5APYA

Sequence matkddian inserted between gcn4 adaptors - structure t9(9)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
DKVEELLSKVYHLENEVARLKKLMATKDDIANMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
molecule keywords GENERAL CONTROL PROTEIN GCN4
total genus 26
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apyA00
3O8ZA 1GK4A 2YNYA 1CZQA 3V5BA 2ZXEB 5AW1B 5AVSB 3UIAA 1GTWA 2N9BA 4DZOA 3A7OA 2Q3IA 1HJBA 4AUWA 5APSA 3VMXA 1S9KE 4JYBA 5APYA 2R5BA 4C46A 3M06A 2WT7A 4GKGA 5APQA 1GU4A 2QM7A 1OXZA 2R5DA 2WWWA 3KQGA 3HTKA 3NFQA 2P7JA 1GU5A 1OWAA 1MV8A 2P67A 3LIDA 2H7HA 3V4WA 3TNUA 4EOTA 1FAVA 3VTPC 1JNMA 3HE5B 1H8AA 3P8MC 2JJLA 3OAKA 5APVA 1CI6B 5AVVB 4LC1A 1MUUA 1KQLA 3M0DA 4XE5B 1T2KD 3M0AA 3NTNA 1MFZA 5AVWB 5AW6B 2YO2A 1IO4A 4B86A 5AVRB 3L37A 3VN0A 2ZFCA 5AVXB 5APWA 2Q7CA 3NMDA 3TK1A 4KHXA 5AVYB 2C9LY 3L36A 3T97A 2BASA 3M9BA 2WT7B 2WTYA 4C7NA 5AVZB 3NXSA 4RESB 5APTA 2IPPA 5AW0B 3MD0A 2WPRA 3TYYA 4M3LA 4GT1A 5APUA 2E42A 1S9KD 1H89A 1J2JB 5AW4B 2W6AA 1SLQA 1HUCA 3KDPB 4I6MC 1DH3A 1GD2E 4JYCA 1YYCA 3HE4A 1T2KC 2C9NY 1JUNA 2KP8A 3SWFA 3VMZA 3TNUB 3P32A 1CSBA 1HBWA 3P7KA 5AW2B 3V4QA 5APXA 1NWQA 5AW9B 2XV5A 4AYCA 3HE5A 2WPQA 2E43A 2Z5HA 1FOSF 4HYTB 1H88A 2R32A 5AVQB 5AW5B 1A02J 1SP4A 4AQRD 2QM8A 3A3YB 3B8EB 2W27A 3IR9A 1NAFA 1CI6A 5AW8B 2WPSA 5AW7B 2VRSA 3VYIA 3L35A 1HWTC 1GZLA 4I2LC 5AVUB 3VMYA 3HE4B 1X8YA 3MGNA 5CMZA 3I5CA 1G2CB 1A02F 3A2AA 2P2UA 3M91A 5AVTB 2XZRA 2R3CA 3A5TA 2XU6A 2Z5IA 3M9HA 2YO3A 1GK6A 2Q5UA 1FOSE 4C7NB 5AW3B 3LIEA
chains in the Genus database with same CATH superfamily
1S5LX 3V2QA 2E76D 3MZWB 2KYVA 3SWKA 2YNYA 2H8PD 1U7MA 4D6TG 2PRRA 4KT0J 1W5CE 2HG5D 1LTAC 1URQD 2H89C 3HUSC 1PV3A 5AVSB 4ASVA 1KYOD 3H25A 1VQOP 1NU1G 1VQ4P 4H13D 1Z56A 2A45G 1LTJA 2Q3IA 2Y0EA 1FDIA 5EFWB 4AUWA 1KQGB 1LTBC 1NKZB 2JEEA 1NKNA 2AEMA 2FXMA 3ABVC 1GL2D 4N78E 5CJ0A 3CCQP 2P1JA 1L4AC 2ZT9C 3CXHE 2E76B 3M06A 5APQA 1VQNP 4H0LD 1YHQP 2WWWA 1OX3A 2Q6QA 1ZXGA 3OJAB 4R4LA 2FFDA 2WSFH 1QL1A 1SQQD 2IYOA 2J59M 2P7JA 2JWDA 2P67A 2H7HA 4KJMA 4EOTA 3H1JE 1FAVA 4R4MA 1PPJD 2N1TD 1X0TA 3HE5B 3L71E 1JNMA 4NPEA 3D6YA 4PD4D 1BDDA 3GHGA 1BSHA 5APVA 2D2CB 1RE3A 1NTMK 1RQVA 3PP5A 2V7QJ 2NPSB 1N7SB 1ZOYC 3AEDC 4LC1A 3HD7A 3M0DA 5DJUB 3JSVC 3SFEC 4H44D 1JO5A 1SFCB 1SQVD 3BCCD 1KN7A 1M1JC 2WSCJ 3S4RA 1JCDA 1NU1D 1LTGC 2YO2A 2ZXXA 3L74E 2OTKE 4U3FG 4WVZA 3WU2H 1SQQJ 5KLVG 3H1IJ 2OQQA 4EIJA 2Y9YA 1RE4C 2HFED 2WQYC 3G3ZA 1BE3J 1SQPJ 2O01N 3RGUA 3I56P 1L4AD 1IFNA 2ZT9D 4GIFA 3TK1A 4KHXA 1GL2C 4DT0A 4Z1MH 3CCLP 1NTKG 2K3RA 1SFCD 2Y0CA 3L36A 3KYQA 3CCEP 3HD7D 1HJ0A 3CXHI 1SQBD 1N7SD 2QG4A 1NTMG 3HD7C 3G4SP 1DX7A 5B66H 1KILC 3M9BA 2A06E 1LTIC 2WT7B 1NTZJ 3CXHH 3L73D 3QWOC 3RK3E 3NXSA 3H1KD 1BCCE 2E76C 1L4AB 2ZT9B 1VDFA 1SS1A 1NJIQ 4M3LA 3MTUE 1SQVG 4GT1A 2OYIA 3E1IA 3EFGA 1VQKP 1ZR4A 5CCGA 1S9KD 4H44C 1JTHA 1NO4A 2KS1A 3KDPB 4JYCA 1NTME 1M56D 1X79B 1ZRTD 2SPZA 2ITAA 1JUNA 4RO0A 4U7JA 1IC2A 1NTKE 2N1TC 3P32A 2KLUA 3TNUB 1Q86Q 1W2EA 1NVOA 1N73A 2I1JA 2M0BA 3V4QA 1L0LD 2H88C 2P10A 1EZVE 2QJPB 3RBZA 3OW2O 5TJHA 2XDJA 3PHLA 2HPCA 3AE8C 3CWBD 1RF0A 2WPQA 4PV1D 3RBXA 1BCCJ 2E43A 3KXDA 2K9YA 3H1KE 4U3FE 1SQXG 1SQBG 1WT6A 2HLOA 2QE7H 4HYTB 2E75B 2R32A 4PJ0E 5AVQB 3RK3D 1PGOA 1SP4A 2V4HA 2OYHC 4XFJA 2CPBA 2QM8A 1LP1B 1LTSC 3EFFK 1PL5A 3A3YB 1EXJA 1CI6A 3FGAD 2WPSA 3A0BH 4H13B 3D70A 2O1KA 1SQBJ 1SQPD 2YIUB 3H1IG 1JMMA 1HVVA 4W7YA 3AEFC 1LT9C 1SQQG 5AVUB 1HWTC 3H32A 2I8DA 3H6PA 2R3SA 4L74A 1GMJA 1J1DC 3AE6C 3I5CA 1G2CB 3H1LD 1D7MA 1A02F 1FBMA 2OARA 1XTCC 2P2UA 2QJPC 1OVRA 1BCCG 2IYPA 2XKMA 2RH0A 2XZRA 2B9BA 2ZYGA 3M91A 5AVTB 1FDMA 2KK7A 1PGJA 2YKQA 3AEBC 2A06G 1WMKA 2Q9IA 3WUVA 1FDOA 1FZFA 4JQ0D 1EZVD 1FZBA 4MN4C 3BRTB 1OVUA 1JY3P 2NPSD 3GF7A 2N1TB 3H1HG 1T3UA 1RH5B 1SQXD 3S9OA 3KPEA 5CCGD 1VQ9P 1SQQK 3PRJA 4JF7A 1K8AQ 1OW7A 2D2CD 3MUDA 5KLVJ 1U7JA 3UIAA 1GTWA 1Q81Q 4DZOA 1AJYA 1USDA 2P58A 1YIJP 2WMMA 2H43A 2NZ2A 3CWBJ 3A7OA 1HGVA 5KAFE 1VQLP 2BCCG 3A0HE 1EDIA 2QJYC 1G1IA 1S9KE 1NTMD 2MJZA 1K05A 1KB9D 1ZLLA 2YKOA 1AQTA 2FBWC 2OYIC 2WT7A 3BCCJ 1ZMEC 3CC7P 3L72G 1ZR2A 1KFMA 4W80A 4D6TJ 4Y99C 1EDLA 3GF3A 2QJKC 3RL0B 3M9QA 4L75A 2O01J 1ZV8A 2A06D 2HYNA 1KILA 2ZYDA 3GMAA 3H1JG 3RK2D 1IK9A 1PP9E 1VQPP 5KKZC 3P8MC 4UB8E 1JCCA 2FXOA 3CC2P 3AEAC 2IFNA 1OW8A 5AVVB 3CX5E 1MUUA 4JPZB 2FYUD 1Y9BA 1T2KD 4BRYB 1KQFB 3MHVA 5KJ7A 1QVFO 2WSEH 1RHZB 2LKMA 2PFXA 5AW6B 1QVGO 1IO4A 1FC2C 1SQPE 3BCCE 5AVRB 5CCHD 3RL0D 3L37A 1NU1E 3L75J 4K3AA 3TF5A 3CC4P 1M1JA 1EDKA 5APWA 2I1KA 1KV4A 4YXDC 3I55P 1L0NG 3P8CE 3NMDA 1S3JA 1Q2NA 2G3AA 3G9RA 1NGMB 1UIIA 2KOGA 1SQVE 2FFDB 4IFDK 1IFJA 4I7ZB 2PGDA 3A0HH 1HGZA 1L0LJ 2BASA 5DJTB 2M5AB 1KILB 2M8RA 2OYHA 1BDCA 1VQ5P 3R4YA 4C7NA 1R8EA 1L0NK 2DW3A 2WZ7A 2M3BA 2BCCJ 3L70J 3L73J 5AVZB 1VQ8P 1L0LE 2AEFA 1AA0A 2K1AA 2YMKA 2FXPA 4RESB 3RK2C 3VP9A 4WY4C 4ZKUA 1N7SA 4ZNCA 2AXCA 3Q1MA 1RF1C 2WPRA 3TYYA 1SFCA 2E42A 3CX5I 1R5SA 3W68A 3CCUP 1LWUA 2G8YA 3O6QB 1NTMJ 2K88A 4GDOA 1FJPA 2N1TA 3GW6A 2QIWA 1H0TB 1E79H 2A45I 1GD2E 1YYCA 3HE4A 2R44A 4N3YB 2C9NY 3G6EP 3C1LA 2LXCB 4JBZA 1NWQA 3CI9A 1BGYG 2NRGA 1N7SC 1EZVG 1KYOE 1P84E 1LWUC 5CCGC 3SSUA 1YJNP 5APXA 1RY3A 3II6A 1SFCC 1J1EB 1USEA 1SQPK 2L91A 2ZYAA 2E74D 2FY8A 2QVAA 2ZVNB 3HE5A 3EQ2A 3L73E 4WY4A 5KAIE 4C7RA 3RL0g 2Z5HA 5KTBA 2IZ1A 3JCUE 3L71J 1FOSF 1NH4A 1NTKK 2KIKA 2POHA 1H88A 1IK7A 1YITP 1BE3G 1JY3N 1KB9I 1KFNA 1UIXA 3B8EB 3AE3C 5GTHE 1YBKA 2IZ0A 1GL2B 5B5EH 1VL2A 3K5BA 2MKVA 1RE4A 3HD7B 5AW7B 1KORA 3VYIA 1QX8A 1MZ9A 3D71A 1VQ7P 3VMYA 1SQXJ 2FKWB 2IX7C 3HE4B 1JY2P 4ZMDA 1X8YA 2WVRA 4GODA 1YJ9P 4W7ZA 3AE5C 1M1KQ 3B5NA 3L70G 1EZVI 1GW4A 1M8OB 5GTIH 1OVVA 3O6QA 2AXTH 1N2DC 1XTGB 1N7LA 3BATA 3GHGC 1YI2P 1L0LG 1M1JB 3B4SA 3M0DC 3TGUJ 3A5TA 1QGKB 3JC22 2WSSH 1GU4A 3M9HA 1K73Q 1KQSO 2YO3A 1GK6A 4EYYQ 1VQ6P 3WMM0 3RK3C 1S4XA 1AFOA 2IBZD 2FYUK 3V2RA 3CMAP 3CL3D 1BE3D 2J58A 2PAJA 1L0ND 3LIEA 2K37A 5KLVE 1P84D 1OW6A 2M5AA 2KLVA 1CZQA 1KC8Q 2IFMA 2ZXEB 1FZAA 1URQC 2KNCA 2O3JA 3CLQA 5AW1B 1YJWP 2B88A 1J1EC 3AEEC 2C0WA 3JCUH 4LLHA 4IOIH 1NTZE 1MFTA 2JKVA 1HJBA 1PFIA 2QJYB 3H32B 2Q1KA 3VMXA 2W6JH 1KTMA 5APYA 2OTJP 3MUDC 4GKGA 5B5EE 1SQBK 4YTPC 1G2CA 1S1CX 2FYNC 5H2FE 3L4FA 2QM7A 4RJTA 2R5DA 3KQGA 3WU2E 3Q5SA 2FYZA 1L0NJ 2W83C 1Q82Q 2LXBA 1X22A 1IFMA 1LGHB 1OWAA 1TU3F 2IBZE 3LIDA 3V6IA 4DJGA 3V4WA 1N73B 3TNUA 2PP6A 3FXDA 5CBNA 1VF5B 1KILD 1SQVK 2ZJSE 3F5HA 1QL2A 3R2PA 3VTPC 5KKZB 2JJLA 5GTIE 2WSCH 2D2CC 3OAKA 1J1DB 1ZP0C 3L73G 4IFFA 4WY4B 5C39A 1CW5A 3AE2C 2B87A 3C9IA 3CCRP 1JY3O 2KSEA 3M0AA 1BGYE 1MFZA 3H1LE 1EC5A 1L2PA 3VP8A 2W6BA 3H1KG 2BCCE 2GUSA 2W90A 3HRNA 4HB1A 3W67A 2JO1A 1DEEG 1AV1A 1BGYJ 1LT9A 2M3EA 5BVZA 4HKZH 4OWFA 2Z4EA 3CCSP 1FZEA 1S5LE 1YTZT 3CX5D 1GW3A 3L72D 3L74J 3CD6P 3H1HE 4ZKPA 4IL6X 4L73A 3PH0A 5KLIB 1K04A 2YXRB 3OA7A 5L8RJ 3L70E 1IFIA 2E74B 2KI7B 2WTYA 4TLFA 3L75G 3CMEP 1AVOA 3S1KA 5H2FH 2WSEJ 3Q5PA 1VQMP 2BEQD 3BCCG 1RF0C 3CWBE 5AW0B 3H1LJ 2OGUA 1ZN5A 1LTTC 2N9YB 1EXIA 1SQXK 3B5NB 1N73C 1YQ3C 1PIXA 3RL0C 2OYHB 4OVNF 2KB7P 4H44B 3N4XA 1NTKD 4PJ0H 1Q7YQ 2YIUC 4PV1C 3H1IE 1K9MQ 1DH3A 4HJGH 4I6MC 3TDKA 1QEXA 5B66E 2JDIH 3H1JJ 1T2KC 1NYHA 3E1RA 1URQA 3H1HJ 1CSBA 2HODA 2KSJA 3A0BE 3P7KA 4WB4A 3D6ZA 2JP3A 4LGDE 5AW2B 3MIWA 2GA1A 1EQ7A 2FYUJ 3AE4C 1DEBA 4I7ZC 4OGQB 5KJ7D 5AW9B 2XV5A 4AYCA 1SQXE 3IAOA 1KB9H 2XNDH 1BCCD 1JY2N 2ZAEB 2UWJE 3CPWO 2E75C 1M57D 3Q3DA 5AW5B 3H1LG 1S5LH 1PGPA 1L0LK 2QA4P 1FZCA 1IFPA 4ASWA 4AQRD 1A02J 4BRYA 3IR9A 5CJ4A 4NPFX 4D6TD 3TGUD 1LNQA 3B5NC 2Y0DA 4QMAA 4OGQD 3CCJP 1RQUA 3H1HD 1VPCA 3L74D 2LR2A 3L72E 2A45H 2VRSA 3L35A 3ZDMA 2E74C 3FWNA 3CCMP 1PGQA 2YMYA 2K9JB 1GZLA 2J5UA 1FS0E 4O9BA 1BSNA 2RN0A 3T97B 3L72J 3VMAA 3ITKA 2B89A 5CMZA 2QRXA 2BCCD 3RK2B 2FYUE 3PTZA 3USSA 3TGUE 1RF1B 1BGYD 3CWBG 3LW5H 3A2AA 1SQVJ 1P84I 1JB0J 1JM0A 5KAFH 2QJKB 3BVHA 5CBOA 4CPGA 2XU6A 3G71P 2Z5IA 1PP9D 1T3JA 1W2BO 4GOEA 4HH2A 4PD4E 5E79H 4IL6E 2FFDC 2QEXP 2GUVA 1PZQA 5CCHA 1FOSE 1SQPG 1KILE 5AW3B 3H1JD 1AVYA 2Q3EA 4WY4D 1H89A 1JOCA 1JTHB 3O8ZA 1M7LA 3QH9A 1GK4A 1LWUB 2WSFJ 3PLNA 3V5BA 1NTKJ 1L4AA 4K35A 3TSIA 3AE7C 2JWAA 1KB9E 2N9BA 4UB6H 3TGUG 3B71A 1H0TA 2FYUG 2XNXA 4UB8H 1OZHA 1SVFA 1FZCB 4N6JA 5APSA 4JYBA 1N86A 1IZNB 3H1KJ 2R5BA 1IJDB 4C46A 1LTJC 1JY2O 1RF1A 1OXZA 1KYOI 1NU1K 1NTZK 3HTKA 5AW4B 3U1CA 3NFQA 1NOHA 5CCHC 1GU5A 1MV8A 1HH0A 2IDBA 4DCKA 3FXEA 2HPCB 4WBAA 2JR8A 1WRGA 1SQBE 3BRVB 3EWKA 4U3FJ 2IBZG 1LT1A 5CHXA 1H8AA 2RMZA 1MKMA 3C8VA 1CI6B 2WPVB 2CPSA 1KQLA 4XE5B 1URQB 1LP1A 2E5YA 2KNCB 4Y28J 3NTNA 4YPCA 4OGQC 1EDJA 1HTLC 2QSIA 3LW5J 1GL2A 3GLMA 4PD4H 5E79E 5AVWB 4IL6H 3AE9C 4B86A 1N8RQ 3Q2YA 2KS1B 1DIPA 1NTZG 3RK3B 3L75D 3SWYA 3VN0A 4EI2A 2ZFCA 5AVXB 1R5LA 2Q7CA 2IBZI 4H0LB 1YQ4C 3V2NA 1OFCX 4D6TE 5AVYB 4UB6E 2C9LY 4EDFA 3HTKB 2RKLA 3L74G 1KD1Q 3HUSB 3CX5H 3T97A 2CK3H 5KJ7C 1FE6A 1KMIZ 1JMBA 1PPJE 4DOJA 4U3FD 1FJKA 3N7NA 1HF9A 1RE3C 3MP7B 3U1AA 4TT3H 1KZUB 1FZCC 1FU1A 1T6AA 1SQQE 3IF4A 1OIPA 3L71D 1KYOH 2K9JA 5APTA 2IPPA 2NPSC 3MD0A 1ZW0A 3CXHD 4Y99B 4WWIA 5APUA 4A7PA 2ZVOB 1ZRTE 2OTLP 3V2PA 5TISH 3KZIE 1J2JB 2E5TA 2KZJA 1LJ2A 3BASA 3AE1C 3H1ID 2W6AA 1IFDA 4N78D 1DD3A 1HUCA 1SLQA 3SFDC 4PD4I 2C0XA 1PPJG 1Q90D 4XA4A 2KP8A 4NPDA 3FWLA 3VMZA 1NTZD 3VOPA 1U57A 1X9VA 5M1BA 3SWFA 1HBWA 4RKUJ 3WUUA 1L0NE 5KLVD 1NAYA 1S72P 3HUSA 3KHUA 3GG2A 1BE3E 3GHGB 2KZIA 2YXQB 2KXPB 3IN6A 2NPSA 5BU8B 2HR3A 2V7QH 3AECC 3FX0A 3L70D 2YKPA 1PP9J 3L71G 5K5GB 2W8ZA 5KLVK 1LTJB 3Q5RA 2AXTE 4H0LC 2W27A 2FYNB 3IFMA 4BXLA 1GDTA 1T8ZA 1NAFA 2KUBA 4GOFA 1G1JA 2AEJA 1YTZI 5AW8B 4L76A 2GM4A 2B87B 1P84H 1Y47A 1S2EA 1E5WA 5KLIC 4H13C 3P8CD 1PP9G 1Y8AA 1LT9B 1FZGA 4I2LC 5KAIH 2BEZF 3U59A 1JEKA 1NU1J 3L75E 3E7KA 3MGNA 1DD4A 3WUTA 2OYIB 1QLED 2HODB 3F89A 4OH8B 5TISE 1M90Q 3KZIH 3B5ND 1NHLA 1VF5D 2O1JA 2R3CA 5GTHH 1AQ5A 2Y9ZA 2WITA 4I1LA 4YXWH 4PV1B 4BWNA 1VF5C 2E75D 3PJSK 2OYOA 3CCVP 3AEGC 2Q5UA 2L5GB 4IFMA 4C7NB 5BU5A 1OMIA 2O01H
chains in the Genus database with same CATH topology
3V2QA 2KYVA 2YNYA 2H8PD 2HG5D 3HUSC 1LTAC 1URQD 5AVSB 1Z56A 2A45G 1LTJA 2Q3IA 4AUWA 4N78E 1LTBC 1NKZB 2JEEA 1NKNA 2FXMA 1GL2D 5CJ0A 2P1JA 1L4AC 3M06A 5APQA 2WWWA 3OJAB 2FFDA 2WSFH 1QL1A 2P7JA 2H7HA 2J59M 2P67A 4EOTA 1FAVA 1JNMA 2N1TD 3HE5B 3GHGA 5APVA 1RE3A 1NTMK 3PP5A 2NPSB 1N7SB 4LC1A 3HD7A 3M0DA 1JO5A 1SFCB 1M1JC 1JCDA 1LTGC 2YO2A 4EIJA 1RE4C 2HFED 3G3ZA 1L4AD 1IFNA 4GIFA 3TK1A 4KHXA 1GL2C 1SFCD 3L36A 3KYQA 3HD7D 3HD7C 1N7SD 1DX7A 1KILC 3M9BA 1LTIC 2WT7B 3NXSA 1L4AB 1VDFA 4M3LA 3MTUE 4GT1A 2OYIA 3E1IA 3EFGA 1ZR4A 5CCGA 1S9KD 1JTHA 1NO4A 3KDPB 4JYCA 1X79B 1JUNA 1IC2A 2N1TC 3P32A 3TNUB 1W2EA 1N73A 2I1JA 3V4QA 2XDJA 2HPCA 1RF0A 2WPQA 2E43A 4HYTB 5BU5A 1WT6A 2HLOA 3RK3D 2R32A 5AVQB 1SP4A 2OYHC 2CPBA 2QM8A 1LTSC 3A3YB 1CI6A 2WPSA 2O1KA 1JMMA 1HVVA 4W7YA 5AVUB 1LT9C 1HWTC 3H32A 3H6PA 1J1DC 3I5CA 1G2CB 1A02F 1FBMA 2OARA 1XTCC 2P2UA 2XKMA 3M91A 2XZRA 5AVTB 1FDMA 2YKQA 2Q9IA 1FZFA 1FZBA 3BRTB 1JY3P 2NPSD 2N1TB 1T3UA 3KPEA 5CCGD 1SQQK 4JF7A 3MUDA 1GTWA 3UIAA 4DZOA 2H43A 3A7OA 1HGVA 1G1IA 1S9KE 2MJZA 2YKOA 1ZLLA 2OYIC 2WT7A 1ZR2A 1KFMA 4W80A 4Y99C 3RL0B 3M9QA 1ZV8A 2HYNA 1KILA 3RK2D 1IK9A 3P8MC 1JCCA 2IFNA 5AVVB 1MUUA 1T2KD 5KJ7A 2WSEH 2LKMA 5AW6B 1IO4A 5AVRB 5CCHD 3RL0D 3L37A 1M1JA 5APWA 2I1KA 3P8CE 3NMDA 2KOGA 2FFDB 4IFDK 1IFJA 1HGZA 2BASA 1KILB 2M8RA 2OYHA 4C7NA 1L0NK 2WZ7A 2M3BA 5AVZB 3VP9A 3RK2C 4RESB 4ZKUA 4WY4C 1N7SA 1RF1C 2WPRA 3TYYA 1SFCA 2E42A 1LWUA 1FJPA 2N1TA 1GD2E 2A45I 1YYCA 3HE4A 4N3YB 2C9NY 3CI9A 1N7SC 5CCGC 1LWUC 5APXA 1RY3A 3II6A 1SFCC 1J1EB 1SQPK 3HE5A 4C7RA 3EQ2A 4WY4A 5KTBA 2Z5HA 1FOSF 1NH4A 1NTKK 2POHA 1H88A 1JY3N 1KFNA 3B8EB 1GL2B 1RE4A 3HD7B 5AW7B 3VYIA 1MZ9A 3VMYA 2FKWB 2IX7C 3HE4B 1JY2P 1X8YA 4W7ZA 3B5NA 1GW4A 3BATA 1N2DC 1N7LA 3GHGC 1XTGB 1M1JB 3M0DC 3A5TA 3M9HA 2YO3A 1GK6A 3WMM0 3RK3C 1AFOA 3V2RA 2FYUK 3CL3D 2J58A 2PAJA 3LIEA 2KLVA 1CZQA 2IFMA 2ZXEB 1FZAA 1URQC 3CLQA 5AW1B 2FFDC 1J1EC 2C0WA 4LLHA 1HJBA 1PFIA 3H32B 3VMXA 5APYA 4GKGA 1GU4A 1SQBK 1G2CA 3L4FA 2QM7A 2R5DA 3KQGA 2FYZA 1IFMA 1LGHB 1OWAA 3LIDA 1N73B 3V4WA 3TNUA 2PP6A 1KILD 1SQVK 3VTPC 1QL2A 3R2PA 2JJLA 2WSCH 3OAKA 1J1DB 4IFFA 1CW5A 4WY4B 3C9IA 1JY3O 3M0AA 1MFZA 3VP8A 2W6BA 3HRNA 2GUSA 1LT9A 5BVZA 2Z4EA 1FZEA 1YTZT 1GW3A 4ZKPA 3OA7A 1IFIA 2WTYA 1RF0C 5AW0B 1ZN5A 1LTTC 1SQXK 3B5NB 1N73C 3RL0C 2OYHB 2KB7P 3N4XA 1DH3A 4I6MC 1T2KC 1URQA 1CSBA 2HODA 2KSJA 3P7KA 4WB4A 4LGDE 5AW2B 5KJ7D 3MIWA 1NWQA 1EQ7A 1DEBA 5AW9B 2XV5A 4AYCA 1JY2N 5AW5B 1L0LK 1FZCA 1A02J 4AQRD 3IR9A 5CJ4A 3B5NC 1VPCA 2A45H 2VRSA 3L35A 2YMYA 1GZLA 4O9BA 5CMZA 3RK2B 1RF1B 3LW5H 3A2AA 3BVHA 2XU6A 2Z5IA 1T3JA 4HH2A 2GUVA 5CCHA 1FOSE 5AW3B 1H89A 4WY4D 1JOCA 1JTHB 3O8ZA 1M7LA 1GK4A 1LWUB 3V5BA 1L4AA 3TSIA 2N9BA 2XNXA 1SVFA 1FZCB 4N6JA 5APSA 4JYBA 1N86A 2R5BA 1IJDB 4C46A 1LTJC 1JY2O 1RF1A 1OXZA 3U1CA 1NU1K 1NTZK 3HTKA 3NFQA 1NOHA 5CCHC 1GU5A 1MV8A 1HH0A 2HPCB 4WBAA 1WRGA 3BRVB 1H8AA 5CHXA 1CI6B 2CPSA 1KQLA 4XE5B 1URQB 3NTNA 1HTLC 1GL2A 5AVWB 4B86A 3RK3B 3VN0A 3SWYA 2ZFCA 5AVXB 2Q7CA 3V2NA 5AVYB 2C9LY 3HTKB 3HUSB 3T97A 5KJ7C 4DOJA 1FJKA 3N7NA 1RE3C 3U1AA 1KZUB 1FZCC 1FU1A 5APTA 2IPPA 2NPSC 3MD0A 4Y99B 5APUA 3V2PA 1J2JB 3BASA 4N78D 5AW4B 2W6AA 1IFDA 1HUCA 1SLQA 2C0XA 4XA4A 2KP8A 3SWFA 3VMZA 3VOPA 1HBWA 1X9VA 3HUSA 3GHGB 2NPSA 5BU8B 2YKPA 5KLVK 1LTJB 2W27A 1GDTA 3IFMA 1T8ZA 1NAFA 5AW8B 1G1JA 1YTZI 2GM4A 1E5WA 3P8CD 1LT9B 1FZGA 4I2LC 3U59A 3MGNA 2OYIB 2HODB 4OH8B 3B5ND 1NHLA 2O1JA 2R3CA 1AQ5A 2WITA 4I1LA 2Q5UA 2L5GB 4IFMA 4C7NB 2O01H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8Z A;  1GK4 A;  2YNY A;  1CZQ A;  3V5B A;  2ZXE B;  5AW1 B;  5AVS B;  3UIA A;  1GTW A;  2N9B A;  4DZO A;  3A7O A;  2Q3I A;  1HJB A;  4AUW A;  5APS A;  3VMX A;  1S9K E;  4JYB A;  5APY A;  2R5B A;  4C46 A;  3M06 A;  2WT7 A;  4GKG A;  5APQ A;  1GU4 A;  2QM7 A;  1OXZ A;  2R5D A;  2WWW A;  3KQG A;  3HTK A;  3NFQ A;  2P7J A;  1GU5 A;  1OWA A;  1MV8 A;  2P67 A;  3LID A;  2H7H A;  3V4W A;  3TNU A;  4EOT A;  1FAV A;  3VTP C;  1JNM A;  3HE5 B;  1H8A A;  3P8M C;  2JJL A;  3OAK A;  5APV A;  1CI6 B;  5AVV B;  4LC1 A;  1MUU A;  1KQL A;  3M0D A;  4XE5 B;  1T2K D;  3M0A A;  3NTN A;  1MFZ A;  5AVW B;  5AW6 B;  2YO2 A;  1IO4 A;  4B86 A;  5AVR B;  3L37 A;  3VN0 A;  2ZFC A;  5AVX B;  5APW A;  2Q7C A;  3NMD A;  3TK1 A;  4KHX A;  5AVY B;  2C9L Y;  3L36 A;  3T97 A;  2BAS A;  3M9B A;  2WT7 B;  2WTY A;  4C7N A;  5AVZ B;  3NXS A;  4RES B;  5APT A;  2IPP A;  5AW0 B;  3MD0 A;  2WPR A;  3TYY A;  4M3L A;  4GT1 A;  5APU A;  2E42 A;  1S9K D;  1H89 A;  1J2J B;  5AW4 B;  2W6A A;  1SLQ A;  1HUC A;  3KDP B;  4I6M C;  1DH3 A;  1GD2 E;  4JYC A;  1YYC A;  3HE4 A;  1T2K C;  2C9N Y;  1JUN A;  2KP8 A;  3SWF A;  3VMZ A;  3TNU B;  3P32 A;  1CSB A;  1HBW A;  3P7K A;  5AW2 B;  3V4Q A;  5APX A;  1NWQ A;  5AW9 B;  2XV5 A;  4AYC A;  3HE5 A;  2WPQ A;  2E43 A;  2Z5H A;  1FOS F;  4HYT B;  1H88 A;  2R32 A;  5AVQ B;  5AW5 B;  1A02 J;  1SP4 A;  4AQR D;  2QM8 A;  3A3Y B;  3B8E B;  2W27 A;  3IR9 A;  1NAF A;  1CI6 A;  5AW8 B;  2WPS A;  5AW7 B;  2VRS A;  3VYI A;  3L35 A;  1HWT C;  1GZL A;  4I2L C;  5AVU B;  3VMY A;  3HE4 B;  1X8Y A;  3MGN A;  5CMZ A;  3I5C A;  1G2C B;  1A02 F;  3A2A A;  2P2U A;  3M91 A;  5AVT B;  2XZR A;  2R3C A;  3A5T A;  2XU6 A;  2Z5I A;  3M9H A;  2YO3 A;  1GK6 A;  2Q5U A;  1FOS E;  4C7N B;  5AW3 B;  3LIE A; 
#chains in the Genus database with same CATH topology
 1S5L X;  3V2Q A;  2E76 D;  3MZW B;  2KYV A;  3SWK A;  2YNY A;  2H8P D;  1U7M A;  4D6T G;  2PRR A;  4KT0 J;  1W5C E;  2HG5 D;  1LTA C;  1URQ D;  2H89 C;  3HUS C;  1PV3 A;  5AVS B;  4ASV A;  1KYO D;  3H25 A;  1VQO P;  1NU1 G;  1VQ4 P;  4H13 D;  1Z56 A;  2A45 G;  1LTJ A;  2Q3I A;  2Y0E A;  1FDI A;  5EFW B;  4AUW A;  1KQG B;  1LTB C;  1NKZ B;  2JEE A;  1NKN A;  2AEM A;  2FXM A;  3ABV C;  1GL2 D;  4N78 E;  5CJ0 A;  3CCQ P;  2P1J A;  1L4A C;  2ZT9 C;  3CXH E;  2E76 B;  3M06 A;  5APQ A;  1VQN P;  4H0L D;  1YHQ P;  2WWW A;  1OX3 A;  2Q6Q A;  1ZXG A;  3OJA B;  4R4L A;  2FFD A;  2WSF H;  1QL1 A;  1SQQ D;  2IYO A;  2J59 M;  2P7J A;  2JWD A;  2P67 A;  2H7H A;  4KJM A;  4EOT A;  3H1J E;  1FAV A;  4R4M A;  1PPJ D;  2N1T D;  1X0T A;  3HE5 B;  3L71 E;  1JNM A;  4NPE A;  3D6Y A;  4PD4 D;  1BDD A;  3GHG A;  1BSH A;  5APV A;  2D2C B;  1RE3 A;  1NTM K;  1RQV A;  3PP5 A;  2V7Q J;  2NPS B;  1N7S B;  1ZOY C;  3AED C;  4LC1 A;  3HD7 A;  3M0D A;  5DJU B;  3JSV C;  3SFE C;  4H44 D;  1JO5 A;  1SFC B;  1SQV D;  3BCC D;  1KN7 A;  1M1J C;  2WSC J;  3S4R A;  1JCD A;  1NU1 D;  1LTG C;  2YO2 A;  2ZXX A;  3L74 E;  2OTK E;  4U3F G;  4WVZ A;  3WU2 H;  1SQQ J;  5KLV G;  3H1I J;  2OQQ A;  4EIJ A;  2Y9Y A;  1RE4 C;  2HFE D;  2WQY C;  3G3Z A;  1BE3 J;  1SQP J;  2O01 N;  3RGU A;  3I56 P;  1L4A D;  1IFN A;  2ZT9 D;  4GIF A;  3TK1 A;  4KHX A;  1GL2 C;  4DT0 A;  4Z1M H;  3CCL P;  1NTK G;  2K3R A;  1SFC D;  2Y0C A;  3L36 A;  3KYQ A;  3CCE P;  3HD7 D;  1HJ0 A;  3CXH I;  1SQB D;  1N7S D;  2QG4 A;  1NTM G;  3HD7 C;  3G4S P;  1DX7 A;  5B66 H;  1KIL C;  3M9B A;  2A06 E;  1LTI C;  2WT7 B;  1NTZ J;  3CXH H;  3L73 D;  3QWO C;  3RK3 E;  3NXS A;  3H1K D;  1BCC E;  2E76 C;  1L4A B;  2ZT9 B;  1VDF A;  1SS1 A;  1NJI Q;  4M3L A;  3MTU E;  1SQV G;  4GT1 A;  2OYI A;  3E1I A;  3EFG A;  1VQK P;  1ZR4 A;  5CCG A;  1S9K D;  4H44 C;  1JTH A;  1NO4 A;  2KS1 A;  3KDP B;  4JYC A;  1NTM E;  1M56 D;  1X79 B;  1ZRT D;  2SPZ A;  2ITA A;  1JUN A;  4RO0 A;  4U7J A;  1IC2 A;  1NTK E;  2N1T C;  3P32 A;  2KLU A;  3TNU B;  1Q86 Q;  1W2E A;  1NVO A;  1N73 A;  2I1J A;  2M0B A;  3V4Q A;  1L0L D;  2H88 C;  2P10 A;  1EZV E;  2QJP B;  3RBZ A;  3OW2 O;  5TJH A;  2XDJ A;  3PHL A;  2HPC A;  3AE8 C;  3CWB D;  1RF0 A;  2WPQ A;  4PV1 D;  3RBX A;  1BCC J;  2E43 A;  3KXD A;  2K9Y A;  3H1K E;  4U3F E;  1SQX G;  1SQB G;  1WT6 A;  2HLO A;  2QE7 H;  4HYT B;  2E75 B;  2R32 A;  4PJ0 E;  5AVQ B;  3RK3 D;  1PGO A;  1SP4 A;  2V4H A;  2OYH C;  4XFJ A;  2CPB A;  2QM8 A;  1LP1 B;  1LTS C;  3EFF K;  1PL5 A;  3A3Y B;  1EXJ A;  1CI6 A;  3FGA D;  2WPS A;  3A0B H;  4H13 B;  3D70 A;  2O1K A;  1SQB J;  1SQP D;  2YIU B;  3H1I G;  1JMM A;  1HVV A;  4W7Y A;  3AEF C;  1LT9 C;  1SQQ G;  5AVU B;  1HWT C;  3H32 A;  2I8D A;  3H6P A;  2R3S A;  4L74 A;  1GMJ A;  1J1D C;  3AE6 C;  3I5C A;  1G2C B;  3H1L D;  1D7M A;  1A02 F;  1FBM A;  2OAR A;  1XTC C;  2P2U A;  2QJP C;  1OVR A;  1BCC G;  2IYP A;  2XKM A;  2RH0 A;  2XZR A;  2B9B A;  2ZYG A;  3M91 A;  5AVT B;  1FDM A;  2KK7 A;  1PGJ A;  2YKQ A;  3AEB C;  2A06 G;  1WMK A;  2Q9I A;  3WUV A;  1FDO A;  1FZF A;  4JQ0 D;  1EZV D;  1FZB A;  4MN4 C;  3BRT B;  1OVU A;  1JY3 P;  2NPS D;  3GF7 A;  2N1T B;  3H1H G;  1T3U A;  1RH5 B;  1SQX D;  3S9O A;  3KPE A;  5CCG D;  1VQ9 P;  1SQQ K;  3PRJ A;  4JF7 A;  1K8A Q;  1OW7 A;  2D2C D;  3MUD A;  5KLV J;  1U7J A;  3UIA A;  1GTW A;  1Q81 Q;  4DZO A;  1AJY A;  1USD A;  2P58 A;  1YIJ P;  2WMM A;  2H43 A;  2NZ2 A;  3CWB J;  3A7O A;  1HGV A;  5KAF E;  1VQL P;  2BCC G;  3A0H E;  1EDI A;  2QJY C;  1G1I A;  1S9K E;  1NTM D;  2MJZ A;  1K05 A;  1KB9 D;  1ZLL A;  2YKO A;  1AQT A;  2FBW C;  2OYI C;  2WT7 A;  3BCC J;  1ZME C;  3CC7 P;  3L72 G;  1ZR2 A;  1KFM A;  4W80 A;  4D6T J;  4Y99 C;  1EDL A;  3GF3 A;  2QJK C;  3RL0 B;  3M9Q A;  4L75 A;  2O01 J;  1ZV8 A;  2A06 D;  2HYN A;  1KIL A;  2ZYD A;  3GMA A;  3H1J G;  3RK2 D;  1IK9 A;  1PP9 E;  1VQP P;  5KKZ C;  3P8M C;  4UB8 E;  1JCC A;  2FXO A;  3CC2 P;  3AEA C;  2IFN A;  1OW8 A;  5AVV B;  3CX5 E;  1MUU A;  4JPZ B;  2FYU D;  1Y9B A;  1T2K D;  4BRY B;  1KQF B;  3MHV A;  5KJ7 A;  1QVF O;  2WSE H;  1RHZ B;  2LKM A;  2PFX A;  5AW6 B;  1QVG O;  1IO4 A;  1FC2 C;  1SQP E;  3BCC E;  5AVR B;  5CCH D;  3RL0 D;  3L37 A;  1NU1 E;  3L75 J;  4K3A A;  3TF5 A;  3CC4 P;  1M1J A;  1EDK A;  5APW A;  2I1K A;  1KV4 A;  4YXD C;  3I55 P;  1L0N G;  3P8C E;  3NMD A;  1S3J A;  1Q2N A;  2G3A A;  3G9R A;  1NGM B;  1UII A;  2KOG A;  1SQV E;  2FFD B;  4IFD K;  1IFJ A;  4I7Z B;  2PGD A;  3A0H H;  1HGZ A;  1L0L J;  2BAS A;  5DJT B;  2M5A B;  1KIL B;  2M8R A;  2OYH A;  1BDC A;  1VQ5 P;  3R4Y A;  4C7N A;  1R8E A;  1L0N K;  2DW3 A;  2WZ7 A;  2M3B A;  2BCC J;  3L70 J;  3L73 J;  5AVZ B;  1VQ8 P;  1L0L E;  2AEF A;  1AA0 A;  2K1A A;  2YMK A;  2FXP A;  4RES B;  3RK2 C;  3VP9 A;  4WY4 C;  4ZKU A;  1N7S A;  4ZNC A;  2AXC A;  3Q1M A;  1RF1 C;  2WPR A;  3TYY A;  1SFC A;  2E42 A;  3CX5 I;  1R5S A;  3W68 A;  3CCU P;  1LWU A;  2G8Y A;  3O6Q B;  1NTM J;  2K88 A;  4GDO A;  1FJP A;  2N1T A;  3GW6 A;  2QIW A;  1H0T B;  1E79 H;  2A45 I;  1GD2 E;  1YYC A;  3HE4 A;  2R44 A;  4N3Y B;  2C9N Y;  3G6E P;  3C1L A;  2LXC B;  4JBZ A;  1NWQ A;  3CI9 A;  1BGY G;  2NRG A;  1N7S C;  1EZV G;  1KYO E;  1P84 E;  1LWU C;  5CCG C;  3SSU A;  1YJN P;  5APX A;  1RY3 A;  3II6 A;  1SFC C;  1J1E B;  1USE A;  1SQP K;  2L91 A;  2ZYA A;  2E74 D;  2FY8 A;  2QVA A;  2ZVN B;  3HE5 A;  3EQ2 A;  3L73 E;  4WY4 A;  5KAI E;  4C7R A;  3RL0 g;  2Z5H A;  5KTB A;  2IZ1 A;  3JCU E;  3L71 J;  1FOS F;  1NH4 A;  1NTK K;  2KIK A;  2POH A;  1H88 A;  1IK7 A;  1YIT P;  1BE3 G;  1JY3 N;  1KB9 I;  1KFN A;  1UIX A;  3B8E B;  3AE3 C;  5GTH E;  1YBK A;  2IZ0 A;  1GL2 B;  5B5E H;  1VL2 A;  3K5B A;  2MKV A;  1RE4 A;  3HD7 B;  5AW7 B;  1KOR A;  3VYI A;  1QX8 A;  1MZ9 A;  3D71 A;  1VQ7 P;  3VMY A;  1SQX J;  2FKW B;  2IX7 C;  3HE4 B;  1JY2 P;  4ZMD A;  1X8Y A;  2WVR A;  4GOD A;  1YJ9 P;  4W7Z A;  3AE5 C;  1M1K Q;  3B5N A;  3L70 G;  1EZV I;  1GW4 A;  1M8O B;  5GTI H;  1OVV A;  3O6Q A;  2AXT H;  1N2D C;  1XTG B;  1N7L A;  3BAT A;  3GHG C;  1YI2 P;  1L0L G;  1M1J B;  3B4S A;  3M0D C;  3TGU J;  3A5T A;  1QGK B;  3JC2 2;  2WSS H;  1GU4 A;  3M9H A;  1K73 Q;  1KQS O;  2YO3 A;  1GK6 A;  4EYY Q;  1VQ6 P;  3WMM 0;  3RK3 C;  1S4X A;  1AFO A;  2IBZ D;  2FYU K;  3V2R A;  3CMA P;  3CL3 D;  1BE3 D;  2J58 A;  2PAJ A;  1L0N D;  3LIE A;  2K37 A;  5KLV E;  1P84 D;  1OW6 A;  2M5A A;  2KLV A;  1CZQ A;  1KC8 Q;  2IFM A;  2ZXE B;  1FZA A;  1URQ C;  2KNC A;  2O3J A;  3CLQ A;  5AW1 B;  1YJW P;  2B88 A;  1J1E C;  3AEE C;  2C0W A;  3JCU H;  4LLH A;  4IOI H;  1NTZ E;  1MFT A;  2JKV A;  1HJB A;  1PFI A;  2QJY B;  3H32 B;  2Q1K A;  3VMX A;  2W6J H;  1KTM A;  5APY A;  2OTJ P;  3MUD C;  4GKG A;  5B5E E;  1SQB K;  4YTP C;  1G2C A;  1S1C X;  2FYN C;  5H2F E;  3L4F A;  2QM7 A;  4RJT A;  2R5D A;  3KQG A;  3WU2 E;  3Q5S A;  2FYZ A;  1L0N J;  2W83 C;  1Q82 Q;  2LXB A;  1X22 A;  1IFM A;  1LGH B;  1OWA A;  1TU3 F;  2IBZ E;  3LID A;  3V6I A;  4DJG A;  3V4W A;  1N73 B;  3TNU A;  2PP6 A;  3FXD A;  5CBN A;  1VF5 B;  1KIL D;  1SQV K;  2ZJS E;  3F5H A;  1QL2 A;  3R2P A;  3VTP C;  5KKZ B;  2JJL A;  5GTI E;  2WSC H;  2D2C C;  3OAK A;  1J1D B;  1ZP0 C;  3L73 G;  4IFF A;  4WY4 B;  5C39 A;  1CW5 A;  3AE2 C;  2B87 A;  3C9I A;  3CCR P;  1JY3 O;  2KSE A;  3M0A A;  1BGY E;  1MFZ A;  3H1L E;  1EC5 A;  1L2P A;  3VP8 A;  2W6B A;  3H1K G;  2BCC E;  2GUS A;  2W90 A;  3HRN A;  4HB1 A;  3W67 A;  2JO1 A;  1DEE G;  1AV1 A;  1BGY J;  1LT9 A;  2M3E A;  5BVZ A;  4HKZ H;  4OWF A;  2Z4E A;  3CCS P;  1FZE A;  1S5L E;  1YTZ T;  3CX5 D;  1GW3 A;  3L72 D;  3L74 J;  3CD6 P;  3H1H E;  4ZKP A;  4IL6 X;  4L73 A;  3PH0 A;  5KLI B;  1K04 A;  2YXR B;  3OA7 A;  5L8R J;  3L70 E;  1IFI A;  2E74 B;  2KI7 B;  2WTY A;  4TLF A;  3L75 G;  3CME P;  1AVO A;  3S1K A;  5H2F H;  2WSE J;  3Q5P A;  1VQM P;  2BEQ D;  3BCC G;  1RF0 C;  3CWB E;  5AW0 B;  3H1L J;  2OGU A;  1ZN5 A;  1LTT C;  2N9Y B;  1EXI A;  1SQX K;  3B5N B;  1N73 C;  1YQ3 C;  1PIX A;  3RL0 C;  2OYH B;  4OVN F;  2KB7 P;  4H44 B;  3N4X A;  1NTK D;  4PJ0 H;  1Q7Y Q;  2YIU C;  4PV1 C;  3H1I E;  1K9M Q;  1DH3 A;  4HJG H;  4I6M C;  3TDK A;  1QEX A;  5B66 E;  2JDI H;  3H1J J;  1T2K C;  1NYH A;  3E1R A;  1URQ A;  3H1H J;  1CSB A;  2HOD A;  2KSJ A;  3A0B E;  3P7K A;  4WB4 A;  3D6Z A;  2JP3 A;  4LGD E;  5AW2 B;  3MIW A;  2GA1 A;  1EQ7 A;  2FYU J;  3AE4 C;  1DEB A;  4I7Z C;  4OGQ B;  5KJ7 D;  5AW9 B;  2XV5 A;  4AYC A;  1SQX E;  3IAO A;  1KB9 H;  2XND H;  1BCC D;  1JY2 N;  2ZAE B;  2UWJ E;  3CPW O;  2E75 C;  1M57 D;  3Q3D A;  5AW5 B;  3H1L G;  1S5L H;  1PGP A;  1L0L K;  2QA4 P;  1FZC A;  1IFP A;  4ASW A;  4AQR D;  1A02 J;  4BRY A;  3IR9 A;  5CJ4 A;  4NPF X;  4D6T D;  3TGU D;  1LNQ A;  3B5N C;  2Y0D A;  4QMA A;  4OGQ D;  3CCJ P;  1RQU A;  3H1H D;  1VPC A;  3L74 D;  2LR2 A;  3L72 E;  2A45 H;  2VRS A;  3L35 A;  3ZDM A;  2E74 C;  3FWN A;  3CCM P;  1PGQ A;  2YMY A;  2K9J B;  1GZL A;  2J5U A;  1FS0 E;  4O9B A;  1BSN A;  2RN0 A;  3T97 B;  3L72 J;  3VMA A;  3ITK A;  2B89 A;  5CMZ A;  2QRX A;  2BCC D;  3RK2 B;  2FYU E;  3PTZ A;  3USS A;  3TGU E;  1RF1 B;  1BGY D;  3CWB G;  3LW5 H;  3A2A A;  1SQV J;  1P84 I;  1JB0 J;  1JM0 A;  5KAF H;  2QJK B;  3BVH A;  5CBO A;  4CPG A;  2XU6 A;  3G71 P;  2Z5I A;  1PP9 D;  1T3J A;  1W2B O;  4GOE A;  4HH2 A;  4PD4 E;  5E79 H;  4IL6 E;  2FFD C;  2QEX P;  2GUV A;  1PZQ A;  5CCH A;  1FOS E;  1SQP G;  1KIL E;  5AW3 B;  3H1J D;  1AVY A;  2Q3E A;  4WY4 D;  1H89 A;  1JOC A;  1JTH B;  3O8Z A;  1M7L A;  3QH9 A;  1GK4 A;  1LWU B;  2WSF J;  3PLN A;  3V5B A;  1NTK J;  1L4A A;  4K35 A;  3TSI A;  3AE7 C;  2JWA A;  1KB9 E;  2N9B A;  4UB6 H;  3TGU G;  3B71 A;  1H0T A;  2FYU G;  2XNX A;  4UB8 H;  1OZH A;  1SVF A;  1FZC B;  4N6J A;  5APS A;  4JYB A;  1N86 A;  1IZN B;  3H1K J;  2R5B A;  1IJD B;  4C46 A;  1LTJ C;  1JY2 O;  1RF1 A;  1OXZ A;  1KYO I;  1NU1 K;  1NTZ K;  3HTK A;  5AW4 B;  3U1C A;  3NFQ A;  1NOH A;  5CCH C;  1GU5 A;  1MV8 A;  1HH0 A;  2IDB A;  4DCK A;  3FXE A;  2HPC B;  4WBA A;  2JR8 A;  1WRG A;  1SQB E;  3BRV B;  3EWK A;  4U3F J;  2IBZ G;  1LT1 A;  5CHX A;  1H8A A;  2RMZ A;  1MKM A;  3C8V A;  1CI6 B;  2WPV B;  2CPS A;  1KQL A;  4XE5 B;  1URQ B;  1LP1 A;  2E5Y A;  2KNC B;  4Y28 J;  3NTN A;  4YPC A;  4OGQ C;  1EDJ A;  1HTL C;  2QSI A;  3LW5 J;  1GL2 A;  3GLM A;  4PD4 H;  5E79 E;  5AVW B;  4IL6 H;  3AE9 C;  4B86 A;  1N8R Q;  3Q2Y A;  2KS1 B;  1DIP A;  1NTZ G;  3RK3 B;  3L75 D;  3SWY A;  3VN0 A;  4EI2 A;  2ZFC A;  5AVX B;  1R5L A;  2Q7C A;  2IBZ I;  4H0L B;  1YQ4 C;  3V2N A;  1OFC X;  4D6T E;  5AVY B;  4UB6 E;  2C9L Y;  4EDF A;  3HTK B;  2RKL A;  3L74 G;  1KD1 Q;  3HUS B;  3CX5 H;  3T97 A;  2CK3 H;  5KJ7 C;  1FE6 A;  1KMI Z;  1JMB A;  1PPJ E;  4DOJ A;  4U3F D;  1FJK A;  3N7N A;  1HF9 A;  1RE3 C;  3MP7 B;  3U1A A;  4TT3 H;  1KZU B;  1FZC C;  1FU1 A;  1T6A A;  1SQQ E;  3IF4 A;  1OIP A;  3L71 D;  1KYO H;  2K9J A;  5APT A;  2IPP A;  2NPS C;  3MD0 A;  1ZW0 A;  3CXH D;  4Y99 B;  4WWI A;  5APU A;  4A7P A;  2ZVO B;  1ZRT E;  2OTL P;  3V2P A;  5TIS H;  3KZI E;  1J2J B;  2E5T A;  2KZJ A;  1LJ2 A;  3BAS A;  3AE1 C;  3H1I D;  2W6A A;  1IFD A;  4N78 D;  1DD3 A;  1HUC A;  1SLQ A;  3SFD C;  4PD4 I;  2C0X A;  1PPJ G;  1Q90 D;  4XA4 A;  2KP8 A;  4NPD A;  3FWL A;  3VMZ A;  1NTZ D;  3VOP A;  1U57 A;  1X9V A;  5M1B A;  3SWF A;  1HBW A;  4RKU J;  3WUU A;  1L0N E;  5KLV D;  1NAY A;  1S72 P;  3HUS A;  3KHU A;  3GG2 A;  1BE3 E;  3GHG B;  2KZI A;  2YXQ B;  2KXP B;  3IN6 A;  2NPS A;  5BU8 B;  2HR3 A;  2V7Q H;  3AEC C;  3FX0 A;  3L70 D;  2YKP A;  1PP9 J;  3L71 G;  5K5G B;  2W8Z A;  5KLV K;  1LTJ B;  3Q5R A;  2AXT E;  4H0L C;  2W27 A;  2FYN B;  3IFM A;  4BXL A;  1GDT A;  1T8Z A;  1NAF A;  2KUB A;  4GOF A;  1G1J A;  2AEJ A;  1YTZ I;  5AW8 B;  4L76 A;  2GM4 A;  2B87 B;  1P84 H;  1Y47 A;  1S2E A;  1E5W A;  5KLI C;  4H13 C;  3P8C D;  1PP9 G;  1Y8A A;  1LT9 B;  1FZG A;  4I2L C;  5KAI H;  2BEZ F;  3U59 A;  1JEK A;  1NU1 J;  3L75 E;  3E7K A;  3MGN A;  1DD4 A;  3WUT A;  2OYI B;  1QLE D;  2HOD B;  3F89 A;  4OH8 B;  5TIS E;  1M90 Q;  3KZI H;  3B5N D;  1NHL A;  1VF5 D;  2O1J A;  2R3C A;  5GTH H;  1AQ5 A;  2Y9Z A;  2WIT A;  4I1L A;  4YXW H;  4PV1 B;  4BWN A;  1VF5 C;  2E75 D;  3PJS K;  2OYO A;  3CCV P;  3AEG C;  2Q5U A;  2L5G B;  4IFM A;  4C7N B;  5BU5 A;  1OMI A;  2O01 H; 
#chains in the Genus database with same CATH homology
 3V2Q A;  2KYV A;  2YNY A;  2H8P D;  2HG5 D;  3HUS C;  1LTA C;  1URQ D;  5AVS B;  1Z56 A;  2A45 G;  1LTJ A;  2Q3I A;  4AUW A;  4N78 E;  1LTB C;  1NKZ B;  2JEE A;  1NKN A;  2FXM A;  1GL2 D;  5CJ0 A;  2P1J A;  1L4A C;  3M06 A;  5APQ A;  2WWW A;  3OJA B;  2FFD A;  2WSF H;  1QL1 A;  2P7J A;  2H7H A;  2J59 M;  2P67 A;  4EOT A;  1FAV A;  1JNM A;  2N1T D;  3HE5 B;  3GHG A;  5APV A;  1RE3 A;  1NTM K;  3PP5 A;  2NPS B;  1N7S B;  4LC1 A;  3HD7 A;  3M0D A;  1JO5 A;  1SFC B;  1M1J C;  1JCD A;  1LTG C;  2YO2 A;  4EIJ A;  1RE4 C;  2HFE D;  3G3Z A;  1L4A D;  1IFN A;  4GIF A;  3TK1 A;  4KHX A;  1GL2 C;  1SFC D;  3L36 A;  3KYQ A;  3HD7 D;  3HD7 C;  1N7S D;  1DX7 A;  1KIL C;  3M9B A;  1LTI C;  2WT7 B;  3NXS A;  1L4A B;  1VDF A;  4M3L A;  3MTU E;  4GT1 A;  2OYI A;  3E1I A;  3EFG A;  1ZR4 A;  5CCG A;  1S9K D;  1JTH A;  1NO4 A;  3KDP B;  4JYC A;  1X79 B;  1JUN A;  1IC2 A;  2N1T C;  3P32 A;  3TNU B;  1W2E A;  1N73 A;  2I1J A;  3V4Q A;  2XDJ A;  2HPC A;  1RF0 A;  2WPQ A;  2E43 A;  4HYT B;  5BU5 A;  1WT6 A;  2HLO A;  3RK3 D;  2R32 A;  5AVQ B;  1SP4 A;  2OYH C;  2CPB A;  2QM8 A;  1LTS C;  3A3Y B;  1CI6 A;  2WPS A;  2O1K A;  1JMM A;  1HVV A;  4W7Y A;  5AVU B;  1LT9 C;  1HWT C;  3H32 A;  3H6P A;  1J1D C;  3I5C A;  1G2C B;  1A02 F;  1FBM A;  2OAR A;  1XTC C;  2P2U A;  2XKM A;  3M91 A;  2XZR A;  5AVT B;  1FDM A;  2YKQ A;  2Q9I A;  1FZF A;  1FZB A;  3BRT B;  1JY3 P;  2NPS D;  2N1T B;  1T3U A;  3KPE A;  5CCG D;  1SQQ K;  4JF7 A;  3MUD A;  1GTW A;  3UIA A;  4DZO A;  2H43 A;  3A7O A;  1HGV A;  1G1I A;  1S9K E;  2MJZ A;  2YKO A;  1ZLL A;  2OYI C;  2WT7 A;  1ZR2 A;  1KFM A;  4W80 A;  4Y99 C;  3RL0 B;  3M9Q A;  1ZV8 A;  2HYN A;  1KIL A;  3RK2 D;  1IK9 A;  3P8M C;  1JCC A;  2IFN A;  5AVV B;  1MUU A;  1T2K D;  5KJ7 A;  2WSE H;  2LKM A;  5AW6 B;  1IO4 A;  5AVR B;  5CCH D;  3RL0 D;  3L37 A;  1M1J A;  5APW A;  2I1K A;  3P8C E;  3NMD A;  2KOG A;  2FFD B;  4IFD K;  1IFJ A;  1HGZ A;  2BAS A;  1KIL B;  2M8R A;  2OYH A;  4C7N A;  1L0N K;  2WZ7 A;  2M3B A;  5AVZ B;  3VP9 A;  3RK2 C;  4RES B;  4ZKU A;  4WY4 C;  1N7S A;  1RF1 C;  2WPR A;  3TYY A;  1SFC A;  2E42 A;  1LWU A;  1FJP A;  2N1T A;  1GD2 E;  2A45 I;  1YYC A;  3HE4 A;  4N3Y B;  2C9N Y;  3CI9 A;  1N7S C;  5CCG C;  1LWU C;  5APX A;  1RY3 A;  3II6 A;  1SFC C;  1J1E B;  1SQP K;  3HE5 A;  4C7R A;  3EQ2 A;  4WY4 A;  5KTB A;  2Z5H A;  1FOS F;  1NH4 A;  1NTK K;  2POH A;  1H88 A;  1JY3 N;  1KFN A;  3B8E B;  1GL2 B;  1RE4 A;  3HD7 B;  5AW7 B;  3VYI A;  1MZ9 A;  3VMY A;  2FKW B;  2IX7 C;  3HE4 B;  1JY2 P;  1X8Y A;  4W7Z A;  3B5N A;  1GW4 A;  3BAT A;  1N2D C;  1N7L A;  3GHG C;  1XTG B;  1M1J B;  3M0D C;  3A5T A;  3M9H A;  2YO3 A;  1GK6 A;  3WMM 0;  3RK3 C;  1AFO A;  3V2R A;  2FYU K;  3CL3 D;  2J58 A;  2PAJ A;  3LIE A;  2KLV A;  1CZQ A;  2IFM A;  2ZXE B;  1FZA A;  1URQ C;  3CLQ A;  5AW1 B;  2FFD C;  1J1E C;  2C0W A;  4LLH A;  1HJB A;  1PFI A;  3H32 B;  3VMX A;  5APY A;  4GKG A;  1GU4 A;  1SQB K;  1G2C A;  3L4F A;  2QM7 A;  2R5D A;  3KQG A;  2FYZ A;  1IFM A;  1LGH B;  1OWA A;  3LID A;  1N73 B;  3V4W A;  3TNU A;  2PP6 A;  1KIL D;  1SQV K;  3VTP C;  1QL2 A;  3R2P A;  2JJL A;  2WSC H;  3OAK A;  1J1D B;  4IFF A;  1CW5 A;  4WY4 B;  3C9I A;  1JY3 O;  3M0A A;  1MFZ A;  3VP8 A;  2W6B A;  3HRN A;  2GUS A;  1LT9 A;  5BVZ A;  2Z4E A;  1FZE A;  1YTZ T;  1GW3 A;  4ZKP A;  3OA7 A;  1IFI A;  2WTY A;  1RF0 C;  5AW0 B;  1ZN5 A;  1LTT C;  1SQX K;  3B5N B;  1N73 C;  3RL0 C;  2OYH B;  2KB7 P;  3N4X A;  1DH3 A;  4I6M C;  1T2K C;  1URQ A;  1CSB A;  2HOD A;  2KSJ A;  3P7K A;  4WB4 A;  4LGD E;  5AW2 B;  5KJ7 D;  3MIW A;  1NWQ A;  1EQ7 A;  1DEB A;  5AW9 B;  2XV5 A;  4AYC A;  1JY2 N;  5AW5 B;  1L0L K;  1FZC A;  1A02 J;  4AQR D;  3IR9 A;  5CJ4 A;  3B5N C;  1VPC A;  2A45 H;  2VRS A;  3L35 A;  2YMY A;  1GZL A;  4O9B A;  5CMZ A;  3RK2 B;  1RF1 B;  3LW5 H;  3A2A A;  3BVH A;  2XU6 A;  2Z5I A;  1T3J A;  4HH2 A;  2GUV A;  5CCH A;  1FOS E;  5AW3 B;  1H89 A;  4WY4 D;  1JOC A;  1JTH B;  3O8Z A;  1M7L A;  1GK4 A;  1LWU B;  3V5B A;  1L4A A;  3TSI A;  2N9B A;  2XNX A;  1SVF A;  1FZC B;  4N6J A;  5APS A;  4JYB A;  1N86 A;  2R5B A;  1IJD B;  4C46 A;  1LTJ C;  1JY2 O;  1RF1 A;  1OXZ A;  3U1C A;  1NU1 K;  1NTZ K;  3HTK A;  3NFQ A;  1NOH A;  5CCH C;  1GU5 A;  1MV8 A;  1HH0 A;  2HPC B;  4WBA A;  1WRG A;  3BRV B;  1H8A A;  5CHX A;  1CI6 B;  2CPS A;  1KQL A;  4XE5 B;  1URQ B;  3NTN A;  1HTL C;  1GL2 A;  5AVW B;  4B86 A;  3RK3 B;  3VN0 A;  3SWY A;  2ZFC A;  5AVX B;  2Q7C A;  3V2N A;  5AVY B;  2C9L Y;  3HTK B;  3HUS B;  3T97 A;  5KJ7 C;  4DOJ A;  1FJK A;  3N7N A;  1RE3 C;  3U1A A;  1KZU B;  1FZC C;  1FU1 A;  5APT A;  2IPP A;  2NPS C;  3MD0 A;  4Y99 B;  5APU A;  3V2P A;  1J2J B;  3BAS A;  4N78 D;  5AW4 B;  2W6A A;  1IFD A;  1HUC A;  1SLQ A;  2C0X A;  4XA4 A;  2KP8 A;  3SWF A;  3VMZ A;  3VOP A;  1HBW A;  1X9V A;  3HUS A;  3GHG B;  2NPS A;  5BU8 B;  2YKP A;  5KLV K;  1LTJ B;  2W27 A;  1GDT A;  3IFM A;  1T8Z A;  1NAF A;  5AW8 B;  1G1J A;  1YTZ I;  2GM4 A;  1E5W A;  3P8C D;  1LT9 B;  1FZG A;  4I2L C;  3U59 A;  3MGN A;  2OYI B;  2HOD B;  4OH8 B;  3B5N D;  1NHL A;  2O1J A;  2R3C A;  1AQ5 A;  2WIT A;  4I1L A;  2Q5U A;  2L5G B;  4IFM A;  4C7N B;  2O01 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...