1VF5B

Crystal structure of cytochrome b6f complex from m.laminosus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords CYTOCHROME B6
total genus 29
structure length 138
sequence length 138
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1vf5B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1vf5B01
4H0LB 2FYNC 4H13B 1ZRTE 2YIUC 2WSCJ 2E74B 1S5LX 2WSFJ 4KT0J 5L8RJ 2D2CB 2QJYC 2QJPC 3LW5J 2WPVB 4OGQB 2QIWA 4IL6X 2E75B 4PV1B 2QJKC 2QSIA 2WSEJ 4I7ZB 4RKUJ 2O01J 5KLIC 1VF5B 1Q90D 4Y28J 1JB0J 4H44B 2K9YA 2E76B 2ZT9B 3C8VA 5KKZC
chains in the Genus database with same CATH superfamily
1JJOA 3ABUA 2K9JA 2Q7EA 5BY1A 5KAFZ 1VQOV 3BCCG 2ZCEA 2OIGA 5H5NA 3GWKC 3WMM0 1YF2A 3L73H 2D2CB 1NKDA 1J1EB 4YJ3A 2VRSA 1VQPP 1NVOA 5HFLA 2ODMA 1H8AA 2Y9ZA 2F4VO 3H1LH 3FX7A 4JV5O 2FFDC 1T5EA 3LNMB 3H1HD 3ETEA 1VQPV 1KILA 1GMJA 1AVYA 2ZD9A 1KB9E 3RK2C 2VQEO 1KYOD 1Z5VA 3WB1A 2JWAA 1VQKV 3A3YB 2KNCA 2IBZD 2UUAO 2IH3C 3AG1C 5KKZC 4LFCO 2AHZA 4YJ2B 2RH0A 1TU3F 3ZHVA 1RH5B 4UV8A 4X8AA 3OGCC 1L0LG 1EZVD 2YKOA 2Q7HA 2CTQA 2HG5D 2Q3EA 5LHIA 4FLXA 3LDCA 1WB8A 2Z5UA 1W2EA 2R70A 3OE7G 4FVMA 5IJ0A 1KV4A 1YBKA 4Y99C 4Y28J 5BU8B 1JM0A 4NXMO 1USDA 3M0DA 1OVUA 2EX3A 3HR0A 1BDDA 3CB2A 2EIKC 1N36O 1OIPA 3KQGA 1G1XB 1DF5A 1YITP 1QR9A 1OJHA 2N04A 5J2UB 5C8YA 3CRMA 3THOA 5APWA 1N33B 4C7NA 1VQOP 4C7UA 4NKGB 3A2AA 3RBZA 1PP9J 2DYSC 4RJTA 3H1IG 5KJ7D 3IJ4A 1DEEG 3STZC 1JA8A 3ZMUA 2YMKA 2NPSC 4GUNA 3ZMZA 4FPPA 3UM7A 1YTZI 2WPQA 2OCHA 3L71H 1N7LA 1IFIA 1SLQA 1QNMA 1H0TB 2KP8A 3NR7A 4OGQC 1KTMA 3CCSP 1ZR2A 2W6AA 3U1AA 4P30A 5D5QA 3CCJV 3VMZA 4TT3G 1BCCH 1USEA 1N0JA 2ZT9C 1N73C 2BOCC 5EBLC 3LW5J 3S9OA 5EBWC 1FZCB 1X59A 1SQQD 2P67A 4UCUA 3O65A 4MVMA 2UXBO 1FJGO 3A0BZ 4A5UB 2HLDG 1YTFB 4WWIA 2Q68A 1NJIQ 3Q5RA 1SQPG 3F5TA 1Q82W 2ZXXA 3P3NA 3OMIB 1PL0A 2V7QG 2IFNA 2OTLP 2H89C 4R50A 4IFMA 4X20B 4LFCB 2LXCB 3W7UA 1N7SD 3KXDA 4YXDC 3CMEP 2PFXA 1JR9A 4W4LA 3H6PA 3HUSA 3AG1B 4QMAA 1XILA 1N8RQ 1VQ9P 4DV4B 1WJZA 2NR5A 2HR3A 4BRYB 1BL8A 3JALB 3W7WA 3MUDC 2WLIB 1Q81W 1RF0C 1G8MA 1HNWO 4X20A 1EZJA 5D5PA 1BCCG 1SQFA 4QPKA 3RGUA 2H43A 3OMNB 1VP7A 2LJ2A 4GKKO 4O9BA 3RK3D 4GX0A 2R5DA 3G6EP 1L0LE 2RJZA 2YSUB 3APQA 3CE2A 3QO5A 4X1YB 1AI5A 3J81N 1HR0O 1GAXA 2HFED 3WU2Z 3Q5PA 1HR0B 4JYBA 4X88A 1LTJC 5JQGB 3G6EV 4PDMA 4UFZA 2K3RA 3AE7C 3V2QA 3VBBA 2W6BA 5J9PC 1QL1A 3L71D 1PKXA 1KECA 2AW9A 3B5NC 4PI2A 1X22A 1Y67A 1S5LE 2CTPA 1DK1A 1RF0A 2D2CC 3A0BE 3KZIE 3QTCA 3ABTA 1FS0G 5B1BB 3KDPB 3M06A 5KLVK 1AJPA 3L74D 1EZVG 1OCOB 3IN6A 2FL4A 5CJ4A 3E7KA 1SQGA 5J2TB 4N78D 3KZIZ 1JNMA 2LGWA 3OEHG 2QVAA 2YDEA 2QWNB 4L8JA 4DXWA 2EJ7A 3HKEA 3AEBC 3CX5H 2QWPB 1H2LA 4KXRA 3L75G 3F89A 3HD7D 2EIMC 5CBFA 4J9ZB 1BSMA 2ZE5A 5KUMA 5J2TA 2VWJA 4LF6O 1BQZA 1L0ND 1MZ9A 4IL6H 4ZKIA 1OW7A 5KLVH 3WG7B 4U3JB 1HP8A 4EI2A 2LP7A 2IH1C 2ADQB 1R73A 2YI9A 1GN2A 1QU7A 3CCVP 2YIBA 3AG7A 4N21A 3M7MX 4NXNB 4K3AA 1KQSO 1KILD 2YXRB 5H6RA 4RKUJ 1EBOA 3D70A 1UJWB 4RUEA 3QG5A 5CA3A 3HE5B 1LT1A 1EQ7A 2YIAA 3RYIB 3RN4A 1URQD 1I5YA 1XQ8A 3OM3B 3BATA 2EZPA 4GYCB 4PA7A 2ZJSE 3IFXA 2ZM6O 1DD4A 4W7YA 2YC0A 5BVZA 3LDEA 2W27A 3CC4P 3R2PA 1XNQB 4ZMDA 2WLMA 3TGUG 2WPVB 3CCEP 1RSOB 3VQVA 1ZRTD 2WSSH 2A7WA 5CMUA 1SRYA 1OCCB 1MNGA 2ZVOB 3SYAA 3ASOC 1JX9A 1SQXD 4YY3B 3RBXA 3TF5A 1SQQJ 4U3FJ 2LR2A 1IFMA 5KKZB 1KC8W 3G3ZA 1L8DA 1FJKA 1SQQK 4DOJA 4H37A 4O4LA 4DV4O 3H1HG 3P3PA 3H1HE 2WLLA 4JYAO 2PAJA 3P8MC 3ZDMA 4HB1A 3JATA 3KHUA 1U97A 3CLQA 4YTPC 5GONA 2RN0A 1S72V 2GDSA 2G3AA 4J7KA 2OYOA 4ZKUA 1S77D 3AE9C 1P84F 3W7SA 2BTQB 1K73Q 3CC2V 4QPJA 3H1JE 1Y74B 4WF9V 4NXMB 5LXTB 1I5XA 1EZVE 4NTXA 3B4SA 1UIXA 1EFRG 4H0LC 1YITV 2C9NY 3NFQA 2GM4A 5EYPB 3TGUH 1GRJA 3AG3C 4E2LA 2EIJC 4PJ0H 5H2FE 4AI8A 1I0HA 3QVNA 1DLBA 2OIEA 2JEEA 2FYNC 2XNDH 3U59A 3OW2O 1YJ9P 2NZ2A 3LNNA 3A8TA 3AG4B 5JJNB 1N0NA 1GTOA 2Y9YA 3J7AU 2OYHB 2ZINA 2GUSA 1R6TA 1DF4A 3QWOC 2XASA 4BIZA 3A0HH 2A06H 2BOBC 5KJ7A 3FX0A 3JAKB 2Q5ZA 2EILC 4PHZA 2ZIOA 4IIJA 4X1KA 3CCUP 2F43G 4ZI7B 1LT9C 2OARA 4BR6A 2VRZA 2FYUE 3E86A 5LMUB 2YIUC 3I56V 2PYLA 4E4EA 3CCUV 3T97B 3BCCE 3BVHA 2K9PA 2PUSA 2WPDG 1PGJA 2EINC 1J1DB 1N34O 1IJDB 2GUVA 3OT7A 4TUYB 2J58A 1S76D 3JD3A 3L4FA 3VMYA 3CXCU 1RE4C 5EK0A 2KSDA 4B7EA 4O4JA 4B86A 4W4KA 1WNSA 4UCSA 1EDLA 1H2NA 4K0KO 3QF7A 3H25A 5E1AC 1DX7A 1N7SB 2A06E 1GTWA 3K5MA 2DJVA 3CPWO 1IFPA 1HVVA 3CWBE 1FDOA 1RFYA 3LIEA 3I55P 2ETNA 3SJQC 1EN5A 2FKXA 1K8AW 4B3TB 4WBAA 3JD2A 3OW2U 1OMIA 2B9ZA 1NTZE 1UIIA 1G2CA 2HODA 1W0JG 3E89A 4JPRA 3AE1C 3HTKA 3CD6P 3ZMTA 2ADPA 3AE4C 4H13D 1U57A 2QE7H 2E3CA 1W2BO 1ZLZA 3E8FA 2E5LB 1DIPA 1F4MA 1IXMA 1P4RA 5CA1A 3CPWU 1L0NG 2O1JA 1CP9A 1JUNA 5LP6C 5CA0B 3RYFA 3E1RA 2YIBD 3HE4A 1SQVK 3K06A 4JBZA 1NHLA 2FMLA 1GMGA 2DOSA 3CWBH 2IBZH 2JVDA 4DK0A 2ZNJA 2N1TC 1XMQB 1M57C 3RYFB 2B1GA 2B1IA 1KFMA 2GA1A 1I7FA 4DR1O 5B5EH 4IFDK 2GUZA 5CMZA 4MTXA 1VF6C 1WA8A 5KHHA 3D8CA 2POHA 5CN0A 2YO2A 1YJWV 1QVFO 2PGGA 4D7SA 3V2NA 1BMFG 1S9KE 5LMUO 1SQVJ 3RVZA 1OFCX 1HGVA 1H38A 3E8HA 2OT5A 4LFBO 1PP9D 3MHSC 1YQ3C 2Q0AA 1HBWA 1SFCA 5DN6G 1SKVA 1D7MA 4OPHA 4BRYA 4WVZA 2KS1A 3JSVC 4DUZO 1U7MA 4CC6A 3DGEA 4UVCA 3A0HZ 3AK2A 1F23A 1KP2A 4FLTA 4AHCA 1LTJB 2FB5A 3ABKC 2KB7P 4HJGH 2KOGA 1QLED 3RK2B 3Q4HB 2ZXEB 1MABG 2F4VB 5B5EE 5BMVA 1SP4A 1FXHA 1AFOA 4UV9A 3WU2H 3OEEG 3TGUJ 2Z4EA 1M9NA 2AZ2A 3AE3C 4DV0B 2ITDC 1R6NA 2EIKB 4JZ2A 3PTZA 4G27B 4X1KB 1YQ4C 4PI0A 1NR7A 2ZE6A 2HVKC 1JY3P 3F7VC 1BCCD 2R44A 1JTHA 1K33A 1W59A 4B3SB 1NH4A 1RE3A 1YJNV 1I08A 4IFFA 5TISZ 4J11A 5IDJA 1Q7YQ 1S5LZ 3H1LJ 5AW6B 2UXBB 1SF9A 1YI2V 3R65A 2JRIA 5AW4B 1EM1A 3D36A 5GTIZ 1AJNA 3H1LE 2OYHA 1JTHB 2WA3A 2YI8A 4PDVA 1XNRB 4K0KB 2J59M 4LWSA 4ZNCA 2UUAB 4KHXA 3DSQA 3SDLA 3BABA 1Z56A 1RQUA 2O3JA 1LR1A 4MW3A 3NTNA 1HTLC 1SQXE 1LTTC 3K59A 3EFGA 3TDKA 3CCSV 1HWTC 5BMVB 4O4IB 3P32A 1FXKA 4OVNF 1QVFU 3Q5SA 3UO2A 3ICXA 2ZKOA 1Y74A 1URQC 4L75A 5JCOA 1FZCA 5APTA 2BTQA 3ML0A 2PY5A 1XHZA 2IYPA 4DR4O 5EIBC 2JGDB 1R3LC 4MW8A 4GOEA 1PM9A 1N33O 3DC5A 1SFCB 2C9LY 2YIDA 1EZVI 3GLMA 4AQYO 5LGUA 2AXTZ 1HJ0A 3BA8A 4WFGA 4DV1B 1NYHA 1SC5B 3X2QC 4QIWF 1JOYA 1OW6A 2N1TB 1JVMA 5JH7A 2ZYDA 4D6TJ 3G71V 1H2GA 2CH7B 3D3QA 2JDIG 3UIAA 3QO8A 2ZFCA 4ICGA 3AE6C 1OHHG 2OGUA 4NR1A 1GU4A 3G9RA 1NU1E 2P58A 3T1YB 3WUUA 3HE5A 5LP6B 1BGYJ 4H44B 3G71P 1Y6XA 3HD7B 1WP7A 2A3QA 2E74D 2H8PC 1P84I 2OCCB 5DJTB 5B66H 2YUAA 4U7NA 5FLXN 5KLVD 1GK9A 1WN7A 2PI5A 2IBZI 1S72P 2OTJP 4FJCC 2UXXA 1J95A 4LC1A 1GM8A 2LGQA 1BGYH 4EEQA 2RMZA 2PTMA 3Q4HA 4GX2A 1S5JA 4DV7O 1OX3A 1SQXG 3CJHA 4PD4H 3OTFA 1IDSA 2O01H 3LUTB 2P22C 4ZOLA 3MIWA 2JJ2G 3RWRD 2A45H 4NTWA 1HH0A 1URQB 2E76B 4U3JA 4I9QA 3H1KH 2IJJA 2Q6QA 3MHHC 3JCUZ 1MFZA 1JQ0A 1LUWA 5LA6A 1AR1B 1MG1A 1FFXA 4IGGA 4AYCA 2P4VA 1LWUA 2CK3H 1X79B 1ZOYC 1PPJG 3UCSC 4X1IB 1FFXB 1M1KW 1AB3A 1M90Q 4UCVA 1L0LD 4LF8B 1KYOF 1VIBA 1CZQA 4P9PA 2OQQA 1L4AB 2OYIA 4DV5B 3BAAA 4OWFA 1IZNB 3JC22 3F5WC 4O4HB 4HYOA 2K9JB 2YEVB 4LCUC 4B7KA 1NVPD 2L5GB 1OZ0A 1ZL8B 3TETA 2M5AB 3I56P 3D36C 1QLEC 4LR3A 1ZXGA 1N8RW 4GODA 1R8EA 3JYCA 3OMAB 3MP7B 4KP4A 1XUQA 5KTBA 1Q86Q 4AQYB 3V2RA 2CTRA 1S0VA 4K8ZA 4R6ZA 2JO1A 3X2QB 1Q6HA 1PP9H 3K08A 3V2PA 5JVDA 2QJKC 3CRCA 3PN1A 1X4TA 5CHXA 3A0BH 1W5CE 3H32B 3FXEA 4N78E 3ZIAG 5JQGA 1FZAA 2JS3A 3IFMA 2HODB 1M56C 3PHLA 1F7YA 1K3EA 4CPGA 5TISH 3ZMVA 3CXHI 2WLIA 1JPXA 1JCCA 1VQ9V 4WY4B 4JI1B 3H1HJ 3H1IE 3OUSA 2FYUG 5A9GA 1QQCA 1M1JB 2FYZA 3OR6C 2XAHA 1VQNP 5KA6A 1NU1G 4WFAV 1SESA 4WCEV 1ZWIC 1ZN5A 2GTSA 4CH6A 4FIPC 4F6RA 4B3RO 1K5SA 3JCUH 1T3JA 3D71A 1H8EG 2JGUA 1PNLA 2FXOA 1VQLV 1KD1Q 4MN4C 3E8BA 3ZS8C 5APXA 1PP9E 1K97A 2MK3A 4MTFA 2Q69A 3RFRA 3D6ZA 4RUFA 3Q2YA 3BCCJ 1XTGB 3C8VA 1YYCA 4C7RA 4X66B 2HPCB 1ZSPA 4I4TB 3ZN0A 4B3TO 1L0NK 1KILE 3BFRA 2XHBA 4XBFA 4I9WA 4IYHA 3DC6A 3JASA 4FM0A 4TQDA 5JVDB 2R3SA 1SQVH 4IL6X 3L73G 1NAYA 3LSSA 1JY3N 1JJ2U 2RCVA 1NO4A 2L35A 1QX8A 4TQFA 1L0LK 2BCCG 3HRNA 3UO3A 1Y8AA 3O6QB 4TV9A 4X65O 4LBEC 1RSOA 2XAQA 3SYOA 4LF4O 2X0LA 5FPOA 4KHPB 1BGYD 4ASWA 1WB7A 1BCCE 1D5NA 1IXBA 4Z1VA 1L4AA 1FOSF 1ZTEA 1EDKA 1XREA 2UU9O 2QM4A 5AVTB 4WBNB 2WT7A 2FFDB 2JKVA 3MD0A 2LW7A 5KLIB 3L74J 4MT8A 5APSA 4X62O 2CPBA 2PGDA 1LWUC 1Y76B 2QDOA 2CAZC 4JTDB 1N32O 1JY2N 4OPAA 2Z0AA 5KX5B 1N73B 1FKAO 4H13B 1CW5A 1NH2D 3L74H 4LFAO 1AQTA 3H1JD 3G6BA 2QKCA 3JARB 4RO2A 2QRXA 1QGKB 4JTAB 5LMNB 5IWAB 1NOHA 1LT9A 4UCRA 1FYJA 3H1JH 3UQ8A 1RPRA 3CEIA 2PRRA 4PA9A 1T3UA 4XDLA 5L3GA 1JMKC 1NTKG 1SS3A 3OD4A 3S3XA 4Y99B 3U0ZA 1AP6A 4D6TD 3CRAA 1SQBE 2ITCC 3RL0C 2I1JA 5AVQB 2AXTE 2OTKE 3LDDA 1R3JC 1MZEA 4U7OA 3JSNA 1KKDA 3HD7A 1K34A 5APQA 1NTMD 2ZDIA 1XHXA 4LF6B 2MW2B 3CXHD 1T2KD 1QLNA 5L3EA 1VF6A 2N1TD 2LW1A 2M6YA 3OA7A 4ZIBA 1KZUB 1H2MA 2YIUB 1I94B 3GF3A 5LGNA 1XBLA 1SQPJ 2E5TA 4J9YB 1S1CX 2EINB 1J1DC 3ABMC 4CS3A 4CS4A 2XT9A 3RYHA 2CTWA 1H88A 4GKGA 4JI8O 2K9YA 3KZIH 2ARHA 5H9CA 1L1FA 2UUCB 3M9HA 1OV9A 5B1AC 4TV9B 4EIJA 2QTOA 3L70G 3VQYA 1FAFA 1VQLP 1YHQP 1SQPH 1JEKA 2N05A 2WZ7A 2DW4A 2ZR3A 3G4SP 4IHJB 3K03A 4EYYQ 2Z3YA 2ZDIC 3K5BA 3N7NA 2W8ZA 5AVRB 3W68A 3M0DC 5CCGD 2QGNA 5B1BC 1ORQC 2NRGA 4MSWC 4DV2O 2A06D 1YSCA 3FAVA 2KQXA 3TXQA 3VTPC 3CX5E 4I0XA 4MS2A 2H94A 3KYQA 1SFCC 3CWBD 1G2CB 3E22B 4JV5B 1QVGO 2Y69B 2P5OA 4JF7A 1SQQH 1PZQA 4FM2A 1TVKA 2Y4TA 3ZJZA 2DYRC 3SPCA 5KAFH 3CRQA 1XMQO 3JALA 5BR8O 2ZT9D 3E83A 4UXNA 1IBMO 1NTZD 1DGSA 3MAQA 4HBNA 4QGPA 5IYBO 2V4HA 4X9QA 3RK3E 3CCMV 1NU1K 1NTZH 3PH0A 5CB4A 2ZE7A 2FFDA 1KYOI 5IJ9B 1KILC 3L75H 4Z2WA 1OVVA 3CMAP 3GWOA 2IJIA 3L73E 3P7KA 5M1BA 2PP6A 1RE4A 1P84H 3CP1A 4WY4A 1NTZK 1QEXA 3MZWB 4PA4A 4NTYA 2WA4A 4UB8E 1XNQO 1IK9A 2QWOB 2BASA 3SSUA 1L0NH 4JF3A 4TUYA 1P84D 3A2FA 2RMKB 1NKZB 2E43A 1NZ6A 1EXJA 3BVOA 1VQMV 3U10A 3M9QA 2KLUA 2KB1A 2ZIMA 4DV6B 1SQBK 2R72A 2NPSA 4H44C 1NU1J 3ZRXA 2ATKC 2Q3IA 5AW0B 1NR1A 3FYEB 4NPFX 1A02F 1VQMP 3CYOA 5JWPA 4MVOA 2P6JA 4IIJB 1Q8IA 5C93A 1YJ9V 2DWEC 3AE2C 1QR8A 4DV1O 3KPEA 1K9MW 3ZMSA 2XTAA 3RL0D 1IK7A 1VL2A 1FC2C 4PD4F 4FLYA 2K37A 1MV8A 2ZXWC 1SZTA 1QVGU 2WSFJ 1XL6A 3K0GA 1OXZA 2OYIB 2EBOA 4JYAB 2B87A 2QE7G 2WPSA 1NBMG 1XOUA 2WSSG 3H1KJ 4UB8H 5KLVG 3WUTA 1S5HC 3B5ND 2R9IA 1L0NE 5ITZA 2H88C 4JI0B 4I50B 5CB4B 1TVKB 3B2EE 3PRJA 3CCMP 5AW9B 2F1MA 3FXDA 4H44D 3WUVA 2A79B 1GN3A 2O01N 1M1JA 1BE3J 2K88A 1PNKA 2P2UA 1N32B 1J5EO 3UKMA 1NAFA 4PJ0E 2IJKA 2YXQB 5DM6V 3HKBB 1T6AA 3ZHSA 2A0LA 2QM8A 2V4DA 1WA8B 3RVYA 5LL6Y 4DUZB 1KP3A 2HFEC 5CBHA 2Q1KA 4ASUG 2C2AA 5GTIH 5IWAO 4KJMA 3P8CD 3CC2P 1BHBA 3LSQA 3TJTA 4JI2O 1KFNA 2UUBO 2XKMA 1ZAUA 4LF5B 5EFWB 1AP5A 4JASA 4JI3B 1KILB 5APUA 2M8RA 1N4CA 1KC8Q 3AE5C 2Y48A 4LFAB 4DV0O 1V9PA 3RT3C 3T2MA 1M57D 1HNZB 2LFRA 2N9YB 3PJSK 4JI6B 2LXBA 3STLC 2DQ3A 1M57B 3JAMN 3RYHB 1IBLO 1GW4A 3ZBHA 4KT0J 1YZBA 3BCCH 1K73W 1NI8A 2BSKB 2EZOA 3SJAC 3CCLP 4YIPA 2JP3A 1OVRA 1FBMA 4FFBA 5IY5B 1FJPA 1FE6A 4LP8A 3N2GB 1XTCC 4GX5A 4TLFA 2LQTA 1BHAA 3RYCA 4Z1MH 2OCCC 1CI6B 4LLHA 4J80A 4XDJA 3H1LD 3EHBB 2Q4PA 1AILA 1RM1B 4H13C 4DCKA 1J1EC 2WLJA 2FYUK 1BE3D 3C3TA 3HD7C 2JGDA 1RF1C 3W7TA 1IZ3A 3OTOB 3CRRA 5L8RJ 4PA3A 2QEXV 1FZGA 2KZJA 1JY2O 4ZOLB 1FZEA 1L0LH 3VQXA 3T1HO 3V4QA 3V6IA 2E76C 1AR4A 3ETDA 2QA4V 1B06A 2EULA 2KNCB 4LGDE 5GTHZ 5JJEB 1PL5A 5KAIH 1BSHA 3L72G 4PV1D 3JARA 4MVZA 3TSIA 1YJNP 3JCZA 1YDXA 1EDIA 4D7TA 1L0LJ 1MFTA 2A06G 1PIXA 2AZ0A 1KQGB 2QJYB 3L75D 4I50A 4RESB 1AROP 1EC5A 4Z1MG 1H2KA 4BIUA 3JAWA 5H2FZ 5LP6A 4WFEA 5AVUB 2B87B 2GHYA 2Q9LA 2AEJA 3G80A 2UUBB 1NWQA 2GTAA 1NTME 3B71A 3T1CA 5CBGA 4X64B 2C0WA 4I7ZB 4I55B 4JAVA 1L0NJ 1Q90D 2Q73A 3L71G 3CCQV 3V4WA 1FFTB 3CCJP 1JB0J 1NTMJ 3BCCD 4YHHB 4DR3B 4HH2A 2F93B 5A2QN 1CEZA 5AW1B 1AR5A 4RQFA 3V5BA 3CCVV 4DR6O 5KAIE 4QE7A 1NJIW 1RE3C 1K4CC 2RN9A 2E74C 4DRXA 4UB6Z 3JASB 3H1IJ 1KN7A 2HVJC 2YXLA 5LYJA 3CCRP 2GBOA 1TGOA 1HGZA 4O2AB 4IL6E 2J5UA 4I4TA 2XAFA 3CWBG 4J7ZA 3EXAA 5KLVE 1VQ7V 3GG2A 4L76A 1JY2P 2CPSA 2QSIA 1MSWD 2A45G 4W7ZA 2Q7GA 3GVMA 4O2BB 5DEDA 1SQXK 5KLIC 1BZKA 2V7QH 1Q2NA 4LH7A 3H1JJ 4PDRA 2FKWB 1KQFB 1VQ7P 2R9RB 1Q81Q 3SGIA 5DJUB 3H9VA 4O4LB 3R66A 3SPJA 3ABLB 5ITZB 4H0LB 2LFSA 3CX5I 3L72E 2H3OA 3N4XA 4W80A 5KHKA 1LTBC 2XNDG 1OCOC 1WAZA 3E35A 5AVSB 1PPJE 1MOFA 5EIBD 3AEDC 2HEPA 2KS1B 4FFKA 2VQFO 2H8PD 3EWKA 3SFEC 3WU2E 1F51A 5CCGC 1WPXA 2YXHA 2N9BA 4HNAA 1VQNV 1VF5C 4JI8B 1J2JB 1ZX3A 4B3SO 4OGQD 1VEWA 3IAYA 3I5CA 4BWAA 3CX5F 4JTCB 2Q0OC 1YIJP 1PFIA 3K57A 3HKCB 1MUUA 1ZV8A 2NPSD 3OAKA 2JS5A 1FPOA 1VQ4V 3SYQA 5EZYB 1PV3A 3FKSG 1XNRO 4JQ0D 4MVSA 2WLKA 2GUZB 4KUMA 4JI5O 2NPSB 1S5LX 4FLZA 3ZRWB 3FWLA 1BQ0A 3ASNC 3VN0A 1VQ4P 2QJ1A 1URFA 4DR5O 1FJGB 2JEUA 3ZHRA 1IURA 2F23A 2OYQA 4LF5O 4XA4A 5KJ7C 4HAMA 2IX7C 1L2PA 2QIWA 1BSNA 1M1JC 1D5AA 2Q67A 2M5AA 5FNVA 1SA0B 2OYIC 4X64O 3DTUB 1CXZB 1PPJH 3BY6A 4ABMA 3OUFA 3C9IA 3ABVC 3GHGC 3H1ID 4K35A 1DTOA 2B9BA 2X6CA 3K5LA 1XMOO 5TISE 4ZKPA 4DV3O 1K7DA 4I1LA 3OGIB 3SPGA 1LTJA 3AK3A 2Y0EA 3UT5B 2W6JH 4WY4C 1BT8A 2RKLA 5B66Z 2QJPC 4UB6E 4I5SA 2E5LO 5C8YB 4IYIA 1RPOA 2JJLA 5FL7G 3LW5H 3CMAV 2Q8VA 2M3BA 3T4DA 1O9GA 4P9OA 2HG5C 4CS2A 3D3IA 3FWNA 1RF1B 4JZGA 3BEHA 5B5EZ 4JPZB 1Q5OA 2WVRA 1URQA 2IPPA 1NTZJ 3A5TA 4YXWG 4B3RB 5IJ0B 5LA6B 2EIMB 4RO0A 1M7LA 4WFFA 2I1KA 5AVZB 3A0HE 1IX9A 1YTZT 3FB7C 1TUBB 4EFEA 4UCOA 1B3QA 1PGPA 1CPYA 1Q6IA 5GW7A 3ETGA 2ZQMA 1WT6A 2Q7CA 1VMGA 2P06A 1O9HA 5LBQA 3APOA 3CC7P 1SQBG 4H33A 1GW3A 4GIFA 1S2EA 2FYUH 2FYNB 3Q3DA 1RP3B 2B89A 3IGAC 1JCDA 2P1JA 1XL4A 2IZ1A 1NU1H 2BCCH 4B08A 3EVKA 2CUGA 3GMAA 3RYCB 1IBKO 3A0RA 4DR1B 1GL2A 1JFFB 1QL2A 2CE4A 2ZM6B 3RW0A 1BE3H 5JH7B 3HKCA 4RWUA 2D2CD 4CBCA 2UU9B 3IAOA 3AG2B 5CBNA 1VQ5V 3K5NA 5AW8B 4JI5B 4DV2B 1G4YB 4G2KA 4KL1A 1K04A 2HYNA 2W0XA 1OWAA 3CXHH 4K8XA 3OFNG 3GHGA 1WP8A 4JGSA 3ASNB 4RQEA 2A45I 5AVVB 4NVPA 5JJJB 2WSFH 1YVWA 3S4RA 2DN9A 2WLHA 5AVWB 4AQRD 1YI2P 3BRCA 1LP1B 4FLWA 1AV1A 1L4AD 1SQVG 1VPCA 1VQ6P 3JSLA 3GB7C 2FY8A 1SQPK 1Z2GA 2R32A 1GN4A 3H01A 4KFMA 2G8YA 1Q82Q 1LT9B 5B1NA 2QSAA 2BCCE 1UFIA 1GL2C 1FXKB 2DQ0A 2W83C 2WITA 1KYOE 2YS8A 2QJYC 2BE3A 4D6TE 5L3DA 4DV5O 5APYA 4D6TG 1BE3E 5AVYB 3SR2C 1TAEA 3VOPA 2H7HA 5CCHA 1M5IA 2KXPB 5AW3B 1YJWP 2B5UA 1GD2E 4UCTA 3CXHE 4LWSB 2P7JA 2R9AA 1PNMA 2W6IG 5B3SC 3L36A 1E1RG 4OX9O 4HKZH 4JAAA 1SQBD 2HJFC 1LTSC 1GU5A 2WSEH 3MHVA 4PELA 1VQ5P 2AXCA 1PL4A 5CBOA 2VS0A 4J10A 2Y0PA 2Y4UA 3GHGB 2XAJA 2Q9IA 4PJ0Z 5F2VO 3CCEV 4YY3O 1VDFA 5E79E 4DV3B 1KYOH 2KKWA 1IVSA 3K79A 3C90A 4JI2B 1M8OB 4FLUA 3H1JG 3F7YC 3ZRVA 3ABMB 4LF8O 3CCRV 1GH6A 2HHHB 1G1IA 3OTOO 3N2KB 3MUDA 4DW0A 4PDLA 1JFFA 2EJRA 1PV0A 5LOVB 1SQPE 3ZX6A 4L87A 1OCCC 4EB6B 2QEXP 2HP8A 3B77A 2DMXA 1N86A 5E79Z 2XZRA 4R8CA 3MDSA 3P30A 1E5WA 4RAIA 3QO7A 2FXMA 5K1XA 3GF7A 1Q6UA 5LXTA 1M93A 5LGTA 1GN6A 1THZA 1JOCA 2HPCA 2Q5UA 2ILMA 1Y4MA 2ZR2A 1WPBA 2F66C 2YEVA 4Q20A 1X9VA 1SQVD 3JCUE 3ZRSA 4O4HA 2WPRA 2P90A 3K58A 5L3FA 1VQ8V 1JMBA 5C39A 2YKQA 3JD4A 1V54C 4UVBA 1OCRB 5HFMA 2JIZG 1SQQE 3L70J 3ABLC 5KAFE 4U3FH 3A7OA 2L91A 1R1BA 3FB5C 1G6UA 3FD9A 5IYCO 1KQLA 2QWRB 4MVQA 4ZHQA 2QKSA 2MJZA 4AILC 1FDMA 3L73D 2HLOA 1GL2D 2EIJB 3L70H 2IYOA 4UVAA 3AEAC 3L72D 3HKDA 2PF4E 4UB8Z 3RK3B 4LF7B 3S1KA 5IYZA 5TJHA 2BSKA 3S3WA 1PPJD 4JI7O 3L70D 1JCHA 1P84E 2XOKG 1AVOA 4KHPO 3UT5A 2R3CA 1PP9G 5EBMC 1YHQV 2V7QJ 3BASA 5IYDO 1Y9BA 2FBWC 2NLJC 2K1AA 3RYIA 1XEQA 3CL3D 3CD6V 4G28B 2Z5IA 4EDFA 4IHJA 5CA0A 2JR8A 3AEGC 1J5EB 1VQKP 1WRGA 4U3FG 4U3FE 2E75C 1KMIZ 3DXRA 2AHYA 4TOIA 2BCCJ 1SETA 1TA8A 1ZL8A 1HNXO 4PV1B 1SZXA 1E79G 1SQXH 4I7ZC 3HPLC 1Z5WA 4DUYO 3L71E 1TUBA 5IYZB 1AI7A 5BZBA 2OTLV 3O9OA 3G67A 3TCUA 4CH5A 2QM7A 3BRVB 1SQXJ 2KG7A 1H89A 2K1EA 1TUEB 1FU1A 2BTOA 1GZLA 3CS5A 1OCZB 2KK7A 3TNUB 2ZAEB 4OXSA 2SPZA 3IR9A 3J80N 3RL0g 4DV6O 1SQBH 1HF9A 1FXVA 4JI0O 2ZYAA 1SS1A 3ABKB 1VARA 2Y0IA 1NTMK 3CJHB 1M1KQ 5LHHA 2KYVA 3SWFA 3H1KD 4N6JA 4TWKA 3D6YA 2VQEB 1QCEA 4LH6A 2X6BA 1EN4A 4C46A 4CH4A 2Z5HA 1XMOB 3BPZA 5B66E 3QNEA 4NPEA 1NTKE 3M0AA 3ZHTA 4ZI7A 1H8HG 3P8CE 1Y76A 1AI4A 1NS1A 3CSXA 1LJ2A 1US6A 5LYJB 2VQFB 3L71J 3JAKA 1BGYE 3EQ2A 1FDIA 3AG4C 2HKOA 2OWOA 1IO4A 2WAMA 4F4LA 2ITAA 1M56D 1VQ8P 2RNBA 5IE9A 4X65B 3FB8C 1M56B 2XU6A 1HWYA 4EOTA 1W2BU 4DV7B 3OAAG 2N74A 1PGOA 2NN4A 1KB9D 2WLNA 1G1JA 3LSUA 3OJAB 2E75B 2AEFA 2RDCA 5CCHC 2E75D 5BU5A 4DR2O 2FYUJ 3VMAA 4NPDA 2CGNA 4DR7B 3FYIB 1NTKH 5DECA 4JYCA 1NT2B 3QH9A 3G4SV 1R3KC 2WWWA 2D3OW 2B88A 3KKYA 5GONB 2UUCO 5AW7B 4DW1A 4O4IA 4I0XB 3JATB 2QKAA 4FZ0A 1GDTA 3RK3C 5B3SB 1ZUQA 3C1LA 4L73A 3SYPA 2UXDO 1Y47A 4N3YB 2BCCD 3L75E 2HHHO 2QTSA 1OZHA 1EXIA 1NQTA 4JI6O 4MTGA 1LP1A 1Y66A 4TT3H 2IDBA 1BS3A 2WLLB 2QR4A 3AG3B 5KHIA 4F6RB 1H0TA 5LHGA 4DR5B 5KHJA 3JD1A 5APVA 3WG7C 1CI6A 1DEBA 3E2EA 1MKMA 1S3JA 3PLNA 1NTMH 2A9HA 4EKWA 4IL6Z 2XDJA 4FFBB 2X7RB 2HJDA 2ZE8A 2M7WA 4YJ3B 4JI4B 2WQYC 2IU3A 3H1IH 3U11A 5KMGB 5CJ0A 2JDIH 5KAIZ 3BRTB 5JCOC 2I8DA 2P7TC 5BXZA 1K05A 2YKPA 3R4YA 5CCGA 5J2UA 3BA9A 3SPHA 4AUWA 1QBZA 1R5SA 1S4XA 4BXLA 3W7XA 2E74B 5EC1C 4JI1O 3AG2C 3L74G 1E1QG 3CX5D 1LTGC 5CA1B 4B3MO 2W90A 4NYKA 1SQPD 2XAGA 3BHPA 3JD0A 1BGYG 4YPCA 2OTJV 3B09A 2WSEJ 1V55C 2KI7B 3SJCC 1NTMG 2QJPB 1NTZG 5H6QA 3II6A 4J42A 1AA0A 1A32A 2V1DA 2PZSA 3H1KG 2DYRB 1SQVE 4GX1A 3TNUA 1UPGA 2E76D 1EDJA 4JI3O 3AECC 3SFDC 2WSCJ 1QHTA 3I5DA 3VP9A 4DJGA 2KG7B 2CK3G 2IM9A 2DWDC 3SWYA 1ZMEC 3L35A 2QG4A 3RGBA 1SQBJ 2AEMA 3VP8A 4DR3O 4FM1A 1FZBA 3TYYA 1GK4A 1EZVH 3B5NA 3NXSA 3Q1MA 3TGUE 1NVPB 1IBLB 2NNUA 2OYHC 1WLEA 4GKJB 4O4JB 1KB9I 3M8AA 5FNVB 1E79H 4GKKB 1R5LA 3O6QA 4DZOA 3DXRB 3C3SA 1RQVA 1M90W 3ZHUA 3AEIA 4TV8A 1VQ6V 1R6KA 5B1AB 3OR7C 1N2DC 4ZBMA 3FFQA 4J41A 3M99B 2CDYA 1KORA 1K8AQ 5LOVA 1HDJA 4UUJC 3N2KA 2YNYA 5EC2C 1OCRC 4DUYB 3L74E 2C0XA 2QJKB 2PYJA 2Y69C 4LF9O 3HTKB 4I2LC 3KCXA 1FZCC 1S5LH 5KMGA 4NXNO 1FAVA 3IC7A 4F6EA 3ZN1A 2DE0X 2CH7A 1JMMA 1KU9A 4FMTA 1H2SB 3HKBA 4FLVA 3NMDA 3HKDB 3M91A 3T4ZA 1XDCA 1K4DC 4UB6H 1GKFA 2IBZG 3N27A 1F4NA 4ZHQB 4DR6B 2W0FC 3CC4V 4HNAB 4DO2A 2FXPA 2KSEA 3MTUE 1N7SA 1YIJV 4DK1A 2O01J 1V55B 5AG2A 3VMXA 3HUSB 5EYPA 2IW5A 1P49A 1FXKC 4O2BA 1KKCA 1VF7A 3L73J 3U1CA 2VWKA 4PD4E 5K1PA 4XE5B 1OCZC 1A02J 4I6MC 5AVXB 4ASVA 2KSJA 2BEZF 3T97A 1SERA 2F95B 2UXDB 4EB6A 2BEQD 2P10A 3H1KE 3EFFK 1YTFD 2UWJE 2IFMA 1OW8A 4DR4B 4DR7O 2FTKA 1LUVA 1VF5B 4PA6A 4IOIH 1KQSU 4I55A 1R3IC 1NTKD 2IZ0A 2KZIA 3CHXA 1FD9A 1ZRTE 4LNUB 4JYYA 3K5OA 4YXWH 2QWQB 3L9DA 1HUCA 3VYIA 3VOUA 4OGQB 4BW9A 5IJ9A 1AVMA 2M0BA 4BWNA 1JO5A 1DD3A 1GL2B 3L72J 4BW5A 2IBZE 1K9MQ 4X1IA 4NB5A 3CCLV 1LWUB 2M3EA 3VQWA 2ZYGA 3B8EB 2E42A 3E8GA 3JAWB 3IC9A 2UXCB 1NH2B 1NKNA 2GV9A 4A7PA 1ZR4A 4WB4A 1Q43A 3L72H 3TK1A 3SWKA 3HUSC 2JWDA 4GLXA 2CGOA 2XNXA 3K3WA 4CH3A 3H1HH 4D6TH 5BR8B 1Q7YW 4HYTB 3H1LG 4MTOA 4WFHA 3K04A 1JY3O 1P7BA 4GZRB 4XDKA 1B6QA 4YIOA 3FAVB 1U96A 1HW7A 1V54B 3ZEDA 2IU0A 1M4UA 3WB2A 2AGAA 3ETQA 2Y0CA 3ZHQA 1EN6A 1ROPA 4LFBB 1SFCD 4QNHB 4DYLA 4YJ2A 2QA4P 4P2ZA 4X66O 3ITKA 1HJBA 1LGHB 5KHGA 4IT5A 3CMEV 5KX5A 1N73A 5H2FH 1YCIA 4R4LA 3B8MA 1KUQA 1HNZO 4M3LA 1YEWA 5K5GB 1N36B 2ZNIA 1HNXB 1NTKJ 3FGAD 1MZFA 3K0DA 4JI4O 1NGMB 3N2GA 4CZZA 4WBNA 2WT7B 4BIOA 1ZW0A 2N1TA 1Q86W 3IF4A 2E5YA 4WFBV 5FPRA 4JAUA 1RM1C 1MMMA 4LNUA 2ZVNB 1SA0A 4GT1A 3GW6A 2KUBA 1T8ZA 2GSMB 3CC7V 3CCQP 3AEEC 4BAYA 1NU1D 2MKVA 1K92A 1XI1A 3L37A 4LF7O 1QLEB 2G38A 3RK2D 3K9SA 1X0TA 3SPIA 2DW3A 3K9AA 1MA1A 1ENVA 4R7CA 2FYUD 1T2KC 1YXBA 2JJ1G 1KB9F 1DH3A 4X1YA 3KG2A 4LF9B 5GTIE 3AK1A 3TXSA 1GM9A 3FB6C 4GDOA 5B1OA 2Y0DA 1N7SC 1SQQG 4J7JA 1RF1A 2ZT9B 3HKEB 1MSDA 3AE8C 3MGNA 1RHZB 5KA5A 4DR2B 1Q3EA 4H0LD 5L3CA 1IFJA 3L70E 2YICA 4TSFG 2O1KA 3CI9A 5AW5B 2Q6AA 4QE9A 1GO3F 2LKMA 1HNWB 1N34B 1FOSE 1B04A 1AJYA 4LF4B 2LO1A 1U7JA 3W67A 4U3FD 1X8YA 4JI7B 2EILB 2R5BA 2YMYA 3TGUD 4X89A 5CCHD 3WB0A 3H32A 1D2DA 3B40A 3ZRWA 1W0KG 4CC5A 2AXTH 4DRXB 3LIDA 2P4KA 1CSBA 5EZYA 2W6JG 1GM7A 3WFVA 4HZ3A 1BCCJ 1GK6A 4OH8B 1BDCA 1I94O 2DYSB 4PV1C 1COWG 5KLVJ 1AJQA 1S9KD 3CXHF 4WY4D 3USSA 1IBMB 5GTHE 2O57A 3I55V 4YHHO 2ZXWB 2XUMA 3CWBJ 4GCZA 3ZCCA 3AEFC 4U7JA 3T1YO 1IBKB 1PD3A 1IFNA 4C7NB 3B5NB 5IT9N 3T1HB 4EFBA 4OX9B 2WSCH 4FZ1A 3PP5A 4GKJO 1KBHA 4Q6GA 4XFJA 1SVFA 1RY3A 4MVUA 5IY5C 4PD4I 4B3MB 5KUKA 1K5QA 1LNQA 2L6LA 3ASOB 3F5HA 2KLVA 4FK5C 1IC2A 1PGQA 1L4AC 5L3BA 4DT0A 4MVRA 3E22A 1FZFA 3SJBC 1P7GA 4O2AA 2KIKA 1AQ5A 2JEXA 2RQ6A 2IJHA 4N23A 3E1IA 2YO3A 1WMKA 4PD4D 1BE3G 4X62B 5GTHH 1ZP0C 1KB9H 3RL0B 2WTYA 3B8NA 1VF5D 4QJFB 2WMMA 3HE4B 1NTKK 2XV5A 2PI4A 2UXCO 3M9BA 2UXNA 1LTAC 4R4MA 1LTIC 5E79H 3L75J 5AW2B 3HB3B 4TV8B 1AI6A 1IFDA 4L74A 2X6AA 3SYCA 1ZLLA 3O8ZA 4GOFA 1KD1W 1FS0E 3KCYA 2JK5C 2YXYA 5LMNO
chains in the Genus database with same CATH topology
4H0LB 2E76D 2D2CD 3AECC 1ZRTE 4YXDC 2ZT9D 1DD4A 3IAOA 3SFDC 2WSCJ 1FDOA 4H0LD 4KT0J 2D2CB 1ZOYC 3AEDC 1K04A 3RK3E 3EWKA 3SFEC 2JP3A 1ZMEC 2WPVB 4OGQB 1OMIA 3AEAC 1VF5C 2E75B 1DD3A 4OGQD 4Z1MH 2OQQA 2E75D 3Q1MA 3AE1C 5M1BA 1GMJA 1RQUA 3AE4C 1AJYA 4H13D 1U57A 4H13C 2V7QJ 1PV3A 3O6QA 5KKZC 1Y9BA 3Q5PA 4H13B 2FBWC 2G8YA 1R8EA 1RQVA 1TU3F 1DIPA 1S5LX 1EXJA 5L8RJ 3AE7C 3AEGC 4YTPC 2QJYC 3Q5SA 2G3AA 2E75C 3AE9C 2JO1A 1KMIZ 4H44C 1KORA 2QIWA 2E76C 4PV1B 2QJKC 1EXIA 1UIXA 4PV1C 1PL5A 4H0LC 4I7ZC 3ABVC 4PV1D 4Y28J 2D2CC 3AE2C 4TT3H 2IDBA 1PIXA 1KQGB 1IK7A 4R4LA 1VL2A 3IN6A 2FYNC 3GLMA 3AEFC 4U7JA 2WSFJ 1HJ0A 1MKMA 3FGAD 1NYHA 2QJPC 1NGMB 1OW6A 3B71A 1YQ3C 2H88C 2FXPA 3GF3A 3AEBC 4I7ZB 2WQYC 2YMKA 4XFJA 3D71A 4H44D 2O01J 3AE6C 1S1CX 1Q90D 3RL0g 3G9RA 1HF9A 2NZ2A 1JB0J 4H44B 1K05A 2K9YA 3R4YA 3D6ZA 3Q2YA 1OW7A 3C8VA 4OGQC 2E74D 1KTMA 2E74C 2YIUC 3AEEC 2MKVA 1KILE 2E74B 3T97B 3D6YA 2ZT9C 3GF7A 2BEZF 3LW5J 1WMKA 2J5UA 3S9OA 2BEQD 1ZP0C 2P10A 3AE3C 4IL6X 1VF5D 2WSEJ 1OW8A 2QSIA 4RKUJ 3Q3DA 4R4MA 3D70A 5KLIC 4GDOA 1YQ4C 1VF5B 3Q5RA 3AE5C 1KQFB 3GMAA 1FDIA 3H25A 2E76B 2H89C 2ZT9B 3AE8C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4H0L B;  2FYN C;  4H13 B;  1ZRT E;  2YIU C;  2WSC J;  2E74 B;  1S5L X;  2WSF J;  4KT0 J;  5L8R J;  2D2C B;  2QJY C;  2QJP C;  3LW5 J;  2WPV B;  4OGQ B;  2QIW A;  4IL6 X;  2E75 B;  4PV1 B;  2QJK C;  2QSI A;  2WSE J;  4I7Z B;  4RKU J;  2O01 J;  5KLI C;  1VF5 B;  1Q90 D;  4Y28 J;  1JB0 J;  4H44 B;  2K9Y A;  2E76 B;  2ZT9 B;  3C8V A;  5KKZ C; 
#chains in the Genus database with same CATH topology
 1JJO A;  3ABU A;  2K9J A;  2Q7E A;  5BY1 A;  5KAF Z;  1VQO V;  3BCC G;  2ZCE A;  2OIG A;  5H5N A;  3GWK C;  3WMM 0;  1YF2 A;  3L73 H;  2D2C B;  1NKD A;  1J1E B;  4YJ3 A;  2VRS A;  1VQP P;  1NVO A;  5HFL A;  2ODM A;  1H8A A;  2Y9Z A;  2F4V O;  3H1L H;  3FX7 A;  4JV5 O;  2FFD C;  1T5E A;  3LNM B;  3H1H D;  3ETE A;  1VQP V;  1KIL A;  1GMJ A;  1AVY A;  2ZD9 A;  1KB9 E;  3RK2 C;  2VQE O;  1KYO D;  1Z5V A;  3WB1 A;  2JWA A;  1VQK V;  3A3Y B;  2KNC A;  2IBZ D;  2UUA O;  2IH3 C;  3AG1 C;  5KKZ C;  4LFC O;  2AHZ A;  4YJ2 B;  2RH0 A;  1TU3 F;  3ZHV A;  1RH5 B;  4UV8 A;  4X8A A;  3OGC C;  1L0L G;  1EZV D;  2YKO A;  2Q7H A;  2CTQ A;  2HG5 D;  2Q3E A;  5LHI A;  4FLX A;  3LDC A;  1WB8 A;  2Z5U A;  1W2E A;  2R70 A;  3OE7 G;  4FVM A;  5IJ0 A;  1KV4 A;  1YBK A;  4Y99 C;  4Y28 J;  5BU8 B;  1JM0 A;  4NXM O;  1USD A;  3M0D A;  1OVU A;  2EX3 A;  3HR0 A;  1BDD A;  3CB2 A;  2EIK C;  1N36 O;  1OIP A;  3KQG A;  1G1X B;  1DF5 A;  1YIT P;  1QR9 A;  1OJH A;  2N04 A;  5J2U B;  5C8Y A;  3CRM A;  3THO A;  5APW A;  1N33 B;  4C7N A;  1VQO P;  4C7U A;  4NKG B;  3A2A A;  3RBZ A;  1PP9 J;  2DYS C;  4RJT A;  3H1I G;  5KJ7 D;  3IJ4 A;  1DEE G;  3STZ C;  1JA8 A;  3ZMU A;  2YMK A;  2NPS C;  4GUN A;  3ZMZ A;  4FPP A;  3UM7 A;  1YTZ I;  2WPQ A;  2OCH A;  3L71 H;  1N7L A;  1IFI A;  1SLQ A;  1QNM A;  1H0T B;  2KP8 A;  3NR7 A;  4OGQ C;  1KTM A;  3CCS P;  1ZR2 A;  2W6A A;  3U1A A;  4P30 A;  5D5Q A;  3CCJ V;  3VMZ A;  4TT3 G;  1BCC H;  1USE A;  1N0J A;  2ZT9 C;  1N73 C;  2BOC C;  5EBL C;  3LW5 J;  3S9O A;  5EBW C;  1FZC B;  1X59 A;  1SQQ D;  2P67 A;  4UCU A;  3O65 A;  4MVM A;  2UXB O;  1FJG O;  3A0B Z;  4A5U B;  2HLD G;  1YTF B;  4WWI A;  2Q68 A;  1NJI Q;  3Q5R A;  1SQP G;  3F5T A;  1Q82 W;  2ZXX A;  3P3N A;  3OMI B;  1PL0 A;  2V7Q G;  2IFN A;  2OTL P;  2H89 C;  4R50 A;  4IFM A;  4X20 B;  4LFC B;  2LXC B;  3W7U A;  1N7S D;  3KXD A;  4YXD C;  3CME P;  2PFX A;  1JR9 A;  4W4L A;  3H6P A;  3HUS A;  3AG1 B;  4QMA A;  1XIL A;  1N8R Q;  1VQ9 P;  4DV4 B;  1WJZ A;  2NR5 A;  2HR3 A;  4BRY B;  1BL8 A;  3JAL B;  3W7W A;  3MUD C;  2WLI B;  1Q81 W;  1RF0 C;  1G8M A;  1HNW O;  4X20 A;  1EZJ A;  5D5P A;  1BCC G;  1SQF A;  4QPK A;  3RGU A;  2H43 A;  3OMN B;  1VP7 A;  2LJ2 A;  4GKK O;  4O9B A;  3RK3 D;  4GX0 A;  2R5D A;  3G6E P;  1L0L E;  2RJZ A;  2YSU B;  3APQ A;  3CE2 A;  3QO5 A;  4X1Y B;  1AI5 A;  3J81 N;  1HR0 O;  1GAX A;  2HFE D;  3WU2 Z;  3Q5P A;  1HR0 B;  4JYB A;  4X88 A;  1LTJ C;  5JQG B;  3G6E V;  4PDM A;  4UFZ A;  2K3R A;  3AE7 C;  3V2Q A;  3VBB A;  2W6B A;  5J9P C;  1QL1 A;  3L71 D;  1PKX A;  1KEC A;  2AW9 A;  3B5N C;  4PI2 A;  1X22 A;  1Y67 A;  1S5L E;  2CTP A;  1DK1 A;  1RF0 A;  2D2C C;  3A0B E;  3KZI E;  3QTC A;  3ABT A;  1FS0 G;  5B1B B;  3KDP B;  3M06 A;  5KLV K;  1AJP A;  3L74 D;  1EZV G;  1OCO B;  3IN6 A;  2FL4 A;  5CJ4 A;  3E7K A;  1SQG A;  5J2T B;  4N78 D;  3KZI Z;  1JNM A;  2LGW A;  3OEH G;  2QVA A;  2YDE A;  2QWN B;  4L8J A;  4DXW A;  2EJ7 A;  3HKE A;  3AEB C;  3CX5 H;  2QWP B;  1H2L A;  4KXR A;  3L75 G;  3F89 A;  3HD7 D;  2EIM C;  5CBF A;  4J9Z B;  1BSM A;  2ZE5 A;  5KUM A;  5J2T A;  2VWJ A;  4LF6 O;  1BQZ A;  1L0N D;  1MZ9 A;  4IL6 H;  4ZKI A;  1OW7 A;  5KLV H;  3WG7 B;  4U3J B;  1HP8 A;  4EI2 A;  2LP7 A;  2IH1 C;  2ADQ B;  1R73 A;  2YI9 A;  1GN2 A;  1QU7 A;  3CCV P;  2YIB A;  3AG7 A;  4N21 A;  3M7M X;  4NXN B;  4K3A A;  1KQS O;  1KIL D;  2YXR B;  5H6R A;  4RKU J;  1EBO A;  3D70 A;  1UJW B;  4RUE A;  3QG5 A;  5CA3 A;  3HE5 B;  1LT1 A;  1EQ7 A;  2YIA A;  3RYI B;  3RN4 A;  1URQ D;  1I5Y A;  1XQ8 A;  3OM3 B;  3BAT A;  2EZP A;  4GYC B;  4PA7 A;  2ZJS E;  3IFX A;  2ZM6 O;  1DD4 A;  4W7Y A;  2YC0 A;  5BVZ A;  3LDE A;  2W27 A;  3CC4 P;  3R2P A;  1XNQ B;  4ZMD A;  2WLM A;  3TGU G;  2WPV B;  3CCE P;  1RSO B;  3VQV A;  1ZRT D;  2WSS H;  2A7W A;  5CMU A;  1SRY A;  1OCC B;  1MNG A;  2ZVO B;  3SYA A;  3ASO C;  1JX9 A;  1SQX D;  4YY3 B;  3RBX A;  3TF5 A;  1SQQ J;  4U3F J;  2LR2 A;  1IFM A;  5KKZ B;  1KC8 W;  3G3Z A;  1L8D A;  1FJK A;  1SQQ K;  4DOJ A;  4H37 A;  4O4L A;  4DV4 O;  3H1H G;  3P3P A;  3H1H E;  2WLL A;  4JYA O;  2PAJ A;  3P8M C;  3ZDM A;  4HB1 A;  3JAT A;  3KHU A;  1U97 A;  3CLQ A;  4YTP C;  5GON A;  2RN0 A;  1S72 V;  2GDS A;  2G3A A;  4J7K A;  2OYO A;  4ZKU A;  1S77 D;  3AE9 C;  1P84 F;  3W7S A;  2BTQ B;  1K73 Q;  3CC2 V;  4QPJ A;  3H1J E;  1Y74 B;  4WF9 V;  4NXM B;  5LXT B;  1I5X A;  1EZV E;  4NTX A;  3B4S A;  1UIX A;  1EFR G;  4H0L C;  1YIT V;  2C9N Y;  3NFQ A;  2GM4 A;  5EYP B;  3TGU H;  1GRJ A;  3AG3 C;  4E2L A;  2EIJ C;  4PJ0 H;  5H2F E;  4AI8 A;  1I0H A;  3QVN A;  1DLB A;  2OIE A;  2JEE A;  2FYN C;  2XND H;  3U59 A;  3OW2 O;  1YJ9 P;  2NZ2 A;  3LNN A;  3A8T A;  3AG4 B;  5JJN B;  1N0N A;  1GTO A;  2Y9Y A;  3J7A U;  2OYH B;  2ZIN A;  2GUS A;  1R6T A;  1DF4 A;  3QWO C;  2XAS A;  4BIZ A;  3A0H H;  2A06 H;  2BOB C;  5KJ7 A;  3FX0 A;  3JAK B;  2Q5Z A;  2EIL C;  4PHZ A;  2ZIO A;  4IIJ A;  4X1K A;  3CCU P;  2F43 G;  4ZI7 B;  1LT9 C;  2OAR A;  4BR6 A;  2VRZ A;  2FYU E;  3E86 A;  5LMU B;  2YIU C;  3I56 V;  2PYL A;  4E4E A;  3CCU V;  3T97 B;  3BCC E;  3BVH A;  2K9P A;  2PUS A;  2WPD G;  1PGJ A;  2EIN C;  1J1D B;  1N34 O;  1IJD B;  2GUV A;  3OT7 A;  4TUY B;  2J58 A;  1S76 D;  3JD3 A;  3L4F A;  3VMY A;  3CXC U;  1RE4 C;  5EK0 A;  2KSD A;  4B7E A;  4O4J A;  4B86 A;  4W4K A;  1WNS A;  4UCS A;  1EDL A;  1H2N A;  4K0K O;  3QF7 A;  3H25 A;  5E1A C;  1DX7 A;  1N7S B;  2A06 E;  1GTW A;  3K5M A;  2DJV A;  3CPW O;  1IFP A;  1HVV A;  3CWB E;  1FDO A;  1RFY A;  3LIE A;  3I55 P;  2ETN A;  3SJQ C;  1EN5 A;  2FKX A;  1K8A W;  4B3T B;  4WBA A;  3JD2 A;  3OW2 U;  1OMI A;  2B9Z A;  1NTZ E;  1UII A;  1G2C A;  2HOD A;  1W0J G;  3E89 A;  4JPR A;  3AE1 C;  3HTK A;  3CD6 P;  3ZMT A;  2ADP A;  3AE4 C;  4H13 D;  1U57 A;  2QE7 H;  2E3C A;  1W2B O;  1ZLZ A;  3E8F A;  2E5L B;  1DIP A;  1F4M A;  1IXM A;  1P4R A;  5CA1 A;  3CPW U;  1L0N G;  2O1J A;  1CP9 A;  1JUN A;  5LP6 C;  5CA0 B;  3RYF A;  3E1R A;  2YIB D;  3HE4 A;  1SQV K;  3K06 A;  4JBZ A;  1NHL A;  2FML A;  1GMG A;  2DOS A;  3CWB H;  2IBZ H;  2JVD A;  4DK0 A;  2ZNJ A;  2N1T C;  1XMQ B;  1M57 C;  3RYF B;  2B1G A;  2B1I A;  1KFM A;  2GA1 A;  1I7F A;  4DR1 O;  5B5E H;  4IFD K;  2GUZ A;  5CMZ A;  4MTX A;  1VF6 C;  1WA8 A;  5KHH A;  3D8C A;  2POH A;  5CN0 A;  2YO2 A;  1YJW V;  1QVF O;  2PGG A;  4D7S A;  3V2N A;  1BMF G;  1S9K E;  5LMU O;  1SQV J;  3RVZ A;  1OFC X;  1HGV A;  1H38 A;  3E8H A;  2OT5 A;  4LFB O;  1PP9 D;  3MHS C;  1YQ3 C;  2Q0A A;  1HBW A;  1SFC A;  5DN6 G;  1SKV A;  1D7M A;  4OPH A;  4BRY A;  4WVZ A;  2KS1 A;  3JSV C;  4DUZ O;  1U7M A;  4CC6 A;  3DGE A;  4UVC A;  3A0H Z;  3AK2 A;  1F23 A;  1KP2 A;  4FLT A;  4AHC A;  1LTJ B;  2FB5 A;  3ABK C;  2KB7 P;  4HJG H;  2KOG A;  1QLE D;  3RK2 B;  3Q4H B;  2ZXE B;  1MAB G;  2F4V B;  5B5E E;  5BMV A;  1SP4 A;  1FXH A;  1AFO A;  4UV9 A;  3WU2 H;  3OEE G;  3TGU J;  2Z4E A;  1M9N A;  2AZ2 A;  3AE3 C;  4DV0 B;  2ITD C;  1R6N A;  2EIK B;  4JZ2 A;  3PTZ A;  4G27 B;  4X1K B;  1YQ4 C;  4PI0 A;  1NR7 A;  2ZE6 A;  2HVK C;  1JY3 P;  3F7V C;  1BCC D;  2R44 A;  1JTH A;  1K33 A;  1W59 A;  4B3S B;  1NH4 A;  1RE3 A;  1YJN V;  1I08 A;  4IFF A;  5TIS Z;  4J11 A;  5IDJ A;  1Q7Y Q;  1S5L Z;  3H1L J;  5AW6 B;  2UXB B;  1SF9 A;  1YI2 V;  3R65 A;  2JRI A;  5AW4 B;  1EM1 A;  3D36 A;  5GTI Z;  1AJN A;  3H1L E;  2OYH A;  1JTH B;  2WA3 A;  2YI8 A;  4PDV A;  1XNR B;  4K0K B;  2J59 M;  4LWS A;  4ZNC A;  2UUA B;  4KHX A;  3DSQ A;  3SDL A;  3BAB A;  1Z56 A;  1RQU A;  2O3J A;  1LR1 A;  4MW3 A;  3NTN A;  1HTL C;  1SQX E;  1LTT C;  3K59 A;  3EFG A;  3TDK A;  3CCS V;  1HWT C;  5BMV B;  4O4I B;  3P32 A;  1FXK A;  4OVN F;  1QVF U;  3Q5S A;  3UO2 A;  3ICX A;  2ZKO A;  1Y74 A;  1URQ C;  4L75 A;  5JCO A;  1FZC A;  5APT A;  2BTQ A;  3ML0 A;  2PY5 A;  1XHZ A;  2IYP A;  4DR4 O;  5EIB C;  2JGD B;  1R3L C;  4MW8 A;  4GOE A;  1PM9 A;  1N33 O;  3DC5 A;  1SFC B;  2C9L Y;  2YID A;  1EZV I;  3GLM A;  4AQY O;  5LGU A;  2AXT Z;  1HJ0 A;  3BA8 A;  4WFG A;  4DV1 B;  1NYH A;  1SC5 B;  3X2Q C;  4QIW F;  1JOY A;  1OW6 A;  2N1T B;  1JVM A;  5JH7 A;  2ZYD A;  4D6T J;  3G71 V;  1H2G A;  2CH7 B;  3D3Q A;  2JDI G;  3UIA A;  3QO8 A;  2ZFC A;  4ICG A;  3AE6 C;  1OHH G;  2OGU A;  4NR1 A;  1GU4 A;  3G9R A;  1NU1 E;  2P58 A;  3T1Y B;  3WUU A;  3HE5 A;  5LP6 B;  1BGY J;  4H44 B;  3G71 P;  1Y6X A;  3HD7 B;  1WP7 A;  2A3Q A;  2E74 D;  2H8P C;  1P84 I;  2OCC B;  5DJT B;  5B66 H;  2YUA A;  4U7N A;  5FLX N;  5KLV D;  1GK9 A;  1WN7 A;  2PI5 A;  2IBZ I;  1S72 P;  2OTJ P;  4FJC C;  2UXX A;  1J95 A;  4LC1 A;  1GM8 A;  2LGQ A;  1BGY H;  4EEQ A;  2RMZ A;  2PTM A;  3Q4H A;  4GX2 A;  1S5J A;  4DV7 O;  1OX3 A;  1SQX G;  3CJH A;  4PD4 H;  3OTF A;  1IDS A;  2O01 H;  3LUT B;  2P22 C;  4ZOL A;  3MIW A;  2JJ2 G;  3RWR D;  2A45 H;  4NTW A;  1HH0 A;  1URQ B;  2E76 B;  4U3J A;  4I9Q A;  3H1K H;  2IJJ A;  2Q6Q A;  3MHH C;  3JCU Z;  1MFZ A;  1JQ0 A;  1LUW A;  5LA6 A;  1AR1 B;  1MG1 A;  1FFX A;  4IGG A;  4AYC A;  2P4V A;  1LWU A;  2CK3 H;  1X79 B;  1ZOY C;  1PPJ G;  3UCS C;  4X1I B;  1FFX B;  1M1K W;  1AB3 A;  1M90 Q;  4UCV A;  1L0L D;  4LF8 B;  1KYO F;  1VIB A;  1CZQ A;  4P9P A;  2OQQ A;  1L4A B;  2OYI A;  4DV5 B;  3BAA A;  4OWF A;  1IZN B;  3JC2 2;  3F5W C;  4O4H B;  4HYO A;  2K9J B;  2YEV B;  4LCU C;  4B7K A;  1NVP D;  2L5G B;  1OZ0 A;  1ZL8 B;  3TET A;  2M5A B;  3I56 P;  3D36 C;  1QLE C;  4LR3 A;  1ZXG A;  1N8R W;  4GOD A;  1R8E A;  3JYC A;  3OMA B;  3MP7 B;  4KP4 A;  1XUQ A;  5KTB A;  1Q86 Q;  4AQY B;  3V2R A;  2CTR A;  1S0V A;  4K8Z A;  4R6Z A;  2JO1 A;  3X2Q B;  1Q6H A;  1PP9 H;  3K08 A;  3V2P A;  5JVD A;  2QJK C;  3CRC A;  3PN1 A;  1X4T A;  5CHX A;  3A0B H;  1W5C E;  3H32 B;  3FXE A;  4N78 E;  3ZIA G;  5JQG A;  1FZA A;  2JS3 A;  3IFM A;  2HOD B;  1M56 C;  3PHL A;  1F7Y A;  1K3E A;  4CPG A;  5TIS H;  3ZMV A;  3CXH I;  2WLI A;  1JPX A;  1JCC A;  1VQ9 V;  4WY4 B;  4JI1 B;  3H1H J;  3H1I E;  3OUS A;  2FYU G;  5A9G A;  1QQC A;  1M1J B;  2FYZ A;  3OR6 C;  2XAH A;  1VQN P;  5KA6 A;  1NU1 G;  4WFA V;  1SES A;  4WCE V;  1ZWI C;  1ZN5 A;  2GTS A;  4CH6 A;  4FIP C;  4F6R A;  4B3R O;  1K5S A;  3JCU H;  1T3J A;  3D71 A;  1H8E G;  2JGU A;  1PNL A;  2FXO A;  1VQL V;  1KD1 Q;  4MN4 C;  3E8B A;  3ZS8 C;  5APX A;  1PP9 E;  1K97 A;  2MK3 A;  4MTF A;  2Q69 A;  3RFR A;  3D6Z A;  4RUF A;  3Q2Y A;  3BCC J;  1XTG B;  3C8V A;  1YYC A;  4C7R A;  4X66 B;  2HPC B;  1ZSP A;  4I4T B;  3ZN0 A;  4B3T O;  1L0N K;  1KIL E;  3BFR A;  2XHB A;  4XBF A;  4I9W A;  4IYH A;  3DC6 A;  3JAS A;  4FM0 A;  4TQD A;  5JVD B;  2R3S A;  1SQV H;  4IL6 X;  3L73 G;  1NAY A;  3LSS A;  1JY3 N;  1JJ2 U;  2RCV A;  1NO4 A;  2L35 A;  1QX8 A;  4TQF A;  1L0L K;  2BCC G;  3HRN A;  3UO3 A;  1Y8A A;  3O6Q B;  4TV9 A;  4X65 O;  4LBE C;  1RSO A;  2XAQ A;  3SYO A;  4LF4 O;  2X0L A;  5FPO A;  4KHP B;  1BGY D;  4ASW A;  1WB7 A;  1BCC E;  1D5N A;  1IXB A;  4Z1V A;  1L4A A;  1FOS F;  1ZTE A;  1EDK A;  1XRE A;  2UU9 O;  2QM4 A;  5AVT B;  4WBN B;  2WT7 A;  2FFD B;  2JKV A;  3MD0 A;  2LW7 A;  5KLI B;  3L74 J;  4MT8 A;  5APS A;  4X62 O;  2CPB A;  2PGD A;  1LWU C;  1Y76 B;  2QDO A;  2CAZ C;  4JTD B;  1N32 O;  1JY2 N;  4OPA A;  2Z0A A;  5KX5 B;  1N73 B;  1FKA O;  4H13 B;  1CW5 A;  1NH2 D;  3L74 H;  4LFA O;  1AQT A;  3H1J D;  3G6B A;  2QKC A;  3JAR B;  4RO2 A;  2QRX A;  1QGK B;  4JTA B;  5LMN B;  5IWA B;  1NOH A;  1LT9 A;  4UCR A;  1FYJ A;  3H1J H;  3UQ8 A;  1RPR A;  3CEI A;  2PRR A;  4PA9 A;  1T3U A;  4XDL A;  5L3G A;  1JMK C;  1NTK G;  1SS3 A;  3OD4 A;  3S3X A;  4Y99 B;  3U0Z A;  1AP6 A;  4D6T D;  3CRA A;  1SQB E;  2ITC C;  3RL0 C;  2I1J A;  5AVQ B;  2AXT E;  2OTK E;  3LDD A;  1R3J C;  1MZE A;  4U7O A;  3JSN A;  1KKD A;  3HD7 A;  1K34 A;  5APQ A;  1NTM D;  2ZDI A;  1XHX A;  4LF6 B;  2MW2 B;  3CXH D;  1T2K D;  1QLN A;  5L3E A;  1VF6 A;  2N1T D;  2LW1 A;  2M6Y A;  3OA7 A;  4ZIB A;  1KZU B;  1H2M A;  2YIU B;  1I94 B;  3GF3 A;  5LGN A;  1XBL A;  1SQP J;  2E5T A;  4J9Y B;  1S1C X;  2EIN B;  1J1D C;  3ABM C;  4CS3 A;  4CS4 A;  2XT9 A;  3RYH A;  2CTW A;  1H88 A;  4GKG A;  4JI8 O;  2K9Y A;  3KZI H;  2ARH A;  5H9C A;  1L1F A;  2UUC B;  3M9H A;  1OV9 A;  5B1A C;  4TV9 B;  4EIJ A;  2QTO A;  3L70 G;  3VQY A;  1FAF A;  1VQL P;  1YHQ P;  1SQP H;  1JEK A;  2N05 A;  2WZ7 A;  2DW4 A;  2ZR3 A;  3G4S P;  4IHJ B;  3K03 A;  4EYY Q;  2Z3Y A;  2ZDI C;  3K5B A;  3N7N A;  2W8Z A;  5AVR B;  3W68 A;  3M0D C;  5CCG D;  2QGN A;  5B1B C;  1ORQ C;  2NRG A;  4MSW C;  4DV2 O;  2A06 D;  1YSC A;  3FAV A;  2KQX A;  3TXQ A;  3VTP C;  3CX5 E;  4I0X A;  4MS2 A;  2H94 A;  3KYQ A;  1SFC C;  3CWB D;  1G2C B;  3E22 B;  4JV5 B;  1QVG O;  2Y69 B;  2P5O A;  4JF7 A;  1SQQ H;  1PZQ A;  4FM2 A;  1TVK A;  2Y4T A;  3ZJZ A;  2DYR C;  3SPC A;  5KAF H;  3CRQ A;  1XMQ O;  3JAL A;  5BR8 O;  2ZT9 D;  3E83 A;  4UXN A;  1IBM O;  1NTZ D;  1DGS A;  3MAQ A;  4HBN A;  4QGP A;  5IYB O;  2V4H A;  4X9Q A;  3RK3 E;  3CCM V;  1NU1 K;  1NTZ H;  3PH0 A;  5CB4 A;  2ZE7 A;  2FFD A;  1KYO I;  5IJ9 B;  1KIL C;  3L75 H;  4Z2W A;  1OVV A;  3CMA P;  3GWO A;  2IJI A;  3L73 E;  3P7K A;  5M1B A;  2PP6 A;  1RE4 A;  1P84 H;  3CP1 A;  4WY4 A;  1NTZ K;  1QEX A;  3MZW B;  4PA4 A;  4NTY A;  2WA4 A;  4UB8 E;  1XNQ O;  1IK9 A;  2QWO B;  2BAS A;  3SSU A;  1L0N H;  4JF3 A;  4TUY A;  1P84 D;  3A2F A;  2RMK B;  1NKZ B;  2E43 A;  1NZ6 A;  1EXJ A;  3BVO A;  1VQM V;  3U10 A;  3M9Q A;  2KLU A;  2KB1 A;  2ZIM A;  4DV6 B;  1SQB K;  2R72 A;  2NPS A;  4H44 C;  1NU1 J;  3ZRX A;  2ATK C;  2Q3I A;  5AW0 B;  1NR1 A;  3FYE B;  4NPF X;  1A02 F;  1VQM P;  3CYO A;  5JWP A;  4MVO A;  2P6J A;  4IIJ B;  1Q8I A;  5C93 A;  1YJ9 V;  2DWE C;  3AE2 C;  1QR8 A;  4DV1 O;  3KPE A;  1K9M W;  3ZMS A;  2XTA A;  3RL0 D;  1IK7 A;  1VL2 A;  1FC2 C;  4PD4 F;  4FLY A;  2K37 A;  1MV8 A;  2ZXW C;  1SZT A;  1QVG U;  2WSF J;  1XL6 A;  3K0G A;  1OXZ A;  2OYI B;  2EBO A;  4JYA B;  2B87 A;  2QE7 G;  2WPS A;  1NBM G;  1XOU A;  2WSS G;  3H1K J;  4UB8 H;  5KLV G;  3WUT A;  1S5H C;  3B5N D;  2R9I A;  1L0N E;  5ITZ A;  2H88 C;  4JI0 B;  4I50 B;  5CB4 B;  1TVK B;  3B2E E;  3PRJ A;  3CCM P;  5AW9 B;  2F1M A;  3FXD A;  4H44 D;  3WUV A;  2A79 B;  1GN3 A;  2O01 N;  1M1J A;  1BE3 J;  2K88 A;  1PNK A;  2P2U A;  1N32 B;  1J5E O;  3UKM A;  1NAF A;  4PJ0 E;  2IJK A;  2YXQ B;  5DM6 V;  3HKB B;  1T6A A;  3ZHS A;  2A0L A;  2QM8 A;  2V4D A;  1WA8 B;  3RVY A;  5LL6 Y;  4DUZ B;  1KP3 A;  2HFE C;  5CBH A;  2Q1K A;  4ASU G;  2C2A A;  5GTI H;  5IWA O;  4KJM A;  3P8C D;  3CC2 P;  1BHB A;  3LSQ A;  3TJT A;  4JI2 O;  1KFN A;  2UUB O;  2XKM A;  1ZAU A;  4LF5 B;  5EFW B;  1AP5 A;  4JAS A;  4JI3 B;  1KIL B;  5APU A;  2M8R A;  1N4C A;  1KC8 Q;  3AE5 C;  2Y48 A;  4LFA B;  4DV0 O;  1V9P A;  3RT3 C;  3T2M A;  1M57 D;  1HNZ B;  2LFR A;  2N9Y B;  3PJS K;  4JI6 B;  2LXB A;  3STL C;  2DQ3 A;  1M57 B;  3JAM N;  3RYH B;  1IBL O;  1GW4 A;  3ZBH A;  4KT0 J;  1YZB A;  3BCC H;  1K73 W;  1NI8 A;  2BSK B;  2EZO A;  3SJA C;  3CCL P;  4YIP A;  2JP3 A;  1OVR A;  1FBM A;  4FFB A;  5IY5 B;  1FJP A;  1FE6 A;  4LP8 A;  3N2G B;  1XTC C;  4GX5 A;  4TLF A;  2LQT A;  1BHA A;  3RYC A;  4Z1M H;  2OCC C;  1CI6 B;  4LLH A;  4J80 A;  4XDJ A;  3H1L D;  3EHB B;  2Q4P A;  1AIL A;  1RM1 B;  4H13 C;  4DCK A;  1J1E C;  2WLJ A;  2FYU K;  1BE3 D;  3C3T A;  3HD7 C;  2JGD A;  1RF1 C;  3W7T A;  1IZ3 A;  3OTO B;  3CRR A;  5L8R J;  4PA3 A;  2QEX V;  1FZG A;  2KZJ A;  1JY2 O;  4ZOL B;  1FZE A;  1L0L H;  3VQX A;  3T1H O;  3V4Q A;  3V6I A;  2E76 C;  1AR4 A;  3ETD A;  2QA4 V;  1B06 A;  2EUL A;  2KNC B;  4LGD E;  5GTH Z;  5JJE B;  1PL5 A;  5KAI H;  1BSH A;  3L72 G;  4PV1 D;  3JAR A;  4MVZ A;  3TSI A;  1YJN P;  3JCZ A;  1YDX A;  1EDI A;  4D7T A;  1L0L J;  1MFT A;  2A06 G;  1PIX A;  2AZ0 A;  1KQG B;  2QJY B;  3L75 D;  4I50 A;  4RES B;  1ARO P;  1EC5 A;  4Z1M G;  1H2K A;  4BIU A;  3JAW A;  5H2F Z;  5LP6 A;  4WFE A;  5AVU B;  2B87 B;  2GHY A;  2Q9L A;  2AEJ A;  3G80 A;  2UUB B;  1NWQ A;  2GTA A;  1NTM E;  3B71 A;  3T1C A;  5CBG A;  4X64 B;  2C0W A;  4I7Z B;  4I55 B;  4JAV A;  1L0N J;  1Q90 D;  2Q73 A;  3L71 G;  3CCQ V;  3V4W A;  1FFT B;  3CCJ P;  1JB0 J;  1NTM J;  3BCC D;  4YHH B;  4DR3 B;  4HH2 A;  2F93 B;  5A2Q N;  1CEZ A;  5AW1 B;  1AR5 A;  4RQF A;  3V5B A;  3CCV V;  4DR6 O;  5KAI E;  4QE7 A;  1NJI W;  1RE3 C;  1K4C C;  2RN9 A;  2E74 C;  4DRX A;  4UB6 Z;  3JAS B;  3H1I J;  1KN7 A;  2HVJ C;  2YXL A;  5LYJ A;  3CCR P;  2GBO A;  1TGO A;  1HGZ A;  4O2A B;  4IL6 E;  2J5U A;  4I4T A;  2XAF A;  3CWB G;  4J7Z A;  3EXA A;  5KLV E;  1VQ7 V;  3GG2 A;  4L76 A;  1JY2 P;  2CPS A;  2QSI A;  1MSW D;  2A45 G;  4W7Z A;  2Q7G A;  3GVM A;  4O2B B;  5DED A;  1SQX K;  5KLI C;  1BZK A;  2V7Q H;  1Q2N A;  4LH7 A;  3H1J J;  4PDR A;  2FKW B;  1KQF B;  1VQ7 P;  2R9R B;  1Q81 Q;  3SGI A;  5DJU B;  3H9V A;  4O4L B;  3R66 A;  3SPJ A;  3ABL B;  5ITZ B;  4H0L B;  2LFS A;  3CX5 I;  3L72 E;  2H3O A;  3N4X A;  4W80 A;  5KHK A;  1LTB C;  2XND G;  1OCO C;  1WAZ A;  3E35 A;  5AVS B;  1PPJ E;  1MOF A;  5EIB D;  3AED C;  2HEP A;  2KS1 B;  4FFK A;  2VQF O;  2H8P D;  3EWK A;  3SFE C;  3WU2 E;  1F51 A;  5CCG C;  1WPX A;  2YXH A;  2N9B A;  4HNA A;  1VQN V;  1VF5 C;  4JI8 B;  1J2J B;  1ZX3 A;  4B3S O;  4OGQ D;  1VEW A;  3IAY A;  3I5C A;  4BWA A;  3CX5 F;  4JTC B;  2Q0O C;  1YIJ P;  1PFI A;  3K57 A;  3HKC B;  1MUU A;  1ZV8 A;  2NPS D;  3OAK A;  2JS5 A;  1FPO A;  1VQ4 V;  3SYQ A;  5EZY B;  1PV3 A;  3FKS G;  1XNR O;  4JQ0 D;  4MVS A;  2WLK A;  2GUZ B;  4KUM A;  4JI5 O;  2NPS B;  1S5L X;  4FLZ A;  3ZRW B;  3FWL A;  1BQ0 A;  3ASN C;  3VN0 A;  1VQ4 P;  2QJ1 A;  1URF A;  4DR5 O;  1FJG B;  2JEU A;  3ZHR A;  1IUR A;  2F23 A;  2OYQ A;  4LF5 O;  4XA4 A;  5KJ7 C;  4HAM A;  2IX7 C;  1L2P A;  2QIW A;  1BSN A;  1M1J C;  1D5A A;  2Q67 A;  2M5A A;  5FNV A;  1SA0 B;  2OYI C;  4X64 O;  3DTU B;  1CXZ B;  1PPJ H;  3BY6 A;  4ABM A;  3OUF A;  3C9I A;  3ABV C;  3GHG C;  3H1I D;  4K35 A;  1DTO A;  2B9B A;  2X6C A;  3K5L A;  1XMO O;  5TIS E;  4ZKP A;  4DV3 O;  1K7D A;  4I1L A;  3OGI B;  3SPG A;  1LTJ A;  3AK3 A;  2Y0E A;  3UT5 B;  2W6J H;  4WY4 C;  1BT8 A;  2RKL A;  5B66 Z;  2QJP C;  4UB6 E;  4I5S A;  2E5L O;  5C8Y B;  4IYI A;  1RPO A;  2JJL A;  5FL7 G;  3LW5 H;  3CMA V;  2Q8V A;  2M3B A;  3T4D A;  1O9G A;  4P9O A;  2HG5 C;  4CS2 A;  3D3I A;  3FWN A;  1RF1 B;  4JZG A;  3BEH A;  5B5E Z;  4JPZ B;  1Q5O A;  2WVR A;  1URQ A;  2IPP A;  1NTZ J;  3A5T A;  4YXW G;  4B3R B;  5IJ0 B;  5LA6 B;  2EIM B;  4RO0 A;  1M7L A;  4WFF A;  2I1K A;  5AVZ B;  3A0H E;  1IX9 A;  1YTZ T;  3FB7 C;  1TUB B;  4EFE A;  4UCO A;  1B3Q A;  1PGP A;  1CPY A;  1Q6I A;  5GW7 A;  3ETG A;  2ZQM A;  1WT6 A;  2Q7C A;  1VMG A;  2P06 A;  1O9H A;  5LBQ A;  3APO A;  3CC7 P;  1SQB G;  4H33 A;  1GW3 A;  4GIF A;  1S2E A;  2FYU H;  2FYN B;  3Q3D A;  1RP3 B;  2B89 A;  3IGA C;  1JCD A;  2P1J A;  1XL4 A;  2IZ1 A;  1NU1 H;  2BCC H;  4B08 A;  3EVK A;  2CUG A;  3GMA A;  3RYC B;  1IBK O;  3A0R A;  4DR1 B;  1GL2 A;  1JFF B;  1QL2 A;  2CE4 A;  2ZM6 B;  3RW0 A;  1BE3 H;  5JH7 B;  3HKC A;  4RWU A;  2D2C D;  4CBC A;  2UU9 B;  3IAO A;  3AG2 B;  5CBN A;  1VQ5 V;  3K5N A;  5AW8 B;  4JI5 B;  4DV2 B;  1G4Y B;  4G2K A;  4KL1 A;  1K04 A;  2HYN A;  2W0X A;  1OWA A;  3CXH H;  4K8X A;  3OFN G;  3GHG A;  1WP8 A;  4JGS A;  3ASN B;  4RQE A;  2A45 I;  5AVV B;  4NVP A;  5JJJ B;  2WSF H;  1YVW A;  3S4R A;  2DN9 A;  2WLH A;  5AVW B;  4AQR D;  1YI2 P;  3BRC A;  1LP1 B;  4FLW A;  1AV1 A;  1L4A D;  1SQV G;  1VPC A;  1VQ6 P;  3JSL A;  3GB7 C;  2FY8 A;  1SQP K;  1Z2G A;  2R32 A;  1GN4 A;  3H01 A;  4KFM A;  2G8Y A;  1Q82 Q;  1LT9 B;  5B1N A;  2QSA A;  2BCC E;  1UFI A;  1GL2 C;  1FXK B;  2DQ0 A;  2W83 C;  2WIT A;  1KYO E;  2YS8 A;  2QJY C;  2BE3 A;  4D6T E;  5L3D A;  4DV5 O;  5APY A;  4D6T G;  1BE3 E;  5AVY B;  3SR2 C;  1TAE A;  3VOP A;  2H7H A;  5CCH A;  1M5I A;  2KXP B;  5AW3 B;  1YJW P;  2B5U A;  1GD2 E;  4UCT A;  3CXH E;  4LWS B;  2P7J A;  2R9A A;  1PNM A;  2W6I G;  5B3S C;  3L36 A;  1E1R G;  4OX9 O;  4HKZ H;  4JAA A;  1SQB D;  2HJF C;  1LTS C;  1GU5 A;  2WSE H;  3MHV A;  4PEL A;  1VQ5 P;  2AXC A;  1PL4 A;  5CBO A;  2VS0 A;  4J10 A;  2Y0P A;  2Y4U A;  3GHG B;  2XAJ A;  2Q9I A;  4PJ0 Z;  5F2V O;  3CCE V;  4YY3 O;  1VDF A;  5E79 E;  4DV3 B;  1KYO H;  2KKW A;  1IVS A;  3K79 A;  3C90 A;  4JI2 B;  1M8O B;  4FLU A;  3H1J G;  3F7Y C;  3ZRV A;  3ABM B;  4LF8 O;  3CCR V;  1GH6 A;  2HHH B;  1G1I A;  3OTO O;  3N2K B;  3MUD A;  4DW0 A;  4PDL A;  1JFF A;  2EJR A;  1PV0 A;  5LOV B;  1SQP E;  3ZX6 A;  4L87 A;  1OCC C;  4EB6 B;  2QEX P;  2HP8 A;  3B77 A;  2DMX A;  1N86 A;  5E79 Z;  2XZR A;  4R8C A;  3MDS A;  3P30 A;  1E5W A;  4RAI A;  3QO7 A;  2FXM A;  5K1X A;  3GF7 A;  1Q6U A;  5LXT A;  1M93 A;  5LGT A;  1GN6 A;  1THZ A;  1JOC A;  2HPC A;  2Q5U A;  2ILM A;  1Y4M A;  2ZR2 A;  1WPB A;  2F66 C;  2YEV A;  4Q20 A;  1X9V A;  1SQV D;  3JCU E;  3ZRS A;  4O4H A;  2WPR A;  2P90 A;  3K58 A;  5L3F A;  1VQ8 V;  1JMB A;  5C39 A;  2YKQ A;  3JD4 A;  1V54 C;  4UVB A;  1OCR B;  5HFM A;  2JIZ G;  1SQQ E;  3L70 J;  3ABL C;  5KAF E;  4U3F H;  3A7O A;  2L91 A;  1R1B A;  3FB5 C;  1G6U A;  3FD9 A;  5IYC O;  1KQL A;  2QWR B;  4MVQ A;  4ZHQ A;  2QKS A;  2MJZ A;  4AIL C;  1FDM A;  3L73 D;  2HLO A;  1GL2 D;  2EIJ B;  3L70 H;  2IYO A;  4UVA A;  3AEA C;  3L72 D;  3HKD A;  2PF4 E;  4UB8 Z;  3RK3 B;  4LF7 B;  3S1K A;  5IYZ A;  5TJH A;  2BSK A;  3S3W A;  1PPJ D;  4JI7 O;  3L70 D;  1JCH A;  1P84 E;  2XOK G;  1AVO A;  4KHP O;  3UT5 A;  2R3C A;  1PP9 G;  5EBM C;  1YHQ V;  2V7Q J;  3BAS A;  5IYD O;  1Y9B A;  2FBW C;  2NLJ C;  2K1A A;  3RYI A;  1XEQ A;  3CL3 D;  3CD6 V;  4G28 B;  2Z5I A;  4EDF A;  4IHJ A;  5CA0 A;  2JR8 A;  3AEG C;  1J5E B;  1VQK P;  1WRG A;  4U3F G;  4U3F E;  2E75 C;  1KMI Z;  3DXR A;  2AHY A;  4TOI A;  2BCC J;  1SET A;  1TA8 A;  1ZL8 A;  1HNX O;  4PV1 B;  1SZX A;  1E79 G;  1SQX H;  4I7Z C;  3HPL C;  1Z5W A;  4DUY O;  3L71 E;  1TUB A;  5IYZ B;  1AI7 A;  5BZB A;  2OTL V;  3O9O A;  3G67 A;  3TCU A;  4CH5 A;  2QM7 A;  3BRV B;  1SQX J;  2KG7 A;  1H89 A;  2K1E A;  1TUE B;  1FU1 A;  2BTO A;  1GZL A;  3CS5 A;  1OCZ B;  2KK7 A;  3TNU B;  2ZAE B;  4OXS A;  2SPZ A;  3IR9 A;  3J80 N;  3RL0 g;  4DV6 O;  1SQB H;  1HF9 A;  1FXV A;  4JI0 O;  2ZYA A;  1SS1 A;  3ABK B;  1VAR A;  2Y0I A;  1NTM K;  3CJH B;  1M1K Q;  5LHH A;  2KYV A;  3SWF A;  3H1K D;  4N6J A;  4TWK A;  3D6Y A;  2VQE B;  1QCE A;  4LH6 A;  2X6B A;  1EN4 A;  4C46 A;  4CH4 A;  2Z5H A;  1XMO B;  3BPZ A;  5B66 E;  3QNE A;  4NPE A;  1NTK E;  3M0A A;  3ZHT A;  4ZI7 A;  1H8H G;  3P8C E;  1Y76 A;  1AI4 A;  1NS1 A;  3CSX A;  1LJ2 A;  1US6 A;  5LYJ B;  2VQF B;  3L71 J;  3JAK A;  1BGY E;  3EQ2 A;  1FDI A;  3AG4 C;  2HKO A;  2OWO A;  1IO4 A;  2WAM A;  4F4L A;  2ITA A;  1M56 D;  1VQ8 P;  2RNB A;  5IE9 A;  4X65 B;  3FB8 C;  1M56 B;  2XU6 A;  1HWY A;  4EOT A;  1W2B U;  4DV7 B;  3OAA G;  2N74 A;  1PGO A;  2NN4 A;  1KB9 D;  2WLN A;  1G1J A;  3LSU A;  3OJA B;  2E75 B;  2AEF A;  2RDC A;  5CCH C;  2E75 D;  5BU5 A;  4DR2 O;  2FYU J;  3VMA A;  4NPD A;  2CGN A;  4DR7 B;  3FYI B;  1NTK H;  5DEC A;  4JYC A;  1NT2 B;  3QH9 A;  3G4S V;  1R3K C;  2WWW A;  2D3O W;  2B88 A;  3KKY A;  5GON B;  2UUC O;  5AW7 B;  4DW1 A;  4O4I A;  4I0X B;  3JAT B;  2QKA A;  4FZ0 A;  1GDT A;  3RK3 C;  5B3S B;  1ZUQ A;  3C1L A;  4L73 A;  3SYP A;  2UXD O;  1Y47 A;  4N3Y B;  2BCC D;  3L75 E;  2HHH O;  2QTS A;  1OZH A;  1EXI A;  1NQT A;  4JI6 O;  4MTG A;  1LP1 A;  1Y66 A;  4TT3 H;  2IDB A;  1BS3 A;  2WLL B;  2QR4 A;  3AG3 B;  5KHI A;  4F6R B;  1H0T A;  5LHG A;  4DR5 B;  5KHJ A;  3JD1 A;  5APV A;  3WG7 C;  1CI6 A;  1DEB A;  3E2E A;  1MKM A;  1S3J A;  3PLN A;  1NTM H;  2A9H A;  4EKW A;  4IL6 Z;  2XDJ A;  4FFB B;  2X7R B;  2HJD A;  2ZE8 A;  2M7W A;  4YJ3 B;  4JI4 B;  2WQY C;  2IU3 A;  3H1I H;  3U11 A;  5KMG B;  5CJ0 A;  2JDI H;  5KAI Z;  3BRT B;  5JCO C;  2I8D A;  2P7T C;  5BXZ A;  1K05 A;  2YKP A;  3R4Y A;  5CCG A;  5J2U A;  3BA9 A;  3SPH A;  4AUW A;  1QBZ A;  1R5S A;  1S4X A;  4BXL A;  3W7X A;  2E74 B;  5EC1 C;  4JI1 O;  3AG2 C;  3L74 G;  1E1Q G;  3CX5 D;  1LTG C;  5CA1 B;  4B3M O;  2W90 A;  4NYK A;  1SQP D;  2XAG A;  3BHP A;  3JD0 A;  1BGY G;  4YPC A;  2OTJ V;  3B09 A;  2WSE J;  1V55 C;  2KI7 B;  3SJC C;  1NTM G;  2QJP B;  1NTZ G;  5H6Q A;  3II6 A;  4J42 A;  1AA0 A;  1A32 A;  2V1D A;  2PZS A;  3H1K G;  2DYR B;  1SQV E;  4GX1 A;  3TNU A;  1UPG A;  2E76 D;  1EDJ A;  4JI3 O;  3AEC C;  3SFD C;  2WSC J;  1QHT A;  3I5D A;  3VP9 A;  4DJG A;  2KG7 B;  2CK3 G;  2IM9 A;  2DWD C;  3SWY A;  1ZME C;  3L35 A;  2QG4 A;  3RGB A;  1SQB J;  2AEM A;  3VP8 A;  4DR3 O;  4FM1 A;  1FZB A;  3TYY A;  1GK4 A;  1EZV H;  3B5N A;  3NXS A;  3Q1M A;  3TGU E;  1NVP B;  1IBL B;  2NNU A;  2OYH C;  1WLE A;  4GKJ B;  4O4J B;  1KB9 I;  3M8A A;  5FNV B;  1E79 H;  4GKK B;  1R5L A;  3O6Q A;  4DZO A;  3DXR B;  3C3S A;  1RQV A;  1M90 W;  3ZHU A;  3AEI A;  4TV8 A;  1VQ6 V;  1R6K A;  5B1A B;  3OR7 C;  1N2D C;  4ZBM A;  3FFQ A;  4J41 A;  3M99 B;  2CDY A;  1KOR A;  1K8A Q;  5LOV A;  1HDJ A;  4UUJ C;  3N2K A;  2YNY A;  5EC2 C;  1OCR C;  4DUY B;  3L74 E;  2C0X A;  2QJK B;  2PYJ A;  2Y69 C;  4LF9 O;  3HTK B;  4I2L C;  3KCX A;  1FZC C;  1S5L H;  5KMG A;  4NXN O;  1FAV A;  3IC7 A;  4F6E A;  3ZN1 A;  2DE0 X;  2CH7 A;  1JMM A;  1KU9 A;  4FMT A;  1H2S B;  3HKB A;  4FLV A;  3NMD A;  3HKD B;  3M91 A;  3T4Z A;  1XDC A;  1K4D C;  4UB6 H;  1GKF A;  2IBZ G;  3N27 A;  1F4N A;  4ZHQ B;  4DR6 B;  2W0F C;  3CC4 V;  4HNA B;  4DO2 A;  2FXP A;  2KSE A;  3MTU E;  1N7S A;  1YIJ V;  4DK1 A;  2O01 J;  1V55 B;  5AG2 A;  3VMX A;  3HUS B;  5EYP A;  2IW5 A;  1P49 A;  1FXK C;  4O2B A;  1KKC A;  1VF7 A;  3L73 J;  3U1C A;  2VWK A;  4PD4 E;  5K1P A;  4XE5 B;  1OCZ C;  1A02 J;  4I6M C;  5AVX B;  4ASV A;  2KSJ A;  2BEZ F;  3T97 A;  1SER A;  2F95 B;  2UXD B;  4EB6 A;  2BEQ D;  2P10 A;  3H1K E;  3EFF K;  1YTF D;  2UWJ E;  2IFM A;  1OW8 A;  4DR4 B;  4DR7 O;  2FTK A;  1LUV A;  1VF5 B;  4PA6 A;  4IOI H;  1KQS U;  4I55 A;  1R3I C;  1NTK D;  2IZ0 A;  2KZI A;  3CHX A;  1FD9 A;  1ZRT E;  4LNU B;  4JYY A;  3K5O A;  4YXW H;  2QWQ B;  3L9D A;  1HUC A;  3VYI A;  3VOU A;  4OGQ B;  4BW9 A;  5IJ9 A;  1AVM A;  2M0B A;  4BWN A;  1JO5 A;  1DD3 A;  1GL2 B;  3L72 J;  4BW5 A;  2IBZ E;  1K9M Q;  4X1I A;  4NB5 A;  3CCL V;  1LWU B;  2M3E A;  3VQW A;  2ZYG A;  3B8E B;  2E42 A;  3E8G A;  3JAW B;  3IC9 A;  2UXC B;  1NH2 B;  1NKN A;  2GV9 A;  4A7P A;  1ZR4 A;  4WB4 A;  1Q43 A;  3L72 H;  3TK1 A;  3SWK A;  3HUS C;  2JWD A;  4GLX A;  2CGO A;  2XNX A;  3K3W A;  4CH3 A;  3H1H H;  4D6T H;  5BR8 B;  1Q7Y W;  4HYT B;  3H1L G;  4MTO A;  4WFH A;  3K04 A;  1JY3 O;  1P7B A;  4GZR B;  4XDK A;  1B6Q A;  4YIO A;  3FAV B;  1U96 A;  1HW7 A;  1V54 B;  3ZED A;  2IU0 A;  1M4U A;  3WB2 A;  2AGA A;  3ETQ A;  2Y0C A;  3ZHQ A;  1EN6 A;  1ROP A;  4LFB B;  1SFC D;  4QNH B;  4DYL A;  4YJ2 A;  2QA4 P;  4P2Z A;  4X66 O;  3ITK A;  1HJB A;  1LGH B;  5KHG A;  4IT5 A;  3CME V;  5KX5 A;  1N73 A;  5H2F H;  1YCI A;  4R4L A;  3B8M A;  1KUQ A;  1HNZ O;  4M3L A;  1YEW A;  5K5G B;  1N36 B;  2ZNI A;  1HNX B;  1NTK J;  3FGA D;  1MZF A;  3K0D A;  4JI4 O;  1NGM B;  3N2G A;  4CZZ A;  4WBN A;  2WT7 B;  4BIO A;  1ZW0 A;  2N1T A;  1Q86 W;  3IF4 A;  2E5Y A;  4WFB V;  5FPR A;  4JAU A;  1RM1 C;  1MMM A;  4LNU A;  2ZVN B;  1SA0 A;  4GT1 A;  3GW6 A;  2KUB A;  1T8Z A;  2GSM B;  3CC7 V;  3CCQ P;  3AEE C;  4BAY A;  1NU1 D;  2MKV A;  1K92 A;  1XI1 A;  3L37 A;  4LF7 O;  1QLE B;  2G38 A;  3RK2 D;  3K9S A;  1X0T A;  3SPI A;  2DW3 A;  3K9A A;  1MA1 A;  1ENV A;  4R7C A;  2FYU D;  1T2K C;  1YXB A;  2JJ1 G;  1KB9 F;  1DH3 A;  4X1Y A;  3KG2 A;  4LF9 B;  5GTI E;  3AK1 A;  3TXS A;  1GM9 A;  3FB6 C;  4GDO A;  5B1O A;  2Y0D A;  1N7S C;  1SQQ G;  4J7J A;  1RF1 A;  2ZT9 B;  3HKE B;  1MSD A;  3AE8 C;  3MGN A;  1RHZ B;  5KA5 A;  4DR2 B;  1Q3E A;  4H0L D;  5L3C A;  1IFJ A;  3L70 E;  2YIC A;  4TSF G;  2O1K A;  3CI9 A;  5AW5 B;  2Q6A A;  4QE9 A;  1GO3 F;  2LKM A;  1HNW B;  1N34 B;  1FOS E;  1B04 A;  1AJY A;  4LF4 B;  2LO1 A;  1U7J A;  3W67 A;  4U3F D;  1X8Y A;  4JI7 B;  2EIL B;  2R5B A;  2YMY A;  3TGU D;  4X89 A;  5CCH D;  3WB0 A;  3H32 A;  1D2D A;  3B40 A;  3ZRW A;  1W0K G;  4CC5 A;  2AXT H;  4DRX B;  3LID A;  2P4K A;  1CSB A;  5EZY A;  2W6J G;  1GM7 A;  3WFV A;  4HZ3 A;  1BCC J;  1GK6 A;  4OH8 B;  1BDC A;  1I94 O;  2DYS B;  4PV1 C;  1COW G;  5KLV J;  1AJQ A;  1S9K D;  3CXH F;  4WY4 D;  3USS A;  1IBM B;  5GTH E;  2O57 A;  3I55 V;  4YHH O;  2ZXW B;  2XUM A;  3CWB J;  4GCZ A;  3ZCC A;  3AEF C;  4U7J A;  3T1Y O;  1IBK B;  1PD3 A;  1IFN A;  4C7N B;  3B5N B;  5IT9 N;  3T1H B;  4EFB A;  4OX9 B;  2WSC H;  4FZ1 A;  3PP5 A;  4GKJ O;  1KBH A;  4Q6G A;  4XFJ A;  1SVF A;  1RY3 A;  4MVU A;  5IY5 C;  4PD4 I;  4B3M B;  5KUK A;  1K5Q A;  1LNQ A;  2L6L A;  3ASO B;  3F5H A;  2KLV A;  4FK5 C;  1IC2 A;  1PGQ A;  1L4A C;  5L3B A;  4DT0 A;  4MVR A;  3E22 A;  1FZF A;  3SJB C;  1P7G A;  4O2A A;  2KIK A;  1AQ5 A;  2JEX A;  2RQ6 A;  2IJH A;  4N23 A;  3E1I A;  2YO3 A;  1WMK A;  4PD4 D;  1BE3 G;  4X62 B;  5GTH H;  1ZP0 C;  1KB9 H;  3RL0 B;  2WTY A;  3B8N A;  1VF5 D;  4QJF B;  2WMM A;  3HE4 B;  1NTK K;  2XV5 A;  2PI4 A;  2UXC O;  3M9B A;  2UXN A;  1LTA C;  4R4M A;  1LTI C;  5E79 H;  3L75 J;  5AW2 B;  3HB3 B;  4TV8 B;  1AI6 A;  1IFD A;  4L74 A;  2X6A A;  3SYC A;  1ZLL A;  3O8Z A;  4GOF A;  1KD1 W;  1FS0 E;  3KCY A;  2JK5 C;  2YXY A;  5LMN O; 
#chains in the Genus database with same CATH homology
 4H0L B;  2E76 D;  2D2C D;  3AEC C;  1ZRT E;  4YXD C;  2ZT9 D;  1DD4 A;  3IAO A;  3SFD C;  2WSC J;  1FDO A;  4H0L D;  4KT0 J;  2D2C B;  1ZOY C;  3AED C;  1K04 A;  3RK3 E;  3EWK A;  3SFE C;  2JP3 A;  1ZME C;  2WPV B;  4OGQ B;  1OMI A;  3AEA C;  1VF5 C;  2E75 B;  1DD3 A;  4OGQ D;  4Z1M H;  2OQQ A;  2E75 D;  3Q1M A;  3AE1 C;  5M1B A;  1GMJ A;  1RQU A;  3AE4 C;  1AJY A;  4H13 D;  1U57 A;  4H13 C;  2V7Q J;  1PV3 A;  3O6Q A;  5KKZ C;  1Y9B A;  3Q5P A;  4H13 B;  2FBW C;  2G8Y A;  1R8E A;  1RQV A;  1TU3 F;  1DIP A;  1S5L X;  1EXJ A;  5L8R J;  3AE7 C;  3AEG C;  4YTP C;  2QJY C;  3Q5S A;  2G3A A;  2E75 C;  3AE9 C;  2JO1 A;  1KMI Z;  4H44 C;  1KOR A;  2QIW A;  2E76 C;  4PV1 B;  2QJK C;  1EXI A;  1UIX A;  4PV1 C;  1PL5 A;  4H0L C;  4I7Z C;  3ABV C;  4PV1 D;  4Y28 J;  2D2C C;  3AE2 C;  4TT3 H;  2IDB A;  1PIX A;  1KQG B;  1IK7 A;  4R4L A;  1VL2 A;  3IN6 A;  2FYN C;  3GLM A;  3AEF C;  4U7J A;  2WSF J;  1HJ0 A;  1MKM A;  3FGA D;  1NYH A;  2QJP C;  1NGM B;  1OW6 A;  3B71 A;  1YQ3 C;  2H88 C;  2FXP A;  3GF3 A;  3AEB C;  4I7Z B;  2WQY C;  2YMK A;  4XFJ A;  3D71 A;  4H44 D;  2O01 J;  3AE6 C;  1S1C X;  1Q90 D;  3RL0 g;  3G9R A;  1HF9 A;  2NZ2 A;  1JB0 J;  4H44 B;  1K05 A;  2K9Y A;  3R4Y A;  3D6Z A;  3Q2Y A;  1OW7 A;  3C8V A;  4OGQ C;  2E74 D;  1KTM A;  2E74 C;  2YIU C;  3AEE C;  2MKV A;  1KIL E;  2E74 B;  3T97 B;  3D6Y A;  2ZT9 C;  3GF7 A;  2BEZ F;  3LW5 J;  1WMK A;  2J5U A;  3S9O A;  2BEQ D;  1ZP0 C;  2P10 A;  3AE3 C;  4IL6 X;  1VF5 D;  2WSE J;  1OW8 A;  2QSI A;  4RKU J;  3Q3D A;  4R4M A;  3D70 A;  5KLI C;  4GDO A;  1YQ4 C;  1VF5 B;  3Q5R A;  3AE5 C;  1KQF B;  3GMA A;  1FDI A;  3H25 A;  2E76 B;  2H89 C;  2ZT9 B;  3AE8 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...