5APYA

Sequence matkddian inserted between gcn4 adaptors - structure t9(9)
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
62
structure length
62
Chain Sequence
DKVEELLSKVYHLENEVARLKKLMATKDDIANMKQLEDKVEELLSKVYHLENEVARLKKLVG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GENERAL CONTROL PROTEIN GCN4
publication title alpha / beta coiled coils.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Dna binding protein
total genus 26
structure length 62
sequence length 62
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2015-09-17
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5apyA00
2R5DA 3A3YB 3M9BA 1H8AA 3O8ZA 4C7NB 3VTPC 1CZQA 3P7KA 3VMYA 1CSBA 2XU6A 1HJBA 1GK6A 3NFQA 2JJLA 2W27A 2XV5A 2WPSA 3HTKA 1GZLA 5AVQB 4GT1A 3HE5A 3NMDA 2P2UA 2BASA 4AUWA 3UIAA 1GU5A 1MV8A 2KP8A 2N9BA 1A02F 4C46A 3HE4A 1HBWA 3VN0A 3M0DA 1HWTC 4AQRD 3LIEA 3LIDA 2Z5HA 2R32A 5AW7B 1GD2E 2Z5IA 5AVYB 4KHXA 1DH3A 2Q3IA 5AW8B 3SWFA 2YNYA 5APSA 5AW5B 4C7NA 1T2KD 4I2LC 2YO2A 3TNUB 1SP4A 3A5TA 1GTWA 3MGNA 2C9LY 4LC1A 5AW4B 3OAKA 2QM7A 1S9KD 1G2CB 3L35A 1IO4A 1SLQA 3A7OA 5APUA 3MD0A 5APYA 5AVWB 2YO3A 1KQLA 2XZRA 5AW2B 4HYTB 5AVZB 5AVVB 3VMZA 1H88A 1GK4A 1S9KE 1J2JB 2ZFCA 1CI6B 2P67A 2R5BA 3NXSA 1OXZA 3TK1A 3TNUA 3M9HA 2E42A 2WPRA 1GU4A 3I5CA 1T2KC 3NTNA 3TYYA 5AVSB 1HUCA 1NWQA 2W6AA 3M91A 4JYCA 3VMXA 5AVUB 4GKGA 1YYCA 4RESB 5AW0B 1H89A 2H7HA 5APTA 2E43A 4I6MC 5APXA 1MUUA 3L37A 1FAVA 5APQA 1FOSE 2C9NY 3P32A 5AW6B 1CI6A 3IR9A 5AW1B 2Q5UA 1X8YA 2WT7B 3T97A 3A2AA 3L36A 2R3CA 3M0AA 3V4WA 2WWWA 1NAFA 2Q7CA 2VRSA 1A02J 1JNMA 2ZXEB 5APWA 4XE5B 3VYIA 3KQGA 2P7JA 5AVXB 1FOSF 1JUNA 2QM8A 3V5BA 4DZOA 3P8MC 5APVA 4EOTA 5AW3B 3HE5B 3M06A 2WPQA 4JYBA 3KDPB 3V4QA 2WT7A 1MFZA 3HE4B 4AYCA 2WTYA 5CMZA 5AVRB 4B86A 2IPPA 4M3LA 3B8EB 1OWAA 5AVTB 5AW9B
chains in the Genus database with same CATH superfamily
3AE7C 1H8AA 2Y9YA 1FDOA 1HF9A 1SQQD 2W90A 2BASA 1NO4A 4WY4B 1OZHA 5KKZB 3L70D 2YNYA 4I2LC 3A5TA 1GL2B 1PGOA 1OIPA 2YKOA 1FZCA 2J5UA 1VQ5P 3A7OA 4EI2A 2XKMA 1PP9E 5KLVJ 3H1IE 1J2JB 2KUBA 3RK3E 3H1KD 2C0WA 4MN4C 3PP5A 1YHQP 1L2PA 5H2FH 4IFMA 4PV1C 2ITAA 5AW0B 1JEKA 2ZVNB 1SQVG 3CCSP 3R2PA 1YIJP 5GTHE 1HH0A 2OQQA 2W6JH 3C1LA 2E5YA 4GDOA 5K5GB 3G6EP 2B88A 2FYUE 5EFWB 2KSJA 2LKMA 1QLED 1NTKD 3AE5C 1PPJG 2WPQA 4YPCA 1KD1Q 3II6A 1DD3A 3CX5D 3TDKA 3B8EB 1QGKB 3GW6A 2FFDC 3A0BE 3I56P 1KYOI 2XU6A 2JJLA 2A06G 3MHVA 1DEEG 2G8YA 2OTLP 2JWDA 3RL0D 3HE4A 2HPCB 1VDFA 3CPWO 2R32A 2AXTH 1FZBA 2XNDH 2BCCJ 1G2CB 3L73E 1XTCC 4H44C 5C39A 3P8CE 1KQLA 1J1DB 2K1AA 2H88C 1JMMA 3JSVC 2JKVA 1JY3N 3TSIA 4D6TE 2NPSB 1T2KC 2W6AA 1IFJA 2QJPB 3RK2C 5CCHA 2GA1A 1M1JC 1PIXA 4HKZH 3T97A 3CMAP 3M0AA 1HGVA 3EQ2A 5KJ7D 3CWBD 1DIPA 1GW3A 1JTHA 3WMM0 3B5ND 4NPDA 1L0LD 3V5BA 2IFNA 1W2BO 1P84I 1L0ND 3Q5RA 4GOEA 5DJUB 4I7ZB 3V4QA 1BSHA 4DOJA 5AVTB 2N1TD 2J58A 1FJKA 3H32B 3L4FA 1N2DC 2J59M 4IFFA 2KS1A 1AA0A 5GTHH 4JPZB 4C46A 1EQ7A 1YITP 3Q5SA 1N8RQ 4C7NA 4Y28J 1YI2P 1LTSC 2L91A 1SQVJ 3MGNA 1EDKA 2OGUA 3CD6P 3B71A 4PV1B 2OARA 3MD0A 3O6QB 2YO3A 5AW2B 1N7SB 1SQQG 5AVVB 2O1JA 1LTJC 3MTUE 3A0BH 1SQQE 2IX7C 2RMZA 3BASA 1SQPK 1BE3D 2ZYDA 1X9VA 3CLQA 1VQKP 2M5AB 4KJMA 3VMXA 4GKGA 1YYCA 3L70E 5APTA 1KQGB 4PD4D 1L4AB 3L72D 3TF5A 4LGDE 2OYOA 2I1JA 1AFOA 3H1KG 1JNMA 2ZXEB 2IFMA 3FWNA 2FY8A 1T8ZA 3VYIA 1M90Q 2ZVOB 1IFIA 1SVFA 3H1KE 1SFCC 4I1LA 4IOIH 1NU1D 3ABVC 1RE3A 2WT7A 2LXBA 1EZVI 1JY2O 2E74C 3FWLA 1LT9A 4CPGA 2IBZG 1UIIA 2V7QH 4GT1A 4AUWA 3JCUE 4H44B 4KHXA 3CXHH 5GTIE 1IJDB 4H13D 1NTKE 2QG4A 4U3FD 3TNUB 1PP9D 4EDFA 3HD7D 3GF3A 3H1ID 3CX5E 3HUSC 4WY4A 5AVZB 3CCQP 1M1JB 1S9KE 2E42A 1Y47A 3I5CA 3M9QA 1NWQA 2QIWA 1SQXK 3TGUD 1N7LA 1XTGB 3G4SP 3CCEP 1H89A 3Q1MA 2OTKE 4XA4A 1OW7A 2OYHC 2FXPA 3P32A 3Q2YA 3BVHA 1HVVA 1GMJA 3BCCG 2JR8A 3VOPA 1NTZK 2WWWA 1WMKA 3KQGA 2Z4EA 3CI9A 5M1BA 3MZWB 2JDIH 3PJSK 3HE5B 2LR2A 3MUDA 2RN0A 1KB9H 2JWAA 1JB0J 3CC4P 3WUUA 2A45G 1OWAA 2OYIC 5AW9B 5E79E 1SQQJ 4GOFA 3CWBG 1LTBC 3NFQA 1LTGC 1L0LG 2FYNC 1M1KQ 2KP8A 5CBNA 1L0NG 3CWBE 4WVZA 1AV1A 1L0LE 2KSEA 3BATA 5AW8B 1LTJB 1L0NE 3GLMA 1ZR2A 1W5CE 2WSEJ 2M8RA 3HD7C 1RF0C 3ITKA 3RK3C 4L73A 2HPCA 1LP1B 3H1KJ 3ZDMA 1X0TA 1DD4A 5BU5A 1FJPA 1FZFA 2WITA 1VQ9P 2I1KA 1G2CA 1KC8Q 3AE9C 4O9BA 3JCUH 4JYCA 3OJAB 2H7HA 1AVYA 2WPVB 3CXHD 1MUUA 5APQA 1R5SA 3D6YA 2NPSA 2E74B 3CX5H 3S9OA 2IBZI 1BE3G 5KLVK 5BVZA 2BEQD 1M7LA 3G9RA 3LW5J 1BE3E 1BCCD 2SPZA 3L75D 3B4SA 1X22A 1JY2P 4M3LA 2IZ0A 1NHLA 1Y8AA 4OH8B 2ZT9C 3U59A 1AJYA 4PD4E 2D2CD 1KQFB 3L72E 1CSBA 4IFDK 1NTMD 1AQTA 4WB4A 4QMAA 2P1JA 3WUTA 3HUSB 1SQBK 1JCCA 1NU1G 4N6JA 1DH3A 2Q3IA 4L74A 1RE4C 2WMMA 5APSA 1HTLC 3H32A 1ZP0C 1NU1E 3AE2C 1USEA 3E1IA 3BCCJ 3L35A 4I7ZC 1KB9D 5TISH 2OYHB 4PJ0E 5E79H 2H89C 1RQUA 1RHZB 4BRYB 2A45H 4BXLA 4Z1MH 1K05A 2E75D 1Q90D 4U3FG 2Q3EA 1PP9G 1N73C 3O6QA 4K35A 3H1IG 2HG5D 4U3FE 2N9YB 1K04A 1S1CX 3CWBJ 1BSNA 1VQ6P 1L0LJ 1ZLLA 3U1CA 1GDTA 1CW5A 3H1LD 1L0NJ 2OYIB 2Y0EA 2M5AA 2KZIA 4UB6E 3TGUG 1N7SC 1Q82Q 2B87B 2FYNB 1ZMEC 1YQ4C 4NPEA 2WTYA 2FYUG 3TGUE 2HFED 2KLUA 1SQXD 2FFDA 1M8OB 3P7KA 3VMYA 3HD7B 3U1AA 3GHGC 2WQYC 3RK3B 1A02F 1U57A 1L4AC 1EDLA 1Q7YQ 1KILE 2YMYA 2CK3H 1NTZD 1VF5D 1IFDA 2H8PD 2R3SA 2RKLA 2YO2A 1S2EA 1LWUC 2C9LY 1YTZI 3AEGC 3OAKA 5CCHD 1S9KD 2XZRA 3KPEA 1BE3J 3SFDC 3JC22 2B89A 4HJGH 2KYVA 4PD4H 3CCMP 1LGHB 2R5BA 2WSSH 3TNUA 3S4RA 3L73G 1IZNB 2G3AA 2PP6A 1URQA 3IN6A 1K73Q 3FXDA 4H0LD 4D6TG 1M1JA 2C9NY 1SQVK 3SWYA 1PGQA 2KZJA 5KAFH 2ZT9B 3D71A 1NU1J 3SFEC 4ZKUA 1EC5A 4PJ0H 2KOGA 2WSCH 2M3EA 3CC2P 1KTMA 1OX3A 3AE8C 2YKPA 3O8ZA 3KYQA 3CXHE 1P84H 1N86A 2UWJE 3OA7A 3HE5A 2P2UA 1MV8A 1HBWA 4U3FJ 4AQRD 3LIDA 1E5WA 1PP9J 1BCCG 3L75G 2E76D 3H1IJ 3PH0A 5AW5B 1K9MQ 3Q5PA 2QE7H 1NGMB 4UB6H 1BCCE 3L75E 4JQ0D 2WSFH 3PTZA 1OMIA 1SLQA 1N73B 1NTMG 3RL0C 1IFNA 1BDCA 2YXRB 4ZKPA 2O01H 1LTJA 1CI6B 2IDBA 1U7JA 3R4YA 1NTME 3TGUJ 4DJGA 1GU4A 2LXCB 2O01J 3AEEC 4KT0J 2Y9ZA 4XFJA 2FYUJ 1LP1A 3H1HD 3QWOC 1PZQA 4OGQD 1OW8A 1SQBD 1W2EA 3IF4A 1KN7A 5AW1B 3RGUA 2GUSA 2KI7B 3L70G 1KB9E 4W7YA 1BGYD 5CCGA 2K3RA 1FDMA 1SFCA 3GHGB 1T6AA 4JYBA 5CHXA 2IPPA 1S3JA 2YMKA 2AEMA 1YJWP 3H1JD 3USSA 3C9IA 3H1LG 5KJ7C 3D6ZA 1LWUB 1VPCA 3B5NC 3W68A 2W27A 1GZLA 1OVRA 3NMDA 3L73J 3H1LE 3M0DC 2P10A 1KFMA 4JF7A 2E76C 1IK7A 4D6TJ 1EDJA 2N1TC 3V2RA 4ZMDA 2CPBA 3AE6C 1SQXE 1NTKG 3KZIE 1PFIA 3N7NA 2V7QJ 1J1EC 1NTZG 1P84D 4UB8E 1NTZE 2ZYAA 5AVUB 4I6MC 1FZGA 1G1IA 3A0HH 3SSUA 1AQ5A 2ZJSE 3CXHI 3L36A 1NKNA 4EYYQ 2K37A 1GL2A 1JY3O 1BCCJ 2GM4A 3L75J 2QM8A 3E7KA 2WVRA 3AEBC 2RH0A 1Q81Q 3HTKB 1KZUB 1MFZA 4AYCA 2OYIA 3AE1C 1NTMJ 2KB7P 2FYZA 3K5BA 4IL6X 2E5TA 1KILD 1Y9BA 3E1RA 1HJ0A 5DJTB 2HODB 2YIUC 1OFCX 2B87A 1SQVD 2QSIA 4GIFA 3RL0B 2K9JB 1GD2E 5KTBA 3CL3D 2MKVA 3SWFA 5TISE 2IZ1A 4L75A 1FBMA 1Q86Q 4IL6H 3HD7A 2PFXA 4ZNCA 1RF0A 1YJ9P 3H25A 1SS1A 5APYA 5CJ0A 3L70J 1GK4A 2W8ZA 1WRGA 2NPSD 2P67A 4H13C 2A06D 3PHLA 4R4MA 1ZRTE 2JO1A 3G71P 4ASVA 3C8VA 4RESB 3WU2E 1EZVD 1FZEA 2E43A 3H1LJ 3MUDC 1Q2NA 3IR9A 3WUVA 2R3CA 2NZ2A 1QVGO 2XNXA 3V4WA 1S5LE 4TT3H 1VQMP 3KZIH 3B5NB 1JMBA 3H1HG 1FU1A 3N4XA 1SQBG 1NOHA 3H1HE 4RO0A 1KFNA 1SQBE 3A3YB 4UB8H 2E76B 1NTKJ 5TJHA 3AE4C 2FXOA 1CZQA 1KILC 2QJYC 2N1TB 1R5LA 2XV5A 1L0LK 1NTZJ 1YTZT 1NJIQ 1KYOE 1BGYG 2N9BA 1RF1C 1EDIA 2ZAEB 2Z5IA 1SQPD 1RE4A 3L72G 1J1EB 4ASWA 1BGYE 4EIJA 1YJNP 1KV4A 1LJ2A 4WWIA 3CX5I 3H1JG 5AW4B 1OW6A 5APUA 2PRRA 4OGQB 3H1JE 4OVNF 4W7ZA 1EXJA 2Y0DA 2W6BA 3L74D 1HGZA 2R44A 3EFGA 1FS0E 2O1KA 1N73A 5KAFE 5APXA 3AEAC 1R8EA 1CI6A 2JEEA 2QJKC 2Q5UA 3SWKA 4LLHA 5L8RJ 1OVVA 5APWA 1JY3P 1JM0A 2P7JA 4DZOA 4HB1A 1N7SA 2YIUB 4EOTA 1JOCA 1P84E 3V6IA 1ZW0A 4YXWH 1S5LX 4R4LA 2A45I 1QX8A 1E79H 3WU2H 1IFPA 2QA4P 4H44D 2WPSA 4A7PA 3GHGA 1RY3A 1FZAA 2KIKA 1L4AA 3OW2O 1S72P 5B5EE 3QH9A 1NU1K 5AVYB 1S5LH 2ZXXA 1MFTA 1T2KD 3KHUA 1FC2C 1LWUA 4H13B 1URQD 2ZYGA 3RK2D 1S4XA 2D2CC 1FZCC 3CMEP 3L71D 2AXCA 2B9BA 1LTTC 3NXSA 2IBZD 3H1HJ 1SQVE 3FX0A 4L76A 3NTNA 1SQBJ 2Y0CA 2Q6QA 4RKUJ 1KYOH 2AEJA 3W67A 4RJTA 1VQLP 3V2NA 3GF7A 2POHA 1JY2N 3I55P 5AW6B 3AEDC 1T3UA 1PPJE 3IAOA 1BGYJ 1NYHA 1A02J 1QL1A 1KQSO 1IFMA 2E75C 4XE5B 5AVXB 4DT0A 1MKMA 3L72J 1KILB 2QJYB 3P8MC 5AW3B 3M06A 1EZVG 3H1JJ 2A06E 2FYUK 1RF1B 2OTJP 4PD4I 1IC2A 2R5DA 3RBXA 3CCVP 1EZVE 1HJBA 3HTKA 3BCCD 4JBZA 1ZV8A 5AW7B 1NKZB 1JO5A 2CPSA 1VQPP 2WSCJ 1GTWA 2KNCB 2KLVA 2HODA 1URQC 1ZN5A 2QEXP 1IO4A 3PLNA 5AVWB 1LT1A 2K9JA 2PGDA 1VQ7P 3VMZA 1ZRTD 1M57D 1NAYA 5CBOA 1OXZA 2QJKB 3TK1A 1VF5C 3M9HA 2MJZA 1SQPG 5KLVD 3A0HE 5B5EH 5CCGD 5CCHC 2IYPA 1SFCD 1SQPE 3BRVB 1H0TB 3CCUP 1FOSE 3G3ZA 4U7JA 2DW3A 2WSFJ 2E74D 1D7MA 3VP9A 3L74G 1G1JA 5KAIE 3FGAD 1PL5A 3L74E 3CCJP 4H0LC 3IFMA 3H6PA 1KYOD 3M9BA 1USDA 2FBWC 3VTPC 5KJ7A 3B5NA 1KMIZ 2D2CB 2H43A 1FZCB 4N78D 4IL6E 3UIAA 1GU5A 3M0DA 3AE3C 2V4HA 3S1KA 2N1TA 2O3JA 2AEFA 2QM7A 2XDJA 4WY4D 1NTMK 1LTAC 4HYTB 2I8DA 2BCCD 2GUVA 4WBAA 3BRTB 2ZFCA 4Y99C 1FDIA 1GL2D 4K3AA 2M0BA 5AVSB 1JCDA 2FFDB 1RQVA 3PRJA 1SQXG 2E75B 1WT6A 1YBKA 3GMAA 5CCGC 1TU3F 1VL2A 1VQ8P 3HUSA 3L37A 1SQQK 1FAVA 3L71G 3CCLP 2Q9IA 3AEFC 2KK7A 5KLIC 2M3BA 3L71E 2VRSA 2KXPB 2FXMA 1FOSF 2IBZE 1IK9A 1BDDA 4OGQC 1ZXGA 1ZOYC 3RL0g 2OYHA 2HR3A 3KDPB 1RE3C 3HE4B 2P58A 4BRYA 1LT9C 4NPFX 3V2PA 2JP3A 1GK6A 3RK3D 1URQB 3RK2B 1DX7A 3Q3DA 2HLOA 1SQPJ 1U7MA 2O01N 1HWTC 4OWFA 3GG2A 1RH5B 3EWKA 3CC7P 5B66E 1VF5B 5BU8B 5KAIH 2C0XA 1YQ3C 3MIWA 2PAJA 2IYOA 1M56D 1VQNP 4WY4C 3F89A 2FYUD 3L74J 1NTKK 3F5HA 3HRNA 3FXEA 4W80A 5KKZC 2BEZF 1MZ9A 3T97B 1GL2C 3D70A 1NH4A 2NRGA 3BCCE 1JTHB 3M91A 4YTPC 1PPJD 3VMAA 4YXDC 2W83C 4H0LB 1QVFO 1LTIC 1PGPA 1KB9I 2ZT9D 1PV3A 2FKWB 5KLVG 1NVOA 1JUNA 3EFFK 1FE6A 2KS1B 4BWNA 1OVUA 2L5GB 3RBZA 5KLVE 4DCKA 4B86A 2WSEH 3L73D 1Z56A 1VQOP 3P8CD 4C7NB 1EXIA 1KILA 4TLFA 4D6TD 5AVQB 4N3YB 5H2FE 1DEBA 3VN0A 3LIEA 1RF1A 2Z5HA 1SQXJ 1QEXA 3V2QA 1KORA 4Y99B 1SP4A 3L71J 4LC1A 2YXQB 2K9YA 2K88A 1UIXA 5GTIH 1SFCB 3MP7B 2WZ7A 1L0NK 3VP8A 1H88A 2YKQA 5CJ4A 2HYNA 1QL2A 4C7RA 2WPRA 2KNCA 4N78E 5KLIB 3TYYA 1HUCA 3LW5H 4PV1D 1AVOA 1N7SD 1J1DC 1T3JA 1ZR4A 2QVAA 1LNQA 5B66H 2BCCG 1X8YA 2WT7B 3A2AA 2NPSC 3CCRP 1PGJA 2AXTE 1NAFA 1VQ4P 2Q7CA 1K8AQ 1LT9B 2BCCE 2QJPC 1H0TA 1GW4A 4HH2A 5APVA 1L4AD 3AECC 4GODA 1X79B 3KXDA 2QRXA 5CMZA 5AVRB 2Q1KA
chains in the Genus database with same CATH topology
2R5DA 1H8AA 3C9IA 5KJ7C 1LWUB 1VPCA 1HJBA 1LTBC 3B5NC 3NFQA 2W27A 1LTGC 3HTKA 1GZLA 3NMDA 2BASA 1NO4A 2KP8A 3M0DC 4WY4B 1ZV8A 5AW7B 1NKZB 1JO5A 2CPSA 3BATA 5AW8B 1KFMA 1LTJB 4JF7A 2YNYA 4I2LC 3A5TA 1GTWA 1ZR2A 1GL2B 2N1TC 2KLVA 2HODA 2M8RA 2YKOA 3HD7C 1URQC 3V2RA 1RF0C 2CPBA 1FZCA 1ZN5A 1IO4A 3RK3C 3A7OA 2HPCA 5AVWB 2XKMA 1PFIA 3N7NA 3VMZA 1J1EC 1J2JB 1FJPA 5BU5A 1OXZA 3TK1A 1FZFA 2WITA 3M9HA 2MJZA 2C0WA 2I1KA 3PP5A 1G2CA 4IFMA 4O9BA 4JYCA 5CCGD 5CCHC 3BRVB 1SFCD 5AVUB 3OJAB 2H7HA 5AW0B 4I6MC 1FZGA 1MUUA 5APQA 1G1IA 1FOSE 3G3ZA 3R2PA 1HH0A 1AQ5A 2NPSA 3L36A 1NKNA 3VP9A 1GL2A 1JY3O 1G1JA 2KSJA 5KLVK 2GM4A 2LKMA 2QM8A 5BVZA 1M7LA 3HTKB 2WPQA 3II6A 1KZUB 1MFZA 4AYCA 1JY2P 3IFMA 4M3LA 3B8EB 2OYIA 1NHLA 4OH8B 3H6PA 2KB7P 3M9BA 2FYZA 3U59A 2FFDC 3VTPC 5KJ7A 1KILD 1CSBA 2XU6A 3B5NA 2JJLA 4IFDK 2HODB 2H43A 4GIFA 3RL0D 1FZCB 4N78D 3UIAA 1GU5A 4WB4A 2P1JA 3HE4A 2HPCB 1VDFA 3HUSB 3M0DA 3RL0B 1SQBK 1JCCA 4N6JA 2R32A 1GD2E 5KTBA 1DH3A 2Q3IA 3CL3D 1RE4C 3SWFA 5APSA 1HTLC 1FZBA 3H32A 1FBMA 2N1TA 3HD7A 3E1IA 1RF0A 2QM7A 1G2CB 3L35A 2XDJA 1XTCC 4WY4D 5APYA 3P8CE 1KQLA 1J1DB 1NTMK 5CJ0A 1LTAC 4HYTB 1JMMA 2GUVA 2OYHB 4WBAA 3BRTB 1GK4A 1WRGA 2ZFCA 2NPSD 2P67A 1JY3N 3TSIA 4Y99C 1GL2D 2A45H 2NPSB 1T2KC 5AVSB 1JCDA 2FFDB 1WT6A 2W6AA 1IFJA 3RK2C 1N73C 5CCHA 5CCGC 4RESB 2HG5D 1FZEA 2E43A 3HUSA 3L37A 1M1JC 1FAVA 1SQQK 2Q9IA 3IR9A 3T97A 1ZLLA 2M3BA 2R3CA 3U1CA 1GDTA 2XNXA 3M0AA 3V4WA 1CW5A 1HGVA 3EQ2A 2VRSA 2OYIB 5KJ7D 1GW3A 1JTHA 3WMM0 3B5ND 2FXMA 1FOSF 3V5BA 2IFNA 3B5NB 1IK9A 1N7SC 1FU1A 3N4XA 2OYHA 3KDPB 1RE3C 3V4QA 3HE4B 2WTYA 1NOHA 2HFED 4DOJA 1KFNA 5AVTB 1LT9C 3A3YB 2N1TD 2J58A 1FJKA 3H32B 2FFDA 3V2PA 1CZQA 3P7KA 1KILC 3L4FA 1N2DC 2N1TB 3VMYA 1GK6A 2J59M 4IFFA 3RK3D 3HD7B 1URQB 2XV5A 3U1AA 3RK2B 1L0LK 1YTZT 1DX7A 2HLOA 3GHGC 2N9BA 3RK3B 1A02F 1L4AC 4C46A 1HWTC 1EQ7A 1RF1C 2YMYA 2Z5IA 1IFDA 1RE4A 2H8PD 1J1EB 4C7NA 4EIJA 2YO2A 1LTSC 5BU8B 2C0XA 3MGNA 1LWUC 2C9LY 1YTZI 5AW4B 3OAKA 3MIWA 5CCHD 1S9KD 2OARA 2PAJA 5APUA 3MD0A 2YO3A 4WY4C 2XZRA 1N7SB 3KPEA 5AW2B 5AVVB 2O1JA 1NTKK 3HRNA 4W80A 1LTJC 2KYVA 4W7ZA 1LGHB 2R5BA 3TNUA 3MTUE 2W6BA 2IX7C 1MZ9A 3BASA 1GL2C 1HGZA 1SQPK 3EFGA 1NH4A 2PP6A 1X9VA 3CLQA 2O1KA 1URQA 1N73A 1JTHB 3M91A 3VMXA 4GKGA 1YYCA 5APTA 5APXA 1M1JA 2C9NY 1L4AB 1SQVK 1CI6A 2JEEA 3SWYA 2Q5UA 4LLHA 4LGDE 1LTIC 2I1JA 1AFOA 2FKWB 1JNMA 2ZXEB 5APWA 1JY3P 2IFMA 1T8ZA 3VYIA 2P7JA 1JUNA 4ZKUA 4DZOA 1IFIA 1SVFA 1N7SA 1SFCC 4I1LA 4EOTA 2KOGA 2L5GB 1JOCA 1RE3A 2WSCH 2WT7A 4B86A 2WSEH 1JY2O 1Z56A 3P8CD 1LT9A 2YKPA 2A45I 3O8ZA 4C7NB 3KYQA 1KILA 1N86A 3OA7A 2WPSA 5AVQB 4GT1A 3HE5A 4N3YB 3GHGA 1RY3A 2P2UA 4AUWA 1FZAA 1MV8A 1DEBA 1L4AA 1HBWA 3VN0A 4AQRD 3LIEA 3LIDA 1RF1A 1E5WA 2Z5HA 1NU1K 5AVYB 4KHXA 1IJDB 3V2QA 5AW5B 1T2KD 3TNUB 4Y99B 1SP4A 1LWUA 3HD7D 4LC1A 1URQD 3RK2D 1FZCC 2WSFH 1SLQA 1N73B 3HUSC 4WY4A 3RL0C 1SFCB 1IFNA 5AVZB 2WZ7A 1L0NK 3VP8A 1H88A 1M1JB 4ZKPA 2O01H 1LTJA 1LTTC 2YKQA 1S9KE 1CI6B 3NXSA 5CJ4A 2HYNA 1QL2A 2E42A 2WPRA 4C7RA 1GU4A 3I5CA 3M9QA 4N78E 3NTNA 3TYYA 1HUCA 3LW5H 1NWQA 1SQXK 1N7LA 3V2NA 1XTGB 1N7SD 1J1DC 1H89A 1T3JA 1W2EA 1ZR4A 4XA4A 2POHA 2OYHC 1JY2N 3P32A 5AW6B 3BVHA 5AW1B 1HVVA 1X8YA 2WT7B 2GUSA 3A2AA 2NPSC 1T3UA 3VOPA 1NTZK 2WWWA 1NAFA 2Q7CA 1A02J 1QL1A 1IFMA 1LT9B 4XE5B 4W7YA 3KQGA 5AVXB 2Z4EA 3CI9A 1GW4A 4HH2A 1KILB 3P8MC 5CCGA 1FDMA 5APVA 1L4AD 1SFCA 5AW3B 3HE5B 3M06A 3GHGB 1X79B 4JYBA 5CHXA 3MUDA 5CMZA 5AVRB 2FYUK 2IPPA 1RF1B 2A45G 1OWAA 1IC2A 2OYIC 5AW9B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5D A;  3A3Y B;  3M9B A;  1H8A A;  3O8Z A;  4C7N B;  3VTP C;  1CZQ A;  3P7K A;  3VMY A;  1CSB A;  2XU6 A;  1HJB A;  1GK6 A;  3NFQ A;  2JJL A;  2W27 A;  2XV5 A;  2WPS A;  3HTK A;  1GZL A;  5AVQ B;  4GT1 A;  3HE5 A;  3NMD A;  2P2U A;  2BAS A;  4AUW A;  3UIA A;  1GU5 A;  1MV8 A;  2KP8 A;  2N9B A;  1A02 F;  4C46 A;  3HE4 A;  1HBW A;  3VN0 A;  3M0D A;  1HWT C;  4AQR D;  3LIE A;  3LID A;  2Z5H A;  2R32 A;  5AW7 B;  1GD2 E;  2Z5I A;  5AVY B;  4KHX A;  1DH3 A;  2Q3I A;  5AW8 B;  3SWF A;  2YNY A;  5APS A;  5AW5 B;  4C7N A;  1T2K D;  4I2L C;  2YO2 A;  3TNU B;  1SP4 A;  3A5T A;  1GTW A;  3MGN A;  2C9L Y;  4LC1 A;  5AW4 B;  3OAK A;  2QM7 A;  1S9K D;  1G2C B;  3L35 A;  1IO4 A;  1SLQ A;  3A7O A;  5APU A;  3MD0 A;  5APY A;  5AVW B;  2YO3 A;  1KQL A;  2XZR A;  5AW2 B;  4HYT B;  5AVZ B;  5AVV B;  3VMZ A;  1H88 A;  1GK4 A;  1S9K E;  1J2J B;  2ZFC A;  1CI6 B;  2P67 A;  2R5B A;  3NXS A;  1OXZ A;  3TK1 A;  3TNU A;  3M9H A;  2E42 A;  2WPR A;  1GU4 A;  3I5C A;  1T2K C;  3NTN A;  3TYY A;  5AVS B;  1HUC A;  1NWQ A;  2W6A A;  3M91 A;  4JYC A;  3VMX A;  5AVU B;  4GKG A;  1YYC A;  4RES B;  5AW0 B;  1H89 A;  2H7H A;  5APT A;  2E43 A;  4I6M C;  5APX A;  1MUU A;  3L37 A;  1FAV A;  5APQ A;  1FOS E;  2C9N Y;  3P32 A;  5AW6 B;  1CI6 A;  3IR9 A;  5AW1 B;  2Q5U A;  1X8Y A;  2WT7 B;  3T97 A;  3A2A A;  3L36 A;  2R3C A;  3M0A A;  3V4W A;  2WWW A;  1NAF A;  2Q7C A;  2VRS A;  1A02 J;  1JNM A;  2ZXE B;  5APW A;  4XE5 B;  3VYI A;  3KQG A;  2P7J A;  5AVX B;  1FOS F;  1JUN A;  2QM8 A;  3V5B A;  4DZO A;  3P8M C;  5APV A;  4EOT A;  5AW3 B;  3HE5 B;  3M06 A;  2WPQ A;  4JYB A;  3KDP B;  3V4Q A;  2WT7 A;  1MFZ A;  3HE4 B;  4AYC A;  2WTY A;  5CMZ A;  5AVR B;  4B86 A;  2IPP A;  4M3L A;  3B8E B;  1OWA A;  5AVT B;  5AW9 B; 
#chains in the Genus database with same CATH topology
 3AE7 C;  1H8A A;  2Y9Y A;  1FDO A;  1HF9 A;  1SQQ D;  2W90 A;  2BAS A;  1NO4 A;  4WY4 B;  1OZH A;  5KKZ B;  3L70 D;  2YNY A;  4I2L C;  3A5T A;  1GL2 B;  1PGO A;  1OIP A;  2YKO A;  1FZC A;  2J5U A;  1VQ5 P;  3A7O A;  4EI2 A;  2XKM A;  1PP9 E;  5KLV J;  3H1I E;  1J2J B;  2KUB A;  3RK3 E;  3H1K D;  2C0W A;  4MN4 C;  3PP5 A;  1YHQ P;  1L2P A;  5H2F H;  4IFM A;  4PV1 C;  2ITA A;  5AW0 B;  1JEK A;  2ZVN B;  1SQV G;  3CCS P;  3R2P A;  1YIJ P;  5GTH E;  1HH0 A;  2OQQ A;  2W6J H;  3C1L A;  2E5Y A;  4GDO A;  5K5G B;  3G6E P;  2B88 A;  2FYU E;  5EFW B;  2KSJ A;  2LKM A;  1QLE D;  1NTK D;  3AE5 C;  1PPJ G;  2WPQ A;  4YPC A;  1KD1 Q;  3II6 A;  1DD3 A;  3CX5 D;  3TDK A;  3B8E B;  1QGK B;  3GW6 A;  2FFD C;  3A0B E;  3I56 P;  1KYO I;  2XU6 A;  2JJL A;  2A06 G;  3MHV A;  1DEE G;  2G8Y A;  2OTL P;  2JWD A;  3RL0 D;  3HE4 A;  2HPC B;  1VDF A;  3CPW O;  2R32 A;  2AXT H;  1FZB A;  2XND H;  2BCC J;  1G2C B;  3L73 E;  1XTC C;  4H44 C;  5C39 A;  3P8C E;  1KQL A;  1J1D B;  2K1A A;  2H88 C;  1JMM A;  3JSV C;  2JKV A;  1JY3 N;  3TSI A;  4D6T E;  2NPS B;  1T2K C;  2W6A A;  1IFJ A;  2QJP B;  3RK2 C;  5CCH A;  2GA1 A;  1M1J C;  1PIX A;  4HKZ H;  3T97 A;  3CMA P;  3M0A A;  1HGV A;  3EQ2 A;  5KJ7 D;  3CWB D;  1DIP A;  1GW3 A;  1JTH A;  3WMM 0;  3B5N D;  4NPD A;  1L0L D;  3V5B A;  2IFN A;  1W2B O;  1P84 I;  1L0N D;  3Q5R A;  4GOE A;  5DJU B;  4I7Z B;  3V4Q A;  1BSH A;  4DOJ A;  5AVT B;  2N1T D;  2J58 A;  1FJK A;  3H32 B;  3L4F A;  1N2D C;  2J59 M;  4IFF A;  2KS1 A;  1AA0 A;  5GTH H;  4JPZ B;  4C46 A;  1EQ7 A;  1YIT P;  3Q5S A;  1N8R Q;  4C7N A;  4Y28 J;  1YI2 P;  1LTS C;  2L91 A;  1SQV J;  3MGN A;  1EDK A;  2OGU A;  3CD6 P;  3B71 A;  4PV1 B;  2OAR A;  3MD0 A;  3O6Q B;  2YO3 A;  5AW2 B;  1N7S B;  1SQQ G;  5AVV B;  2O1J A;  1LTJ C;  3MTU E;  3A0B H;  1SQQ E;  2IX7 C;  2RMZ A;  3BAS A;  1SQP K;  1BE3 D;  2ZYD A;  1X9V A;  3CLQ A;  1VQK P;  2M5A B;  4KJM A;  3VMX A;  4GKG A;  1YYC A;  3L70 E;  5APT A;  1KQG B;  4PD4 D;  1L4A B;  3L72 D;  3TF5 A;  4LGD E;  2OYO A;  2I1J A;  1AFO A;  3H1K G;  1JNM A;  2ZXE B;  2IFM A;  3FWN A;  2FY8 A;  1T8Z A;  3VYI A;  1M90 Q;  2ZVO B;  1IFI A;  1SVF A;  3H1K E;  1SFC C;  4I1L A;  4IOI H;  1NU1 D;  3ABV C;  1RE3 A;  2WT7 A;  2LXB A;  1EZV I;  1JY2 O;  2E74 C;  3FWL A;  1LT9 A;  4CPG A;  2IBZ G;  1UII A;  2V7Q H;  4GT1 A;  4AUW A;  3JCU E;  4H44 B;  4KHX A;  3CXH H;  5GTI E;  1IJD B;  4H13 D;  1NTK E;  2QG4 A;  4U3F D;  3TNU B;  1PP9 D;  4EDF A;  3HD7 D;  3GF3 A;  3H1I D;  3CX5 E;  3HUS C;  4WY4 A;  5AVZ B;  3CCQ P;  1M1J B;  1S9K E;  2E42 A;  1Y47 A;  3I5C A;  3M9Q A;  1NWQ A;  2QIW A;  1SQX K;  3TGU D;  1N7L A;  1XTG B;  3G4S P;  3CCE P;  1H89 A;  3Q1M A;  2OTK E;  4XA4 A;  1OW7 A;  2OYH C;  2FXP A;  3P32 A;  3Q2Y A;  3BVH A;  1HVV A;  1GMJ A;  3BCC G;  2JR8 A;  3VOP A;  1NTZ K;  2WWW A;  1WMK A;  3KQG A;  2Z4E A;  3CI9 A;  5M1B A;  3MZW B;  2JDI H;  3PJS K;  3HE5 B;  2LR2 A;  3MUD A;  2RN0 A;  1KB9 H;  2JWA A;  1JB0 J;  3CC4 P;  3WUU A;  2A45 G;  1OWA A;  2OYI C;  5AW9 B;  5E79 E;  1SQQ J;  4GOF A;  3CWB G;  1LTB C;  3NFQ A;  1LTG C;  1L0L G;  2FYN C;  1M1K Q;  2KP8 A;  5CBN A;  1L0N G;  3CWB E;  4WVZ A;  1AV1 A;  1L0L E;  2KSE A;  3BAT A;  5AW8 B;  1LTJ B;  1L0N E;  3GLM A;  1ZR2 A;  1W5C E;  2WSE J;  2M8R A;  3HD7 C;  1RF0 C;  3ITK A;  3RK3 C;  4L73 A;  2HPC A;  1LP1 B;  3H1K J;  3ZDM A;  1X0T A;  1DD4 A;  5BU5 A;  1FJP A;  1FZF A;  2WIT A;  1VQ9 P;  2I1K A;  1G2C A;  1KC8 Q;  3AE9 C;  4O9B A;  3JCU H;  4JYC A;  3OJA B;  2H7H A;  1AVY A;  2WPV B;  3CXH D;  1MUU A;  5APQ A;  1R5S A;  3D6Y A;  2NPS A;  2E74 B;  3CX5 H;  3S9O A;  2IBZ I;  1BE3 G;  5KLV K;  5BVZ A;  2BEQ D;  1M7L A;  3G9R A;  3LW5 J;  1BE3 E;  1BCC D;  2SPZ A;  3L75 D;  3B4S A;  1X22 A;  1JY2 P;  4M3L A;  2IZ0 A;  1NHL A;  1Y8A A;  4OH8 B;  2ZT9 C;  3U59 A;  1AJY A;  4PD4 E;  2D2C D;  1KQF B;  3L72 E;  1CSB A;  4IFD K;  1NTM D;  1AQT A;  4WB4 A;  4QMA A;  2P1J A;  3WUT A;  3HUS B;  1SQB K;  1JCC A;  1NU1 G;  4N6J A;  1DH3 A;  2Q3I A;  4L74 A;  1RE4 C;  2WMM A;  5APS A;  1HTL C;  3H32 A;  1ZP0 C;  1NU1 E;  3AE2 C;  1USE A;  3E1I A;  3BCC J;  3L35 A;  4I7Z C;  1KB9 D;  5TIS H;  2OYH B;  4PJ0 E;  5E79 H;  2H89 C;  1RQU A;  1RHZ B;  4BRY B;  2A45 H;  4BXL A;  4Z1M H;  1K05 A;  2E75 D;  1Q90 D;  4U3F G;  2Q3E A;  1PP9 G;  1N73 C;  3O6Q A;  4K35 A;  3H1I G;  2HG5 D;  4U3F E;  2N9Y B;  1K04 A;  1S1C X;  3CWB J;  1BSN A;  1VQ6 P;  1L0L J;  1ZLL A;  3U1C A;  1GDT A;  1CW5 A;  3H1L D;  1L0N J;  2OYI B;  2Y0E A;  2M5A A;  2KZI A;  4UB6 E;  3TGU G;  1N7S C;  1Q82 Q;  2B87 B;  2FYN B;  1ZME C;  1YQ4 C;  4NPE A;  2WTY A;  2FYU G;  3TGU E;  2HFE D;  2KLU A;  1SQX D;  2FFD A;  1M8O B;  3P7K A;  3VMY A;  3HD7 B;  3U1A A;  3GHG C;  2WQY C;  3RK3 B;  1A02 F;  1U57 A;  1L4A C;  1EDL A;  1Q7Y Q;  1KIL E;  2YMY A;  2CK3 H;  1NTZ D;  1VF5 D;  1IFD A;  2H8P D;  2R3S A;  2RKL A;  2YO2 A;  1S2E A;  1LWU C;  2C9L Y;  1YTZ I;  3AEG C;  3OAK A;  5CCH D;  1S9K D;  2XZR A;  3KPE A;  1BE3 J;  3SFD C;  3JC2 2;  2B89 A;  4HJG H;  2KYV A;  4PD4 H;  3CCM P;  1LGH B;  2R5B A;  2WSS H;  3TNU A;  3S4R A;  3L73 G;  1IZN B;  2G3A A;  2PP6 A;  1URQ A;  3IN6 A;  1K73 Q;  3FXD A;  4H0L D;  4D6T G;  1M1J A;  2C9N Y;  1SQV K;  3SWY A;  1PGQ A;  2KZJ A;  5KAF H;  2ZT9 B;  3D71 A;  1NU1 J;  3SFE C;  4ZKU A;  1EC5 A;  4PJ0 H;  2KOG A;  2WSC H;  2M3E A;  3CC2 P;  1KTM A;  1OX3 A;  3AE8 C;  2YKP A;  3O8Z A;  3KYQ A;  3CXH E;  1P84 H;  1N86 A;  2UWJ E;  3OA7 A;  3HE5 A;  2P2U A;  1MV8 A;  1HBW A;  4U3F J;  4AQR D;  3LID A;  1E5W A;  1PP9 J;  1BCC G;  3L75 G;  2E76 D;  3H1I J;  3PH0 A;  5AW5 B;  1K9M Q;  3Q5P A;  2QE7 H;  1NGM B;  4UB6 H;  1BCC E;  3L75 E;  4JQ0 D;  2WSF H;  3PTZ A;  1OMI A;  1SLQ A;  1N73 B;  1NTM G;  3RL0 C;  1IFN A;  1BDC A;  2YXR B;  4ZKP A;  2O01 H;  1LTJ A;  1CI6 B;  2IDB A;  1U7J A;  3R4Y A;  1NTM E;  3TGU J;  4DJG A;  1GU4 A;  2LXC B;  2O01 J;  3AEE C;  4KT0 J;  2Y9Z A;  4XFJ A;  2FYU J;  1LP1 A;  3H1H D;  3QWO C;  1PZQ A;  4OGQ D;  1OW8 A;  1SQB D;  1W2E A;  3IF4 A;  1KN7 A;  5AW1 B;  3RGU A;  2GUS A;  2KI7 B;  3L70 G;  1KB9 E;  4W7Y A;  1BGY D;  5CCG A;  2K3R A;  1FDM A;  1SFC A;  3GHG B;  1T6A A;  4JYB A;  5CHX A;  2IPP A;  1S3J A;  2YMK A;  2AEM A;  1YJW P;  3H1J D;  3USS A;  3C9I A;  3H1L G;  5KJ7 C;  3D6Z A;  1LWU B;  1VPC A;  3B5N C;  3W68 A;  2W27 A;  1GZL A;  1OVR A;  3NMD A;  3L73 J;  3H1L E;  3M0D C;  2P10 A;  1KFM A;  4JF7 A;  2E76 C;  1IK7 A;  4D6T J;  1EDJ A;  2N1T C;  3V2R A;  4ZMD A;  2CPB A;  3AE6 C;  1SQX E;  1NTK G;  3KZI E;  1PFI A;  3N7N A;  2V7Q J;  1J1E C;  1NTZ G;  1P84 D;  4UB8 E;  1NTZ E;  2ZYA A;  5AVU B;  4I6M C;  1FZG A;  1G1I A;  3A0H H;  3SSU A;  1AQ5 A;  2ZJS E;  3CXH I;  3L36 A;  1NKN A;  4EYY Q;  2K37 A;  1GL2 A;  1JY3 O;  1BCC J;  2GM4 A;  3L75 J;  2QM8 A;  3E7K A;  2WVR A;  3AEB C;  2RH0 A;  1Q81 Q;  3HTK B;  1KZU B;  1MFZ A;  4AYC A;  2OYI A;  3AE1 C;  1NTM J;  2KB7 P;  2FYZ A;  3K5B A;  4IL6 X;  2E5T A;  1KIL D;  1Y9B A;  3E1R A;  1HJ0 A;  5DJT B;  2HOD B;  2YIU C;  1OFC X;  2B87 A;  1SQV D;  2QSI A;  4GIF A;  3RL0 B;  2K9J B;  1GD2 E;  5KTB A;  3CL3 D;  2MKV A;  3SWF A;  5TIS E;  2IZ1 A;  4L75 A;  1FBM A;  1Q86 Q;  4IL6 H;  3HD7 A;  2PFX A;  4ZNC A;  1RF0 A;  1YJ9 P;  3H25 A;  1SS1 A;  5APY A;  5CJ0 A;  3L70 J;  1GK4 A;  2W8Z A;  1WRG A;  2NPS D;  2P67 A;  4H13 C;  2A06 D;  3PHL A;  4R4M A;  1ZRT E;  2JO1 A;  3G71 P;  4ASV A;  3C8V A;  4RES B;  3WU2 E;  1EZV D;  1FZE A;  2E43 A;  3H1L J;  3MUD C;  1Q2N A;  3IR9 A;  3WUV A;  2R3C A;  2NZ2 A;  1QVG O;  2XNX A;  3V4W A;  1S5L E;  4TT3 H;  1VQM P;  3KZI H;  3B5N B;  1JMB A;  3H1H G;  1FU1 A;  3N4X A;  1SQB G;  1NOH A;  3H1H E;  4RO0 A;  1KFN A;  1SQB E;  3A3Y B;  4UB8 H;  2E76 B;  1NTK J;  5TJH A;  3AE4 C;  2FXO A;  1CZQ A;  1KIL C;  2QJY C;  2N1T B;  1R5L A;  2XV5 A;  1L0L K;  1NTZ J;  1YTZ T;  1NJI Q;  1KYO E;  1BGY G;  2N9B A;  1RF1 C;  1EDI A;  2ZAE B;  2Z5I A;  1SQP D;  1RE4 A;  3L72 G;  1J1E B;  4ASW A;  1BGY E;  4EIJ A;  1YJN P;  1KV4 A;  1LJ2 A;  4WWI A;  3CX5 I;  3H1J G;  5AW4 B;  1OW6 A;  5APU A;  2PRR A;  4OGQ B;  3H1J E;  4OVN F;  4W7Z A;  1EXJ A;  2Y0D A;  2W6B A;  3L74 D;  1HGZ A;  2R44 A;  3EFG A;  1FS0 E;  2O1K A;  1N73 A;  5KAF E;  5APX A;  3AEA C;  1R8E A;  1CI6 A;  2JEE A;  2QJK C;  2Q5U A;  3SWK A;  4LLH A;  5L8R J;  1OVV A;  5APW A;  1JY3 P;  1JM0 A;  2P7J A;  4DZO A;  4HB1 A;  1N7S A;  2YIU B;  4EOT A;  1JOC A;  1P84 E;  3V6I A;  1ZW0 A;  4YXW H;  1S5L X;  4R4L A;  2A45 I;  1QX8 A;  1E79 H;  3WU2 H;  1IFP A;  2QA4 P;  4H44 D;  2WPS A;  4A7P A;  3GHG A;  1RY3 A;  1FZA A;  2KIK A;  1L4A A;  3OW2 O;  1S72 P;  5B5E E;  3QH9 A;  1NU1 K;  5AVY B;  1S5L H;  2ZXX A;  1MFT A;  1T2K D;  3KHU A;  1FC2 C;  1LWU A;  4H13 B;  1URQ D;  2ZYG A;  3RK2 D;  1S4X A;  2D2C C;  1FZC C;  3CME P;  3L71 D;  2AXC A;  2B9B A;  1LTT C;  3NXS A;  2IBZ D;  3H1H J;  1SQV E;  3FX0 A;  4L76 A;  3NTN A;  1SQB J;  2Y0C A;  2Q6Q A;  4RKU J;  1KYO H;  2AEJ A;  3W67 A;  4RJT A;  1VQL P;  3V2N A;  3GF7 A;  2POH A;  1JY2 N;  3I55 P;  5AW6 B;  3AED C;  1T3U A;  1PPJ E;  3IAO A;  1BGY J;  1NYH A;  1A02 J;  1QL1 A;  1KQS O;  1IFM A;  2E75 C;  4XE5 B;  5AVX B;  4DT0 A;  1MKM A;  3L72 J;  1KIL B;  2QJY B;  3P8M C;  5AW3 B;  3M06 A;  1EZV G;  3H1J J;  2A06 E;  2FYU K;  1RF1 B;  2OTJ P;  4PD4 I;  1IC2 A;  2R5D A;  3RBX A;  3CCV P;  1EZV E;  1HJB A;  3HTK A;  3BCC D;  4JBZ A;  1ZV8 A;  5AW7 B;  1NKZ B;  1JO5 A;  2CPS A;  1VQP P;  2WSC J;  1GTW A;  2KNC B;  2KLV A;  2HOD A;  1URQ C;  1ZN5 A;  2QEX P;  1IO4 A;  3PLN A;  5AVW B;  1LT1 A;  2K9J A;  2PGD A;  1VQ7 P;  3VMZ A;  1ZRT D;  1M57 D;  1NAY A;  5CBO A;  1OXZ A;  2QJK B;  3TK1 A;  1VF5 C;  3M9H A;  2MJZ A;  1SQP G;  5KLV D;  3A0H E;  5B5E H;  5CCG D;  5CCH C;  2IYP A;  1SFC D;  1SQP E;  3BRV B;  1H0T B;  3CCU P;  1FOS E;  3G3Z A;  4U7J A;  2DW3 A;  2WSF J;  2E74 D;  1D7M A;  3VP9 A;  3L74 G;  1G1J A;  5KAI E;  3FGA D;  1PL5 A;  3L74 E;  3CCJ P;  4H0L C;  3IFM A;  3H6P A;  1KYO D;  3M9B A;  1USD A;  2FBW C;  3VTP C;  5KJ7 A;  3B5N A;  1KMI Z;  2D2C B;  2H43 A;  1FZC B;  4N78 D;  4IL6 E;  3UIA A;  1GU5 A;  3M0D A;  3AE3 C;  2V4H A;  3S1K A;  2N1T A;  2O3J A;  2AEF A;  2QM7 A;  2XDJ A;  4WY4 D;  1NTM K;  1LTA C;  4HYT B;  2I8D A;  2BCC D;  2GUV A;  4WBA A;  3BRT B;  2ZFC A;  4Y99 C;  1FDI A;  1GL2 D;  4K3A A;  2M0B A;  5AVS B;  1JCD A;  2FFD B;  1RQV A;  3PRJ A;  1SQX G;  2E75 B;  1WT6 A;  1YBK A;  3GMA A;  5CCG C;  1TU3 F;  1VL2 A;  1VQ8 P;  3HUS A;  3L37 A;  1SQQ K;  1FAV A;  3L71 G;  3CCL P;  2Q9I A;  3AEF C;  2KK7 A;  5KLI C;  2M3B A;  3L71 E;  2VRS A;  2KXP B;  2FXM A;  1FOS F;  2IBZ E;  1IK9 A;  1BDD A;  4OGQ C;  1ZXG A;  1ZOY C;  3RL0 g;  2OYH A;  2HR3 A;  3KDP B;  1RE3 C;  3HE4 B;  2P58 A;  4BRY A;  1LT9 C;  4NPF X;  3V2P A;  2JP3 A;  1GK6 A;  3RK3 D;  1URQ B;  3RK2 B;  1DX7 A;  3Q3D A;  2HLO A;  1SQP J;  1U7M A;  2O01 N;  1HWT C;  4OWF A;  3GG2 A;  1RH5 B;  3EWK A;  3CC7 P;  5B66 E;  1VF5 B;  5BU8 B;  5KAI H;  2C0X A;  1YQ3 C;  3MIW A;  2PAJ A;  2IYO A;  1M56 D;  1VQN P;  4WY4 C;  3F89 A;  2FYU D;  3L74 J;  1NTK K;  3F5H A;  3HRN A;  3FXE A;  4W80 A;  5KKZ C;  2BEZ F;  1MZ9 A;  3T97 B;  1GL2 C;  3D70 A;  1NH4 A;  2NRG A;  3BCC E;  1JTH B;  3M91 A;  4YTP C;  1PPJ D;  3VMA A;  4YXD C;  2W83 C;  4H0L B;  1QVF O;  1LTI C;  1PGP A;  1KB9 I;  2ZT9 D;  1PV3 A;  2FKW B;  5KLV G;  1NVO A;  1JUN A;  3EFF K;  1FE6 A;  2KS1 B;  4BWN A;  1OVU A;  2L5G B;  3RBZ A;  5KLV E;  4DCK A;  4B86 A;  2WSE H;  3L73 D;  1Z56 A;  1VQO P;  3P8C D;  4C7N B;  1EXI A;  1KIL A;  4TLF A;  4D6T D;  5AVQ B;  4N3Y B;  5H2F E;  1DEB A;  3VN0 A;  3LIE A;  1RF1 A;  2Z5H A;  1SQX J;  1QEX A;  3V2Q A;  1KOR A;  4Y99 B;  1SP4 A;  3L71 J;  4LC1 A;  2YXQ B;  2K9Y A;  2K88 A;  1UIX A;  5GTI H;  1SFC B;  3MP7 B;  2WZ7 A;  1L0N K;  3VP8 A;  1H88 A;  2YKQ A;  5CJ4 A;  2HYN A;  1QL2 A;  4C7R A;  2WPR A;  2KNC A;  4N78 E;  5KLI B;  3TYY A;  1HUC A;  3LW5 H;  4PV1 D;  1AVO A;  1N7S D;  1J1D C;  1T3J A;  1ZR4 A;  2QVA A;  1LNQ A;  5B66 H;  2BCC G;  1X8Y A;  2WT7 B;  3A2A A;  2NPS C;  3CCR P;  1PGJ A;  2AXT E;  1NAF A;  1VQ4 P;  2Q7C A;  1K8A Q;  1LT9 B;  2BCC E;  2QJP C;  1H0T A;  1GW4 A;  4HH2 A;  5APV A;  1L4A D;  3AEC C;  4GOD A;  1X79 B;  3KXD A;  2QRX A;  5CMZ A;  5AVR B;  2Q1K A; 
#chains in the Genus database with same CATH homology
 2R5D A;  1H8A A;  3C9I A;  5KJ7 C;  1LWU B;  1VPC A;  1HJB A;  1LTB C;  3B5N C;  3NFQ A;  2W27 A;  1LTG C;  3HTK A;  1GZL A;  3NMD A;  2BAS A;  1NO4 A;  2KP8 A;  3M0D C;  4WY4 B;  1ZV8 A;  5AW7 B;  1NKZ B;  1JO5 A;  2CPS A;  3BAT A;  5AW8 B;  1KFM A;  1LTJ B;  4JF7 A;  2YNY A;  4I2L C;  3A5T A;  1GTW A;  1ZR2 A;  1GL2 B;  2N1T C;  2KLV A;  2HOD A;  2M8R A;  2YKO A;  3HD7 C;  1URQ C;  3V2R A;  1RF0 C;  2CPB A;  1FZC A;  1ZN5 A;  1IO4 A;  3RK3 C;  3A7O A;  2HPC A;  5AVW B;  2XKM A;  1PFI A;  3N7N A;  3VMZ A;  1J1E C;  1J2J B;  1FJP A;  5BU5 A;  1OXZ A;  3TK1 A;  1FZF A;  2WIT A;  3M9H A;  2MJZ A;  2C0W A;  2I1K A;  3PP5 A;  1G2C A;  4IFM A;  4O9B A;  4JYC A;  5CCG D;  5CCH C;  3BRV B;  1SFC D;  5AVU B;  3OJA B;  2H7H A;  5AW0 B;  4I6M C;  1FZG A;  1MUU A;  5APQ A;  1G1I A;  1FOS E;  3G3Z A;  3R2P A;  1HH0 A;  1AQ5 A;  2NPS A;  3L36 A;  1NKN A;  3VP9 A;  1GL2 A;  1JY3 O;  1G1J A;  2KSJ A;  5KLV K;  2GM4 A;  2LKM A;  2QM8 A;  5BVZ A;  1M7L A;  3HTK B;  2WPQ A;  3II6 A;  1KZU B;  1MFZ A;  4AYC A;  1JY2 P;  3IFM A;  4M3L A;  3B8E B;  2OYI A;  1NHL A;  4OH8 B;  3H6P A;  2KB7 P;  3M9B A;  2FYZ A;  3U59 A;  2FFD C;  3VTP C;  5KJ7 A;  1KIL D;  1CSB A;  2XU6 A;  3B5N A;  2JJL A;  4IFD K;  2HOD B;  2H43 A;  4GIF A;  3RL0 D;  1FZC B;  4N78 D;  3UIA A;  1GU5 A;  4WB4 A;  2P1J A;  3HE4 A;  2HPC B;  1VDF A;  3HUS B;  3M0D A;  3RL0 B;  1SQB K;  1JCC A;  4N6J A;  2R32 A;  1GD2 E;  5KTB A;  1DH3 A;  2Q3I A;  3CL3 D;  1RE4 C;  3SWF A;  5APS A;  1HTL C;  1FZB A;  3H32 A;  1FBM A;  2N1T A;  3HD7 A;  3E1I A;  1RF0 A;  2QM7 A;  1G2C B;  3L35 A;  2XDJ A;  1XTC C;  4WY4 D;  5APY A;  3P8C E;  1KQL A;  1J1D B;  1NTM K;  5CJ0 A;  1LTA C;  4HYT B;  1JMM A;  2GUV A;  2OYH B;  4WBA A;  3BRT B;  1GK4 A;  1WRG A;  2ZFC A;  2NPS D;  2P67 A;  1JY3 N;  3TSI A;  4Y99 C;  1GL2 D;  2A45 H;  2NPS B;  1T2K C;  5AVS B;  1JCD A;  2FFD B;  1WT6 A;  2W6A A;  1IFJ A;  3RK2 C;  1N73 C;  5CCH A;  5CCG C;  4RES B;  2HG5 D;  1FZE A;  2E43 A;  3HUS A;  3L37 A;  1M1J C;  1FAV A;  1SQQ K;  2Q9I A;  3IR9 A;  3T97 A;  1ZLL A;  2M3B A;  2R3C A;  3U1C A;  1GDT A;  2XNX A;  3M0A A;  3V4W A;  1CW5 A;  1HGV A;  3EQ2 A;  2VRS A;  2OYI B;  5KJ7 D;  1GW3 A;  1JTH A;  3WMM 0;  3B5N D;  2FXM A;  1FOS F;  3V5B A;  2IFN A;  3B5N B;  1IK9 A;  1N7S C;  1FU1 A;  3N4X A;  2OYH A;  3KDP B;  1RE3 C;  3V4Q A;  3HE4 B;  2WTY A;  1NOH A;  2HFE D;  4DOJ A;  1KFN A;  5AVT B;  1LT9 C;  3A3Y B;  2N1T D;  2J58 A;  1FJK A;  3H32 B;  2FFD A;  3V2P A;  1CZQ A;  3P7K A;  1KIL C;  3L4F A;  1N2D C;  2N1T B;  3VMY A;  1GK6 A;  2J59 M;  4IFF A;  3RK3 D;  3HD7 B;  1URQ B;  2XV5 A;  3U1A A;  3RK2 B;  1L0L K;  1YTZ T;  1DX7 A;  2HLO A;  3GHG C;  2N9B A;  3RK3 B;  1A02 F;  1L4A C;  4C46 A;  1HWT C;  1EQ7 A;  1RF1 C;  2YMY A;  2Z5I A;  1IFD A;  1RE4 A;  2H8P D;  1J1E B;  4C7N A;  4EIJ A;  2YO2 A;  1LTS C;  5BU8 B;  2C0X A;  3MGN A;  1LWU C;  2C9L Y;  1YTZ I;  5AW4 B;  3OAK A;  3MIW A;  5CCH D;  1S9K D;  2OAR A;  2PAJ A;  5APU A;  3MD0 A;  2YO3 A;  4WY4 C;  2XZR A;  1N7S B;  3KPE A;  5AW2 B;  5AVV B;  2O1J A;  1NTK K;  3HRN A;  4W80 A;  1LTJ C;  2KYV A;  4W7Z A;  1LGH B;  2R5B A;  3TNU A;  3MTU E;  2W6B A;  2IX7 C;  1MZ9 A;  3BAS A;  1GL2 C;  1HGZ A;  1SQP K;  3EFG A;  1NH4 A;  2PP6 A;  1X9V A;  3CLQ A;  2O1K A;  1URQ A;  1N73 A;  1JTH B;  3M91 A;  3VMX A;  4GKG A;  1YYC A;  5APT A;  5APX A;  1M1J A;  2C9N Y;  1L4A B;  1SQV K;  1CI6 A;  2JEE A;  3SWY A;  2Q5U A;  4LLH A;  4LGD E;  1LTI C;  2I1J A;  1AFO A;  2FKW B;  1JNM A;  2ZXE B;  5APW A;  1JY3 P;  2IFM A;  1T8Z A;  3VYI A;  2P7J A;  1JUN A;  4ZKU A;  4DZO A;  1IFI A;  1SVF A;  1N7S A;  1SFC C;  4I1L A;  4EOT A;  2KOG A;  2L5G B;  1JOC A;  1RE3 A;  2WSC H;  2WT7 A;  4B86 A;  2WSE H;  1JY2 O;  1Z56 A;  3P8C D;  1LT9 A;  2YKP A;  2A45 I;  3O8Z A;  4C7N B;  3KYQ A;  1KIL A;  1N86 A;  3OA7 A;  2WPS A;  5AVQ B;  4GT1 A;  3HE5 A;  4N3Y B;  3GHG A;  1RY3 A;  2P2U A;  4AUW A;  1FZA A;  1MV8 A;  1DEB A;  1L4A A;  1HBW A;  3VN0 A;  4AQR D;  3LIE A;  3LID A;  1RF1 A;  1E5W A;  2Z5H A;  1NU1 K;  5AVY B;  4KHX A;  1IJD B;  3V2Q A;  5AW5 B;  1T2K D;  3TNU B;  4Y99 B;  1SP4 A;  1LWU A;  3HD7 D;  4LC1 A;  1URQ D;  3RK2 D;  1FZC C;  2WSF H;  1SLQ A;  1N73 B;  3HUS C;  4WY4 A;  3RL0 C;  1SFC B;  1IFN A;  5AVZ B;  2WZ7 A;  1L0N K;  3VP8 A;  1H88 A;  1M1J B;  4ZKP A;  2O01 H;  1LTJ A;  1LTT C;  2YKQ A;  1S9K E;  1CI6 B;  3NXS A;  5CJ4 A;  2HYN A;  1QL2 A;  2E42 A;  2WPR A;  4C7R A;  1GU4 A;  3I5C A;  3M9Q A;  4N78 E;  3NTN A;  3TYY A;  1HUC A;  3LW5 H;  1NWQ A;  1SQX K;  1N7L A;  3V2N A;  1XTG B;  1N7S D;  1J1D C;  1H89 A;  1T3J A;  1W2E A;  1ZR4 A;  4XA4 A;  2POH A;  2OYH C;  1JY2 N;  3P32 A;  5AW6 B;  3BVH A;  5AW1 B;  1HVV A;  1X8Y A;  2WT7 B;  2GUS A;  3A2A A;  2NPS C;  1T3U A;  3VOP A;  1NTZ K;  2WWW A;  1NAF A;  2Q7C A;  1A02 J;  1QL1 A;  1IFM A;  1LT9 B;  4XE5 B;  4W7Y A;  3KQG A;  5AVX B;  2Z4E A;  3CI9 A;  1GW4 A;  4HH2 A;  1KIL B;  3P8M C;  5CCG A;  1FDM A;  5APV A;  1L4A D;  1SFC A;  5AW3 B;  3HE5 B;  3M06 A;  3GHG B;  1X79 B;  4JYB A;  5CHX A;  3MUD A;  5CMZ A;  5AVR B;  2FYU K;  2IPP A;  1RF1 B;  2A45 G;  1OWA A;  1IC2 A;  2OYI C;  5AW9 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...