1VF5B

Crystal structure of cytochrome b6f complex from m.laminosus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords CYTOCHROME B6
publication title Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
pubmed doi rcsb
total genus 29
structure length 138
sequence length 138
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1vf5B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1vf5B01
2E76B 2K9YA 2YIUC 4KT0J 4I7ZB 2E74B 2E75B 1Q90D 2WPVB 2QSIA 2WSFJ 4IL6X 1S5LX 2ZT9B 5L8RJ 1JB0J 4OGQB 2FYNC 5KLIC 4RKUJ 2WSEJ 1ZRTE 5KKZC 2D2CB 2QJKC 2WSCJ 2QJPC 1VF5B 4H0LB 3LW5J 4H44B 2QIWA 3C8VA 4PV1B 4H13B 2QJYC 2O01J 4Y28J
chains in the Genus database with same CATH superfamily
3CWBJ 1SQQG 5KAFZ 1RE3A 2IH1C 2WLIA 1S77D 1Z5VA 1YTFD 2I8DA 5AVYB 1N34O 1Q7YQ 2WSFH 4PDMA 5EYPB 3CD6V 3VMZA 1QQCA 2QWQB 4EYYQ 2ZXEB 2ZD9A 3HRNA 4IIJB 2POHA 3W7SA 3CX5D 5KMGB 2QEXV 3H1JE 1H0TA 4LC1A 2ZNIA 5EBWC 1J1EC 1NYHA 2Y0IA 3DTUB 3KZIE 5L3BA 3L72E 2UU9O 1M1KQ 1PL4A 1YITV 1DF4A 2NPSA 1H2NA 1NU1K 3TNUB 4IFDK 4DRXB 1BCCD 3K58A 4OPAA 1CI6A 2Q9LA 2Y48A 3PJSK 1SZXA 3CL3D 3L71H 3ZHTA 5JQGA 3B8NA 3E2EA 2JEEA 3C90A 1V54C 3RYFB 3C1LA 4XBFA 4RQEA 2M8RA 4EKWA 1W0KG 3HKBA 1OCCC 1UPGA 1L4AD 4DT0A 2BOBC 1LTBC 3G71P 3E8GA 1RPOA 3Q4HA 4MVSA 4F6RB 3JAMN 4XE5B 2Y4UA 3ZN1A 1GO3F 4X88A 1PIXA 2LKMA 1AV1A 4GKKB 4W7YA 2F66C 2ITDC 4NXNO 2DW3A 3L75E 4R4MA 3BFRA 4X89A 4GX1A 5LYJB 3WB1A 1KQSU 5LXTA 1S0VA 2M5AA 1H0TB 4PJ0E 3FYIB 4AHCA 2E74C 4BRYB 3V2QA 5KAIH 4O4LB 1FAFA 4UCUA 1EQ7A 5C8YB 1Z2GA 1FJKA 3FX0A 1YTZT 3AE9C 1USDA 3SGIA 2WLNA 3P7KA 2OYQA 1LP1A 1CEZA 4X8AA 1L0NE 3OE7G 3AEFC 1VQLP 3ZHUA 1YJ9P 4LP8A 3IAOA 3EFGA 2ZNJA 4UVCA 5AW9B 5FPRA 1XL4A 5KAIZ 2IU0A 2MK3A 3IGAC 3ZBHA 3MHVA 1H89A 3ZIAG 1XILA 1QGKB 1TVKB 3RYIA 4ASVA 2DYSB 3L70J 4E4EA 2OTJP 2Z5IA 1DLBA 1S76D 1DEEG 4YPCA 4U3FE 2DJVA 1KILA 3H1ID 2ITCC 3ABKC 5IYBO 4E2LA 1YDXA 2X6AA 5KX5A 3K5LA 3CCLP 2WWWA 4QE7A 3JC22 1OV9A 3RWRD 5AW6B 1M57B 3M91A 4CPGA 1FC2C 4JTAB 2JWAA 2X6CA 3L37A 1WPBA 4O4HA 2Q7EA 5CBHA 2C0WA 5EC2C 3IJ4A 2Q4PA 2QWNB 3A0BH 3B5NB 3Q5RA 3CD6P 4RJTA 4B3RB 1F51A 2IM9A 1FFTB 4DW1A 4TUYB 3BCCD 5LHIA 2N1TA 1USEA 1XHZA 3CWBE 3AE6C 1Q86Q 4AYCA 2W0XA 3G6BA 3OMIB 1KUQA 5AVSB 1FZCC 2Q9IA 2WPSA 3CRQA 5HFLA 1AVMA 1TUBA 3LUTB 3CYOA 2CK3G 1EDJA 1KB9H 4Z1VA 1MFTA 1IXBA 3A0BZ 3RYIB 1I94B 1BHBA 1JCCA 3C9IA 4JASA 4O4IA 3WB0A 1TU3F 1XHXA 1AP6A 4D6TH 1QR9A 3FX7A 4N6JA 3H1HH 4DV4B 1OXZA 2B9BA 3A3YB 3M8AA 4DV3B 3HD7D 3A5TA 4TQFA 1SQQH 4MVOA 5KX5B 1RM1B 2RH0A 5EFWB 4BW9A 3CC4V 4Y28J 2E5LB 2ARHA 4DV2O 1L4AA 2B87B 4FK5C 5KA6A 1LT9B 1J2JB 2F95B 2ZQMA 3JD0A 5CA0A 1VQ7P 2HHHO 1XI1A 1NKDA 1NTZK 2ZVOB 4MVQA 3ZCCA 5L8RJ 4RO0A 2EIJB 4DK0A 2EINB 2QA4V 1K73W 1SQBD 1KMIZ 2OIGA 4JI6O 2N1TB 5CCHD 4J10A 4H37A 3CCVV 1N7SD 3DXRA 2FBWC 4HBNA 1PPJE 1SLQA 2ZIOA 2MW2B 1SQBG 2KS1B 2BSKB 2EIKB 2YDEA 1T2KC 3FWNA 2PI5A 1HDJA 2F4VB 2WLMA 2O1JA 3GF7A 1FOSE 1RE3C 5D5QA 3D3QA 4O4IB 1G2CA 4J9YB 1VMGA 2PY5A 3LIDA 1LR1A 3MAQA 5BXZA 3LSUA 2EULA 2KB1A 4IHJB 3AG4B 2HEPA 2EZPA 5H5NA 4B3TO 2W6JG 4X1IB 2HODA 1L4AB 4WY4D 1MNGA 1LWUA 3O9OA 2R70A 3CX5I 1PM9A 3P30A 3V6IA 3LDDA 1VQ8P 5CMUA 2IH3C 3SYCA 2FXPA 2O57A 2HLOA 3PN1A 3AE5C 3TGUG 2NPSC 3CRMA 1HWYA 4DUZO 1Y4MA 4ZBMA 3A0HE 3OD4A 4PELA 1U57A 4LNUB 3DXRB 3WUTA 1M8OB 3VMXA 4LF9O 1Q81Q 5APYA 3L70E 1YCIA 1SS3A 2EJRA 2CPBA 2JVDA 4X1KA 1KYOI 1LTGC 1NKNA 3I56V 2J58A 2MJZA 3FGAD 1ZUQA 2AHYA 1MFZA 1RHZB 2BE3A 3FB5C 1IFPA 3H32A 3QG5A 1VDFA 2PAJA 1BCCJ 1G2CB 2FB5A 2IPPA 4I55A 1NTMK 3H1JG 3E22A 1NH2B 5AW5B 1QEXA 4W7ZA 1FDMA 5B1AC 1VQKV 5LGTA 3L72G 1L0LE 1ZW0A 4GOEA 3ZMTA 1MA1A 1WB8A 3SDLA 2HODB 3H01A 1JY3N 1XTCC 4OH8B 1VQ9V 1YF2A 1FBMA 1B3QA 1IBMB 1G1XB 4EIJA 1M4UA 3HD7A 3JD4A 2AXTH 3AEGC 3SFDC 4KP4A 3B8MA 5TISH 3RYCA 2R72A 1RE4A 3CC4P 4EFEA 4IL6X 1JCDA 4CBCA 2WLHA 1H2SB 1I5XA 2OYHB 2IJIA 1S4XA 5LP6A 1OW8A 1YJNV 3AG7A 1F4NA 3H1LE 4X64O 4Z1MG 3FXEA 1VARA 1FZEA 3L75D 1VF5B 2LP7A 1P84F 4MTXA 5CCHA 2YXHA 1ZR2A 3ZRVA 1N7SA 3USSA 2AXTZ 3BCCH 1O9HA 2DWEC 2XUMA 5LMUO 5TISZ 4ZIBA 3L75G 3CCVP 1SQQK 4I55B 1FXKB 1KILC 2CK3H 1K3EA 3STLC 3LIEA 4YJ2B 1IJDB 3SYQA 4QIWF 3ZMVA 2VQFB 1S1CX 1L0ND 1DEBA 4JV5B 1PZQA 4DO2A 3BAAA 3JATA 1H2KA 1J95A 1X9VA 1L0NG 3MZWB 2JRIA 3OTOO 1AI5A 2X7RB 4JI8O 3JAKA 4O9BA 2VRZA 3H1IJ 4WY4A 1K33A 3IAYA 4BR6A 2N05A 2N1TC 4LBEC 3SJAC 1WJZA 1ZAUA 2RJZA 5LP6B 3SWFA 2RCVA 2RN0A 2BTOA 1EC5A 4JI7B 3R65A 4O2AB 4U3FG 5LGUA 4QNHB 3FKSG 4PA4A 3JD3A 1GW3A 3AEAC 1NKZB 3ZMSA 4RAIA 1RH5B 4JF7A 4LF4B 1SQBH 3QTCA 1W2BO 1KILE 3BCCJ 3DC5A 1A02J 5IT9N 2HP8A 3I5DA 4DV2B 4BW5A 3M9QA 1Q6IA 1NS1A 1AB3A 3BASA 3AG4C 3MGNA 3P3NA 4UV9A 1HR0B 3I56P 1OW6A 5ITZA 1L4AC 4P2ZA 4MT8A 2Q73A 1A32A 1ZV8A 2Y0PA 2PYJA 5CB4B 1PGOA 2EIMB 1M90W 3MHSC 1OCZB 3CWBG 3JATB 4UV8A 4FLYA 1T6AA 3V2NA 2E42A 1SQGA 3X2QB 3CX5E 3UT5B 2QKAA 2W6JH 2P06A 3T1HO 3JAKB 1KBHA 4L76A 3I55P 1VQKP 4I0XB 3HB3B 5LOVA 3LW5H 1HBWA 2EJ7A 5EK0A 2Q67A 4R8CA 1GD2E 1BMFG 4R6ZA 1BCCE 2R3SA 2QE7G 3L4FA 5TJHA 1Y74B 1XL6A 1I0HA 1WT6A 2YIUC 1GMGA 4I1LA 5CBFA 4DV7B 2E5YA 2PI4A 2HFED 5DN6G 4DV5B 3WB2A 1CZQA 1KYOE 1XEQA 2P10A 2VWKA 2HPCB 2D3OW 1XNQB 1SQBJ 4LWSA 3WMM0 2Y69B 2KG7B 2YIBD 1YJNP 3H25A 1EZVD 3L9DA 2IFMA 2JDIG 2UUAO 4UCOA 4ZHQA 5ITZB 3CC2P 1PPJD 3BY6A 1R5LA 4TV9A 2W6IG 4G28B 4P9PA 1LWUC 3OEHG 1MSDA 4BIUA 3OUSA 3KZIH 3L72H 3U1AA 4ZI7A 4X9QA 2WVRA 3TDKA 2ZT9B 1J1DB 4OGQB 3JARB 4AQRD 2JEXA 3RK2B 1KV4A 5APSA 3HPLC 2E5TA 5LOVB 1N32O 4OX9O 2H7HA 3AG1C 5DM6V 1SZTA 1SC5B 2QIWA 1KECA 5J2UB 3G80A 2JR8A 2HJFC 4HNAB 1SQXE 3SR2C 5GTIE 4DR3O 5FNVA 2DWDC 1EDKA 1QHTA 5AG2A 3KZIZ 1VF5C 4NPEA 3SFEC 2V7QJ 2YSUB 2KYVA 3AEEC 4O2BA 2VRSA 4CH6A 2OQQA 2G3AA 4JI3B 4Z1MH 1URFA 1HJ0A 1PNKA 4LF6O 1JFFB 3CCSP 4YY3B 3L75H 1JEKA 2M3BA 2LW1A 5H6RA 2QKCA 3C8VA 3H1IE 4PJ0H 2YEVA 5J2TA 4WFAV 2OTKE 3M06A 4HYTB 3T97A 1J5EO 4N21A 3KHUA 3R66A 1SQVJ 3HD7C 3GMAA 1TAEA 3L70G 3OW2O 3GB7C 2XTAA 4ZKIA 1EXJA 3KPEA 2Q3IA 5KTBA 1PV3A 1JY2P 4GYCB 3E8HA 1RE4C 3ASOC 1PGQA 2LJ2A 2XAHA 2JJLA 1P7GA 5E79E 1L0NH 5LP6C 3MD0A 4QE9A 1IX9A 5B5EE 4MN4C 1IZNB 1KU9A 4PJ0Z 1IBLO 1W0JG 2FTKA 1KD1Q 1KC8Q 5FNVB 1L0LD 1GU5A 1P4RA 2W83C 2K9PA 5CCHC 1MSWD 1NQTA 1Q6UA 1N7SC 4RUFA 2Y9YA 3HUSA 2KKWA 4O2BB 1L0LG 1NR1A 3EXAA 1OWAA 1ORQC 2H43A 3CCJP 3SPJA 2J59M 1UIIA 4DJGA 2WPDG 4IT5A 3KCXA 1PL5A 3ZHVA 1DGSA 4DR7O 1RF0A 2XASA 4GKJO 1Q82Q 1R3LC 2K1AA 2YIBA 3H1LD 1XMQB 3OGCC 3CCMV 3RGUA 2W6AA 1I5YA 4RUEA 4WY4C 3U59A 5H2FE 2OYIB 3CWBH 3ETGA 1YEWA 3STZC 1M57D 4LFAO 4R7CA 5IYZA 5KUKA 2IX7C 3E1RA 1L0NJ 3AE7C 4WBNB 4OVNF 4ZKPA 2C2AA 1QU7A 1LUWA 2Q0OC 2UXXA 5EYPA 4DV1B 4H44B 3H9VA 2QE7H 3B5ND 4NXMB 4PV1B 3RYHA 3R2PA 4BIOA 1LTSC 4IIJA 1RP3B 5KMGA 2Y69C 2L6LA 2VQEB 3VQXA 1YJ9V 2KOGA 4WB4A 2N9BA 1BQZA 3BABA 2LR2A 3VMYA 1FXHA 1H88A 2R3CA 4X1YA 5L3EA 1XMOB 1N33O 3ABLC 3TNUA 5IE9A 1XNRB 1Y47A 5AW0B 1HH0A 4DR4O 2OTJV 2ZYDA 2P4KA 2FFDB 2JDIH 3T1YB 4BWAA 3OAAG 2OARA 4OGQC 2PZSA 1ZMEC 4EOTA 2Q68A 3QVNA 1JO5A 5HFMA 1BSMA 1JQ0A 2UWJE 3CP1A 5JJEB 3RYFA 3QWOC 1PPJH 2EILB 3KCYA 4I7ZB 4LF7O 1URQB 5KHJA 1LGHB 3GW6A 5IYZB 1HW7A 3HKCA 5LHHA 3DC6A 4F6RA 1N36O 1IFDA 5IWAO 2M0BA 1Q3EA 4UVAA 4NPFX 2KSJA 1EFRG 1OX3A 1SQPD 3RYHB 1HNZB 2HG5D 4WVZA 3EFFK 4EDFA 5LYJA 1WN7A 2N1TD 1RQUA 2OIEA 1SQVE 4BRYA 2LGQA 5CBGA 1THZA 4PDLA 1JY3P 2O01N 4O4LA 4UUJC 1EZVI 1KFNA 5C8YA 4X1YB 1RQVA 1R3JC 1L1FA 4QGPA 3N2KA 4PDVA 3B2EE 1CPYA 5KHGA 3PHLA 3AG2B 1DK1A 4UCSA 3M7MX 3P32A 3JSNA 2QTOA 4K8XA 3ZMUA 5FLXN 1T8ZA 1KYOD 4MTOA 2KNCA 4TOIA 1BCCG 3ABMB 1SS1A 2BEQD 2PYLA 4LF8O 3A0HH 3PP5A 1H2MA 3PTZA 2GV9A 4PA6A 4TT3H 4WFFA 2BEZF 1IBKO 4D7SA 3L70H 1FJGO 1PD3A 1TVKA 3CPWO 5JJNB 2UUBB 1DX7A 2NNUA 3HKCB 3A8TA 4GDOA 1VQ7V 4MW8A 2KB7P 3CMEV 2H3OA 3CCMP 2DW4A 3Q5SA 2AZ2A 4B3MO 3L74E 3OFNG 2JS5A 4DR2O 5K1PA 2B9ZA 4I9QA 1KZUB 3TETA 3IR9A 2FMLA 4JI0B 1OCRB 1GRJA 3A0HZ 2Q7HA 5B66E 2QJKC 2QWPB 3CLQA 3FXDA 1ZXGA 1LTJA 1AJQA 3HR0A 1OFCX 2HKOA 2F23A 4K0KB 1L0LH 1J5EB 3B5NA 1G8MA 1YJWP 3ASNC 3OJAB 2GTAA 1NTKJ 3IN6A 3N2KB 4TUYA 1QX8A 1N73B 3ZS8C 3DSQA 4AQYB 1Q6HA 4JI5O 1SQXD 1M5IA 2XZRA 1IZ3A 1KD1W 3V2PA 5B1NA 5LA6B 4DR1O 5AW1B 2KNCB 2Z0AA 4TV8B 1K9MQ 3ABUA 1SQXG 5CBOA 3LNNA 4I5SA 1ZTEA 1PFIA 1NH2D 2CGOA 4GKGA 1NU1E 1JJ2U 4B3SO 4O4JB 3CXCU 1B06A 1I08A 3P3PA 3H1LH 4H13B 1ZWIC 2P58A 1MZ9A 1VQ8V 5BMVB 2UXNA 4DZOA 4IGGA 1BL8A 2HYNA 1H8AA 2KZJA 2E75B 3HUSC 2Z4EA 3II6A 4A5UB 4JAUA 4TLFA 4X62B 4GUNA 3H1IG 4J7JA 1Q5OA 2ETNA 3RL0B 3VYIA 2UXCB 2B87A 1WNSA 4U7NA 4XDLA 1LT9A 1NOHA 2HFEC 5C39A 1LTJB 4I6MC 5GTHE 4XDJA 3JD2A 4PDRA 2VWJA 2P7JA 2W6BA 3K0GA 4UCRA 5IJ0B 1L0LJ 1IFNA 1RF0C 1FD9A 5APVA 3FYEB 1SP4A 1VF5D 3CCEP 4JI4O 3ETDA 1P84E 4WFHA 5BR8O 3BCCG 4PD4F 3T1CA 1K8AQ 2KS1A 1OZ0A 2BSKA 4LFAB 3GWOA 4X65O 3CJHB 3SYOA 2P2UA 3D6YA 1IC2A 2BOCC 2NLJC 3OTFA 2R5BA 2XDJA 1GM7A 1ZP0C 4UB8E 4DUYB 1VQ5V 1N86A 4ASWA 2K37A 4KFMA 3GHGA 4RESB 3H1LJ 2UXDO 3IFMA 2Q7GA 3UM7A 4IHJA 4JYYA 2A06E 1GKFA 1HGZA 1YYCA 3G3ZA 4KJMA 2UUCO 3CHXA 4DV6O 2XU6A 4X1IA 3KXDA 2WMMA 4KHPB 1G1IA 4DR5O 2OT5A 3SJCC 2XAGA 1S5LX 1DH3A 3F5HA 3B4SA 3CMEP 1BE3D 4FLTA 1EZVE 1HNWB 3BRVB 3M9HA 1OCOB 2Q5UA 1R3KC 1TUEB 4LNUA 3CX5H 2LW7A 1Q7YW 3U1CA 2QM4A 4KXRA 2LXBA 2LFRA 4JGSA 1ZN5A 4EFBA 1QVFO 4Y99B 4X20B 1IFJA 3A0RA 1N34B 1BCCH 1M56B 3E1IA 3P8MC 4XA4A 2LFSA 1SA0B 1VQOP 2W8ZA 2WLLB 1M1KW 3GHGB 1KYOH 3Q1MA 4I4TB 1FDOA 1AR5A 1CW5A 3BA8A 3ICXA 2R32A 3IFXA 1DD4A 5B1OA 4FMTA 2X6BA 1NTKE 1YI2V 1OCRC 1SFCB 1HNXO 2UU9B 1VF7A 4LR3A 1IDSA 3HTKB 4P30A 3B77A 4JBZA 5C93A 1ZL8B 1HVVA 2BTQB 3FB7C 1VQ4P 2QG4A 2IBZD 1XUQA 3K5MA 4OPHA 3QO7A 1MMMA 2V7QG 2NRGA 5L3CA 3JAWB 4JF3A 1BQ0A 2JO1A 2ZFCA 2OYHA 1SQPJ 1JVMA 3W7WA 1YSCA 5JH7B 4WBAA 2CTPA 4YTPC 3T4DA 5LMNO 2XNDG 3ZJZA 4CS4A 2ZYGA 1DF5A 4NKGB 1KFMA 1NTZE 2ZINA 1OVRA 2L91A 1V55B 3S3WA 1SQVD 2ZDIA 4YHHO 2DYSC 1SQXH 4TWKA 4JI1O 4C7RA 5GTIH 4PHZA 1JM0A 4NXNB 1FXKA 1SQVG 1Y66A 3OW2U 4EB6B 3MP7B 3MTUE 3RK3B 4ZKUA 3N2GB 3QO5A 3I55V 4YJ2A 2B5UA 2CH7B 2Q8VA 2ZT9D 1M57C 4MS2A 4OGQD 5KLVJ 3O6QA 3RL0C 1N0NA 4F6EA 3RK2D 1VQ5P 4DR6O 4IL6E 2PGGA 1LTJC 1QVGU 1RF1B 3U11A 5A2QN 3KG2A 4ASUG 1GU4A 1ZLZA 3B5NC 3H1IH 1FXVA 3K06A 5GTIZ 5K1XA 5AVRB 3JASB 2UXBO 4W4LA 3B71A 4JI2O 3LDCA 1NO4A 2NN4A 1AQTA 3L74D 2FYUD 4O2AA 3H1KJ 4JAAA 1NBMG 3N7NA 3CRAA 5E79H 1JMKC 4TSFG 3RN4A 1L8DA 3CC2V 2SPZA 2Q5ZA 2IYOA 5B5EH 2K9JB 2ZM6O 1N8RQ 1NI8A 2F93B 2ZE7A 4YXWG 1NHLA 5AVTB 2Y9ZA 2H89C 1SQXJ 4YJ3A 2QM7A 5BVZA 2O1KA 4FM0A 1KQSO 1FZAA 3D70A 1KP2A 1IVSA 1RM1C 5KJ7D 1H8EG 4JYAO 4DV0O 2KUBA 3O6QB 1Q86W 2DN9A 1YQ4C 4MW3A 2GUZB 3G6EV 1LT9C 5CB4A 3VP9A 5E79Z 1K8AW 1AP5A 3K04A 3SPGA 4ZNCA 1N7LA 3CXHF 3UT5A 5B5EZ 1NTME 4GODA 1NU1D 4J11A 1JY2O 2EIJC 2EINC 2HG5C 2P90A 4LFCO 4I0XA 3K03A 1R3IC 3LNMB 1OCOC 1Y76B 4CH4A 1JMMA 1YI2P 4L73A 3THOA 2Y0CA 4NPDA 2VS0A 4PI0A 3SYPA 1NU1G 4C7NB 2ZXWB 4UXNA 4FZ1A 3J7AU 1Y74A 4F4LA 2BCCE 4X66O 1VQNV 5H2FH 3CCSV 2KIKA 2EIKC 2R9IA 2DYRB 4U7OA 3E8BA 1KKCA 2IJKA 2A7WA 4CH3A 3U0ZA 1M56C 2HPCA 3V2RA 2CAZC 2PGDA 1D5AA 4YJ3B 3GHGC 2KG7A 2XOKG 1X22A 1GN4A 3GLMA 3AE1C 1US6A 5DJUB 2WPQA 1P84D 3EHBB 1YIJV 2FY8A 1VQPV 2Q69A 2Q6AA 2HHHB 1ZX3A 5H2FZ 2LO1A 3BHPA 1QBZA 1GK4A 4CC5A 1SQPE 3E89A 4JI6B 3RGBA 5GONB 4A7PA 3E83A 4MSWC 3JARA 1YBKA 5EZYB 1T3JA 4H44D 2A9HA 4CS3A 4PV1D 1LUVA 3CCJV 3V4QA 5J2UA 4U3JA 2A06D 5KKZB 3AG3B 4HNAA 3CXHD 1YTZI 2V7QH 1GN2A 2JS3A 1ZSPA 4NVPA 4B08A 3CCUV 2HVKC 4LF5O 5A9GA 1GL2B 2JWDA 1HJBA 2EBOA 2A06G 3NXSA 1BE3J 3QO8A 4WFEA 4LFBO 5KLVE 1KP3A 1LTAC 5B3SB 2XNDH 4P9OA 3K59A 2YXLA 4H0LB 3WU2E 4B3TB 3AE4C 1JFFA 1M9NA 4PD4I 3C3SA 2JJ1G 4J80A 2WSSG 1Q81W 1D2DA 1EZVG 1EM1A 2LXCB 1SQVH 1GK6A 5IDJA 1BGYE 3VMAA 3CPWU 3MHHC 3O65A 4JYBA 4YIPA 3RBZA 4DUZB 1FDIA 2RMZA 1URQD 5AVXB 1K4DC 2HR3A 5BZBA 1PPJG 1JOYA 1N0JA 2ZJSE 5KJ7A 4LF9B 3PLNA 3H1KE 3JCZA 2D2CB 1FAVA 4FIPC 2IBZI 1S5JA 5APXA 2C9NY 1IK7A 2GBOA 4PA3A 3UIAA 5KUMA 4MTGA 4JPZB 5B1BB 1YVWA 3G6EP 2OYHC 4RO2A 2WTYA 4U3JB 4BXLA 3LSQA 2O01J 1AILA 4I2LC 3FAVB 2E76B 3FB6C 1NTKD 1K92A 1PNLA 4WCEV 3F7YC 3Q5PA 3ABVC 2ZDIC 1NTKG 1U7JA 1I7FA 3RK3E 5IY5B 2AEJA 3V4WA 2P7TC 3TXQA 1JA8A 1JY3O 1FXKC 3L35A 3L74H 2IFNA 1VIBA 3AK2A 4GLXA 1VQNP 2G8YA 4R4LA 1X59A 1PP9E 4YXWH 1G4YB 5B66H 5IJ9A 2P6JA 3OM3B 1VQMV 4DOJA 4TT3G 4UCTA 4K3AA 3K0DA 2K9YA 2LQTA 3MUDA 1S3JA 1VP7A 1NTZD 1KQFB 4KHXA 1MZFA 3K3WA 3L71D 2V4DA 3JYCA 2QDOA 3B8EB 4I50B 3M9BA 2XAJA 1E1QG 1J1EB 4GKKO 1N8RW 2OYIA 1YIJP 3ZRSA 1VQPP 3K5OA 4X64B 2CDYA 3E35A 1AI7A 4FFBA 3ML0A 1OZHA 2ADPA 3ZRWB 3CCRP 2A0LA 4CC6A 2K3RA 4NR1A 1HTLC 4PA9A 1ZRTD 1QLEB 5B66Z 4WBNA 5KHIA 5LMUB 1SQBK 2ZM6B 4FLXA 2DYRC 3S4RA 1NU1H 1RPRA 1UFIA 1V54B 4UCVA 3K5NA 3TXSA 1FZBA 3I5CA 3FB8C 3RW0A 3L74J 2RNBA 2WA4A 4IFMA 3CCUP 2FYUJ 3ZDMA 5GW7A 1LJ2A 2JP3A 3MIWA 5IJ9B 1OVUA 3OTOB 4JTDB 4JI8B 4N78E 4FLUA 2EIMC 3KKYA 2A3QA 2FFDA 1KB9F 1OCZC 4OWFA 1Q43A 1IURA 5GTHH 2I1KA 3X2QC 3L36A 2ZE6A 3JSLA 4H13D 1NVOA 1ZLLA 1DIPA 3H1LG 2E74B 3CI9A 4M3LA 1P84H 1NZ6A 2IJJA 1BE3E 4FFBB 1PL0A 1FZFA 2E75D 2ZVNB 1URQA 1RSOB 1NR7A 1WRGA 3RL0D 2KLVA 1LNQA 3HKEA 4GX0A 1NJIQ 1H2GA 3ZRXA 3OMAB 1YJWV 4UB8H 5GTHZ 2EZOA 4B3RO 5CA3A 5AVWB 4LLHA 1NU1J 4JQ0D 4NTWA 1VPCA 2ITAA 1AROP 1NTMD 4DXWA 1ZOYC 1R6KA 2OGUA 1R5SA 3VN0A 4YXDC 1IFIA 2A06H 2WLKA 1TA8A 2FL4A 2Y4TA 3SYAA 2OWOA 1PGJA 2ZKOA 1SQVK 1NTMG 3P8CE 3JALB 4PD4E 1AFOA 4DW0A 3VQWA 2QVAA 5H6QA 1P84I 1VQ6V 1I94O 4U7JA 3ABKB 4UB8Z 3T1HB 2BCCD 1E79G 4IYHA 2CTWA 4IOIH 3L73E 1X0TA 2WSSH 4DV4O 3WUVA 2ZT9C 1J1DC 1EZVH 4J7KA 2BCCG 4DV3O 3TSIA 4ABMA 1LTTC 1BDCA 1CXZB 3RK2C 2CPSA 2E5LO 4HZ3A 2IBZE 4GX5A 1JR9A 3K08A 5FPOA 1N2DC 1VQMP 1T5EA 1KB9D 3HKEB 4BIZA 1VEWA 3CXHI 4D6TD 2WSEH 3CMAP 1H2LA 2B89A 3H1HD 3O8ZA 5AW8B 3CCEV 5H9CA 1SQQD 5AW4B 4J7ZA 1P49A 2A45I 5IY5C 1U7MA 2JIZG 5CCGA 2UUAB 4ZOLB 3T2MA 3G4SP 4BAYA 1HF9A 4FLVA 1NT2B 1SQPG 1K73Q 1AVOA 1NTKH 4IYIA 1GW4A 3RVZA 2F4VO 4C46A 3B40A 1N73A 1HUCA 2JGDA 1X4TA 1WA8B 1M56D 5LA6A 2O3JA 1XOUA 1N32B 4OX9B 4TV8A 5KJ7C 1S9KE 1YHQV 1L0NK 3HKDB 5KLVD 2N9YB 1S72V 1Z56A 1FKAO 2YS8A 3OR6C 1FU1A 1GM9A 4DR3B 5LBQA 3EVKA 1QLNA 2Z3YA 5KLVG 4J41A 5D5PA 4O4JA 5CN0A 1QLEC 1SFCD 5JVDB 2YUAA 1EN4A 1NTZH 1M7LA 5BMVA 3AK1A 1WP7A 4LF6B 1BGYD 2FYUE 1JUNA 4QJFB 2WSEJ 3OEEG 4L87A 2ADQB 4JPRA 4HH2A 1NAFA 4L74A 1QL2A 1JOCA 1BGYG 3GG2A 1NWQA 2ILMA 3H1KD 2I1JA 1XQ8A 2WLIB 5APUA 2IU3A 2ZYAA 4WWIA 5IJ0A 1MG1A 3H1KG 4ZMDA 4IL6H 1JX9A 2FKXA 2JGDB 1VQOV 4FM2A 5EC1C 1M1JA 2WSFJ 5JCOA 1KC8W 1MABG 2WA3A 3MUDC 2YNYA 1A02F 1XREA 4XFJA 4JZGA 1UIXA 2QGNA 1QCEA 2Q1KA 3CJHA 2OYIC 2DE0X 3RK3D 1IBLB 1G6UA 3BRTB 2H88C 3B09A 2GUVA 2WSCH 2YXRB 3TK1A 2IZ1A 1VQ6P 1K97A 1FJPA 5JWPA 1IBMO 1SERA 1GDTA 2NPSB 1H38A 1CI6B 1BS3A 4IL6Z 1VQ4V 1PP9D 5FL7G 2QKSA 2HLDG 5JQGB 3WG7B 2WZ7A 2YKQA 1NTZJ 1Q82W 1Q90D 3L71J 1RFYA 3T4ZA 4H44C 3SWYA 1IO4A 3BPZA 4PV1C 1HGVA 2FKWB 3RBXA 1PP9G 5BU8B 4MVRA 1AJYA 1D7MA 1BT8A 1E1RG 3QNEA 4DR7B 1Q8IA 3NR7A 2XHBA 2P22C 1NAYA 5EBLC 2ZR2A 2CTQA 3HKBB 4GKJB 1K34A 1WPXA 3QH9A 3AECC 1IFMA 2K88A 2Q7CA 1OJHA 3Q4HB 5BY1A 2C0XA 4GOFA 2PFXA 1ZR4A 3S1KA 1W2BU 5B1AB 1M1JB 1WAZA 2FFDC 1HWTC 1NTMH 1NJIW 1H8HG 3OUFA 1JJOA 2QJPB 5LXTB 2M5AB 1SRYA 3UO3A 1GMJA 4X20A 3RL0g 1K5QA 2GSMB 1E79H 3GF3A 3C3TA 2YMYA 3KQGA 4UFZA 2VQFO 2EILC 4I7ZC 3Q3DA 4JV5O 2ZE5A 1URQC 2BCCH 2WSCJ 1AR1B 1SA0A 1G1JA 2ATKC 1W2EA 2WLLA 3E86A 1KKDA 2KP8A 3TYYA 4DK1A 1JPXA 1LP1B 1BSHA 1R6TA 4W4KA 3CB2A 1IK9A 1S5LE 4I4TA 2QEXP 1YHQP 1JY2N 4N78D 1QR8A 3CXHE 1S72P 2H94A 2KZIA 3K5BA 2YO3A 4LGDE 1SFCA 3BA9A 3W7XA 4FZ0A 1YITP 4B86A 1NTKK 2J5UA 1SVFA 3HTKA 1N33B 4UB6H 1ZL8A 4JI7O 3MDSA 2BTQA 5IYDO 4DR4B 1IXMA 5DJTB 2XT9A 3SPIA 4LF4O 3OGIB 2DOSA 3SPCA 1KILB 3AG2C 3JAWA 1F4MA 1AA0A 1SESA 1SQPH 1BE3G 1YQ3C 1B6QA 1SF9A 1U96A 1K5SA 3OR7C 4DCKA 1VF6A 1W59A 2PP6A 2G38A 5JH7A 5KAFE 5LHGA 3ABMC 1NTMJ 4K35A 4LF7B 5DECA 1Y67A 5CA1A 1YTFB 2FXMA 1FYJA 5EIBD 3SPHA 4O4HB 3V5BA 4UB6Z 1HR0O 1NGMB 2OCHA 1N36B 4NYKA 2HVJC 4GIFA 5IWAB 3UCSC 2P1JA 4HJGH 3P8CD 1N4CA 2BCCJ 1MZEA 2LGWA 4H33A 4PD4D 1KB9I 3ZMZA 4EB6A 3N2GA 5KLVH 3VQYA 2CH7A 3H1HG 1XDCA 2XNXA 1M90Q 2YIDA 2AEFA 1KQLA 3L73D 3WU2H 4NTXA 2OYOA 1TUBB 1L0LK 5CCGC 3R4YA 4Q20A 3M0DA 3E8FA 1RF1A 3GWKC 4DV7O 3L73G 4DV5O 3S3XA 1BDDA 3K9SA 2E3CA 1Q2NA 1BGYH 3UKMA 1N73C 2MKVA 1GL2D 4D6TJ 4LF8B 3JASA 3H1HJ 5AW3B 1XNQO 2IBZG 2AZ0A 2WLJA 1SQQJ 2NR5A 4BWNA 1IBKB 4K8ZA 3WU2Z 3H1KH 1FJGB 1QNMA 3ZHSA 5CA1B 4H0LD 3N4XA 3TGUD 4FJCC 1HP8A 4J42A 3WFVA 3APOA 3L71E 1R1BA 2IJHA 5CA0B 2FYNB 3NFQA 2B1GA 2RQ6A 4B3MB 2YI9A 5APWA 2K9JA 4DR2B 3TCUA 4H13C 4B7EA 5AW7B 3FFQA 4RQFA 3WG7C 2GDSA 2FYZA 2H8PC 1ZRTE 4L75A 1UJWB 3NTNA 2RKLA 3OAKA 5CHXA 2W90A 2E75C 1Y9BA 2YIUB 3AE3C 3Q2YA 1BHAA 2HJDA 2CGNA 2D2CD 2PUSA 2GUZA 1S9KD 1K9MW 2M6YA 3ZHRA 1MKMA 2B88A 3H1JD 3E7KA 1EZJA 4CH5A 4JI5B 4KT0J 1PP9H 2R9AA 1GH6A 3L72D 2ZXXA 4DR1B 2E76D 1GZLA 2JEUA 4LH6A 2ZAEB 2EX3A 1Y76A 1JMBA 3CE2A 2ZIMA 4JI3O 1BGYJ 1M1JC 1T3UA 5KAIE 5JCOC 4MVMA 4FLWA 3W7TA 4C7NA 3G67A 2Q3EA 2QJYB 2RN9A 4HYOA 2OCCB 2QJPC 4B3SB 2R5DA 1LWUB 4YY3O 3VBBA 5JJJB 2ODMA 1Z5WA 2KLUA 3L74G 2GM4A 4DYLA 3BVOA 1KN7A 2FYUG 3D36A 1EDLA 4NTYA 5CBNA 4N3YB 2QR4A 1TGOA 1SKVA 2AEMA 3AG1B 2DQ0A 1YXBA 3FWLA 3VTPC 2ZE8A 1WB7A 1GTOA 5AVUB 4X1KB 1S2EA 5E1AC 4FM1A 4HAMA 2R44A 3H32B 2QA4P 2WPRA 2YXYA 4JI4B 4JAVA 5GONA 5EBMC 3PH0A 1QLED 2P67A 4PA7A 1SQPK 1K7DA 1R8EA 1GTWA 5BR8B 1PP9J 2OTLV 1DD3A 3E22B 5EZYA 4QMAA 4MVZA 2N74A 4X65B 1R73A 3H6PA 3SSUA 3A0BE 3CRCA 3CSXA 1K4CC 1GN3A 1MOFA 4KL1A 2XKMA 5J9PC 4Y99C 4KUMA 1M93A 2IDBA 1FZGA 1BE3H 1AQ5A 2AW9A 1GL2A 2KSEA 3HD7B 2JKVA 3A7OA 2X0LA 1FS0E 2UXDB 4D7TA 4AILC 3RYCB 1XMQO 1KQGB 2E43A 5KLVK 3BVHA 3SJBC 2UUCB 4DV6B 3ASOB 5AVVB 4R50A 3LSSA 4WFBV 4U3FD 1FPOA 5F2VO 1KB9E 3W7UA 4DR5B 3CC7V 4UB6E 4N23A 4CZZA 3N27A 3AEDC 2M7WA 2KXPB 2Q6QA 3IF4A 3LDEA 1SFCC 2E74D 2Z5UA 3K79A 3CCRV 4D6TE 5CJ4A 1WMKA 3H1HE 3EQ2A 1NVPD 1MUUA 1SQFA 1N7SB 2WITA 2L5GB 1SQQE 3U10A 4PD4H 2YI8A 4B7KA 1AR4A 1W5CE 4DV1O 1EXIA 3FD9A 1ENVA 5LL6Y 4NXMO 1EN5A 1OIPA 2XAFA 3WUUA 3K57A 1FOSF 3L73H 2YMKA 1VF6C 2DQ3A 2GA1A 2O01H 2KSDA 2VQEO 3CWBD 2CUGA 3F5TA 2YKOA 3D6ZA 2M3EA 1LT1A 5AW2B 3FAVA 2KQXA 1WLEA 4C7UA 1MV8A 2QJ1A 3SWKA 2IBZH 1SQXK 1XMOO 2FYNC 1AI6A 5IYCO 1U97A 4IFFA 3D71A 3J80N 1XNRO 1V55C 1WP8A 2F1MA 2YC0A 3UQ8A 1BZKA 4WY4B 3T1YO 2R9RB 4YIOA 2F43G 3JCUH 2A45G 4EEQA 1HNXB 2AGAA 2QRXA 3RK3C 2JJ2G 1VQ9P 3TGUH 3AEIA 3F89A 3KDPB 4Z2WA 5KHHA 3VP8A 1D5NA 1LTIC 3VOPA 2PTMA 1KORA 3M0DC 5APQA 3BATA 3CEIA 1JNMA 1RF1C 2GUSA 1F23A 2YIAA 5L3FA 1KTMA 2YXQB 3M99B 4I50A 5KHKA 4WF9V 3CCQV 1Y8AA 3A2FA 3JCUZ 5AVQB 3ETQA 3GVMA 4JZ2A 3BRCA 5LMNB 1HNZO 1OHHG 1S5HC 3BEHA 4ICGA 3ZRWA 1Y6XA 2XV5A 5M1BA 2QM8A 4FFKA 2KI7B 2QJYC 3L73J 3OMNB 3APQA 3H1JH 1EDIA 3ABLB 2OCCC 2FXOA 3SJQC 5KLIB 3AEBC 4YHHB 3IC9A 4JI1B 1QL1A 2WAMA 4W80A 3OA7A 2YICA 2OTLP 2JGUA 4LCUC 4MTFA 2V1DA 4OXSA 3ETEA 3M0AA 4FLZA 4FVMA 2RMKB 2FYUH 3LW5J 4DR6B 4GT1A 3RVYA 1YZBA 3TGUJ 2B1IA 3DGEA 2GHYA 5BU5A 2UUBO 2CTRA 4TQDA 2WQYC 3IC7A 5LGNA 3RT3C 1RY3A 4XDKA 3G9RA 1PV0A 4J9ZB 2UXBB 1SETA 4LWSB 3ZEDA 1AVYA 3CC7P 3CMAV 4JI2B 2C9LY 1NTZG 4JI0O 3QF7A 3L71G 3VOUA 1JTHA 3F7VC 1RSOA 2ZXWC 2AXTE 2RDCA 1XBLA 1K04A 4ZHQB 2Z5HA 3G4SV 3K9AA 3L70D 5TISE 2QSAA 5L3GA 4TV9B 2W27A 5CCGD 1T2KD 2P4VA 4K0KO 3H1JJ 1EBOA 4CS2A 3ZHQA 4ZI7B 1CP9A 2BASA 3L72J 2IYPA 2XAQA 2IZ0A 2L35A 3D3IA 4AQYO 3D36C 2WPVB 4EI2A 2P5OA 4G27B 3OT7A 1CSBA 4JTCB 2Y0DA 4JYAB 3ZX6A 4DV0B 5EIBC 2PRRA 3HE5A 3F5WC 4GCZA 1AI4A 1COWG 3BCCE 1OCCB 1FE6A 2IW5A 1QVGO 3JALA 5DEDA 3TF5A 4LH7A 3ABTA 4RWUA 4GX2A 4PI2A 1E5WA 1L2PA 1GM8A 4FPPA 4G2KA 4LFCB 3A2AA 5CMZA 2A79B 3AK3A 1P7BA 3J81N 1AJPA 2NPSD 4U3FH 1GK9A 2AHZA 2ZCEA 2QJKB 5CJ0A 3HE4A 3PRJA 4AUWA 2QTSA 4X62O 2GTSA 3ZN0A 2QWRB 2W0FC 4X66B 1NVPB 1NH4A 2ZR3A 4WFGA 1JTHB 2H8PD 2UXCO 1JCHA 3ASNB 4RKUJ 5KKZC 1FFXA 3AG3C 3L75J 1OW7A 1V9PA 2YEVB 5J2TB 1B04A 3T97B 2N04A 2WT7A 2CE4A 1GN6A 1GL2C 3AE2C 3G71V 3CCQP 1FZCA 2PF4E 4HB1A 1X8YA 5B3SC 1OVVA 3AE8C 4H0LC 1F7YA 3KYQA 1S5LH 1PKXA 2DMXA 4ZOLA 3HE5B 2QSIA 3CX5F 3CXHH 1QVFU 1SQBE 2K1EA 1JB0J 4QPJA 1VL2A 3ITKA 3NMDA 1O9GA 3EWKA 2KK7A 3S9OA 2Y0EA 4DUYO 2JK5C 1EN6A 4UVBA 1XTGB 2A45H 1X79B 4QPKA 5APTA 1WA8A 3HUSB 3JD1A 2NZ2A 1PGPA 4NB5A 3RFRA 2Q0AA 3CS5A 3HKDA 2V4HA 2AXCA 3HE4B 4Q6GA 1VQLV 1KYOF 1S5LZ 2D2CC 4U3FJ 5AVZB 4JYCA 4L8JA 1OMIA 3W68A 1GAXA 4KHPO 1DTOA 1FS0G 1AJNA 3D8CA 3UO2A 3W67A 5KAFH 4LF5B 5B1BC 1FFXB 1PNMA 3TJTA 4DRXA 5JVDA 5K5GB 4LFBB 1BSNA 5KLIC 2E76C 3JSVC 2WT7B 3JCUE 4MVUA 3CRRA 4GZRB 4AI8A 1R6NA 1K05A 1FZCB 1HNWO 3TGUE 2QWOB 5L3DA 1ROPA 2YO2A 3CCLV 2FYUK 1KILD 4D6TG 3VQVA 4I9WA 5KA5A 4HKZH 2YKPA
chains in the Genus database with same CATH topology
3SFEC 1VF5C 2YMKA 4H13D 4KT0J 2V7QJ 2H89C 1DIPA 2E74B 3AEEC 3D6ZA 1FDIA 2E76D 2WPVB 3D70A 2FXPA 3AE5C 2J5UA 2OQQA 2G3AA 4Z1MH 1HJ0A 2E75D 2FYNC 1U57A 3D71A 2WSEJ 1YQ4C 3AEAC 3Q1MA 2D2CB 3Q5RA 2QJPC 1IK7A 1FDOA 1KILE 3C8VA 1DD4A 1YQ3C 4OGQC 1NYHA 4H13B 1ZMEC 3FGAD 2O01J 3AE6C 2E76B 1ZOYC 4I7ZB 3GMAA 4YXDC 2E75B 1OW6A 1EXJA 2WSFJ 3Q5PA 3ABVC 1NGMB 1KORA 1PV3A 3RK3E 4RKUJ 1KTMA 2JO1A 4XFJA 5KKZC 1UIXA 1TU3F 4U7JA 1OW7A 3T97B 2H88C 2G8YA 4R4LA 3AE2C 4YTPC 2ZT9C 1RQUA 1VF5D 5M1BA 1R8EA 2QJYC 3GLMA 4Y28J 3AE1C 1DD3A 3AEGC 3SFDC 2K9YA 3R4YA 2YIUC 3AEBC 3AE8C 4H0LC 1RQVA 1KQFB 1Q90D 4H44C 2QSIA 4PV1C 4IL6X 1PIXA 3D6YA 1OW8A 1JB0J 2P10A 1ZP0C 5L8RJ 1VL2A 4R4MA 3S9OA 1AJYA 3EWKA 2MKVA 2IDBA 1PL5A 2BEQD 2ZT9D 1KMIZ 2E74C 4OGQD 1VF5B 3O6QA 3AECC 2FBWC 3LW5J 3H25A 4TT3H 2NZ2A 2BEZF 4H0LD 1KQGB 4H44D 3AE9C 1HF9A 2D2CC 4PV1D 2WQYC 4GDOA 1OMIA 3GF7A 3Q5SA 3G9RA 3AEDC 3AEFC 1S5LX 1GMJA 3IAOA 4H13C 3RL0g 2E74D 2ZT9B 3GF3A 1WMKA 4OGQB 5KLIC 1S1CX 2E76C 3B71A 3AE7C 1ZRTE 4I7ZC 3Q3DA 2QJKC 2E75C 1Y9BA 2JP3A 2WSCJ 3AE3C 1K05A 4H0LB 3Q2YA 3AE4C 1K04A 4H44B 2QIWA 2D2CD 1EXIA 4PV1B 1MKMA 3IN6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E76 B;  2K9Y A;  2YIU C;  4KT0 J;  4I7Z B;  2E74 B;  2E75 B;  1Q90 D;  2WPV B;  2QSI A;  2WSF J;  4IL6 X;  1S5L X;  2ZT9 B;  5L8R J;  1JB0 J;  4OGQ B;  2FYN C;  5KLI C;  4RKU J;  2WSE J;  1ZRT E;  5KKZ C;  2D2C B;  2QJK C;  2WSC J;  2QJP C;  1VF5 B;  4H0L B;  3LW5 J;  4H44 B;  2QIW A;  3C8V A;  4PV1 B;  4H13 B;  2QJY C;  2O01 J;  4Y28 J; 
#chains in the Genus database with same CATH topology
 3CWB J;  1SQQ G;  5KAF Z;  1RE3 A;  2IH1 C;  2WLI A;  1S77 D;  1Z5V A;  1YTF D;  2I8D A;  5AVY B;  1N34 O;  1Q7Y Q;  2WSF H;  4PDM A;  5EYP B;  3CD6 V;  3VMZ A;  1QQC A;  2QWQ B;  4EYY Q;  2ZXE B;  2ZD9 A;  3HRN A;  4IIJ B;  2POH A;  3W7S A;  3CX5 D;  5KMG B;  2QEX V;  3H1J E;  1H0T A;  4LC1 A;  2ZNI A;  5EBW C;  1J1E C;  1NYH A;  2Y0I A;  3DTU B;  3KZI E;  5L3B A;  3L72 E;  2UU9 O;  1M1K Q;  1PL4 A;  1YIT V;  1DF4 A;  2NPS A;  1H2N A;  1NU1 K;  3TNU B;  4IFD K;  4DRX B;  1BCC D;  3K58 A;  4OPA A;  1CI6 A;  2Q9L A;  2Y48 A;  3PJS K;  1SZX A;  3CL3 D;  3L71 H;  3ZHT A;  5JQG A;  3B8N A;  3E2E A;  2JEE A;  3C90 A;  1V54 C;  3RYF B;  3C1L A;  4XBF A;  4RQE A;  2M8R A;  4EKW A;  1W0K G;  3HKB A;  1OCC C;  1UPG A;  1L4A D;  4DT0 A;  2BOB C;  1LTB C;  3G71 P;  3E8G A;  1RPO A;  3Q4H A;  4MVS A;  4F6R B;  3JAM N;  4XE5 B;  2Y4U A;  3ZN1 A;  1GO3 F;  4X88 A;  1PIX A;  2LKM A;  1AV1 A;  4GKK B;  4W7Y A;  2F66 C;  2ITD C;  4NXN O;  2DW3 A;  3L75 E;  4R4M A;  3BFR A;  4X89 A;  4GX1 A;  5LYJ B;  3WB1 A;  1KQS U;  5LXT A;  1S0V A;  2M5A A;  1H0T B;  4PJ0 E;  3FYI B;  4AHC A;  2E74 C;  4BRY B;  3V2Q A;  5KAI H;  4O4L B;  1FAF A;  4UCU A;  1EQ7 A;  5C8Y B;  1Z2G A;  1FJK A;  3FX0 A;  1YTZ T;  3AE9 C;  1USD A;  3SGI A;  2WLN A;  3P7K A;  2OYQ A;  1LP1 A;  1CEZ A;  4X8A A;  1L0N E;  3OE7 G;  3AEF C;  1VQL P;  3ZHU A;  1YJ9 P;  4LP8 A;  3IAO A;  3EFG A;  2ZNJ A;  4UVC A;  5AW9 B;  5FPR A;  1XL4 A;  5KAI Z;  2IU0 A;  2MK3 A;  3IGA C;  3ZBH A;  3MHV A;  1H89 A;  3ZIA G;  1XIL A;  1QGK B;  1TVK B;  3RYI A;  4ASV A;  2DYS B;  3L70 J;  4E4E A;  2OTJ P;  2Z5I A;  1DLB A;  1S76 D;  1DEE G;  4YPC A;  4U3F E;  2DJV A;  1KIL A;  3H1I D;  2ITC C;  3ABK C;  5IYB O;  4E2L A;  1YDX A;  2X6A A;  5KX5 A;  3K5L A;  3CCL P;  2WWW A;  4QE7 A;  3JC2 2;  1OV9 A;  3RWR D;  5AW6 B;  1M57 B;  3M91 A;  4CPG A;  1FC2 C;  4JTA B;  2JWA A;  2X6C A;  3L37 A;  1WPB A;  4O4H A;  2Q7E A;  5CBH A;  2C0W A;  5EC2 C;  3IJ4 A;  2Q4P A;  2QWN B;  3A0B H;  3B5N B;  3Q5R A;  3CD6 P;  4RJT A;  4B3R B;  1F51 A;  2IM9 A;  1FFT B;  4DW1 A;  4TUY B;  3BCC D;  5LHI A;  2N1T A;  1USE A;  1XHZ A;  3CWB E;  3AE6 C;  1Q86 Q;  4AYC A;  2W0X A;  3G6B A;  3OMI B;  1KUQ A;  5AVS B;  1FZC C;  2Q9I A;  2WPS A;  3CRQ A;  5HFL A;  1AVM A;  1TUB A;  3LUT B;  3CYO A;  2CK3 G;  1EDJ A;  1KB9 H;  4Z1V A;  1MFT A;  1IXB A;  3A0B Z;  3RYI B;  1I94 B;  1BHB A;  1JCC A;  3C9I A;  4JAS A;  4O4I A;  3WB0 A;  1TU3 F;  1XHX A;  1AP6 A;  4D6T H;  1QR9 A;  3FX7 A;  4N6J A;  3H1H H;  4DV4 B;  1OXZ A;  2B9B A;  3A3Y B;  3M8A A;  4DV3 B;  3HD7 D;  3A5T A;  4TQF A;  1SQQ H;  4MVO A;  5KX5 B;  1RM1 B;  2RH0 A;  5EFW B;  4BW9 A;  3CC4 V;  4Y28 J;  2E5L B;  2ARH A;  4DV2 O;  1L4A A;  2B87 B;  4FK5 C;  5KA6 A;  1LT9 B;  1J2J B;  2F95 B;  2ZQM A;  3JD0 A;  5CA0 A;  1VQ7 P;  2HHH O;  1XI1 A;  1NKD A;  1NTZ K;  2ZVO B;  4MVQ A;  3ZCC A;  5L8R J;  4RO0 A;  2EIJ B;  4DK0 A;  2EIN B;  2QA4 V;  1K73 W;  1SQB D;  1KMI Z;  2OIG A;  4JI6 O;  2N1T B;  5CCH D;  4J10 A;  4H37 A;  3CCV V;  1N7S D;  3DXR A;  2FBW C;  4HBN A;  1PPJ E;  1SLQ A;  2ZIO A;  2MW2 B;  1SQB G;  2KS1 B;  2BSK B;  2EIK B;  2YDE A;  1T2K C;  3FWN A;  2PI5 A;  1HDJ A;  2F4V B;  2WLM A;  2O1J A;  3GF7 A;  1FOS E;  1RE3 C;  5D5Q A;  3D3Q A;  4O4I B;  1G2C A;  4J9Y B;  1VMG A;  2PY5 A;  3LID A;  1LR1 A;  3MAQ A;  5BXZ A;  3LSU A;  2EUL A;  2KB1 A;  4IHJ B;  3AG4 B;  2HEP A;  2EZP A;  5H5N A;  4B3T O;  2W6J G;  4X1I B;  2HOD A;  1L4A B;  4WY4 D;  1MNG A;  1LWU A;  3O9O A;  2R70 A;  3CX5 I;  1PM9 A;  3P30 A;  3V6I A;  3LDD A;  1VQ8 P;  5CMU A;  2IH3 C;  3SYC A;  2FXP A;  2O57 A;  2HLO A;  3PN1 A;  3AE5 C;  3TGU G;  2NPS C;  3CRM A;  1HWY A;  4DUZ O;  1Y4M A;  4ZBM A;  3A0H E;  3OD4 A;  4PEL A;  1U57 A;  4LNU B;  3DXR B;  3WUT A;  1M8O B;  3VMX A;  4LF9 O;  1Q81 Q;  5APY A;  3L70 E;  1YCI A;  1SS3 A;  2EJR A;  2CPB A;  2JVD A;  4X1K A;  1KYO I;  1LTG C;  1NKN A;  3I56 V;  2J58 A;  2MJZ A;  3FGA D;  1ZUQ A;  2AHY A;  1MFZ A;  1RHZ B;  2BE3 A;  3FB5 C;  1IFP A;  3H32 A;  3QG5 A;  1VDF A;  2PAJ A;  1BCC J;  1G2C B;  2FB5 A;  2IPP A;  4I55 A;  1NTM K;  3H1J G;  3E22 A;  1NH2 B;  5AW5 B;  1QEX A;  4W7Z A;  1FDM A;  5B1A C;  1VQK V;  5LGT A;  3L72 G;  1L0L E;  1ZW0 A;  4GOE A;  3ZMT A;  1MA1 A;  1WB8 A;  3SDL A;  2HOD B;  3H01 A;  1JY3 N;  1XTC C;  4OH8 B;  1VQ9 V;  1YF2 A;  1FBM A;  1B3Q A;  1IBM B;  1G1X B;  4EIJ A;  1M4U A;  3HD7 A;  3JD4 A;  2AXT H;  3AEG C;  3SFD C;  4KP4 A;  3B8M A;  5TIS H;  3RYC A;  2R72 A;  1RE4 A;  3CC4 P;  4EFE A;  4IL6 X;  1JCD A;  4CBC A;  2WLH A;  1H2S B;  1I5X A;  2OYH B;  2IJI A;  1S4X A;  5LP6 A;  1OW8 A;  1YJN V;  3AG7 A;  1F4N A;  3H1L E;  4X64 O;  4Z1M G;  3FXE A;  1VAR A;  1FZE A;  3L75 D;  1VF5 B;  2LP7 A;  1P84 F;  4MTX A;  5CCH A;  2YXH A;  1ZR2 A;  3ZRV A;  1N7S A;  3USS A;  2AXT Z;  3BCC H;  1O9H A;  2DWE C;  2XUM A;  5LMU O;  5TIS Z;  4ZIB A;  3L75 G;  3CCV P;  1SQQ K;  4I55 B;  1FXK B;  1KIL C;  2CK3 H;  1K3E A;  3STL C;  3LIE A;  4YJ2 B;  1IJD B;  3SYQ A;  4QIW F;  3ZMV A;  2VQF B;  1S1C X;  1L0N D;  1DEB A;  4JV5 B;  1PZQ A;  4DO2 A;  3BAA A;  3JAT A;  1H2K A;  1J95 A;  1X9V A;  1L0N G;  3MZW B;  2JRI A;  3OTO O;  1AI5 A;  2X7R B;  4JI8 O;  3JAK A;  4O9B A;  2VRZ A;  3H1I J;  4WY4 A;  1K33 A;  3IAY A;  4BR6 A;  2N05 A;  2N1T C;  4LBE C;  3SJA C;  1WJZ A;  1ZAU A;  2RJZ A;  5LP6 B;  3SWF A;  2RCV A;  2RN0 A;  2BTO A;  1EC5 A;  4JI7 B;  3R65 A;  4O2A B;  4U3F G;  5LGU A;  4QNH B;  3FKS G;  4PA4 A;  3JD3 A;  1GW3 A;  3AEA C;  1NKZ B;  3ZMS A;  4RAI A;  1RH5 B;  4JF7 A;  4LF4 B;  1SQB H;  3QTC A;  1W2B O;  1KIL E;  3BCC J;  3DC5 A;  1A02 J;  5IT9 N;  2HP8 A;  3I5D A;  4DV2 B;  4BW5 A;  3M9Q A;  1Q6I A;  1NS1 A;  1AB3 A;  3BAS A;  3AG4 C;  3MGN A;  3P3N A;  4UV9 A;  1HR0 B;  3I56 P;  1OW6 A;  5ITZ A;  1L4A C;  4P2Z A;  4MT8 A;  2Q73 A;  1A32 A;  1ZV8 A;  2Y0P A;  2PYJ A;  5CB4 B;  1PGO A;  2EIM B;  1M90 W;  3MHS C;  1OCZ B;  3CWB G;  3JAT B;  4UV8 A;  4FLY A;  1T6A A;  3V2N A;  2E42 A;  1SQG A;  3X2Q B;  3CX5 E;  3UT5 B;  2QKA A;  2W6J H;  2P06 A;  3T1H O;  3JAK B;  1KBH A;  4L76 A;  3I55 P;  1VQK P;  4I0X B;  3HB3 B;  5LOV A;  3LW5 H;  1HBW A;  2EJ7 A;  5EK0 A;  2Q67 A;  4R8C A;  1GD2 E;  1BMF G;  4R6Z A;  1BCC E;  2R3S A;  2QE7 G;  3L4F A;  5TJH A;  1Y74 B;  1XL6 A;  1I0H A;  1WT6 A;  2YIU C;  1GMG A;  4I1L A;  5CBF A;  4DV7 B;  2E5Y A;  2PI4 A;  2HFE D;  5DN6 G;  4DV5 B;  3WB2 A;  1CZQ A;  1KYO E;  1XEQ A;  2P10 A;  2VWK A;  2HPC B;  2D3O W;  1XNQ B;  1SQB J;  4LWS A;  3WMM 0;  2Y69 B;  2KG7 B;  2YIB D;  1YJN P;  3H25 A;  1EZV D;  3L9D A;  2IFM A;  2JDI G;  2UUA O;  4UCO A;  4ZHQ A;  5ITZ B;  3CC2 P;  1PPJ D;  3BY6 A;  1R5L A;  4TV9 A;  2W6I G;  4G28 B;  4P9P A;  1LWU C;  3OEH G;  1MSD A;  4BIU A;  3OUS A;  3KZI H;  3L72 H;  3U1A A;  4ZI7 A;  4X9Q A;  2WVR A;  3TDK A;  2ZT9 B;  1J1D B;  4OGQ B;  3JAR B;  4AQR D;  2JEX A;  3RK2 B;  1KV4 A;  5APS A;  3HPL C;  2E5T A;  5LOV B;  1N32 O;  4OX9 O;  2H7H A;  3AG1 C;  5DM6 V;  1SZT A;  1SC5 B;  2QIW A;  1KEC A;  5J2U B;  3G80 A;  2JR8 A;  2HJF C;  4HNA B;  1SQX E;  3SR2 C;  5GTI E;  4DR3 O;  5FNV A;  2DWD C;  1EDK A;  1QHT A;  5AG2 A;  3KZI Z;  1VF5 C;  4NPE A;  3SFE C;  2V7Q J;  2YSU B;  2KYV A;  3AEE C;  4O2B A;  2VRS A;  4CH6 A;  2OQQ A;  2G3A A;  4JI3 B;  4Z1M H;  1URF A;  1HJ0 A;  1PNK A;  4LF6 O;  1JFF B;  3CCS P;  4YY3 B;  3L75 H;  1JEK A;  2M3B A;  2LW1 A;  5H6R A;  2QKC A;  3C8V A;  3H1I E;  4PJ0 H;  2YEV A;  5J2T A;  4WFA V;  2OTK E;  3M06 A;  4HYT B;  3T97 A;  1J5E O;  4N21 A;  3KHU A;  3R66 A;  1SQV J;  3HD7 C;  3GMA A;  1TAE A;  3L70 G;  3OW2 O;  3GB7 C;  2XTA A;  4ZKI A;  1EXJ A;  3KPE A;  2Q3I A;  5KTB A;  1PV3 A;  1JY2 P;  4GYC B;  3E8H A;  1RE4 C;  3ASO C;  1PGQ A;  2LJ2 A;  2XAH A;  2JJL A;  1P7G A;  5E79 E;  1L0N H;  5LP6 C;  3MD0 A;  4QE9 A;  1IX9 A;  5B5E E;  4MN4 C;  1IZN B;  1KU9 A;  4PJ0 Z;  1IBL O;  1W0J G;  2FTK A;  1KD1 Q;  1KC8 Q;  5FNV B;  1L0L D;  1GU5 A;  1P4R A;  2W83 C;  2K9P A;  5CCH C;  1MSW D;  1NQT A;  1Q6U A;  1N7S C;  4RUF A;  2Y9Y A;  3HUS A;  2KKW A;  4O2B B;  1L0L G;  1NR1 A;  3EXA A;  1OWA A;  1ORQ C;  2H43 A;  3CCJ P;  3SPJ A;  2J59 M;  1UII A;  4DJG A;  2WPD G;  4IT5 A;  3KCX A;  1PL5 A;  3ZHV A;  1DGS A;  4DR7 O;  1RF0 A;  2XAS A;  4GKJ O;  1Q82 Q;  1R3L C;  2K1A A;  2YIB A;  3H1L D;  1XMQ B;  3OGC C;  3CCM V;  3RGU A;  2W6A A;  1I5Y A;  4RUE A;  4WY4 C;  3U59 A;  5H2F E;  2OYI B;  3CWB H;  3ETG A;  1YEW A;  3STZ C;  1M57 D;  4LFA O;  4R7C A;  5IYZ A;  5KUK A;  2IX7 C;  3E1R A;  1L0N J;  3AE7 C;  4WBN B;  4OVN F;  4ZKP A;  2C2A A;  1QU7 A;  1LUW A;  2Q0O C;  2UXX A;  5EYP A;  4DV1 B;  4H44 B;  3H9V A;  2QE7 H;  3B5N D;  4NXM B;  4PV1 B;  3RYH A;  3R2P A;  4BIO A;  1LTS C;  4IIJ A;  1RP3 B;  5KMG A;  2Y69 C;  2L6L A;  2VQE B;  3VQX A;  1YJ9 V;  2KOG A;  4WB4 A;  2N9B A;  1BQZ A;  3BAB A;  2LR2 A;  3VMY A;  1FXH A;  1H88 A;  2R3C A;  4X1Y A;  5L3E A;  1XMO B;  1N33 O;  3ABL C;  3TNU A;  5IE9 A;  1XNR B;  1Y47 A;  5AW0 B;  1HH0 A;  4DR4 O;  2OTJ V;  2ZYD A;  2P4K A;  2FFD B;  2JDI H;  3T1Y B;  4BWA A;  3OAA G;  2OAR A;  4OGQ C;  2PZS A;  1ZME C;  4EOT A;  2Q68 A;  3QVN A;  1JO5 A;  5HFM A;  1BSM A;  1JQ0 A;  2UWJ E;  3CP1 A;  5JJE B;  3RYF A;  3QWO C;  1PPJ H;  2EIL B;  3KCY A;  4I7Z B;  4LF7 O;  1URQ B;  5KHJ A;  1LGH B;  3GW6 A;  5IYZ B;  1HW7 A;  3HKC A;  5LHH A;  3DC6 A;  4F6R A;  1N36 O;  1IFD A;  5IWA O;  2M0B A;  1Q3E A;  4UVA A;  4NPF X;  2KSJ A;  1EFR G;  1OX3 A;  1SQP D;  3RYH B;  1HNZ B;  2HG5 D;  4WVZ A;  3EFF K;  4EDF A;  5LYJ A;  1WN7 A;  2N1T D;  1RQU A;  2OIE A;  1SQV E;  4BRY A;  2LGQ A;  5CBG A;  1THZ A;  4PDL A;  1JY3 P;  2O01 N;  4O4L A;  4UUJ C;  1EZV I;  1KFN A;  5C8Y A;  4X1Y B;  1RQV A;  1R3J C;  1L1F A;  4QGP A;  3N2K A;  4PDV A;  3B2E E;  1CPY A;  5KHG A;  3PHL A;  3AG2 B;  1DK1 A;  4UCS A;  3M7M X;  3P32 A;  3JSN A;  2QTO A;  4K8X A;  3ZMU A;  5FLX N;  1T8Z A;  1KYO D;  4MTO A;  2KNC A;  4TOI A;  1BCC G;  3ABM B;  1SS1 A;  2BEQ D;  2PYL A;  4LF8 O;  3A0H H;  3PP5 A;  1H2M A;  3PTZ A;  2GV9 A;  4PA6 A;  4TT3 H;  4WFF A;  2BEZ F;  1IBK O;  4D7S A;  3L70 H;  1FJG O;  1PD3 A;  1TVK A;  3CPW O;  5JJN B;  2UUB B;  1DX7 A;  2NNU A;  3HKC B;  3A8T A;  4GDO A;  1VQ7 V;  4MW8 A;  2KB7 P;  3CME V;  2H3O A;  3CCM P;  2DW4 A;  3Q5S A;  2AZ2 A;  4B3M O;  3L74 E;  3OFN G;  2JS5 A;  4DR2 O;  5K1P A;  2B9Z A;  4I9Q A;  1KZU B;  3TET A;  3IR9 A;  2FML A;  4JI0 B;  1OCR B;  1GRJ A;  3A0H Z;  2Q7H A;  5B66 E;  2QJK C;  2QWP B;  3CLQ A;  3FXD A;  1ZXG A;  1LTJ A;  1AJQ A;  3HR0 A;  1OFC X;  2HKO A;  2F23 A;  4K0K B;  1L0L H;  1J5E B;  3B5N A;  1G8M A;  1YJW P;  3ASN C;  3OJA B;  2GTA A;  1NTK J;  3IN6 A;  3N2K B;  4TUY A;  1QX8 A;  1N73 B;  3ZS8 C;  3DSQ A;  4AQY B;  1Q6H A;  4JI5 O;  1SQX D;  1M5I A;  2XZR A;  1IZ3 A;  1KD1 W;  3V2P A;  5B1N A;  5LA6 B;  4DR1 O;  5AW1 B;  2KNC B;  2Z0A A;  4TV8 B;  1K9M Q;  3ABU A;  1SQX G;  5CBO A;  3LNN A;  4I5S A;  1ZTE A;  1PFI A;  1NH2 D;  2CGO A;  4GKG A;  1NU1 E;  1JJ2 U;  4B3S O;  4O4J B;  3CXC U;  1B06 A;  1I08 A;  3P3P A;  3H1L H;  4H13 B;  1ZWI C;  2P58 A;  1MZ9 A;  1VQ8 V;  5BMV B;  2UXN A;  4DZO A;  4IGG A;  1BL8 A;  2HYN A;  1H8A A;  2KZJ A;  2E75 B;  3HUS C;  2Z4E A;  3II6 A;  4A5U B;  4JAU A;  4TLF A;  4X62 B;  4GUN A;  3H1I G;  4J7J A;  1Q5O A;  2ETN A;  3RL0 B;  3VYI A;  2UXC B;  2B87 A;  1WNS A;  4U7N A;  4XDL A;  1LT9 A;  1NOH A;  2HFE C;  5C39 A;  1LTJ B;  4I6M C;  5GTH E;  4XDJ A;  3JD2 A;  4PDR A;  2VWJ A;  2P7J A;  2W6B A;  3K0G A;  4UCR A;  5IJ0 B;  1L0L J;  1IFN A;  1RF0 C;  1FD9 A;  5APV A;  3FYE B;  1SP4 A;  1VF5 D;  3CCE P;  4JI4 O;  3ETD A;  1P84 E;  4WFH A;  5BR8 O;  3BCC G;  4PD4 F;  3T1C A;  1K8A Q;  2KS1 A;  1OZ0 A;  2BSK A;  4LFA B;  3GWO A;  4X65 O;  3CJH B;  3SYO A;  2P2U A;  3D6Y A;  1IC2 A;  2BOC C;  2NLJ C;  3OTF A;  2R5B A;  2XDJ A;  1GM7 A;  1ZP0 C;  4UB8 E;  4DUY B;  1VQ5 V;  1N86 A;  4ASW A;  2K37 A;  4KFM A;  3GHG A;  4RES B;  3H1L J;  2UXD O;  3IFM A;  2Q7G A;  3UM7 A;  4IHJ A;  4JYY A;  2A06 E;  1GKF A;  1HGZ A;  1YYC A;  3G3Z A;  4KJM A;  2UUC O;  3CHX A;  4DV6 O;  2XU6 A;  4X1I A;  3KXD A;  2WMM A;  4KHP B;  1G1I A;  4DR5 O;  2OT5 A;  3SJC C;  2XAG A;  1S5L X;  1DH3 A;  3F5H A;  3B4S A;  3CME P;  1BE3 D;  4FLT A;  1EZV E;  1HNW B;  3BRV B;  3M9H A;  1OCO B;  2Q5U A;  1R3K C;  1TUE B;  4LNU A;  3CX5 H;  2LW7 A;  1Q7Y W;  3U1C A;  2QM4 A;  4KXR A;  2LXB A;  2LFR A;  4JGS A;  1ZN5 A;  4EFB A;  1QVF O;  4Y99 B;  4X20 B;  1IFJ A;  3A0R A;  1N34 B;  1BCC H;  1M56 B;  3E1I A;  3P8M C;  4XA4 A;  2LFS A;  1SA0 B;  1VQO P;  2W8Z A;  2WLL B;  1M1K W;  3GHG B;  1KYO H;  3Q1M A;  4I4T B;  1FDO A;  1AR5 A;  1CW5 A;  3BA8 A;  3ICX A;  2R32 A;  3IFX A;  1DD4 A;  5B1O A;  4FMT A;  2X6B A;  1NTK E;  1YI2 V;  1OCR C;  1SFC B;  1HNX O;  2UU9 B;  1VF7 A;  4LR3 A;  1IDS A;  3HTK B;  4P30 A;  3B77 A;  4JBZ A;  5C93 A;  1ZL8 B;  1HVV A;  2BTQ B;  3FB7 C;  1VQ4 P;  2QG4 A;  2IBZ D;  1XUQ A;  3K5M A;  4OPH A;  3QO7 A;  1MMM A;  2V7Q G;  2NRG A;  5L3C A;  3JAW B;  4JF3 A;  1BQ0 A;  2JO1 A;  2ZFC A;  2OYH A;  1SQP J;  1JVM A;  3W7W A;  1YSC A;  5JH7 B;  4WBA A;  2CTP A;  4YTP C;  3T4D A;  5LMN O;  2XND G;  3ZJZ A;  4CS4 A;  2ZYG A;  1DF5 A;  4NKG B;  1KFM A;  1NTZ E;  2ZIN A;  1OVR A;  2L91 A;  1V55 B;  3S3W A;  1SQV D;  2ZDI A;  4YHH O;  2DYS C;  1SQX H;  4TWK A;  4JI1 O;  4C7R A;  5GTI H;  4PHZ A;  1JM0 A;  4NXN B;  1FXK A;  1SQV G;  1Y66 A;  3OW2 U;  4EB6 B;  3MP7 B;  3MTU E;  3RK3 B;  4ZKU A;  3N2G B;  3QO5 A;  3I55 V;  4YJ2 A;  2B5U A;  2CH7 B;  2Q8V A;  2ZT9 D;  1M57 C;  4MS2 A;  4OGQ D;  5KLV J;  3O6Q A;  3RL0 C;  1N0N A;  4F6E A;  3RK2 D;  1VQ5 P;  4DR6 O;  4IL6 E;  2PGG A;  1LTJ C;  1QVG U;  1RF1 B;  3U11 A;  5A2Q N;  3KG2 A;  4ASU G;  1GU4 A;  1ZLZ A;  3B5N C;  3H1I H;  1FXV A;  3K06 A;  5GTI Z;  5K1X A;  5AVR B;  3JAS B;  2UXB O;  4W4L A;  3B71 A;  4JI2 O;  3LDC A;  1NO4 A;  2NN4 A;  1AQT A;  3L74 D;  2FYU D;  4O2A A;  3H1K J;  4JAA A;  1NBM G;  3N7N A;  3CRA A;  5E79 H;  1JMK C;  4TSF G;  3RN4 A;  1L8D A;  3CC2 V;  2SPZ A;  2Q5Z A;  2IYO A;  5B5E H;  2K9J B;  2ZM6 O;  1N8R Q;  1NI8 A;  2F93 B;  2ZE7 A;  4YXW G;  1NHL A;  5AVT B;  2Y9Z A;  2H89 C;  1SQX J;  4YJ3 A;  2QM7 A;  5BVZ A;  2O1K A;  4FM0 A;  1KQS O;  1FZA A;  3D70 A;  1KP2 A;  1IVS A;  1RM1 C;  5KJ7 D;  1H8E G;  4JYA O;  4DV0 O;  2KUB A;  3O6Q B;  1Q86 W;  2DN9 A;  1YQ4 C;  4MW3 A;  2GUZ B;  3G6E V;  1LT9 C;  5CB4 A;  3VP9 A;  5E79 Z;  1K8A W;  1AP5 A;  3K04 A;  3SPG A;  4ZNC A;  1N7L A;  3CXH F;  3UT5 A;  5B5E Z;  1NTM E;  4GOD A;  1NU1 D;  4J11 A;  1JY2 O;  2EIJ C;  2EIN C;  2HG5 C;  2P90 A;  4LFC O;  4I0X A;  3K03 A;  1R3I C;  3LNM B;  1OCO C;  1Y76 B;  4CH4 A;  1JMM A;  1YI2 P;  4L73 A;  3THO A;  2Y0C A;  4NPD A;  2VS0 A;  4PI0 A;  3SYP A;  1NU1 G;  4C7N B;  2ZXW B;  4UXN A;  4FZ1 A;  3J7A U;  1Y74 A;  4F4L A;  2BCC E;  4X66 O;  1VQN V;  5H2F H;  3CCS V;  2KIK A;  2EIK C;  2R9I A;  2DYR B;  4U7O A;  3E8B A;  1KKC A;  2IJK A;  2A7W A;  4CH3 A;  3U0Z A;  1M56 C;  2HPC A;  3V2R A;  2CAZ C;  2PGD A;  1D5A A;  4YJ3 B;  3GHG C;  2KG7 A;  2XOK G;  1X22 A;  1GN4 A;  3GLM A;  3AE1 C;  1US6 A;  5DJU B;  2WPQ A;  1P84 D;  3EHB B;  1YIJ V;  2FY8 A;  1VQP V;  2Q69 A;  2Q6A A;  2HHH B;  1ZX3 A;  5H2F Z;  2LO1 A;  3BHP A;  1QBZ A;  1GK4 A;  4CC5 A;  1SQP E;  3E89 A;  4JI6 B;  3RGB A;  5GON B;  4A7P A;  3E83 A;  4MSW C;  3JAR A;  1YBK A;  5EZY B;  1T3J A;  4H44 D;  2A9H A;  4CS3 A;  4PV1 D;  1LUV A;  3CCJ V;  3V4Q A;  5J2U A;  4U3J A;  2A06 D;  5KKZ B;  3AG3 B;  4HNA A;  3CXH D;  1YTZ I;  2V7Q H;  1GN2 A;  2JS3 A;  1ZSP A;  4NVP A;  4B08 A;  3CCU V;  2HVK C;  4LF5 O;  5A9G A;  1GL2 B;  2JWD A;  1HJB A;  2EBO A;  2A06 G;  3NXS A;  1BE3 J;  3QO8 A;  4WFE A;  4LFB O;  5KLV E;  1KP3 A;  1LTA C;  5B3S B;  2XND H;  4P9O A;  3K59 A;  2YXL A;  4H0L B;  3WU2 E;  4B3T B;  3AE4 C;  1JFF A;  1M9N A;  4PD4 I;  3C3S A;  2JJ1 G;  4J80 A;  2WSS G;  1Q81 W;  1D2D A;  1EZV G;  1EM1 A;  2LXC B;  1SQV H;  1GK6 A;  5IDJ A;  1BGY E;  3VMA A;  3CPW U;  3MHH C;  3O65 A;  4JYB A;  4YIP A;  3RBZ A;  4DUZ B;  1FDI A;  2RMZ A;  1URQ D;  5AVX B;  1K4D C;  2HR3 A;  5BZB A;  1PPJ G;  1JOY A;  1N0J A;  2ZJS E;  5KJ7 A;  4LF9 B;  3PLN A;  3H1K E;  3JCZ A;  2D2C B;  1FAV A;  4FIP C;  2IBZ I;  1S5J A;  5APX A;  2C9N Y;  1IK7 A;  2GBO A;  4PA3 A;  3UIA A;  5KUM A;  4MTG A;  4JPZ B;  5B1B B;  1YVW A;  3G6E P;  2OYH C;  4RO2 A;  2WTY A;  4U3J B;  4BXL A;  3LSQ A;  2O01 J;  1AIL A;  4I2L C;  3FAV B;  2E76 B;  3FB6 C;  1NTK D;  1K92 A;  1PNL A;  4WCE V;  3F7Y C;  3Q5P A;  3ABV C;  2ZDI C;  1NTK G;  1U7J A;  1I7F A;  3RK3 E;  5IY5 B;  2AEJ A;  3V4W A;  2P7T C;  3TXQ A;  1JA8 A;  1JY3 O;  1FXK C;  3L35 A;  3L74 H;  2IFN A;  1VIB A;  3AK2 A;  4GLX A;  1VQN P;  2G8Y A;  4R4L A;  1X59 A;  1PP9 E;  4YXW H;  1G4Y B;  5B66 H;  5IJ9 A;  2P6J A;  3OM3 B;  1VQM V;  4DOJ A;  4TT3 G;  4UCT A;  4K3A A;  3K0D A;  2K9Y A;  2LQT A;  3MUD A;  1S3J A;  1VP7 A;  1NTZ D;  1KQF B;  4KHX A;  1MZF A;  3K3W A;  3L71 D;  2V4D A;  3JYC A;  2QDO A;  3B8E B;  4I50 B;  3M9B A;  2XAJ A;  1E1Q G;  1J1E B;  4GKK O;  1N8R W;  2OYI A;  1YIJ P;  3ZRS A;  1VQP P;  3K5O A;  4X64 B;  2CDY A;  3E35 A;  1AI7 A;  4FFB A;  3ML0 A;  1OZH A;  2ADP A;  3ZRW B;  3CCR P;  2A0L A;  4CC6 A;  2K3R A;  4NR1 A;  1HTL C;  4PA9 A;  1ZRT D;  1QLE B;  5B66 Z;  4WBN A;  5KHI A;  5LMU B;  1SQB K;  2ZM6 B;  4FLX A;  2DYR C;  3S4R A;  1NU1 H;  1RPR A;  1UFI A;  1V54 B;  4UCV A;  3K5N A;  3TXS A;  1FZB A;  3I5C A;  3FB8 C;  3RW0 A;  3L74 J;  2RNB A;  2WA4 A;  4IFM A;  3CCU P;  2FYU J;  3ZDM A;  5GW7 A;  1LJ2 A;  2JP3 A;  3MIW A;  5IJ9 B;  1OVU A;  3OTO B;  4JTD B;  4JI8 B;  4N78 E;  4FLU A;  2EIM C;  3KKY A;  2A3Q A;  2FFD A;  1KB9 F;  1OCZ C;  4OWF A;  1Q43 A;  1IUR A;  5GTH H;  2I1K A;  3X2Q C;  3L36 A;  2ZE6 A;  3JSL A;  4H13 D;  1NVO A;  1ZLL A;  1DIP A;  3H1L G;  2E74 B;  3CI9 A;  4M3L A;  1P84 H;  1NZ6 A;  2IJJ A;  1BE3 E;  4FFB B;  1PL0 A;  1FZF A;  2E75 D;  2ZVN B;  1URQ A;  1RSO B;  1NR7 A;  1WRG A;  3RL0 D;  2KLV A;  1LNQ A;  3HKE A;  4GX0 A;  1NJI Q;  1H2G A;  3ZRX A;  3OMA B;  1YJW V;  4UB8 H;  5GTH Z;  2EZO A;  4B3R O;  5CA3 A;  5AVW B;  4LLH A;  1NU1 J;  4JQ0 D;  4NTW A;  1VPC A;  2ITA A;  1ARO P;  1NTM D;  4DXW A;  1ZOY C;  1R6K A;  2OGU A;  1R5S A;  3VN0 A;  4YXD C;  1IFI A;  2A06 H;  2WLK A;  1TA8 A;  2FL4 A;  2Y4T A;  3SYA A;  2OWO A;  1PGJ A;  2ZKO A;  1SQV K;  1NTM G;  3P8C E;  3JAL B;  4PD4 E;  1AFO A;  4DW0 A;  3VQW A;  2QVA A;  5H6Q A;  1P84 I;  1VQ6 V;  1I94 O;  4U7J A;  3ABK B;  4UB8 Z;  3T1H B;  2BCC D;  1E79 G;  4IYH A;  2CTW A;  4IOI H;  3L73 E;  1X0T A;  2WSS H;  4DV4 O;  3WUV A;  2ZT9 C;  1J1D C;  1EZV H;  4J7K A;  2BCC G;  4DV3 O;  3TSI A;  4ABM A;  1LTT C;  1BDC A;  1CXZ B;  3RK2 C;  2CPS A;  2E5L O;  4HZ3 A;  2IBZ E;  4GX5 A;  1JR9 A;  3K08 A;  5FPO A;  1N2D C;  1VQM P;  1T5E A;  1KB9 D;  3HKE B;  4BIZ A;  1VEW A;  3CXH I;  4D6T D;  2WSE H;  3CMA P;  1H2L A;  2B89 A;  3H1H D;  3O8Z A;  5AW8 B;  3CCE V;  5H9C A;  1SQQ D;  5AW4 B;  4J7Z A;  1P49 A;  2A45 I;  5IY5 C;  1U7M A;  2JIZ G;  5CCG A;  2UUA B;  4ZOL B;  3T2M A;  3G4S P;  4BAY A;  1HF9 A;  4FLV A;  1NT2 B;  1SQP G;  1K73 Q;  1AVO A;  1NTK H;  4IYI A;  1GW4 A;  3RVZ A;  2F4V O;  4C46 A;  3B40 A;  1N73 A;  1HUC A;  2JGD A;  1X4T A;  1WA8 B;  1M56 D;  5LA6 A;  2O3J A;  1XOU A;  1N32 B;  4OX9 B;  4TV8 A;  5KJ7 C;  1S9K E;  1YHQ V;  1L0N K;  3HKD B;  5KLV D;  2N9Y B;  1S72 V;  1Z56 A;  1FKA O;  2YS8 A;  3OR6 C;  1FU1 A;  1GM9 A;  4DR3 B;  5LBQ A;  3EVK A;  1QLN A;  2Z3Y A;  5KLV G;  4J41 A;  5D5P A;  4O4J A;  5CN0 A;  1QLE C;  1SFC D;  5JVD B;  2YUA A;  1EN4 A;  1NTZ H;  1M7L A;  5BMV A;  3AK1 A;  1WP7 A;  4LF6 B;  1BGY D;  2FYU E;  1JUN A;  4QJF B;  2WSE J;  3OEE G;  4L87 A;  2ADQ B;  4JPR A;  4HH2 A;  1NAF A;  4L74 A;  1QL2 A;  1JOC A;  1BGY G;  3GG2 A;  1NWQ A;  2ILM A;  3H1K D;  2I1J A;  1XQ8 A;  2WLI B;  5APU A;  2IU3 A;  2ZYA A;  4WWI A;  5IJ0 A;  1MG1 A;  3H1K G;  4ZMD A;  4IL6 H;  1JX9 A;  2FKX A;  2JGD B;  1VQO V;  4FM2 A;  5EC1 C;  1M1J A;  2WSF J;  5JCO A;  1KC8 W;  1MAB G;  2WA3 A;  3MUD C;  2YNY A;  1A02 F;  1XRE A;  4XFJ A;  4JZG A;  1UIX A;  2QGN A;  1QCE A;  2Q1K A;  3CJH A;  2OYI C;  2DE0 X;  3RK3 D;  1IBL B;  1G6U A;  3BRT B;  2H88 C;  3B09 A;  2GUV A;  2WSC H;  2YXR B;  3TK1 A;  2IZ1 A;  1VQ6 P;  1K97 A;  1FJP A;  5JWP A;  1IBM O;  1SER A;  1GDT A;  2NPS B;  1H38 A;  1CI6 B;  1BS3 A;  4IL6 Z;  1VQ4 V;  1PP9 D;  5FL7 G;  2QKS A;  2HLD G;  5JQG B;  3WG7 B;  2WZ7 A;  2YKQ A;  1NTZ J;  1Q82 W;  1Q90 D;  3L71 J;  1RFY A;  3T4Z A;  4H44 C;  3SWY A;  1IO4 A;  3BPZ A;  4PV1 C;  1HGV A;  2FKW B;  3RBX A;  1PP9 G;  5BU8 B;  4MVR A;  1AJY A;  1D7M A;  1BT8 A;  1E1R G;  3QNE A;  4DR7 B;  1Q8I A;  3NR7 A;  2XHB A;  2P22 C;  1NAY A;  5EBL C;  2ZR2 A;  2CTQ A;  3HKB B;  4GKJ B;  1K34 A;  1WPX A;  3QH9 A;  3AEC C;  1IFM A;  2K88 A;  2Q7C A;  1OJH A;  3Q4H B;  5BY1 A;  2C0X A;  4GOF A;  2PFX A;  1ZR4 A;  3S1K A;  1W2B U;  5B1A B;  1M1J B;  1WAZ A;  2FFD C;  1HWT C;  1NTM H;  1NJI W;  1H8H G;  3OUF A;  1JJO A;  2QJP B;  5LXT B;  2M5A B;  1SRY A;  3UO3 A;  1GMJ A;  4X20 A;  3RL0 g;  1K5Q A;  2GSM B;  1E79 H;  3GF3 A;  3C3T A;  2YMY A;  3KQG A;  4UFZ A;  2VQF O;  2EIL C;  4I7Z C;  3Q3D A;  4JV5 O;  2ZE5 A;  1URQ C;  2BCC H;  2WSC J;  1AR1 B;  1SA0 A;  1G1J A;  2ATK C;  1W2E A;  2WLL A;  3E86 A;  1KKD A;  2KP8 A;  3TYY A;  4DK1 A;  1JPX A;  1LP1 B;  1BSH A;  1R6T A;  4W4K A;  3CB2 A;  1IK9 A;  1S5L E;  4I4T A;  2QEX P;  1YHQ P;  1JY2 N;  4N78 D;  1QR8 A;  3CXH E;  1S72 P;  2H94 A;  2KZI A;  3K5B A;  2YO3 A;  4LGD E;  1SFC A;  3BA9 A;  3W7X A;  4FZ0 A;  1YIT P;  4B86 A;  1NTK K;  2J5U A;  1SVF A;  3HTK A;  1N33 B;  4UB6 H;  1ZL8 A;  4JI7 O;  3MDS A;  2BTQ A;  5IYD O;  4DR4 B;  1IXM A;  5DJT B;  2XT9 A;  3SPI A;  4LF4 O;  3OGI B;  2DOS A;  3SPC A;  1KIL B;  3AG2 C;  3JAW A;  1F4M A;  1AA0 A;  1SES A;  1SQP H;  1BE3 G;  1YQ3 C;  1B6Q A;  1SF9 A;  1U96 A;  1K5S A;  3OR7 C;  4DCK A;  1VF6 A;  1W59 A;  2PP6 A;  2G38 A;  5JH7 A;  5KAF E;  5LHG A;  3ABM C;  1NTM J;  4K35 A;  4LF7 B;  5DEC A;  1Y67 A;  5CA1 A;  1YTF B;  2FXM A;  1FYJ A;  5EIB D;  3SPH A;  4O4H B;  3V5B A;  4UB6 Z;  1HR0 O;  1NGM B;  2OCH A;  1N36 B;  4NYK A;  2HVJ C;  4GIF A;  5IWA B;  3UCS C;  2P1J A;  4HJG H;  3P8C D;  1N4C A;  2BCC J;  1MZE A;  2LGW A;  4H33 A;  4PD4 D;  1KB9 I;  3ZMZ A;  4EB6 A;  3N2G A;  5KLV H;  3VQY A;  2CH7 A;  3H1H G;  1XDC A;  2XNX A;  1M90 Q;  2YID A;  2AEF A;  1KQL A;  3L73 D;  3WU2 H;  4NTX A;  2OYO A;  1TUB B;  1L0L K;  5CCG C;  3R4Y A;  4Q20 A;  3M0D A;  3E8F A;  1RF1 A;  3GWK C;  4DV7 O;  3L73 G;  4DV5 O;  3S3X A;  1BDD A;  3K9S A;  2E3C A;  1Q2N A;  1BGY H;  3UKM A;  1N73 C;  2MKV A;  1GL2 D;  4D6T J;  4LF8 B;  3JAS A;  3H1H J;  5AW3 B;  1XNQ O;  2IBZ G;  2AZ0 A;  2WLJ A;  1SQQ J;  2NR5 A;  4BWN A;  1IBK B;  4K8Z A;  3WU2 Z;  3H1K H;  1FJG B;  1QNM A;  3ZHS A;  5CA1 B;  4H0L D;  3N4X A;  3TGU D;  4FJC C;  1HP8 A;  4J42 A;  3WFV A;  3APO A;  3L71 E;  1R1B A;  2IJH A;  5CA0 B;  2FYN B;  3NFQ A;  2B1G A;  2RQ6 A;  4B3M B;  2YI9 A;  5APW A;  2K9J A;  4DR2 B;  3TCU A;  4H13 C;  4B7E A;  5AW7 B;  3FFQ A;  4RQF A;  3WG7 C;  2GDS A;  2FYZ A;  2H8P C;  1ZRT E;  4L75 A;  1UJW B;  3NTN A;  2RKL A;  3OAK A;  5CHX A;  2W90 A;  2E75 C;  1Y9B A;  2YIU B;  3AE3 C;  3Q2Y A;  1BHA A;  2HJD A;  2CGN A;  2D2C D;  2PUS A;  2GUZ A;  1S9K D;  1K9M W;  2M6Y A;  3ZHR A;  1MKM A;  2B88 A;  3H1J D;  3E7K A;  1EZJ A;  4CH5 A;  4JI5 B;  4KT0 J;  1PP9 H;  2R9A A;  1GH6 A;  3L72 D;  2ZXX A;  4DR1 B;  2E76 D;  1GZL A;  2JEU A;  4LH6 A;  2ZAE B;  2EX3 A;  1Y76 A;  1JMB A;  3CE2 A;  2ZIM A;  4JI3 O;  1BGY J;  1M1J C;  1T3U A;  5KAI E;  5JCO C;  4MVM A;  4FLW A;  3W7T A;  4C7N A;  3G67 A;  2Q3E A;  2QJY B;  2RN9 A;  4HYO A;  2OCC B;  2QJP C;  4B3S B;  2R5D A;  1LWU B;  4YY3 O;  3VBB A;  5JJJ B;  2ODM A;  1Z5W A;  2KLU A;  3L74 G;  2GM4 A;  4DYL A;  3BVO A;  1KN7 A;  2FYU G;  3D36 A;  1EDL A;  4NTY A;  5CBN A;  4N3Y B;  2QR4 A;  1TGO A;  1SKV A;  2AEM A;  3AG1 B;  2DQ0 A;  1YXB A;  3FWL A;  3VTP C;  2ZE8 A;  1WB7 A;  1GTO A;  5AVU B;  4X1K B;  1S2E A;  5E1A C;  4FM1 A;  4HAM A;  2R44 A;  3H32 B;  2QA4 P;  2WPR A;  2YXY A;  4JI4 B;  4JAV A;  5GON A;  5EBM C;  3PH0 A;  1QLE D;  2P67 A;  4PA7 A;  1SQP K;  1K7D A;  1R8E A;  1GTW A;  5BR8 B;  1PP9 J;  2OTL V;  1DD3 A;  3E22 B;  5EZY A;  4QMA A;  4MVZ A;  2N74 A;  4X65 B;  1R73 A;  3H6P A;  3SSU A;  3A0B E;  3CRC A;  3CSX A;  1K4C C;  1GN3 A;  1MOF A;  4KL1 A;  2XKM A;  5J9P C;  4Y99 C;  4KUM A;  1M93 A;  2IDB A;  1FZG A;  1BE3 H;  1AQ5 A;  2AW9 A;  1GL2 A;  2KSE A;  3HD7 B;  2JKV A;  3A7O A;  2X0L A;  1FS0 E;  2UXD B;  4D7T A;  4AIL C;  3RYC B;  1XMQ O;  1KQG B;  2E43 A;  5KLV K;  3BVH A;  3SJB C;  2UUC B;  4DV6 B;  3ASO B;  5AVV B;  4R50 A;  3LSS A;  4WFB V;  4U3F D;  1FPO A;  5F2V O;  1KB9 E;  3W7U A;  4DR5 B;  3CC7 V;  4UB6 E;  4N23 A;  4CZZ A;  3N27 A;  3AED C;  2M7W A;  2KXP B;  2Q6Q A;  3IF4 A;  3LDE A;  1SFC C;  2E74 D;  2Z5U A;  3K79 A;  3CCR V;  4D6T E;  5CJ4 A;  1WMK A;  3H1H E;  3EQ2 A;  1NVP D;  1MUU A;  1SQF A;  1N7S B;  2WIT A;  2L5G B;  1SQQ E;  3U10 A;  4PD4 H;  2YI8 A;  4B7K A;  1AR4 A;  1W5C E;  4DV1 O;  1EXI A;  3FD9 A;  1ENV A;  5LL6 Y;  4NXM O;  1EN5 A;  1OIP A;  2XAF A;  3WUU A;  3K57 A;  1FOS F;  3L73 H;  2YMK A;  1VF6 C;  2DQ3 A;  2GA1 A;  2O01 H;  2KSD A;  2VQE O;  3CWB D;  2CUG A;  3F5T A;  2YKO A;  3D6Z A;  2M3E A;  1LT1 A;  5AW2 B;  3FAV A;  2KQX A;  1WLE A;  4C7U A;  1MV8 A;  2QJ1 A;  3SWK A;  2IBZ H;  1SQX K;  1XMO O;  2FYN C;  1AI6 A;  5IYC O;  1U97 A;  4IFF A;  3D71 A;  3J80 N;  1XNR O;  1V55 C;  1WP8 A;  2F1M A;  2YC0 A;  3UQ8 A;  1BZK A;  4WY4 B;  3T1Y O;  2R9R B;  4YIO A;  2F43 G;  3JCU H;  2A45 G;  4EEQ A;  1HNX B;  2AGA A;  2QRX A;  3RK3 C;  2JJ2 G;  1VQ9 P;  3TGU H;  3AEI A;  3F89 A;  3KDP B;  4Z2W A;  5KHH A;  3VP8 A;  1D5N A;  1LTI C;  3VOP A;  2PTM A;  1KOR A;  3M0D C;  5APQ A;  3BAT A;  3CEI A;  1JNM A;  1RF1 C;  2GUS A;  1F23 A;  2YIA A;  5L3F A;  1KTM A;  2YXQ B;  3M99 B;  4I50 A;  5KHK A;  4WF9 V;  3CCQ V;  1Y8A A;  3A2F A;  3JCU Z;  5AVQ B;  3ETQ A;  3GVM A;  4JZ2 A;  3BRC A;  5LMN B;  1HNZ O;  1OHH G;  1S5H C;  3BEH A;  4ICG A;  3ZRW A;  1Y6X A;  2XV5 A;  5M1B A;  2QM8 A;  4FFK A;  2KI7 B;  2QJY C;  3L73 J;  3OMN B;  3APQ A;  3H1J H;  1EDI A;  3ABL B;  2OCC C;  2FXO A;  3SJQ C;  5KLI B;  3AEB C;  4YHH B;  3IC9 A;  4JI1 B;  1QL1 A;  2WAM A;  4W80 A;  3OA7 A;  2YIC A;  2OTL P;  2JGU A;  4LCU C;  4MTF A;  2V1D A;  4OXS A;  3ETE A;  3M0A A;  4FLZ A;  4FVM A;  2RMK B;  2FYU H;  3LW5 J;  4DR6 B;  4GT1 A;  3RVY A;  1YZB A;  3TGU J;  2B1I A;  3DGE A;  2GHY A;  5BU5 A;  2UUB O;  2CTR A;  4TQD A;  2WQY C;  3IC7 A;  5LGN A;  3RT3 C;  1RY3 A;  4XDK A;  3G9R A;  1PV0 A;  4J9Z B;  2UXB B;  1SET A;  4LWS B;  3ZED A;  1AVY A;  3CC7 P;  3CMA V;  4JI2 B;  2C9L Y;  1NTZ G;  4JI0 O;  3QF7 A;  3L71 G;  3VOU A;  1JTH A;  3F7V C;  1RSO A;  2ZXW C;  2AXT E;  2RDC A;  1XBL A;  1K04 A;  4ZHQ B;  2Z5H A;  3G4S V;  3K9A A;  3L70 D;  5TIS E;  2QSA A;  5L3G A;  4TV9 B;  2W27 A;  5CCG D;  1T2K D;  2P4V A;  4K0K O;  3H1J J;  1EBO A;  4CS2 A;  3ZHQ A;  4ZI7 B;  1CP9 A;  2BAS A;  3L72 J;  2IYP A;  2XAQ A;  2IZ0 A;  2L35 A;  3D3I A;  4AQY O;  3D36 C;  2WPV B;  4EI2 A;  2P5O A;  4G27 B;  3OT7 A;  1CSB A;  4JTC B;  2Y0D A;  4JYA B;  3ZX6 A;  4DV0 B;  5EIB C;  2PRR A;  3HE5 A;  3F5W C;  4GCZ A;  1AI4 A;  1COW G;  3BCC E;  1OCC B;  1FE6 A;  2IW5 A;  1QVG O;  3JAL A;  5DED A;  3TF5 A;  4LH7 A;  3ABT A;  4RWU A;  4GX2 A;  4PI2 A;  1E5W A;  1L2P A;  1GM8 A;  4FPP A;  4G2K A;  4LFC B;  3A2A A;  5CMZ A;  2A79 B;  3AK3 A;  1P7B A;  3J81 N;  1AJP A;  2NPS D;  4U3F H;  1GK9 A;  2AHZ A;  2ZCE A;  2QJK B;  5CJ0 A;  3HE4 A;  3PRJ A;  4AUW A;  2QTS A;  4X62 O;  2GTS A;  3ZN0 A;  2QWR B;  2W0F C;  4X66 B;  1NVP B;  1NH4 A;  2ZR3 A;  4WFG A;  1JTH B;  2H8P D;  2UXC O;  1JCH A;  3ASN B;  4RKU J;  5KKZ C;  1FFX A;  3AG3 C;  3L75 J;  1OW7 A;  1V9P A;  2YEV B;  5J2T B;  1B04 A;  3T97 B;  2N04 A;  2WT7 A;  2CE4 A;  1GN6 A;  1GL2 C;  3AE2 C;  3G71 V;  3CCQ P;  1FZC A;  2PF4 E;  4HB1 A;  1X8Y A;  5B3S C;  1OVV A;  3AE8 C;  4H0L C;  1F7Y A;  3KYQ A;  1S5L H;  1PKX A;  2DMX A;  4ZOL A;  3HE5 B;  2QSI A;  3CX5 F;  3CXH H;  1QVF U;  1SQB E;  2K1E A;  1JB0 J;  4QPJ A;  1VL2 A;  3ITK A;  3NMD A;  1O9G A;  3EWK A;  2KK7 A;  3S9O A;  2Y0E A;  4DUY O;  2JK5 C;  1EN6 A;  4UVB A;  1XTG B;  2A45 H;  1X79 B;  4QPK A;  5APT A;  1WA8 A;  3HUS B;  3JD1 A;  2NZ2 A;  1PGP A;  4NB5 A;  3RFR A;  2Q0A A;  3CS5 A;  3HKD A;  2V4H A;  2AXC A;  3HE4 B;  4Q6G A;  1VQL V;  1KYO F;  1S5L Z;  2D2C C;  4U3F J;  5AVZ B;  4JYC A;  4L8J A;  1OMI A;  3W68 A;  1GAX A;  4KHP O;  1DTO A;  1FS0 G;  1AJN A;  3D8C A;  3UO2 A;  3W67 A;  5KAF H;  4LF5 B;  5B1B C;  1FFX B;  1PNM A;  3TJT A;  4DRX A;  5JVD A;  5K5G B;  4LFB B;  1BSN A;  5KLI C;  2E76 C;  3JSV C;  2WT7 B;  3JCU E;  4MVU A;  3CRR A;  4GZR B;  4AI8 A;  1R6N A;  1K05 A;  1FZC B;  1HNW O;  3TGU E;  2QWO B;  5L3D A;  1ROP A;  2YO2 A;  3CCL V;  2FYU K;  1KIL D;  4D6T G;  3VQV A;  4I9W A;  5KA5 A;  4HKZ H;  2YKP A; 
#chains in the Genus database with same CATH homology
 3SFE C;  1VF5 C;  2YMK A;  4H13 D;  4KT0 J;  2V7Q J;  2H89 C;  1DIP A;  2E74 B;  3AEE C;  3D6Z A;  1FDI A;  2E76 D;  2WPV B;  3D70 A;  2FXP A;  3AE5 C;  2J5U A;  2OQQ A;  2G3A A;  4Z1M H;  1HJ0 A;  2E75 D;  2FYN C;  1U57 A;  3D71 A;  2WSE J;  1YQ4 C;  3AEA C;  3Q1M A;  2D2C B;  3Q5R A;  2QJP C;  1IK7 A;  1FDO A;  1KIL E;  3C8V A;  1DD4 A;  1YQ3 C;  4OGQ C;  1NYH A;  4H13 B;  1ZME C;  3FGA D;  2O01 J;  3AE6 C;  2E76 B;  1ZOY C;  4I7Z B;  3GMA A;  4YXD C;  2E75 B;  1OW6 A;  1EXJ A;  2WSF J;  3Q5P A;  3ABV C;  1NGM B;  1KOR A;  1PV3 A;  3RK3 E;  4RKU J;  1KTM A;  2JO1 A;  4XFJ A;  5KKZ C;  1UIX A;  1TU3 F;  4U7J A;  1OW7 A;  3T97 B;  2H88 C;  2G8Y A;  4R4L A;  3AE2 C;  4YTP C;  2ZT9 C;  1RQU A;  1VF5 D;  5M1B A;  1R8E A;  2QJY C;  3GLM A;  4Y28 J;  3AE1 C;  1DD3 A;  3AEG C;  3SFD C;  2K9Y A;  3R4Y A;  2YIU C;  3AEB C;  3AE8 C;  4H0L C;  1RQV A;  1KQF B;  1Q90 D;  4H44 C;  2QSI A;  4PV1 C;  4IL6 X;  1PIX A;  3D6Y A;  1OW8 A;  1JB0 J;  2P10 A;  1ZP0 C;  5L8R J;  1VL2 A;  4R4M A;  3S9O A;  1AJY A;  3EWK A;  2MKV A;  2IDB A;  1PL5 A;  2BEQ D;  2ZT9 D;  1KMI Z;  2E74 C;  4OGQ D;  1VF5 B;  3O6Q A;  3AEC C;  2FBW C;  3LW5 J;  3H25 A;  4TT3 H;  2NZ2 A;  2BEZ F;  4H0L D;  1KQG B;  4H44 D;  3AE9 C;  1HF9 A;  2D2C C;  4PV1 D;  2WQY C;  4GDO A;  1OMI A;  3GF7 A;  3Q5S A;  3G9R A;  3AED C;  3AEF C;  1S5L X;  1GMJ A;  3IAO A;  4H13 C;  3RL0 g;  2E74 D;  2ZT9 B;  3GF3 A;  1WMK A;  4OGQ B;  5KLI C;  1S1C X;  2E76 C;  3B71 A;  3AE7 C;  1ZRT E;  4I7Z C;  3Q3D A;  2QJK C;  2E75 C;  1Y9B A;  2JP3 A;  2WSC J;  3AE3 C;  1K05 A;  4H0L B;  3Q2Y A;  3AE4 C;  1K04 A;  4H44 B;  2QIW A;  2D2C D;  1EXI A;  4PV1 B;  1MKM A;  3IN6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...