3B5NA

Structure of the yeast plasma membrane snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
61
structure length
61
Chain Sequence
GSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Synaptobrevin homolog 1
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Membrane protein
total genus 28
structure length 61
sequence length 61
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nA00
4W80A 1JTHB 5CCHD 1XTGB 2NPSD 1JTHA 3B5NC 3RL0D 3B5NB 1HVVA 3RK2D 3B5NA 1GL2C 5KJ7D 1GL2B 3HTKB 1GL2A 1KILD 5CCGC 5CCGA 4WY4D 4JF7A 1URQD 1L4AD 3RL0B 1N7SD 2N1TD 3KYQA 4W7YA 1NHLA 1SFCC 3P8CE 3RK3D 1SFCB 3VOPA 4LGDE 1SFCA 2PP6A 4N78E 3M0DC 3B5ND 3HD7C 1T3JA 3HD7B 1GL2D 5CCHC 3HD7A 2NPSC 2KOGA 2NPSB 3RL0C 5CCHA 3RK2C 2NPSA 5CCGD 3RK2B 2XDJA 1L4AB 5KJ7C 1L4AA 5KJ7A 1KILC 2HG5D 2WZ7A 1KILB 1KILA 4WY4C 2HFED 4WY4B 4OH8B 4WY4A 1URQC 1SFCD 2YMYA 1URQB 4W7ZA 1L4AC 1URQA 1N7SC 2N1TC 3PP5A 3TSIA 1N7SB 2N1TB 2H8PD 1N7SA 2N1TA 3RK3C 3HD7D 2M8RA 3RK3B
chains in the Genus database with same CATH superfamily
1SLQA 1XTGB 3G9RA 2E74D 4N3YB 1L0NJ 1LTGC 2YXQB 2QG4A 1VQ4P 3N4XA 2IYOA 4DCKA 3L75D 3L71J 3V2NA 3N7NA 4H13C 3CWBE 1KILD 2D2CC 1K9MQ 3TK1A 2KZJA 1HH0A 3H1JD 4RO0A 1VQ8P 2WVRA 3L72E 2LXBA 3RL0B 1EDLA 1KYOI 1K73Q 3VMXA 2YKOA 4EDFA 3CLQA 2IYPA 1BGYD 2JWAA 3PTZA 2KB7P 1LTBC 3ZDMA 1BE3G 1RQVA 2E74C 2QJKB 1VL2A 2OYIC 4KHXA 1NYHA 3V2RA 1KILC 2HG5D 2FFDC 1K04A 3AECC 1Q90D 3NTNA 1R5LA 1QX8A 2Z4EA 3V2PA 1S5LH 3L74E 2O1JA 1EZVD 2A45G 2Q9IA 2QA4P 2ZVOB 1OVVA 2AXTH 1VQ9P 1L0LK 1M8OB 1VQLP 1L0NG 5AW3B 5CCHD 1RF1A 4N78D 2L5GB 3L71G 1OWAA 3B5NB 1DX7A 2IPPA 1M57D 3HTKB 4ZKPA 1NTKE 3VMAA 3MGNA 4IL6X 1H0TA 1OIPA 1E79H 1RHZB 5L8RJ 4JQ0D 1R8EA 3CX5H 2OTJP 2ZJSE 3C1LA 3AE8C 3L70E 3RBZA 3HUSC 2N1TD 3O6QB 4JPZB 1KQLA 2HLOA 4NPEA 3SWFA 1FU1A 3BRTB 1M7LA 3RK3D 3Q5RA 2PAJA 1CSBA 2KXPB 2BEQD 2W8ZA 1PPJE 5CCHC 1SQBE 3L73J 1LWUA 2KLUA 2NPSB 1JCDA 2NZ2A 2HODA 3AE1C 2OTLP 2AEMA 1SP4A 1PGJA 1BSHA 3CWBD 5AW5B 2C9LY 3AE2C 3EFGA 2E76B 2BEZF 3L72D 3SWKA 2WWWA 4GODA 1IJDB 2N1TC 3PP5A 4ZNCA 4B86A 1EDJA 1N7SB 1S3JA 1NJIQ 1HGZA 4EIJA 1KYOD 2Y0EA 3RK3C 5C39A 1Y9BA 1DD4A 2M5AA 1JY2P 1JTHB 4KJMA 3TGUE 5TISH 1OW7A 4GOFA 3AEFC 4IL6H 1NTMK 1SQQJ 4HB1A 3GW6A 3EQ2A 2QM8A 1BE3E 2Z5HA 4QMAA 1FJPA 1Q7YQ 3HE5A 1FE6A 3L74D 2OYOA 5DJTB 2CPSA 2PP6A 4GIFA 5AVRB 1OMIA 2FFDB 1JY2N 2IX7C 3L73G 3M0AA 2BCCJ 5M1BA 4UB8E 1G1IA 2A45I 3U59A 2E42A 1NTKD 2FY8A 1ZN5A 4PD4I 3L71E 4PD4E 2W27A 1ZOYC 3L70D 4W7ZA 3VMZA 1LGHB 1EQ7A 1GK4A 1RF1C 3AE5C 1MV8A 2G8YA 2UWJE 2OQQA 1BDDA 5AVVB 1NU1J 1N2DC 1IFDA 1PPJD 2WPQA 1SQBD 3HUSB 1FZEA 1SQQG 1MKMA 3CXHI 4XFJA 5AW8B 3K5BA 3CXHE 3KZIE 4ASWA 2K9YA 3D70A 2QJPC 2C0WA 1OVUA 3KXDA 5APVA 2E43A 2ZYDA 2ZXEB 4RKUJ 1SFCA 1IK9A 5E79E 1Q86Q 1GU5A 1U57A 3BCCJ 1T6AA 1VQPP 1FZGA 1VQNP 3HD7A 3TGUD 1PIXA 2O01N 3PJSK 4RJTA 2XZRA 3OW2O 2A06E 4DT0A 2DW3A 4DOJA 4XA4A 3L35A 1BCCJ 1KB9H 1E5WA 4OH8B 1BE3D 3MD0A 2BASA 1NO4A 4WVZA 4HKZH 1URQB 2YMKA 3SWYA 1JO5A 2RKLA 3M9HA 2OYHA 2P1JA 5B66H 5H2FE 3H1HG 4C46A 2Y0DA 1YJNP 3D6ZA 1HVVA 2HR3A 1JMBA 4Y99B 1LT9A 3VMYA 1GL2B 2JDIH 1JEKA 3F5HA 3M91A 3SFDC 1LP1B 1KN7A 1LTJA 3AE6C 2WSEH 2ZT9B 3H32B 2K88A 3L73E 2Y0CA 1KZUB 1L0LJ 2VRSA 3L71D 4U7JA 2WITA 4PD4D 3KYQA 3A0HE 4I7ZC 1ZXGA 3BCCG 2FYUK 1AJYA 3H1IG 2XU6A 5CJ4A 4C7RA 5AW4B 1WMKA 3WU2H 2ZVNB 1JY3O 3HE4A 1ZLLA 5CBOA 1LJ2A 1PP9G 1M1KQ 2XNDH 1GW4A 3A7OA 2B87B 1L4AA 3IN6A 3CXHD 1QVGO 1G1JA 2PFXA 2O3JA 3HRNA 3CCUP 4AUWA 1OXZA 1SFCD 4IFMA 3Q5PA 2IBZG 5AVXB 1SQQE 1VPCA 3T97A 5TJHA 1SS1A 1SQVE 2QEXP 3HD7D 3KDPB 3S1KA 4GDOA 3CCEP 2KS1B 3GLMA 3V4WA 1VF5D 1NKNA 5CJ0A 3KHUA 1IO4A 4C7NA 2K9JB 2A06D 2BCCE 5BVZA 4K3AA 3G4SP 5AW1B 1L0LG 2K3RA 3GHGB 2RN0A 3WUUA 1LT1A 2E75D 4PV1D 5GTHE 4IFDK 1N73B 1IFNA 1PGOA 3CC4P 3LIEA 1GD2E 1SFCC 3EWKA 2C9NY 4EYYQ 1FZCB 3HD7C 1K8AQ 4YPCA 3IR9A 3TNUA 2XDJA 1VF5C 4BRYA 5KAFE 4N6JA 1NU1E 2HPCB 2KNCA 1W2BO 3L73D 1NTKK 4UB6H 3A0BH 3EFFK 1EDIA 2P7JA 2E75C 5AVQB 4PV1C 1J1EB 4ZMDA 1FZAA 4H44D 5APYA 5KLVK 2QM7A 2AXCA 1S1CX 3H1KD 2Q5UA 1LT9C 2JJLA 3ITKA 3TDKA 2WSFH 2H43A 1UIIA 2JWDA 2FXPA 1EC5A 1LTJC 1G2CA 1RE4C 1QVFO 3D6YA 3BCCE 3FX0A 1SQBK 3IAOA 4OGQD 3GF7A 4DJGA 1RH5B 2YNYA 3VP8A 2OTKE 3M9BA 3O8ZA 1YJWP 1DEBA 1AQTA 1KYOH 1LTAC 1SQQD 1GZLA 5AVZB 4H44C 1BCCE 5AW9B 1M1JB 1KD1Q 1SQVD 1MUUA 4JBZA 2YIUC 2J58A 1IC2A 1QLED 1OFCX 4GT1A 1YQ3C 1IZNB 1PGPA 2PRRA 4ZKUA 2IBZE 3AEBC 2RMZA 4U3FJ 3AE9C 1HJ0A 3H1JJ 2BCCD 4OGQC 1QL1A 4WY4B 4R4LA 1HUCA 3M06A 5TISE 1P84I 2P10A 1P84E 1S72P 2IFNA 1GDTA 1JMMA 3AEDC 3VP9A 1L0LE 3RGUA 1MFTA 2W6JH 2QJYC 3RK2D 1YYCA 2P2UA 3SSUA 2XV5A 2KIKA 5KTBA 1FZFA 3CCLP 2M3BA 3QH9A 4H13B 5CHXA 3G71P 2D2CB 3CCRP 3RL0g 4PJ0E 4JF7A 3CCJP 1YIJP 3AE7C 4LC1A 3BVHA 1NU1D 1DEEG 1FOSF 2R32A 3CMAP 3LW5H 2KI7B 1SQPK 1CW5A 1NTZK 4H0LD 3MTUE 2KP8A 1Y8AA 1AA0A 2XNXA 2O01H 1USDA 2N9BA 3L75G 4HH2A 2E74B 3RK2C 4K35A 2FYNC 2Y9ZA 1JB0J 4U3FG 3U1AA 2OYIB 2K1AA 3H1JG 5DJUB 4LLHA 4JYCA 1KILB 2C0XA 2HFED 2JP3A 2FYUJ 4I6MC 1PV3A 2WT7B 2WQYC 1NAYA 5BU5A 3TSIA 3WMM0 1ZR4A 1BSNA 2QSIA 4JYBA 4H0LC 2QE7H 2N9YB 3I56P 1BCCD 2L91A 1EXIA 1L0NE 1MFZA 3CCQP 1YBKA 2YKPA 1X79B 3NFQA 4KT0J 3H25A 2K37A 2ZXXA 3B5NA 3IFMA 1ZRTE 3WUVA 3HTKA 2W83C 1H8AA 2IBZD 1U7MA 4YTPC 1JY3P 5CCGA 2POHA 4I2LC 5GTIE 1JOCA 2P67A 1HWTC 2RH0A 4EOTA 1SQXJ 3JCUH 1ZMEC 3H1HJ 2G3AA 5KKZC 1CI6B 2ZYGA 1L2PA 3O6QA 3P8CE 5AW6B 3B4SA 1P84D 1WT6A 2FBWC 5AW2B 1X8YA 2AEFA 1L0LD 3NMDA 1A02F 2A45H 3KPEA 2NPSA 3VYIA 3FWLA 2GA1A 5KLIC 1VQOP 4I1LA 4ASVA 1JY3N 3Q5SA 1EDKA 2FYUG 4PD4H 3L36A 3H1IJ 1LWUC 2KYVA 1VQKP 2XKMA 2AEJA 2MJZA 2CK3H 2W6AA 1OW8A 1PP9J 2N1TB 3C8VA 2WSCH 1N7SA 1ZP0C 3RK3B 1K05A 2I8DA 1JTHA 2HYNA 1DH3A 3E7KA 2WSSH 3CWBG 1QGKB 3CXHH 3VTPC 4OWFA 1D7MA 3FXDA 1A02J 1SQXG 1YI2P 4TT3H 1KQGB 3VN0A 1H89A 2WMMA 3JC22 5KLVJ 4YXDC 3AE4C 1H88A 1NHLA 1N7LA 4U3FE 1YJ9P 1PGQA 5E79H 3H1JE 1IFJA 1S9KE 3B5ND 2FFDA 1AVYA 3PRJA 1L0ND 4D6TJ 1X9VA 2QJKC 1SQVK 1N8RQ 5CCGD 3GG2A 1KTMA 4M3LA 1ZRTD 5KAIE 1CZQA 1VQ5P 3W68A 1HJBA 2I1JA 3AEEC 1LNQA 1HTLC 3L74G 1NKZB 3MP7B 5B5EE 1S2EA 2R5BA 4GOEA 2H8PD 2P58A 3P8CD 1RF1B 5CMZA 3G3ZA 1AQ5A 2NPSD 3D71A 3B5NC 1JNMA 1IK7A 1YTZI 1LTTC 1NTKG 3HUSA 1H0TB 1RE3A 1X22A 5CCGC 2H89C 1VQ7P 3CCSP 2E76D 3L37A 5APTA 5KLVG 2ZFCA 3A0HH 1MZ9A 2QJPB 1FAVA 1N7SD 2YXRB 2R3CA 3JSVC 1NU1K 3CCVP 1GW3A 2GUVA 4D6TG 1NVOA 1ZW0A 2FYUE 3R4YA 1KFMA 2ZAEB 1SQBG 1LWUB 2NPSC 1DIPA 3E1RA 2HODB 4UB6E 1NH4A 1J1DC 1FOSE 2JKVA 2LXCB 2WPSA 4O9BA 3CC2P 4Z1MH 3CCMP 2E76C 1SQPJ 1VQMP 3G6EP 1NTZJ 1NTMJ 3H1LJ 2OARA 4MN4C 1S5LE 1Z56A 2QVAA 3CL3D 1RQUA 1URQA 3RBXA 1N7SC 2LKMA 2FYZA 2M5AB 1IFIA 4U3FD 2CPBA 2AXTE 3V6IA 4BXLA 3TGUG 1SQXE 3H1HE 2NRGA 1S9KD 2WSCJ 2IFMA 3IF4A 4OVNF 1FZBA 2B89A 1KYOE 1GL2A 1LP1A 2OYHC 3MUDA 3CMEP 3A2AA 2Q3EA 3H32A 3CX5I 1T2KD 5GTHH 1U7JA 3CX5E 3HE5B 1L4AD 1PL5A 2YKQA 4I7ZB 5AW7B 4LGDE 2J59M 3C9IA 3H1IE 3LIDA 4XE5B 1T3JA 4L76A 2WSEJ 2FXOA 5APQA 1PP9E 5KAFH 3BATA 3F89A 2Q6QA 1SQPG 2B87A 5KJ7A 2WZ7A 1FS0E 1NTZG 1NTMG 3H1LG 3PHLA 2E5TA 2KSEA 4CPGA 4YXWH 3OA7A 1T2KC 1ZV8A 2IBZI 4IFFA 1M90Q 3L75J 1L4AC 3P8MC 4DZOA 3V4QA 1QEXA 5KLVE 1FDOA 2FYUD 2R3SA 4Y28J 3PH0A 4RESB 2KS1A 1QL2A 1RE3C 3TF5A 4IL6E 2K9JA 1S4XA 2MKVA 4D6TE 1USEA 1BGYJ 1TU3F 4L74A 2IDBA 1UIXA 1Q2NA 1URQD 4GKGA 3GHGA 1IFPA 5AVTB 2V7QH 2JO1A 3AE3C 1N73A 1J1DB 1SFCB 3P7KA 1W2EA 3S9OA 1FZCA 3H1KJ 3HD7B 2W6BA 1GL2D 1SQXD 3H1HD 3I55P 1DD3A 3NXSA 1Q82Q 2ZT9D 3USSA 5AVYB 2A06G 1L0NK 1VF5B 2V4HA 3B8EB 2Z5IA 1Q81Q 2HPCA 3R2PA 1OZHA 1OVRA 3CX5D 1URQC 3V5BA 1P84H 1KV4A 2E75B 3A5TA 4PV1B 2M3EA 2GM4A 2OYHB 4EI2A 4WB4A 1SQVJ 1LTSC 2M8RA 1ZR2A 3BCCD 3H1ID 5APUA 1NWQA 3QWOC 2WPVB 2O1KA 2KUBA 4Y99C 1Y47A 4R4MA 1LT9B 3MZWB 1KQFB 1J2JB 1GL2C 5KJ7D 4NPFX 3GMAA 3JCUE 3MUDC 1LTJB 1PP9D 2ZT9C 4TLFA 3MIWA 4PJ0H 1BGYG 1JCCA 3FGAD 2IZ0A 1SVFA 3WUTA 1HF9A 1T8ZA 3E1IA 1AFOA 1NOHA 3ABVC 4W7YA 3MHVA 2KK7A 2KZIA 1FDMA 4AYCA 2WSFJ 3H1KG 1R5SA 1SQPE 4H44B 3CWBJ 1M1JA 2IZ1A 1NTZE 1NTME 3H1LE 2Y9YA 3HE4B 2B9BA 3V2QA 5AVUB 3M0DA 2YIUB 5KLVD 2H7HA 1FDIA 1RF0A 1EZVG 1OX3A 3FWNA 3L72J 1L4AB 3AEAC 5KJ7C 1KMIZ 1BDCA 3CI9A 3Q2YA 1GMJA 1XTCC 3KQGA 2KSJA 1KB9I 2ITAA 4D6TD 4OGQB 4UB8H 1KB9E 2PGDA 4WY4A 1W5CE 4L75A 4A7PA 1YTZT 2Q1KA 5APWA 3T97B 1FBMA 5APSA 1SQVG 1NGMB 2R44A 1N86A 2H88C 4W80A 4HJGH 3CC7P 2SPZA 5B66E 2B88A 1WRGA 2M0BA 3RL0D 3W67A 1HGVA 2QJYB 1KFNA 4C7NB 3M9QA 3L74J 2I1KA 1T3UA 4NPDA 1FJKA 2BCCG 3Q1MA 5GTIH 3GHGC 1GU4A 1JY2O 2J5UA 2E5YA 1N73C 4WBAA 3BASA 4BWNA 5AW0B 1JUNA 3KZIH 3VOPA 2OGUA 1NAFA 1AVOA 2V7QJ 5AVSB 1NTKJ 1FZCC 1OW6A 2W90A 2QIWA 3L72G 3L75E 3TNUB 3WU2E 4HYTB 2LR2A 3RL0C 3L70J 1KILE 3GF3A 2Q7CA 3RK2B 4BRYB 2FYNB 3AEGC 4AQRD 2OYIA 2WTYA 1NU1G 3LW5J 2KNCB 1M56D 1RY3A 5EFWB 1KILA 1HBWA 1AV1A 2JEEA 4WWIA 1SQQK 3CPWO 3L4FA 1GK6A 2JR8A 2O01J 1J1EC 1SQBJ 3PLNA 3UIAA 2WT7A 1KC8Q 3CD6P 1BGYE 1RE4A 4H0LB 1SQPD 3FXEA 2FKWB 1YQ4C 3I5CA 1NTZD 1NTMD 3H1LD 3B71A 1G2CB 5K5GB 2WPRA 1KORA 1GTWA 5H2FH 5APXA 3H1KE 4WY4D 2FXMA 3II6A 5BU8B 1FC2C 1IFMA 5AVWB 1YHQP 1EZVI 1EZVE 3TGUJ 1KB9D 2YO2A 5KKZB 1KQSO 4L73A 1CI6A 1BCCG 1VQ6P 1PFIA 1M1JC 3OAKA 1YITP 4N78E 3M0DC 1RF0C 3SFEC 3S4RA 3L70G 3BRVB 2KOGA 1BE3J 5CCHA 4H13D 5KAIH 2D2CD 1LTIC 3P32A 5KLIB 1SQXK 2KLVA 2ZYAA 3U1CA 2GUSA 1X0TA 3H6PA 2YO3A 2Q3IA 4WY4C 1PPJG 1JM0A 3Q3DA 2QRXA 2R5DA 1S5LX 3TYYA 5B5EH 2YMYA 4IOIH 3RK3E 3A0BE 3OJAB 3A3YB 2N1TA 1VDFA 1PZQA 5CBNA 1EXJA
chains in the Genus database with same CATH topology
1MFZA 1SLQA 4C46A 1XTGB 2YKPA 4N3YB 1X79B 3NFQA 1LTGC 1HVVA 4Y99B 4RESB 3B5NA 1LT9A 1QL2A 3VMYA 3N4XA 1RE3C 3IFMA 1GL2B 3M91A 3V2NA 3N7NA 3HTKA 1H8AA 1KILD 1LTJA 2WSEH 3TK1A 3H32B 1JY3P 5CCGA 1HH0A 2POHA 4I2LC 1JOCA 2P67A 1HWTC 1URQD 1KZUB 4GKGA 3GHGA 4EOTA 2VRSA 2WITA 5AVTB 3RL0B 3KYQA 1CI6B 1N73A 1J1DB 3VMXA 2YKOA 3P8CE 5AW6B 1SFCB 3CLQA 2FYUK 3P7KA 1W2EA 2XU6A 1WT6A 2KB7P 1LTBC 5CJ4A 4C7RA 5AW4B 1FZCA 3HD7B 5AW2B 1JY3O 1X8YA 2W6BA 3HE4A 1GL2D 1ZLLA 3NMDA 1A02F 2A45H 3NXSA 3KPEA 1GW4A 3A7OA 2NPSA 3VYIA 2OYIC 4KHXA 5AVYB 1L0NK 1L4AA 4I1LA 3V2RA 1KILC 2HG5D 1JY3N 2FFDC 3NTNA 1G1JA 3L36A 3B8EB 2Z5IA 2Z4EA 2HPCA 1LWUC 2KYVA 3V2PA 3R2PA 3HRNA 2XKMA 4AUWA 2MJZA 1OXZA 1URQC 1SFCD 2O1JA 4IFMA 3V5BA 5AVXB 2W6AA 1VPCA 2A45G 3T97A 3A5TA 2Q9IA 2GM4A 2N1TB 2OYHB 2WSCH 1L0LK 1N7SA 4WB4A 3HD7D 2M8RA 1LTSC 3KDPB 3RK3B 1ZR2A 5AW3B 5CCHD 5APUA 1RF1A 4N78D 1NWQA 2L5GB 1JTHA 2O1KA 4Y99C 1OWAA 3B5NB 1LT9B 1DX7A 2HYNA 3V4WA 2IPPA 1DH3A 1J2JB 1GL2C 5KJ7D 3HTKB 1NKNA 1LTJB 4ZKPA 3VTPC 5CJ0A 1IO4A 3MGNA 4C7NA 3MIWA 1JCCA 1SVFA 5BVZA 1A02J 5AW1B 3GHGB 3VN0A 1H89A 1T8ZA 3E1IA 1AFOA 1NOHA 4IFDK 1N73B 3HUSC 1IFNA 2N1TD 1H88A 4W7YA 1NHLA 1KQLA 1N7LA 2HLOA 3LIEA 1GD2E 1SFCC 3SWFA 1FU1A 3BRTB 1M7LA 3RK3D 1FDMA 4AYCA 2C9NY 2PAJA 1M1JA 1IFJA 1S9KE 3B5ND 1FZCB 1CSBA 2FFDA 3HD7C 3HE4B 3V2QA 5AVUB 3M0DA 2H7HA 5CCHC 3IR9A 1X9VA 1RF0A 1SQVK 1LWUA 2NPSB 1JCDA 3TNUA 5CCGD 2HODA 2XDJA 1L4AB 4M3LA 1SP4A 5KJ7C 3CI9A 5AW5B 1XTCC 2C9LY 4N6JA 3KQGA 1CZQA 3EFGA 2KSJA 1HJBA 2HPCB 2I1JA 1HTLC 1NTKK 4WY4A 1NKZB 1YTZT 5APWA 2P7JA 1FBMA 5AVQB 1J1EB 5APSA 2WWWA 1FZAA 5APYA 1IJDB 2N1TC 1N86A 3PP5A 4B86A 2R5BA 1N7SB 5KLVK 2H8PD 3P8CD 1HGZA 2QM7A 4EIJA 3RK3C 1JY2P 1RF1B 4W80A 1JTHB 5CMZA 3G3ZA 1AQ5A 2NPSD 1WRGA 2Q5UA 1LT9C 2JJLA 3B5NC 3RL0D 1JNMA 2WSFH 2H43A 1HGVA 1YTZI 1LTJC 1G2CA 1LTTC 3HUSA 1KFNA 4C7NB 1RE3A 3M9QA 1NTMK 1RE4C 2I1KA 5CCGC 1T3UA 1FJKA 3EQ2A 3L37A 1SQBK 2QM8A 5APTA 2ZFCA 3GHGC 2Z5HA 2YNYA 3VP8A 1GU4A 3M9BA 1JY2O 1MZ9A 3O8ZA 1N73C 1FJPA 1FAVA 1DEBA 3HE5A 4WBAA 1N7SD 3BASA 1LTAC 5AW0B 2R3CA 1JUNA 1NU1K 3VOPA 2CPSA 1GZLA 5AVZB 2PP6A 1NAFA 4GIFA 1M1JB 5AW9B 5AVRB 5AVSB 1GW3A 2GUVA 2FFDB 1FZCC 1MUUA 1JY2N 2IX7C 2J58A 3M0AA 1IC2A 1KFMA 1LWUB 3TNUB 2NPSC 4GT1A 4HYTB 1G1IA 3RL0C 2HODB 4ZKUA 2A45I 1NH4A 2Q7CA 1J1DC 3U59A 3RK2B 2E42A 1FOSE 4AQRD 2OYIA 2WTYA 2WPSA 1ZN5A 4O9BA 1RY3A 1KILA 1HBWA 2JEEA 1QL1A 4WY4B 1SQQK 3L4FA 2OARA 1HUCA 2W27A 3M06A 1GK6A 1J1EC 4W7ZA 1Z56A 3VMZA 1LGHB 3CL3D 1EQ7A 1GK4A 1URQA 1N7SC 3UIAA 2WT7A 2LKMA 2IFNA 1GDTA 1RE4A 2FYZA 1IFIA 1JMMA 1RF1C 2CPBA 1MV8A 2FKWB 3VP9A 3I5CA 1S9KD 5AVVB 2IFMA 1N2DC 3RK2D 1YYCA 1IFDA 2P2UA 1G2CB 2WPQA 3HUSB 1FZEA 2XV5A 1FZBA 2WPRA 1GL2A 5KTBA 1FZFA 2M3BA 5AW8B 2OYHC 3MUDA 5CHXA 1GTWA 5APXA 3A2AA 4WY4D 2FXMA 4JF7A 3H32A 3II6A 5BU8B 1IFMA 4LC1A 5AVWB 3BVHA 1T2KD 3HE5B 2C0WA 1FOSF 2R32A 1L4AD 5APVA 3LW5H 2YO2A 2E43A 1SQPK 2YKQA 1CW5A 1CI6A 2ZXEB 5AW7B 1NTZK 3MTUE 1PFIA 1M1JC 4LGDE 2J59M 2KP8A 1SFCA 3C9IA 3OAKA 2XNXA 4N78E 3M0DC 1IK9A 2O01H 1GU5A 3LIDA 1RF0C 2N9BA 1T3JA 4XE5B 4HH2A 1FZGA 3HD7A 3BRVB 2KOGA 5APQA 5CCHA 3RK2C 2XZRA 3BATA 1LTIC 3U1AA 3P32A 2OYIB 1SQXK 2KLVA 5KJ7A 4LLHA 4JYCA 2GUSA 2WZ7A 4DOJA 1KILB 2C0XA 3H6PA 3U1CA 2YO3A 4XA4A 2Q3IA 3L35A 1E5WA 4WY4C 2HFED 4OH8B 3OA7A 2R5DA 1T2KC 1ZV8A 3MD0A 4I6MC 2BASA 3TYYA 1NO4A 2YMYA 1URQB 4IFFA 2WT7B 1L4AC 3P8MC 4DZOA 5BU5A 3TSIA 3SWYA 3OJAB 3A3YB 1JO5A 3WMM0 1ZR4A 4JYBA 2N1TA 1VDFA 3M9HA 3V4QA 2OYHA 2P1JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W80 A;  1JTH B;  5CCH D;  1XTG B;  2NPS D;  1JTH A;  3B5N C;  3RL0 D;  3B5N B;  1HVV A;  3RK2 D;  3B5N A;  1GL2 C;  5KJ7 D;  1GL2 B;  3HTK B;  1GL2 A;  1KIL D;  5CCG C;  5CCG A;  4WY4 D;  4JF7 A;  1URQ D;  1L4A D;  3RL0 B;  1N7S D;  2N1T D;  3KYQ A;  4W7Y A;  1NHL A;  1SFC C;  3P8C E;  3RK3 D;  1SFC B;  3VOP A;  4LGD E;  1SFC A;  2PP6 A;  4N78 E;  3M0D C;  3B5N D;  3HD7 C;  1T3J A;  3HD7 B;  1GL2 D;  5CCH C;  3HD7 A;  2NPS C;  2KOG A;  2NPS B;  3RL0 C;  5CCH A;  3RK2 C;  2NPS A;  5CCG D;  3RK2 B;  2XDJ A;  1L4A B;  5KJ7 C;  1L4A A;  5KJ7 A;  1KIL C;  2HG5 D;  2WZ7 A;  1KIL B;  1KIL A;  4WY4 C;  2HFE D;  4WY4 B;  4OH8 B;  4WY4 A;  1URQ C;  1SFC D;  2YMY A;  1URQ B;  4W7Z A;  1L4A C;  1URQ A;  1N7S C;  2N1T C;  3PP5 A;  3TSI A;  1N7S B;  2N1T B;  2H8P D;  1N7S A;  2N1T A;  3RK3 C;  3HD7 D;  2M8R A;  3RK3 B; 
#chains in the Genus database with same CATH topology
 1SLQ A;  1XTG B;  3G9R A;  2E74 D;  4N3Y B;  1L0N J;  1LTG C;  2YXQ B;  2QG4 A;  1VQ4 P;  3N4X A;  2IYO A;  4DCK A;  3L75 D;  3L71 J;  3V2N A;  3N7N A;  4H13 C;  3CWB E;  1KIL D;  2D2C C;  1K9M Q;  3TK1 A;  2KZJ A;  1HH0 A;  3H1J D;  4RO0 A;  1VQ8 P;  2WVR A;  3L72 E;  2LXB A;  3RL0 B;  1EDL A;  1KYO I;  1K73 Q;  3VMX A;  2YKO A;  4EDF A;  3CLQ A;  2IYP A;  1BGY D;  2JWA A;  3PTZ A;  2KB7 P;  1LTB C;  3ZDM A;  1BE3 G;  1RQV A;  2E74 C;  2QJK B;  1VL2 A;  2OYI C;  4KHX A;  1NYH A;  3V2R A;  1KIL C;  2HG5 D;  2FFD C;  1K04 A;  3AEC C;  1Q90 D;  3NTN A;  1R5L A;  1QX8 A;  2Z4E A;  3V2P A;  1S5L H;  3L74 E;  2O1J A;  1EZV D;  2A45 G;  2Q9I A;  2QA4 P;  2ZVO B;  1OVV A;  2AXT H;  1VQ9 P;  1L0L K;  1M8O B;  1VQL P;  1L0N G;  5AW3 B;  5CCH D;  1RF1 A;  4N78 D;  2L5G B;  3L71 G;  1OWA A;  3B5N B;  1DX7 A;  2IPP A;  1M57 D;  3HTK B;  4ZKP A;  1NTK E;  3VMA A;  3MGN A;  4IL6 X;  1H0T A;  1OIP A;  1E79 H;  1RHZ B;  5L8R J;  4JQ0 D;  1R8E A;  3CX5 H;  2OTJ P;  2ZJS E;  3C1L A;  3AE8 C;  3L70 E;  3RBZ A;  3HUS C;  2N1T D;  3O6Q B;  4JPZ B;  1KQL A;  2HLO A;  4NPE A;  3SWF A;  1FU1 A;  3BRT B;  1M7L A;  3RK3 D;  3Q5R A;  2PAJ A;  1CSB A;  2KXP B;  2BEQ D;  2W8Z A;  1PPJ E;  5CCH C;  1SQB E;  3L73 J;  1LWU A;  2KLU A;  2NPS B;  1JCD A;  2NZ2 A;  2HOD A;  3AE1 C;  2OTL P;  2AEM A;  1SP4 A;  1PGJ A;  1BSH A;  3CWB D;  5AW5 B;  2C9L Y;  3AE2 C;  3EFG A;  2E76 B;  2BEZ F;  3L72 D;  3SWK A;  2WWW A;  4GOD A;  1IJD B;  2N1T C;  3PP5 A;  4ZNC A;  4B86 A;  1EDJ A;  1N7S B;  1S3J A;  1NJI Q;  1HGZ A;  4EIJ A;  1KYO D;  2Y0E A;  3RK3 C;  5C39 A;  1Y9B A;  1DD4 A;  2M5A A;  1JY2 P;  1JTH B;  4KJM A;  3TGU E;  5TIS H;  1OW7 A;  4GOF A;  3AEF C;  4IL6 H;  1NTM K;  1SQQ J;  4HB1 A;  3GW6 A;  3EQ2 A;  2QM8 A;  1BE3 E;  2Z5H A;  4QMA A;  1FJP A;  1Q7Y Q;  3HE5 A;  1FE6 A;  3L74 D;  2OYO A;  5DJT B;  2CPS A;  2PP6 A;  4GIF A;  5AVR B;  1OMI A;  2FFD B;  1JY2 N;  2IX7 C;  3L73 G;  3M0A A;  2BCC J;  5M1B A;  4UB8 E;  1G1I A;  2A45 I;  3U59 A;  2E42 A;  1NTK D;  2FY8 A;  1ZN5 A;  4PD4 I;  3L71 E;  4PD4 E;  2W27 A;  1ZOY C;  3L70 D;  4W7Z A;  3VMZ A;  1LGH B;  1EQ7 A;  1GK4 A;  1RF1 C;  3AE5 C;  1MV8 A;  2G8Y A;  2UWJ E;  2OQQ A;  1BDD A;  5AVV B;  1NU1 J;  1N2D C;  1IFD A;  1PPJ D;  2WPQ A;  1SQB D;  3HUS B;  1FZE A;  1SQQ G;  1MKM A;  3CXH I;  4XFJ A;  5AW8 B;  3K5B A;  3CXH E;  3KZI E;  4ASW A;  2K9Y A;  3D70 A;  2QJP C;  2C0W A;  1OVU A;  3KXD A;  5APV A;  2E43 A;  2ZYD A;  2ZXE B;  4RKU J;  1SFC A;  1IK9 A;  5E79 E;  1Q86 Q;  1GU5 A;  1U57 A;  3BCC J;  1T6A A;  1VQP P;  1FZG A;  1VQN P;  3HD7 A;  3TGU D;  1PIX A;  2O01 N;  3PJS K;  4RJT A;  2XZR A;  3OW2 O;  2A06 E;  4DT0 A;  2DW3 A;  4DOJ A;  4XA4 A;  3L35 A;  1BCC J;  1KB9 H;  1E5W A;  4OH8 B;  1BE3 D;  3MD0 A;  2BAS A;  1NO4 A;  4WVZ A;  4HKZ H;  1URQ B;  2YMK A;  3SWY A;  1JO5 A;  2RKL A;  3M9H A;  2OYH A;  2P1J A;  5B66 H;  5H2F E;  3H1H G;  4C46 A;  2Y0D A;  1YJN P;  3D6Z A;  1HVV A;  2HR3 A;  1JMB A;  4Y99 B;  1LT9 A;  3VMY A;  1GL2 B;  2JDI H;  1JEK A;  3F5H A;  3M91 A;  3SFD C;  1LP1 B;  1KN7 A;  1LTJ A;  3AE6 C;  2WSE H;  2ZT9 B;  3H32 B;  2K88 A;  3L73 E;  2Y0C A;  1KZU B;  1L0L J;  2VRS A;  3L71 D;  4U7J A;  2WIT A;  4PD4 D;  3KYQ A;  3A0H E;  4I7Z C;  1ZXG A;  3BCC G;  2FYU K;  1AJY A;  3H1I G;  2XU6 A;  5CJ4 A;  4C7R A;  5AW4 B;  1WMK A;  3WU2 H;  2ZVN B;  1JY3 O;  3HE4 A;  1ZLL A;  5CBO A;  1LJ2 A;  1PP9 G;  1M1K Q;  2XND H;  1GW4 A;  3A7O A;  2B87 B;  1L4A A;  3IN6 A;  3CXH D;  1QVG O;  1G1J A;  2PFX A;  2O3J A;  3HRN A;  3CCU P;  4AUW A;  1OXZ A;  1SFC D;  4IFM A;  3Q5P A;  2IBZ G;  5AVX B;  1SQQ E;  1VPC A;  3T97 A;  5TJH A;  1SS1 A;  1SQV E;  2QEX P;  3HD7 D;  3KDP B;  3S1K A;  4GDO A;  3CCE P;  2KS1 B;  3GLM A;  3V4W A;  1VF5 D;  1NKN A;  5CJ0 A;  3KHU A;  1IO4 A;  4C7N A;  2K9J B;  2A06 D;  2BCC E;  5BVZ A;  4K3A A;  3G4S P;  5AW1 B;  1L0L G;  2K3R A;  3GHG B;  2RN0 A;  3WUU A;  1LT1 A;  2E75 D;  4PV1 D;  5GTH E;  4IFD K;  1N73 B;  1IFN A;  1PGO A;  3CC4 P;  3LIE A;  1GD2 E;  1SFC C;  3EWK A;  2C9N Y;  4EYY Q;  1FZC B;  3HD7 C;  1K8A Q;  4YPC A;  3IR9 A;  3TNU A;  2XDJ A;  1VF5 C;  4BRY A;  5KAF E;  4N6J A;  1NU1 E;  2HPC B;  2KNC A;  1W2B O;  3L73 D;  1NTK K;  4UB6 H;  3A0B H;  3EFF K;  1EDI A;  2P7J A;  2E75 C;  5AVQ B;  4PV1 C;  1J1E B;  4ZMD A;  1FZA A;  4H44 D;  5APY A;  5KLV K;  2QM7 A;  2AXC A;  1S1C X;  3H1K D;  2Q5U A;  1LT9 C;  2JJL A;  3ITK A;  3TDK A;  2WSF H;  2H43 A;  1UII A;  2JWD A;  2FXP A;  1EC5 A;  1LTJ C;  1G2C A;  1RE4 C;  1QVF O;  3D6Y A;  3BCC E;  3FX0 A;  1SQB K;  3IAO A;  4OGQ D;  3GF7 A;  4DJG A;  1RH5 B;  2YNY A;  3VP8 A;  2OTK E;  3M9B A;  3O8Z A;  1YJW P;  1DEB A;  1AQT A;  1KYO H;  1LTA C;  1SQQ D;  1GZL A;  5AVZ B;  4H44 C;  1BCC E;  5AW9 B;  1M1J B;  1KD1 Q;  1SQV D;  1MUU A;  4JBZ A;  2YIU C;  2J58 A;  1IC2 A;  1QLE D;  1OFC X;  4GT1 A;  1YQ3 C;  1IZN B;  1PGP A;  2PRR A;  4ZKU A;  2IBZ E;  3AEB C;  2RMZ A;  4U3F J;  3AE9 C;  1HJ0 A;  3H1J J;  2BCC D;  4OGQ C;  1QL1 A;  4WY4 B;  4R4L A;  1HUC A;  3M06 A;  5TIS E;  1P84 I;  2P10 A;  1P84 E;  1S72 P;  2IFN A;  1GDT A;  1JMM A;  3AED C;  3VP9 A;  1L0L E;  3RGU A;  1MFT A;  2W6J H;  2QJY C;  3RK2 D;  1YYC A;  2P2U A;  3SSU A;  2XV5 A;  2KIK A;  5KTB A;  1FZF A;  3CCL P;  2M3B A;  3QH9 A;  4H13 B;  5CHX A;  3G71 P;  2D2C B;  3CCR P;  3RL0 g;  4PJ0 E;  4JF7 A;  3CCJ P;  1YIJ P;  3AE7 C;  4LC1 A;  3BVH A;  1NU1 D;  1DEE G;  1FOS F;  2R32 A;  3CMA P;  3LW5 H;  2KI7 B;  1SQP K;  1CW5 A;  1NTZ K;  4H0L D;  3MTU E;  2KP8 A;  1Y8A A;  1AA0 A;  2XNX A;  2O01 H;  1USD A;  2N9B A;  3L75 G;  4HH2 A;  2E74 B;  3RK2 C;  4K35 A;  2FYN C;  2Y9Z A;  1JB0 J;  4U3F G;  3U1A A;  2OYI B;  2K1A A;  3H1J G;  5DJU B;  4LLH A;  4JYC A;  1KIL B;  2C0X A;  2HFE D;  2JP3 A;  2FYU J;  4I6M C;  1PV3 A;  2WT7 B;  2WQY C;  1NAY A;  5BU5 A;  3TSI A;  3WMM 0;  1ZR4 A;  1BSN A;  2QSI A;  4JYB A;  4H0L C;  2QE7 H;  2N9Y B;  3I56 P;  1BCC D;  2L91 A;  1EXI A;  1L0N E;  1MFZ A;  3CCQ P;  1YBK A;  2YKP A;  1X79 B;  3NFQ A;  4KT0 J;  3H25 A;  2K37 A;  2ZXX A;  3B5N A;  3IFM A;  1ZRT E;  3WUV A;  3HTK A;  2W83 C;  1H8A A;  2IBZ D;  1U7M A;  4YTP C;  1JY3 P;  5CCG A;  2POH A;  4I2L C;  5GTI E;  1JOC A;  2P67 A;  1HWT C;  2RH0 A;  4EOT A;  1SQX J;  3JCU H;  1ZME C;  3H1H J;  2G3A A;  5KKZ C;  1CI6 B;  2ZYG A;  1L2P A;  3O6Q A;  3P8C E;  5AW6 B;  3B4S A;  1P84 D;  1WT6 A;  2FBW C;  5AW2 B;  1X8Y A;  2AEF A;  1L0L D;  3NMD A;  1A02 F;  2A45 H;  3KPE A;  2NPS A;  3VYI A;  3FWL A;  2GA1 A;  5KLI C;  1VQO P;  4I1L A;  4ASV A;  1JY3 N;  3Q5S A;  1EDK A;  2FYU G;  4PD4 H;  3L36 A;  3H1I J;  1LWU C;  2KYV A;  1VQK P;  2XKM A;  2AEJ A;  2MJZ A;  2CK3 H;  2W6A A;  1OW8 A;  1PP9 J;  2N1T B;  3C8V A;  2WSC H;  1N7S A;  1ZP0 C;  3RK3 B;  1K05 A;  2I8D A;  1JTH A;  2HYN A;  1DH3 A;  3E7K A;  2WSS H;  3CWB G;  1QGK B;  3CXH H;  3VTP C;  4OWF A;  1D7M A;  3FXD A;  1A02 J;  1SQX G;  1YI2 P;  4TT3 H;  1KQG B;  3VN0 A;  1H89 A;  2WMM A;  3JC2 2;  5KLV J;  4YXD C;  3AE4 C;  1H88 A;  1NHL A;  1N7L A;  4U3F E;  1YJ9 P;  1PGQ A;  5E79 H;  3H1J E;  1IFJ A;  1S9K E;  3B5N D;  2FFD A;  1AVY A;  3PRJ A;  1L0N D;  4D6T J;  1X9V A;  2QJK C;  1SQV K;  1N8R Q;  5CCG D;  3GG2 A;  1KTM A;  4M3L A;  1ZRT D;  5KAI E;  1CZQ A;  1VQ5 P;  3W68 A;  1HJB A;  2I1J A;  3AEE C;  1LNQ A;  1HTL C;  3L74 G;  1NKZ B;  3MP7 B;  5B5E E;  1S2E A;  2R5B A;  4GOE A;  2H8P D;  2P58 A;  3P8C D;  1RF1 B;  5CMZ A;  3G3Z A;  1AQ5 A;  2NPS D;  3D71 A;  3B5N C;  1JNM A;  1IK7 A;  1YTZ I;  1LTT C;  1NTK G;  3HUS A;  1H0T B;  1RE3 A;  1X22 A;  5CCG C;  2H89 C;  1VQ7 P;  3CCS P;  2E76 D;  3L37 A;  5APT A;  5KLV G;  2ZFC A;  3A0H H;  1MZ9 A;  2QJP B;  1FAV A;  1N7S D;  2YXR B;  2R3C A;  3JSV C;  1NU1 K;  3CCV P;  1GW3 A;  2GUV A;  4D6T G;  1NVO A;  1ZW0 A;  2FYU E;  3R4Y A;  1KFM A;  2ZAE B;  1SQB G;  1LWU B;  2NPS C;  1DIP A;  3E1R A;  2HOD B;  4UB6 E;  1NH4 A;  1J1D C;  1FOS E;  2JKV A;  2LXC B;  2WPS A;  4O9B A;  3CC2 P;  4Z1M H;  3CCM P;  2E76 C;  1SQP J;  1VQM P;  3G6E P;  1NTZ J;  1NTM J;  3H1L J;  2OAR A;  4MN4 C;  1S5L E;  1Z56 A;  2QVA A;  3CL3 D;  1RQU A;  1URQ A;  3RBX A;  1N7S C;  2LKM A;  2FYZ A;  2M5A B;  1IFI A;  4U3F D;  2CPB A;  2AXT E;  3V6I A;  4BXL A;  3TGU G;  1SQX E;  3H1H E;  2NRG A;  1S9K D;  2WSC J;  2IFM A;  3IF4 A;  4OVN F;  1FZB A;  2B89 A;  1KYO E;  1GL2 A;  1LP1 A;  2OYH C;  3MUD A;  3CME P;  3A2A A;  2Q3E A;  3H32 A;  3CX5 I;  1T2K D;  5GTH H;  1U7J A;  3CX5 E;  3HE5 B;  1L4A D;  1PL5 A;  2YKQ A;  4I7Z B;  5AW7 B;  4LGD E;  2J59 M;  3C9I A;  3H1I E;  3LID A;  4XE5 B;  1T3J A;  4L76 A;  2WSE J;  2FXO A;  5APQ A;  1PP9 E;  5KAF H;  3BAT A;  3F89 A;  2Q6Q A;  1SQP G;  2B87 A;  5KJ7 A;  2WZ7 A;  1FS0 E;  1NTZ G;  1NTM G;  3H1L G;  3PHL A;  2E5T A;  2KSE A;  4CPG A;  4YXW H;  3OA7 A;  1T2K C;  1ZV8 A;  2IBZ I;  4IFF A;  1M90 Q;  3L75 J;  1L4A C;  3P8M C;  4DZO A;  3V4Q A;  1QEX A;  5KLV E;  1FDO A;  2FYU D;  2R3S A;  4Y28 J;  3PH0 A;  4RES B;  2KS1 A;  1QL2 A;  1RE3 C;  3TF5 A;  4IL6 E;  2K9J A;  1S4X A;  2MKV A;  4D6T E;  1USE A;  1BGY J;  1TU3 F;  4L74 A;  2IDB A;  1UIX A;  1Q2N A;  1URQ D;  4GKG A;  3GHG A;  1IFP A;  5AVT B;  2V7Q H;  2JO1 A;  3AE3 C;  1N73 A;  1J1D B;  1SFC B;  3P7K A;  1W2E A;  3S9O A;  1FZC A;  3H1K J;  3HD7 B;  2W6B A;  1GL2 D;  1SQX D;  3H1H D;  3I55 P;  1DD3 A;  3NXS A;  1Q82 Q;  2ZT9 D;  3USS A;  5AVY B;  2A06 G;  1L0N K;  1VF5 B;  2V4H A;  3B8E B;  2Z5I A;  1Q81 Q;  2HPC A;  3R2P A;  1OZH A;  1OVR A;  3CX5 D;  1URQ C;  3V5B A;  1P84 H;  1KV4 A;  2E75 B;  3A5T A;  4PV1 B;  2M3E A;  2GM4 A;  2OYH B;  4EI2 A;  4WB4 A;  1SQV J;  1LTS C;  2M8R A;  1ZR2 A;  3BCC D;  3H1I D;  5APU A;  1NWQ A;  3QWO C;  2WPV B;  2O1K A;  2KUB A;  4Y99 C;  1Y47 A;  4R4M A;  1LT9 B;  3MZW B;  1KQF B;  1J2J B;  1GL2 C;  5KJ7 D;  4NPF X;  3GMA A;  3JCU E;  3MUD C;  1LTJ B;  1PP9 D;  2ZT9 C;  4TLF A;  3MIW A;  4PJ0 H;  1BGY G;  1JCC A;  3FGA D;  2IZ0 A;  1SVF A;  3WUT A;  1HF9 A;  1T8Z A;  3E1I A;  1AFO A;  1NOH A;  3ABV C;  4W7Y A;  3MHV A;  2KK7 A;  2KZI A;  1FDM A;  4AYC A;  2WSF J;  3H1K G;  1R5S A;  1SQP E;  4H44 B;  3CWB J;  1M1J A;  2IZ1 A;  1NTZ E;  1NTM E;  3H1L E;  2Y9Y A;  3HE4 B;  2B9B A;  3V2Q A;  5AVU B;  3M0D A;  2YIU B;  5KLV D;  2H7H A;  1FDI A;  1RF0 A;  1EZV G;  1OX3 A;  3FWN A;  3L72 J;  1L4A B;  3AEA C;  5KJ7 C;  1KMI Z;  1BDC A;  3CI9 A;  3Q2Y A;  1GMJ A;  1XTC C;  3KQG A;  2KSJ A;  1KB9 I;  2ITA A;  4D6T D;  4OGQ B;  4UB8 H;  1KB9 E;  2PGD A;  4WY4 A;  1W5C E;  4L75 A;  4A7P A;  1YTZ T;  2Q1K A;  5APW A;  3T97 B;  1FBM A;  5APS A;  1SQV G;  1NGM B;  2R44 A;  1N86 A;  2H88 C;  4W80 A;  4HJG H;  3CC7 P;  2SPZ A;  5B66 E;  2B88 A;  1WRG A;  2M0B A;  3RL0 D;  3W67 A;  1HGV A;  2QJY B;  1KFN A;  4C7N B;  3M9Q A;  3L74 J;  2I1K A;  1T3U A;  4NPD A;  1FJK A;  2BCC G;  3Q1M A;  5GTI H;  3GHG C;  1GU4 A;  1JY2 O;  2J5U A;  2E5Y A;  1N73 C;  4WBA A;  3BAS A;  4BWN A;  5AW0 B;  1JUN A;  3KZI H;  3VOP A;  2OGU A;  1NAF A;  1AVO A;  2V7Q J;  5AVS B;  1NTK J;  1FZC C;  1OW6 A;  2W90 A;  2QIW A;  3L72 G;  3L75 E;  3TNU B;  3WU2 E;  4HYT B;  2LR2 A;  3RL0 C;  3L70 J;  1KIL E;  3GF3 A;  2Q7C A;  3RK2 B;  4BRY B;  2FYN B;  3AEG C;  4AQR D;  2OYI A;  2WTY A;  1NU1 G;  3LW5 J;  2KNC B;  1M56 D;  1RY3 A;  5EFW B;  1KIL A;  1HBW A;  1AV1 A;  2JEE A;  4WWI A;  1SQQ K;  3CPW O;  3L4F A;  1GK6 A;  2JR8 A;  2O01 J;  1J1E C;  1SQB J;  3PLN A;  3UIA A;  2WT7 A;  1KC8 Q;  3CD6 P;  1BGY E;  1RE4 A;  4H0L B;  1SQP D;  3FXE A;  2FKW B;  1YQ4 C;  3I5C A;  1NTZ D;  1NTM D;  3H1L D;  3B71 A;  1G2C B;  5K5G B;  2WPR A;  1KOR A;  1GTW A;  5H2F H;  5APX A;  3H1K E;  4WY4 D;  2FXM A;  3II6 A;  5BU8 B;  1FC2 C;  1IFM A;  5AVW B;  1YHQ P;  1EZV I;  1EZV E;  3TGU J;  1KB9 D;  2YO2 A;  5KKZ B;  1KQS O;  4L73 A;  1CI6 A;  1BCC G;  1VQ6 P;  1PFI A;  1M1J C;  3OAK A;  1YIT P;  4N78 E;  3M0D C;  1RF0 C;  3SFE C;  3S4R A;  3L70 G;  3BRV B;  2KOG A;  1BE3 J;  5CCH A;  4H13 D;  5KAI H;  2D2C D;  1LTI C;  3P32 A;  5KLI B;  1SQX K;  2KLV A;  2ZYA A;  3U1C A;  2GUS A;  1X0T A;  3H6P A;  2YO3 A;  2Q3I A;  4WY4 C;  1PPJ G;  1JM0 A;  3Q3D A;  2QRX A;  2R5D A;  1S5L X;  3TYY A;  5B5E H;  2YMY A;  4IOI H;  3RK3 E;  3A0B E;  3OJA B;  3A3Y B;  2N1T A;  1VDF A;  1PZQ A;  5CBN A;  1EXJ A; 
#chains in the Genus database with same CATH homology
 1MFZ A;  1SLQ A;  4C46 A;  1XTG B;  2YKP A;  4N3Y B;  1X79 B;  3NFQ A;  1LTG C;  1HVV A;  4Y99 B;  4RES B;  3B5N A;  1LT9 A;  1QL2 A;  3VMY A;  3N4X A;  1RE3 C;  3IFM A;  1GL2 B;  3M91 A;  3V2N A;  3N7N A;  3HTK A;  1H8A A;  1KIL D;  1LTJ A;  2WSE H;  3TK1 A;  3H32 B;  1JY3 P;  5CCG A;  1HH0 A;  2POH A;  4I2L C;  1JOC A;  2P67 A;  1HWT C;  1URQ D;  1KZU B;  4GKG A;  3GHG A;  4EOT A;  2VRS A;  2WIT A;  5AVT B;  3RL0 B;  3KYQ A;  1CI6 B;  1N73 A;  1J1D B;  3VMX A;  2YKO A;  3P8C E;  5AW6 B;  1SFC B;  3CLQ A;  2FYU K;  3P7K A;  1W2E A;  2XU6 A;  1WT6 A;  2KB7 P;  1LTB C;  5CJ4 A;  4C7R A;  5AW4 B;  1FZC A;  3HD7 B;  5AW2 B;  1JY3 O;  1X8Y A;  2W6B A;  3HE4 A;  1GL2 D;  1ZLL A;  3NMD A;  1A02 F;  2A45 H;  3NXS A;  3KPE A;  1GW4 A;  3A7O A;  2NPS A;  3VYI A;  2OYI C;  4KHX A;  5AVY B;  1L0N K;  1L4A A;  4I1L A;  3V2R A;  1KIL C;  2HG5 D;  1JY3 N;  2FFD C;  3NTN A;  1G1J A;  3L36 A;  3B8E B;  2Z5I A;  2Z4E A;  2HPC A;  1LWU C;  2KYV A;  3V2P A;  3R2P A;  3HRN A;  2XKM A;  4AUW A;  2MJZ A;  1OXZ A;  1URQ C;  1SFC D;  2O1J A;  4IFM A;  3V5B A;  5AVX B;  2W6A A;  1VPC A;  2A45 G;  3T97 A;  3A5T A;  2Q9I A;  2GM4 A;  2N1T B;  2OYH B;  2WSC H;  1L0L K;  1N7S A;  4WB4 A;  3HD7 D;  2M8R A;  1LTS C;  3KDP B;  3RK3 B;  1ZR2 A;  5AW3 B;  5CCH D;  5APU A;  1RF1 A;  4N78 D;  1NWQ A;  2L5G B;  1JTH A;  2O1K A;  4Y99 C;  1OWA A;  3B5N B;  1LT9 B;  1DX7 A;  2HYN A;  3V4W A;  2IPP A;  1DH3 A;  1J2J B;  1GL2 C;  5KJ7 D;  3HTK B;  1NKN A;  1LTJ B;  4ZKP A;  3VTP C;  5CJ0 A;  1IO4 A;  3MGN A;  4C7N A;  3MIW A;  1JCC A;  1SVF A;  5BVZ A;  1A02 J;  5AW1 B;  3GHG B;  3VN0 A;  1H89 A;  1T8Z A;  3E1I A;  1AFO A;  1NOH A;  4IFD K;  1N73 B;  3HUS C;  1IFN A;  2N1T D;  1H88 A;  4W7Y A;  1NHL A;  1KQL A;  1N7L A;  2HLO A;  3LIE A;  1GD2 E;  1SFC C;  3SWF A;  1FU1 A;  3BRT B;  1M7L A;  3RK3 D;  1FDM A;  4AYC A;  2C9N Y;  2PAJ A;  1M1J A;  1IFJ A;  1S9K E;  3B5N D;  1FZC B;  1CSB A;  2FFD A;  3HD7 C;  3HE4 B;  3V2Q A;  5AVU B;  3M0D A;  2H7H A;  5CCH C;  3IR9 A;  1X9V A;  1RF0 A;  1SQV K;  1LWU A;  2NPS B;  1JCD A;  3TNU A;  5CCG D;  2HOD A;  2XDJ A;  1L4A B;  4M3L A;  1SP4 A;  5KJ7 C;  3CI9 A;  5AW5 B;  1XTC C;  2C9L Y;  4N6J A;  3KQG A;  1CZQ A;  3EFG A;  2KSJ A;  1HJB A;  2HPC B;  2I1J A;  1HTL C;  1NTK K;  4WY4 A;  1NKZ B;  1YTZ T;  5APW A;  2P7J A;  1FBM A;  5AVQ B;  1J1E B;  5APS A;  2WWW A;  1FZA A;  5APY A;  1IJD B;  2N1T C;  1N86 A;  3PP5 A;  4B86 A;  2R5B A;  1N7S B;  5KLV K;  2H8P D;  3P8C D;  1HGZ A;  2QM7 A;  4EIJ A;  3RK3 C;  1JY2 P;  1RF1 B;  4W80 A;  1JTH B;  5CMZ A;  3G3Z A;  1AQ5 A;  2NPS D;  1WRG A;  2Q5U A;  1LT9 C;  2JJL A;  3B5N C;  3RL0 D;  1JNM A;  2WSF H;  2H43 A;  1HGV A;  1YTZ I;  1LTJ C;  1G2C A;  1LTT C;  3HUS A;  1KFN A;  4C7N B;  1RE3 A;  3M9Q A;  1NTM K;  1RE4 C;  2I1K A;  5CCG C;  1T3U A;  1FJK A;  3EQ2 A;  3L37 A;  1SQB K;  2QM8 A;  5APT A;  2ZFC A;  3GHG C;  2Z5H A;  2YNY A;  3VP8 A;  1GU4 A;  3M9B A;  1JY2 O;  1MZ9 A;  3O8Z A;  1N73 C;  1FJP A;  1FAV A;  1DEB A;  3HE5 A;  4WBA A;  1N7S D;  3BAS A;  1LTA C;  5AW0 B;  2R3C A;  1JUN A;  1NU1 K;  3VOP A;  2CPS A;  1GZL A;  5AVZ B;  2PP6 A;  1NAF A;  4GIF A;  1M1J B;  5AW9 B;  5AVR B;  5AVS B;  1GW3 A;  2GUV A;  2FFD B;  1FZC C;  1MUU A;  1JY2 N;  2IX7 C;  2J58 A;  3M0A A;  1IC2 A;  1KFM A;  1LWU B;  3TNU B;  2NPS C;  4GT1 A;  4HYT B;  1G1I A;  3RL0 C;  2HOD B;  4ZKU A;  2A45 I;  1NH4 A;  2Q7C A;  1J1D C;  3U59 A;  3RK2 B;  2E42 A;  1FOS E;  4AQR D;  2OYI A;  2WTY A;  2WPS A;  1ZN5 A;  4O9B A;  1RY3 A;  1KIL A;  1HBW A;  2JEE A;  1QL1 A;  4WY4 B;  1SQQ K;  3L4F A;  2OAR A;  1HUC A;  2W27 A;  3M06 A;  1GK6 A;  1J1E C;  4W7Z A;  1Z56 A;  3VMZ A;  1LGH B;  3CL3 D;  1EQ7 A;  1GK4 A;  1URQ A;  1N7S C;  3UIA A;  2WT7 A;  2LKM A;  2IFN A;  1GDT A;  1RE4 A;  2FYZ A;  1IFI A;  1JMM A;  1RF1 C;  2CPB A;  1MV8 A;  2FKW B;  3VP9 A;  3I5C A;  1S9K D;  5AVV B;  2IFM A;  1N2D C;  3RK2 D;  1YYC A;  1IFD A;  2P2U A;  1G2C B;  2WPQ A;  3HUS B;  1FZE A;  2XV5 A;  1FZB A;  2WPR A;  1GL2 A;  5KTB A;  1FZF A;  2M3B A;  5AW8 B;  2OYH C;  3MUD A;  5CHX A;  1GTW A;  5APX A;  3A2A A;  4WY4 D;  2FXM A;  4JF7 A;  3H32 A;  3II6 A;  5BU8 B;  1IFM A;  4LC1 A;  5AVW B;  3BVH A;  1T2K D;  3HE5 B;  2C0W A;  1FOS F;  2R32 A;  1L4A D;  5APV A;  3LW5 H;  2YO2 A;  2E43 A;  1SQP K;  2YKQ A;  1CW5 A;  1CI6 A;  2ZXE B;  5AW7 B;  1NTZ K;  3MTU E;  1PFI A;  1M1J C;  4LGD E;  2J59 M;  2KP8 A;  1SFC A;  3C9I A;  3OAK A;  2XNX A;  4N78 E;  3M0D C;  1IK9 A;  2O01 H;  1GU5 A;  3LID A;  1RF0 C;  2N9B A;  1T3J A;  4XE5 B;  4HH2 A;  1FZG A;  3HD7 A;  3BRV B;  2KOG A;  5APQ A;  5CCH A;  3RK2 C;  2XZR A;  3BAT A;  1LTI C;  3U1A A;  3P32 A;  2OYI B;  1SQX K;  2KLV A;  5KJ7 A;  4LLH A;  4JYC A;  2GUS A;  2WZ7 A;  4DOJ A;  1KIL B;  2C0X A;  3H6P A;  3U1C A;  2YO3 A;  4XA4 A;  2Q3I A;  3L35 A;  1E5W A;  4WY4 C;  2HFE D;  4OH8 B;  3OA7 A;  2R5D A;  1T2K C;  1ZV8 A;  3MD0 A;  4I6M C;  2BAS A;  3TYY A;  1NO4 A;  2YMY A;  1URQ B;  4IFF A;  2WT7 B;  1L4A C;  3P8M C;  4DZO A;  5BU5 A;  3TSI A;  3SWY A;  3OJA B;  3A3Y B;  1JO5 A;  3WMM 0;  1ZR4 A;  4JYB A;  2N1T A;  1VDF A;  3M9H A;  3V4Q A;  2OYH A;  2P1J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...