5APYA

Sequence matkddian inserted between gcn4 adaptors - structure t9(9)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
DKVEELLSKVYHLENEVARLKKLMATKDDIANMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 26
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apyA00
1X8YA 3B8EB 2KP8A 5CMZA 5APVA 1A02J 3IR9A 3HE4A 3VMZA 1MFZA 5APSA 2E42A 3I5CA 1FAVA 2W27A 2WTYA 3VMXA 3KQGA 3L37A 5AVWB 2ZXEB 3KDPB 5APQA 1YYCA 2Z5IA 2E43A 2XU6A 1FOSF 3SWFA 2VRSA 2W6AA 5APTA 3O8ZA 1NWQA 4RESB 3HE5B 5AW0B 2Q3IA 2Z5HA 1SLQA 1GZLA 4AUWA 3M9HA 3NXSA 4GT1A 2IPPA 2P2UA 5AW8B 2R3CA 2ZFCA 2QM7A 3MGNA 3M06A 2Q7CA 2WPQA 1A02F 5APUA 4AYCA 2C9LY 3L35A 5AW4B 1MV8A 3M91A 3OAKA 2WT7B 4DZOA 5AVQB 3NTNA 2H7HA 1HUCA 2XZRA 2P67A 3HE5A 3HTKA 1HWTC 5AVXB 3VMYA 1S9KD 2BASA 1H88A 4KHXA 3V4QA 3P7KA 1S9KE 2C9NY 3A2AA 1HJBA 5APYA 1G2CB 5AVVB 2WWWA 3M0AA 3VN0A 5AW7B 3V4WA 1T2KD 1CI6B 2P7JA 2Q5UA 5AVUB 4I2LC 5APWA 1JUNA 2N9BA 3P32A 3VTPC 1DH3A 5AVTB 4HYTB 4B86A 1GU5A 2YNYA 3MD0A 1IO4A 2WT7A 3V5BA 2WPSA 4XE5B 3T97A 3TK1A 2R5BA 3LIDA 1OXZA 3M0DA 1GK6A 1GTWA 2R5DA 1J2JB 1H89A 5APXA 3LIEA 3M9BA 4AQRD 1H8AA 2YO3A 1CI6A 2XV5A 4M3LA 3P8MC 5AW2B 4C7NB 1MUUA 3L36A 3NFQA 3A5TA 1GU4A 3TNUB 3VYIA 1GD2E 5AW3B 4LC1A 3A3YB 3UIAA 5AVSB 1CZQA 2WPRA 3HE4B 1FOSE 2JJLA 2R32A 3TYYA 4EOTA 5AVRB 4JYBA 1GK4A 1JNMA 5AVZB 5AW1B 2QM8A 1T2KC 4I6MC 4JYCA 1NAFA 1SP4A 5AW5B 1OWAA 1KQLA 5AVYB 3A7OA 4C46A 1CSBA 4C7NA 3NMDA 2YO2A 4GKGA 5AW9B 5AW6B 3TNUA 1HBWA
chains in the Genus database with same CATH superfamily
3Q2YA 2K9JA 4NPEA 1NTKG 2KP8A 1LTJC 2YKPA 4TLFA 3EWKA 1MFZA 3B5NB 1JY3P 2W27A 2Y9ZA 4ZNCA 3L37A 5GTIH 3JCUE 1Y8AA 4JPZB 2SPZA 2H88C 1NTKK 1JO5A 1LTIC 4IL6X 1FZCC 2MJZA 1BGYE 3W68A 4K3AA 1L0NG 2C9LY 2HPCB 1QLED 3L71G 2QJKC 4WBAA 3SFDC 1HWTC 5AVXB 2BASA 1L0NK 1OW7A 2OYIB 3VN0A 3V4WA 3I56P 1R5SA 3H1HD 1TU3F 3AE1C 2Q3EA 2A45H 1PV3A 3EQ2A 5BU8B 5KAFH 3M0DA 3RL0B 2E74B 2A45G 3RK3D 4ASWA 2GUSA 2QEXP 1DX7A 3TNUB 4N78D 1GD2E 1SFCC 1PP9D 1OIPA 3H1LD 2JJLA 1KD1Q 1URQD 1T2KC 3AEDC 2JWDA 2PGDA 3MP7B 1KB9I 2BCCG 2L91A 1NGMB 2D2CC 1HBWA 2K37A 1ZXGA 4UB8E 2IYOA 3S4RA 2K88A 4IFMA 1BDCA 3GMAA 1AJYA 2ZT9B 4N6JA 1JY3N 1S5LX 4H13C 3H25A 3MUDC 5CCHA 2VRSA 1VQ6P 1YTZT 2W6AA 5APTA 3CXHI 2Q3IA 1GZLA 4AUWA 2UWJE 2YKOA 4H44D 2WPQA 1BGYJ 2O01J 1ZRTE 1SQQG 3HUSC 1MV8A 1N7SA 2XZRA 3HD7A 2WSFH 1H88A 2I1KA 1HJBA 2HYNA 1SQQK 3II6A 3PJSK 1FJKA 3P32A 1VF5C 3MD0A 1JY2O 2ZYGA 1FBMA 1R5LA 1LGHB 4WY4A 2QJYC 3CC7P 1IK9A 3V2RA 3A0HE 1K9MQ 1J2JB 3MTUE 3BATA 1VQNP 2NRGA 1NTZG 2XV5A 1KYOH 3ABVC 3AE4C 1P84E 1PPJE 3ZDMA 2N1TC 1EXJA 2GUVA 3P8CE 3KZIE 1H0TA 1U57A 5KKZC 1WT6A 2E75B 4GKGA 2O3JA 2B88A 3B8EB 5BVZA 3G9RA 4WB4A 3WUTA 3IR9A 2B87B 3L75D 1FDOA 1EDLA 3AE3C 2HODA 3F89A 1QVFO 3KYQA 1BCCD 2J59M 3CMAP 3L72G 4RESB 3RK3B 1YTZI 1NOHA 1NTKD 1M1JC 3SWYA 4H0LC 2IYPA 4JBZA 2D2CD 2W6BA 1QEXA 1JCCA 2V7QJ 1URQB 2YXRB 4H13D 3GHGA 3CMEP 3OJAB 3D71A 3RK2D 3TSIA 4PJ0E 1AVYA 1JUNA 1L0ND 4GDOA 2HG5D 3H1HE 3SFEC 2JP3A 1HVVA 3PH0A 2E76C 3L71D 1L2PA 2BEQD 2WSCH 1UIIA 5L8RJ 3FWLA 2FXPA 1H89A 1G2CA 1K8AQ 2YIUC 1VL2A 3V2PA 1GL2C 4O9BA 2FFDB 1MUUA 2Y0EA 3A3YB 4H44B 2AXTE 1PP9E 3H1LE 1VF5D 1LTJB 2ZXXA 4I6MC 2QJPC 4YPCA 1J1DC 2Q6QA 1M8OB 4IFDK 1CSBA 4C7NA 2LKMA 3KPEA 2QE7H 3VP9A 2FXMA 3AE8C 1FZCB 1VDFA 4EI2A 2KNCB 2OYOA 2FYUG 2ZAEB 2N1TD 4PV1C 3AEFC 2OYHA 1LTSC 1SQVG 3L73E 3MZWB 2BCCD 5AW0B 3AE2C 2FYUK 1K73Q 1SQVK 4AYCA 1P84I 1USDA 4OVNF 3GW6A 2RN0A 3N7NA 2IFNA 1JMMA 1SQXG 1S9KD 1AA0A 4LLHA 1M7LA 1HH0A 2WWWA 4R4LA 5AVUB 1KFMA 5BU5A 3A0BE 1D7MA 2GA1A 1SQQD 4GODA 3H32A 3CCRP 4EIJA 3H1HJ 1EZVG 1SFCB 1YQ4C 1PIXA 2G3AA 1NTMG 2IX7C 3H1IJ 3PLNA 1Q82Q 2YO3A 3Q5PA 4M3LA 1E5WA 1JTHB 1LWUC 1LTTC 5AW3B 3UIAA 1FZFA 4L74A 2R32A 2D2CB 4A7PA 1M1KQ 2B9BA 1L4AC 2ITAA 3IFMA 1ZOYC 3G6EP 1PZQA 2YKQA 3H1LJ 2E76D 1N73A 4JQ0D 2RH0A 5TISE 3OA7A 4H13B 2Y0DA 1LT9A 1JOCA 1LNQA 1R8EA 1PL5A 5APVA 3R2PA 1GL2D 4I7ZC 3L75E 2Y9YA 2KI7B 4UB6E 3E1IA 1NU1G 4HJGH 1LP1B 2OTLP 3HTKB 3HUSB 2BEZF 2NPSA 2PFXA 1Q2NA 1EDKA 1FDMA 2IPPA 3L73J 2YMYA 3M06A 2M0BA 1NTKE 1NU1K 1KQGB 4IFFA 5KAIH 4OH8B 3FWNA 2WT7B 1LTBC 1VF5B 2KSEA 1OVRA 3VOPA 3L72D 2LXCB 1S1CX 1ZN5A 5GTIE 1BE3G 2QJYB 3S1KA 3HRNA 2Q5UA 3V2QA 1L0NE 2PRRA 1W2EA 2WPSA 1NKZB 3CI9A 3MIWA 4D6TE 1VQ8P 2N1TB 1GTWA 1Q7YQ 4W7ZA 2E5TA 1S4XA 3NFQA 5KKZB 2JWAA 1Q86Q 1IFNA 4JYBA 1N86A 3Q5SA 4PD4H 1E79H 4U3FJ 2M8RA 1NAFA 2YO2A 5C39A 5B66H 3CX5H 5KAFE 4WWIA 3HE4A 4BWNA 3O6QA 1QVGO 1JEKA 1RF1A 1M1JB 3AE5C 4H0LB 1L4AD 4XFJA 2BCCE 4BRYA 3CWBG 2Q7CA 2WSEJ 1S2EA 2FBWC 2FYNC 2KS1B 5E79H 2FYUD 2P67A 1SQVD 3VMYA 2M3BA 2E76B 3V4QA 1S9KE 2Z4EA 3AEBC 3B71A 3M0AA 2C0WA 3M9QA 2YIUB 1GDTA 5KJ7C 1GL2B 1GW3A 1SQBG 1SQQE 4XE5B 3CCQP 1VQOP 1L0NJ 2IZ0A 4HH2A 1SQXD 1DEBA 3CLQA 2E75D 4D6TJ 3SWKA 1KFNA 1SQBK 2QJPB 3PHLA 1J1DB 4L73A 4EOTA 4YXWH 2K9YA 3RGUA 1EZVD 1BSHA 3CPWO 1NTMD 3A7OA 2FYZA 1JY2P 3QH9A 4JF7A 1SQPG 4PV1B 1MZ9A 2M5AB 4EYYQ 2XKMA 4IL6H 2K3RA 2H43A 1EDJA 4Y99C 1KYOE 3U59A 2Z5IA 1SQPK 5KLIC 3SSUA 3CCEP 2QG4A 3JSVC 1GMJA 2Z5HA 1PGQA 1RF0A 1SLQA 2HLOA 2OTJP 2P2UA 3AEGC 3L74J 1RE4A 3RBZA 2BCCJ 3WUVA 3I55P 1OVVA 1CW5A 5CCGA 1NU1D 4Z1MH 2P10A 1BDDA 3L72E 3A2AA 1KILA 2NZ2A 5AW7B 1MFTA 2A45I 4I1LA 1WRGA 4KJMA 1T3JA 2YNYA 3M0DC 2WSSH 3T97A 3C9IA 1LWUB 1FS0E 2Q1KA 3M9BA 1L4AB 4C7RA 1CI6A 1BE3D 3LW5H 1GU4A 2V4HA 4LC1A 4DJGA 5KLVG 4MN4C 1K05A 3OW2O 5AVRB 1NAYA 3FXDA 1KTMA 2WQYC 4JYCA 3BASA 5KJ7D 1SP4A 4I7ZB 3H1KE 5KLVK 5AVYB 1S5LH 1ZR4A 1LT1A 2W83C 1JY2N 1SVFA 3L70G 5B5EH 1NO4A 5AVWB 5CCHC 1IJDB 3BCCG 1PGJA 4HB1A 1NTZK 2XU6A 3C8VA 4EDFA 1YI2P 3BRTB 3H1JG 4PD4D 5CBOA 2ZFCA 3B5NA 3MGNA 1N7LA 1T8ZA 1N7SC 3HD7C 3CX5D 1IZNB 4DZOA 1VPCA 5AVQB 1K04A 1GW4A 2FYUE 2QA4P 1SFCD 2ZYAA 1SQVE 5DJUB 3P7KA 1T2KD 4I2LC 3CWBD 5CBNA 1AQ5A 2HPCA 4WY4C 3U1AA 3JC22 2IDBA 2KSJA 2R5BA 1JMBA 4BXLA 1ZW0A 2KZJA 1M57D 1KYOI 1SQXE 3LIEA 2OYIA 2CPSA 2FY8A 1ZR2A 4CPGA 2PAJA 3VYIA 4ZKPA 3AE7C 1SQBD 4K35A 1GK4A 2WMMA 1KQSO 2QM8A 4RO0A 1L0LG 1EZVE 1LTAC 1NTME 5H2FH 3RK3E 3E1RA 1QX8A 3TNUA 2L5GB 1X8YA 3H1KJ 1NYHA 1IFIA 2W8ZA 1X22A 4N78E 1L0LK 2AEFA 1VQMP 2WSCJ 2KUBA 1EDIA 1PGPA 3WUUA 2FYNB 1N2DC 2LXBA 4IOIH 3HE5B 1T6AA 3AEEC 1SQPD 3M9HA 1PPJG 3D70A 2AXCA 2QM7A 3TF5A 1NKNA 3CXHD 1FZAA 3OAKA 3GHGC 4LGDE 1IK7A 1NU1E 5CCHD 1VQ5P 2P1JA 2QJKB 4R4MA 3RL0C 5GTHH 1HJ0A 5TJHA 1VQKP 3HD7D 4QMAA 2KOGA 4AQRD 5KAIE 5AW2B 1FZBA 3N4XA 2K9JB 1Y9BA 3ITKA 2CPBA 1SQXK 1YIJP 4OGQC 2O01N 4H0LD 4WY4D 2RMZA 3C1LA 2YXQB 2IBZG 4GOEA 4Y99B 3K5BA 5AW9B 2KYVA 2ZYDA 3G3ZA 5KLIB 1FJPA 3H1HG 1DD4A 3CC4P 5KLVD 2Q9IA 3S9OA 3H1IG 2OYHC 1NTMK 1YYCA 1FOSF 1PP9J 1HGVA 3FGAD 1NTZD 3TGUG 4PD4E 2B87A 3L70D 1AVOA 2N9YB 5AW4B 1DIPA 1VQ4P 1RQUA 3BCCD 5B66E 2FXOA 3CX5E 1OVUA 2R3SA 1VQ7P 3V6IA 1BCCE 1OZHA 2O1JA 3H1JD 1NU1J 2P58A 5APWA 2WVRA 1ZP0C 3CWBE 1ZMEC 2JR8A 1URQA 1M56D 2A06G 1QL2A 3L73G 2R5DA 3GLMA 3BRVB 1RE3A 3CL3D 1VQ9P 1H8AA 5E79E 4PV1D 3L36A 2KLVA 3A5TA 1FOSE 4ZMDA 1N73C 1SQBE 2KZIA 2JEEA 3L71E 1LT9C 5AW5B 2FFDA 3G71P 2FKWB 1Q90D 3E7KA 1ZRTD 3CCLP 5APSA 2E42A 3I5CA 3VMXA 3KQGA 1W2BO 1LTJA 2NPSC 1ZV8A 1OW8A 1L0LD 1N7SB 2JDIH 3HD7B 4DOJA 4OGQD 1RQVA 2LR2A 1SQPE 2R3CA 4U3FG 1RH5B 1FZCA 2KNCA 1FZGA 3L35A 1NJIQ 3NTNA 4WY4B 1W5CE 3AECC 3L75J 4IL6E 1BSNA 1PPJD 1BCCJ 2R44A 2Y0CA 1VQPP 1XTCC 1DH3A 1X9VA 1AV1A 4N3YB 5DJTB 3CCMP 3TK1A 4GIFA 1NTKJ 5EFWB 1GK6A 1H0TB 2OGUA 2XNXA 1DD3A 3H6PA 1Z56A 1CZQA 4YTPC 4PD4I 1YQ3C 5AW1B 1JCDA 1SFCA 1U7JA 1FE6A 2HODB 2GM4A 1SQBJ 1RHZB 1KC8Q 2WPVB 3CX5I 3L71J 1JTHA 1KB9H 3PRJA 4DT0A 4OWFA 3VMZA 1RF1C 5KLVE 1KQFB 4D6TG 4DCKA 1G1IA 1IFPA 1HTLC 2IBZD 1YHQP 3MUDA 2POHA 3GHGB 3CC2P 3CXHH 3NXSA 3WU2H 1NTZE 3G4SP 4ASVA 1A02F 1KORA 5M1BA 1S5LE 2QIWA 1SQPJ 3L70E 3H1ID 3M91A 2XNDH 3BCCE 1LP1A 3HTKA 3HUSA 2OTKE 5B5EE 1G2CB 5AVVB 2NPSD 3TGUD 3H1JE 3USSA 1JB0J 2P7JA 3RL0g 4HYTB 1GU5A 1EQ7A 1N8RQ 1S3JA 2WT7A 3KHUA 3GG2A 3V5BA 3B4SA 2KB7P 3L74G 1JY3O 1EC5A 4OGQB 2ZVOB 4ZKUA 3P8MC 4C7NB 3JCUH 3FXEA 3CCUP 4L76A 2WPRA 4NPFX 1FU1A 1JNMA 2O01H 4Y28J 2A06D 2N1TA 3L73D 3RK2C 1KQLA 1SQQJ 1Y47A 2OYHB 1BGYG 1HF9A 1PFIA 1NHLA 3FX0A 1FDIA 1FAVA 2JO1A 3R4YA 2H8PD 3KDPB 1WMKA 3PP5A 2WSFJ 1YJ9P 3W67A 5KLVJ 4KT0J 1RF0C 1L0LE 3LW5J 1RE4C 2AEJA 1XTGB 2MKVA 1IFMA 4GT1A 3MHVA 2I8DA 5CHXA 5CCGC 2ZVNB 1NTZJ 5H2FE 1M1JA 3H32B 2I1JA 1KILC 3L70J 3BCCJ 2W90A 3D6YA 4U3FD 3VTPC 2KS1A 4B86A 3H1JJ 2M3EA 1OXZA 4UB8H 5APXA 1N73B 1DEEG 1QGKB 1USEA 1LT9B 3L72J 1GL2A 2DW3A 1FC2C 2V7QH 2AEMA 1VQLP 5GTHE 4C46A 2KXPB 2NPSB 3Q3DA 1KZUB 4W7YA 1A02J 3GF3A 1M90Q 2ZXEB 1OW6A 1J1EC 1OMIA 2KIKA 1NWQA 3B5NC 2IBZE 2HFED 1IFJA 2M5AA 1L0LJ 3A0HH 1ZLLA 5APUA 1KB9D 2WITA 3H1IE 4D6TD 1P84H 2KK7A 3H1KG 1IFDA 4KHXA 1Q81Q 5APYA 3EFGA 3KZIH 3TGUE 2OQQA 5CJ0A 2E5YA 3L4FA 2OYIC 3LIDA 5CCGD 2RKLA 2FYUJ 1HGZA 1KILD 1NH4A 1SQVJ 3QWOC 3IN6A 1UIXA 3VMAA 2E74C 5KTBA 3HE4B 2J58A 3TYYA 1LWUA 3BVHA 4RJTA 2XDJA 3O6QB 3AE6C 2A06E 4WVZA 3L74D 2JKVA 1N7SD 1RF1B 1L4AA 1S72P 1KV4A 2OARA 3F5HA 3U1CA 3WMM0 1BE3E 2K1AA 1SQXJ 1KN7A 4BRYB 3IF4A 2WTYA 2ZJSE 5APQA 2CK3H 2E43A 4PJ0H 2QSIA 1AQTA 5CJ4A 3SWFA 1YBKA 3O8ZA 1LJ2A 3CD6P 2B89A 1BGYD 1MKMA 2ZT9C 1YJNP 5AW8B 3V2NA 1NTMJ 1X0TA 4XA4A 2H7HA 1U7MA 1RY3A 1HUCA 2AXTH 4RKUJ 1EXIA 3Q5RA 2N9BA 3B5ND 4U3FE 3EFFK 2QVAA 5AVTB 1PP9G 1YJWP 3H1LG 4HKZH 3TGUJ 4U7JA 2IFMA 1KMIZ 2J5UA 2W6JH 3GF7A 1G1JA 3RK2B 1EZVI 3PTZA 2IBZI 1KYOD 2C0XA 1FZEA 3CCSP 3VP8A 3D6ZA 3CCVP 3Q1MA 1OWAA 1OX3A 3NMDA 5AW6B 5CMZA 3AE9C 1IC2A 2H89C 2WZ7A 1BE3J 4TT3H 1AFOA 2E75C 3RL0D 2E74D 3A0BH 2YMKA 1OFCX 1KILB 2G8YA 3RK3C 1KB9E 1YITP 3T97B 3IAOA 1QL1A 3HE5A 4GOFA 2C9NY 3RBXA 1JM0A 1CI6B 1T3UA 1SS1A 1URQC 2O1KA 2ZT9D 1IO4A 5TISH 4W80A 1NVOA 2QRXA 1RE3C 3CXHE 3WU2E 5KJ7A 3H1KD 1PGOA 4NPDA 4UB6H 4YXDC 1P84D 3KXDA 1KILE 2HR3A 5AVSB 3L75G 2KLUA 3P8CD 2WSEH 5AVZB 1LTGC 2PP6A 3AEAC 3CCJP 3CWBJ 2FFDC 1BCCG 4L75A 5K5GB 1X79B 3TDKA 3L74E 4H44C 1J1EB 2IZ1A
chains in the Genus database with same CATH topology
1JOCA 1X8YA 2KP8A 1LTJC 1IFIA 5APVA 2YKPA 3R2PA 1MFZA 3B5NB 1JY3P 1FAVA 1GL2D 2W27A 4N78E 1L0LK 3L37A 2H8PD 3KDPB 3PP5A 3E1IA 1RF0C 1N2DC 1NTKK 1JO5A 3HE5B 3HTKB 1RE4C 1LTIC 3HUSB 2NPSA 1FZCC 1XTGB 1IFMA 2MJZA 3M9HA 4GT1A 1FDMA 2IPPA 2QM7A 2YMYA 3M06A 1NKNA 1NU1K 5CHXA 4IFFA 5CCGC 2C9LY 2HPCB 1FZAA 4OH8B 1M1JA 3OAKA 2WT7B 1LTBC 3GHGC 3H32B 2I1JA 4LGDE 4WBAA 1KILC 3VOPA 1HWTC 5AVXB 5CCHD 2BASA 1L0NK 1ZN5A 2OYIB 3VN0A 3V4WA 3HRNA 2P1JA 2Q5UA 3V2QA 3RL0C 3VTPC 4B86A 2A45H 3EQ2A 5BU8B 1W2EA 2WPSA 1NKZB 3CI9A 3MIWA 1OXZA 3M0DA 2N1TB 1GTWA 3RL0B 3HD7D 2A45G 2KOGA 3RK3D 5APXA 4W7ZA 1N73B 4AQRD 2GUSA 5AW2B 3NFQA 1DX7A 1FZBA 3N4XA 1LT9B 4N78D 3TNUB 1GD2E 1GL2A 1SFCC 2CPBA 1IFNA 2JJLA 1SQXK 4JYBA 1N86A 1URQD 1T2KC 4WY4D 2M8RA 1NAFA 4C46A 4Y99B 2YO2A 5AW9B 2KYVA 1HBWA 2NPSB 3G3ZA 1KZUB 1FJPA 4W7YA 1A02J 3HE4A 2Q9IA 4IFMA 4N6JA 2ZXEB 1NTMK 1JY3N 1LT9A 2OYHC 1J1EC 1YYCA 1RF1A 1M1JB 1FOSF 5CCHA 2VRSA 1HGVA 1YTZT 2W6AA 5APTA 1L4AD 1NWQA 3B5NC 2Q3IA 2HFED 1IFJA 1GZLA 4AUWA 2YKOA 2Q7CA 2WPQA 1ZLLA 5APUA 2WITA 5AW4B 3HUSC 1MV8A 1N7SA 2XZRA 3HD7A 2P67A 2WSFH 1IFDA 3VMYA 2M3BA 1H88A 4KHXA 2I1KA 3V4QA 1S9KE 2O1JA 1HJBA 2Z4EA 2HYNA 5APYA 1SQQK 3M0AA 3EFGA 3II6A 2C0WA 5APWA 1FJKA 3P32A 3M9QA 1GDTA 3MD0A 5CJ0A 1JY2O 5KJ7C 1GL2B 1GW3A 1URQA 4XE5B 1FBMA 1QL2A 1LGHB 3L4FA 3LIDA 4WY4A 2OYIC 4HH2A 1IK9A 3V2RA 5CCGD 2R5DA 1J2JB 1DEBA 3MTUE 3BRVB 1RE3A 3BATA 3CLQA 3CL3D 1H8AA 2XV5A 1KFNA 1HGZA 1SQBK 1KILD 3L36A 1NH4A 2KLVA 3A5TA 1J1DB 2N1TC 2GUVA 5KTBA 3HE4B 2J58A 1FOSE 3TYYA 1LWUA 4EOTA 3BVHA 2XDJA 3P8CE 1N73C 2JEEA 1RF1B 1N7SD 1L4AA 1LT9C 5AW5B 3A7OA 2FFDA 1WT6A 2FYZA 2OARA 1JY2P 4GKGA 2FKWB 4JF7A 3U1CA 3WMM0 1MZ9A 3B8EB 5BVZA 4WB4A 3IR9A 2XKMA 5APSA 2H43A 3I5CA 2E42A 2WTYA 3VMXA 3KQGA 1LTJA 4Y99C 2HODA 5APQA 3U59A 2Z5IA 3KYQA 2E43A 1SQPK 2NPSC 1ZV8A 5CJ4A 2J59M 3SWFA 1N7SB 3O8ZA 3HD7B 4DOJA 4RESB 3RK3B 2Z5HA 1RF0A 1YTZI 1SLQA 1NOHA 2HLOA 2P2UA 5AW8B 3V2NA 2R3CA 1RE4A 1FZCA 1M1JC 3SWYA 2W6BA 1JCCA 1FZGA 3L35A 3NTNA 4XA4A 2H7HA 1URQB 5CCGA 1CW5A 1RY3A 1HUCA 4WY4B 3GHGA 3A2AA 1KILA 3OJAB 5AW7B 3RK2D 3TSIA 2A45I 4I1LA 1JUNA 2N9BA 3B5ND 1XTCC 1WRGA 1DH3A 1T3JA 1X9VA 5AVTB 2HG5D 2YNYA 1HVVA 3M0DC 4N3YB 3T97A 3C9IA 3TK1A 1LWUB 4GIFA 2IFMA 2WSCH 1GK6A 2XNXA 1H89A 1G2CA 1G1JA 3M9BA 1L4AB 4C7RA 3V2PA 1CI6A 1GL2C 4O9BA 2FFDB 1MUUA 3H6PA 3LW5H 3RK2B 1GU4A 4LC1A 1Z56A 3A3YB 1CZQA 2C0XA 5AVRB 5AW1B 1JCDA 1FZEA 1SFCA 1LTJB 4I6MC 2HODB 4JYCA 3BASA 2GM4A 3VP8A 5KJ7D 1J1DC 1SP4A 1OWAA 4IFDK 5KLVK 5AVYB 1ZR4A 1CSBA 4C7NA 3NMDA 1JTHA 5AW6B 2LKMA 3KPEA 1JY2N 3VP9A 5CMZA 1SVFA 1IC2A 2FXMA 3VMZA 1RF1C 1FZCB 1VDFA 2WZ7A 1NO4A 5AVWB 5CCHC 1AFOA 1IJDB 1G1IA 2N1TD 1NTZK 3RL0D 2XU6A 1HTLC 2OYHA 1LTSC 3MUDA 5AW0B 3BRTB 2POHA 3GHGB 3NXSA 1KILB 2ZFCA 3B5NA 2FYUK 3MGNA 1A02F 1N7LA 1T8ZA 1N7SC 1SQVK 4AYCA 3HD7C 3RK3C 3M91A 4DZOA 1VPCA 5AVQB 3N7NA 2IFNA 1GW4A 1JMMA 1SFCD 1QL1A 3HE5A 3HTKA 3HUSA 1S9KD 3P7KA 4LLHA 2C9NY 1M7LA 1G2CB 5AVVB 2NPSD 1HH0A 2WWWA 1T2KD 1CI6B 2P7JA 1T3UA 5AVUB 4I2LC 1KFMA 5BU5A 1URQC 1AQ5A 2HPCA 4HYTB 4WY4C 1GU5A 2O1KA 1EQ7A 1IO4A 2WT7A 4W80A 3U1AA 3V5BA 3H32A 2KSJA 4EIJA 1RE3C 2R5BA 2KB7P 5KJ7A 1SFCB 1JY3O 2IX7C 3LIEA 2OYIA 2CPSA 2YO3A 1ZR2A 4ZKUA 4M3LA 3P8MC 4C7NB 1E5WA 1JTHB 2PAJA 1LWUC 1LTTC 3VYIA 5AW3B 3UIAA 4ZKPA 5AVSB 1FZFA 2WPRA 2R32A 3P8CD 2WSEH 1FU1A 1GK4A 1L4AC 5AVZB 1JNMA 2O01H 3IFMA 2N1TA 1LTGC 2PP6A 2QM8A 2FFDC 3RK2C 2YKQA 1X79B 1N73A 1KQLA 1LTAC 2OYHB 3OA7A 1J1EB 1PFIA 1NHLA 3TNUA 2L5GB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X8Y A;  3B8E B;  2KP8 A;  5CMZ A;  5APV A;  1A02 J;  3IR9 A;  3HE4 A;  3VMZ A;  1MFZ A;  5APS A;  2E42 A;  3I5C A;  1FAV A;  2W27 A;  2WTY A;  3VMX A;  3KQG A;  3L37 A;  5AVW B;  2ZXE B;  3KDP B;  5APQ A;  1YYC A;  2Z5I A;  2E43 A;  2XU6 A;  1FOS F;  3SWF A;  2VRS A;  2W6A A;  5APT A;  3O8Z A;  1NWQ A;  4RES B;  3HE5 B;  5AW0 B;  2Q3I A;  2Z5H A;  1SLQ A;  1GZL A;  4AUW A;  3M9H A;  3NXS A;  4GT1 A;  2IPP A;  2P2U A;  5AW8 B;  2R3C A;  2ZFC A;  2QM7 A;  3MGN A;  3M06 A;  2Q7C A;  2WPQ A;  1A02 F;  5APU A;  4AYC A;  2C9L Y;  3L35 A;  5AW4 B;  1MV8 A;  3M91 A;  3OAK A;  2WT7 B;  4DZO A;  5AVQ B;  3NTN A;  2H7H A;  1HUC A;  2XZR A;  2P67 A;  3HE5 A;  3HTK A;  1HWT C;  5AVX B;  3VMY A;  1S9K D;  2BAS A;  1H88 A;  4KHX A;  3V4Q A;  3P7K A;  1S9K E;  2C9N Y;  3A2A A;  1HJB A;  5APY A;  1G2C B;  5AVV B;  2WWW A;  3M0A A;  3VN0 A;  5AW7 B;  3V4W A;  1T2K D;  1CI6 B;  2P7J A;  2Q5U A;  5AVU B;  4I2L C;  5APW A;  1JUN A;  2N9B A;  3P32 A;  3VTP C;  1DH3 A;  5AVT B;  4HYT B;  4B86 A;  1GU5 A;  2YNY A;  3MD0 A;  1IO4 A;  2WT7 A;  3V5B A;  2WPS A;  4XE5 B;  3T97 A;  3TK1 A;  2R5B A;  3LID A;  1OXZ A;  3M0D A;  1GK6 A;  1GTW A;  2R5D A;  1J2J B;  1H89 A;  5APX A;  3LIE A;  3M9B A;  4AQR D;  1H8A A;  2YO3 A;  1CI6 A;  2XV5 A;  4M3L A;  3P8M C;  5AW2 B;  4C7N B;  1MUU A;  3L36 A;  3NFQ A;  3A5T A;  1GU4 A;  3TNU B;  3VYI A;  1GD2 E;  5AW3 B;  4LC1 A;  3A3Y B;  3UIA A;  5AVS B;  1CZQ A;  2WPR A;  3HE4 B;  1FOS E;  2JJL A;  2R32 A;  3TYY A;  4EOT A;  5AVR B;  4JYB A;  1GK4 A;  1JNM A;  5AVZ B;  5AW1 B;  2QM8 A;  1T2K C;  4I6M C;  4JYC A;  1NAF A;  1SP4 A;  5AW5 B;  1OWA A;  1KQL A;  5AVY B;  3A7O A;  4C46 A;  1CSB A;  4C7N A;  3NMD A;  2YO2 A;  4GKG A;  5AW9 B;  5AW6 B;  3TNU A;  1HBW A; 
#chains in the Genus database with same CATH topology
 3Q2Y A;  2K9J A;  4NPE A;  1NTK G;  2KP8 A;  1LTJ C;  2YKP A;  4TLF A;  3EWK A;  1MFZ A;  3B5N B;  1JY3 P;  2W27 A;  2Y9Z A;  4ZNC A;  3L37 A;  5GTI H;  3JCU E;  1Y8A A;  4JPZ B;  2SPZ A;  2H88 C;  1NTK K;  1JO5 A;  1LTI C;  4IL6 X;  1FZC C;  2MJZ A;  1BGY E;  3W68 A;  4K3A A;  1L0N G;  2C9L Y;  2HPC B;  1QLE D;  3L71 G;  2QJK C;  4WBA A;  3SFD C;  1HWT C;  5AVX B;  2BAS A;  1L0N K;  1OW7 A;  2OYI B;  3VN0 A;  3V4W A;  3I56 P;  1R5S A;  3H1H D;  1TU3 F;  3AE1 C;  2Q3E A;  2A45 H;  1PV3 A;  3EQ2 A;  5BU8 B;  5KAF H;  3M0D A;  3RL0 B;  2E74 B;  2A45 G;  3RK3 D;  4ASW A;  2GUS A;  2QEX P;  1DX7 A;  3TNU B;  4N78 D;  1GD2 E;  1SFC C;  1PP9 D;  1OIP A;  3H1L D;  2JJL A;  1KD1 Q;  1URQ D;  1T2K C;  3AED C;  2JWD A;  2PGD A;  3MP7 B;  1KB9 I;  2BCC G;  2L91 A;  1NGM B;  2D2C C;  1HBW A;  2K37 A;  1ZXG A;  4UB8 E;  2IYO A;  3S4R A;  2K88 A;  4IFM A;  1BDC A;  3GMA A;  1AJY A;  2ZT9 B;  4N6J A;  1JY3 N;  1S5L X;  4H13 C;  3H25 A;  3MUD C;  5CCH A;  2VRS A;  1VQ6 P;  1YTZ T;  2W6A A;  5APT A;  3CXH I;  2Q3I A;  1GZL A;  4AUW A;  2UWJ E;  2YKO A;  4H44 D;  2WPQ A;  1BGY J;  2O01 J;  1ZRT E;  1SQQ G;  3HUS C;  1MV8 A;  1N7S A;  2XZR A;  3HD7 A;  2WSF H;  1H88 A;  2I1K A;  1HJB A;  2HYN A;  1SQQ K;  3II6 A;  3PJS K;  1FJK A;  3P32 A;  1VF5 C;  3MD0 A;  1JY2 O;  2ZYG A;  1FBM A;  1R5L A;  1LGH B;  4WY4 A;  2QJY C;  3CC7 P;  1IK9 A;  3V2R A;  3A0H E;  1K9M Q;  1J2J B;  3MTU E;  3BAT A;  1VQN P;  2NRG A;  1NTZ G;  2XV5 A;  1KYO H;  3ABV C;  3AE4 C;  1P84 E;  1PPJ E;  3ZDM A;  2N1T C;  1EXJ A;  2GUV A;  3P8C E;  3KZI E;  1H0T A;  1U57 A;  5KKZ C;  1WT6 A;  2E75 B;  4GKG A;  2O3J A;  2B88 A;  3B8E B;  5BVZ A;  3G9R A;  4WB4 A;  3WUT A;  3IR9 A;  2B87 B;  3L75 D;  1FDO A;  1EDL A;  3AE3 C;  2HOD A;  3F89 A;  1QVF O;  3KYQ A;  1BCC D;  2J59 M;  3CMA P;  3L72 G;  4RES B;  3RK3 B;  1YTZ I;  1NOH A;  1NTK D;  1M1J C;  3SWY A;  4H0L C;  2IYP A;  4JBZ A;  2D2C D;  2W6B A;  1QEX A;  1JCC A;  2V7Q J;  1URQ B;  2YXR B;  4H13 D;  3GHG A;  3CME P;  3OJA B;  3D71 A;  3RK2 D;  3TSI A;  4PJ0 E;  1AVY A;  1JUN A;  1L0N D;  4GDO A;  2HG5 D;  3H1H E;  3SFE C;  2JP3 A;  1HVV A;  3PH0 A;  2E76 C;  3L71 D;  1L2P A;  2BEQ D;  2WSC H;  1UII A;  5L8R J;  3FWL A;  2FXP A;  1H89 A;  1G2C A;  1K8A Q;  2YIU C;  1VL2 A;  3V2P A;  1GL2 C;  4O9B A;  2FFD B;  1MUU A;  2Y0E A;  3A3Y B;  4H44 B;  2AXT E;  1PP9 E;  3H1L E;  1VF5 D;  1LTJ B;  2ZXX A;  4I6M C;  2QJP C;  4YPC A;  1J1D C;  2Q6Q A;  1M8O B;  4IFD K;  1CSB A;  4C7N A;  2LKM A;  3KPE A;  2QE7 H;  3VP9 A;  2FXM A;  3AE8 C;  1FZC B;  1VDF A;  4EI2 A;  2KNC B;  2OYO A;  2FYU G;  2ZAE B;  2N1T D;  4PV1 C;  3AEF C;  2OYH A;  1LTS C;  1SQV G;  3L73 E;  3MZW B;  2BCC D;  5AW0 B;  3AE2 C;  2FYU K;  1K73 Q;  1SQV K;  4AYC A;  1P84 I;  1USD A;  4OVN F;  3GW6 A;  2RN0 A;  3N7N A;  2IFN A;  1JMM A;  1SQX G;  1S9K D;  1AA0 A;  4LLH A;  1M7L A;  1HH0 A;  2WWW A;  4R4L A;  5AVU B;  1KFM A;  5BU5 A;  3A0B E;  1D7M A;  2GA1 A;  1SQQ D;  4GOD A;  3H32 A;  3CCR P;  4EIJ A;  3H1H J;  1EZV G;  1SFC B;  1YQ4 C;  1PIX A;  2G3A A;  1NTM G;  2IX7 C;  3H1I J;  3PLN A;  1Q82 Q;  2YO3 A;  3Q5P A;  4M3L A;  1E5W A;  1JTH B;  1LWU C;  1LTT C;  5AW3 B;  3UIA A;  1FZF A;  4L74 A;  2R32 A;  2D2C B;  4A7P A;  1M1K Q;  2B9B A;  1L4A C;  2ITA A;  3IFM A;  1ZOY C;  3G6E P;  1PZQ A;  2YKQ A;  3H1L J;  2E76 D;  1N73 A;  4JQ0 D;  2RH0 A;  5TIS E;  3OA7 A;  4H13 B;  2Y0D A;  1LT9 A;  1JOC A;  1LNQ A;  1R8E A;  1PL5 A;  5APV A;  3R2P A;  1GL2 D;  4I7Z C;  3L75 E;  2Y9Y A;  2KI7 B;  4UB6 E;  3E1I A;  1NU1 G;  4HJG H;  1LP1 B;  2OTL P;  3HTK B;  3HUS B;  2BEZ F;  2NPS A;  2PFX A;  1Q2N A;  1EDK A;  1FDM A;  2IPP A;  3L73 J;  2YMY A;  3M06 A;  2M0B A;  1NTK E;  1NU1 K;  1KQG B;  4IFF A;  5KAI H;  4OH8 B;  3FWN A;  2WT7 B;  1LTB C;  1VF5 B;  2KSE A;  1OVR A;  3VOP A;  3L72 D;  2LXC B;  1S1C X;  1ZN5 A;  5GTI E;  1BE3 G;  2QJY B;  3S1K A;  3HRN A;  2Q5U A;  3V2Q A;  1L0N E;  2PRR A;  1W2E A;  2WPS A;  1NKZ B;  3CI9 A;  3MIW A;  4D6T E;  1VQ8 P;  2N1T B;  1GTW A;  1Q7Y Q;  4W7Z A;  2E5T A;  1S4X A;  3NFQ A;  5KKZ B;  2JWA A;  1Q86 Q;  1IFN A;  4JYB A;  1N86 A;  3Q5S A;  4PD4 H;  1E79 H;  4U3F J;  2M8R A;  1NAF A;  2YO2 A;  5C39 A;  5B66 H;  3CX5 H;  5KAF E;  4WWI A;  3HE4 A;  4BWN A;  3O6Q A;  1QVG O;  1JEK A;  1RF1 A;  1M1J B;  3AE5 C;  4H0L B;  1L4A D;  4XFJ A;  2BCC E;  4BRY A;  3CWB G;  2Q7C A;  2WSE J;  1S2E A;  2FBW C;  2FYN C;  2KS1 B;  5E79 H;  2FYU D;  2P67 A;  1SQV D;  3VMY A;  2M3B A;  2E76 B;  3V4Q A;  1S9K E;  2Z4E A;  3AEB C;  3B71 A;  3M0A A;  2C0W A;  3M9Q A;  2YIU B;  1GDT A;  5KJ7 C;  1GL2 B;  1GW3 A;  1SQB G;  1SQQ E;  4XE5 B;  3CCQ P;  1VQO P;  1L0N J;  2IZ0 A;  4HH2 A;  1SQX D;  1DEB A;  3CLQ A;  2E75 D;  4D6T J;  3SWK A;  1KFN A;  1SQB K;  2QJP B;  3PHL A;  1J1D B;  4L73 A;  4EOT A;  4YXW H;  2K9Y A;  3RGU A;  1EZV D;  1BSH A;  3CPW O;  1NTM D;  3A7O A;  2FYZ A;  1JY2 P;  3QH9 A;  4JF7 A;  1SQP G;  4PV1 B;  1MZ9 A;  2M5A B;  4EYY Q;  2XKM A;  4IL6 H;  2K3R A;  2H43 A;  1EDJ A;  4Y99 C;  1KYO E;  3U59 A;  2Z5I A;  1SQP K;  5KLI C;  3SSU A;  3CCE P;  2QG4 A;  3JSV C;  1GMJ A;  2Z5H A;  1PGQ A;  1RF0 A;  1SLQ A;  2HLO A;  2OTJ P;  2P2U A;  3AEG C;  3L74 J;  1RE4 A;  3RBZ A;  2BCC J;  3WUV A;  3I55 P;  1OVV A;  1CW5 A;  5CCG A;  1NU1 D;  4Z1M H;  2P10 A;  1BDD A;  3L72 E;  3A2A A;  1KIL A;  2NZ2 A;  5AW7 B;  1MFT A;  2A45 I;  4I1L A;  1WRG A;  4KJM A;  1T3J A;  2YNY A;  3M0D C;  2WSS H;  3T97 A;  3C9I A;  1LWU B;  1FS0 E;  2Q1K A;  3M9B A;  1L4A B;  4C7R A;  1CI6 A;  1BE3 D;  3LW5 H;  1GU4 A;  2V4H A;  4LC1 A;  4DJG A;  5KLV G;  4MN4 C;  1K05 A;  3OW2 O;  5AVR B;  1NAY A;  3FXD A;  1KTM A;  2WQY C;  4JYC A;  3BAS A;  5KJ7 D;  1SP4 A;  4I7Z B;  3H1K E;  5KLV K;  5AVY B;  1S5L H;  1ZR4 A;  1LT1 A;  2W83 C;  1JY2 N;  1SVF A;  3L70 G;  5B5E H;  1NO4 A;  5AVW B;  5CCH C;  1IJD B;  3BCC G;  1PGJ A;  4HB1 A;  1NTZ K;  2XU6 A;  3C8V A;  4EDF A;  1YI2 P;  3BRT B;  3H1J G;  4PD4 D;  5CBO A;  2ZFC A;  3B5N A;  3MGN A;  1N7L A;  1T8Z A;  1N7S C;  3HD7 C;  3CX5 D;  1IZN B;  4DZO A;  1VPC A;  5AVQ B;  1K04 A;  1GW4 A;  2FYU E;  2QA4 P;  1SFC D;  2ZYA A;  1SQV E;  5DJU B;  3P7K A;  1T2K D;  4I2L C;  3CWB D;  5CBN A;  1AQ5 A;  2HPC A;  4WY4 C;  3U1A A;  3JC2 2;  2IDB A;  2KSJ A;  2R5B A;  1JMB A;  4BXL A;  1ZW0 A;  2KZJ A;  1M57 D;  1KYO I;  1SQX E;  3LIE A;  2OYI A;  2CPS A;  2FY8 A;  1ZR2 A;  4CPG A;  2PAJ A;  3VYI A;  4ZKP A;  3AE7 C;  1SQB D;  4K35 A;  1GK4 A;  2WMM A;  1KQS O;  2QM8 A;  4RO0 A;  1L0L G;  1EZV E;  1LTA C;  1NTM E;  5H2F H;  3RK3 E;  3E1R A;  1QX8 A;  3TNU A;  2L5G B;  1X8Y A;  3H1K J;  1NYH A;  1IFI A;  2W8Z A;  1X22 A;  4N78 E;  1L0L K;  2AEF A;  1VQM P;  2WSC J;  2KUB A;  1EDI A;  1PGP A;  3WUU A;  2FYN B;  1N2D C;  2LXB A;  4IOI H;  3HE5 B;  1T6A A;  3AEE C;  1SQP D;  3M9H A;  1PPJ G;  3D70 A;  2AXC A;  2QM7 A;  3TF5 A;  1NKN A;  3CXH D;  1FZA A;  3OAK A;  3GHG C;  4LGD E;  1IK7 A;  1NU1 E;  5CCH D;  1VQ5 P;  2P1J A;  2QJK B;  4R4M A;  3RL0 C;  5GTH H;  1HJ0 A;  5TJH A;  1VQK P;  3HD7 D;  4QMA A;  2KOG A;  4AQR D;  5KAI E;  5AW2 B;  1FZB A;  3N4X A;  2K9J B;  1Y9B A;  3ITK A;  2CPB A;  1SQX K;  1YIJ P;  4OGQ C;  2O01 N;  4H0L D;  4WY4 D;  2RMZ A;  3C1L A;  2YXQ B;  2IBZ G;  4GOE A;  4Y99 B;  3K5B A;  5AW9 B;  2KYV A;  2ZYD A;  3G3Z A;  5KLI B;  1FJP A;  3H1H G;  1DD4 A;  3CC4 P;  5KLV D;  2Q9I A;  3S9O A;  3H1I G;  2OYH C;  1NTM K;  1YYC A;  1FOS F;  1PP9 J;  1HGV A;  3FGA D;  1NTZ D;  3TGU G;  4PD4 E;  2B87 A;  3L70 D;  1AVO A;  2N9Y B;  5AW4 B;  1DIP A;  1VQ4 P;  1RQU A;  3BCC D;  5B66 E;  2FXO A;  3CX5 E;  1OVU A;  2R3S A;  1VQ7 P;  3V6I A;  1BCC E;  1OZH A;  2O1J A;  3H1J D;  1NU1 J;  2P58 A;  5APW A;  2WVR A;  1ZP0 C;  3CWB E;  1ZME C;  2JR8 A;  1URQ A;  1M56 D;  2A06 G;  1QL2 A;  3L73 G;  2R5D A;  3GLM A;  3BRV B;  1RE3 A;  3CL3 D;  1VQ9 P;  1H8A A;  5E79 E;  4PV1 D;  3L36 A;  2KLV A;  3A5T A;  1FOS E;  4ZMD A;  1N73 C;  1SQB E;  2KZI A;  2JEE A;  3L71 E;  1LT9 C;  5AW5 B;  2FFD A;  3G71 P;  2FKW B;  1Q90 D;  3E7K A;  1ZRT D;  3CCL P;  5APS A;  2E42 A;  3I5C A;  3VMX A;  3KQG A;  1W2B O;  1LTJ A;  2NPS C;  1ZV8 A;  1OW8 A;  1L0L D;  1N7S B;  2JDI H;  3HD7 B;  4DOJ A;  4OGQ D;  1RQV A;  2LR2 A;  1SQP E;  2R3C A;  4U3F G;  1RH5 B;  1FZC A;  2KNC A;  1FZG A;  3L35 A;  1NJI Q;  3NTN A;  4WY4 B;  1W5C E;  3AEC C;  3L75 J;  4IL6 E;  1BSN A;  1PPJ D;  1BCC J;  2R44 A;  2Y0C A;  1VQP P;  1XTC C;  1DH3 A;  1X9V A;  1AV1 A;  4N3Y B;  5DJT B;  3CCM P;  3TK1 A;  4GIF A;  1NTK J;  5EFW B;  1GK6 A;  1H0T B;  2OGU A;  2XNX A;  1DD3 A;  3H6P A;  1Z56 A;  1CZQ A;  4YTP C;  4PD4 I;  1YQ3 C;  5AW1 B;  1JCD A;  1SFC A;  1U7J A;  1FE6 A;  2HOD B;  2GM4 A;  1SQB J;  1RHZ B;  1KC8 Q;  2WPV B;  3CX5 I;  3L71 J;  1JTH A;  1KB9 H;  3PRJ A;  4DT0 A;  4OWF A;  3VMZ A;  1RF1 C;  5KLV E;  1KQF B;  4D6T G;  4DCK A;  1G1I A;  1IFP A;  1HTL C;  2IBZ D;  1YHQ P;  3MUD A;  2POH A;  3GHG B;  3CC2 P;  3CXH H;  3NXS A;  3WU2 H;  1NTZ E;  3G4S P;  4ASV A;  1A02 F;  1KOR A;  5M1B A;  1S5L E;  2QIW A;  1SQP J;  3L70 E;  3H1I D;  3M91 A;  2XND H;  3BCC E;  1LP1 A;  3HTK A;  3HUS A;  2OTK E;  5B5E E;  1G2C B;  5AVV B;  2NPS D;  3TGU D;  3H1J E;  3USS A;  1JB0 J;  2P7J A;  3RL0 g;  4HYT B;  1GU5 A;  1EQ7 A;  1N8R Q;  1S3J A;  2WT7 A;  3KHU A;  3GG2 A;  3V5B A;  3B4S A;  2KB7 P;  3L74 G;  1JY3 O;  1EC5 A;  4OGQ B;  2ZVO B;  4ZKU A;  3P8M C;  4C7N B;  3JCU H;  3FXE A;  3CCU P;  4L76 A;  2WPR A;  4NPF X;  1FU1 A;  1JNM A;  2O01 H;  4Y28 J;  2A06 D;  2N1T A;  3L73 D;  3RK2 C;  1KQL A;  1SQQ J;  1Y47 A;  2OYH B;  1BGY G;  1HF9 A;  1PFI A;  1NHL A;  3FX0 A;  1FDI A;  1FAV A;  2JO1 A;  3R4Y A;  2H8P D;  3KDP B;  1WMK A;  3PP5 A;  2WSF J;  1YJ9 P;  3W67 A;  5KLV J;  4KT0 J;  1RF0 C;  1L0L E;  3LW5 J;  1RE4 C;  2AEJ A;  1XTG B;  2MKV A;  1IFM A;  4GT1 A;  3MHV A;  2I8D A;  5CHX A;  5CCG C;  2ZVN B;  1NTZ J;  5H2F E;  1M1J A;  3H32 B;  2I1J A;  1KIL C;  3L70 J;  3BCC J;  2W90 A;  3D6Y A;  4U3F D;  3VTP C;  2KS1 A;  4B86 A;  3H1J J;  2M3E A;  1OXZ A;  4UB8 H;  5APX A;  1N73 B;  1DEE G;  1QGK B;  1USE A;  1LT9 B;  3L72 J;  1GL2 A;  2DW3 A;  1FC2 C;  2V7Q H;  2AEM A;  1VQL P;  5GTH E;  4C46 A;  2KXP B;  2NPS B;  3Q3D A;  1KZU B;  4W7Y A;  1A02 J;  3GF3 A;  1M90 Q;  2ZXE B;  1OW6 A;  1J1E C;  1OMI A;  2KIK A;  1NWQ A;  3B5N C;  2IBZ E;  2HFE D;  1IFJ A;  2M5A A;  1L0L J;  3A0H H;  1ZLL A;  5APU A;  1KB9 D;  2WIT A;  3H1I E;  4D6T D;  1P84 H;  2KK7 A;  3H1K G;  1IFD A;  4KHX A;  1Q81 Q;  5APY A;  3EFG A;  3KZI H;  3TGU E;  2OQQ A;  5CJ0 A;  2E5Y A;  3L4F A;  2OYI C;  3LID A;  5CCG D;  2RKL A;  2FYU J;  1HGZ A;  1KIL D;  1NH4 A;  1SQV J;  3QWO C;  3IN6 A;  1UIX A;  3VMA A;  2E74 C;  5KTB A;  3HE4 B;  2J58 A;  3TYY A;  1LWU A;  3BVH A;  4RJT A;  2XDJ A;  3O6Q B;  3AE6 C;  2A06 E;  4WVZ A;  3L74 D;  2JKV A;  1N7S D;  1RF1 B;  1L4A A;  1S72 P;  1KV4 A;  2OAR A;  3F5H A;  3U1C A;  3WMM 0;  1BE3 E;  2K1A A;  1SQX J;  1KN7 A;  4BRY B;  3IF4 A;  2WTY A;  2ZJS E;  5APQ A;  2CK3 H;  2E43 A;  4PJ0 H;  2QSI A;  1AQT A;  5CJ4 A;  3SWF A;  1YBK A;  3O8Z A;  1LJ2 A;  3CD6 P;  2B89 A;  1BGY D;  1MKM A;  2ZT9 C;  1YJN P;  5AW8 B;  3V2N A;  1NTM J;  1X0T A;  4XA4 A;  2H7H A;  1U7M A;  1RY3 A;  1HUC A;  2AXT H;  4RKU J;  1EXI A;  3Q5R A;  2N9B A;  3B5N D;  4U3F E;  3EFF K;  2QVA A;  5AVT B;  1PP9 G;  1YJW P;  3H1L G;  4HKZ H;  3TGU J;  4U7J A;  2IFM A;  1KMI Z;  2J5U A;  2W6J H;  3GF7 A;  1G1J A;  3RK2 B;  1EZV I;  3PTZ A;  2IBZ I;  1KYO D;  2C0X A;  1FZE A;  3CCS P;  3VP8 A;  3D6Z A;  3CCV P;  3Q1M A;  1OWA A;  1OX3 A;  3NMD A;  5AW6 B;  5CMZ A;  3AE9 C;  1IC2 A;  2H89 C;  2WZ7 A;  1BE3 J;  4TT3 H;  1AFO A;  2E75 C;  3RL0 D;  2E74 D;  3A0B H;  2YMK A;  1OFC X;  1KIL B;  2G8Y A;  3RK3 C;  1KB9 E;  1YIT P;  3T97 B;  3IAO A;  1QL1 A;  3HE5 A;  4GOF A;  2C9N Y;  3RBX A;  1JM0 A;  1CI6 B;  1T3U A;  1SS1 A;  1URQ C;  2O1K A;  2ZT9 D;  1IO4 A;  5TIS H;  4W80 A;  1NVO A;  2QRX A;  1RE3 C;  3CXH E;  3WU2 E;  5KJ7 A;  3H1K D;  1PGO A;  4NPD A;  4UB6 H;  4YXD C;  1P84 D;  3KXD A;  1KIL E;  2HR3 A;  5AVS B;  3L75 G;  2KLU A;  3P8C D;  2WSE H;  5AVZ B;  1LTG C;  2PP6 A;  3AEA C;  3CCJ P;  3CWB J;  2FFD C;  1BCC G;  4L75 A;  5K5G B;  1X79 B;  3TDK A;  3L74 E;  4H44 C;  1J1E B;  2IZ1 A; 
#chains in the Genus database with same CATH homology
 1JOC A;  1X8Y A;  2KP8 A;  1LTJ C;  1IFI A;  5APV A;  2YKP A;  3R2P A;  1MFZ A;  3B5N B;  1JY3 P;  1FAV A;  1GL2 D;  2W27 A;  4N78 E;  1L0L K;  3L37 A;  2H8P D;  3KDP B;  3PP5 A;  3E1I A;  1RF0 C;  1N2D C;  1NTK K;  1JO5 A;  3HE5 B;  3HTK B;  1RE4 C;  1LTI C;  3HUS B;  2NPS A;  1FZC C;  1XTG B;  1IFM A;  2MJZ A;  3M9H A;  4GT1 A;  1FDM A;  2IPP A;  2QM7 A;  2YMY A;  3M06 A;  1NKN A;  1NU1 K;  5CHX A;  4IFF A;  5CCG C;  2C9L Y;  2HPC B;  1FZA A;  4OH8 B;  1M1J A;  3OAK A;  2WT7 B;  1LTB C;  3GHG C;  3H32 B;  2I1J A;  4LGD E;  4WBA A;  1KIL C;  3VOP A;  1HWT C;  5AVX B;  5CCH D;  2BAS A;  1L0N K;  1ZN5 A;  2OYI B;  3VN0 A;  3V4W A;  3HRN A;  2P1J A;  2Q5U A;  3V2Q A;  3RL0 C;  3VTP C;  4B86 A;  2A45 H;  3EQ2 A;  5BU8 B;  1W2E A;  2WPS A;  1NKZ B;  3CI9 A;  3MIW A;  1OXZ A;  3M0D A;  2N1T B;  1GTW A;  3RL0 B;  3HD7 D;  2A45 G;  2KOG A;  3RK3 D;  5APX A;  4W7Z A;  1N73 B;  4AQR D;  2GUS A;  5AW2 B;  3NFQ A;  1DX7 A;  1FZB A;  3N4X A;  1LT9 B;  4N78 D;  3TNU B;  1GD2 E;  1GL2 A;  1SFC C;  2CPB A;  1IFN A;  2JJL A;  1SQX K;  4JYB A;  1N86 A;  1URQ D;  1T2K C;  4WY4 D;  2M8R A;  1NAF A;  4C46 A;  4Y99 B;  2YO2 A;  5AW9 B;  2KYV A;  1HBW A;  2NPS B;  3G3Z A;  1KZU B;  1FJP A;  4W7Y A;  1A02 J;  3HE4 A;  2Q9I A;  4IFM A;  4N6J A;  2ZXE B;  1NTM K;  1JY3 N;  1LT9 A;  2OYH C;  1J1E C;  1YYC A;  1RF1 A;  1M1J B;  1FOS F;  5CCH A;  2VRS A;  1HGV A;  1YTZ T;  2W6A A;  5APT A;  1L4A D;  1NWQ A;  3B5N C;  2Q3I A;  2HFE D;  1IFJ A;  1GZL A;  4AUW A;  2YKO A;  2Q7C A;  2WPQ A;  1ZLL A;  5APU A;  2WIT A;  5AW4 B;  3HUS C;  1MV8 A;  1N7S A;  2XZR A;  3HD7 A;  2P67 A;  2WSF H;  1IFD A;  3VMY A;  2M3B A;  1H88 A;  4KHX A;  2I1K A;  3V4Q A;  1S9K E;  2O1J A;  1HJB A;  2Z4E A;  2HYN A;  5APY A;  1SQQ K;  3M0A A;  3EFG A;  3II6 A;  2C0W A;  5APW A;  1FJK A;  3P32 A;  3M9Q A;  1GDT A;  3MD0 A;  5CJ0 A;  1JY2 O;  5KJ7 C;  1GL2 B;  1GW3 A;  1URQ A;  4XE5 B;  1FBM A;  1QL2 A;  1LGH B;  3L4F A;  3LID A;  4WY4 A;  2OYI C;  4HH2 A;  1IK9 A;  3V2R A;  5CCG D;  2R5D A;  1J2J B;  1DEB A;  3MTU E;  3BRV B;  1RE3 A;  3BAT A;  3CLQ A;  3CL3 D;  1H8A A;  2XV5 A;  1KFN A;  1HGZ A;  1SQB K;  1KIL D;  3L36 A;  1NH4 A;  2KLV A;  3A5T A;  1J1D B;  2N1T C;  2GUV A;  5KTB A;  3HE4 B;  2J58 A;  1FOS E;  3TYY A;  1LWU A;  4EOT A;  3BVH A;  2XDJ A;  3P8C E;  1N73 C;  2JEE A;  1RF1 B;  1N7S D;  1L4A A;  1LT9 C;  5AW5 B;  3A7O A;  2FFD A;  1WT6 A;  2FYZ A;  2OAR A;  1JY2 P;  4GKG A;  2FKW B;  4JF7 A;  3U1C A;  3WMM 0;  1MZ9 A;  3B8E B;  5BVZ A;  4WB4 A;  3IR9 A;  2XKM A;  5APS A;  2H43 A;  3I5C A;  2E42 A;  2WTY A;  3VMX A;  3KQG A;  1LTJ A;  4Y99 C;  2HOD A;  5APQ A;  3U59 A;  2Z5I A;  3KYQ A;  2E43 A;  1SQP K;  2NPS C;  1ZV8 A;  5CJ4 A;  2J59 M;  3SWF A;  1N7S B;  3O8Z A;  3HD7 B;  4DOJ A;  4RES B;  3RK3 B;  2Z5H A;  1RF0 A;  1YTZ I;  1SLQ A;  1NOH A;  2HLO A;  2P2U A;  5AW8 B;  3V2N A;  2R3C A;  1RE4 A;  1FZC A;  1M1J C;  3SWY A;  2W6B A;  1JCC A;  1FZG A;  3L35 A;  3NTN A;  4XA4 A;  2H7H A;  1URQ B;  5CCG A;  1CW5 A;  1RY3 A;  1HUC A;  4WY4 B;  3GHG A;  3A2A A;  1KIL A;  3OJA B;  5AW7 B;  3RK2 D;  3TSI A;  2A45 I;  4I1L A;  1JUN A;  2N9B A;  3B5N D;  1XTC C;  1WRG A;  1DH3 A;  1T3J A;  1X9V A;  5AVT B;  2HG5 D;  2YNY A;  1HVV A;  3M0D C;  4N3Y B;  3T97 A;  3C9I A;  3TK1 A;  1LWU B;  4GIF A;  2IFM A;  2WSC H;  1GK6 A;  2XNX A;  1H89 A;  1G2C A;  1G1J A;  3M9B A;  1L4A B;  4C7R A;  3V2P A;  1CI6 A;  1GL2 C;  4O9B A;  2FFD B;  1MUU A;  3H6P A;  3LW5 H;  3RK2 B;  1GU4 A;  4LC1 A;  1Z56 A;  3A3Y B;  1CZQ A;  2C0X A;  5AVR B;  5AW1 B;  1JCD A;  1FZE A;  1SFC A;  1LTJ B;  4I6M C;  2HOD B;  4JYC A;  3BAS A;  2GM4 A;  3VP8 A;  5KJ7 D;  1J1D C;  1SP4 A;  1OWA A;  4IFD K;  5KLV K;  5AVY B;  1ZR4 A;  1CSB A;  4C7N A;  3NMD A;  1JTH A;  5AW6 B;  2LKM A;  3KPE A;  1JY2 N;  3VP9 A;  5CMZ A;  1SVF A;  1IC2 A;  2FXM A;  3VMZ A;  1RF1 C;  1FZC B;  1VDF A;  2WZ7 A;  1NO4 A;  5AVW B;  5CCH C;  1AFO A;  1IJD B;  1G1I A;  2N1T D;  1NTZ K;  3RL0 D;  2XU6 A;  1HTL C;  2OYH A;  1LTS C;  3MUD A;  5AW0 B;  3BRT B;  2POH A;  3GHG B;  3NXS A;  1KIL B;  2ZFC A;  3B5N A;  2FYU K;  3MGN A;  1A02 F;  1N7L A;  1T8Z A;  1N7S C;  1SQV K;  4AYC A;  3HD7 C;  3RK3 C;  3M91 A;  4DZO A;  1VPC A;  5AVQ B;  3N7N A;  2IFN A;  1GW4 A;  1JMM A;  1SFC D;  1QL1 A;  3HE5 A;  3HTK A;  3HUS A;  1S9K D;  3P7K A;  4LLH A;  2C9N Y;  1M7L A;  1G2C B;  5AVV B;  2NPS D;  1HH0 A;  2WWW A;  1T2K D;  1CI6 B;  2P7J A;  1T3U A;  5AVU B;  4I2L C;  1KFM A;  5BU5 A;  1URQ C;  1AQ5 A;  2HPC A;  4HYT B;  4WY4 C;  1GU5 A;  2O1K A;  1EQ7 A;  1IO4 A;  2WT7 A;  4W80 A;  3U1A A;  3V5B A;  3H32 A;  2KSJ A;  4EIJ A;  1RE3 C;  2R5B A;  2KB7 P;  5KJ7 A;  1SFC B;  1JY3 O;  2IX7 C;  3LIE A;  2OYI A;  2CPS A;  2YO3 A;  1ZR2 A;  4ZKU A;  4M3L A;  3P8M C;  4C7N B;  1E5W A;  1JTH B;  2PAJ A;  1LWU C;  1LTT C;  3VYI A;  5AW3 B;  3UIA A;  4ZKP A;  5AVS B;  1FZF A;  2WPR A;  2R32 A;  3P8C D;  2WSE H;  1FU1 A;  1GK4 A;  1L4A C;  5AVZ B;  1JNM A;  2O01 H;  3IFM A;  2N1T A;  1LTG C;  2PP6 A;  2QM8 A;  2FFD C;  3RK2 C;  2YKQ A;  1X79 B;  1N73 A;  1KQL A;  1LTA C;  2OYH B;  3OA7 A;  1J1E B;  1PFI A;  1NHL A;  3TNU A;  2L5G B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...