1VF5B

Crystal structure of cytochrome b6f complex from m.laminosus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords CYTOCHROME B6
total genus 29
structure length 138
sequence length 138
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1vf5B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1vf5B01
3LW5J 2ZT9B 4H13B 5L8RJ 1VF5B 3C8VA 2QIWA 1Q90D 4KT0J 5KKZC 1JB0J 4OGQB 2WSCJ 2QJPC 2O01J 4PV1B 2E75B 2E74B 2QJKC 2QJYC 4IL6X 2D2CB 4H0LB 4H44B 2QSIA 5KLIC 4RKUJ 2K9YA 2FYNC 1ZRTE 2YIUC 2WPVB 2WSFJ 4I7ZB 2WSEJ 4Y28J 1S5LX 2E76B
chains in the Genus database with same CATH superfamily
2NPSB 3AEDC 4EB6B 2VWKA 1OCOC 2L6LA 3RK3C 5B1OA 4DV3O 2JP3A 3CYOA 1N33B 4TOIA 1YIJV 5A2QN 3MHHC 4OX9B 3HUSB 3Q4HA 2WA3A 4U3FG 1Z56A 4F6EA 4RO2A 1GL2A 2YIUB 2YI9A 1N7SD 3SPJA 3ZMSA 3SYPA 2EZOA 1SQBG 3NTNA 1NO4A 3OAKA 3LSSA 1N34O 4UB8E 3D6YA 1IFMA 1NGMB 2H94A 4ZKPA 1Q86W 2Y4UA 2W8ZA 2E76D 1YXBA 4D6TJ 1K5SA 5EBMC 1YVWA 3D36C 1DF4A 3WG7C 3L75J 1S72V 3AEGC 3W7UA 2EIJB 1PNLA 2VQEB 1NYHA 3ZIAG 2N9YB 4WVZA 3SWYA 3AE8C 5KJ7C 1IBMO 1NTMG 2D2CC 5BMVA 2QA4P 3B40A 2JGDB 2W83C 2YIAA 1NTKD 2P58A 3H1LG 2EILB 3L73E 3H32B 5EK0A 3K57A 1NTZH 1K8AW 3H1JJ 1LTJB 2OTKE 2RDCA 3RL0C 3UT5A 3A0BZ 1JNMA 1VF7A 4JI0B 4C7NA 2V7QG 2E76B 4DR6B 3N2KA 3TDKA 1YQ4C 1M8OB 2M3BA 1H0TB 5JWPA 3DGEA 1FZBA 1BSHA 1VQNV 3LIDA 1G8MA 3PRJA 2Y48A 3QVNA 5EBLC 2GUSA 4ZNCA 2PF4E 3MAQA 3AE4C 2BEZF 3H1ID 3SPIA 1W2BU 3FB6C 1YJ9P 2UUCO 2RQ6A 1FS0E 4TSFG 4AQYB 1GM8A 4X1IA 2UUBO 1LT9C 1NT2B 2R9IA 2WLIA 1JY3P 1UFIA 2AXTE 4XDJA 4JQ0D 4I0XA 1JCDA 4FFBB 2HJFC 4N3YB 4J42A 4DUYO 1Y66A 1YJWP 2ZNJA 4K0KB 1HNZO 2H89C 3CCSP 2YXYA 1SQBD 4DCKA 1AR5A 3AK2A 3TXQA 2JKVA 4X64B 3H1HG 2O1KA 2YXLA 5IWAO 1CXZB 1NJIW 4GT1A 2CGOA 1XMQB 3PN1A 1S4XA 5KA6A 2O3JA 3GWKC 2DQ3A 2QE7G 3RBXA 4OVNF 4HYOA 1R5LA 5KHJA 4ASVA 4FJCC 5KLVE 3MDSA 4DW1A 3GF3A 5AVQB 4R6ZA 3L72D 3W7XA 3ZN1A 2K88A 2PI4A 3DSQA 4JZGA 5LXTA 1FAFA 3A0BE 2KI7B 4AI8A 3ZHVA 2ZXWB 5B1AC 3R4YA 5LP6A 1SQPG 4N78D 1QL2A 3OGCC 2B1GA 3CB2A 3L73H 2V7QH 2IFNA 2L91A 2A06G 1N0NA 3ABTA 1AV1A 1L0NK 5BVZA 1T5EA 1R1BA 1EM1A 3RK2C 1WA8B 4JI2B 1MFTA 3B2EE 2BCCH 2LW1A 2H8PC 1P84E 3WB1A 4FVMA 1KQSO 4DV5B 1KB9I 5LMUB 2Q68A 4X1YB 2ARHA 1SQXH 1HR0O 3H1IH 1SQBJ 1H38A 5JJJB 1YCIA 4WFBV 1NBMG 1RQUA 4YIOA 1LTAC 4ZHQA 2Z5UA 2JJ2G 1FZGA 2YKPA 5APYA 3HKEA 1IVSA 1PIXA 3RYHA 3I56V 1N86A 3IN6A 3CLQA 2WSCJ 3ABMB 4IT5A 1WP7A 2Y9YA 4Z2WA 3CMEP 1FPOA 2LXBA 1GD2E 2ZE8A 1GMGA 4D6TE 4TV8B 2ZIMA 1GW3A 1X8YA 2E75B 1FJGB 1KTMA 3CP1A 3K03A 2YIDA 3SDLA 3S3WA 1BE3G 1OW8A 5H2FE 1SQPH 2FFDA 4ICGA 3SYCA 1Y74A 5AVUB 3BRVB 5AVRB 4P30A 3CPWO 3L73J 4MN4C 3C1LA 3JD2A 2XKMA 2IBZG 4DR6O 5AVWB 4YXDC 5H6RA 1FDMA 1DGSA 3F7YC 1N36O 2A7WA 1GN2A 1LNQA 5KUKA 3FAVB 3A3YB 1FD9A 3OR7C 5LGNA 4BR6A 4B3SB 1ZLZA 1NTMK 4F6RB 1ZR4A 1L2PA 1AA0A 5AVYB 3GMAA 5CB4B 1L0LG 2KXPB 1E5WA 1NH4A 3D3QA 4GCZA 2JGUA 3TETA 1PGPA 1SRYA 2YI8A 1BGYH 1OW6A 4CH3A 1SERA 3RGBA 4FLZA 3B09A 1X59A 2JDIG 1T2KD 5J2TB 2ZVOB 3K79A 5KAIZ 2HFEC 5CMZA 4DR2B 4ZI7A 2BTQA 2EINB 4UV9A 5E1AC 4JI2O 1DEBA 1B04A 4J7ZA 2L35A 1SQBE 1EDJA 1PGJA 1YI2P 5IJ9A 2Q8VA 3OR6C 3K5NA 4NTYA 3T1HO 3BVOA 3HKDA 4D6TG 2BCCD 2YKOA 5B1AB 4JI5O 4B7EA 4KHPB 4DV6B 2Q5ZA 5APQA 2JRIA 4LLHA 1GH6A 5KHIA 3HD7A 4DZOA 4ABMA 3R2PA 2PZSA 2ZE5A 1QVFU 5KLVD 4P2ZA 5TISZ 1J5EO 5KHGA 2K9JB 3K5BA 5IJ9B 4X66B 5KAIH 1PNKA 1NOHA 1SFCC 3RK3B 2ZE6A 4N78E 3AECC 4X65O 1S5LZ 2O1JA 4FFKA 2QM8A 4X62B 2Y0PA 4LF8B 1NTMD 4HJGH 3ASOC 4O4LB 2P10A 3GF7A 2LP7A 1NAFA 2KSJA 3VN0A 2HYNA 1SQFA 4QIWF 4YY3O 1OCRC 2CGNA 2CH7B 1S2EA 1H2NA 3HKCB 3UO3A 1JB0J 4DR4B 4PD4I 2NRGA 3QWOC 2GM4A 2Y0EA 1NVOA 1NKDA 2AHYA 1L4AD 4LF6B 3V6IA 1VQNP 1RSOA 1SQXD 1ZOYC 4AILC 3D36A 2UXXA 2BE3A 4PELA 1PNMA 4JTDB 4JAVA 4EI2A 1NTKJ 1E1RG 2CK3G 1LTGC 1N2DC 3CX5F 1U97A 5CCHD 2HODA 2CTWA 1TAEA 1P49A 2YNYA 1AVYA 2ITDC 1VL2A 4NPFX 2QSAA 3RL0B 1NTKE 1JQ0A 2YSUB 2EIMC 1O9HA 3L73D 4HKZH 5CA1B 4I50A 4B3RB 4B3TB 1VQPV 2W90A 5A9GA 1L0LD 2KS1A 4BRYB 4B08A 2X7RB 2LFSA 4BAYA 2PY5A 5J2UB 3OTFA 3CX5E 3OE7G 2IJJA 1GM9A 3OFNG 1LT1A 1KFNA 1NTZD 5GTIH 4P9PA 2HG5D 1RM1B 3M91A 2DYSC 1ZRTD 3G80A 4JBZA 1R3LC 3ABKC 3VMAA 4LF9O 2RCVA 2KB7P 5C8YB 3B8EB 3GG2A 2QRXA 2EX3A 4OPHA 2OGUA 3HD7B 3H1IE 2WLHA 1LGHB 1LT9A 3W7SA 1HW7A 3C3TA 3L72J 1FBMA 1F7YA 4DR5O 3JAKA 1JOYA 1NR7A 4PV1B 1BDDA 1R8EA 3JD0A 3G6EP 1MSWD 3P7KA 2VRSA 3DTUB 1WLEA 5IYZB 5BU5A 1YJNP 1HGVA 1OCOB 1FKAO 1XNRO 2C2AA 1PFIA 3HTKB 1PPJE 2KUBA 4Y28J 2UU9B 1Y9BA 2QM4A 2IPPA 1IDSA 2L5GB 2XAQA 1W0KG 1XILA 4O4IA 1ZUQA 5CBNA 2C0XA 3ABLB 1PGQA 3T2MA 3J7AU 1QCEA 2WZ7A 1EN4A 2OYIB 3PJSK 3CC4V 1P7BA 3KCXA 4JF3A 2NPSD 2JK5C 1D5NA 1SESA 4O4IB 5APSA 1KU9A 2CDYA 1KECA 4DK1A 1HNXB 1JOCA 4BW5A 3G9RA 4H44C 5GONB 4AQYO 3EFGA 1KORA 1KYOE 2E5LB 4LBEC 4IIJB 3RT3C 2N1TB 4IYIA 5IYZA 2ZT9C 1HJBA 3KCYA 5KJ7D 4NKGB 3WMM0 1AI7A 2XOKG 4MVZA 4LF5O 2KOGA 1KB9E 4I50B 4J9ZB 3OMAB 3HKDB 4DV0O 3H1LJ 5EBWC 5FL7G 2KSEA 2Q73A 4O4HB 1VQKP 2ZXXA 2HKOA 2QJKC 2WSSG 5JJNB 4LF7B 1OW7A 4GKJB 4LF4B 1J2JB 2XNXA 3U1CA 1B6QA 1F4NA 1Q7YQ 5EZYA 5LOVA 2UXCB 1YI2V 2KB1A 3H1LE 3L73G 3OTOO 1OJHA 2IM9A 1FFXA 1KQFB 1VQMP 4XFJA 3M0DA 2KQXA 2KG7A 4HZ3A 5BXZA 1Z2GA 4LP8A 2QJKB 4LF9B 1TVKA 3A0HZ 3G4SV 1PV3A 3KKYA 3OA7A 2Q7EA 4WF9V 1URQA 3L72G 3VQWA 4PDLA 2IH3C 3D70A 4HAMA 3ZS8C 1YTFB 1VP7A 4O2BB 4UB8Z 1JR9A 3B5NC 4IFDK 3M7MX 4GKGA 1YEWA 1OCZC 1FFXB 1KUQA 1AI5A 2XNDH 1PGOA 2M0BA 2JVDA 1UIIA 1FZFA 2E75D 1L4AC 5EZYB 4G27B 4KL1A 2W6IG 2P4KA 3BEHA 4JGSA 3G6BA 2GHYA 3STZC 3C3SA 1NTZG 2AEFA 1ZL8B 1Q5OA 3AE6C 1QVGO 3OUSA 1RE3C 2W6JH 4GKKO 1LWUB 2Y0IA 4O2AA 4JYYA 2M7WA 4X9QA 4J9YB 3I55P 3JSNA 4E4EA 3V2RA 2P67A 1QLEC 4QNHB 1SQPE 3W68A 1IZNB 4MVRA 1NU1D 3CXHE 3CEIA 4U3JA 4WBNB 2LR2A 2XZRA 1OMIA 2XAHA 2I1KA 1EDLA 2FYUH 3ETQA 3JALB 4PD4D 2P06A 1GU5A 1AROP 1KKCA 4J10A 5BZBA 1YTZI 4DUYB 2R5DA 5IJ0B 2O01H 1NH2B 4J7JA 1XNQO 2DWEC 1FYJA 4X62O 3Q5PA 1I7FA 4LC1A 2WSFH 1UIXA 3KQGA 3PH0A 3BATA 4I7ZC 1FXKC 2W0XA 2RJZA 3ZDMA 5B3SC 3U1AA 3SYAA 1BGYG 4UUJC 1Y4MA 2XNDG 3H9VA 4KXRA 4F6RA 4JV5B 2QEXP 1UPGA 2CPSA 4OGQB 2JO1A 3AEFC 1WAZA 3TJTA 5LMNB 1KILA 2GBOA 3AE7C 4DV1O 1FOSF 3SFDC 1Q43A 1ZTEA 3OW2O 1VQ8V 2BCCE 5FNVA 1YJWV 3TGUH 2P7TC 4QGPA 2JGDA 3BY6A 4X1KB 5KMGB 5GTIZ 5L3EA 2VWJA 4ASWA 1NQTA 1OCRB 2KYVA 3A0BH 1L4AB 3CXHH 2QKCA 3L70D 1OV9A 4F4LA 3IAOA 3GHGA 1KB9F 2W6AA 3CI9A 1SQQJ 1KILC 1L0LJ 3VQYA 3FB7C 4LFCB 1SQQK 1M1JC 5B1BB 2GA1A 2F43G 4N21A 1BS3A 4MTXA 1YYCA 1EFRG 4GODA 2ZNIA 2CTPA 3CRMA 2DE0X 1L0LE 4GX1A 1K8AQ 3LNNA 3H1JG 4C7NB 2ATKC 3M8AA 2WPRA 5K5GB 5TISE 5LA6B 1QR8A 4JV5O 4MTFA 1KYOI 1SQXK 1H2MA 3K3WA 1ZMEC 3QTCA 2IBZD 1IX9A 3LIEA 4XDKA 1NU1K 3GHGC 2R9RB 2EIKC 3NMDA 4OPAA 4I7ZB 1OCCC 2B9ZA 3TGUG 4DV6O 2CUGA 5CA3A 3L75E 5C8YA 1P4RA 2WLNA 3UM7A 1Q86Q 3ZHQA 1G1IA 2Q69A 3UKMA 1PL4A 4L8JA 1AQTA 1EQ7A 1FDIA 4NPEA 3QO5A 4R4LA 2V1DA 2YXRB 5KLIB 2Z5IA 1PL0A 4NPDA 1O9GA 1KILD 5BY1A 1R3IC 1PPJD 2E43A 4H44B 1VQ4V 3WUUA 1S72P 4R7CA 1HNWB 1SVFA 1N8RW 2G38A 4RESB 2PTMA 2PAJA 1KYOF 2OCHA 3IC9A 4PA3A 2KNCB 4X1KA 1YJ9V 4YJ3A 1X9VA 1MZ9A 2B9BA 5KA5A 3BRTB 4BWNA 4UB6H 5CBGA 2A06E 2B1IA 3H6PA 1YIJP 3L74E 3K58A 1N32B 4HYTB 2ZJSE 4JI6O 4I9QA 5AVZB 1SQQE 1RFYA 1T6AA 2JEUA 4PI2A 3KPEA 2PUSA 2X6CA 2WLIB 4RKUJ 1MUUA 2MKVA 1BCCH 2UXDO 5KKZB 2WSFJ 2OWOA 2HP8A 3CRRA 3JCUZ 4W4LA 3JAKB 1IBKO 2ZE7A 1FZCA 1GM7A 4MTGA 3OW2U 1XTGB 2ZIOA 3VMZA 1S5HC 2WPQA 5KAFH 4KT0J 3RYIA 2Z4EA 3HR0A 2LFRA 1RY3A 2HPCA 4H37A 4JZ2A 1IK9A 1OVVA 1CPYA 5KLVJ 3HE4B 3FB8C 1HP8A 1NKNA 4JYAB 5CCGA 1G4YB 2ODMA 3OTOB 1QNMA 3GWOA 3MHVA 1OCZB 5AW2B 5KAFE 2VQFO 2WSEJ 1GRJA 5B5EE 3A0RA 1OX3A 1YQ3C 2CPBA 3L70H 3TF5A 4X65B 3C9IA 1HNWO 1EZVH 4UCVA 1YZBA 1HH0A 4J7KA 2P2UA 2ZVNB 3CC4P 3OEHG 3B5NA 4UB6Z 1JMBA 3ZHSA 1RF0C 4WB4A 2EJ7A 3SPCA 1Y8AA 3A0HE 3CWBH 3W67A 3E22A 1U57A 1NTME 4DR4O 3LUTB 1YBKA 2Q4PA 3W7TA 3N7NA 1VQOP 1VEWA 3SJBC 2CK3H 2YKQA 1N7SB 3V2PA 2R3SA 2R44A 1QVGU 4WBAA 4MS2A 3P3PA 4X1IB 2FYUE 1VF5B 4A5UB 1CZQA 2QIWA 4HBNA 1X79B 1GN6A 2YXHA 3H1KH 3K06A 3JSLA 1XQ8A 3WU2H 2IU3A 2WLLB 2G3AA 1K97A 4W80A 4IL6E 3AG4B 3P8MC 3U10A 4RWUA 4R8CA 4HB1A 3E8GA 5DEDA 1ORQC 3AEIA 2N1TC 4DR7O 3U11A 2IZ0A 2YO2A 2R5BA 3T4DA 2N05A 2VRZA 5C93A 3ZHUA 1IFIA 4JYBA 4DR3B 1GO3F 3O8ZA 4QPJA 1HNXO 2HVJC 4JI7B 1TUBA 4MVQA 1FZEA 1EZVG 1Q6UA 2EINC 3QH9A 4R4MA 5APXA 3RVYA 5LMNO 5B3SB 2E74C 1VQPP 2G8YA 1YTZT 5AW4B 2WT7A 3AG3C 5AG2A 3HB3B 5B1BC 1U7JA 1JUNA 1M7LA 3CWBG 2IBZI 5EIBD 2ZYDA 4PJ0E 1LT9B 2BASA 4NXNO 1ZN5A 2HR3A 4IIJA 1IFPA 3L74J 4DV2B 1LUWA 5LHHA 1ENVA 2QJYB 1S9KE 3BCCE 3AEAC 4O2AB 4DW0A 4CS4A 2FYUG 4GLXA 1B3QA 1IO4A 1A32A 1MZEA 2LQTA 4IL6H 3CMAP 1VQMV 2AXCA 1VPCA 1FXKA 1FJPA 1SQBH 1G6UA 2D2CB 3MUDC 4NXNB 3OJAB 1US6A 5FNVB 2JJLA 2R3CA 2UUAO 1BE3D 2WA4A 5HFMA 1MZFA 2LGWA 2WLJA 4JI4O 2YO3A 4DOJA 2Z0AA 3Q1MA 4C7UA 1K4DC 5H9CA 2MK3A 3TGUE 5B5EZ 1XMQO 4RO0A 5DN6G 2XTAA 4JF7A 1K7DA 2KG7B 1HVVA 3AG3B 2XAJA 3K0DA 5LGTA 4MW3A 1NS1A 2OYHC 1NTMH 1KFMA 4FK5C 1RH5B 1FS0G 4D7SA 1M1JA 3MGNA 4RQEA 3AE3C 4I2LC 1USEA 3L4FA 3HKBB 1R3KC 3CSXA 4O9BA 2GUVA 2I1JA 2P90A 4AHCA 3L75D 1M56B 1EZVE 3ZHTA 4YJ2A 3MP7B 3T97B 2P6JA 3JCUE 1P84I 3LSUA 4JAUA 5B5EH 4DUZO 1DTOA 5D5PA 4OWFA 4WCEV 4EDFA 4GX2A 3RBZA 3A8TA 4LNUA 3CC2V 2QA4V 1U7MA 3HPLC 1DEEG 2QWPB 2C0WA 2QM7A 4OGQD 5EYPA 2DQ0A 1F51A 5EC2C 2ZYAA 2F4VB 1X0TA 1KD1W 1E79H 1GZLA 3E1IA 2H43A 3E35A 4O4JA 4CPGA 1OWAA 3PLNA 1FU1A 2PP6A 1N73A 4YHHB 2WPSA 2V4HA 3KG2A 4HNAB 3I5CA 3JD4A 4EB6A 2FXOA 3L36A 1Q90D 4QMAA 1R73A 5LBQA 1SLQA 1NH2D 2R32A 3L71H 3SFEC 4XE5B 1QHTA 1VQ6V 1LP1B 4K3AA 2CAZC 1SQPK 3RL0D 4QJFB 2PRRA 4U7JA 3JATB 2GUZB 4FLUA 1PP9D 1RP3B 5GTHZ 5H2FZ 2YXQB 5KJ7A 1VQ9V 3TNUA 3WUTA 5GTIE 4O2BA 1EN5A 3QO8A 4DO2A 4BWAA 3B4SA 1JY2P 2OYOA 3P8CD 4M3LA 2IW5A 2LJ2A 1DD3A 4K0KO 5CCGC 2F95B 2RN9A 4DV1B 4GDOA 3H1HD 1DD4A 1J95A 4R50A 1ZLLA 1I08A 4DV2O 3GLMA 2BSKA 4U3FD 4WY4A 3L74D 4GYCB 3HE5A 3E89A 3E7KA 3H1JD 3IR9A 5LP6B 1NU1J 3G71V 1HBWA 2UXBB 3AG7A 4WFGA 3U59A 3CXCU 1LTJA 4NXMB 3H1IG 4WY4B 1M57D 4YPCA 3IC7A 1JX9A 3L75H 3OAAG 1Q81W 2Q5UA 2OIGA 1SS3A 3T1HB 2IZ1A 1NZ6A 3IAYA 2A06D 1YTFD 2NPSA 3O6QA 3V4WA 3K5MA 1NVPB 1D5AA 1GN4A 1GK9A 4PD4E 1SZTA 4I55A 1V55C 3RN4A 4ZIBA 5DJTB 1Y76A 1ROPA 3CWBJ 2D3OW 4E2LA 5AVVB 1EBOA 4KUMA 4FMTA 5CCGD 3X2QC 4ZOLA 4B7KA 3UO2A 1H8EG 2JR8A 2ZYGA 2AEJA 3OMIB 3D3IA 1PPJG 4JAAA 1DLBA 2WPDG 1DIPA 3CCUP 2ILMA 1URQC 1BCCG 1BE3H 5J9PC 5CA1A 4FFBA 4PJ0Z 1LTJC 3AG2B 1SQVJ 4UCOA 1VQ4P 4H0LD 3FFQA 1M93A 1VIBA 2WSCH 3JARA 3B5ND 5LP6C 1SA0B 3VTPC 3IF4A 3OUFA 2YEVB 1JY2O 3LDEA 3SJAC 4YTPC 4JTAB 1PV0A 2ZAEB 4P9OA 1ZW0A 1K9MQ 2ZM6B 4RUEA 2HVKC 5BR8O 2HHHO 2PGDA 3CCLP 3OEEG 4YJ3B 1EZVD 1SQPJ 2WAMA 1Z5VA 1WP8A 4DV7B 1T8ZA 1NTZE 5TJHA 3UT5B 1I94B 2EZPA 1GTWA 3K0GA 3K04A 3HKBA 3L70G 2ZINA 3CWBD 3NR7A 1Q8IA 3ABMC 2XHBA 4JI8O 5APUA 3FX7A 1X22A 1N34B 3HE5B 1NTZJ 1KP2A 2RMZA 3H1JH 4KFMA 4B3MO 3CC2P 3VQVA 4B3TO 2Q9LA 3GHGB 3JAMN 4K8XA 4ZKIA 1G1XB 4YY3B 2YEVA 2JIZG 2LKMA 3GB7C 2OARA 1HJ0A 3A2AA 2EBOA 4DR5B 3CX5D 4FIPC 1RHZB 1TGOA 2IYOA 2Z3YA 3L74G 3B71A 4XDLA 2XASA 3HKEB 3CCRV 1BCCD 2FYNB 3JATA 1HWTC 2Q6AA 2ADPA 2BCCJ 4I0XB 1BGYD 2OQQA 3RK2D 4TV9B 4YXWH 1T3JA 2BOBC 1JMKC 1V54C 3HD7D 1IJDB 1SFCA 2SPZA 3VOUA 1CI6A 4Z1VA 1BE3J 5JH7B 1NTKH 4WFHA 2OYHA 4G2KA 1W59A 4BXLA 2ZM6O 5JCOC 2H8PD 2CE4A 3AK1A 3E1RA 4JI1O 4UFZA 4LFCO 2KK7A 1U96A 4CC5A 4B3RO 4JI1B 2ZD9A 3H32A 1H2GA 1H2SB 3A5TA 2IH1C 1NTMJ 2KKWA 4U7OA 3ZMUA 1YITV 1SQQD 1XBLA 3M9HA 2Q7HA 4UVCA 3U0ZA 4GOFA 1M4UA 2A45I 2CTRA 3JCUH 5IJ0A 3HUSC 2LGQA 2AEMA 2Q3EA 1TUBB 2ZFCA 4Q6GA 4TLFA 2PGGA 4CH5A 1Q3EA 5E79E 2UU9O 2E76C 5LGUA 2UWJE 3ZRXA 2QR4A 4LH6A 2IBZE 3ZHRA 3QNEA 5GONA 2RN0A 4PA6A 3APQA 4FLXA 3ZN0A 4WFFA 2RMKB 2OTJV 2X6BA 5CBHA 5LYJA 1R6NA 1CSBA 5CBFA 1S1CX 1A02F 2QDOA 4NTXA 4BIOA 1IBMB 3V2NA 1IFJA 3VOPA 3D71A 2BTQB 2GUZA 4FZ1A 1Q81Q 1LR1A 1SQVK 1BQZA 2Y0DA 5LHGA 1KQLA 4LFBO 1V55B 4C7RA 4MVOA 1HWYA 5H5NA 2OTLP 3FAVA 3L35A 4LCUC 3S3XA 1WB7A 2JJ1G 1I94O 5IE9A 2E3CA 3N2KB 1RF1A 1OVRA 2J5UA 1F23A 2XT9A 2LXCB 5LYJB 3II6A 4ZKUA 3ETEA 4JTCB 3PP5A 3TXSA 1ZP0C 3JSVC 1QVFO 1VQLP 1SP4A 3ZEDA 1R6TA 4DR7B 2KLVA 1VQ5P 1VF6C 2ITAA 1BE3E 5AW8B 4X88A 4PJ0H 2UXNA 5APTA 3CD6V 5B66H 2FMLA 4TT3H 4GZRB 1XTCC 1GTOA 4I1LA 5IYCO 1KYOH 3V5BA 1M1KQ 1VQ9P 4NB5A 3RYHB 3E22B 5CA0B 1OXZA 2VQFB 1Q82Q 3B5NB 2NR5A 1WPBA 5GTHH 2KNCA 4EFBA 1XHXA 1K05A 1FZCB 1MV8A 3P8CE 4QE9A 3VMXA 2K9PA 2B5UA 2A79B 4KHXA 1SETA 3MIWA 2HODB 2W0FC 3SGIA 3DXRB 3AG1C 2PYJA 3CRAA 4WY4D 1QLNA 1M5IA 1S5LE 4H13B 1WJZA 5IYDO 5H2FH 1FZCC 2AHZA 1XEQA 2M8RA 1S3JA 3AE9C 2Q67A 2P1JA 1L8DA 1JFFB 2JWAA 2QJPB 1VMGA 2WSSH 4CC6A 4UXNA 5CA0A 2I8DA 1XOUA 3CPWU 2F93B 5B66Z 3NFQA 3A0HH 2FYUK 2LW7A 1J1EB 4JPRA 5KKZC 4LF7O 3FB5C 1KKDA 4OGQC 3EQ2A 5ITZA 3K5LA 4MSWC 1K92A 5LXTB 4FLVA 3GVMA 4UCTA 3CX5I 3AK3A 2W6BA 5LOVB 3L70E 5AW9B 1AJYA 1XUQA 2R72A 3CRCA 1NU1H 3L72H 2QJ1A 3DC5A 3P32A 4IYHA 4DK0A 4EEQA 1HR0B 1COWG 1Y47A 2ZXEB 1ZL8A 1XNRB 4BIZA 3TGUD 3JASB 3RW0A 3H1HJ 5JVDB 1MNGA 2KLUA 2NPSC 3A7OA 3H01A 1MSDA 2P22C 3H1HH 1JJ2U 4JI7O 3KHUA 4G28B 1KQSU 4PA7A 4X20A 1FAVA 1L4AA 3I5DA 1IBLB 5EC1C 2UXCO 3C90A 1QLEB 1FOSE 3DC6A 3RK3E 2OYIC 1JVMA 4BRYA 2QEXV 3KZIH 1QGKB 3VYIA 2EIMB 1D2DA 5DECA 1EZVI 1KC8Q 1S77D 2R9AA 2NLJC 1BCCE 3I55V 2Q7GA 3ABUA 4K8ZA 1AJPA 4O4LA 1YHQV 4I4TA 1TUEB 3RYCA 3DXRA 1TU3F 2A06H 4HNAA 2CH7A 1IBLO 3E8HA 4X20B 3RVZA 5FPRA 4JI6B 1DK1A 2HLOA 5JCOA 2DMXA 4GX0A 3QF7A 2A0LA 4D6TD 1WN7A 3E8BA 5B66E 3OD4A 2BCCG 3TSIA 4RAIA 3RYFA 1W5CE 1MOFA 3FWLA 3M0DC 3KZIZ 1Z5WA 3E83A 5KAIE 2IFMA 2Q9IA 3N2GB 4J11A 4PA9A 3P30A 2EULA 3KXDA 5IT9N 5AW5B 4QPKA 2VQEO 3W7WA 2K9YA 1QBZA 3ABVC 1F4MA 2ZT9D 2WPVB 2A9HA 1XI1A 1KILE 1YHQP 2IYPA 3HUSA 3RYFB 1AVOA 2UUAB 4I6MC 2QWRB 4JI4B 4GX5A 3LNMB 1M90W 1NAYA 2PI5A 2YMKA 3GW6A 1PL5A 4KP4A 2WQYC 5JQGB 4IOIH 3CCEP 1XREA 3BHPA 2FYUJ 1FJGO 1K33A 2GTSA 1W0JG 3BA9A 3BCCH 5ITZB 3M0AA 1AVMA 3MTUE 5APVA 1W2BO 3L71G 1HUCA 1SQVE 1SQPD 3F5HA 1Q2NA 5GW7A 3G3ZA 1NJIQ 5JH7A 2DN9A 1SC5B 4X1YA 4CH6A 3CCSV 3RYIB 2FXMA 4RUFA 2ZR3A 3WB2A 4B3MB 4IHJB 4H44D 2Y9ZA 1R6KA 3CD6P 1KILB 1L0ND 2MW2B 4FLYA 4K35A 5E79Z 2AW9A 2IBZH 4DXWA 1QX8A 2N04A 5CCHC 3THOA 3K9AA 2BEQD 4L74A 4RQFA 2E5LO 1W2EA 1M1KW 4EIJA 3ITKA 1YDXA 4CS3A 4IL6X 5AVSB 3RK2B 1XNQB 1H2KA 1NTKG 3H1LD 4DV4O 5EIBC 1AP6A 3T1YO 4B3SO 2OYQA 4JI3B 3R65A 3L75G 3KYQA 3L70J 2QWNB 2E42A 3WU2E 1JA8A 5L3CA 3S4RA 3H1KE 2E5TA 1RE4C 2HG5C 1KP3A 1ZWIC 3AEBC 1GU4A 2JDIH 2FB5A 3BCCJ 5FPOA 1G2CB 3CCVV 3FD9A 4LFBB 2KZIA 3T97A 1NU1E 3CXHD 5CN0A 3HE4A 5CCHA 4BW9A 5LL6Y 3FYIB 4FPPA 5IYBO 1K34A 1LTIC 3JYCA 3ZX6A 4FZ0A 2F66C 4YHHO 4EYYQ 1G2CA 2O01N 4A7PA 2GSMB 1L0LK 3S9OA 1VQ8P 3ZBHA 4PV1D 4MW8A 1NHLA 1ZR2A 2CTQA 2B87B 1P84D 2ADQB 3TNUB 1SQXE 3B8NA 3TCUA 3RK3D 4LF4O 4L87A 3HD7C 3F89A 5KLVK 3F5WC 4DRXB 1VF5D 3CCVP 1GAXA 3RYCB 1P84H 3G67A 4JASA 2QJYC 3H1JE 1DF5A 1EXIA 2YDEA 4I55B 1URQD 3WU2Z 3Q2YA 1SQXJ 2WWWA 2QKSA 2O57A 4IHJA 4UCUA 1IXMA 2DYRB 4ZMDA 1L1FA 4H0LC 4DR1O 4NVPA 3L71D 2Q0OC 3BAAA 4GUNA 4NYKA 1D7MA 1QLED 4TQDA 4ZBMA 2LO1A 1BL8A 3T1YB 1NTZK 4JYAO 3CCQP 2YC0A 3CMAV 3O65A 2KP8A 3FXEA 5KHHA 4DV3B 5AW6B 1TVKB 2FYUD 2M3EA 2M5AA 1VF6A 1J1DC 5KLVH 1AB3A 3CL3D 4DR2O 5JQGA 1L0NG 2QSIA 5AVXB 2QTOA 3RWRD 4X66O 3L74H 1EC5A 2ETNA 3FGAD 2ZKOA 2QWQB 1M57C 1FZAA 3J81N 1E1QG 3ETGA 4JI5B 3VMYA 3E86A 1Q6HA 2AXTH 2X6AA 4MVMA 4I5SA 5AVTB 2FFDB 2ITCC 3Q3DA 4Z1MG 1S9KD 2XAGA 3O9OA 3R66A 5LA6A 2FTKA 5CJ0A 2OTJP 1SKVA 1N73C 1PP9H 2R70A 3VP8A 5H6QA 2DYRC 1QQCA 4WFAV 4J80A 3H1KD 3T4ZA 1M57B 2JS5A 4I4TB 4MT8A 4LFAO 1PP9J 1THZA 3OGIB 1SFCB 1ZX3A 5D5QA 1USDA 3E8FA 3STLC 4CH4A 4PV1C 1H0TA 2UXDB 1HGZA 1XL4A 1WB8A 1QEXA 3ASOB 4PHZA 1RQVA 4J41A 2QWOB 2KZJA 5FLXN 3BCCD 5C39A 1AR1B 3NXSA 5IY5C 4CS2A 3VP9A 2WTYA 1VQ7P 4MTOA 1L0NH 1MKMA 1AJQA 3FXDA 1G1JA 1PZQA 1CEZA 3M99B 2K1AA 5L3FA 3KDPB 2KIKA 3CRQA 1Q82W 4B86A 1IURA 2JS3A 2WLKA 1K9MW 1VQ5V 3ZRVA 4CZZA 3N4XA 2MJZA 2N9BA 4JI8B 1KB9H 1JTHB 2J58A 2XDJA 2AGAA 1HF9A 2P4VA 3LSQA 3ZCCA 1VDFA 3CHXA 1NKZB 5E79H 4MVSA 1VARA 2HEPA 1Y67A 1VQ6P 3VBBA 1P7GA 1IFDA 2Z5HA 1NU1G 1SZXA 2N1TA 3I56P 2E74B 3WFVA 1PP9G 1WT6A 3L71E 2BSKB 3X2QB 1S76D 4DJGA 2IJHA 2N74A 1OHHG 2Q3IA 5APWA 3SJQC 1IK7A 3BA8A 3FKSG 4AYCA 2Y69C 2F4VO 1YJNV 2ZQMA 1S0VA 2ZDIC 2POHA 3FYEB 2EIKB 1M56D 1SQBK 1Q7YW 2EILC 1A02J 1FDOA 3JARB 1WMKA 1SA0A 3G6EV 3L71J 1X4TA 4GKJO 2EIJC 2OYIA 1JCCA 4LH7A 4LWSA 3F7VC 4N6JA 1KBHA 3EXAA 1SQGA 3Q4HB 3WUVA 1AR4A 4X89A 3OM3B 1FXKB 2IJIA 4LF5B 4AUWA 4DV5O 1RM1C 1L0NJ 2W27A 3HKCA 4NR1A 3AE2C 1GK6A 4W7ZA 4DRXA 1RF0A 2A45G 1H89A 3ABKB 3SSUA 1PM9A 4ZOLB 4IFFA 2DYSB 2K1EA 1KZUB 3K59A 2WITA 1GK4A 1SQVD 3RFRA 4FLTA 3CMEV 3SPGA 2QJPC 5KTBA 1KD1Q 4CBCA 2XU6A 5CMUA 3APOA 1YITP 3CCQV 4U3FE 4H13D 1QR9A 3FX0A 3JC22 3SR2C 2GDSA 4IFMA 1PD3A 4FM0A 1BQ0A 2Q6QA 2A3QA 2YMYA 2IX7C 2FYNC 1ZRTE 3SPHA 3JALA 3K9SA 2UXBO 3ML0A 4WY4C 4QE7A 2YUAA 4LFAB 2V7QJ 2YIBD 2XAFA 5KMGA 1KQGB 1J1DB 3CC7V 3MHSC 3QO7A 1VQ7V 2E74D 3BCCG 4DT0A 1J1EC 2H88C 4OX9O 4W7YA 4DV4B 1LWUC 3AG1B 1M9NA 2Q0AA 1WPXA 1MG1A 3ZMTA 4JYCA 4FM2A 3OMNB 4PDMA 1Y6XA 4H0LB 1OCCB 5AW3B 2OYHB 3ZMVA 1RE4A 3ASNB 2W6JG 1AFOA 4PA4A 2N1TD 4NXMO 2A45H 2DW4A 3K08A 2NNUA 1M1JB 1CP9A 3LW5J 2ZT9B 1YSCA 2VS0A 3ZRWA 1JJOA 1NI8A 2WMMA 5IWAB 1VQKV 3B77A 3LW5H 3CE2A 4X64O 5J2TA 1MA1A 1H8AA 3LDCA 4JPZB 3BABA 4ZHQB 1H8HG 2P7JA 2QGNA 3Q5SA 1IXBA 2K3RA 1E79G 1SFCD 3TK1A 4IGGA 1GL2C 1JM0A 1KYOD 2UUBB 2J59M 3CCMV 1L0NE 1FXHA 1N7LA 5BMVB 4PD4H 3ICXA 1KC8W 1EN6A 3CCUV 2DWDC 3A2FA 3AG2C 3MUDA 1GN3A 4WFEA 4C46A 2XV5A 4PI0A 3M06A 2DJVA 4GKKB 4WWIA 2Y69B 1WA8A 2YICA 1K04A 4DUZB 1KB9D 3G4SP 1EXJA 4DYLA 5BU8B 1UJWB 1Y74B 3EHBB 1J5EB 2BTOA 3H1LH 3FWNA 4JI0O 4U3FJ 1QL1A 2H7HA 3L9DA 2P5OA 5J2UA 2BOCC 3N2GA 1K73W 3CC7P 5L3BA 5BR8B 3CJHA 2HHHB 4HH2A 3AG4C 1GL2D 2K9JA 2OIEA 3ETDA 3CCMP 4LWSB 2FL4A 1T2KC 3ZRSA 5M1BA 1CW5A 1LUVA 5EFWB 3UQ8A 3P3NA 4UCSA 1BMFG 1R3JC 4GOEA 2DOSA 1SQQG 1JY3N 1BGYE 1GKFA 1N73B 2H3OA 4L76A 5LMUO 3SYQA 1RSOB 3CCEV 1GMJA 3PHLA 3MZWB 2FY8A 4LF6O 3H1KJ 2PYLA 3D6ZA 4DV7O 2Q7CA 5KLIC 3CJHB 2HJDA 1LTSC 2RKLA 1RF1C 1EDKA 2FKWB 2YIUC 3IGAC 2RNBA 5CBOA 1VF5C 3M9BA 3KZIE 3CS5A 1URQB 4H33A 2AXTZ 3JAWB 1JMMA 1JTHA 5L3DA 5DM6V 1ZV8A 4GIFA 2QE7H 3H1HE 5JVDA 3T1CA 3PTZA 1AI6A 1BSMA 4TQFA 1NVPD 1TA8A 1LJ2A 3EFFK 1BT8A 3UIAA 1JY3O 4IL6Z 5KLVG 2OT5A 1MFZA 2EJRA 1PPJH 2OCCC 1KN7A 2QG4A 5IDJA 3CCRP 3J80N 2KSDA 3SWKA 1EDIA 4EFEA 2NN4A 1FJKA 1R5SA 3JD3A 3S1KA 4Y99C 4D6TH 3QG5A 2ZR2A 3AEEC 5KHKA 1OZ0A 1V54B 4Q20A 4UVBA 1GW4A 3N27A 2B89A 3JAWA 1I0HA 2M6YA 4UV8A 3Q5RA 1N32O 1IFNA 4FLWA 5L3GA 2NZ2A 1SF9A 4EOTA 5AW7B 2YS8A 2GTAA 2OCCB 1HNZB 1LTBC 1SQQH 4EKWA 1BZKA 3MD0A 4H13C 1XL6A 3F5TA 4Z1MH 3CCJP 2ZDIA 4ZI7B 1RF1B 1NWQA 2DW3A 4UB6E 5AW0B 2C9LY 3ABLC 3UCSC 3H1IJ 4ASUG 3K5OA 2ZXWC 1SQXG 2RH0A 2K37A 5K1PA 4YIPA 3CX5H 1HDJA 4PDVA 2WVRA 3B8MA 4TWKA 4UCRA 1S5LX 1AJNA 1T3UA 2C9NY 1JO5A 5KX5B 1M56C 5EYPB 1FFTB 1NTKK 4KHPO 2B87A 5KAFZ 3V2QA 1MABG 4JI3O 5CB4A 1JCHA 3HTKA 4O4JB 1H88A 1IC2A 1S5LH 2E5YA 4PD4F 1Q6IA 1B06A 1XDCA 5CJ4A 1AQ5A 2FKXA 1IZ3A 2QVAA 4TUYB 3JCZA 2PFXA 1MMMA 2QTSA 4U3JB 4WBNA 4RJTA 4NTWA 1N36B 3V4QA 4LF8O 1YF2A 1ZSPA 2KS1B 3BPZA 2HLDG 4I9WA 3TGUJ 5GTHE 2FFDC 3JD1A 2WSEH 4UVAA 2AZ2A 2AZ0A 5L8RJ 3C8VA 5JJEB 3VQXA 3CXHF 2IDBA 1KMIZ 4YXWG 2FYZA 1BDCA 1KV4A 1PP9E 2WT7B 3RL0g 4L75A 1LTTC 5TISH 3H25A 2FXPA 1DH3A 1ZXGA 1OFCX 3BRCA 1OZHA 3EWKA 1XMOB 1V9PA 4TUYA 3USSA 3SYOA 1BCCJ 1L0LH 3OT7A 4DR3O 1XMOO 5AW1B 3WG7B 4AQRD 4TV9A 3SWFA 1N33O 1AI4A 2WLLA 4L73A 1BGYJ 3IJ4A 1JFFA 1DX7A 1AILA 3CCLV 1CI6B 4OH8B 1SQVH 3ZRWB 1N8RQ 1N0JA 2WLMA 5CHXA 4DV0B 1JY2N 1K73Q 1H2LA 3G71P 1HTLC 4KJMA 1BSNA 1N7SA 3WB0A 3TYYA 1OVUA 1BHAA 3BVHA 1P84F 1WNSA 1JPXA 1GDTA 4LGDE 2Q1KA 4W4KA 3BFRA 4OXSA 4LNUB 2QKAA 3BASA 2YIBA 4BIUA 2F1MA 5KUMA 1LP1A 2D2CD 1RPRA 2IJKA 1VQOV 2JEEA 2GV9A 3D8CA 1I5XA 3AE5C 3IFXA 3O6QB 1FXVA 3M9QA 1VQLV 1JEKA 1SS1A 3JASA 4U7NA 1FC2C 3H1KG 4D7TA 2JWDA 4DR1B 3CWBE 2UUCB 3ZJZA 5DJUB 2FBWC 1N4CA 4O4HA 2XUMA 4U3FH 1URFA 4TV8A 1RE3A 3HRNA 1N7SC 5K1XA 3ASNC 1PKXA 1I5YA 4X8AA 2IU0A 5F2VO 1S5JA 2OTLV 4N23A 4UB8H 1BHBA 2E75C 3SJCC 3AE1C 4YJ2B 5HFLA 2M5AB 1K4CC 3ZMZA 3IFMA 3L37A 1AP5A 1QU7A 5LHIA 4LR3A 1OIPA 1K3EA 1GL2B 1SQVG 3RGUA 1K5QA 4XBFA 1XHZA 2F23A 3CCJV 1LWUA 5B1NA 4XA4A 1NR1A 2V4DA 2HPCB 1EZJA 3LDDA 3EVKA 2HFED 2O01J 4MVUA 4Y99B 2ZCEA 4FM1A 1ZAUA 5KX5A 1IBKB 1FE6A 2X0LA 4PDRA 1WRGA 1M90Q 1RPOA 3CXHI 3E2EA 4TT3G 1Y76B 2JEXA 2Y4TA 2Y0CA 3L72E 2B88A 5IY5B
chains in the Genus database with same CATH topology
3AEDC 5L8RJ 1VF5B 3C8VA 4OGQC 2QIWA 2JP3A 2IDBA 1FDIA 1KMIZ 1OMIA 2QJPC 4YTPC 1S1CX 2BEQD 1AJYA 4R4LA 2G3AA 3Q3DA 3RL0g 3D71A 3H25A 2FXPA 1GMJA 4H13D 4OGQD 3D6ZA 4IL6X 3EWKA 3Q5PA 4H44B 3AECC 5KLIC 1UIXA 3D6YA 4I7ZC 2FYNC 1NGMB 1ZRTE 2YIUC 1VF5C 3G9RA 2E76D 4H44C 2P10A 3GF7A 1RQUA 1KORA 2V7QJ 2J5UA 3AEGC 1KQGB 4PV1C 1NYHA 1PIXA 2ZT9C 1Q90D 2E74D 5KKZC 3AEBC 3IN6A 4R4MA 2H88C 1JB0J 4OGQB 2JO1A 2WSCJ 2E74C 3AE8C 2G8YA 3AEFC 3SFEC 2D2CC 1RQVA 3AE7C 1ZP0C 3RK3E 1ZOYC 3SFDC 4U7JA 2E75B 1KTMA 2QJKC 1OW7A 1MKMA 4H0LB 4RKUJ 2MKVA 1OW8A 1HJ0A 4TT3H 2WSFJ 2D2CD 3S9OA 1DD3A 3AEEC 3B71A 2E76B 1TU3F 3AE5C 3LW5J 2ZT9B 1YQ4C 1VL2A 1KQFB 3Q5RA 4GDOA 4PV1D 1DD4A 4XFJA 4YXDC 2NZ2A 3GLMA 4KT0J 1HF9A 2OQQA 3AEAC 3IAOA 1VF5D 4H13C 1PV3A 2FBWC 2BEZF 3AE4C 4Z1MH 1K05A 3Q5SA 2E74B 2QJYC 3D70A 1EXIA 2D2CB 3GMAA 3Q2YA 2K9YA 3ABVC 2ZT9D 2WPVB 3T97B 2E75C 1KILE 2WSEJ 3AE1C 2H89C 1IK7A 3Q1MA 4H0LC 1S5LX 1YQ3C 1OW6A 2YMKA 1PL5A 3O6QA 2WQYC 4H13B 1FDOA 1WMKA 1K04A 1EXJA 2E75D 3AE9C 3AE3C 2O01J 4PV1B 1R8EA 3GF3A 1ZMEC 1U57A 2QSIA 3AE6C 1DIPA 3AE2C 2E76C 3R4YA 4Y28J 4I7ZB 4H44D 5M1BA 4H0LD 1Y9BA 3FGAD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LW5 J;  2ZT9 B;  4H13 B;  5L8R J;  1VF5 B;  3C8V A;  2QIW A;  1Q90 D;  4KT0 J;  5KKZ C;  1JB0 J;  4OGQ B;  2WSC J;  2QJP C;  2O01 J;  4PV1 B;  2E75 B;  2E74 B;  2QJK C;  2QJY C;  4IL6 X;  2D2C B;  4H0L B;  4H44 B;  2QSI A;  5KLI C;  4RKU J;  2K9Y A;  2FYN C;  1ZRT E;  2YIU C;  2WPV B;  2WSF J;  4I7Z B;  2WSE J;  4Y28 J;  1S5L X;  2E76 B; 
#chains in the Genus database with same CATH topology
 2NPS B;  3AED C;  4EB6 B;  2VWK A;  1OCO C;  2L6L A;  3RK3 C;  5B1O A;  4DV3 O;  2JP3 A;  3CYO A;  1N33 B;  4TOI A;  1YIJ V;  5A2Q N;  3MHH C;  4OX9 B;  3HUS B;  3Q4H A;  2WA3 A;  4U3F G;  1Z56 A;  4F6E A;  4RO2 A;  1GL2 A;  2YIU B;  2YI9 A;  1N7S D;  3SPJ A;  3ZMS A;  3SYP A;  2EZO A;  1SQB G;  3NTN A;  1NO4 A;  3OAK A;  3LSS A;  1N34 O;  4UB8 E;  3D6Y A;  1IFM A;  1NGM B;  2H94 A;  4ZKP A;  1Q86 W;  2Y4U A;  2W8Z A;  2E76 D;  1YXB A;  4D6T J;  1K5S A;  5EBM C;  1YVW A;  3D36 C;  1DF4 A;  3WG7 C;  3L75 J;  1S72 V;  3AEG C;  3W7U A;  2EIJ B;  1PNL A;  2VQE B;  1NYH A;  3ZIA G;  2N9Y B;  4WVZ A;  3SWY A;  3AE8 C;  5KJ7 C;  1IBM O;  1NTM G;  2D2C C;  5BMV A;  2QA4 P;  3B40 A;  2JGD B;  2W83 C;  2YIA A;  1NTK D;  2P58 A;  3H1L G;  2EIL B;  3L73 E;  3H32 B;  5EK0 A;  3K57 A;  1NTZ H;  1K8A W;  3H1J J;  1LTJ B;  2OTK E;  2RDC A;  3RL0 C;  3UT5 A;  3A0B Z;  1JNM A;  1VF7 A;  4JI0 B;  4C7N A;  2V7Q G;  2E76 B;  4DR6 B;  3N2K A;  3TDK A;  1YQ4 C;  1M8O B;  2M3B A;  1H0T B;  5JWP A;  3DGE A;  1FZB A;  1BSH A;  1VQN V;  3LID A;  1G8M A;  3PRJ A;  2Y48 A;  3QVN A;  5EBL C;  2GUS A;  4ZNC A;  2PF4 E;  3MAQ A;  3AE4 C;  2BEZ F;  3H1I D;  3SPI A;  1W2B U;  3FB6 C;  1YJ9 P;  2UUC O;  2RQ6 A;  1FS0 E;  4TSF G;  4AQY B;  1GM8 A;  4X1I A;  2UUB O;  1LT9 C;  1NT2 B;  2R9I A;  2WLI A;  1JY3 P;  1UFI A;  2AXT E;  4XDJ A;  4JQ0 D;  4I0X A;  1JCD A;  4FFB B;  2HJF C;  4N3Y B;  4J42 A;  4DUY O;  1Y66 A;  1YJW P;  2ZNJ A;  4K0K B;  1HNZ O;  2H89 C;  3CCS P;  2YXY A;  1SQB D;  4DCK A;  1AR5 A;  3AK2 A;  3TXQ A;  2JKV A;  4X64 B;  3H1H G;  2O1K A;  2YXL A;  5IWA O;  1CXZ B;  1NJI W;  4GT1 A;  2CGO A;  1XMQ B;  3PN1 A;  1S4X A;  5KA6 A;  2O3J A;  3GWK C;  2DQ3 A;  2QE7 G;  3RBX A;  4OVN F;  4HYO A;  1R5L A;  5KHJ A;  4ASV A;  4FJC C;  5KLV E;  3MDS A;  4DW1 A;  3GF3 A;  5AVQ B;  4R6Z A;  3L72 D;  3W7X A;  3ZN1 A;  2K88 A;  2PI4 A;  3DSQ A;  4JZG A;  5LXT A;  1FAF A;  3A0B E;  2KI7 B;  4AI8 A;  3ZHV A;  2ZXW B;  5B1A C;  3R4Y A;  5LP6 A;  1SQP G;  4N78 D;  1QL2 A;  3OGC C;  2B1G A;  3CB2 A;  3L73 H;  2V7Q H;  2IFN A;  2L91 A;  2A06 G;  1N0N A;  3ABT A;  1AV1 A;  1L0N K;  5BVZ A;  1T5E A;  1R1B A;  1EM1 A;  3RK2 C;  1WA8 B;  4JI2 B;  1MFT A;  3B2E E;  2BCC H;  2LW1 A;  2H8P C;  1P84 E;  3WB1 A;  4FVM A;  1KQS O;  4DV5 B;  1KB9 I;  5LMU B;  2Q68 A;  4X1Y B;  2ARH A;  1SQX H;  1HR0 O;  3H1I H;  1SQB J;  1H38 A;  5JJJ B;  1YCI A;  4WFB V;  1NBM G;  1RQU A;  4YIO A;  1LTA C;  4ZHQ A;  2Z5U A;  2JJ2 G;  1FZG A;  2YKP A;  5APY A;  3HKE A;  1IVS A;  1PIX A;  3RYH A;  3I56 V;  1N86 A;  3IN6 A;  3CLQ A;  2WSC J;  3ABM B;  4IT5 A;  1WP7 A;  2Y9Y A;  4Z2W A;  3CME P;  1FPO A;  2LXB A;  1GD2 E;  2ZE8 A;  1GMG A;  4D6T E;  4TV8 B;  2ZIM A;  1GW3 A;  1X8Y A;  2E75 B;  1FJG B;  1KTM A;  3CP1 A;  3K03 A;  2YID A;  3SDL A;  3S3W A;  1BE3 G;  1OW8 A;  5H2F E;  1SQP H;  2FFD A;  4ICG A;  3SYC A;  1Y74 A;  5AVU B;  3BRV B;  5AVR B;  4P30 A;  3CPW O;  3L73 J;  4MN4 C;  3C1L A;  3JD2 A;  2XKM A;  2IBZ G;  4DR6 O;  5AVW B;  4YXD C;  5H6R A;  1FDM A;  1DGS A;  3F7Y C;  1N36 O;  2A7W A;  1GN2 A;  1LNQ A;  5KUK A;  3FAV B;  3A3Y B;  1FD9 A;  3OR7 C;  5LGN A;  4BR6 A;  4B3S B;  1ZLZ A;  1NTM K;  4F6R B;  1ZR4 A;  1L2P A;  1AA0 A;  5AVY B;  3GMA A;  5CB4 B;  1L0L G;  2KXP B;  1E5W A;  1NH4 A;  3D3Q A;  4GCZ A;  2JGU A;  3TET A;  1PGP A;  1SRY A;  2YI8 A;  1BGY H;  1OW6 A;  4CH3 A;  1SER A;  3RGB A;  4FLZ A;  3B09 A;  1X59 A;  2JDI G;  1T2K D;  5J2T B;  2ZVO B;  3K79 A;  5KAI Z;  2HFE C;  5CMZ A;  4DR2 B;  4ZI7 A;  2BTQ A;  2EIN B;  4UV9 A;  5E1A C;  4JI2 O;  1DEB A;  1B04 A;  4J7Z A;  2L35 A;  1SQB E;  1EDJ A;  1PGJ A;  1YI2 P;  5IJ9 A;  2Q8V A;  3OR6 C;  3K5N A;  4NTY A;  3T1H O;  3BVO A;  3HKD A;  4D6T G;  2BCC D;  2YKO A;  5B1A B;  4JI5 O;  4B7E A;  4KHP B;  4DV6 B;  2Q5Z A;  5APQ A;  2JRI A;  4LLH A;  1GH6 A;  5KHI A;  3HD7 A;  4DZO A;  4ABM A;  3R2P A;  2PZS A;  2ZE5 A;  1QVF U;  5KLV D;  4P2Z A;  5TIS Z;  1J5E O;  5KHG A;  2K9J B;  3K5B A;  5IJ9 B;  4X66 B;  5KAI H;  1PNK A;  1NOH A;  1SFC C;  3RK3 B;  2ZE6 A;  4N78 E;  3AEC C;  4X65 O;  1S5L Z;  2O1J A;  4FFK A;  2QM8 A;  4X62 B;  2Y0P A;  4LF8 B;  1NTM D;  4HJG H;  3ASO C;  4O4L B;  2P10 A;  3GF7 A;  2LP7 A;  1NAF A;  2KSJ A;  3VN0 A;  2HYN A;  1SQF A;  4QIW F;  4YY3 O;  1OCR C;  2CGN A;  2CH7 B;  1S2E A;  1H2N A;  3HKC B;  3UO3 A;  1JB0 J;  4DR4 B;  4PD4 I;  2NRG A;  3QWO C;  2GM4 A;  2Y0E A;  1NVO A;  1NKD A;  2AHY A;  1L4A D;  4LF6 B;  3V6I A;  1VQN P;  1RSO A;  1SQX D;  1ZOY C;  4AIL C;  3D36 A;  2UXX A;  2BE3 A;  4PEL A;  1PNM A;  4JTD B;  4JAV A;  4EI2 A;  1NTK J;  1E1R G;  2CK3 G;  1LTG C;  1N2D C;  3CX5 F;  1U97 A;  5CCH D;  2HOD A;  2CTW A;  1TAE A;  1P49 A;  2YNY A;  1AVY A;  2ITD C;  1VL2 A;  4NPF X;  2QSA A;  3RL0 B;  1NTK E;  1JQ0 A;  2YSU B;  2EIM C;  1O9H A;  3L73 D;  4HKZ H;  5CA1 B;  4I50 A;  4B3R B;  4B3T B;  1VQP V;  2W90 A;  5A9G A;  1L0L D;  2KS1 A;  4BRY B;  4B08 A;  2X7R B;  2LFS A;  4BAY A;  2PY5 A;  5J2U B;  3OTF A;  3CX5 E;  3OE7 G;  2IJJ A;  1GM9 A;  3OFN G;  1LT1 A;  1KFN A;  1NTZ D;  5GTI H;  4P9P A;  2HG5 D;  1RM1 B;  3M91 A;  2DYS C;  1ZRT D;  3G80 A;  4JBZ A;  1R3L C;  3ABK C;  3VMA A;  4LF9 O;  2RCV A;  2KB7 P;  5C8Y B;  3B8E B;  3GG2 A;  2QRX A;  2EX3 A;  4OPH A;  2OGU A;  3HD7 B;  3H1I E;  2WLH A;  1LGH B;  1LT9 A;  3W7S A;  1HW7 A;  3C3T A;  3L72 J;  1FBM A;  1F7Y A;  4DR5 O;  3JAK A;  1JOY A;  1NR7 A;  4PV1 B;  1BDD A;  1R8E A;  3JD0 A;  3G6E P;  1MSW D;  3P7K A;  2VRS A;  3DTU B;  1WLE A;  5IYZ B;  5BU5 A;  1YJN P;  1HGV A;  1OCO B;  1FKA O;  1XNR O;  2C2A A;  1PFI A;  3HTK B;  1PPJ E;  2KUB A;  4Y28 J;  2UU9 B;  1Y9B A;  2QM4 A;  2IPP A;  1IDS A;  2L5G B;  2XAQ A;  1W0K G;  1XIL A;  4O4I A;  1ZUQ A;  5CBN A;  2C0X A;  3ABL B;  1PGQ A;  3T2M A;  3J7A U;  1QCE A;  2WZ7 A;  1EN4 A;  2OYI B;  3PJS K;  3CC4 V;  1P7B A;  3KCX A;  4JF3 A;  2NPS D;  2JK5 C;  1D5N A;  1SES A;  4O4I B;  5APS A;  1KU9 A;  2CDY A;  1KEC A;  4DK1 A;  1HNX B;  1JOC A;  4BW5 A;  3G9R A;  4H44 C;  5GON B;  4AQY O;  3EFG A;  1KOR A;  1KYO E;  2E5L B;  4LBE C;  4IIJ B;  3RT3 C;  2N1T B;  4IYI A;  5IYZ A;  2ZT9 C;  1HJB A;  3KCY A;  5KJ7 D;  4NKG B;  3WMM 0;  1AI7 A;  2XOK G;  4MVZ A;  4LF5 O;  2KOG A;  1KB9 E;  4I50 B;  4J9Z B;  3OMA B;  3HKD B;  4DV0 O;  3H1L J;  5EBW C;  5FL7 G;  2KSE A;  2Q73 A;  4O4H B;  1VQK P;  2ZXX A;  2HKO A;  2QJK C;  2WSS G;  5JJN B;  4LF7 B;  1OW7 A;  4GKJ B;  4LF4 B;  1J2J B;  2XNX A;  3U1C A;  1B6Q A;  1F4N A;  1Q7Y Q;  5EZY A;  5LOV A;  2UXC B;  1YI2 V;  2KB1 A;  3H1L E;  3L73 G;  3OTO O;  1OJH A;  2IM9 A;  1FFX A;  1KQF B;  1VQM P;  4XFJ A;  3M0D A;  2KQX A;  2KG7 A;  4HZ3 A;  5BXZ A;  1Z2G A;  4LP8 A;  2QJK B;  4LF9 B;  1TVK A;  3A0H Z;  3G4S V;  1PV3 A;  3KKY A;  3OA7 A;  2Q7E A;  4WF9 V;  1URQ A;  3L72 G;  3VQW A;  4PDL A;  2IH3 C;  3D70 A;  4HAM A;  3ZS8 C;  1YTF B;  1VP7 A;  4O2B B;  4UB8 Z;  1JR9 A;  3B5N C;  4IFD K;  3M7M X;  4GKG A;  1YEW A;  1OCZ C;  1FFX B;  1KUQ A;  1AI5 A;  2XND H;  1PGO A;  2M0B A;  2JVD A;  1UII A;  1FZF A;  2E75 D;  1L4A C;  5EZY B;  4G27 B;  4KL1 A;  2W6I G;  2P4K A;  3BEH A;  4JGS A;  3G6B A;  2GHY A;  3STZ C;  3C3S A;  1NTZ G;  2AEF A;  1ZL8 B;  1Q5O A;  3AE6 C;  1QVG O;  3OUS A;  1RE3 C;  2W6J H;  4GKK O;  1LWU B;  2Y0I A;  4O2A A;  4JYY A;  2M7W A;  4X9Q A;  4J9Y B;  3I55 P;  3JSN A;  4E4E A;  3V2R A;  2P67 A;  1QLE C;  4QNH B;  1SQP E;  3W68 A;  1IZN B;  4MVR A;  1NU1 D;  3CXH E;  3CEI A;  4U3J A;  4WBN B;  2LR2 A;  2XZR A;  1OMI A;  2XAH A;  2I1K A;  1EDL A;  2FYU H;  3ETQ A;  3JAL B;  4PD4 D;  2P06 A;  1GU5 A;  1ARO P;  1KKC A;  4J10 A;  5BZB A;  1YTZ I;  4DUY B;  2R5D A;  5IJ0 B;  2O01 H;  1NH2 B;  4J7J A;  1XNQ O;  2DWE C;  1FYJ A;  4X62 O;  3Q5P A;  1I7F A;  4LC1 A;  2WSF H;  1UIX A;  3KQG A;  3PH0 A;  3BAT A;  4I7Z C;  1FXK C;  2W0X A;  2RJZ A;  3ZDM A;  5B3S C;  3U1A A;  3SYA A;  1BGY G;  4UUJ C;  1Y4M A;  2XND G;  3H9V A;  4KXR A;  4F6R A;  4JV5 B;  2QEX P;  1UPG A;  2CPS A;  4OGQ B;  2JO1 A;  3AEF C;  1WAZ A;  3TJT A;  5LMN B;  1KIL A;  2GBO A;  3AE7 C;  4DV1 O;  1FOS F;  3SFD C;  1Q43 A;  1ZTE A;  3OW2 O;  1VQ8 V;  2BCC E;  5FNV A;  1YJW V;  3TGU H;  2P7T C;  4QGP A;  2JGD A;  3BY6 A;  4X1K B;  5KMG B;  5GTI Z;  5L3E A;  2VWJ A;  4ASW A;  1NQT A;  1OCR B;  2KYV A;  3A0B H;  1L4A B;  3CXH H;  2QKC A;  3L70 D;  1OV9 A;  4F4L A;  3IAO A;  3GHG A;  1KB9 F;  2W6A A;  3CI9 A;  1SQQ J;  1KIL C;  1L0L J;  3VQY A;  3FB7 C;  4LFC B;  1SQQ K;  1M1J C;  5B1B B;  2GA1 A;  2F43 G;  4N21 A;  1BS3 A;  4MTX A;  1YYC A;  1EFR G;  4GOD A;  2ZNI A;  2CTP A;  3CRM A;  2DE0 X;  1L0L E;  4GX1 A;  1K8A Q;  3LNN A;  3H1J G;  4C7N B;  2ATK C;  3M8A A;  2WPR A;  5K5G B;  5TIS E;  5LA6 B;  1QR8 A;  4JV5 O;  4MTF A;  1KYO I;  1SQX K;  1H2M A;  3K3W A;  1ZME C;  3QTC A;  2IBZ D;  1IX9 A;  3LIE A;  4XDK A;  1NU1 K;  3GHG C;  2R9R B;  2EIK C;  3NMD A;  4OPA A;  4I7Z B;  1OCC C;  2B9Z A;  3TGU G;  4DV6 O;  2CUG A;  5CA3 A;  3L75 E;  5C8Y A;  1P4R A;  2WLN A;  3UM7 A;  1Q86 Q;  3ZHQ A;  1G1I A;  2Q69 A;  3UKM A;  1PL4 A;  4L8J A;  1AQT A;  1EQ7 A;  1FDI A;  4NPE A;  3QO5 A;  4R4L A;  2V1D A;  2YXR B;  5KLI B;  2Z5I A;  1PL0 A;  4NPD A;  1O9G A;  1KIL D;  5BY1 A;  1R3I C;  1PPJ D;  2E43 A;  4H44 B;  1VQ4 V;  3WUU A;  1S72 P;  4R7C A;  1HNW B;  1SVF A;  1N8R W;  2G38 A;  4RES B;  2PTM A;  2PAJ A;  1KYO F;  2OCH A;  3IC9 A;  4PA3 A;  2KNC B;  4X1K A;  1YJ9 V;  4YJ3 A;  1X9V A;  1MZ9 A;  2B9B A;  5KA5 A;  3BRT B;  4BWN A;  4UB6 H;  5CBG A;  2A06 E;  2B1I A;  3H6P A;  1YIJ P;  3L74 E;  3K58 A;  1N32 B;  4HYT B;  2ZJS E;  4JI6 O;  4I9Q A;  5AVZ B;  1SQQ E;  1RFY A;  1T6A A;  2JEU A;  4PI2 A;  3KPE A;  2PUS A;  2X6C A;  2WLI B;  4RKU J;  1MUU A;  2MKV A;  1BCC H;  2UXD O;  5KKZ B;  2WSF J;  2OWO A;  2HP8 A;  3CRR A;  3JCU Z;  4W4L A;  3JAK B;  1IBK O;  2ZE7 A;  1FZC A;  1GM7 A;  4MTG A;  3OW2 U;  1XTG B;  2ZIO A;  3VMZ A;  1S5H C;  2WPQ A;  5KAF H;  4KT0 J;  3RYI A;  2Z4E A;  3HR0 A;  2LFR A;  1RY3 A;  2HPC A;  4H37 A;  4JZ2 A;  1IK9 A;  1OVV A;  1CPY A;  5KLV J;  3HE4 B;  3FB8 C;  1HP8 A;  1NKN A;  4JYA B;  5CCG A;  1G4Y B;  2ODM A;  3OTO B;  1QNM A;  3GWO A;  3MHV A;  1OCZ B;  5AW2 B;  5KAF E;  2VQF O;  2WSE J;  1GRJ A;  5B5E E;  3A0R A;  1OX3 A;  1YQ3 C;  2CPB A;  3L70 H;  3TF5 A;  4X65 B;  3C9I A;  1HNW O;  1EZV H;  4UCV A;  1YZB A;  1HH0 A;  4J7K A;  2P2U A;  2ZVN B;  3CC4 P;  3OEH G;  3B5N A;  4UB6 Z;  1JMB A;  3ZHS A;  1RF0 C;  4WB4 A;  2EJ7 A;  3SPC A;  1Y8A A;  3A0H E;  3CWB H;  3W67 A;  3E22 A;  1U57 A;  1NTM E;  4DR4 O;  3LUT B;  1YBK A;  2Q4P A;  3W7T A;  3N7N A;  1VQO P;  1VEW A;  3SJB C;  2CK3 H;  2YKQ A;  1N7S B;  3V2P A;  2R3S A;  2R44 A;  1QVG U;  4WBA A;  4MS2 A;  3P3P A;  4X1I B;  2FYU E;  1VF5 B;  4A5U B;  1CZQ A;  2QIW A;  4HBN A;  1X79 B;  1GN6 A;  2YXH A;  3H1K H;  3K06 A;  3JSL A;  1XQ8 A;  3WU2 H;  2IU3 A;  2WLL B;  2G3A A;  1K97 A;  4W80 A;  4IL6 E;  3AG4 B;  3P8M C;  3U10 A;  4RWU A;  4R8C A;  4HB1 A;  3E8G A;  5DED A;  1ORQ C;  3AEI A;  2N1T C;  4DR7 O;  3U11 A;  2IZ0 A;  2YO2 A;  2R5B A;  3T4D A;  2N05 A;  2VRZ A;  5C93 A;  3ZHU A;  1IFI A;  4JYB A;  4DR3 B;  1GO3 F;  3O8Z A;  4QPJ A;  1HNX O;  2HVJ C;  4JI7 B;  1TUB A;  4MVQ A;  1FZE A;  1EZV G;  1Q6U A;  2EIN C;  3QH9 A;  4R4M A;  5APX A;  3RVY A;  5LMN O;  5B3S B;  2E74 C;  1VQP P;  2G8Y A;  1YTZ T;  5AW4 B;  2WT7 A;  3AG3 C;  5AG2 A;  3HB3 B;  5B1B C;  1U7J A;  1JUN A;  1M7L A;  3CWB G;  2IBZ I;  5EIB D;  2ZYD A;  4PJ0 E;  1LT9 B;  2BAS A;  4NXN O;  1ZN5 A;  2HR3 A;  4IIJ A;  1IFP A;  3L74 J;  4DV2 B;  1LUW A;  5LHH A;  1ENV A;  2QJY B;  1S9K E;  3BCC E;  3AEA C;  4O2A B;  4DW0 A;  4CS4 A;  2FYU G;  4GLX A;  1B3Q A;  1IO4 A;  1A32 A;  1MZE A;  2LQT A;  4IL6 H;  3CMA P;  1VQM V;  2AXC A;  1VPC A;  1FXK A;  1FJP A;  1SQB H;  1G6U A;  2D2C B;  3MUD C;  4NXN B;  3OJA B;  1US6 A;  5FNV B;  2JJL A;  2R3C A;  2UUA O;  1BE3 D;  2WA4 A;  5HFM A;  1MZF A;  2LGW A;  2WLJ A;  4JI4 O;  2YO3 A;  4DOJ A;  2Z0A A;  3Q1M A;  4C7U A;  1K4D C;  5H9C A;  2MK3 A;  3TGU E;  5B5E Z;  1XMQ O;  4RO0 A;  5DN6 G;  2XTA A;  4JF7 A;  1K7D A;  2KG7 B;  1HVV A;  3AG3 B;  2XAJ A;  3K0D A;  5LGT A;  4MW3 A;  1NS1 A;  2OYH C;  1NTM H;  1KFM A;  4FK5 C;  1RH5 B;  1FS0 G;  4D7S A;  1M1J A;  3MGN A;  4RQE A;  3AE3 C;  4I2L C;  1USE A;  3L4F A;  3HKB B;  1R3K C;  3CSX A;  4O9B A;  2GUV A;  2I1J A;  2P90 A;  4AHC A;  3L75 D;  1M56 B;  1EZV E;  3ZHT A;  4YJ2 A;  3MP7 B;  3T97 B;  2P6J A;  3JCU E;  1P84 I;  3LSU A;  4JAU A;  5B5E H;  4DUZ O;  1DTO A;  5D5P A;  4OWF A;  4WCE V;  4EDF A;  4GX2 A;  3RBZ A;  3A8T A;  4LNU A;  3CC2 V;  2QA4 V;  1U7M A;  3HPL C;  1DEE G;  2QWP B;  2C0W A;  2QM7 A;  4OGQ D;  5EYP A;  2DQ0 A;  1F51 A;  5EC2 C;  2ZYA A;  2F4V B;  1X0T A;  1KD1 W;  1E79 H;  1GZL A;  3E1I A;  2H43 A;  3E35 A;  4O4J A;  4CPG A;  1OWA A;  3PLN A;  1FU1 A;  2PP6 A;  1N73 A;  4YHH B;  2WPS A;  2V4H A;  3KG2 A;  4HNA B;  3I5C A;  3JD4 A;  4EB6 A;  2FXO A;  3L36 A;  1Q90 D;  4QMA A;  1R73 A;  5LBQ A;  1SLQ A;  1NH2 D;  2R32 A;  3L71 H;  3SFE C;  4XE5 B;  1QHT A;  1VQ6 V;  1LP1 B;  4K3A A;  2CAZ C;  1SQP K;  3RL0 D;  4QJF B;  2PRR A;  4U7J A;  3JAT B;  2GUZ B;  4FLU A;  1PP9 D;  1RP3 B;  5GTH Z;  5H2F Z;  2YXQ B;  5KJ7 A;  1VQ9 V;  3TNU A;  3WUT A;  5GTI E;  4O2B A;  1EN5 A;  3QO8 A;  4DO2 A;  4BWA A;  3B4S A;  1JY2 P;  2OYO A;  3P8C D;  4M3L A;  2IW5 A;  2LJ2 A;  1DD3 A;  4K0K O;  5CCG C;  2F95 B;  2RN9 A;  4DV1 B;  4GDO A;  3H1H D;  1DD4 A;  1J95 A;  4R50 A;  1ZLL A;  1I08 A;  4DV2 O;  3GLM A;  2BSK A;  4U3F D;  4WY4 A;  3L74 D;  4GYC B;  3HE5 A;  3E89 A;  3E7K A;  3H1J D;  3IR9 A;  5LP6 B;  1NU1 J;  3G71 V;  1HBW A;  2UXB B;  3AG7 A;  4WFG A;  3U59 A;  3CXC U;  1LTJ A;  4NXM B;  3H1I G;  4WY4 B;  1M57 D;  4YPC A;  3IC7 A;  1JX9 A;  3L75 H;  3OAA G;  1Q81 W;  2Q5U A;  2OIG A;  1SS3 A;  3T1H B;  2IZ1 A;  1NZ6 A;  3IAY A;  2A06 D;  1YTF D;  2NPS A;  3O6Q A;  3V4W A;  3K5M A;  1NVP B;  1D5A A;  1GN4 A;  1GK9 A;  4PD4 E;  1SZT A;  4I55 A;  1V55 C;  3RN4 A;  4ZIB A;  5DJT B;  1Y76 A;  1ROP A;  3CWB J;  2D3O W;  4E2L A;  5AVV B;  1EBO A;  4KUM A;  4FMT A;  5CCG D;  3X2Q C;  4ZOL A;  4B7K A;  3UO2 A;  1H8E G;  2JR8 A;  2ZYG A;  2AEJ A;  3OMI B;  3D3I A;  1PPJ G;  4JAA A;  1DLB A;  2WPD G;  1DIP A;  3CCU P;  2ILM A;  1URQ C;  1BCC G;  1BE3 H;  5J9P C;  5CA1 A;  4FFB A;  4PJ0 Z;  1LTJ C;  3AG2 B;  1SQV J;  4UCO A;  1VQ4 P;  4H0L D;  3FFQ A;  1M93 A;  1VIB A;  2WSC H;  3JAR A;  3B5N D;  5LP6 C;  1SA0 B;  3VTP C;  3IF4 A;  3OUF A;  2YEV B;  1JY2 O;  3LDE A;  3SJA C;  4YTP C;  4JTA B;  1PV0 A;  2ZAE B;  4P9O A;  1ZW0 A;  1K9M Q;  2ZM6 B;  4RUE A;  2HVK C;  5BR8 O;  2HHH O;  2PGD A;  3CCL P;  3OEE G;  4YJ3 B;  1EZV D;  1SQP J;  2WAM A;  1Z5V A;  1WP8 A;  4DV7 B;  1T8Z A;  1NTZ E;  5TJH A;  3UT5 B;  1I94 B;  2EZP A;  1GTW A;  3K0G A;  3K04 A;  3HKB A;  3L70 G;  2ZIN A;  3CWB D;  3NR7 A;  1Q8I A;  3ABM C;  2XHB A;  4JI8 O;  5APU A;  3FX7 A;  1X22 A;  1N34 B;  3HE5 B;  1NTZ J;  1KP2 A;  2RMZ A;  3H1J H;  4KFM A;  4B3M O;  3CC2 P;  3VQV A;  4B3T O;  2Q9L A;  3GHG B;  3JAM N;  4K8X A;  4ZKI A;  1G1X B;  4YY3 B;  2YEV A;  2JIZ G;  2LKM A;  3GB7 C;  2OAR A;  1HJ0 A;  3A2A A;  2EBO A;  4DR5 B;  3CX5 D;  4FIP C;  1RHZ B;  1TGO A;  2IYO A;  2Z3Y A;  3L74 G;  3B71 A;  4XDL A;  2XAS A;  3HKE B;  3CCR V;  1BCC D;  2FYN B;  3JAT A;  1HWT C;  2Q6A A;  2ADP A;  2BCC J;  4I0X B;  1BGY D;  2OQQ A;  3RK2 D;  4TV9 B;  4YXW H;  1T3J A;  2BOB C;  1JMK C;  1V54 C;  3HD7 D;  1IJD B;  1SFC A;  2SPZ A;  3VOU A;  1CI6 A;  4Z1V A;  1BE3 J;  5JH7 B;  1NTK H;  4WFH A;  2OYH A;  4G2K A;  1W59 A;  4BXL A;  2ZM6 O;  5JCO C;  2H8P D;  2CE4 A;  3AK1 A;  3E1R A;  4JI1 O;  4UFZ A;  4LFC O;  2KK7 A;  1U96 A;  4CC5 A;  4B3R O;  4JI1 B;  2ZD9 A;  3H32 A;  1H2G A;  1H2S B;  3A5T A;  2IH1 C;  1NTM J;  2KKW A;  4U7O A;  3ZMU A;  1YIT V;  1SQQ D;  1XBL A;  3M9H A;  2Q7H A;  4UVC A;  3U0Z A;  4GOF A;  1M4U A;  2A45 I;  2CTR A;  3JCU H;  5IJ0 A;  3HUS C;  2LGQ A;  2AEM A;  2Q3E A;  1TUB B;  2ZFC A;  4Q6G A;  4TLF A;  2PGG A;  4CH5 A;  1Q3E A;  5E79 E;  2UU9 O;  2E76 C;  5LGU A;  2UWJ E;  3ZRX A;  2QR4 A;  4LH6 A;  2IBZ E;  3ZHR A;  3QNE A;  5GON A;  2RN0 A;  4PA6 A;  3APQ A;  4FLX A;  3ZN0 A;  4WFF A;  2RMK B;  2OTJ V;  2X6B A;  5CBH A;  5LYJ A;  1R6N A;  1CSB A;  5CBF A;  1S1C X;  1A02 F;  2QDO A;  4NTX A;  4BIO A;  1IBM B;  3V2N A;  1IFJ A;  3VOP A;  3D71 A;  2BTQ B;  2GUZ A;  4FZ1 A;  1Q81 Q;  1LR1 A;  1SQV K;  1BQZ A;  2Y0D A;  5LHG A;  1KQL A;  4LFB O;  1V55 B;  4C7R A;  4MVO A;  1HWY A;  5H5N A;  2OTL P;  3FAV A;  3L35 A;  4LCU C;  3S3X A;  1WB7 A;  2JJ1 G;  1I94 O;  5IE9 A;  2E3C A;  3N2K B;  1RF1 A;  1OVR A;  2J5U A;  1F23 A;  2XT9 A;  2LXC B;  5LYJ B;  3II6 A;  4ZKU A;  3ETE A;  4JTC B;  3PP5 A;  3TXS A;  1ZP0 C;  3JSV C;  1QVF O;  1VQL P;  1SP4 A;  3ZED A;  1R6T A;  4DR7 B;  2KLV A;  1VQ5 P;  1VF6 C;  2ITA A;  1BE3 E;  5AW8 B;  4X88 A;  4PJ0 H;  2UXN A;  5APT A;  3CD6 V;  5B66 H;  2FML A;  4TT3 H;  4GZR B;  1XTC C;  1GTO A;  4I1L A;  5IYC O;  1KYO H;  3V5B A;  1M1K Q;  1VQ9 P;  4NB5 A;  3RYH B;  3E22 B;  5CA0 B;  1OXZ A;  2VQF B;  1Q82 Q;  3B5N B;  2NR5 A;  1WPB A;  5GTH H;  2KNC A;  4EFB A;  1XHX A;  1K05 A;  1FZC B;  1MV8 A;  3P8C E;  4QE9 A;  3VMX A;  2K9P A;  2B5U A;  2A79 B;  4KHX A;  1SET A;  3MIW A;  2HOD B;  2W0F C;  3SGI A;  3DXR B;  3AG1 C;  2PYJ A;  3CRA A;  4WY4 D;  1QLN A;  1M5I A;  1S5L E;  4H13 B;  1WJZ A;  5IYD O;  5H2F H;  1FZC C;  2AHZ A;  1XEQ A;  2M8R A;  1S3J A;  3AE9 C;  2Q67 A;  2P1J A;  1L8D A;  1JFF B;  2JWA A;  2QJP B;  1VMG A;  2WSS H;  4CC6 A;  4UXN A;  5CA0 A;  2I8D A;  1XOU A;  3CPW U;  2F93 B;  5B66 Z;  3NFQ A;  3A0H H;  2FYU K;  2LW7 A;  1J1E B;  4JPR A;  5KKZ C;  4LF7 O;  3FB5 C;  1KKD A;  4OGQ C;  3EQ2 A;  5ITZ A;  3K5L A;  4MSW C;  1K92 A;  5LXT B;  4FLV A;  3GVM A;  4UCT A;  3CX5 I;  3AK3 A;  2W6B A;  5LOV B;  3L70 E;  5AW9 B;  1AJY A;  1XUQ A;  2R72 A;  3CRC A;  1NU1 H;  3L72 H;  2QJ1 A;  3DC5 A;  3P32 A;  4IYH A;  4DK0 A;  4EEQ A;  1HR0 B;  1COW G;  1Y47 A;  2ZXE B;  1ZL8 A;  1XNR B;  4BIZ A;  3TGU D;  3JAS B;  3RW0 A;  3H1H J;  5JVD B;  1MNG A;  2KLU A;  2NPS C;  3A7O A;  3H01 A;  1MSD A;  2P22 C;  3H1H H;  1JJ2 U;  4JI7 O;  3KHU A;  4G28 B;  1KQS U;  4PA7 A;  4X20 A;  1FAV A;  1L4A A;  3I5D A;  1IBL B;  5EC1 C;  2UXC O;  3C90 A;  1QLE B;  1FOS E;  3DC6 A;  3RK3 E;  2OYI C;  1JVM A;  4BRY A;  2QEX V;  3KZI H;  1QGK B;  3VYI A;  2EIM B;  1D2D A;  5DEC A;  1EZV I;  1KC8 Q;  1S77 D;  2R9A A;  2NLJ C;  1BCC E;  3I55 V;  2Q7G A;  3ABU A;  4K8Z A;  1AJP A;  4O4L A;  1YHQ V;  4I4T A;  1TUE B;  3RYC A;  3DXR A;  1TU3 F;  2A06 H;  4HNA A;  2CH7 A;  1IBL O;  3E8H A;  4X20 B;  3RVZ A;  5FPR A;  4JI6 B;  1DK1 A;  2HLO A;  5JCO A;  2DMX A;  4GX0 A;  3QF7 A;  2A0L A;  4D6T D;  1WN7 A;  3E8B A;  5B66 E;  3OD4 A;  2BCC G;  3TSI A;  4RAI A;  3RYF A;  1W5C E;  1MOF A;  3FWL A;  3M0D C;  3KZI Z;  1Z5W A;  3E83 A;  5KAI E;  2IFM A;  2Q9I A;  3N2G B;  4J11 A;  4PA9 A;  3P30 A;  2EUL A;  3KXD A;  5IT9 N;  5AW5 B;  4QPK A;  2VQE O;  3W7W A;  2K9Y A;  1QBZ A;  3ABV C;  1F4M A;  2ZT9 D;  2WPV B;  2A9H A;  1XI1 A;  1KIL E;  1YHQ P;  2IYP A;  3HUS A;  3RYF B;  1AVO A;  2UUA B;  4I6M C;  2QWR B;  4JI4 B;  4GX5 A;  3LNM B;  1M90 W;  1NAY A;  2PI5 A;  2YMK A;  3GW6 A;  1PL5 A;  4KP4 A;  2WQY C;  5JQG B;  4IOI H;  3CCE P;  1XRE A;  3BHP A;  2FYU J;  1FJG O;  1K33 A;  2GTS A;  1W0J G;  3BA9 A;  3BCC H;  5ITZ B;  3M0A A;  1AVM A;  3MTU E;  5APV A;  1W2B O;  3L71 G;  1HUC A;  1SQV E;  1SQP D;  3F5H A;  1Q2N A;  5GW7 A;  3G3Z A;  1NJI Q;  5JH7 A;  2DN9 A;  1SC5 B;  4X1Y A;  4CH6 A;  3CCS V;  3RYI B;  2FXM A;  4RUF A;  2ZR3 A;  3WB2 A;  4B3M B;  4IHJ B;  4H44 D;  2Y9Z A;  1R6K A;  3CD6 P;  1KIL B;  1L0N D;  2MW2 B;  4FLY A;  4K35 A;  5E79 Z;  2AW9 A;  2IBZ H;  4DXW A;  1QX8 A;  2N04 A;  5CCH C;  3THO A;  3K9A A;  2BEQ D;  4L74 A;  4RQF A;  2E5L O;  1W2E A;  1M1K W;  4EIJ A;  3ITK A;  1YDX A;  4CS3 A;  4IL6 X;  5AVS B;  3RK2 B;  1XNQ B;  1H2K A;  1NTK G;  3H1L D;  4DV4 O;  5EIB C;  1AP6 A;  3T1Y O;  4B3S O;  2OYQ A;  4JI3 B;  3R65 A;  3L75 G;  3KYQ A;  3L70 J;  2QWN B;  2E42 A;  3WU2 E;  1JA8 A;  5L3C A;  3S4R A;  3H1K E;  2E5T A;  1RE4 C;  2HG5 C;  1KP3 A;  1ZWI C;  3AEB C;  1GU4 A;  2JDI H;  2FB5 A;  3BCC J;  5FPO A;  1G2C B;  3CCV V;  3FD9 A;  4LFB B;  2KZI A;  3T97 A;  1NU1 E;  3CXH D;  5CN0 A;  3HE4 A;  5CCH A;  4BW9 A;  5LL6 Y;  3FYI B;  4FPP A;  5IYB O;  1K34 A;  1LTI C;  3JYC A;  3ZX6 A;  4FZ0 A;  2F66 C;  4YHH O;  4EYY Q;  1G2C A;  2O01 N;  4A7P A;  2GSM B;  1L0L K;  3S9O A;  1VQ8 P;  3ZBH A;  4PV1 D;  4MW8 A;  1NHL A;  1ZR2 A;  2CTQ A;  2B87 B;  1P84 D;  2ADQ B;  3TNU B;  1SQX E;  3B8N A;  3TCU A;  3RK3 D;  4LF4 O;  4L87 A;  3HD7 C;  3F89 A;  5KLV K;  3F5W C;  4DRX B;  1VF5 D;  3CCV P;  1GAX A;  3RYC B;  1P84 H;  3G67 A;  4JAS A;  2QJY C;  3H1J E;  1DF5 A;  1EXI A;  2YDE A;  4I55 B;  1URQ D;  3WU2 Z;  3Q2Y A;  1SQX J;  2WWW A;  2QKS A;  2O57 A;  4IHJ A;  4UCU A;  1IXM A;  2DYR B;  4ZMD A;  1L1F A;  4H0L C;  4DR1 O;  4NVP A;  3L71 D;  2Q0O C;  3BAA A;  4GUN A;  4NYK A;  1D7M A;  1QLE D;  4TQD A;  4ZBM A;  2LO1 A;  1BL8 A;  3T1Y B;  1NTZ K;  4JYA O;  3CCQ P;  2YC0 A;  3CMA V;  3O65 A;  2KP8 A;  3FXE A;  5KHH A;  4DV3 B;  5AW6 B;  1TVK B;  2FYU D;  2M3E A;  2M5A A;  1VF6 A;  1J1D C;  5KLV H;  1AB3 A;  3CL3 D;  4DR2 O;  5JQG A;  1L0N G;  2QSI A;  5AVX B;  2QTO A;  3RWR D;  4X66 O;  3L74 H;  1EC5 A;  2ETN A;  3FGA D;  2ZKO A;  2QWQ B;  1M57 C;  1FZA A;  3J81 N;  1E1Q G;  3ETG A;  4JI5 B;  3VMY A;  3E86 A;  1Q6H A;  2AXT H;  2X6A A;  4MVM A;  4I5S A;  5AVT B;  2FFD B;  2ITC C;  3Q3D A;  4Z1M G;  1S9K D;  2XAG A;  3O9O A;  3R66 A;  5LA6 A;  2FTK A;  5CJ0 A;  2OTJ P;  1SKV A;  1N73 C;  1PP9 H;  2R70 A;  3VP8 A;  5H6Q A;  2DYR C;  1QQC A;  4WFA V;  4J80 A;  3H1K D;  3T4Z A;  1M57 B;  2JS5 A;  4I4T B;  4MT8 A;  4LFA O;  1PP9 J;  1THZ A;  3OGI B;  1SFC B;  1ZX3 A;  5D5Q A;  1USD A;  3E8F A;  3STL C;  4CH4 A;  4PV1 C;  1H0T A;  2UXD B;  1HGZ A;  1XL4 A;  1WB8 A;  1QEX A;  3ASO B;  4PHZ A;  1RQV A;  4J41 A;  2QWO B;  2KZJ A;  5FLX N;  3BCC D;  5C39 A;  1AR1 B;  3NXS A;  5IY5 C;  4CS2 A;  3VP9 A;  2WTY A;  1VQ7 P;  4MTO A;  1L0N H;  1MKM A;  1AJQ A;  3FXD A;  1G1J A;  1PZQ A;  1CEZ A;  3M99 B;  2K1A A;  5L3F A;  3KDP B;  2KIK A;  3CRQ A;  1Q82 W;  4B86 A;  1IUR A;  2JS3 A;  2WLK A;  1K9M W;  1VQ5 V;  3ZRV A;  4CZZ A;  3N4X A;  2MJZ A;  2N9B A;  4JI8 B;  1KB9 H;  1JTH B;  2J58 A;  2XDJ A;  2AGA A;  1HF9 A;  2P4V A;  3LSQ A;  3ZCC A;  1VDF A;  3CHX A;  1NKZ B;  5E79 H;  4MVS A;  1VAR A;  2HEP A;  1Y67 A;  1VQ6 P;  3VBB A;  1P7G A;  1IFD A;  2Z5H A;  1NU1 G;  1SZX A;  2N1T A;  3I56 P;  2E74 B;  3WFV A;  1PP9 G;  1WT6 A;  3L71 E;  2BSK B;  3X2Q B;  1S76 D;  4DJG A;  2IJH A;  2N74 A;  1OHH G;  2Q3I A;  5APW A;  3SJQ C;  1IK7 A;  3BA8 A;  3FKS G;  4AYC A;  2Y69 C;  2F4V O;  1YJN V;  2ZQM A;  1S0V A;  2ZDI C;  2POH A;  3FYE B;  2EIK B;  1M56 D;  1SQB K;  1Q7Y W;  2EIL C;  1A02 J;  1FDO A;  3JAR B;  1WMK A;  1SA0 A;  3G6E V;  3L71 J;  1X4T A;  4GKJ O;  2EIJ C;  2OYI A;  1JCC A;  4LH7 A;  4LWS A;  3F7V C;  4N6J A;  1KBH A;  3EXA A;  1SQG A;  3Q4H B;  3WUV A;  1AR4 A;  4X89 A;  3OM3 B;  1FXK B;  2IJI A;  4LF5 B;  4AUW A;  4DV5 O;  1RM1 C;  1L0N J;  2W27 A;  3HKC A;  4NR1 A;  3AE2 C;  1GK6 A;  4W7Z A;  4DRX A;  1RF0 A;  2A45 G;  1H89 A;  3ABK B;  3SSU A;  1PM9 A;  4ZOL B;  4IFF A;  2DYS B;  2K1E A;  1KZU B;  3K59 A;  2WIT A;  1GK4 A;  1SQV D;  3RFR A;  4FLT A;  3CME V;  3SPG A;  2QJP C;  5KTB A;  1KD1 Q;  4CBC A;  2XU6 A;  5CMU A;  3APO A;  1YIT P;  3CCQ V;  4U3F E;  4H13 D;  1QR9 A;  3FX0 A;  3JC2 2;  3SR2 C;  2GDS A;  4IFM A;  1PD3 A;  4FM0 A;  1BQ0 A;  2Q6Q A;  2A3Q A;  2YMY A;  2IX7 C;  2FYN C;  1ZRT E;  3SPH A;  3JAL A;  3K9S A;  2UXB O;  3ML0 A;  4WY4 C;  4QE7 A;  2YUA A;  4LFA B;  2V7Q J;  2YIB D;  2XAF A;  5KMG A;  1KQG B;  1J1D B;  3CC7 V;  3MHS C;  3QO7 A;  1VQ7 V;  2E74 D;  3BCC G;  4DT0 A;  1J1E C;  2H88 C;  4OX9 O;  4W7Y A;  4DV4 B;  1LWU C;  3AG1 B;  1M9N A;  2Q0A A;  1WPX A;  1MG1 A;  3ZMT A;  4JYC A;  4FM2 A;  3OMN B;  4PDM A;  1Y6X A;  4H0L B;  1OCC B;  5AW3 B;  2OYH B;  3ZMV A;  1RE4 A;  3ASN B;  2W6J G;  1AFO A;  4PA4 A;  2N1T D;  4NXM O;  2A45 H;  2DW4 A;  3K08 A;  2NNU A;  1M1J B;  1CP9 A;  3LW5 J;  2ZT9 B;  1YSC A;  2VS0 A;  3ZRW A;  1JJO A;  1NI8 A;  2WMM A;  5IWA B;  1VQK V;  3B77 A;  3LW5 H;  3CE2 A;  4X64 O;  5J2T A;  1MA1 A;  1H8A A;  3LDC A;  4JPZ B;  3BAB A;  4ZHQ B;  1H8H G;  2P7J A;  2QGN A;  3Q5S A;  1IXB A;  2K3R A;  1E79 G;  1SFC D;  3TK1 A;  4IGG A;  1GL2 C;  1JM0 A;  1KYO D;  2UUB B;  2J59 M;  3CCM V;  1L0N E;  1FXH A;  1N7L A;  5BMV B;  4PD4 H;  3ICX A;  1KC8 W;  1EN6 A;  3CCU V;  2DWD C;  3A2F A;  3AG2 C;  3MUD A;  1GN3 A;  4WFE A;  4C46 A;  2XV5 A;  4PI0 A;  3M06 A;  2DJV A;  4GKK B;  4WWI A;  2Y69 B;  1WA8 A;  2YIC A;  1K04 A;  4DUZ B;  1KB9 D;  3G4S P;  1EXJ A;  4DYL A;  5BU8 B;  1UJW B;  1Y74 B;  3EHB B;  1J5E B;  2BTO A;  3H1L H;  3FWN A;  4JI0 O;  4U3F J;  1QL1 A;  2H7H A;  3L9D A;  2P5O A;  5J2U A;  2BOC C;  3N2G A;  1K73 W;  3CC7 P;  5L3B A;  5BR8 B;  3CJH A;  2HHH B;  4HH2 A;  3AG4 C;  1GL2 D;  2K9J A;  2OIE A;  3ETD A;  3CCM P;  4LWS B;  2FL4 A;  1T2K C;  3ZRS A;  5M1B A;  1CW5 A;  1LUV A;  5EFW B;  3UQ8 A;  3P3N A;  4UCS A;  1BMF G;  1R3J C;  4GOE A;  2DOS A;  1SQQ G;  1JY3 N;  1BGY E;  1GKF A;  1N73 B;  2H3O A;  4L76 A;  5LMU O;  3SYQ A;  1RSO B;  3CCE V;  1GMJ A;  3PHL A;  3MZW B;  2FY8 A;  4LF6 O;  3H1K J;  2PYL A;  3D6Z A;  4DV7 O;  2Q7C A;  5KLI C;  3CJH B;  2HJD A;  1LTS C;  2RKL A;  1RF1 C;  1EDK A;  2FKW B;  2YIU C;  3IGA C;  2RNB A;  5CBO A;  1VF5 C;  3M9B A;  3KZI E;  3CS5 A;  1URQ B;  4H33 A;  2AXT Z;  3JAW B;  1JMM A;  1JTH A;  5L3D A;  5DM6 V;  1ZV8 A;  4GIF A;  2QE7 H;  3H1H E;  5JVD A;  3T1C A;  3PTZ A;  1AI6 A;  1BSM A;  4TQF A;  1NVP D;  1TA8 A;  1LJ2 A;  3EFF K;  1BT8 A;  3UIA A;  1JY3 O;  4IL6 Z;  5KLV G;  2OT5 A;  1MFZ A;  2EJR A;  1PPJ H;  2OCC C;  1KN7 A;  2QG4 A;  5IDJ A;  3CCR P;  3J80 N;  2KSD A;  3SWK A;  1EDI A;  4EFE A;  2NN4 A;  1FJK A;  1R5S A;  3JD3 A;  3S1K A;  4Y99 C;  4D6T H;  3QG5 A;  2ZR2 A;  3AEE C;  5KHK A;  1OZ0 A;  1V54 B;  4Q20 A;  4UVB A;  1GW4 A;  3N27 A;  2B89 A;  3JAW A;  1I0H A;  2M6Y A;  4UV8 A;  3Q5R A;  1N32 O;  1IFN A;  4FLW A;  5L3G A;  2NZ2 A;  1SF9 A;  4EOT A;  5AW7 B;  2YS8 A;  2GTA A;  2OCC B;  1HNZ B;  1LTB C;  1SQQ H;  4EKW A;  1BZK A;  3MD0 A;  4H13 C;  1XL6 A;  3F5T A;  4Z1M H;  3CCJ P;  2ZDI A;  4ZI7 B;  1RF1 B;  1NWQ A;  2DW3 A;  4UB6 E;  5AW0 B;  2C9L Y;  3ABL C;  3UCS C;  3H1I J;  4ASU G;  3K5O A;  2ZXW C;  1SQX G;  2RH0 A;  2K37 A;  5K1P A;  4YIP A;  3CX5 H;  1HDJ A;  4PDV A;  2WVR A;  3B8M A;  4TWK A;  4UCR A;  1S5L X;  1AJN A;  1T3U A;  2C9N Y;  1JO5 A;  5KX5 B;  1M56 C;  5EYP B;  1FFT B;  1NTK K;  4KHP O;  2B87 A;  5KAF Z;  3V2Q A;  1MAB G;  4JI3 O;  5CB4 A;  1JCH A;  3HTK A;  4O4J B;  1H88 A;  1IC2 A;  1S5L H;  2E5Y A;  4PD4 F;  1Q6I A;  1B06 A;  1XDC A;  5CJ4 A;  1AQ5 A;  2FKX A;  1IZ3 A;  2QVA A;  4TUY B;  3JCZ A;  2PFX A;  1MMM A;  2QTS A;  4U3J B;  4WBN A;  4RJT A;  4NTW A;  1N36 B;  3V4Q A;  4LF8 O;  1YF2 A;  1ZSP A;  2KS1 B;  3BPZ A;  2HLD G;  4I9W A;  3TGU J;  5GTH E;  2FFD C;  3JD1 A;  2WSE H;  4UVA A;  2AZ2 A;  2AZ0 A;  5L8R J;  3C8V A;  5JJE B;  3VQX A;  3CXH F;  2IDB A;  1KMI Z;  4YXW G;  2FYZ A;  1BDC A;  1KV4 A;  1PP9 E;  2WT7 B;  3RL0 g;  4L75 A;  1LTT C;  5TIS H;  3H25 A;  2FXP A;  1DH3 A;  1ZXG A;  1OFC X;  3BRC A;  1OZH A;  3EWK A;  1XMO B;  1V9P A;  4TUY A;  3USS A;  3SYO A;  1BCC J;  1L0L H;  3OT7 A;  4DR3 O;  1XMO O;  5AW1 B;  3WG7 B;  4AQR D;  4TV9 A;  3SWF A;  1N33 O;  1AI4 A;  2WLL A;  4L73 A;  1BGY J;  3IJ4 A;  1JFF A;  1DX7 A;  1AIL A;  3CCL V;  1CI6 B;  4OH8 B;  1SQV H;  3ZRW B;  1N8R Q;  1N0J A;  2WLM A;  5CHX A;  4DV0 B;  1JY2 N;  1K73 Q;  1H2L A;  3G71 P;  1HTL C;  4KJM A;  1BSN A;  1N7S A;  3WB0 A;  3TYY A;  1OVU A;  1BHA A;  3BVH A;  1P84 F;  1WNS A;  1JPX A;  1GDT A;  4LGD E;  2Q1K A;  4W4K A;  3BFR A;  4OXS A;  4LNU B;  2QKA A;  3BAS A;  2YIB A;  4BIU A;  2F1M A;  5KUM A;  1LP1 A;  2D2C D;  1RPR A;  2IJK A;  1VQO V;  2JEE A;  2GV9 A;  3D8C A;  1I5X A;  3AE5 C;  3IFX A;  3O6Q B;  1FXV A;  3M9Q A;  1VQL V;  1JEK A;  1SS1 A;  3JAS A;  4U7N A;  1FC2 C;  3H1K G;  4D7T A;  2JWD A;  4DR1 B;  3CWB E;  2UUC B;  3ZJZ A;  5DJU B;  2FBW C;  1N4C A;  4O4H A;  2XUM A;  4U3F H;  1URF A;  4TV8 A;  1RE3 A;  3HRN A;  1N7S C;  5K1X A;  3ASN C;  1PKX A;  1I5Y A;  4X8A A;  2IU0 A;  5F2V O;  1S5J A;  2OTL V;  4N23 A;  4UB8 H;  1BHB A;  2E75 C;  3SJC C;  3AE1 C;  4YJ2 B;  5HFL A;  2M5A B;  1K4C C;  3ZMZ A;  3IFM A;  3L37 A;  1AP5 A;  1QU7 A;  5LHI A;  4LR3 A;  1OIP A;  1K3E A;  1GL2 B;  1SQV G;  3RGU A;  1K5Q A;  4XBF A;  1XHZ A;  2F23 A;  3CCJ V;  1LWU A;  5B1N A;  4XA4 A;  1NR1 A;  2V4D A;  2HPC B;  1EZJ A;  3LDD A;  3EVK A;  2HFE D;  2O01 J;  4MVU A;  4Y99 B;  2ZCE A;  4FM1 A;  1ZAU A;  5KX5 A;  1IBK B;  1FE6 A;  2X0L A;  4PDR A;  1WRG A;  1M90 Q;  1RPO A;  3CXH I;  3E2E A;  4TT3 G;  1Y76 B;  2JEX A;  2Y4T A;  2Y0C A;  3L72 E;  2B88 A;  5IY5 B; 
#chains in the Genus database with same CATH homology
 3AED C;  5L8R J;  1VF5 B;  3C8V A;  4OGQ C;  2QIW A;  2JP3 A;  2IDB A;  1FDI A;  1KMI Z;  1OMI A;  2QJP C;  4YTP C;  1S1C X;  2BEQ D;  1AJY A;  4R4L A;  2G3A A;  3Q3D A;  3RL0 g;  3D71 A;  3H25 A;  2FXP A;  1GMJ A;  4H13 D;  4OGQ D;  3D6Z A;  4IL6 X;  3EWK A;  3Q5P A;  4H44 B;  3AEC C;  5KLI C;  1UIX A;  3D6Y A;  4I7Z C;  2FYN C;  1NGM B;  1ZRT E;  2YIU C;  1VF5 C;  3G9R A;  2E76 D;  4H44 C;  2P10 A;  3GF7 A;  1RQU A;  1KOR A;  2V7Q J;  2J5U A;  3AEG C;  1KQG B;  4PV1 C;  1NYH A;  1PIX A;  2ZT9 C;  1Q90 D;  2E74 D;  5KKZ C;  3AEB C;  3IN6 A;  4R4M A;  2H88 C;  1JB0 J;  4OGQ B;  2JO1 A;  2WSC J;  2E74 C;  3AE8 C;  2G8Y A;  3AEF C;  3SFE C;  2D2C C;  1RQV A;  3AE7 C;  1ZP0 C;  3RK3 E;  1ZOY C;  3SFD C;  4U7J A;  2E75 B;  1KTM A;  2QJK C;  1OW7 A;  1MKM A;  4H0L B;  4RKU J;  2MKV A;  1OW8 A;  1HJ0 A;  4TT3 H;  2WSF J;  2D2C D;  3S9O A;  1DD3 A;  3AEE C;  3B71 A;  2E76 B;  1TU3 F;  3AE5 C;  3LW5 J;  2ZT9 B;  1YQ4 C;  1VL2 A;  1KQF B;  3Q5R A;  4GDO A;  4PV1 D;  1DD4 A;  4XFJ A;  4YXD C;  2NZ2 A;  3GLM A;  4KT0 J;  1HF9 A;  2OQQ A;  3AEA C;  3IAO A;  1VF5 D;  4H13 C;  1PV3 A;  2FBW C;  2BEZ F;  3AE4 C;  4Z1M H;  1K05 A;  3Q5S A;  2E74 B;  2QJY C;  3D70 A;  1EXI A;  2D2C B;  3GMA A;  3Q2Y A;  2K9Y A;  3ABV C;  2ZT9 D;  2WPV B;  3T97 B;  2E75 C;  1KIL E;  2WSE J;  3AE1 C;  2H89 C;  1IK7 A;  3Q1M A;  4H0L C;  1S5L X;  1YQ3 C;  1OW6 A;  2YMK A;  1PL5 A;  3O6Q A;  2WQY C;  4H13 B;  1FDO A;  1WMK A;  1K04 A;  1EXJ A;  2E75 D;  3AE9 C;  3AE3 C;  2O01 J;  4PV1 B;  1R8E A;  3GF3 A;  1ZME C;  1U57 A;  2QSI A;  3AE6 C;  1DIP A;  3AE2 C;  2E76 C;  3R4Y A;  4Y28 J;  4I7Z B;  4H44 D;  5M1B A;  4H0L D;  1Y9B A;  3FGA D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...