5APYA

Sequence matkddian inserted between gcn4 adaptors - structure t9(9)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
DKVEELLSKVYHLENEVARLKKLMATKDDIANMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 26
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apyA00
1A02F 5APSA 4I2LC 2XZRA 3A3YB 4GKGA 1HBWA 5AVWB 1S9KE 3M0AA 4I6MC 1FOSE 5AW6B 2YO3A 3A7OA 2N9BA 4RESB 4HYTB 5APTA 2ZXEB 5APXA 1MFZA 1FOSF 3MGNA 2IPPA 3M06A 5APVA 1H8AA 1KQLA 4AUWA 3LIEA 1HUCA 2XV5A 5AVRB 5AW2B 2R5DA 3A2AA 5AVQB 2W6AA 2P7JA 3O8ZA 5AVVB 3TYYA 2R32A 4KHXA 3KDPB 2E43A 5AVUB 1OWAA 2H7HA 2XU6A 2KP8A 1GU5A 5APWA 3VYIA 3T97A 2Q3IA 3M91A 4GT1A 1GK6A 1SP4A 3IR9A 2WPQA 4AYCA 5AW4B 1H89A 2P2UA 1T2KD 5CMZA 1GTWA 5AW0B 1CI6A 1CI6B 1MV8A 2R3CA 1SLQA 4JYCA 1CSBA 2QM7A 2C9LY 2Z5HA 5AW8B 3TNUA 1H88A 3HTKA 3UIAA 3OAKA 3TNUB 4EOTA 1T2KC 1JNMA 1IO4A 3MD0A 1NAFA 5AVSB 2JJLA 2ZFCA 2YO2A 3A5TA 4C46A 3LIDA 3KQGA 1NWQA 3NXSA 3P8MC 3SWFA 2E42A 3VMYA 2VRSA 5AW9B 4C7NA 1CZQA 4C7NB 2Z5IA 2WWWA 5AVYB 1G2CB 2QM8A 4M3LA 5AW3B 3NTNA 1GU4A 3P32A 2WPRA 2WT7A 2WPSA 2WT7B 2WTYA 2W27A 1J2JB 3VMZA 3M9BA 3VMXA 2BASA 4DZOA 2YNYA 3HE4A 5AW1B 3NMDA 1GZLA 3HE4B 4XE5B 5APYA 3V4WA 1GK4A 3I5CA 3L36A 3NFQA 3L37A 1HJBA 3L35A 2C9NY 5APUA 4AQRD 2Q7CA 4B86A 2Q5UA 3TK1A 3HE5A 5AVTB 1YYCA 1DH3A 1GD2E 4JYBA 3HE5B 1MUUA 3VTPC 1S9KD 3M9HA 3M0DA 3V4QA 3VN0A 3B8EB 4LC1A 5AVXB 1A02J 2P67A 1OXZA 5AVZB 5APQA 3P7KA 5AW7B 2R5BA 3V5BA 1X8YA 1HWTC 1JUNA 5AW5B 1FAVA
chains in the Genus database with same CATH superfamily
1L0NG 5E79H 1M1JB 1H0TA 2JWDA 5KAIE 1HGZA 4H13C 1H8AA 5AW2B 2G8YA 3AE4C 1NTZD 2A06E 2AXTH 1LT9A 2ZT9D 3GHGA 2A45G 2Z4EA 4U3FG 3HD7B 3TGUE 3L72D 2CPSA 1AA0A 2IFMA 3V2QA 1MV8A 2R3CA 4YPCA 1FZAA 1U7JA 2JEEA 2QJKB 3EWKA 5K5GB 1NAFA 5KAFE 1FZCB 2KLVA 1JTHB 4ZMDA 5AW3B 1N8RQ 1XTCC 2WT7A 2WPSA 3CCVP 1BCCJ 3CX5D 3VMXA 2HPCB 1DD4A 2OYOA 4YXDC 1J1EB 3V4WA 1FE6A 1BCCG 2K1AA 3L75J 3Q5RA 4N78D 3V2NA 1URQB 3VTPC 1OW7A 4BWNA 5CBNA 2FKWB 3M9QA 3CC2P 4U7JA 2K9JA 2LXBA 1VF5B 3L75D 3V5BA 2RKLA 2MKVA 3CCRP 2PP6A 2CPBA 3CPWO 5KLIC 1FOSF 5APXA 2B88A 2K9YA 1PGOA 1LTJB 1PP9J 1KQLA 1L4AC 3Q2YA 3IN6A 3CL3D 1PP9G 3MZWB 3G9RA 1N73B 3CD6P 2KP8A 1GU5A 2Q9IA 3T97A 1S72P 1N2DC 4IOIH 2WPQA 3CLQA 3L71J 1GL2C 2NPSB 1Q81Q 2OTLP 4O9BA 3V6IA 1N7LA 2FY8A 2I8DA 3EFFK 3L71G 1S4XA 1IO4A 4PD4H 2M5AB 2B89A 1SQBK 3A5TA 3LIDA 3P8MC 2JKVA 2DW3A 5CCHC 2E74D 4PJ0E 1NU1D 3IF4A 1J2JB 2M3BA 2NRGA 2IYPA 2N1TB 4R4MA 1SQQG 4IFMA 3L36A 4NPEA 2Q6QA 1YYCA 1NTKE 2FYUK 3M0DA 1DD3A 1OXZA 1KTMA 1FDIA 1BGYE 1HWTC 1JUNA 1MFTA 2QA4P 1JCDA 4YTPC 1VQ7P 1YTZT 2H88C 3H1KJ 3L73D 4OGQC 3E1RA 1VQOP 1LT9C 5AVRB 1T8ZA 3GHGC 3U1CA 5DJUB 4DT0A 3O8ZA 3FWNA 1R5LA 1LTIC 3USSA 1NTKK 1OVUA 3HRNA 1EC5A 1ZXGA 3RK3D 5CMZA 3TSIA 1N7SD 2IFNA 1EZVE 1BE3D 1S3JA 4D6TD 2Q1KA 1YI2P 1KQFB 2KOGA 3L70J 4H44D 2IBZG 3U1AA 5CBOA 4ZKPA 2E42A 3RBXA 4RKUJ 3L70G 1NYHA 3CWBJ 2WSCH 3MP7B 1SQXJ 1RH5B 2WQYC 3N4XA 1L0NE 1SQXG 4PD4I 1VQPP 1M1KQ 1YIJP 1NTMD 4ASVA 1K04A 1RE4A 3O6QB 4L74A 5APUA 3H1HD 2OARA 3VP9A 3AEBC 2NZ2A 1N86A 1LNQA 3B8EB 5AVXB 5KTBA 1W2BO 5AW7B 3WUTA 4U3FE 2K88A 3V2PA 2W83C 3VP8A 2JWAA 2HLOA 1P84D 5APTA 1Q86Q 3WUVA 5KLVJ 3GMAA 5KJ7D 3GW6A 1KMIZ 4GIFA 5AVQB 1KYOH 3H1IJ 3PH0A 2IZ0A 4PD4D 2R44A 4H13B 5KLVD 2L91A 3H1IG 1Y47A 3H1LJ 1LTBC 2LXCB 1U7MA 2AEMA 1ZV8A 1H89A 1T2KD 4C7RA 1KILC 1S1CX 1SLQA 1OW6A 3H1LD 2FXMA 4EOTA 1JNMA 1MZ9A 2ZVOB 1BCCE 1D7MA 1W5CE 1LT1A 5M1BA 1N7SA 5AW9B 2QJPC 2BEQD 3NTNA 2WPRA 3H25A 2XNDH 2V7QH 3PJSK 2WTYA 3D70A 3VMZA 1SQBG 1EXJA 2FYZA 3SWYA 3M0DC 3L35A 1L0LD 1GDTA 2Q5UA 3BCCJ 3Q5SA 1YITP 4NPFX 1PP9E 2OQQA 2B87B 1IZNB 1QEXA 3A0BE 3SFEC 3BCCD 4N3YB 4YXWH 4I2LC 4IL6X 4EI2A 2WSEJ 1JMMA 1AJYA 2FYUG 3LIEA 1GMJA 3CXHE 2R5DA 3L71E 2FXPA 1VQ6P 3N7NA 5KLIB 2W8ZA 2YIUC 1PV3A 3CCSP 1L4AB 1RF1A 2H7HA 1JY2P 4Y28J 2O01J 2M8RA 2YXRB 5KJ7A 5CJ0A 4AYCA 4OVNF 5AW4B 1DEBA 1CI6A 2OYHA 3L74D 1JY2N 1CSBA 2LKMA 1KYOI 2Y0EA 3CCEP 1SQQE 3ITKA 3QWOC 2BCCJ 3TDKA 3AEEC 1ZRTE 2YO2A 1GL2B 4C46A 4ZKUA 2BCCG 1VQ4P 2KIKA 1UIIA 1IFPA 1RE4C 2I1KA 1EZVI 1GK4A 3SFDC 2E74C 3C8VA 1S5LX 4H0LC 4L73A 3CCQP 1M57D 4WBAA 1SQPD 3I55P 1MUUA 1KYOD 4LC1A 2PFXA 1NH4A 1X79B 3SWKA 2R3SA 1H0TB 2ITAA 3MGNA 2E75D 1SQVJ 2IBZE 4OGQB 2E43A 3LW5J 2XU6A 1LT9B 3L70E 3CXHH 5APWA 3GHGB 2KZIA 2Q3IA 4UB8E 1NTZJ 1ZN5A 1PGPA 1SQVD 3E7KA 2KS1A 2HFED 1NTZG 3RK3C 1SQXE 1OMIA 3L72J 1N7SC 3AE6C 1HTLC 3NXSA 1RHZB 3PRJA 4C7NA 4CPGA 2WSFH 2YMKA 1FS0E 3P32A 2FFDA 2WT7B 1Y9BA 2OYIA 2W27A 3FXEA 3HE4A 4XE5B 4IFFA 3RK2D 1SQXK 3AE3C 1GD2E 3KZIE 1DIPA 2RMZA 2K9JB 1A02J 2P67A 5AVZB 1NJIQ 3H1IE 1IFDA 1S5LE 4W80A 3AEGC 1FOSE 1IK7A 1NVOA 3WU2E 4I7ZC 2ZXEB 4DOJA 1QLED 5APVA 3L75G 4HJGH 5DJTB 2C0WA 2R32A 5KJ7C 2L5GB 1FZCA 5KLVK 3II6A 2OYHC 3T97B 1YJNP 4DJGA 5AW0B 1JY3O 1AQ5A 2W6JH 4W7YA 3MIWA 2P1JA 1SQBE 5AW8B 3D6YA 1T2KC 1KILB 5KAIH 2O1KA 3CCJP 5CHXA 5L8RJ 3CXHI 2KB7P 4BXLA 1SVFA 2O1JA 2ZYGA 4JPZB 2JO1A 1FZGA 2ZXXA 4WY4D 4GOEA 1Q7YQ 3A0HE 2E5YA 5GTHE 3AE5C 2GA1A 3B5ND 2ZYDA 2QJPB 5AW1B 2HR3A 1ZP0C 3NFQA 2FYUE 3Q5PA 2J5UA 4BRYA 1NU1J 1IFJA 1L0LK 1EDIA 1VL2A 1JEKA 5KAFH 5C39A 1NU1G 2GUSA 4K3AA 1SFCD 2G3AA 1X8YA 1PPJD 1X9VA 1FC2C 3H1JJ 3PLNA 2E76D 1NHLA 1YTZI 3OW2O 1QVGO 2WSSH 2Q3EA 1QL2A 1T3JA 3H1JD 3L73J 5CJ4A 1E5WA 1XTGB 2BCCE 4KJMA 3L73G 3VYIA 3MHVA 3P8CD 1OW8A 1SP4A 3R4YA 2YIUB 1LTSC 3TF5A 3RL0C 3PHLA 3H1KG 3CC4P 2Z5HA 1AVOA 2WPVB 3TNUA 1H88A 2HODA 3GF7A 3CI9A 4RJTA 3G3ZA 3C1LA 2IX7C 2WITA 1BE3J 2HYNA 3SWFA 1AVYA 4D6TJ 2FFDC 1Q2NA 2VRSA 2OYIC 2WWWA 2D2CD 2Y0CA 1HF9A 1GU4A 1NKNA 4D6TG 3G4SP 2YKPA 3HTKB 1KZUB 4WVZA 2IZ1A 2C0XA 4XFJA 1ZR4A 4WY4A 1DH3A 1Q90D 3E1IA 2E74B 1NTMJ 1BDCA 3B5NA 4H0LB 3CWBG 3H1HJ 5BU5A 3FGAD 2RH0A 1NTMG 4HB1A 2J58A 1FAVA 1PGQA 4GKGA 1KD1Q 3H1HG 4Y99C 1JOCA 4PJ0H 2W90A 3JC22 1TU3F 2AXCA 4AUWA 1KILE 3A2AA 1SFCA 2H43A 1HJ0A 2OGUA 2E75C 3VOPA 2GM4A 1KB9E 1YQ3C 2P58A 2A06D 3IR9A 1YJ9P 4RO0A 1G1IA 3EFGA 1SQVK 4MN4C 3SSUA 3TGUD 3L4FA 5KLVG 1NTZK 2QVAA 1R5SA 2ZFCA 3RK3B 2KNCB 3H32B 1JB0J 4LLHA 1N7SB 2PAJA 2Z5IA 3CX5E 1KN7A 2QM8A 3H1LG 1KC8Q 2ZT9C 1YBKA 5BVZA 2KSEA 4PV1D 2B9BA 1Y8AA 1VQLP 1RY3A 1USDA 2SPZA 1RQUA 4WB4A 3L75E 4EDFA 2KI7B 1GW3A 3WMM0 2ZJSE 2PRRA 3RK2C 1L0LJ 3ZDMA 2M3EA 1OIPA 1A02F 3AEFC 1GL2D 1L0LG 2UWJE 1OVVA 1LJ2A 2H89C 3D6ZA 2XV5A 2JDIH 4I7ZB 3BCCG 3RGUA 1W2EA 4XA4A 1SQBD 1JM0A 1FBMA 3M91A 4OH8B 1DEEG 3GF3A 1DX7A 2POHA 2A45H 1EDJA 3BATA 1KB9H 3AE7C 2N9YB 1ZR2A 1CI6B 2ZVNB 2C9LY 2OYHB 2WSCJ 5AVSB 2QRXA 2JJLA 4K35A 3AEAC 3L74J 3B71A 1HVVA 3F89A 1LWUA 3HUSA 1NU1E 1CZQA 1G2CA 1LTAC 3L74G 1J1DC 2FYUD 3S1KA 5E79E 1JO5A 3I56P 1AFOA 1K73Q 2JR8A 2BASA 3CX5H 4WY4C 2QIWA 2QJYC 3B5NC 3H6PA 3HE5A 2Y9ZA 1LP1A 1PGJA 1VQMP 1FJPA 1QGKB 3L73E 1NTKD 1ZMEC 1NU1K 1SQPJ 2J59M 3Q3DA 1VDFA 5TISE 1NKZB 1SQPG 1BGYD 4RESB 1SFCC 3H1KE 1U57A 3HD7D 2MJZA 3G6EP 1QL1A 1T6AA 1HUCA 4I1LA 4A7PA 2E76C 3RK3E 5AVUB 1NGMB 1OWAA 2M0BA 1GL2A 1BSHA 1WRGA 3BRVB 1JMBA 2P2UA 3A0BH 2KUBA 4D6TE 3U59A 2KS1B 2P10A 1QX8A 3OAKA 1VQ8P 4IL6E 5GTIE 1EZVD 3RL0B 1VPCA 1SQVG 1HGVA 2A45I 4C7NB 1KB9I 1URQD 2KZJA 1CW5A 3CWBE 1L0NJ 1KQGB 1M90Q 1NTME 2FFDB 1VF5D 3M9BA 1UIXA 2QE7H 2OYIB 3H1HE 1X0TA 2D2CC 3HE4B 4JBZA 3I5CA 4IFDK 1L0ND 1VQ9P 3L72G 3TK1A 3RBZA 3ABVC 1PL5A 4H44C 4U3FJ 1NOHA 1KILD 1P84E 3D71A 3CX5I 3VMAA 3WUUA 1VQ5P 1M1JA 5AVWB 1S9KE 1NTMK 1KB9D 3IFMA 4U3FD 3M06A 4PD4E 5KLVE 5TISH 4Y99B 2WVRA 5AVVB 4EIJA 4ASWA 2NPSD 2YMYA 2AEFA 1LTTC 1NO4A 3KHUA 4Z1MH 4GT1A 1GK6A 3HD7A 3H1LE 2XDJA 2E75B 4L76A 3JCUE 2W6BA 2CK3H 1RF1C 1S2EA 2ZYAA 3AE9C 1HH0A 3GLMA 1LWUC 3C9IA 3HUSC 2N1TD 1K05A 1JTHA 1VQNP 4JQ0D 1BCCD 4IL6H 5GTIH 1PFIA 2FYNC 1E79H 5H2FE 4UB8H 2HPCA 4L75A 1L0LE 1FU1A 1WMKA 2ZT9B 3OJAB 5APYA 1Q82Q 4BRYB 1URQA 5KKZC 1FDMA 4PV1C 3M9HA 3BCCE 4R4LA 3S9OA 2KLUA 3PP5A 2E5TA 3P7KA 4LGDE 2R5BA 1PP9D 5APSA 3RK2B 4W7ZA 3G71P 3M0AA 4I6MC 1AQTA 3MUDA 1EXIA 3QH9A 1P84H 3MTUE 1LTJA 2IPPA 1KORA 2KXPB 3W67A 2W6AA 3S4RA 1KILA 2AEJA 3OA7A 1PPJG 2K37A 1N73A 1RQVA 5BU8B 3CXHD 3L71D 3KZIH 4QMAA 3GG2A 3FXDA 3L74E 1FZBA 3EQ2A 1K8AQ 1GTWA 1S5LH 3H1JG 1SQQJ 3K5BA 2NPSA 3KXDA 2WSFJ 3TNUB 3WU2H 4H0LD 2HODB 3JCUH 2M5AA 1SQQD 3KQGA 3BVHA 1OVRA 3VMYA 1VQKP 1ZRTD 2H8PD 1IFNA 1ZLLA 1LGHB 2N1TA 1KV4A 1J1DB 1JY3P 2YNYA 5CCGD 1SQPE 3R2PA 1KYOE 5H2FH 4N6JA 4AQRD 2IBZI 1MKMA 4WY4B 4OWFA 1WT6A 1JY3N 1QVFO 1BE3G 4JF7A 2QJYB 3H1KD 2O3JA 3B5NB 1M1JC 1KFNA 3AE2C 2K3RA 3CMEP 1YQ4C 4H13D 4HH2A 3AE8C 2XZRA 3A3YB 1HBWA 3A0HH 2YO3A 1EDKA 5GTHH 1FZEA 1IFMA 1SQPK 1IJDB 1T3UA 1SFCB 3HD7C 2WSEH 1FJKA 1SQVE 3KYQA 1G1JA 1PIXA 3F5HA 2IBZD 2QJKC 2E76B 1R8EA 1IC2A 1JCCA 1P84I 1NTZE 3L70D 1RE3A 1FZCC 2YKOA 3HTKA 3UIAA 2O01H 2RN0A 3CWBD 1OFCX 1YHQP 3L72E 2A06G 1LTGC 1USEA 2FXOA 1SQXD 1NWQA 3TGUJ 4UB6E 5AVYB 1RF0A 3TGUG 1J1EC 3CMAP 5B66E 1URQC 1Z56A 1GZLA 2FBWC 4EYYQ 1BDDA 3O6QA 3L37A 1L0NK 1VF5C 4B86A 1M8OB 4JYBA 2D2CB 1S9KD 1JY2O 3AE1C 3RL0g 1X22A 3V4QA 3CCLP 3CCUP 3B4SA 5APQA 3MUDC 5CCGA 4TLFA 1LTJC 4H44B 4N78E 1L4AD 3BRTB 1BSNA 2WZ7A 5AW6B 3H1ID 4NPDA 3A7OA 2N9BA 4GOFA 1N73C 2LR2A 2KSJA 2P7JA 3W68A 3TYYA 5B5EE 4TT3H 4KHXA 3AECC 2KNCA 3H32A 3V2RA 2OTKE 2NPSC 3KPEA 1IFIA 1SQBJ 3LW5H 3JSVC 1EDLA 2QEXP 3Q1MA 2HG5D 5EFWB 1RF1B 2WMMA 5CCHD 2I1JA 2OTJP 2PGDA 1LWUB 3HUSB 2JP3A 3IAOA 2N1TC 1G2CB 1GW4A 4ZNCA 4UB6H 4DZOA 2FYUJ 2QSIA 2FYNB 4DCKA 2O01N 2YXQB 2Q7CA 2Y9YA 3FWLA 1KQSO 5B66H 3HE5B 2IDBA 1NAYA 2B87A 1PPJE 2YKQA 1LP1B 3FX0A 4GDOA 1IK9A 5KKZB 1KFMA 4GODA 4PV1B 4OGQD 3RL0D 1OZHA 1PZQA 1OX3A 4HYTB 3H1JE 1AV1A 1MFZA 1NTKJ 2AXTE 2IYOA 1YJWP 1NTKG 1BGYJ 3P8CE 1EQ7A 3AEDC 3KDPB 1L4AA 1ZOYC 1K9MQ 2BEZF 1FDOA 1BGYG 1RE3C 1M56D 5B5EH 1M7LA 2ZAEB 2BCCD 2KK7A 2V4HA 4JYCA 2QM7A 2XNXA 3BASA 3MD0A 1RF0C 4KT0J 1SQQK 2GUVA 1BE3E 3CCMP 4HKZH 4M3LA 2KYVA 1EZVG 1FZFA 5CCHA 3NMDA 2V7QJ 2XKMA 1HJBA 2C9NY 1SS1A 3CC7P 1L2PA 5TJHA 5AVTB 5CCGC 1ZW0A 4WWIA 2Y0DA 3VN0A 2QG4A 5AW5B 3PTZA
chains in the Genus database with same CATH topology
4N3YB 5APSA 4I2LC 3RK2B 4GKGA 4W7ZA 4Y99C 3M0AA 4I6MC 1M1JB 1JOCA 3MUDA 1HGZA 1JMMA 1LTJA 2IPPA 3MTUE 1H8AA 4AUWA 3LIEA 5AW2B 2R5DA 3A2AA 2W6AA 3N7NA 1SFCA 1KILA 2H43A 3OA7A 3VOPA 2GM4A 1N73A 1L4AB 1LT9A 5BU8B 1RF1A 2H7HA 3GHGA 2A45G 1JY2P 2Z4EA 2M8RA 1FZBA 3IR9A 5KJ7A 5CJ0A 4AYCA 3HD7B 5AW4B 1G1IA 3EQ2A 3EFGA 1SQVK 1DEBA 2CPSA 1GTWA 2IFMA 1CI6A 3V2QA 1MV8A 2R3CA 2OYHA 1FZAA 1JY2N 2NPSA 1CSBA 2LKMA 2JEEA 3L4FA 3TNUB 2HODB 1NTZK 1NAFA 1FZCB 2ZFCA 2YO2A 1GL2B 3RK3B 4C46A 3KQGA 4ZKUA 2KLVA 1JTHB 3H32B 3BVHA 3VMYA 4LLHA 1N7SB 2PAJA 2Z5IA 2QM8A 2H8PD 5AW3B 1IFNA 1XTCC 2WT7A 2WPSA 1ZLLA 1LGHB 1RE4C 2N1TA 3VMXA 5BVZA 2HPCB 1J1DB 1JY3P 2YNYA 5CCGD 2I1KA 1J1EB 3R2PA 3V4WA 1GK4A 1RY3A 4N6JA 4AQRD 4N78D 4WB4A 4WBAA 3V2NA 1URQB 4WY4B 3VTPC 1MUUA 1WT6A 1JY3N 1GW3A 4JF7A 3WMM0 2FKWB 3M9QA 3RK2C 3B5NB 4LC1A 1M1JC 1KFNA 1NH4A 3V5BA 1X79B 4HH2A 2PP6A 1A02F 2CPBA 2XZRA 3A3YB 1GL2D 1HBWA 2YO3A 1FOSF 1FZEA 5APXA 3MGNA 1IFMA 1LTJB 1KQLA 1L4AC 1SQPK 1IJDB 2XV5A 1T3UA 3CL3D 1SFCB 3HD7C 2E43A 2WSEH 1FJKA 1W2EA 1N73B 4XA4A 2XU6A 3KYQA 1LT9B 2KP8A 1GU5A 5APWA 3GHGB 2Q9IA 3T97A 1G1JA 1N2DC 2Q3IA 1FBMA 3M91A 4OH8B 1ZN5A 1IC2A 2WPQA 1DX7A 2POHA 1JCCA 2A45H 3BATA 3CLQA 1ZR2A 1CI6B 1RE3A 2HFED 1FZCC 2C9LY 3RK3C 1GL2C 2OYHB 2NPSB 2YKOA 4O9BA 3HTKA 3UIAA 2O01H 1N7LA 1IO4A 1N7SC 5AVSB 2JJLA 1LTGC 1SQBK 3A5TA 3LIDA 1HVVA 1NWQA 1HTLC 3NXSA 3P8MC 1LWUA 3HUSA 4C7NA 2WSFH 1CZQA 1G2CA 1LTAC 1J1DC 5AVYB 1RF0A 1J1EC 3P32A 5CCHC 1JO5A 2FFDA 2WT7B 1AFOA 2OYIA 2W27A 1J2JB 2M3BA 2BASA 2N1TB 1URQC 1Z56A 3HE4A 4WY4C 4IFMA 4XE5B 1GZLA 4IFFA 3L36A 3L37A 1L0NK 1SQXK 3RK2D 3B5NC 3H6PA 4B86A 3HE5A 1YYCA 1GD2E 4JYBA 1S9KD 1JY2O 2FYUK 1FJPA 3M0DA 3V4QA 1A02J 2P67A 1OXZA 5AVZB 5APQA 5CCGA 1NU1K 1HWTC 2J59M 1JUNA 1IFDA 1LTJC 4N78E 4W80A 1L4AD 3BRTB 1VDFA 1NKZB 1JCDA 2WZ7A 1FOSE 1YTZT 5AW6B 3A7OA 2N9BA 4RESB 1SFCC 2ZXEB 4DOJA 3HD7D 5APVA 2MJZA 1QL1A 1N73C 1HUCA 1LT9C 4I1LA 5AVRB 1T8ZA 3GHGC 3U1CA 2KSJA 2P7JA 3O8ZA 3TYYA 1LTIC 2C0WA 2R32A 4KHXA 5KJ7C 5AVUB 2L5GB 1NTKK 3HRNA 1OWAA 1FZCA 5KLVK 1GL2A 3II6A 3H32A 1WRGA 3BRVB 3RK3D 2OYHC 3V2RA 2NPSC 3KPEA 2P2UA 5CMZA 5AW0B 1JY3O 1AQ5A 3TSIA 1IFIA 1N7SD 2IFNA 3LW5H 4W7YA 3U59A 3MIWA 2P1JA 5AW8B 3OAKA 2HG5D 1T2KC 1KILB 2KOGA 3RL0B 2O1KA 1VPCA 5CHXA 3U1AA 1RF1B 4ZKPA 5CCHD 2KB7P 1HGVA 2E42A 2I1JA 1SVFA 2O1JA 1LWUB 2A45I 3HUSB 4C7NB 1FZGA 2N1TC 1G2CB 1GW4A 1URQD 2WSCH 4WY4D 1CW5A 3N4XA 2FFDB 3B5ND 3M9BA 2OYIB 4DZOA 5AW1B 3HE4B 3I5CA 4IFDK 3NFQA 1RE4A 5APUA 1IFJA 2Q7CA 1L0LK 3TK1A 2OARA 3VP9A 3HE5B 2YKQA 1N86A 3B8EB 5AVXB 2GUSA 5KTBA 1NOHA 1SFCD 1IK9A 1KILD 5AW7B 1KFMA 1X8YA 3RL0D 1X9VA 3V2PA 3VP8A 1M1JA 5AVWB 1S9KE 2HLOA 1NTMK 4HYTB 5APTA 3IFMA 1MFZA 1NHLA 1YTZI 3M06A 5KJ7D 1QL2A 1T3JA 4GIFA 4Y99B 5AVQB 5AVVB 4EIJA 5CJ4A 2NPSD 1E5WA 3P8CE 2YMYA 1EQ7A 3KDPB 1L4AA 1XTGB 1FAVA 1LTTC 1NO4A 3VYIA 1LTBC 1RE3C 3P8CD 4GT1A 1GK6A 1SP4A 3HD7A 1ZV8A 2XDJA 1H89A 1M7LA 1T2KD 4C7RA 1KILC 2W6BA 1LTSC 3RL0C 1SLQA 4JYCA 2QM7A 2XNXA 1RF1C 2Z5HA 2FXMA 3TNUA 1H88A 3BASA 2HODA 4EOTA 1HH0A 1JNMA 1MZ9A 3CI9A 1LWUC 3C9IA 3HUSC 3G3ZA 3MD0A 2N1TD 2IX7C 1RF0C 2WITA 1JTHA 2HYNA 1SQQK 2GUVA 3SWFA 2FFDC 1PFIA 2VRSA 1N7SA 5AW9B 2OYIC 2WWWA 4M3LA 3NTNA 1GU4A 1NKNA 2WPRA 2KYVA 2YKPA 2WTYA 2HPCA 3VMZA 1FZFA 3HTKB 1FU1A 5CCHA 3NMDA 2FYZA 3OJAB 5APYA 1KZUB 3SWYA 2XKMA 3M0DC 1HJBA 3L35A 2C0XA 2C9NY 1GDTA 2Q5UA 1URQA 1ZR4A 4WY4A 5AVTB 1DH3A 1FDMA 5CCGC 3M9HA 3E1IA 3B5NA 3VN0A 3PP5A 3P7KA 5BU5A 4LGDE 2R5BA 5AW5B 2J58A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1A02 F;  5APS A;  4I2L C;  2XZR A;  3A3Y B;  4GKG A;  1HBW A;  5AVW B;  1S9K E;  3M0A A;  4I6M C;  1FOS E;  5AW6 B;  2YO3 A;  3A7O A;  2N9B A;  4RES B;  4HYT B;  5APT A;  2ZXE B;  5APX A;  1MFZ A;  1FOS F;  3MGN A;  2IPP A;  3M06 A;  5APV A;  1H8A A;  1KQL A;  4AUW A;  3LIE A;  1HUC A;  2XV5 A;  5AVR B;  5AW2 B;  2R5D A;  3A2A A;  5AVQ B;  2W6A A;  2P7J A;  3O8Z A;  5AVV B;  3TYY A;  2R32 A;  4KHX A;  3KDP B;  2E43 A;  5AVU B;  1OWA A;  2H7H A;  2XU6 A;  2KP8 A;  1GU5 A;  5APW A;  3VYI A;  3T97 A;  2Q3I A;  3M91 A;  4GT1 A;  1GK6 A;  1SP4 A;  3IR9 A;  2WPQ A;  4AYC A;  5AW4 B;  1H89 A;  2P2U A;  1T2K D;  5CMZ A;  1GTW A;  5AW0 B;  1CI6 A;  1CI6 B;  1MV8 A;  2R3C A;  1SLQ A;  4JYC A;  1CSB A;  2QM7 A;  2C9L Y;  2Z5H A;  5AW8 B;  3TNU A;  1H88 A;  3HTK A;  3UIA A;  3OAK A;  3TNU B;  4EOT A;  1T2K C;  1JNM A;  1IO4 A;  3MD0 A;  1NAF A;  5AVS B;  2JJL A;  2ZFC A;  2YO2 A;  3A5T A;  4C46 A;  3LID A;  3KQG A;  1NWQ A;  3NXS A;  3P8M C;  3SWF A;  2E42 A;  3VMY A;  2VRS A;  5AW9 B;  4C7N A;  1CZQ A;  4C7N B;  2Z5I A;  2WWW A;  5AVY B;  1G2C B;  2QM8 A;  4M3L A;  5AW3 B;  3NTN A;  1GU4 A;  3P32 A;  2WPR A;  2WT7 A;  2WPS A;  2WT7 B;  2WTY A;  2W27 A;  1J2J B;  3VMZ A;  3M9B A;  3VMX A;  2BAS A;  4DZO A;  2YNY A;  3HE4 A;  5AW1 B;  3NMD A;  1GZL A;  3HE4 B;  4XE5 B;  5APY A;  3V4W A;  1GK4 A;  3I5C A;  3L36 A;  3NFQ A;  3L37 A;  1HJB A;  3L35 A;  2C9N Y;  5APU A;  4AQR D;  2Q7C A;  4B86 A;  2Q5U A;  3TK1 A;  3HE5 A;  5AVT B;  1YYC A;  1DH3 A;  1GD2 E;  4JYB A;  3HE5 B;  1MUU A;  3VTP C;  1S9K D;  3M9H A;  3M0D A;  3V4Q A;  3VN0 A;  3B8E B;  4LC1 A;  5AVX B;  1A02 J;  2P67 A;  1OXZ A;  5AVZ B;  5APQ A;  3P7K A;  5AW7 B;  2R5B A;  3V5B A;  1X8Y A;  1HWT C;  1JUN A;  5AW5 B;  1FAV A; 
#chains in the Genus database with same CATH topology
 1L0N G;  5E79 H;  1M1J B;  1H0T A;  2JWD A;  5KAI E;  1HGZ A;  4H13 C;  1H8A A;  5AW2 B;  2G8Y A;  3AE4 C;  1NTZ D;  2A06 E;  2AXT H;  1LT9 A;  2ZT9 D;  3GHG A;  2A45 G;  2Z4E A;  4U3F G;  3HD7 B;  3TGU E;  3L72 D;  2CPS A;  1AA0 A;  2IFM A;  3V2Q A;  1MV8 A;  2R3C A;  4YPC A;  1FZA A;  1U7J A;  2JEE A;  2QJK B;  3EWK A;  5K5G B;  1NAF A;  5KAF E;  1FZC B;  2KLV A;  1JTH B;  4ZMD A;  5AW3 B;  1N8R Q;  1XTC C;  2WT7 A;  2WPS A;  3CCV P;  1BCC J;  3CX5 D;  3VMX A;  2HPC B;  1DD4 A;  2OYO A;  4YXD C;  1J1E B;  3V4W A;  1FE6 A;  1BCC G;  2K1A A;  3L75 J;  3Q5R A;  4N78 D;  3V2N A;  1URQ B;  3VTP C;  1OW7 A;  4BWN A;  5CBN A;  2FKW B;  3M9Q A;  3CC2 P;  4U7J A;  2K9J A;  2LXB A;  1VF5 B;  3L75 D;  3V5B A;  2RKL A;  2MKV A;  3CCR P;  2PP6 A;  2CPB A;  3CPW O;  5KLI C;  1FOS F;  5APX A;  2B88 A;  2K9Y A;  1PGO A;  1LTJ B;  1PP9 J;  1KQL A;  1L4A C;  3Q2Y A;  3IN6 A;  3CL3 D;  1PP9 G;  3MZW B;  3G9R A;  1N73 B;  3CD6 P;  2KP8 A;  1GU5 A;  2Q9I A;  3T97 A;  1S72 P;  1N2D C;  4IOI H;  2WPQ A;  3CLQ A;  3L71 J;  1GL2 C;  2NPS B;  1Q81 Q;  2OTL P;  4O9B A;  3V6I A;  1N7L A;  2FY8 A;  2I8D A;  3EFF K;  3L71 G;  1S4X A;  1IO4 A;  4PD4 H;  2M5A B;  2B89 A;  1SQB K;  3A5T A;  3LID A;  3P8M C;  2JKV A;  2DW3 A;  5CCH C;  2E74 D;  4PJ0 E;  1NU1 D;  3IF4 A;  1J2J B;  2M3B A;  2NRG A;  2IYP A;  2N1T B;  4R4M A;  1SQQ G;  4IFM A;  3L36 A;  4NPE A;  2Q6Q A;  1YYC A;  1NTK E;  2FYU K;  3M0D A;  1DD3 A;  1OXZ A;  1KTM A;  1FDI A;  1BGY E;  1HWT C;  1JUN A;  1MFT A;  2QA4 P;  1JCD A;  4YTP C;  1VQ7 P;  1YTZ T;  2H88 C;  3H1K J;  3L73 D;  4OGQ C;  3E1R A;  1VQO P;  1LT9 C;  5AVR B;  1T8Z A;  3GHG C;  3U1C A;  5DJU B;  4DT0 A;  3O8Z A;  3FWN A;  1R5L A;  1LTI C;  3USS A;  1NTK K;  1OVU A;  3HRN A;  1EC5 A;  1ZXG A;  3RK3 D;  5CMZ A;  3TSI A;  1N7S D;  2IFN A;  1EZV E;  1BE3 D;  1S3J A;  4D6T D;  2Q1K A;  1YI2 P;  1KQF B;  2KOG A;  3L70 J;  4H44 D;  2IBZ G;  3U1A A;  5CBO A;  4ZKP A;  2E42 A;  3RBX A;  4RKU J;  3L70 G;  1NYH A;  3CWB J;  2WSC H;  3MP7 B;  1SQX J;  1RH5 B;  2WQY C;  3N4X A;  1L0N E;  1SQX G;  4PD4 I;  1VQP P;  1M1K Q;  1YIJ P;  1NTM D;  4ASV A;  1K04 A;  1RE4 A;  3O6Q B;  4L74 A;  5APU A;  3H1H D;  2OAR A;  3VP9 A;  3AEB C;  2NZ2 A;  1N86 A;  1LNQ A;  3B8E B;  5AVX B;  5KTB A;  1W2B O;  5AW7 B;  3WUT A;  4U3F E;  2K88 A;  3V2P A;  2W83 C;  3VP8 A;  2JWA A;  2HLO A;  1P84 D;  5APT A;  1Q86 Q;  3WUV A;  5KLV J;  3GMA A;  5KJ7 D;  3GW6 A;  1KMI Z;  4GIF A;  5AVQ B;  1KYO H;  3H1I J;  3PH0 A;  2IZ0 A;  4PD4 D;  2R44 A;  4H13 B;  5KLV D;  2L91 A;  3H1I G;  1Y47 A;  3H1L J;  1LTB C;  2LXC B;  1U7M A;  2AEM A;  1ZV8 A;  1H89 A;  1T2K D;  4C7R A;  1KIL C;  1S1C X;  1SLQ A;  1OW6 A;  3H1L D;  2FXM A;  4EOT A;  1JNM A;  1MZ9 A;  2ZVO B;  1BCC E;  1D7M A;  1W5C E;  1LT1 A;  5M1B A;  1N7S A;  5AW9 B;  2QJP C;  2BEQ D;  3NTN A;  2WPR A;  3H25 A;  2XND H;  2V7Q H;  3PJS K;  2WTY A;  3D70 A;  3VMZ A;  1SQB G;  1EXJ A;  2FYZ A;  3SWY A;  3M0D C;  3L35 A;  1L0L D;  1GDT A;  2Q5U A;  3BCC J;  3Q5S A;  1YIT P;  4NPF X;  1PP9 E;  2OQQ A;  2B87 B;  1IZN B;  1QEX A;  3A0B E;  3SFE C;  3BCC D;  4N3Y B;  4YXW H;  4I2L C;  4IL6 X;  4EI2 A;  2WSE J;  1JMM A;  1AJY A;  2FYU G;  3LIE A;  1GMJ A;  3CXH E;  2R5D A;  3L71 E;  2FXP A;  1VQ6 P;  3N7N A;  5KLI B;  2W8Z A;  2YIU C;  1PV3 A;  3CCS P;  1L4A B;  1RF1 A;  2H7H A;  1JY2 P;  4Y28 J;  2O01 J;  2M8R A;  2YXR B;  5KJ7 A;  5CJ0 A;  4AYC A;  4OVN F;  5AW4 B;  1DEB A;  1CI6 A;  2OYH A;  3L74 D;  1JY2 N;  1CSB A;  2LKM A;  1KYO I;  2Y0E A;  3CCE P;  1SQQ E;  3ITK A;  3QWO C;  2BCC J;  3TDK A;  3AEE C;  1ZRT E;  2YO2 A;  1GL2 B;  4C46 A;  4ZKU A;  2BCC G;  1VQ4 P;  2KIK A;  1UII A;  1IFP A;  1RE4 C;  2I1K A;  1EZV I;  1GK4 A;  3SFD C;  2E74 C;  3C8V A;  1S5L X;  4H0L C;  4L73 A;  3CCQ P;  1M57 D;  4WBA A;  1SQP D;  3I55 P;  1MUU A;  1KYO D;  4LC1 A;  2PFX A;  1NH4 A;  1X79 B;  3SWK A;  2R3S A;  1H0T B;  2ITA A;  3MGN A;  2E75 D;  1SQV J;  2IBZ E;  4OGQ B;  2E43 A;  3LW5 J;  2XU6 A;  1LT9 B;  3L70 E;  3CXH H;  5APW A;  3GHG B;  2KZI A;  2Q3I A;  4UB8 E;  1NTZ J;  1ZN5 A;  1PGP A;  1SQV D;  3E7K A;  2KS1 A;  2HFE D;  1NTZ G;  3RK3 C;  1SQX E;  1OMI A;  3L72 J;  1N7S C;  3AE6 C;  1HTL C;  3NXS A;  1RHZ B;  3PRJ A;  4C7N A;  4CPG A;  2WSF H;  2YMK A;  1FS0 E;  3P32 A;  2FFD A;  2WT7 B;  1Y9B A;  2OYI A;  2W27 A;  3FXE A;  3HE4 A;  4XE5 B;  4IFF A;  3RK2 D;  1SQX K;  3AE3 C;  1GD2 E;  3KZI E;  1DIP A;  2RMZ A;  2K9J B;  1A02 J;  2P67 A;  5AVZ B;  1NJI Q;  3H1I E;  1IFD A;  1S5L E;  4W80 A;  3AEG C;  1FOS E;  1IK7 A;  1NVO A;  3WU2 E;  4I7Z C;  2ZXE B;  4DOJ A;  1QLE D;  5APV A;  3L75 G;  4HJG H;  5DJT B;  2C0W A;  2R32 A;  5KJ7 C;  2L5G B;  1FZC A;  5KLV K;  3II6 A;  2OYH C;  3T97 B;  1YJN P;  4DJG A;  5AW0 B;  1JY3 O;  1AQ5 A;  2W6J H;  4W7Y A;  3MIW A;  2P1J A;  1SQB E;  5AW8 B;  3D6Y A;  1T2K C;  1KIL B;  5KAI H;  2O1K A;  3CCJ P;  5CHX A;  5L8R J;  3CXH I;  2KB7 P;  4BXL A;  1SVF A;  2O1J A;  2ZYG A;  4JPZ B;  2JO1 A;  1FZG A;  2ZXX A;  4WY4 D;  4GOE A;  1Q7Y Q;  3A0H E;  2E5Y A;  5GTH E;  3AE5 C;  2GA1 A;  3B5N D;  2ZYD A;  2QJP B;  5AW1 B;  2HR3 A;  1ZP0 C;  3NFQ A;  2FYU E;  3Q5P A;  2J5U A;  4BRY A;  1NU1 J;  1IFJ A;  1L0L K;  1EDI A;  1VL2 A;  1JEK A;  5KAF H;  5C39 A;  1NU1 G;  2GUS A;  4K3A A;  1SFC D;  2G3A A;  1X8Y A;  1PPJ D;  1X9V A;  1FC2 C;  3H1J J;  3PLN A;  2E76 D;  1NHL A;  1YTZ I;  3OW2 O;  1QVG O;  2WSS H;  2Q3E A;  1QL2 A;  1T3J A;  3H1J D;  3L73 J;  5CJ4 A;  1E5W A;  1XTG B;  2BCC E;  4KJM A;  3L73 G;  3VYI A;  3MHV A;  3P8C D;  1OW8 A;  1SP4 A;  3R4Y A;  2YIU B;  1LTS C;  3TF5 A;  3RL0 C;  3PHL A;  3H1K G;  3CC4 P;  2Z5H A;  1AVO A;  2WPV B;  3TNU A;  1H88 A;  2HOD A;  3GF7 A;  3CI9 A;  4RJT A;  3G3Z A;  3C1L A;  2IX7 C;  2WIT A;  1BE3 J;  2HYN A;  3SWF A;  1AVY A;  4D6T J;  2FFD C;  1Q2N A;  2VRS A;  2OYI C;  2WWW A;  2D2C D;  2Y0C A;  1HF9 A;  1GU4 A;  1NKN A;  4D6T G;  3G4S P;  2YKP A;  3HTK B;  1KZU B;  4WVZ A;  2IZ1 A;  2C0X A;  4XFJ A;  1ZR4 A;  4WY4 A;  1DH3 A;  1Q90 D;  3E1I A;  2E74 B;  1NTM J;  1BDC A;  3B5N A;  4H0L B;  3CWB G;  3H1H J;  5BU5 A;  3FGA D;  2RH0 A;  1NTM G;  4HB1 A;  2J58 A;  1FAV A;  1PGQ A;  4GKG A;  1KD1 Q;  3H1H G;  4Y99 C;  1JOC A;  4PJ0 H;  2W90 A;  3JC2 2;  1TU3 F;  2AXC A;  4AUW A;  1KIL E;  3A2A A;  1SFC A;  2H43 A;  1HJ0 A;  2OGU A;  2E75 C;  3VOP A;  2GM4 A;  1KB9 E;  1YQ3 C;  2P58 A;  2A06 D;  3IR9 A;  1YJ9 P;  4RO0 A;  1G1I A;  3EFG A;  1SQV K;  4MN4 C;  3SSU A;  3TGU D;  3L4F A;  5KLV G;  1NTZ K;  2QVA A;  1R5S A;  2ZFC A;  3RK3 B;  2KNC B;  3H32 B;  1JB0 J;  4LLH A;  1N7S B;  2PAJ A;  2Z5I A;  3CX5 E;  1KN7 A;  2QM8 A;  3H1L G;  1KC8 Q;  2ZT9 C;  1YBK A;  5BVZ A;  2KSE A;  4PV1 D;  2B9B A;  1Y8A A;  1VQL P;  1RY3 A;  1USD A;  2SPZ A;  1RQU A;  4WB4 A;  3L75 E;  4EDF A;  2KI7 B;  1GW3 A;  3WMM 0;  2ZJS E;  2PRR A;  3RK2 C;  1L0L J;  3ZDM A;  2M3E A;  1OIP A;  1A02 F;  3AEF C;  1GL2 D;  1L0L G;  2UWJ E;  1OVV A;  1LJ2 A;  2H89 C;  3D6Z A;  2XV5 A;  2JDI H;  4I7Z B;  3BCC G;  3RGU A;  1W2E A;  4XA4 A;  1SQB D;  1JM0 A;  1FBM A;  3M91 A;  4OH8 B;  1DEE G;  3GF3 A;  1DX7 A;  2POH A;  2A45 H;  1EDJ A;  3BAT A;  1KB9 H;  3AE7 C;  2N9Y B;  1ZR2 A;  1CI6 B;  2ZVN B;  2C9L Y;  2OYH B;  2WSC J;  5AVS B;  2QRX A;  2JJL A;  4K35 A;  3AEA C;  3L74 J;  3B71 A;  1HVV A;  3F89 A;  1LWU A;  3HUS A;  1NU1 E;  1CZQ A;  1G2C A;  1LTA C;  3L74 G;  1J1D C;  2FYU D;  3S1K A;  5E79 E;  1JO5 A;  3I56 P;  1AFO A;  1K73 Q;  2JR8 A;  2BAS A;  3CX5 H;  4WY4 C;  2QIW A;  2QJY C;  3B5N C;  3H6P A;  3HE5 A;  2Y9Z A;  1LP1 A;  1PGJ A;  1VQM P;  1FJP A;  1QGK B;  3L73 E;  1NTK D;  1ZME C;  1NU1 K;  1SQP J;  2J59 M;  3Q3D A;  1VDF A;  5TIS E;  1NKZ B;  1SQP G;  1BGY D;  4RES B;  1SFC C;  3H1K E;  1U57 A;  3HD7 D;  2MJZ A;  3G6E P;  1QL1 A;  1T6A A;  1HUC A;  4I1L A;  4A7P A;  2E76 C;  3RK3 E;  5AVU B;  1NGM B;  1OWA A;  2M0B A;  1GL2 A;  1BSH A;  1WRG A;  3BRV B;  1JMB A;  2P2U A;  3A0B H;  2KUB A;  4D6T E;  3U59 A;  2KS1 B;  2P10 A;  1QX8 A;  3OAK A;  1VQ8 P;  4IL6 E;  5GTI E;  1EZV D;  3RL0 B;  1VPC A;  1SQV G;  1HGV A;  2A45 I;  4C7N B;  1KB9 I;  1URQ D;  2KZJ A;  1CW5 A;  3CWB E;  1L0N J;  1KQG B;  1M90 Q;  1NTM E;  2FFD B;  1VF5 D;  3M9B A;  1UIX A;  2QE7 H;  2OYI B;  3H1H E;  1X0T A;  2D2C C;  3HE4 B;  4JBZ A;  3I5C A;  4IFD K;  1L0N D;  1VQ9 P;  3L72 G;  3TK1 A;  3RBZ A;  3ABV C;  1PL5 A;  4H44 C;  4U3F J;  1NOH A;  1KIL D;  1P84 E;  3D71 A;  3CX5 I;  3VMA A;  3WUU A;  1VQ5 P;  1M1J A;  5AVW B;  1S9K E;  1NTM K;  1KB9 D;  3IFM A;  4U3F D;  3M06 A;  4PD4 E;  5KLV E;  5TIS H;  4Y99 B;  2WVR A;  5AVV B;  4EIJ A;  4ASW A;  2NPS D;  2YMY A;  2AEF A;  1LTT C;  1NO4 A;  3KHU A;  4Z1M H;  4GT1 A;  1GK6 A;  3HD7 A;  3H1L E;  2XDJ A;  2E75 B;  4L76 A;  3JCU E;  2W6B A;  2CK3 H;  1RF1 C;  1S2E A;  2ZYA A;  3AE9 C;  1HH0 A;  3GLM A;  1LWU C;  3C9I A;  3HUS C;  2N1T D;  1K05 A;  1JTH A;  1VQN P;  4JQ0 D;  1BCC D;  4IL6 H;  5GTI H;  1PFI A;  2FYN C;  1E79 H;  5H2F E;  4UB8 H;  2HPC A;  4L75 A;  1L0L E;  1FU1 A;  1WMK A;  2ZT9 B;  3OJA B;  5APY A;  1Q82 Q;  4BRY B;  1URQ A;  5KKZ C;  1FDM A;  4PV1 C;  3M9H A;  3BCC E;  4R4L A;  3S9O A;  2KLU A;  3PP5 A;  2E5T A;  3P7K A;  4LGD E;  2R5B A;  1PP9 D;  5APS A;  3RK2 B;  4W7Z A;  3G71 P;  3M0A A;  4I6M C;  1AQT A;  3MUD A;  1EXI A;  3QH9 A;  1P84 H;  3MTU E;  1LTJ A;  2IPP A;  1KOR A;  2KXP B;  3W67 A;  2W6A A;  3S4R A;  1KIL A;  2AEJ A;  3OA7 A;  1PPJ G;  2K37 A;  1N73 A;  1RQV A;  5BU8 B;  3CXH D;  3L71 D;  3KZI H;  4QMA A;  3GG2 A;  3FXD A;  3L74 E;  1FZB A;  3EQ2 A;  1K8A Q;  1GTW A;  1S5L H;  3H1J G;  1SQQ J;  3K5B A;  2NPS A;  3KXD A;  2WSF J;  3TNU B;  3WU2 H;  4H0L D;  2HOD B;  3JCU H;  2M5A A;  1SQQ D;  3KQG A;  3BVH A;  1OVR A;  3VMY A;  1VQK P;  1ZRT D;  2H8P D;  1IFN A;  1ZLL A;  1LGH B;  2N1T A;  1KV4 A;  1J1D B;  1JY3 P;  2YNY A;  5CCG D;  1SQP E;  3R2P A;  1KYO E;  5H2F H;  4N6J A;  4AQR D;  2IBZ I;  1MKM A;  4WY4 B;  4OWF A;  1WT6 A;  1JY3 N;  1QVF O;  1BE3 G;  4JF7 A;  2QJY B;  3H1K D;  2O3J A;  3B5N B;  1M1J C;  1KFN A;  3AE2 C;  2K3R A;  3CME P;  1YQ4 C;  4H13 D;  4HH2 A;  3AE8 C;  2XZR A;  3A3Y B;  1HBW A;  3A0H H;  2YO3 A;  1EDK A;  5GTH H;  1FZE A;  1IFM A;  1SQP K;  1IJD B;  1T3U A;  1SFC B;  3HD7 C;  2WSE H;  1FJK A;  1SQV E;  3KYQ A;  1G1J A;  1PIX A;  3F5H A;  2IBZ D;  2QJK C;  2E76 B;  1R8E A;  1IC2 A;  1JCC A;  1P84 I;  1NTZ E;  3L70 D;  1RE3 A;  1FZC C;  2YKO A;  3HTK A;  3UIA A;  2O01 H;  2RN0 A;  3CWB D;  1OFC X;  1YHQ P;  3L72 E;  2A06 G;  1LTG C;  1USE A;  2FXO A;  1SQX D;  1NWQ A;  3TGU J;  4UB6 E;  5AVY B;  1RF0 A;  3TGU G;  1J1E C;  3CMA P;  5B66 E;  1URQ C;  1Z56 A;  1GZL A;  2FBW C;  4EYY Q;  1BDD A;  3O6Q A;  3L37 A;  1L0N K;  1VF5 C;  4B86 A;  1M8O B;  4JYB A;  2D2C B;  1S9K D;  1JY2 O;  3AE1 C;  3RL0 g;  1X22 A;  3V4Q A;  3CCL P;  3CCU P;  3B4S A;  5APQ A;  3MUD C;  5CCG A;  4TLF A;  1LTJ C;  4H44 B;  4N78 E;  1L4A D;  3BRT B;  1BSN A;  2WZ7 A;  5AW6 B;  3H1I D;  4NPD A;  3A7O A;  2N9B A;  4GOF A;  1N73 C;  2LR2 A;  2KSJ A;  2P7J A;  3W68 A;  3TYY A;  5B5E E;  4TT3 H;  4KHX A;  3AEC C;  2KNC A;  3H32 A;  3V2R A;  2OTK E;  2NPS C;  3KPE A;  1IFI A;  1SQB J;  3LW5 H;  3JSV C;  1EDL A;  2QEX P;  3Q1M A;  2HG5 D;  5EFW B;  1RF1 B;  2WMM A;  5CCH D;  2I1J A;  2OTJ P;  2PGD A;  1LWU B;  3HUS B;  2JP3 A;  3IAO A;  2N1T C;  1G2C B;  1GW4 A;  4ZNC A;  4UB6 H;  4DZO A;  2FYU J;  2QSI A;  2FYN B;  4DCK A;  2O01 N;  2YXQ B;  2Q7C A;  2Y9Y A;  3FWL A;  1KQS O;  5B66 H;  3HE5 B;  2IDB A;  1NAY A;  2B87 A;  1PPJ E;  2YKQ A;  1LP1 B;  3FX0 A;  4GDO A;  1IK9 A;  5KKZ B;  1KFM A;  4GOD A;  4PV1 B;  4OGQ D;  3RL0 D;  1OZH A;  1PZQ A;  1OX3 A;  4HYT B;  3H1J E;  1AV1 A;  1MFZ A;  1NTK J;  2AXT E;  2IYO A;  1YJW P;  1NTK G;  1BGY J;  3P8C E;  1EQ7 A;  3AED C;  3KDP B;  1L4A A;  1ZOY C;  1K9M Q;  2BEZ F;  1FDO A;  1BGY G;  1RE3 C;  1M56 D;  5B5E H;  1M7L A;  2ZAE B;  2BCC D;  2KK7 A;  2V4H A;  4JYC A;  2QM7 A;  2XNX A;  3BAS A;  3MD0 A;  1RF0 C;  4KT0 J;  1SQQ K;  2GUV A;  1BE3 E;  3CCM P;  4HKZ H;  4M3L A;  2KYV A;  1EZV G;  1FZF A;  5CCH A;  3NMD A;  2V7Q J;  2XKM A;  1HJB A;  2C9N Y;  1SS1 A;  3CC7 P;  1L2P A;  5TJH A;  5AVT B;  5CCG C;  1ZW0 A;  4WWI A;  2Y0D A;  3VN0 A;  2QG4 A;  5AW5 B;  3PTZ A; 
#chains in the Genus database with same CATH homology
 4N3Y B;  5APS A;  4I2L C;  3RK2 B;  4GKG A;  4W7Z A;  4Y99 C;  3M0A A;  4I6M C;  1M1J B;  1JOC A;  3MUD A;  1HGZ A;  1JMM A;  1LTJ A;  2IPP A;  3MTU E;  1H8A A;  4AUW A;  3LIE A;  5AW2 B;  2R5D A;  3A2A A;  2W6A A;  3N7N A;  1SFC A;  1KIL A;  2H43 A;  3OA7 A;  3VOP A;  2GM4 A;  1N73 A;  1L4A B;  1LT9 A;  5BU8 B;  1RF1 A;  2H7H A;  3GHG A;  2A45 G;  1JY2 P;  2Z4E A;  2M8R A;  1FZB A;  3IR9 A;  5KJ7 A;  5CJ0 A;  4AYC A;  3HD7 B;  5AW4 B;  1G1I A;  3EQ2 A;  3EFG A;  1SQV K;  1DEB A;  2CPS A;  1GTW A;  2IFM A;  1CI6 A;  3V2Q A;  1MV8 A;  2R3C A;  2OYH A;  1FZA A;  1JY2 N;  2NPS A;  1CSB A;  2LKM A;  2JEE A;  3L4F A;  3TNU B;  2HOD B;  1NTZ K;  1NAF A;  1FZC B;  2ZFC A;  2YO2 A;  1GL2 B;  3RK3 B;  4C46 A;  3KQG A;  4ZKU A;  2KLV A;  1JTH B;  3H32 B;  3BVH A;  3VMY A;  4LLH A;  1N7S B;  2PAJ A;  2Z5I A;  2QM8 A;  2H8P D;  5AW3 B;  1IFN A;  1XTC C;  2WT7 A;  2WPS A;  1ZLL A;  1LGH B;  1RE4 C;  2N1T A;  3VMX A;  5BVZ A;  2HPC B;  1J1D B;  1JY3 P;  2YNY A;  5CCG D;  2I1K A;  1J1E B;  3R2P A;  3V4W A;  1GK4 A;  1RY3 A;  4N6J A;  4AQR D;  4N78 D;  4WB4 A;  4WBA A;  3V2N A;  1URQ B;  4WY4 B;  3VTP C;  1MUU A;  1WT6 A;  1JY3 N;  1GW3 A;  4JF7 A;  3WMM 0;  2FKW B;  3M9Q A;  3RK2 C;  3B5N B;  4LC1 A;  1M1J C;  1KFN A;  1NH4 A;  3V5B A;  1X79 B;  4HH2 A;  2PP6 A;  1A02 F;  2CPB A;  2XZR A;  3A3Y B;  1GL2 D;  1HBW A;  2YO3 A;  1FOS F;  1FZE A;  5APX A;  3MGN A;  1IFM A;  1LTJ B;  1KQL A;  1L4A C;  1SQP K;  1IJD B;  2XV5 A;  1T3U A;  3CL3 D;  1SFC B;  3HD7 C;  2E43 A;  2WSE H;  1FJK A;  1W2E A;  1N73 B;  4XA4 A;  2XU6 A;  3KYQ A;  1LT9 B;  2KP8 A;  1GU5 A;  5APW A;  3GHG B;  2Q9I A;  3T97 A;  1G1J A;  1N2D C;  2Q3I A;  1FBM A;  3M91 A;  4OH8 B;  1ZN5 A;  1IC2 A;  2WPQ A;  1DX7 A;  2POH A;  1JCC A;  2A45 H;  3BAT A;  3CLQ A;  1ZR2 A;  1CI6 B;  1RE3 A;  2HFE D;  1FZC C;  2C9L Y;  3RK3 C;  1GL2 C;  2OYH B;  2NPS B;  2YKO A;  4O9B A;  3HTK A;  3UIA A;  2O01 H;  1N7L A;  1IO4 A;  1N7S C;  5AVS B;  2JJL A;  1LTG C;  1SQB K;  3A5T A;  3LID A;  1HVV A;  1NWQ A;  1HTL C;  3NXS A;  3P8M C;  1LWU A;  3HUS A;  4C7N A;  2WSF H;  1CZQ A;  1G2C A;  1LTA C;  1J1D C;  5AVY B;  1RF0 A;  1J1E C;  3P32 A;  5CCH C;  1JO5 A;  2FFD A;  2WT7 B;  1AFO A;  2OYI A;  2W27 A;  1J2J B;  2M3B A;  2BAS A;  2N1T B;  1URQ C;  1Z56 A;  3HE4 A;  4WY4 C;  4IFM A;  4XE5 B;  1GZL A;  4IFF A;  3L36 A;  3L37 A;  1L0N K;  1SQX K;  3RK2 D;  3B5N C;  3H6P A;  4B86 A;  3HE5 A;  1YYC A;  1GD2 E;  4JYB A;  1S9K D;  1JY2 O;  2FYU K;  1FJP A;  3M0D A;  3V4Q A;  1A02 J;  2P67 A;  1OXZ A;  5AVZ B;  5APQ A;  5CCG A;  1NU1 K;  1HWT C;  2J59 M;  1JUN A;  1IFD A;  1LTJ C;  4N78 E;  4W80 A;  1L4A D;  3BRT B;  1VDF A;  1NKZ B;  1JCD A;  2WZ7 A;  1FOS E;  1YTZ T;  5AW6 B;  3A7O A;  2N9B A;  4RES B;  1SFC C;  2ZXE B;  4DOJ A;  3HD7 D;  5APV A;  2MJZ A;  1QL1 A;  1N73 C;  1HUC A;  1LT9 C;  4I1L A;  5AVR B;  1T8Z A;  3GHG C;  3U1C A;  2KSJ A;  2P7J A;  3O8Z A;  3TYY A;  1LTI C;  2C0W A;  2R32 A;  4KHX A;  5KJ7 C;  5AVU B;  2L5G B;  1NTK K;  3HRN A;  1OWA A;  1FZC A;  5KLV K;  1GL2 A;  3II6 A;  3H32 A;  1WRG A;  3BRV B;  3RK3 D;  2OYH C;  3V2R A;  2NPS C;  3KPE A;  2P2U A;  5CMZ A;  5AW0 B;  1JY3 O;  1AQ5 A;  3TSI A;  1IFI A;  1N7S D;  2IFN A;  3LW5 H;  4W7Y A;  3U59 A;  3MIW A;  2P1J A;  5AW8 B;  3OAK A;  2HG5 D;  1T2K C;  1KIL B;  2KOG A;  3RL0 B;  2O1K A;  1VPC A;  5CHX A;  3U1A A;  1RF1 B;  4ZKP A;  5CCH D;  2KB7 P;  1HGV A;  2E42 A;  2I1J A;  1SVF A;  2O1J A;  1LWU B;  2A45 I;  3HUS B;  4C7N B;  1FZG A;  2N1T C;  1G2C B;  1GW4 A;  1URQ D;  2WSC H;  4WY4 D;  1CW5 A;  3N4X A;  2FFD B;  3B5N D;  3M9B A;  2OYI B;  4DZO A;  5AW1 B;  3HE4 B;  3I5C A;  4IFD K;  3NFQ A;  1RE4 A;  5APU A;  1IFJ A;  2Q7C A;  1L0L K;  3TK1 A;  2OAR A;  3VP9 A;  3HE5 B;  2YKQ A;  1N86 A;  3B8E B;  5AVX B;  2GUS A;  5KTB A;  1NOH A;  1SFC D;  1IK9 A;  1KIL D;  5AW7 B;  1KFM A;  1X8Y A;  3RL0 D;  1X9V A;  3V2P A;  3VP8 A;  1M1J A;  5AVW B;  1S9K E;  2HLO A;  1NTM K;  4HYT B;  5APT A;  3IFM A;  1MFZ A;  1NHL A;  1YTZ I;  3M06 A;  5KJ7 D;  1QL2 A;  1T3J A;  4GIF A;  4Y99 B;  5AVQ B;  5AVV B;  4EIJ A;  5CJ4 A;  2NPS D;  1E5W A;  3P8C E;  2YMY A;  1EQ7 A;  3KDP B;  1L4A A;  1XTG B;  1FAV A;  1LTT C;  1NO4 A;  3VYI A;  1LTB C;  1RE3 C;  3P8C D;  4GT1 A;  1GK6 A;  1SP4 A;  3HD7 A;  1ZV8 A;  2XDJ A;  1H89 A;  1M7L A;  1T2K D;  4C7R A;  1KIL C;  2W6B A;  1LTS C;  3RL0 C;  1SLQ A;  4JYC A;  2QM7 A;  2XNX A;  1RF1 C;  2Z5H A;  2FXM A;  3TNU A;  1H88 A;  3BAS A;  2HOD A;  4EOT A;  1HH0 A;  1JNM A;  1MZ9 A;  3CI9 A;  1LWU C;  3C9I A;  3HUS C;  3G3Z A;  3MD0 A;  2N1T D;  2IX7 C;  1RF0 C;  2WIT A;  1JTH A;  2HYN A;  1SQQ K;  2GUV A;  3SWF A;  2FFD C;  1PFI A;  2VRS A;  1N7S A;  5AW9 B;  2OYI C;  2WWW A;  4M3L A;  3NTN A;  1GU4 A;  1NKN A;  2WPR A;  2KYV A;  2YKP A;  2WTY A;  2HPC A;  3VMZ A;  1FZF A;  3HTK B;  1FU1 A;  5CCH A;  3NMD A;  2FYZ A;  3OJA B;  5APY A;  1KZU B;  3SWY A;  2XKM A;  3M0D C;  1HJB A;  3L35 A;  2C0X A;  2C9N Y;  1GDT A;  2Q5U A;  1URQ A;  1ZR4 A;  4WY4 A;  5AVT B;  1DH3 A;  1FDM A;  5CCG C;  3M9H A;  3E1I A;  3B5N A;  3VN0 A;  3PP5 A;  3P7K A;  5BU5 A;  4LGD E;  2R5B A;  5AW5 B;  2J58 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...