E A;  1K05 A;  1RQU A;  2XZR A;  3FXD A;  1SQQ K;  3I5C A;  3P8C E;  1U7M A;  3P8M C;  3AEE C;  5BU5 A;  1W2E A;  3M9B A;  5AVX B;  1M1J C;  2IZ0 A;  3CX5 I;  4RKU J;  4U3F J;  5DJU B;  4HJG H;  2OQQ A;  1LT9 C;  2HG5 D;  2JWD A;  3OAK A;  2W83 C;  3CCL P;  1L0L J;  1N7S A;  2YKQ A;  2A06 G;  3H1K D;  1KB9 E;  3C9I A;  4ZNC A;  2Y9Y A;  1GK6 A;  3H32 B;  3O6Q B;  1S5L X;  1URQ D;  2K9J A;  3B5N A;  3B71 A;  4PV1 C;  1EDJ A;  1EXJ A;  3I55 P;  1VL2 A;  2O01 H;  3NMD A;  3I56 P;  2C9N Y;  1QVF O;  2E75 B;  2IBZ I;  1BGY E;  1L4A B;  2FKW B;  3LW5 J;  5KLI C;  1URQ A;  2KS1 A;  2J58 A;  1RF1 C;  2QRX A;  1EDK A;  1XTC C;  2KYV A;  3EWK A;  2ZXX A;  2WVR A;  4I1L A;  3SWF A;  5APY A;  1GU4 A;  1KZU B;  1T3U A;  2Q7C A;  1PPJ D;  3K5B A;  1NTK G;  2IPP A;  5AVQ B;  5KAF H;  1BDC A;  3AE3 C;  3KDP B;  2ZYD A;  5AW1 B;  2ZVN B;  1BE3 G;  4IL6 X;  1DEE G;  3L70 E;  3KPE A;  2K88 A;  1CI6 B;  3L74 E;  1BCC J;  1SQX K;  1EZV D;  1U57 A;  3U59 A;  2H7H A;  3CD6 P;  4TLF A;  1ZN5 A;  3JC2 2;  3G6E P;  4YXD C;  2R5B A;  3CCS P;  2Q1K A;  3H1J J;  1OXZ A;  2QM7 A;  4KJM A;  1L0L D;  1SQP K;  1Y47 A;  1N73 B;  2OYI B;  4UB6 E;  1JY2 P;  1SFC C;  1GMJ A;  1N7S B;  3CXH I;  3MGN A;  4PJ0 H;  4UB8 E;  3TK1 A;  3TNU B;  3MTU E;  4BXL A;  4LGD E;  1UIX A;  2JDI H;  1M1K Q;  1M7L A;  1T3J A;  2PFX A;  2R5D A;  5AVZ B;  3SFE C;  4DJG A;  1DH3 A;  2O01 N;  3RBZ A;  2B89 A;  5AVY B;  1VF5 D;  1L0L E;  2QVA A;  3M0D A;  2XDJ A;  1S5L H;  1RHZ B;  4WY4 D;  2HR3 A;  4C46 A;  1KQF B;  1IO4 A;  4PD4 D;  1MFT A;  3HUS C;  1X79 B;  4H13 C;  1LTJ A;  2QJK B;  4H13 D;  1HUC A;  1P84 H;  3TGU D;  1L0N G;  3RK3 C;  4H0L D;  3CCM P;  1FZB A;  4WBA A;  2IFM A;  1NYH A;  2KLV A;  2ZT9 D;  2BEQ D;  1GZL A;  1KQS O;  2N1T C;  5GTH E;  1NOH A;  1BCC E;  1KIL D;  1NTM G;  1PP9 G;  3OJA B;  5M1B A;  1FZE A;  3H1H E;  4H44 B;  1R8E A;  2H43 A;  2OYH C;  5CCH A;  1HBW A;  3CMA P;  2IBZ G;  4PJ0 E;  5EFW B;  1OIP A;  2Z5H A;  2O3J A;  4K35 A;  1LTS C;  3HUS A;  1SQV J;  3W68 A;  3EFG A;  2B87 A;  4IL6 E;  4ZMD A;  1RF0 C;  1GL2 D;  1S4X A;  1G1J A;  1SQV D;  3NTN A;  2D2C D;  2N9Y B;  1FBM A;  1M1J A;  3A2A A;  3QH9 A;  4N3Y B;  4U3F G;  3O8Z A;  4H44 D;  2L91 A;  1S72 P;  2CPS A;  1VQO P;  3VMZ A;  4RJT A;  3L70 G;  2IFN A;  2SPZ A;  2QEX P;  1NO4 A;  1JMB A;  1J2J B;  2A45 H;  2BAS A;  2WSC H;  3P32 A;  3AEF C;  2E76 B;  4D6T G;  4DT0 A;  1PZQ A;  4EDF A;  1J1D C;  1VQ4 P;  1OFC X;  2BCC D;  3H1L E;  4HYT B;  1FOS F;  3M06 A;  2FYN C;  2CPB A;  4JBZ A;  3L4F A;  1ZRT E;  2NPS C;  3HE4 A;  1NTM J;  4N78 E;  1LWU B;  3Q5R A;  4A7P A;  3RK2 C;  1SP4 A;  1BCC G;  3HD7 C;  3BVH A;  2KXP B;  3NXS A;  4AQR D;  2IX7 C;  3RL0 B;  2W6A A;  3CLQ A;  1VQ8 P;  2CK3 H;  1M56 D;  1PGJ A;  3A3Y B;  2Y0D A;  2K1A A;  4IL6 H;  2WPS A;  3L74 D;  1NGM B;  3CCJ P;  2FFD A;  2C0W A;  3OW2 O;  5TIS E;  5CCH C;  1ZRT D;  4RES B;  2A06 D;  3D71 A;  4GOF A;  4K3A A;  1WRG A;  1WMK A;  1NU1 D;  2QJY C;  4I2L C;  3Q2Y A;  3CC4 P;  2KNC A;  2LKM A;  1LTT C;  2HOD A;  3USS A;  1OVU A;  1SQB G;  1L0N D;  2E5T A;  3H1J D;  3R2P A;  3V2N A;  3L75 J;  4L73 A;  1LT9 B;  1LP1 B;  4ZKU A;  2NRG A;  2FYU G;  2P7J A;  1KV4 A;  3HRN A;  2L5G B;  1IFM A;  4WB4 A;  1OW7 A;  4Y99 B;  3P7K A;  1LT9 A;  1LNQ A;  5AW3 B;  1AV1 A;  1DEB A;  1HWT C;  1JCD A;  2YKP A;  3L73 G;  2E74 C;  1L4A C;  1SQP E;  3BCC D;  3IN6 A;  3FWN A;  3LW5 H;  4PD4 H;  3V5B A;  2WT7 A;  1ZR2 A;  4IFD K;  2H88 C;  1PP9 J;  1L2P A;  2JEE A;  2Q5U A;  4HB1 A;  1X22 A;  1JY3 P;  3GMA A;  4WWI A;  3S9O A;  1FDM A;  1FJK A;  1A02 J;  2WWW A;  1CSB A;  5APW A;  1JCC A;  3GHG B;  2IDB A;  4W80 A;  1PPJ G;  2UWJ E;  1IFD A;  1FZC B;  2QM8 A;  5KLV D;  3VMX A;  2WSF J;  2GUV A;  3L36 A;  1NTZ J;  3IAO A;  2K37 A;  1ZR4 A;  1K9M Q;  5AW2 B;  4AUW A;  1JY3 O;  2R44 A;  3CWB J;  1N73 C;  1L0N J;  4D6T E;  1H89 A;  2GUS A;  1GD2 E;  1QL1 A;  1JEK A;  2GA1 A;  3TGU G;  5CCG C; 
#chains in the Genus database with same CATH homology
 1JNM A;  2WTY A;  1NKZ B;  2W6B A;  2R3C A;  5APU A;  4ZKP A;  3HUS B;  1AQ5 A;  4DOJ A;  1KFN A;  2XU6 A;  1FZC A;  1GL2 A;  5KTB A;  1WT6 A;  2FFD B;  2GM4 A;  1RE3 A;  1HGZ A;  4LLH A;  1G1I A;  5AW6 B;  1H88 A;  1T2K D;  2Z4E A;  3KQG A;  4XA4 A;  2C0X A;  3B5N D;  5CHX A;  4C7N A;  3V2R A;  1G2C B;  2WSF H;  3PP5 A;  1L0L K;  1J1D B;  3CL3 D;  2W27 A;  4GKG A;  1FJP A;  2FYU K;  2HOD B;  4GIF A;  2NPS B;  1LTI C;  1LWU C;  1L4A D;  1KIL C;  1KFM A;  1LTJ C;  4HH2 A;  1FZF A;  3II6 A;  1OWA A;  1XTG B;  2OYH A;  2YO2 A;  2HPC A;  1L4A A;  4EOT A;  3UIA A;  3OA7 A;  3V2P A;  3L35 A;  3B5N B;  2YMY A;  1KQL A;  2WPR A;  2KOG A;  1JOC A;  1ZV8 A;  2JJL A;  1M1J B;  1CZQ A;  3VN0 A;  1MV8 A;  2KB7 P;  4GT1 A;  1RE3 C;  2A45 I;  3U1C A;  3N4X A;  4I6M C;  1FZA A;  2KSJ A;  2KP8 A;  1FZC C;  4WY4 A;  1MZ9 A;  2YO3 A;  3IFM A;  3M9Q A;  5AW4 B;  1NHL A;  1N7L A;  3SWY A;  5CCG D;  2NPS D;  3M0D C;  1NAF A;  1HJB A;  1LWU A;  2HFE D;  1MFZ A;  2NPS A;  2WIT A;  1HTL C;  1JUN A;  3MIW A;  4B86 A;  5CCG A;  1QL2 A;  4KHX A;  2P2U A;  5KJ7 D;  1A02 F;  3HTK A;  4IFM A;  2OYI A;  1N7S C;  5AW0 B;  4N78 D;  5KJ7 A;  2HPC B;  1GW3 A;  2E42 A;  1SQB K;  3N7N A;  1J1E C;  2WSE H;  2Q3I A;  1AFO A;  2YNY A;  1S9K D;  2J59 M;  3A7O A;  4JYB A;  2FFD C;  5BVZ A;  1T2K C;  3RK3 B;  1GL2 B;  4WY4 B;  1N86 A;  1Z56 A;  2Z5I A;  5KLV K;  1HGV A;  4M3L A;  5AW1 B;  1VDF A;  3BRT B;  1G2C A;  3E1I A;  4O9B A;  5AVR B;  3M91 A;  1HH0 A;  5APT A;  5AVU B;  5AVW B;  2FYZ A;  3V4W A;  2O1K A;  1KIL B;  3V2Q A;  3MD0 A;  1DX7 A;  4IFF A;  1N73 A;  4AYC A;  3HD7 A;  3NFQ A;  1GU5 A;  1RF1 A;  3M9H A;  2OYH B;  3RK2 B;  2M3B A;  1LGH B;  3RL0 C;  2OAR A;  3B5N C;  2M8R A;  3HE5 B;  2P1J A;  2C9L Y;  1RE4 C;  1URQ C;  3TSI A;  2XV5 A;  3EQ2 A;  1GTW A;  1IC2 A;  1SLQ A;  4C7N B;  1IJD B;  1SVF A;  2R32 A;  5CJ4 A;  1RF0 A;  3LID A;  1YTZ I;  4XE5 B;  1YYC A;  3M0A A;  1SFC D;  3GHG C;  4JYC A;  2PAJ A;  2WT7 B;  3CI9 A;  2I1K A;  2O1J A;  1E5W A;  3HE4 B;  5KJ7 C;  2H8P D;  1SQV K;  5CJ0 A;  3V4Q A;  2N9B A;  2Q9I A;  1LTA C;  1SFC A;  1X8Y A;  4Y99 C;  2VRS A;  1HVV A;  1VPC A;  1S9K E;  1NKN A;  5APX A;  2N1T D;  1J1E B;  2POH A;  3TYY A;  1CW5 A;  1NTM K;  5APQ A;  1IK9 A;  2E43 A;  1FZG A;  4JF7 A;  1IFJ A;  1GK4 A;  1GL2 C;  4WY4 C;  5BU8 B;  4EIJ A;  1RF1 B;  2N1T A;  1FDM A;  3P8C D;  1T8Z A;  3GHG A;  2P67 A;  5AVV B;  1FU1 A;  3RK3 D;  3RL0 D;  3BRV B;  5AW8 B;  1GDT A;  1JY2 O;  1X9V A;  2I1J A;  1JTH A;  1N7S D;  2YKO A;  3H6P A;  4N6J A;  4W7Z A;  1LTG C;  5AW5 B;  2HLO A;  5APS A;  2OYI C;  2WZ7 A;  3HD7 D;  1SFC B;  3TNU A;  1N2D C;  2ZXE B;  2ZFC A;  3VP8 A;  1RY3 A;  1NWQ A;  4W7Y A;  2FXM A;  1JTH B;  5AVT B;  3LIE A;  1CI6 A;  1RE4 A;  5CMZ A;  2PP6 A;  1LTJ B;  3MUD A;  4OH8 B;  2XKM A;  2WPQ A;  1PFI A;  1GW4 A;  3A5T A;  1NTZ K;  3IR9 A;  2N1T B;  3T97 A;  1URQ B;  1ZLL A;  1JY3 N;  1L0N K;  3B8E B;  1JY2 N;  1FAV A;  3VP9 A;  5CCH D;  1JO5 A;  3HTK B;  1IFN A;  1KIL A;  2A45 G;  2HYN A;  1FOS E;  3VOP A;  4DZO A;  1H8A A;  3U1A A;  3L37 A;  5AVS B;  1NH4 A;  3BAT A;  3WMM 0;  3HE5 A;  1IFI A;  2MJZ A;  4LC1 A;  5APV A;  3VYI A;  3G3Z A;  1EQ7 A;  3KYQ A;  1JMM A;  3HD7 B;  4C7R A;  3VTP C;  3BAS A;  1NTK K;  5AW9 B;  5AW7 B;  3RK2 D;  3VMY A;  3H32 A;  1NU1 K;  1MUU A;  2XNX A;  1LTB C;  1YTZ T;  2XZR A;  3I5C A;  3P8C E;  1SQQ K;  3P8M C;  5BU5 A;  1W2E A;  3M9B A;  5AVX B;  1M1J C;  1LT9 C;  2HG5 D;  3OAK A;  1N7S A;  2YKQ A;  3C9I A;  1GK6 A;  3H32 B;  1URQ D;  3B5N A;  2O01 H;  3NMD A;  2C9N Y;  1L4A B;  2FKW B;  1URQ A;  1RF1 C;  3SWF A;  1XTC C;  2KYV A;  4I1L A;  5APY A;  1GU4 A;  1KZU B;  1T3U A;  2Q7C A;  5AVQ B;  2IPP A;  3KDP B;  3KPE A;  1CI6 B;  2H7H A;  1SQX K;  3U59 A;  1ZN5 A;  2R5B A;  1OXZ A;  2QM7 A;  1SQP K;  1N73 B;  2OYI B;  1JY2 P;  1SFC C;  1N7S B;  3TK1 A;  3MGN A;  3TNU B;  3MTU E;  4LGD E;  1M7L A;  1T3J A;  2R5D A;  5AVZ B;  1DH3 A;  5AVY B;  3M0D A;  2XDJ A;  4C46 A;  4WY4 D;  1IO4 A;  3HUS C;  1X79 B;  1LTJ A;  1HUC A;  3RK3 C;  1FZB A;  4WBA A;  2IFM A;  2KLV A;  1GZL A;  2N1T C;  1NOH A;  1KIL D;  3OJA B;  1FZE A;  2OYH C;  2H43 A;  1HBW A;  5CCH A;  2Z5H A;  1LTS C;  3HUS A;  3EFG A;  1RF0 C;  1GL2 D;  3NTN A;  1G1J A;  3A2A A;  4N3Y B;  1FBM A;  1M1J A;  3O8Z A;  2CPS A;  3VMZ A;  2IFN A;  1NO4 A;  3P32 A;  1J2J B;  2A45 H;  2BAS A;  2WSC H;  1J1D C;  4HYT B;  1FOS F;  3M06 A;  2CPB A;  3L4F A;  2NPS C;  3HE4 A;  4N78 E;  1LWU B;  3RK2 C;  1SP4 A;  3HD7 C;  3BVH A;  3NXS A;  4AQR D;  2IX7 C;  3RL0 B;  2W6A A;  3CLQ A;  3A3Y B;  2WPS A;  2FFD A;  2C0W A;  5CCH C;  4RES B;  1WRG A;  4I2L C;  2LKM A;  1LTT C;  2HOD A;  3R2P A;  3V2N A;  1LT9 B;  4ZKU A;  2P7J A;  3HRN A;  2L5G B;  1IFM A;  4WB4 A;  4Y99 B;  3P7K A;  1LT9 A;  5AW3 B;  1DEB A;  1HWT C;  1JCD A;  2YKP A;  3V5B A;  1L4A C;  3LW5 H;  4IFD K;  2WT7 A;  1ZR2 A;  2JEE A;  2Q5U A;  1JY3 P;  1FJK A;  1A02 J;  2WWW A;  1CSB A;  5APW A;  1JCC A;  3GHG B;  4W80 A;  1FZC B;  1IFD A;  2QM8 A;  3VMX A;  3L36 A;  2GUV A;  1ZR4 A;  5AW2 B;  4AUW A;  1JY3 O;  1N73 C;  1H89 A;  2GUS A;  1GD2 E;  1QL1 A;  2J58 A;  5CCG C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...