3B5NA

Structure of the yeast plasma membrane snare complex
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
61
structure length
61
Chain Sequence
GSRTAELQAEIDDTVGIMRDNINKVAERGERLTSIEDKADNLAVSAQGFKRGANRVRKAMW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords Synaptobrevin homolog 1
publication title The Structure of the Yeast Plasma Membrane SNARE Complex Reveals Destabilizing Water-filled Cavities.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 28
structure length 61
sequence length 61
chains with identical sequence E, I
ec nomenclature
pdb deposition date 2007-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3b5nA00
3HD7C 4N78E 1HVVA 1KILB 2N1TC 4W7ZA 3RK3B 5CCGC 4WY4C 1KILD 5KJ7C 1N7SC 3KYQA 5CCHD 4W7YA 2NPSC 1SFCB 2HG5D 3RK2C 2PP6A 3B5NA 3RK3D 4OH8B 2YMYA 1SFCD 5CCHA 1URQC 2XDJA 3RL0C 4WY4B 1N7SB 2NPSB 3RK2B 4LGDE 5CCGD 4WY4D 4JF7A 1N7SD 2NPSD 3RK2D 3HD7B 1L4AC 1KILA 5CCGA 1URQB 4WY4A 3B5NC 2N1TB 3HD7D 2NPSA 1GL2C 2HFED 1URQD 3TSIA 3VOPA 3M0DC 1SFCA 2N1TD 2H8PD 3PP5A 3HD7A 1URQA 1NHLA 1L4AB 5KJ7D 3P8CE 3HTKB 2N1TA 3B5NB 2WZ7A 1L4AD 1GL2B 3RL0B 1JTHB 1N7SA 5KJ7A 4W80A 3B5ND 1GL2D 1KILC 5CCHC 3RL0D 1L4AA 1T3JA 1XTGB 3RK3C 2KOGA 1GL2A 2M8RA 1SFCC 1JTHA
chains in the Genus database with same CATH superfamily
3HD7C 2B89A 1GU5A 1HVVA 1GW4A 3B4SA 1PP9E 4L76A 1PPJD 4W7ZA 4IFFA 5AW9B 5KLVJ 1OX3A 2V7QH 1S72P 2O1KA 1PGOA 3RL0g 1LTJB 2XNDH 1NAYA 4AQRD 2ZVOB 1J1EC 5AVZB 4LGDE 1L0LD 3D70A 2AXTE 2L91A 1FZCC 1OVVA 2E76B 1FC2C 3L74J 1R8EA 3L70J 1MZ9A 1EXJA 4WY4A 3E1RA 3B5NC 1SQQD 2LXCB 2ZT9D 3GHGC 1JEKA 3VMXA 3M0DC 2E75C 1Y9BA 3A0HH 1YHQP 3AEFC 1GDTA 4GIFA 1VF5B 1NU1D 2WMMA 2Q3IA 3AEBC 1Q7YQ 2AEJA 2JKVA 2OYIA 1IZNB 5APVA 1Q81Q 5AVYB 3V4WA 1CI6A 5B5EE 2AEMA 3TNUB 5GTHE 3W67A 2YIUC 4CPGA 2KXPB 4H0LD 5KAIH 2V4HA 1GW3A 1NTKJ 1KFNA 1JCDA 2WPQA 3MZWB 4IFMA 4DT0A 3KYQA 1AFOA 3TGUD 3BCCJ 3H6PA 5AW3B 3RK3D 2P2UA 4ZMDA 1VQNP 3Q5RA 2IBZE 1NKNA 2N9BA 4RO0A 3WU2H 4H44B 2NPSB 2A06G 3E7KA 4H13B 2IBZI 3RK2D 3M0AA 1VQMP 2B87B 5BU8B 4RESB 2R5BA 3H1IJ 4I1LA 1AVOA 3CXHI 1EXIA 2JJLA 1X22A 2FYUG 3L37A 3V4QA 4I7ZC 5B66H 3P8CE 1JY3N 2W8ZA 5AW2B 2N1TA 1BSNA 2R44A 4LLHA 1W5CE 2D2CC 3RL0B 3H1HD 4KT0J 4U3FE 1GZLA 1L0NE 1GD2E 1LTGC 4WVZA 2KB7P 3H1JG 3PH0A 1NTME 2W6JH 2BASA 4JPZB 2KZIA 4JYCA 2RKLA 2BCCE 5KLIC 2O01N 3SWYA 2A45H 3IAOA 1M8OB 3C9IA 1DH3A 1SQPG 1PPJE 4A7PA 2K9JA 4WY4C 1P84H 1N7SC 2FXPA 1G2CB 4W7YA 1M1KQ 1NWQA 4OH8B 2K88A 1AV1A 3KQGA 3CX5H 1S5LX 4UB6H 4GT1A 2LR2A 3M06A 4ZKPA 3BVHA 5KLVG 1BCCD 3H1KG 1VQ6P 1YQ4C 2ZYAA 2H43A 1L0LE 5C39A 1MKMA 1ZW0A 1JY3P 5APYA 2WTYA 3CCEP 1N2DC 3CCRP 2E76D 1FZAA 2E74C 1J1EB 3KZIE 1VQOP 3WUTA 2JO1A 3GF3A 1FZCB 1EZVG 3L70G 3H32B 1OW7A 4R4LA 2Y0DA 3TDKA 3B5NB 1VF5D 5K5GB 3T97B 3GHGB 2QJKC 4YXWH 5KJ7A 1RE4C 2E75B 4KJMA 1OIPA 3V2QA 1QVGO 3CWBD 4U7JA 1N73A 2BCCJ 3A7OA 2Q5UA 2BEQD 3MHVA 1JOCA 1RF0C 1PP9G 2WT7A 5AVVB 2PGDA 2M3EA 2YIUB 2HG5D 3P7KA 3TGUE 4Y99C 3SFDC 3RK3E 2CPSA 4BXLA 2IPPA 3CC4P 2YO2A 1SQXD 1YBKA 3WMM0 4JBZA 3RGUA 1NOHA 4IL6H 3FWNA 4H44D 1KYOD 3IR9A 5E79H 2NPSD 3CCQP 4H13D 1MUUA 2CPBA 2ZFCA 3A2AA 1EDJA 4GKGA 3TSIA 1YJ9P 2MJZA 3HD7A 2LKMA 3JCUH 4B86A 2Q1KA 2HPCA 2Q3EA 2WPSA 1LTAC 4ZNCA 5CHXA 4D6TD 1KTMA 5APSA 3H1HE 1CSBA 3RL0D 1YJNP 2OGUA 1JY2O 1EC5A 1XTGB 3HTKA 3M91A 2P58A 1SFCC 2D2CB 1QEXA 3GF7A 5KKZC 2OTKE 1FZCA 2O3JA 1H88A 5DJUB 2B88A 1BGYD 1YJWP 1BDCA 1IC2A 3B5NA 3SWKA 2GA1A 3AE3C 3CI9A 2IYOA 5TJHA 5KLIB 4GOEA 3M0DA 2MKVA 1J1DC 1BE3J 3M9BA 1U7JA 3WUUA 2IBZG 4WY4B 1PFIA 1N7SB 4LC1A 3II6A 3V2RA 2FYUK 1R5LA 2Z4EA 1BCCE 3FX0A 2K37A 3AE9C 3M9HA 4BRYB 1QGKB 5AVTB 1HTLC 2OYIB 1AJYA 3L73D 3S4RA 1DX7A 1PGJA 2QIWA 2FYUJ 3AE8C 4L73A 1USDA 4W80A 4PV1C 3B5ND 1T8ZA 4U3FG 1M57D 2E75D 1L0NG 2O01J 3CWBE 1GL2A 1EDKA 1DEBA 2QJKB 1NTZD 1PGQA 2QRXA 1LTIC 3SSUA 1Q82Q 2BCCG 2P67A 3R2PA 1FDMA 1PPJG 1PIXA 3L35A 2HR3A 1SQPJ 3H1LE 2G3AA 4OGQB 2KYVA 4YPCA 5BVZA 1GK4A 3L75D 2FXOA 1SQXE 3KDPB 1SQBD 1OVRA 3WU2E 4Y99B 3B71A 3AEEC 1FBMA 1KILE 2O01H 1M56D 1KYOE 2OYOA 1L0LG 3H1KJ 5KAFH 1MV8A 2N1TB 1G1JA 2I8DA 2JEEA 3BRVB 4L74A 1FOSE 1KYOI 2E5YA 4DCKA 3MUDC 3L72D 3D71A 1HWTC 5B66E 3L71D 3CCVP 2W83C 1HBWA 5EFWB 3VN0A 1N7SA 3QWOC 1NGMB 2ZYDA 5AVUB 1S5LE 2POHA 1OZHA 1SQXK 1NAFA 2K9JB 4BRYA 1FOSF 3OJAB 3G3ZA 4ASVA 2D2CD 3RBZA 4EYYQ 2HYNA 2NZ2A 1BGYE 3H1LJ 1SQVD 1SFCB 1OXZA 4N6JA 1PP9J 3AE2C 2A45I 3TGUG 5KKZB 1AQTA 3BASA 1KV4A 3G71P 2VRSA 1MFTA 3CL3D 4WY4D 3EFGA 1N7SD 3HE4A 1RE4A 1BE3G 1M7LA 2B9BA 3VYIA 2C0XA 1N86A 3I5CA 2M5AB 1LGHB 1GL2C 4GODA 1RF1A 2KUBA 3L73E 3CMAP 1J2JB 3CXHE 1JY2P 5KTBA 1RF0A 3HE5A 1N73B 2E43A 4HYTB 4PJ0E 3PTZA 2XNXA 1L4AA 1YI2P 3USSA 2OTJP 1UIIA 3H1HG 3R4YA 1L2PA 3AE4C 3K5BA 1H89A 4AUWA 3LIEA 2WT7B 3VTPC 2G8YA 1JTHA 2XKMA 3TF5A 1KB9D 2ZT9C 2A06D 4PV1B 1NTZE 3G4SP 1VPCA 1ZV8A 2RH0A 2AXTH 2YXQB 3ITKA 1YIJP 3CCSP 2IFMA 3Q5PA 1BSHA 2J58A 3O6QB 4OGQD 4PD4H 2JP3A 3L75E 2QA4P 3PHLA 1JUNA 1K05A 3FGAD 2R3SA 3C1LA 2FY8A 5E79E 3HD7B 3H1JD 3U1AA 1Q86Q 3EWKA 3VMAA 1BCCG 2JWAA 2HPCB 1NTZK 1K04A 3SWFA 5B5EH 1SFCA 2N1TD 5APQA 3SFEC 4QMAA 5CMZA 1L0NK 1K9MQ 5GTIH 1Y8AA 1NTMK 1CZQA 3HTKB 1KORA 3L72E 3VMYA 4XFJA 2FBWC 5APWA 2IZ0A 3L71E 3S1KA 1IFDA 1SQQE 3Q2YA 2K9YA 4U3FJ 2OQQA 5KLVD 2J5UA 1KQGB 1D7MA 1NU1E 2M5AA 1L0NJ 3CWBG 2GUVA 1S9KD 5CBNA 1A02F 1NTMJ 1KQSO 5H2FE 2M0BA 4Y28J 3CCLP 3N4XA 3TYYA 3HUSC 5AW5B 1JMMA 1SQVE 1RF1C 2WSFJ 3IFMA 1SFCD 3L74D 1ZN5A 1L0LK 1KMIZ 3L70D 3MIWA 1T6AA 2QJPC 2H88C 1RQVA 1FJPA 3H1LG 2ZVNB 2W27A 3AEDC 2I1KA 5APXA 1LT9C 3F89A 3V2NA 1ZR2A 1SQXG 1SQQK 2N9YB 3A0BH 1QL2A 2KS1B 4EI2A 2C9LY 4K35A 1Z56A 1L4AC 3AEGC 4HKZH 1NU1K 1W2BO 2QE7H 1A02J 1L0LJ 5AW8B 2KK7A 2UWJE 2H8PD 2GM4A 1IJDB 5KJ7D 1H0TA 1JNMA 1QVFO 1LP1B 4MN4C 1HJBA 2OYHC 2IDBA 3O6QA 2FYNC 3MP7B 1SQVK 1SQQJ 1GL2B 1YTZT 1SS1A 4UB8H 1VQLP 1PZQA 1NTKD 3GMAA 2W6AA 4DJGA 1NU1J 1S4XA 1KD1Q 3BATA 2KNCA 1LNQA 5AW6B 1RH5B 2FYZA 1X8YA 3BCCD 3GLMA 2E76C 2JDIH 2C0WA 3QH9A 1KB9E 4C7NA 4PV1D 4IL6X 4DOJA 2QM8A 3G6EP 2A45G 1QX8A 1OW8A 1ZOYC 4I7ZB 1X79B 5TISE 1LTSC 1BGYG 1KB9I 3F5HA 3N7NA 2KZJA 2ZYGA 2WITA 5CCHA 3D6YA 4JQ0D 3KZIH 2Y9YA 4NPFX 1T2KD 1Q2NA 3VP8A 1NJIQ 2XDJA 4PD4D 1E79H 3AE7C 3P8MC 3MUDA 2O1JA 3H1ID 2YXRB 3ABVC 1JMBA 3TGUJ 2W6BA 3NFQA 1P84D 2H89C 2L5GB 4YTPC 3WUVA 4JF7A 3IF4A 2HODA 3L36A 1FZEA 5CCGA 3CX5D 2XV5A 3HD7D 2AEFA 1YYCA 1OW6A 1X0TA 2I1JA 3VP9A 1URQA 3L73G 4TLFA 1RE3A 1DD4A 2WZ7A 2QJYC 3LW5J 1FAVA 1FS0E 4KHXA 1KILC 3ZDMA 1T3JA 4H44C 2KS1A 1OFCX 1JCCA 3A0HE 2KP8A 1G1IA 4HB1A 3C8VA 4N78D 3AE1C 2E74B 4K3AA 2PFXA 3H1HJ 4GOFA 1M1JC 4NPEA 4M3LA 1U57A 1MFZA 1NTZG 3PJSK 1VDFA 1VQ5P 3AECC 1TU3F 4Z1MH 1LP1A 1NTMG 4HJGH 4RJTA 2QM7A 2FFDA 3HE4B 3V2PA 2JR8A 3L74E 3CPWO 3LW5H 2PRRA 3RL0C 1VQ9P 5KAIE 4AYCA 3P8CD 3L75G 1RF1B 1LTBC 2R3CA 3H25A 1WT6A 2PAJA 1FJKA 2WPVB 1AA0A 2ZJSE 3AE6C 4YXDC 3HE5B 1PGPA 3VOPA 3RBXA 1UIXA 3A5TA 1BCCJ 1FU1A 2Z5IA 2YKPA 2FKWB 4R4MA 3G9RA 4ASWA 1SP4A 4GDOA 3JC22 2QEXP 1L4AB 3EFFK 4N3YB 2BCCD 3PLNA 5AW7B 2P10A 2IX7C 2IYPA 3L72G 2KLVA 1JTHB 2XZRA 2NRGA 1N7LA 1GL2D 3L71G 1LJ2A 5CCHC 1NTKE 1SQQG 2RN0A 2OYHB 2M8RA 3KXDA 2FYNB 1WRGA 3BCCE 2KI7B 3Q5SA 1FZBA 3CLQA 1NU1G 1JO5A 5CBOA 2IZ1A 4D6TE 3CWBJ 5CCGC 3Q1MA 2QVAA 2PP6A 1JY2N 4XE5B 2YKQA 3OA7A 1ZMEC 4NPDA 1K8AQ 1SQVG 4HH2A 1URQC 4L75A 1IO4A 3NTNA 1RE3C 4PD4E 3H1IE 1KN7A 1P84E 1NTKK 1FZGA 1RY3A 5CJ0A 1LWUC 1SQXJ 1IFIA 4PD4I 2Q7CA 1NKZB 1XTCC 1FDIA 3CX5E 3I55P 2Y0CA 3U59A 4UB6E 1P84I 5DJTB 2ZXXA 2Q9IA 1NHLA 5GTIE 1HGZA 3CX5I 1J1DB 1DD3A 1YITP 3HUSA 5AVXB 1BDDA 1Q90D 1H8AA 2FFDC 1QLED 1VL2A 1RHZB 1VQ8P 1NYHA 3NMDA 2QJYB 1M90Q 1T3UA 4D6TJ 4N78E 1LT9A 1KQLA 1KILB 2KLUA 4EDFA 2E74D 2H7HA 1BE3D 1IFJA 1KYOH 1ZR4A 1EDIA 1M1JB 1YTZI 3GG2A 1OWAA 1R5SA 4JYBA 1FE6A 1BGYJ 5AVWB 3CCMP 2W90A 3UIAA 2OARA 2OYHA 1VQKP 1Y47A 1LTJA 3A0BE 1YQ3C 3V5BA 2FYUD 2P1JA 5AVSB 2XU6A 1H0TB 2QG4A 1ZRTD 5AW0B 1S5LH 1FZFA 3AE5C 1U7MA 4C7RA 1HH0A 5AVRB 3GW6A 3MTUE 3CCUP 1NO4A 1SQBE 4H0LC 4IL6E 3L4FA 2KNCB 1L4AD 5AW4B 2E5TA 3L73J 5M1BA 3I56P 4UB8E 1FDOA 1IFNA 3RK3C 5GTHH 4C7NB 3JCUE 3HRNA 1SQPD 1WMKA 2RMZA 4C46A 2OYIC 3TNUA 2J59M 3FXDA 2CK3H 3RK2C 1HGVA 1NTZJ 1HF9A 2K1AA 2YMYA 1SQBK 2HODB 3PRJA 3H1KD 3L74G 2SPZA 3CXHH 3MGNA 1HJ0A 4BWNA 1EDLA 2WSCJ 3FXEA 1KILA 1URQB 4EOTA 3L75J 1EZVD 4PJ0H 2NPSA 2HFED 1SQBJ 1OMIA 3EQ2A 4WWIA 1LWUB 2B87A 1M1JA 3CCJP 3TK1A 2YKOA 2WSEJ 1ZP0C 4OGQC 2M3BA 4WB4A 1IK9A 1KZUB 3M9QA 5BU5A 4WBAA 3E1IA 1USEA 1DIPA 1E5WA 3CD6P 2R32A 3L72J 1IFPA 1EQ7A 1QL1A 3CC2P 3H1LD 2KOGA 1VQ7P 2P7JA 3P32A 2WQYC 1NTKG 1JM0A 3L71J 1GTWA 2HLOA 2WSCH 1PP9D 2WSFH 2KIKA 1N8RQ 1PV3A 2ZXEB 4ZKUA 1LTJC 2FFDB 3NXSA 2N1TC 3BCCG 3CMEP 2WWWA 5APUA 5CJ4A 1KILD 1BE3E 3OW2O 1X9VA 4D6TG 1VQ4P 2QSIA 2R5DA 1LTTC 3Q3DA 3VMZA 4IFDK 3V6IA 1SVFA 3MD0A 2WSEH 1S2EA 3IN6A 2ITAA 1AQ5A 1G2CA 1IFMA 2A06E 2Q6QA 3D6ZA 3LIDA 1SQVJ 2YNYA 1KQFB 2JWDA 3H1IG 1VF5C 2ZT9B 3O8ZA 4O9BA 2FYUE 2YO3A 1PL5A 1NVOA 1ZRTE 3AEAC 1GK6A 2WVRA 1ZXGA 2AXCA 2C9NY 4I6MC 4TT3H 3CC7P 5H2FH 1HUCA 4RKUJ 3H1JE 5KAFE 2E42A 3FWLA 3H32A 2LXBA 1CW5A 4H0LB 3T97A 3GHGA 4IOIH 1S3JA 1SQPE 3OAKA 1S1CX 1KFMA 3KHUA 3W68A 1JB0J 2KSEA 4EIJA 3RK3B 1VQPP 1DEEG 1LWUA 5KJ7C 5CCHD 1OVUA 1SLQA 2KSJA 2NPSC 2BEZF 5AW1B 1ZLLA 4H13C 4OVNF 1LT1A 2IBZD 3BRTB 1N73C 2YMKA 5KLVE 1W2EA 2Y0EA 2GUSA 1S9KE 3H1KE 3CXHD 3RK2B 3KPEA 5CCGD 1GMJA 1CI6B 5AVQB 4DZOA 3B8EB 2IFNA 1IK7A 2WSSH 2Z5HA 1EZVE 3L70E 1URQD 1SQPK 1KC8Q 3HUSB 3A3YB 3PP5A 2Y9ZA 5APTA 1JY3O 2OTLP 2WPRA 3S9OA 2V7QJ 3H1JJ 1K73Q 3JSVC 1AVYA 1T2KC 1SQBG 1EZVI 2QJPB 1KB9H 4OWFA 4U3FD 4I2LC 4XA4A 1NH4A 1L0ND 2ZAEB 2FXMA 1NTMD 2K3RA 1LT9B 5KLVK 5TISH 3U1CA 2DW3A 1GU4A 5L8RJ 1RQUA
chains in the Genus database with same CATH topology
3HD7C 2GUVA 4N78E 1LT9A 1S9KD 1HVVA 1GU5A 1GW4A 1KQLA 1A02F 1KILB 1FZCA 1H88A 2H7HA 4W7ZA 3N4XA 4IFFA 1IFJA 3TYYA 3HUSC 5AW5B 5AW9B 1IC2A 3B5NA 1JMMA 1RF1C 3IFMA 3CI9A 1ZR4A 1SFCD 1M1JB 1ZN5A 3M0DA 2O1KA 1L0LK 1YTZI 1J1DC 1LTJB 1OWAA 3MIWA 4AQRD 4JYBA 1FJPA 5AVWB 3M9BA 1J1EC 2W27A 5AVZB 3UIAA 4WY4B 2I1KA 1PFIA 1N7SB 4LC1A 3II6A 3V2RA 2FYUK 5APXA 1LT9C 2OARA 2OYHA 2Z4EA 4LGDE 3V2NA 1ZR2A 1SQQK 1FZCC 1QL2A 2C9LY 1LTJA 1Z56A 1L4AC 1MZ9A 3V5BA 2P1JA 5AVSB 4WY4A 2XU6A 3B5NC 3M9HA 1NU1K 3GHGC 5AVTB 5AW0B 1HTLC 2OYIB 1A02J 1FZFA 3VMXA 3M0DC 5AW8B 4C7RA 1HH0A 5AVRB 2H8PD 1GDTA 2GM4A 4GIFA 3MTUE 1IJDB 1NO4A 1DX7A 5KJ7D 2Q3IA 3L4FA 1JNMA 1HJBA 2OYHC 2OYIA 1SQVK 1L4AD 1GL2B 1YTZT 5AW4B 5APVA 4W80A 3B5ND 5AVYB 3V4WA 1T8ZA 2W6AA 1CI6A 1IFNA 3RK3C 3BATA 4C7NB 3TNUB 5AW6B 1GL2A 2FYZA 1X8YA 1DEBA 3HRNA 4C46A 1LTIC 2C0WA 1GW3A 1KFNA 1JCDA 4C7NA 2WPQA 4DOJA 3TNUA 2J59M 2OYIC 2P67A 2QM8A 4IFMA 2A45G 3R2PA 3KYQA 1AFOA 1FDMA 3RK2C 1X79B 1HGVA 3L35A 3H6PA 5AW3B 1LTSC 3RK3D 3N7NA 2YMYA 1SQBK 2P2UA 2WITA 5CCHA 2KYVA 2HODB 1T2KD 5BVZA 1GK4A 1NKNA 3VP8A 2XDJA 3P8MC 2N9BA 3MUDA 2O1JA 3KDPB 2NPSB 2W6BA 3NFQA 2L5GB 3MGNA 4JF7A 4Y99B 1FBMA 3RK2D 2HODA 2O01H 3M0AA 3L36A 1FZEA 1KILA 5BU8B 5CCGA 1URQB 4EOTA 4RESB 1MV8A 2XV5A 2N1TB 1G1JA 2NPSA 3HD7D 2R5BA 4I1LA 2HFED 2JEEA 2JJLA 1YYCA 3BRVB 1FOSE 3L37A 3V4QA 3EQ2A 2I1JA 3VP9A 1LWUB 1URQA 1M1JA 3P8CE 1JY3N 5AW2B 2N1TA 1HWTC 1RE3A 3TK1A 2YKOA 2WZ7A 1HBWA 4LLHA 2M3BA 4WB4A 3RL0B 3VN0A 1N7SA 1FAVA 1IK9A 1KZUB 3M9QA 5BU5A 4WBAA 1GZLA 4KHXA 1LTGC 1GD2E 3E1IA 2KB7P 1KILC 5AVUB 1T3JA 1E5WA 2R32A 2POHA 1EQ7A 1JCCA 1SQXK 1NAFA 1QL1A 1G1IA 2KP8A 2KOGA 2P7JA 3P32A 1GTWA 2BASA 4N78D 4JYCA 2HLOA 2WSCH 1FOSF 3OJAB 2WSFH 2ZXEB 3SWYA 2A45H 4ZKUA 1M1JC 1LTJC 3G3ZA 2FFDB 3NXSA 2N1TC 3C9IA 4M3LA 1MFZA 1DH3A 2WWWA 1VDFA 5APUA 5CJ4A 4WY4C 1KILD 2HYNA 1N7SC 1G2CB 4W7YA 1X9VA 1SFCB 1NWQA 1OXZA 4N6JA 2R5DA 1LTTC 4OH8B 2A45I 2QM7A 2FFDA 3VMZA 3KQGA 4IFDK 3HE4B 1SVFA 3MD0A 2WSEH 3V2PA 3LW5H 4GT1A 3BASA 3RL0C 1AQ5A 1G2CA 1IFMA 3M06A 4ZKPA 3BVHA 3LIDA 4AYCA 2VRSA 3P8CD 2YNYA 3CL3D 4WY4D 1RF1B 3EFGA 1LTBC 2H43A 1N7SD 3HE4A 2R3CA 1RE4A 1M7LA 5APYA 1JY3P 1WT6A 2PAJA 3O8ZA 3VYIA 4O9BA 2WTYA 1N2DC 1FJKA 2C0XA 1N86A 1FZAA 1J1EB 3I5CA 1LGHB 1GL2C 3HE5B 2YO3A 3VOPA 1RF1A 3A5TA 1FU1A 2Z5IA 1FZCB 2YKPA 2FKWB 3H32B 1J2JB 1GK6A 1SP4A 1JY2P 1L4AB 2C9NY 4I6MC 5KTBA 4N3YB 1RF0A 5AW7B 3B5NB 3HE5A 1N73B 2E43A 2IX7C 4HYTB 3GHGB 1HUCA 2KLVA 1JTHB 2XZRA 5KJ7A 1RE4C 2E42A 3H32A 1N7LA 1GL2D 2XNXA 5CCHC 3V2QA 1L4AA 1CW5A 1H89A 1N73A 3T97A 2OYHB 3GHGA 4AUWA 2M8RA 3LIEA 3A7OA 2Q5UA 3VTPC 2WT7B 1WRGA 1JTHA 2XKMA 1FZBA 3OAKA 3CLQA 1KFMA 1JO5A 1JOCA 1RF0C 1VPCA 1ZV8A 4EIJA 3RK3B 5CCGC 1LWUA 2WT7A 5AVVB 5KJ7C 5CCHD 1SLQA 2KSJA 2NPSC 2HG5D 2PP6A 5AW1B 1JY2N 1ZLLA 3P7KA 4Y99C 4XE5B 2YKQA 2IFMA 3OA7A 2CPSA 3BRTB 2IPPA 2J58A 1N73C 4HH2A 1URQC 1W2EA 2YO2A 1IO4A 3NTNA 2GUSA 1S9KE 1RE3C 3WMM0 3RK2B 1JUNA 1NOHA 3KPEA 5CCGD 1CI6B 5AVQB 3IR9A 4DZOA 1NTKK 1FZGA 2NPSD 1RY3A 5CJ0A 1LWUC 3B8EB 3HD7B 3U1AA 1MUUA 2IFNA 2HPCB 1IFIA 2Q7CA 2CPBA 2Z5HA 1NKZB 1XTCC 2ZFCA 3A2AA 1NTZK 1URQD 4GKGA 1SQPK 3TSIA 3U59A 3SWFA 1SFCA 3HUSB 2N1TD 5APQA 2MJZA 3A3YB 5CMZA 3PP5A 1L0NK 3HD7A 2LKMA 5APTA 1JY3O 4B86A 2WPRA 2Q9IA 1NHLA 2HPCA 2WPSA 1NTMK 1CZQA 1HGZA 3HTKB 3VMYA 1T2KC 1LTAC 1J1DB 4XA4A 4I2LC 1NH4A 5CHXA 5APWA 3HUSA 5AVXB 5APSA 1IFDA 1H8AA 2FXMA 1LT9B 5KLVK 2FFDC 1CSBA 3RL0D 1JY2O 1XTGB 3U1CA 3HTKA 3M91A 1GU4A 1SFCC 3NMDA 1T3UA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 C;  4N78 E;  1HVV A;  1KIL B;  2N1T C;  4W7Z A;  3RK3 B;  5CCG C;  4WY4 C;  1KIL D;  5KJ7 C;  1N7S C;  3KYQ A;  5CCH D;  4W7Y A;  2NPS C;  1SFC B;  2HG5 D;  3RK2 C;  2PP6 A;  3B5N A;  3RK3 D;  4OH8 B;  2YMY A;  1SFC D;  5CCH A;  1URQ C;  2XDJ A;  3RL0 C;  4WY4 B;  1N7S B;  2NPS B;  3RK2 B;  4LGD E;  5CCG D;  4WY4 D;  4JF7 A;  1N7S D;  2NPS D;  3RK2 D;  3HD7 B;  1L4A C;  1KIL A;  5CCG A;  1URQ B;  4WY4 A;  3B5N C;  2N1T B;  3HD7 D;  2NPS A;  1GL2 C;  2HFE D;  1URQ D;  3TSI A;  3VOP A;  3M0D C;  1SFC A;  2N1T D;  2H8P D;  3PP5 A;  3HD7 A;  1URQ A;  1NHL A;  1L4A B;  5KJ7 D;  3P8C E;  3HTK B;  2N1T A;  3B5N B;  2WZ7 A;  1L4A D;  1GL2 B;  3RL0 B;  1JTH B;  1N7S A;  5KJ7 A;  4W80 A;  3B5N D;  1GL2 D;  1KIL C;  5CCH C;  3RL0 D;  1L4A A;  1T3J A;  1XTG B;  3RK3 C;  2KOG A;  1GL2 A;  2M8R A;  1SFC C;  1JTH A; 
#chains in the Genus database with same CATH topology
 3HD7 C;  2B89 A;  1GU5 A;  1HVV A;  1GW4 A;  3B4S A;  1PP9 E;  4L76 A;  1PPJ D;  4W7Z A;  4IFF A;  5AW9 B;  5KLV J;  1OX3 A;  2V7Q H;  1S72 P;  2O1K A;  1PGO A;  3RL0 g;  1LTJ B;  2XND H;  1NAY A;  4AQR D;  2ZVO B;  1J1E C;  5AVZ B;  4LGD E;  1L0L D;  3D70 A;  2AXT E;  2L91 A;  1FZC C;  1OVV A;  2E76 B;  1FC2 C;  3L74 J;  1R8E A;  3L70 J;  1MZ9 A;  1EXJ A;  4WY4 A;  3E1R A;  3B5N C;  1SQQ D;  2LXC B;  2ZT9 D;  3GHG C;  1JEK A;  3VMX A;  3M0D C;  2E75 C;  1Y9B A;  3A0H H;  1YHQ P;  3AEF C;  1GDT A;  4GIF A;  1VF5 B;  1NU1 D;  2WMM A;  2Q3I A;  3AEB C;  1Q7Y Q;  2AEJ A;  2JKV A;  2OYI A;  1IZN B;  5APV A;  1Q81 Q;  5AVY B;  3V4W A;  1CI6 A;  5B5E E;  2AEM A;  3TNU B;  5GTH E;  3W67 A;  2YIU C;  4CPG A;  2KXP B;  4H0L D;  5KAI H;  2V4H A;  1GW3 A;  1NTK J;  1KFN A;  1JCD A;  2WPQ A;  3MZW B;  4IFM A;  4DT0 A;  3KYQ A;  1AFO A;  3TGU D;  3BCC J;  3H6P A;  5AW3 B;  3RK3 D;  2P2U A;  4ZMD A;  1VQN P;  3Q5R A;  2IBZ E;  1NKN A;  2N9B A;  4RO0 A;  3WU2 H;  4H44 B;  2NPS B;  2A06 G;  3E7K A;  4H13 B;  2IBZ I;  3RK2 D;  3M0A A;  1VQM P;  2B87 B;  5BU8 B;  4RES B;  2R5B A;  3H1I J;  4I1L A;  1AVO A;  3CXH I;  1EXI A;  2JJL A;  1X22 A;  2FYU G;  3L37 A;  3V4Q A;  4I7Z C;  5B66 H;  3P8C E;  1JY3 N;  2W8Z A;  5AW2 B;  2N1T A;  1BSN A;  2R44 A;  4LLH A;  1W5C E;  2D2C C;  3RL0 B;  3H1H D;  4KT0 J;  4U3F E;  1GZL A;  1L0N E;  1GD2 E;  1LTG C;  4WVZ A;  2KB7 P;  3H1J G;  3PH0 A;  1NTM E;  2W6J H;  2BAS A;  4JPZ B;  2KZI A;  4JYC A;  2RKL A;  2BCC E;  5KLI C;  2O01 N;  3SWY A;  2A45 H;  3IAO A;  1M8O B;  3C9I A;  1DH3 A;  1SQP G;  1PPJ E;  4A7P A;  2K9J A;  4WY4 C;  1P84 H;  1N7S C;  2FXP A;  1G2C B;  4W7Y A;  1M1K Q;  1NWQ A;  4OH8 B;  2K88 A;  1AV1 A;  3KQG A;  3CX5 H;  1S5L X;  4UB6 H;  4GT1 A;  2LR2 A;  3M06 A;  4ZKP A;  3BVH A;  5KLV G;  1BCC D;  3H1K G;  1VQ6 P;  1YQ4 C;  2ZYA A;  2H43 A;  1L0L E;  5C39 A;  1MKM A;  1ZW0 A;  1JY3 P;  5APY A;  2WTY A;  3CCE P;  1N2D C;  3CCR P;  2E76 D;  1FZA A;  2E74 C;  1J1E B;  3KZI E;  1VQO P;  3WUT A;  2JO1 A;  3GF3 A;  1FZC B;  1EZV G;  3L70 G;  3H32 B;  1OW7 A;  4R4L A;  2Y0D A;  3TDK A;  3B5N B;  1VF5 D;  5K5G B;  3T97 B;  3GHG B;  2QJK C;  4YXW H;  5KJ7 A;  1RE4 C;  2E75 B;  4KJM A;  1OIP A;  3V2Q A;  1QVG O;  3CWB D;  4U7J A;  1N73 A;  2BCC J;  3A7O A;  2Q5U A;  2BEQ D;  3MHV A;  1JOC A;  1RF0 C;  1PP9 G;  2WT7 A;  5AVV B;  2PGD A;  2M3E A;  2YIU B;  2HG5 D;  3P7K A;  3TGU E;  4Y99 C;  3SFD C;  3RK3 E;  2CPS A;  4BXL A;  2IPP A;  3CC4 P;  2YO2 A;  1SQX D;  1YBK A;  3WMM 0;  4JBZ A;  3RGU A;  1NOH A;  4IL6 H;  3FWN A;  4H44 D;  1KYO D;  3IR9 A;  5E79 H;  2NPS D;  3CCQ P;  4H13 D;  1MUU A;  2CPB A;  2ZFC A;  3A2A A;  1EDJ A;  4GKG A;  3TSI A;  1YJ9 P;  2MJZ A;  3HD7 A;  2LKM A;  3JCU H;  4B86 A;  2Q1K A;  2HPC A;  2Q3E A;  2WPS A;  1LTA C;  4ZNC A;  5CHX A;  4D6T D;  1KTM A;  5APS A;  3H1H E;  1CSB A;  3RL0 D;  1YJN P;  2OGU A;  1JY2 O;  1EC5 A;  1XTG B;  3HTK A;  3M91 A;  2P58 A;  1SFC C;  2D2C B;  1QEX A;  3GF7 A;  5KKZ C;  2OTK E;  1FZC A;  2O3J A;  1H88 A;  5DJU B;  2B88 A;  1BGY D;  1YJW P;  1BDC A;  1IC2 A;  3B5N A;  3SWK A;  2GA1 A;  3AE3 C;  3CI9 A;  2IYO A;  5TJH A;  5KLI B;  4GOE A;  3M0D A;  2MKV A;  1J1D C;  1BE3 J;  3M9B A;  1U7J A;  3WUU A;  2IBZ G;  4WY4 B;  1PFI A;  1N7S B;  4LC1 A;  3II6 A;  3V2R A;  2FYU K;  1R5L A;  2Z4E A;  1BCC E;  3FX0 A;  2K37 A;  3AE9 C;  3M9H A;  4BRY B;  1QGK B;  5AVT B;  1HTL C;  2OYI B;  1AJY A;  3L73 D;  3S4R A;  1DX7 A;  1PGJ A;  2QIW A;  2FYU J;  3AE8 C;  4L73 A;  1USD A;  4W80 A;  4PV1 C;  3B5N D;  1T8Z A;  4U3F G;  1M57 D;  2E75 D;  1L0N G;  2O01 J;  3CWB E;  1GL2 A;  1EDK A;  1DEB A;  2QJK B;  1NTZ D;  1PGQ A;  2QRX A;  1LTI C;  3SSU A;  1Q82 Q;  2BCC G;  2P67 A;  3R2P A;  1FDM A;  1PPJ G;  1PIX A;  3L35 A;  2HR3 A;  1SQP J;  3H1L E;  2G3A A;  4OGQ B;  2KYV A;  4YPC A;  5BVZ A;  1GK4 A;  3L75 D;  2FXO A;  1SQX E;  3KDP B;  1SQB D;  1OVR A;  3WU2 E;  4Y99 B;  3B71 A;  3AEE C;  1FBM A;  1KIL E;  2O01 H;  1M56 D;  1KYO E;  2OYO A;  1L0L G;  3H1K J;  5KAF H;  1MV8 A;  2N1T B;  1G1J A;  2I8D A;  2JEE A;  3BRV B;  4L74 A;  1FOS E;  1KYO I;  2E5Y A;  4DCK A;  3MUD C;  3L72 D;  3D71 A;  1HWT C;  5B66 E;  3L71 D;  3CCV P;  2W83 C;  1HBW A;  5EFW B;  3VN0 A;  1N7S A;  3QWO C;  1NGM B;  2ZYD A;  5AVU B;  1S5L E;  2POH A;  1OZH A;  1SQX K;  1NAF A;  2K9J B;  4BRY A;  1FOS F;  3OJA B;  3G3Z A;  4ASV A;  2D2C D;  3RBZ A;  4EYY Q;  2HYN A;  2NZ2 A;  1BGY E;  3H1L J;  1SQV D;  1SFC B;  1OXZ A;  4N6J A;  1PP9 J;  3AE2 C;  2A45 I;  3TGU G;  5KKZ B;  1AQT A;  3BAS A;  1KV4 A;  3G71 P;  2VRS A;  1MFT A;  3CL3 D;  4WY4 D;  3EFG A;  1N7S D;  3HE4 A;  1RE4 A;  1BE3 G;  1M7L A;  2B9B A;  3VYI A;  2C0X A;  1N86 A;  3I5C A;  2M5A B;  1LGH B;  1GL2 C;  4GOD A;  1RF1 A;  2KUB A;  3L73 E;  3CMA P;  1J2J B;  3CXH E;  1JY2 P;  5KTB A;  1RF0 A;  3HE5 A;  1N73 B;  2E43 A;  4HYT B;  4PJ0 E;  3PTZ A;  2XNX A;  1L4A A;  1YI2 P;  3USS A;  2OTJ P;  1UII A;  3H1H G;  3R4Y A;  1L2P A;  3AE4 C;  3K5B A;  1H89 A;  4AUW A;  3LIE A;  2WT7 B;  3VTP C;  2G8Y A;  1JTH A;  2XKM A;  3TF5 A;  1KB9 D;  2ZT9 C;  2A06 D;  4PV1 B;  1NTZ E;  3G4S P;  1VPC A;  1ZV8 A;  2RH0 A;  2AXT H;  2YXQ B;  3ITK A;  1YIJ P;  3CCS P;  2IFM A;  3Q5P A;  1BSH A;  2J58 A;  3O6Q B;  4OGQ D;  4PD4 H;  2JP3 A;  3L75 E;  2QA4 P;  3PHL A;  1JUN A;  1K05 A;  3FGA D;  2R3S A;  3C1L A;  2FY8 A;  5E79 E;  3HD7 B;  3H1J D;  3U1A A;  1Q86 Q;  3EWK A;  3VMA A;  1BCC G;  2JWA A;  2HPC B;  1NTZ K;  1K04 A;  3SWF A;  5B5E H;  1SFC A;  2N1T D;  5APQ A;  3SFE C;  4QMA A;  5CMZ A;  1L0N K;  1K9M Q;  5GTI H;  1Y8A A;  1NTM K;  1CZQ A;  3HTK B;  1KOR A;  3L72 E;  3VMY A;  4XFJ A;  2FBW C;  5APW A;  2IZ0 A;  3L71 E;  3S1K A;  1IFD A;  1SQQ E;  3Q2Y A;  2K9Y A;  4U3F J;  2OQQ A;  5KLV D;  2J5U A;  1KQG B;  1D7M A;  1NU1 E;  2M5A A;  1L0N J;  3CWB G;  2GUV A;  1S9K D;  5CBN A;  1A02 F;  1NTM J;  1KQS O;  5H2F E;  2M0B A;  4Y28 J;  3CCL P;  3N4X A;  3TYY A;  3HUS C;  5AW5 B;  1JMM A;  1SQV E;  1RF1 C;  2WSF J;  3IFM A;  1SFC D;  3L74 D;  1ZN5 A;  1L0L K;  1KMI Z;  3L70 D;  3MIW A;  1T6A A;  2QJP C;  2H88 C;  1RQV A;  1FJP A;  3H1L G;  2ZVN B;  2W27 A;  3AED C;  2I1K A;  5APX A;  1LT9 C;  3F89 A;  3V2N A;  1ZR2 A;  1SQX G;  1SQQ K;  2N9Y B;  3A0B H;  1QL2 A;  2KS1 B;  4EI2 A;  2C9L Y;  4K35 A;  1Z56 A;  1L4A C;  3AEG C;  4HKZ H;  1NU1 K;  1W2B O;  2QE7 H;  1A02 J;  1L0L J;  5AW8 B;  2KK7 A;  2UWJ E;  2H8P D;  2GM4 A;  1IJD B;  5KJ7 D;  1H0T A;  1JNM A;  1QVF O;  1LP1 B;  4MN4 C;  1HJB A;  2OYH C;  2IDB A;  3O6Q A;  2FYN C;  3MP7 B;  1SQV K;  1SQQ J;  1GL2 B;  1YTZ T;  1SS1 A;  4UB8 H;  1VQL P;  1PZQ A;  1NTK D;  3GMA A;  2W6A A;  4DJG A;  1NU1 J;  1S4X A;  1KD1 Q;  3BAT A;  2KNC A;  1LNQ A;  5AW6 B;  1RH5 B;  2FYZ A;  1X8Y A;  3BCC D;  3GLM A;  2E76 C;  2JDI H;  2C0W A;  3QH9 A;  1KB9 E;  4C7N A;  4PV1 D;  4IL6 X;  4DOJ A;  2QM8 A;  3G6E P;  2A45 G;  1QX8 A;  1OW8 A;  1ZOY C;  4I7Z B;  1X79 B;  5TIS E;  1LTS C;  1BGY G;  1KB9 I;  3F5H A;  3N7N A;  2KZJ A;  2ZYG A;  2WIT A;  5CCH A;  3D6Y A;  4JQ0 D;  3KZI H;  2Y9Y A;  4NPF X;  1T2K D;  1Q2N A;  3VP8 A;  1NJI Q;  2XDJ A;  4PD4 D;  1E79 H;  3AE7 C;  3P8M C;  3MUD A;  2O1J A;  3H1I D;  2YXR B;  3ABV C;  1JMB A;  3TGU J;  2W6B A;  3NFQ A;  1P84 D;  2H89 C;  2L5G B;  4YTP C;  3WUV A;  4JF7 A;  3IF4 A;  2HOD A;  3L36 A;  1FZE A;  5CCG A;  3CX5 D;  2XV5 A;  3HD7 D;  2AEF A;  1YYC A;  1OW6 A;  1X0T A;  2I1J A;  3VP9 A;  1URQ A;  3L73 G;  4TLF A;  1RE3 A;  1DD4 A;  2WZ7 A;  2QJY C;  3LW5 J;  1FAV A;  1FS0 E;  4KHX A;  1KIL C;  3ZDM A;  1T3J A;  4H44 C;  2KS1 A;  1OFC X;  1JCC A;  3A0H E;  2KP8 A;  1G1I A;  4HB1 A;  3C8V A;  4N78 D;  3AE1 C;  2E74 B;  4K3A A;  2PFX A;  3H1H J;  4GOF A;  1M1J C;  4NPE A;  4M3L A;  1U57 A;  1MFZ A;  1NTZ G;  3PJS K;  1VDF A;  1VQ5 P;  3AEC C;  1TU3 F;  4Z1M H;  1LP1 A;  1NTM G;  4HJG H;  4RJT A;  2QM7 A;  2FFD A;  3HE4 B;  3V2P A;  2JR8 A;  3L74 E;  3CPW O;  3LW5 H;  2PRR A;  3RL0 C;  1VQ9 P;  5KAI E;  4AYC A;  3P8C D;  3L75 G;  1RF1 B;  1LTB C;  2R3C A;  3H25 A;  1WT6 A;  2PAJ A;  1FJK A;  2WPV B;  1AA0 A;  2ZJS E;  3AE6 C;  4YXD C;  3HE5 B;  1PGP A;  3VOP A;  3RBX A;  1UIX A;  3A5T A;  1BCC J;  1FU1 A;  2Z5I A;  2YKP A;  2FKW B;  4R4M A;  3G9R A;  4ASW A;  1SP4 A;  4GDO A;  3JC2 2;  2QEX P;  1L4A B;  3EFF K;  4N3Y B;  2BCC D;  3PLN A;  5AW7 B;  2P10 A;  2IX7 C;  2IYP A;  3L72 G;  2KLV A;  1JTH B;  2XZR A;  2NRG A;  1N7L A;  1GL2 D;  3L71 G;  1LJ2 A;  5CCH C;  1NTK E;  1SQQ G;  2RN0 A;  2OYH B;  2M8R A;  3KXD A;  2FYN B;  1WRG A;  3BCC E;  2KI7 B;  3Q5S A;  1FZB A;  3CLQ A;  1NU1 G;  1JO5 A;  5CBO A;  2IZ1 A;  4D6T E;  3CWB J;  5CCG C;  3Q1M A;  2QVA A;  2PP6 A;  1JY2 N;  4XE5 B;  2YKQ A;  3OA7 A;  1ZME C;  4NPD A;  1K8A Q;  1SQV G;  4HH2 A;  1URQ C;  4L75 A;  1IO4 A;  3NTN A;  1RE3 C;  4PD4 E;  3H1I E;  1KN7 A;  1P84 E;  1NTK K;  1FZG A;  1RY3 A;  5CJ0 A;  1LWU C;  1SQX J;  1IFI A;  4PD4 I;  2Q7C A;  1NKZ B;  1XTC C;  1FDI A;  3CX5 E;  3I55 P;  2Y0C A;  3U59 A;  4UB6 E;  1P84 I;  5DJT B;  2ZXX A;  2Q9I A;  1NHL A;  5GTI E;  1HGZ A;  3CX5 I;  1J1D B;  1DD3 A;  1YIT P;  3HUS A;  5AVX B;  1BDD A;  1Q90 D;  1H8A A;  2FFD C;  1QLE D;  1VL2 A;  1RHZ B;  1VQ8 P;  1NYH A;  3NMD A;  2QJY B;  1M90 Q;  1T3U A;  4D6T J;  4N78 E;  1LT9 A;  1KQL A;  1KIL B;  2KLU A;  4EDF A;  2E74 D;  2H7H A;  1BE3 D;  1IFJ A;  1KYO H;  1ZR4 A;  1EDI A;  1M1J B;  1YTZ I;  3GG2 A;  1OWA A;  1R5S A;  4JYB A;  1FE6 A;  1BGY J;  5AVW B;  3CCM P;  2W90 A;  3UIA A;  2OAR A;  2OYH A;  1VQK P;  1Y47 A;  1LTJ A;  3A0B E;  1YQ3 C;  3V5B A;  2FYU D;  2P1J A;  5AVS B;  2XU6 A;  1H0T B;  2QG4 A;  1ZRT D;  5AW0 B;  1S5L H;  1FZF A;  3AE5 C;  1U7M A;  4C7R A;  1HH0 A;  5AVR B;  3GW6 A;  3MTU E;  3CCU P;  1NO4 A;  1SQB E;  4H0L C;  4IL6 E;  3L4F A;  2KNC B;  1L4A D;  5AW4 B;  2E5T A;  3L73 J;  5M1B A;  3I56 P;  4UB8 E;  1FDO A;  1IFN A;  3RK3 C;  5GTH H;  4C7N B;  3JCU E;  3HRN A;  1SQP D;  1WMK A;  2RMZ A;  4C46 A;  2OYI C;  3TNU A;  2J59 M;  3FXD A;  2CK3 H;  3RK2 C;  1HGV A;  1NTZ J;  1HF9 A;  2K1A A;  2YMY A;  1SQB K;  2HOD B;  3PRJ A;  3H1K D;  3L74 G;  2SPZ A;  3CXH H;  3MGN A;  1HJ0 A;  4BWN A;  1EDL A;  2WSC J;  3FXE A;  1KIL A;  1URQ B;  4EOT A;  3L75 J;  1EZV D;  4PJ0 H;  2NPS A;  2HFE D;  1SQB J;  1OMI A;  3EQ2 A;  4WWI A;  1LWU B;  2B87 A;  1M1J A;  3CCJ P;  3TK1 A;  2YKO A;  2WSE J;  1ZP0 C;  4OGQ C;  2M3B A;  4WB4 A;  1IK9 A;  1KZU B;  3M9Q A;  5BU5 A;  4WBA A;  3E1I A;  1USE A;  1DIP A;  1E5W A;  3CD6 P;  2R32 A;  3L72 J;  1IFP A;  1EQ7 A;  1QL1 A;  3CC2 P;  3H1L D;  2KOG A;  1VQ7 P;  2P7J A;  3P32 A;  2WQY C;  1NTK G;  1JM0 A;  3L71 J;  1GTW A;  2HLO A;  2WSC H;  1PP9 D;  2WSF H;  2KIK A;  1N8R Q;  1PV3 A;  2ZXE B;  4ZKU A;  1LTJ C;  2FFD B;  3NXS A;  2N1T C;  3BCC G;  3CME P;  2WWW A;  5APU A;  5CJ4 A;  1KIL D;  1BE3 E;  3OW2 O;  1X9V A;  4D6T G;  1VQ4 P;  2QSI A;  2R5D A;  1LTT C;  3Q3D A;  3VMZ A;  4IFD K;  3V6I A;  1SVF A;  3MD0 A;  2WSE H;  1S2E A;  3IN6 A;  2ITA A;  1AQ5 A;  1G2C A;  1IFM A;  2A06 E;  2Q6Q A;  3D6Z A;  3LID A;  1SQV J;  2YNY A;  1KQF B;  2JWD A;  3H1I G;  1VF5 C;  2ZT9 B;  3O8Z A;  4O9B A;  2FYU E;  2YO3 A;  1PL5 A;  1NVO A;  1ZRT E;  3AEA C;  1GK6 A;  2WVR A;  1ZXG A;  2AXC A;  2C9N Y;  4I6M C;  4TT3 H;  3CC7 P;  5H2F H;  1HUC A;  4RKU J;  3H1J E;  5KAF E;  2E42 A;  3FWL A;  3H32 A;  2LXB A;  1CW5 A;  4H0L B;  3T97 A;  3GHG A;  4IOI H;  1S3J A;  1SQP E;  3OAK A;  1S1C X;  1KFM A;  3KHU A;  3W68 A;  1JB0 J;  2KSE A;  4EIJ A;  3RK3 B;  1VQP P;  1DEE G;  1LWU A;  5KJ7 C;  5CCH D;  1OVU A;  1SLQ A;  2KSJ A;  2NPS C;  2BEZ F;  5AW1 B;  1ZLL A;  4H13 C;  4OVN F;  1LT1 A;  2IBZ D;  3BRT B;  1N73 C;  2YMK A;  5KLV E;  1W2E A;  2Y0E A;  2GUS A;  1S9K E;  3H1K E;  3CXH D;  3RK2 B;  3KPE A;  5CCG D;  1GMJ A;  1CI6 B;  5AVQ B;  4DZO A;  3B8E B;  2IFN A;  1IK7 A;  2WSS H;  2Z5H A;  1EZV E;  3L70 E;  1URQ D;  1SQP K;  1KC8 Q;  3HUS B;  3A3Y B;  3PP5 A;  2Y9Z A;  5APT A;  1JY3 O;  2OTL P;  2WPR A;  3S9O A;  2V7Q J;  3H1J J;  1K73 Q;  3JSV C;  1AVY A;  1T2K C;  1SQB G;  1EZV I;  2QJP B;  1KB9 H;  4OWF A;  4U3F D;  4I2L C;  4XA4 A;  1NH4 A;  1L0N D;  2ZAE B;  2FXM A;  1NTM D;  2K3R A;  1LT9 B;  5KLV K;  5TIS H;  3U1C A;  2DW3 A;  1GU4 A;  5L8R J;  1RQU A; 
#chains in the Genus database with same CATH homology
 3HD7 C;  2GUV A;  4N78 E;  1LT9 A;  1S9K D;  1HVV A;  1GU5 A;  1GW4 A;  1KQL A;  1A02 F;  1KIL B;  1FZC A;  1H88 A;  2H7H A;  4W7Z A;  3N4X A;  4IFF A;  1IFJ A;  3TYY A;  3HUS C;  5AW5 B;  5AW9 B;  1IC2 A;  3B5N A;  1JMM A;  1RF1 C;  3IFM A;  3CI9 A;  1ZR4 A;  1SFC D;  1M1J B;  1ZN5 A;  3M0D A;  2O1K A;  1L0L K;  1YTZ I;  1J1D C;  1LTJ B;  1OWA A;  3MIW A;  4AQR D;  4JYB A;  1FJP A;  5AVW B;  3M9B A;  1J1E C;  2W27 A;  5AVZ B;  3UIA A;  4WY4 B;  2I1K A;  1PFI A;  1N7S B;  4LC1 A;  3II6 A;  3V2R A;  2FYU K;  5APX A;  1LT9 C;  2OAR A;  2OYH A;  2Z4E A;  4LGD E;  3V2N A;  1ZR2 A;  1SQQ K;  1FZC C;  1QL2 A;  2C9L Y;  1LTJ A;  1Z56 A;  1L4A C;  1MZ9 A;  3V5B A;  2P1J A;  5AVS B;  4WY4 A;  2XU6 A;  3B5N C;  3M9H A;  1NU1 K;  3GHG C;  5AVT B;  5AW0 B;  1HTL C;  2OYI B;  1A02 J;  1FZF A;  3VMX A;  3M0D C;  5AW8 B;  4C7R A;  1HH0 A;  5AVR B;  2H8P D;  1GDT A;  2GM4 A;  4GIF A;  3MTU E;  1IJD B;  1NO4 A;  1DX7 A;  5KJ7 D;  2Q3I A;  3L4F A;  1JNM A;  1HJB A;  2OYH C;  2OYI A;  1SQV K;  1L4A D;  1GL2 B;  1YTZ T;  5AW4 B;  5APV A;  4W80 A;  3B5N D;  5AVY B;  3V4W A;  1T8Z A;  2W6A A;  1CI6 A;  1IFN A;  3RK3 C;  3BAT A;  4C7N B;  3TNU B;  5AW6 B;  1GL2 A;  2FYZ A;  1X8Y A;  1DEB A;  3HRN A;  4C46 A;  1LTI C;  2C0W A;  1GW3 A;  1KFN A;  1JCD A;  4C7N A;  2WPQ A;  4DOJ A;  3TNU A;  2J59 M;  2OYI C;  2P67 A;  2QM8 A;  4IFM A;  2A45 G;  3R2P A;  3KYQ A;  1AFO A;  1FDM A;  3RK2 C;  1X79 B;  1HGV A;  3L35 A;  3H6P A;  5AW3 B;  1LTS C;  3RK3 D;  3N7N A;  2YMY A;  1SQB K;  2P2U A;  2WIT A;  5CCH A;  2KYV A;  2HOD B;  1T2K D;  5BVZ A;  1GK4 A;  1NKN A;  3VP8 A;  2XDJ A;  3P8M C;  2N9B A;  3MUD A;  2O1J A;  3KDP B;  2NPS B;  2W6B A;  3NFQ A;  2L5G B;  3MGN A;  4JF7 A;  4Y99 B;  1FBM A;  3RK2 D;  2HOD A;  2O01 H;  3M0A A;  3L36 A;  1FZE A;  1KIL A;  5BU8 B;  5CCG A;  1URQ B;  4EOT A;  4RES B;  1MV8 A;  2XV5 A;  2N1T B;  1G1J A;  2NPS A;  3HD7 D;  2R5B A;  4I1L A;  2HFE D;  2JEE A;  2JJL A;  1YYC A;  3BRV B;  1FOS E;  3L37 A;  3V4Q A;  3EQ2 A;  2I1J A;  3VP9 A;  1LWU B;  1URQ A;  1M1J A;  3P8C E;  1JY3 N;  5AW2 B;  2N1T A;  1HWT C;  1RE3 A;  3TK1 A;  2YKO A;  2WZ7 A;  1HBW A;  4LLH A;  2M3B A;  4WB4 A;  3RL0 B;  3VN0 A;  1N7S A;  1FAV A;  1IK9 A;  1KZU B;  3M9Q A;  5BU5 A;  4WBA A;  1GZL A;  4KHX A;  1LTG C;  1GD2 E;  3E1I A;  2KB7 P;  1KIL C;  5AVU B;  1T3J A;  1E5W A;  2R32 A;  2POH A;  1EQ7 A;  1JCC A;  1SQX K;  1NAF A;  1QL1 A;  1G1I A;  2KP8 A;  2KOG A;  2P7J A;  3P32 A;  1GTW A;  2BAS A;  4N78 D;  4JYC A;  2HLO A;  2WSC H;  1FOS F;  3OJA B;  2WSF H;  2ZXE B;  3SWY A;  2A45 H;  4ZKU A;  1M1J C;  1LTJ C;  3G3Z A;  2FFD B;  3NXS A;  2N1T C;  3C9I A;  4M3L A;  1MFZ A;  1DH3 A;  2WWW A;  1VDF A;  5APU A;  5CJ4 A;  4WY4 C;  1KIL D;  2HYN A;  1N7S C;  1G2C B;  4W7Y A;  1X9V A;  1SFC B;  1NWQ A;  1OXZ A;  4N6J A;  2R5D A;  1LTT C;  4OH8 B;  2A45 I;  2QM7 A;  2FFD A;  3VMZ A;  3KQG A;  4IFD K;  3HE4 B;  1SVF A;  3MD0 A;  2WSE H;  3V2P A;  3LW5 H;  4GT1 A;  3BAS A;  3RL0 C;  1AQ5 A;  1G2C A;  1IFM A;  3M06 A;  4ZKP A;  3BVH A;  3LID A;  4AYC A;  2VRS A;  3P8C D;  2YNY A;  3CL3 D;  4WY4 D;  1RF1 B;  3EFG A;  1LTB C;  2H43 A;  1N7S D;  3HE4 A;  2R3C A;  1RE4 A;  1M7L A;  5APY A;  1JY3 P;  1WT6 A;  2PAJ A;  3O8Z A;  3VYI A;  4O9B A;  2WTY A;  1N2D C;  1FJK A;  2C0X A;  1N86 A;  1FZA A;  1J1E B;  3I5C A;  1LGH B;  1GL2 C;  3HE5 B;  2YO3 A;  3VOP A;  1RF1 A;  3A5T A;  1FU1 A;  2Z5I A;  1FZC B;  2YKP A;  2FKW B;  3H32 B;  1J2J B;  1GK6 A;  1SP4 A;  1JY2 P;  1L4A B;  2C9N Y;  4I6M C;  5KTB A;  4N3Y B;  1RF0 A;  5AW7 B;  3B5N B;  3HE5 A;  1N73 B;  2E43 A;  2IX7 C;  4HYT B;  3GHG B;  1HUC A;  2KLV A;  1JTH B;  2XZR A;  5KJ7 A;  1RE4 C;  2E42 A;  3H32 A;  1N7L A;  1GL2 D;  2XNX A;  5CCH C;  3V2Q A;  1L4A A;  1CW5 A;  1H89 A;  1N73 A;  3T97 A;  2OYH B;  3GHG A;  4AUW A;  2M8R A;  3LIE A;  3A7O A;  2Q5U A;  3VTP C;  2WT7 B;  1WRG A;  1JTH A;  2XKM A;  1FZB A;  3OAK A;  3CLQ A;  1KFM A;  1JO5 A;  1JOC A;  1RF0 C;  1VPC A;  1ZV8 A;  4EIJ A;  3RK3 B;  5CCG C;  1LWU A;  2WT7 A;  5AVV B;  5KJ7 C;  5CCH D;  1SLQ A;  2KSJ A;  2NPS C;  2HG5 D;  2PP6 A;  5AW1 B;  1JY2 N;  1ZLL A;  3P7K A;  4Y99 C;  4XE5 B;  2YKQ A;  2IFM A;  3OA7 A;  2CPS A;  3BRT B;  2IPP A;  2J58 A;  1N73 C;  4HH2 A;  1URQ C;  1W2E A;  2YO2 A;  1IO4 A;  3NTN A;  2GUS A;  1S9K E;  1RE3 C;  3WMM 0;  3RK2 B;  1JUN A;  1NOH A;  3KPE A;  5CCG D;  1CI6 B;  5AVQ B;  3IR9 A;  4DZO A;  1NTK K;  1FZG A;  2NPS D;  1RY3 A;  5CJ0 A;  1LWU C;  3B8E B;  3HD7 B;  3U1A A;  1MUU A;  2IFN A;  2HPC B;  1IFI A;  2Q7C A;  2CPB A;  2Z5H A;  1NKZ B;  1XTC C;  2ZFC A;  3A2A A;  1NTZ K;  1URQ D;  4GKG A;  1SQP K;  3TSI A;  3U59 A;  3SWF A;  1SFC A;  3HUS B;  2N1T D;  5APQ A;  2MJZ A;  3A3Y B;  5CMZ A;  3PP5 A;  1L0N K;  3HD7 A;  2LKM A;  5APT A;  1JY3 O;  4B86 A;  2WPR A;  2Q9I A;  1NHL A;  2HPC A;  2WPS A;  1NTM K;  1CZQ A;  1HGZ A;  3HTK B;  3VMY A;  1T2K C;  1LTA C;  1J1D B;  4XA4 A;  4I2L C;  1NH4 A;  5CHX A;  5APW A;  3HUS A;  5AVX B;  5APS A;  1IFD A;  1H8A A;  2FXM A;  1LT9 B;  5KLV K;  2FFD C;  1CSB A;  3RL0 D;  1JY2 O;  1XTG B;  3U1C A;  3HTK A;  3M91 A;  1GU4 A;  1SFC C;  3NMD A;  1T3U A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...