1VF5B

Crystal structure of cytochrome b6f complex from m.laminosus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
b'LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKTL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B6
publication title Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
pubmed doi rcsb
molecule tags Photosynthesis
total genus 29
structure length 138
sequence length 138
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1vf5B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1vf5B01
1Q90D 2E76B 2ZT9B 5L8RJ 1VF5B 2E74B 2D2CB 2QJPC 5KLIC 4Y28J 2WSEJ 3C8VA 1S5LX 2QJKC 4KT0J 2QSIA 4OGQB 4I7ZB 2O01J 2FYNC 5KKZC 4RKUJ 2YIUC 4H13B 2QIWA 3LW5J 1ZRTE 4H44B 2WSCJ 2WSFJ 2E75B 4IL6X 2K9YA 4PV1B 2QJYC 4H0LB 1JB0J 2WPVB
chains in the Genus database with same CATH superfamily
5H2FE 4PD4H 2ZDIC 1L0NK 3PP5A 1JCHA 2P90A 5IYZA 2H7HA 2O3JA 3G80A 5CMUA 1EFRG 1E1RG 2UUCO 3W7TA 2JK5C 4H13D 2ZIOA 2RJZA 4U3FH 2OYQA 1KYOH 4DW0A 1QVGO 1KV4A 3FX0A 1BQ0A 3K5OA 2FYNC 2AEJA 1KKDA 1RF1A 2YXHA 4KXRA 3UKMA 1P84I 1S3JA 3BASA 1DGSA 2Q6AA 1ROPA 1BE3D 1YJWV 4HYOA 2X6CA 1ZL8B 4LF5B 1PFIA 1K4CC 2ODMA 2WT7B 1PNKA 1YYCA 5L3EA 2ZYDA 1SZTA 4O4HB 5EC2C 4MS2A 2LXCB 3HTKB 4XDKA 5L3GA 4KT0J 4DV0B 3CCSV 4OX9B 1CSBA 5AW8B 3CX5F 2JKVA 2QA4P 3SYOA 1IFJA 3RGUA 3BA8A 4FLWA 1HUCA 5JJJB 1XI1A 1L0NH 4IHJB 3ABMC 3OEEG 1RE4A 5LP6A 3QH9A 2M7WA 2ZT9D 3FYIB 4MVMA 3JAMN 3HKBB 2XV5A 4YY3O 3BA9A 2P2UA 2LO1A 4DV5B 2FYUG 1U7JA 3B71A 3BAAA 1LWUA 1AFOA 2IH3C 1H2MA 3USSA 1FU1A 1JR9A 2A06H 1E79G 1MKMA 3A8TA 3JD0A 4JI3B 3R66A 4A5UB 1ZXGA 1FJPA 4DV1B 5AG2A 5B1NA 1Q5OA 5H5NA 2ZCEA 1R6KA 4J10A 1G6UA 5KJ7C 5HFMA 1VQKP 1WP7A 2ZFCA 1KP2A 1SQBD 1N36O 2AEMA 3Q5PA 2BCCG 3AECC 3RYFA 1LTJB 2Q69A 1GN4A 4IL6E 3SSUA 2Y9ZA 1W5CE 3QO5A 2UXDO 3ZJZA 5C39A 3M7MX 2EINB 2OTJV 3CC2V 3RVYA 1BCCJ 5LGNA 1YF2A 5EBWC 2WSCJ 1EN4A 3VMAA 3AEBC 2QE7H 1WRGA 3E1IA 2UUBB 3F5HA 4F6EA 2C9LY 3BRCA 1Y67A 1IBKB 3BRVB 3OFNG 1AB3A 1AR1B 3FB7C 1ZL8A 5D5PA 1EZJA 1BCCE 3QG5A 3SYCA 2WT7A 1FXHA 4UCRA 3H1IH 2L5GB 4O4HA 3G9RA 2JEUA 2V7QH 3HTKA 1HR0B 5LL6Y 1IXBA 2BOBC 4JAUA 1XBLA 3VBBA 2UU9B 1GO3F 4GUNA 5KLVJ 1VQ4P 4FFBB 3V4QA 3KDPB 3O8ZA 3S1KA 4O4IB 4RQFA 1NO4A 2FXOA 1BGYH 2Q0OC 2YI8A 4AQYB 4IHJA 3CP1A 4PV1C 3PJSK 3B4SA 1L8DA 3JASB 1SRYA 5KLVE 2Q7EA 5TJHA 4DR4O 1LUWA 4OWFA 1HNWB 3HKBA 1YVWA 5KAFE 1DIPA 4B08A 3FB8C 4H33A 4RUFA 3H1IG 3FB5C 1NH2D 3S4RA 2WVRA 1GM7A 4LFBO 5AW0B 1SQQG 1HBWA 3CCUP 4ZOLB 4GYCB 1PL5A 1LTTC 3IGAC 4A7PA 3BCCH 3C3SA 3VOUA 3CI9A 1IO4A 2P5OA 1G1XB 2R3CA 1ZOYC 3L75E 2E42A 4DK0A 2YICA 1ZR4A 1OW8A 4J7ZA 4AI8A 3SWYA 1J1EB 1A02F 4JPRA 1N0JA 3CX5H 1S0VA 3OMIB 4X62B 3C90A 1LTJA 3H1JG 4ASWA 3L70D 2UXNA 1M93A 2R44A 2GM4A 4DV6O 5GTHE 1S9KD 1I94O 4X1YB 5CBNA 2CGNA 1XNQO 1XL4A 3BCCG 2R3SA 4DR7O 1GN3A 2NRGA 2HFEC 1QBZA 1PL4A 1N32O 3MIWA 3CRRA 1KB9D 3K57A 4Q20A 3SPJA 4O4LB 1JB0J 2K88A 1F4MA 2QA4V 5AVUB 1SA0B 2XASA 2ZKOA 1ZR2A 3CXHI 4NXMO 4N21A 1Q81W 2AZ2A 3M8AA 1CEZA 2Z5UA 4J7JA 1N7SC 2WAMA 2YIUB 1P84D 1TGOA 1SQFA 2QKSA 5EBLC 4FFBA 5DM6V 3H1HH 3K3WA 2EIMC 4ICGA 2QJYB 4KL1A 3F89A 1NTZJ 3CL3D 2B89A 1X9VA 1Q81Q 1I5YA 2KQXA 2N04A 3JASA 2E74C 2D2CC 2YIBA 1FAFA 5BXZA 1V55C 1EXIA 1P84F 4PA3A 3ABLC 1NTZE 5LMNO 1VQKV 4DR3O 3NTNA 1JVMA 5LP6C 3SGIA 2W8ZA 1AV1A 4ZOLA 5BU5A 5TISZ 1VQPP 3I56P 2DOSA 5J2TB 3OTOO 3G6EP 2IBZH 4IIJB 4X65O 3H1HG 4U7OA 2N1TB 2Q8VA 5IYDO 3WUVA 3V2RA 3AE3C 4JI7B 4BXLA 1IVSA 2Y0DA 1GU5A 1K5SA 1KU9A 2CGOA 3VN0A 5GW7A 4K0KO 3D70A 1QR8A 5KLIB 3MGNA 2DYRC 1HNXB 1GM9A 1M57B 3M9HA 2UXXA 3O9OA 4TQDA 3SWKA 4FLZA 1FJGB 1PP9D 4X1YA 2Z0AA 1M1JB 3WMM0 1Z2GA 2WLKA 2POHA 3D36A 1VQ7P 2HVJC 2QM8A 2R70A 1GKFA 2BCCJ 2KK7A 1OHHG 1PNMA 3OEHG 1N33O 5TISH 3UCSC 4O4LA 4XDLA 1Y8AA 1VQ4V 2DJVA 2QJPB 5IY5C 1X0TA 4P9PA 1X79B 3VMXA 2H43A 3CCEP 3CJHB 1SA0A 3DC5A 5BZBA 4TV8B 3E89A 1N34O 1MFTA 4WWIA 1RPRA 4Y99B 3H1KH 2DYSC 5KUMA 1NTKD 1H8HG 3MTUE 4NTYA 3VTPC 2WLJA 1S2EA 3MUDC 1KILE 3SJQC 2KSEA 5B66Z 2WITA 1GW4A 3CCUV 1OVVA 3JAKB 4B7KA 3CD6P 2UUAO 3ABKB 3CWBE 1TVKB 2B87B 1VF6A 4YJ3B 2QSIA 4WFGA 3K5BA 4ZMDA 4X1IB 2SPZA 5AW9B 5AW2B 2E75D 1YITP 5LHGA 1GW3A 5IJ9B 1OVRA 2ADPA 1IDSA 5CBOA 2IYPA 2ZJSE 1FYJA 5CJ0A 4B3TB 4Q6GA 3ZCCA 1X8YA 5J2TA 2XNXA 3Q4HB 1GK9A 4IIJA 4FM0A 5IYBO 4JBZA 2KB7P 5LOVB 1AA0A 2N1TA 1GK6A 3CCMV 1SQXD 1X4TA 1VQLV 1SQQJ 2R5DA 1LTIC 3OMAB 2YC0A 4JZ2A 4EFBA 1XMQB 2K1AA 3V4WA 4BRYB 4Z2WA 1OCOB 3U10A 3UO3A 4GCZA 2EBOA 3T97B 4YHHB 4ZNCA 1K4DC 5B66H 1OCRC 1DF4A 1JY3O 5KAIZ 4UVCA 2K3RA 3O6QB 1M1JA 2ZE8A 1L2PA 4CPGA 3AE4C 5E79H 4MW8A 3H1JJ 4XE5B 2M6YA 3KCYA 3QO8A 1LT1A 3ZMSA 1SLQA 3SYAA 1P84H 5LA6B 4W7ZA 3RK2D 1JUNA 1CZQA 1DD3A 1Q6HA 4MTOA 4ZKPA 3HD7C 4BIUA 1S72V 2EIJB 2W0XA 2LFSA 2IX7C 4CZZA 4H44D 3CJHA 3KZIE 4DYLA 3F5WC 4TV8A 4O4JB 1M5IA 4M3LA 1L4AD 3M0DC 4H0LD 4E2LA 1KQSU 1KFMA 1PIXA 4I6MC 3WFVA 1NU1E 2NPSB 3ETDA 3H9VA 2WPVB 1GDTA 2RMKB 4UB8E 1K34A 1K7DA 1NTMD 1YBKA 2A7WA 2HG5C 2PI5A 5KAIH 3RT3C 4JI8O 4XA4A 1EZVE 3JAKA 3CXHD 3I55P 1NHLA 1S1CX 1AR4A 3G6EV 1TVKA 3NXSA 1NYHA 2B87A 4YJ3A 2V4HA 4TLFA 1AROP 3T1CA 3P8CE 3OAKA 1SQPJ 1S5HC 3MD0A 4H13B 4X1IA 2HYNA 1L0LD 4IL6Z 4UB6Z 4JYAB 1PM9A 5IJ9A 2QRXA 3U59A 1WA8B 2JDIH 2XU6A 4X66B 3CX5I 2OYIC 1VARA 2ZNJA 2KKWA 1W2BU 1SQPE 1KQSO 4NYKA 1PPJE 3Q4HA 5IJ0B 2PTMA 1MMMA 4B3RO 3N2GB 1YTFD 2KZIA 5B3SB 5LOVA 3P32A 2HJFC 3L74D 1OCCC 5LMUB 2IYOA 2MW2B 4WFEA 1VQ7V 1Y47A 2Q9LA 4BRYA 4LF4O 1NKDA 3TSIA 2UXCB 4QGPA 4B86A 4I50B 3T97A 2GHYA 1LJ2A 1MSDA 3CCQP 4LF9B 3VQVA 2JDIG 5CN0A 1IFDA 2E76D 3LSSA 1TA8A 1FZAA 2R32A 3CCEV 3O6QA 1SQXK 5APWA 4C7RA 3ZBHA 2JO1A 1Q8IA 1IFIA 4U3FD 2K9PA 2ZT9B 4IL6H 4UB6H 3ZHQA 5GTIE 5AW7B 1DX7A 5LA6A 2I1JA 1W2BO 2WLMA 3ML0A 2PI4A 1FFTB 3BFRA 1LTBC 2ZYAA 2PYLA 5CCHC 4GKKB 2YKPA 4DV5O 3AK3A 4DR6B 3SJAC 3AG2B 2E5LO 4O4JA 2WPRA 3CD6V 1RY3A 4OPAA 3VQYA 1URQD 2BTQB 2FYUD 1LP1B 3CCJP 1XNRB 3FXDA 4H37A 1F7YA 1WAZA 1U7MA 2NPSA 2QWRB 2RDCA 2WSCH 2XZRA 3BPZA 1P7BA 3V2NA 1GL2D 4X8AA 1L0ND 4ZKUA 3JD2A 1ZMEC 2AXTE 4TUYB 4WY4D 2JWDA 1OCZB 4R6ZA 1F4NA 1MZFA 3VMYA 1JMKC 4KHPO 3A3YB 2ILMA 4LBEC 5KHJA 2ADQB 3CCVP 1SFCD 1QCEA 4X20B 1WA8A 1NZ6A 3ZMVA 5KLVH 1NTMK 2OYHC 1OZHA 3ZS8C 4AQRD 2HKOA 1ZTEA 1BCCG 2A06D 3Q5RA 1VF5C 1TU3F 1SP4A 2IFMA 1RQUA 5IJ0A 3A2AA 1VQ9P 2R5BA 4G27B 3N2GA 1Y4MA 3L72J 3ICXA 1S5LX 2FY8A 1YIJP 1I0HA 3PN1A 4L75A 3B8EB 3APOA 1L0LK 4GODA 4DXWA 2Y0PA 3ASOB 4I50A 1NT2B 4I55B 3L72E 3L35A 1N86A 4GX1A 3RW0A 2OIGA 3GMAA 2P6JA 1W0JG 3L73G 2UU9O 2IZ1A 5KLVG 3UIAA 5B1AB 4EB6B 5C8YB 4BR6A 1HGVA 2JR8A 5KKZB 1NWQA 2D3OW 4OGQD 1G1IA 3OTFA 1YJ9P 2KZJA 2MKVA 5KLIC 4AQYO 2KIKA 4WCEV 2YMYA 3MAQA 2LR2A 4NVPA 2NN4A 2C0XA 1NH2B 4FIPC 2OGUA 2Q68A 2P58A 2Q7GA 4EOTA 3VQXA 1SC5B 3L75G 3P8MC 1QLEC 5EFWB 2YS8A 1HWTC 3H1ID 3I55V 1UPGA 2VRZA 2BTQA 4YJ2B 1NVPD 1LP1A 1OX3A 2QKCA 2OYOA 4DK1A 1SQQD 4W4LA 2JP3A 3G3ZA 1R6TA 4U7NA 2IJJA 3E1RA 1BGYD 3T1YO 5APSA 2A79B 4HZ3A 4FZ1A 1Q7YQ 2R9RB 3AG3B 2YXRB 1Q3EA 2ZNIA 2WSSG 1TUEB 2VWKA 1M7LA 1QR9A 4TUYA 1DH3A 2XAGA 4X62O 3RL0C 4RWUA 2FYUK 2YSUB 1AJNA 1V54B 2YIAA 2LFRA 4LFCO 1KILC 1S9KE 1K9MW 3H1JD 5KA6A 3GHGB 2H88C 4X20A 5L3BA 3RK3B 3VYIA 1XEQA 2CPSA 3RK3E 1M9NA 3BCCD 1KB9E 1N4CA 1LR1A 1NTZH 4OGQC 5JCOC 1NVOA 1HNZB 1RF0A 5EYPA 3H1LJ 3AEIA 5KJ7D 2E3CA 4EDFA 2NNUA 4B3MB 1K9MQ 1KTMA 3K5NA 3JYCA 3W7UA 2YKOA 4C7NB 2W6BA 3CX5D 3GWKC 1M56C 1R73A 4I55A 2PYJA 1PNLA 1N73C 3DC6A 1NKNA 3H1LE 3T1HO 1G4YB 4FM1A 5C8YA 4EB6A 4Y28J 2B1GA 2FYUH 4I4TA 1NTZG 4QIWF 4IFDK 2CTQA 2M0BA 5DN6G 3AK2A 4DR5B 4LF6B 2EIKB 4L87A 3FAVB 2JWAA 3CCJV 1E79H 1LT9B 3B5ND 4IFFA 1FZEA 3M9BA 4RUEA 3SR2C 3OAAG 5IE9A 2DE0X 3KG2A 2LGWA 3FYEB 4DR2B 3EQ2A 2A3QA 2OCHA 3B40A 1GRJA 4O2BB 3ZRVA 1JTHB 1IFNA 4LP8A 2BCCH 4I0XB 4YJ2A 1BHBA 2ATKC 2YDEA 5CBHA 3VMZA 3CC4P 4NTWA 4FZ0A 2IJHA 1KORA 1UFIA 1JCDA 4UCVA 1ZRTD 5H6RA 3HE4B 4B7EA 4JTDB 3ZHTA 2PGGA 3D6YA 1QQCA 5CCGA 3H1HD 5B5EE 2YMKA 5EBMC 2CUGA 1EM1A 4PV1D 1MSWD 3GF3A 4JI5O 3TCUA 2W0FC 3WU2E 3W7WA 4F4LA 1PP9E 3W68A 1SQQK 1YIJV 4IFMA 3HB3B 3K5MA 4C7UA 1RM1B 2BSKB 5K1XA 2VQFO 3GHGA 2QTOA 4WBNB 1CXZB 1ORQC 1Q43A 4DV2O 3AG4B 3FGAD 3SWFA 3Q1MA 2QWNB 2IBZD 1V9PA 2B9ZA 4WB4A 1FOSE 4OVNF 4DR1B 3TGUJ 2RMZA 1I5XA 1YCIA 3WUUA 3I5CA 2OARA 3STLC 2ZR3A 2WLLB 3K9AA 1XMOB 2MJZA 2AW9A 1YJ9V 2I1KA 1YHQV 1K97A 3B5NC 4C7NA 2IDBA 1XTCC 5KHGA 1HJ0A 3TGUE 3E8GA 5FLXN 2BASA 4QPKA 1N8RW 1X59A 4DUYO 3CWBG 2ZQMA 2P10A 1IBMO 2HHHO 2N74A 5KHKA 3IN6A 2XNDG 5A9GA 3B2EE 2HFED 2LKMA 3RYIB 3A5TA 2M3EA 1SQQH 1NQTA 2XAJA 3TETA 4MVSA 4JV5B 3L73J 3HUSB 3FAVA 5IWAB 1IBLB 1S5LE 4GIFA 2Y48A 2PY5A 1FS0E 1Q6IA 4DCKA 1IFMA 1LT9A 2E75B 1H2LA 3J7AU 2Q7CA 3ZHSA 1N8RQ 2F4VB 1WB8A 5KUKA 4B3SO 3L73E 1GM8A 4O2BA 3T2MA 4N78D 1JTHA 2QEXP 5JVDB 3OA7A 4IYIA 4IOIH 4J80A 3SPGA 4I0XA 3H1KD 1K5QA 4GDOA 3H1JH 2LW7A 4W4KA 1N7SD 3WB1A 5KA5A 2DMXA 3GLMA 3HE4A 3L75J 3PH0A 2ZIMA 3L9DA 3OUFA 4DUZO 4UCUA 4TOIA 3RWRD 5BY1A 2PF4E 3IF4A 4L73A 2K37A 1J95A 5EK0A 3A0BE 1FC2C 1BSHA 5APTA 4YHHO 2E74D 4JAVA 3T4ZA 2D2CD 4AYCA 2RH0A 5AVWB 3U1AA 5DJUB 2ZXWC 1EZVH 3E83A 4D6TG 2BSKA 1KN7A 4GKJB 1D7MA 3H32B 3RK2B 4WBNA 3L71G 2ZE5A 4UVAA 2GTAA 5LXTB 4J41A 4JTCB 2I8DA 3AG1C 3STZC 1I08A 4TT3G 4W80A 1NU1G 3IR9A 1EBOA 4K3AA 2WLLA 2IPPA 1L4AB 4H0LB 1PV3A 2JVDA 1PPJH 2CE4A 4ABMA 1OWAA 1H2GA 1EZVG 3HR0A 1NKZB 3B77A 3D8CA 1WB7A 1FZGA 1RF1C 4DZOA 1YEWA 4YIOA 4F6RB 4FLTA 1CP9A 4LFAB 1MV8A 1RFYA 5JJEB 1GK4A 3Q5SA 4GX2A 3UM7A 3RYIA 1THZA 5L3DA 5LGTA 1IC2A 2UUCB 3ASNB 3HUSA 3CC4V 4J42A 4O4IA 4QNHB 1EDLA 3ZRSA 4DV3O 1SQPG 1PPJG 2N9YB 1VQNP 2E43A 1JJOA 4J11A 1IK9A 2WPDG 4GOFA 2XUMA 3HKCB 4NPFX 4JI0O 4LF8O 1EN5A 5JVDA 1YTFB 2E5TA 3K06A 2N05A 1RE4C 5B1BB 5AVSB 4EI2A 1FD9A 1R3JC 2JGUA 3K0GA 3UQ8A 1ZLZA 2GTSA 4UFZA 4BWAA 2P7JA 5LMUO 1QVFU 1P7GA 2EILC 3OR7C 1WLEA 3PLNA 3GVMA 1BQZA 2OT5A 2E76B 3CLQA 2F95B 4PD4E 1DEEG 1LWUC 1K3EA 3X2QB 4L76A 1VQ5P 4YTPC 2H8PC 3ZN1A 2IH1C 1GAXA 4J7KA 1SQVJ 4NTXA 4LR3A 3QO7A 1KYOE 3AG3C 1J1DC 5AVQB 3H32A 1KECA 2DWDC 3H01A 4I7ZB 4JYCA 4YY3B 2KLVA 3K9SA 3FX7A 4DW1A 1PKXA 1WJZA 1AQ5A 1SQVE 2FYZA 3E8BA 3A7OA 5LXTA 1BSNA 4FMTA 4LWSB 1FXKB 1Z5VA 4NR1A 4CC6A 2RN0A 5GONB 1RE3A 1QVFO 3RK3C 1L4AA 1KC8W 1N0NA 4K8XA 1URQB 3FWLA 2A45G 4NKGB 3O65A 1SQBG 2Q5UA 1FPOA 4PI0A 3JSNA 1KUQA 3K03A 1XNRO 1GN2A 4WFFA 3Q3DA 1N36B 4ASUG 3QTCA 1GL2B 3H25A 3CRAA 1Y76B 2QSAA 4BW5A 1FZBA 4F6RA 5APVA 4BWNA 1L0NE 4MSWC 2W83C 5FPRA 2G3AA 1VIBA 4WY4B 1Z5WA 3K58A 1XL6A 1VQ6P 4DV7O 2UXDB 1B3QA 3CWBJ 1KQGB 1KC8Q 2IFNA 3RBXA 4X64O 1GMJA 1XDCA 2OWOA 5BR8B 3K79A 3BY6A 1SFCB 3HD7D 4HH2A 3JD4A 1ZUQA 3J81N 4QMAA 4HB1A 5AW1B 2KSJA 3HKCA 2A06E 4N23A 2YXLA 3AK1A 2WLNA 4P30A 4BIOA 1EN6A 2VQEB 5H2FZ 2AXCA 1FBMA 4CBCA 3L72G 3S3XA 3S3WA 1MA1A 1FOSF 2WSEH 1JOYA 1BCCD 3MP7B 2BTOA 1Y66A 1Y6XA 2VRSA 3N27A 3JSLA 1JMMA 3WG7B 2HG5D 2WPQA 2C2AA 2IZ0A 2YKQA 4J9ZB 3N7NA 1XUQA 1H0TB 1COWG 2W6JH 2RCVA 2K9JB 2LQTA 1BDDA 3P7KA 3CE2A 4OXSA 5ITZB 4DR4B 4CC5A 3MHVA 5KLVD 2YUAA 3CSXA 4MTFA 3SFEC 2WMMA 3E22B 2QWOB 1GN6A 4GOEA 4AILC 1BS3A 1G8MA 3JALB 2HPCB 2Q73A 2HVKC 4D6TJ 3V5BA 1FAVA 3CRQA 4LWSA 1FXKA 2DQ3A 4GT1A 3SJCC 3U11A 2ZM6B 1LTJC 3L71J 5H2FH 5GONA 2W6JG 1EDJA 2AHZA 1EDIA 1SKVA 1H89A 1URQA 1KKCA 4JI6O 3DGEA 4D6TE 2M5AB 2ZE6A 2EINC 3L75D 3ZHRA 1NU1J 4P2ZA 1S5JA 3EXAA 3L70G 1KZUB 3L71E 5BU8B 1NGMB 1VQNV 2QIWA 1EDKA 1GL2A 3LW5J 3K0DA 3NMDA 1Y76A 2JS5A 2WSFJ 5APQA 2KXPB 3W7XA 4WY4A 2X6AA 4DV6B 4C46A 3BHPA 1I94B 3H1LH 4JYYA 5AW5B 1XNQB 4TSFG 1OXZA 3OR6C 3E2EA 4DR7B 4PA7A 2HODB 1VMGA 4PDMA 2CTRA 1AVYA 2L35A 3CB2A 1SFCA 3WU2Z 1U57A 5CCHD 1N32B 2W90A 2WZ7A 4RO2A 2HP8A 2WTYA 1VQPV 3I56V 4JI2B 1ZX3A 2EX3A 3OJAB 3F7YC 3B09A 3N4XA 3HUSC 3G4SP 1AQTA 1GZLA 1JOCA 2O01N 1Q6UA 3KQGA 1NOHA 1VQ5V 1CPYA 1WPBA 4NXMB 2YO3A 1HW7A 1BE3J 1EZVI 1XHXA 4JPZB 5CBGA 2IJIA 3H1LG 4KJMA 1H2NA 1H38A 1NH4A 2KS1B 5LGUA 3CMEP 1FJKA 1QNMA 2ZXXA 4FLXA 1NBMG 3SFDC 3APQA 3LSQA 1OIPA 1XREA 1OZ0A 4PJ0E 3G67A 2ZDIA 1BE3E 1H0TA 2F66C 1AI6A 4ZIBA 3PRJA 3ZDMA 4LF5O 3CMAP 2GUZB 4L74A 2UXBB 5ITZA 3WU2H 3R65A 3JATB 5KHIA 2OIEA 3E22A 4DV0O 2RNBA 2BEZF 4OX9O 3M06A 1VF5D 3JALA 4IGGA 4DR3B 2BOCC 5APXA 2HPCA 1HDJA 1J1EC 1NTZD 2JS3A 1ZW0A 4MTXA 2QM7A 2H94A 1MNGA 5CB4B 3OTOB 5KHHA 2KUBA 3ETQA 4X65B 1BDCA 2HJDA 3DXRB 3ETGA 2QGNA 3IFMA 2ZXEB 5KLVK 2LJ2A 3D36C 4AHCA 3OD4A 2M5AA 4EYYQ 5KAFZ 3ABUA 1Z56A 1RH5B 3C3TA 1ZRTE 2QG4A 4K0KB 1S77D 1PP9G 2LP7A 4PV1B 2XHBA 1SQBJ 3TGUH 4QJFB 5KX5B 3AE1C 4RO0A 4JI3O 1W59A 1BCCH 2XOKG 4DV1O 3R2PA 1YJWP 4TV9B 4PD4F 1YITV 2ITAA 1AR5A 2HODA 3CS5A 1SZXA 1SQBE 3ZX6A 3U0ZA 2HR3A 2AHYA 2DQ0A 1R5SA 2O01J 2ETNA 3FFQA 4TQFA 1B06A 1N33B 3M9QA 2YIUC 3MHHC 1QLED 4I1LA 3SPIA 4LF7B 3DSQA 2IJKA 5JH7B 2BCCD 2IBZE 3VP8A 4IL6X 2VS0A 1BZKA 1F51A 2QJYC 1J5EB 5AVZB 3CC7P 3TGUG 5GTHZ 5KJ7A 1AP5A 3L73H 4DR1O 1GH6A 1N34B 1NTKG 1MG1A 2PZSA 2PP6A 5KAFH 2CPBA 1VF6C 1US6A 2GBOA 2KS1A 1JA8A 2DWEC 1O9GA 2IW5A 2Q5ZA 3ZRXA 4Z1MG 1FKAO 2X0LA 4PA4A 4AUWA 2UUBO 4GKGA 4JYBA 3WUTA 3RL0D 3LDDA 3BATA 1IBKO 4UVBA 1KILD 1UJWB 2UUAB 1FS0G 1OV9A 2GUZA 2Q1KA 3IJ4A 2JEEA 2N1TC 3L75H 3JATA 1HR0O 1AI4A 3BVOA 3TNUB 1F23A 1G2CB 2PAJA 2QVAA 1KBHA 1HH0A 4X89A 1PV0A 1NAYA 3CEIA 2YXQB 3KPEA 2O57A 2F4VO 4U3JB 5CB4A 1M57C 4U7JA 5GTHH 4N78E 2RN9A 3DXRA 2YI9A 1YQ3C 1U97A 3OUSA 1M1JC 1HNWO 1BSMA 4I9WA 1MZ9A 1M56D 1N7SB 2WSSH 2E5YA 4HJGH 5EIBC 1VQ8P 5A2QN 3K04A 1K73W 4JI1B 2A9HA 2C0WA 2F23A 1NTZK 1R5LA 2EIMB 3AEAC 5IYCO 5HFLA 1T6AA 2ZYGA 1DK1A 1IXMA 2E74B 2KG7B 5KX5A 2D2CB 2QJPC 4Z1VA 3NFQA 3G71P 3L70J 2M3BA 4WFHA 1V55B 3G6BA 4TV9A 1KFNA 4UV8A 3KKYA 3ABLB 4XBFA 4X88A 1SERA 4I2LC 1K73Q 3EFFK 4Y99C 1H88A 2EZOA 1L1FA 2P22C 1K04A 3CMEV 3L70E 2Q3EA 3AE2C 2B1IA 1VEWA 4CH3A 4GKJO 3CCLP 2CK3G 2F1MA 2XTAA 4K35A 5JH7A 4E4EA 2KYVA 5J2UB 2A0LA 4MW3A 4HAMA 4LLHA 3ZIAG 2Q67A 3ABKC 1LTSC 4R8CA 3RGBA 1PZQA 2FXMA 1NTMG 3ZEDA 3CCQV 1H2KA 2Y4UA 2DYRB 4YPCA 4DT0A 1R8EA 1SQGA 3JCUE 1NU1D 2Y0EA 3DTUB 1IK7A 1AJPA 2LW1A 2P4VA 4JI8B 4FFKA 3N2KB 5CHXA 1EZVD 1XQ8A 1KB9I 2AZ0A 5E79E 5FNVB 2IU0A 4X9QA 2PRRA 1Q90D 1P84E 3TNUA 1Q82W 5CA3A 1G2CA 3P8CD 3QWOC 2OTLP 1HGZA 1S4XA 5IY5B 4MVZA 1OCOC 3RYCB 1Q2NA 4JGSA 1K8AW 2KLUA 4U3JA 4GX5A 5K1PA 1W2EA 3L74G 4B3RB 1SQVH 1SQPD 1PPJD 1PGOA 3LDCA 3LUTB 2DYSB 1N7SA 1Q82Q 2IU3A 1EXJA 1T5EA 4LF4B 2HEPA 4UV9A 1FXVA 2JRIA 3LIDA 5F2VO 3II6A 4MVUA 1WP8A 1Y9BA 5KAIE 2FFDB 1H8AA 1K8AQ 3ZN0A 2EIJC 4CH5A 2KG7A 3C1LA 4U3FG 2Z3YA 1OJHA 3ZRWB 1OMIA 1ZN5A 3CCVV 3FWNA 3FB6C 1OW6A 4I9QA 1PP9J 1SS1A 3CC7V 4JI7O 1SQVG 5K5GB 3TJTA 1K33A 1NJIW 2AEFA 2YEVB 3V6IA 2NPSC 1HNXO 1VQ9V 3TXSA 3PTZA 2FB5A 3CYOA 4QE9A 1FJGO 3QNEA 5J2UA 1O9HA 3GG2A 2OQQA 5JWPA 4HKZH 4CS4A 1JX9A 2E5LB 3CWBH 1RPOA 4FVMA 3GW6A 3D3IA 5DECA 5AVXB 1SETA 3BEHA 2RQ6A 3UT5B 1NJIQ 2XNDH 4IYHA 4CH4A 1L0NG 4H13C 1EQ7A 4D7TA 3A0HE 1OCRB 1NS1A 1T2KD 1NTKJ 2P1JA 4FLVA 3OGCC 4WF9V 1KMIZ 2XAQA 2G38A 1FZCB 3N2KA 1ENVA 3KZIZ 2QWPB 5H6QA 4EEQA 2H89C 5FNVA 5APUA 4KHPB 1YSCA 5B3SC 1QU7A 3RVZA 1NTKE 4UB6E 1ZWIC 4DV4B 1MABG 1VQ8V 3HD7B 2A06G 1NU1K 2ZVNB 2JJ2G 1A32A 5BR8O 2QDOA 4G28B 3RYCA 1E5WA 4JTAB 4UB8Z 1JPXA 4EIJA 4LNUB 3G71V 5FPOA 2GUSA 2VQEO 2ZT9C 1SQXJ 3MUDA 1Y74B 1RSOB 4NPEA 2YNYA 4PDLA 2FMLA 1R3KC 3F7VC 4R7CA 2FFDA 4D6TH 1JM0A 4B3TO 2WLHA 1XTGB 3L72D 4JI4B 3CXCU 3RN4A 3CCLV 4MVOA 1I7FA 1SQPK 3KZIH 1SQXE 3L71H 3ZRWA 5C93A 5B1OA 1LTGC 2CTPA 3S9OA 4UUJC 4DOJA 3AG2C 2QE7G 4PJ0Z 4GX0A 3UO2A 1XMQO 1FFXB 1OFCX 1AI5A 2XKMA 4I5SA 1FDMA 2OYIB 5CBFA 4TT3H 1NU1H 2H3OA 1T2KC 2YEVA 2R9AA 4ZHQB 1WT6A 1JEKA 3OMNB 1K05A 3D3QA 3LW5H 1OW7A 3LNMB 4JF7A 4UB8H 2HLDG 2N9BA 3SPHA 2WSFH 1IFPA 3E7KA 2V7QG 3ZMZA 1JY2O 3D71A 1OCCB 1XHZA 1R3IC 4EFEA 1OCZC 2ZM6O 1WMKA 3E8FA 3H6PA 5AVYB 4R4MA 2EJ7A 3UT5A 4RKUJ 3ITKA 1BGYG 3A2FA 3JD1A 2GUVA 2FL4A 3JAWB 2R9IA 4H44B 5GTIZ 2EZPA 4FLUA 2GA1A 5AW3B 3W7SA 2OTLV 2XAHA 2FKXA 3P3PA 3T1YB 1QEXA 1YI2P 4UCTA 2ITCC 2H8PD 5AVTB 2JEXA 5CCGD 1R6NA 5LYJB 1FZFA 1SQPH 1NTMJ 1Q86W 1UIIA 1FZCA 3HKDB 4R50A 3BVHA 4PI2A 4PJ0H 4WFAV 1X22A 1BE3H 1RP3B 4LFCB 1RF0C 3HE5B 4FK5C 1SF9A 1IURA 3CCMP 1VQLP 4NXNB 3HD7A 1NTME 3OE7G 3TK1A 4BW9A 3ASOC 1L0LJ 3VQWA 4KHXA 1LNQA 3CXHE 3M91A 1SQBK 1DEBA 2M8RA 1NR7A 1Q86Q 5EC1C 3RK3D 2CAZC 4JI2O 3M0DA 4JAAA 2AXTZ 3RBZA 5B1AC 4LNUA 5KKZC 3CCRP 1L0LE 1M90W 1URFA 1QLNA 5CJ4A 1FDOA 1T3UA 3E86A 1BE3G 5GTIH 4JYAO 3L74J 4CS3A 4X66O 2PGDA 1Y74A 1RSOA 3F5TA 3RL0g 2ZINA 5JQGB 4GLXA 1KB9F 3H1LD 4UCSA 3T1HB 1S72P 1R1BA 5J9PC 1GD2E 3L74E 1QGKB 1WNSA 3LSUA 3IAOA 1JQ0A 2J5UA 3B8MA 3QVNA 1KQFB 1M90Q 2B88A 1IZ3A 2R72A 1FE6A 3K08A 1FFXA 4MVQA 1HF9A 2UXCO 4U3FJ 2OYHB 2OYIA 4N6JA 4ZHQA 2UXBO 1VF5B 2C9NY 4MTGA 2A45H 4LF9O 3GF7A 5CCGC 3VP9A 5CMZA 1SQBH 2QM4A 1USDA 2GV9A 2MK3A 4CS2A 2AXTH 2KI7B 1AVOA 2QJKB 3JC22 4HYTB 4U3FE 1VPCA 1MFZA 2Z4EA 2OCCB 1QL1A 1E1QG 2JJLA 4OPHA 4PD4I 2FBWC 2Y69B 1D2DA 2JJ1G 1V54C 2P67A 1G1JA 1JY2N 2FYUJ 2O01H 3JAWA 3SYQA 3GHGC 1KYOI 2ZR2A 1NR1A 1K92A 2WLIB 4PA9A 4GKKO 1JY2P 1GTOA 3P30A 4JI5B 1AJYA 5LYJA 1YTZI 4DR6O 1VDFA 1YDXA 2Q9IA 3AEEC 1L0NJ 2FYUE 2XAFA 1PGPA 3HKDA 3AE7C 3JCZA 4FLYA 3HE5A 3J80N 3KHUA 1VQOP 1BMFG 3VOPA 3K5LA 4X1KB 2Y0IA 2VQFB 5CCHA 2IBZG 1GU4A 3OGIB 1U96A 3L72H 3QF7A 4DV2B 1N2DC 5L3CA 2QEXV 1QLEB 1CI6B 3JARB 2WA4A 2CTWA 1UIXA 2DW4A 2BCCE 2GSMB 3ZMUA 3TYYA 1T8ZA 4LF7O 3THOA 2Q4PA 5KMGB 3GB7C 5CA1B 4FJCC 1J5EO 1IZNB 1CW5A 3MHSC 3T4DA 1GMGA 2EIKC 3WB2A 1LGHB 5JQGA 1LT9C 3TGUD 4DUYB 4JASA 4J9YB 5LHIA 1VL2A 1IBMB 3RL0B 2HHHB 4UXNA 4O9BA 1KILB 2FXPA 1DLBA 1AILA 3JCUZ 2FFDC 1EC5A 5CA0B 2PUSA 2OYHA 2L6LA 4MN4C 4ASVA 5KTBA 3K59A 3V2PA 4BAYA 1BT8A 1YTZT 5E79Z 4OGQB 4DO2A 1HWYA 4B3SB 2GDSA 3OM3B 1YI2V 2KNCB 3H1KG 2FYNB 5EZYB 3L70H 3L73D 4PDRA 4KP4A 2YXYA 2YIBD 2XDJA 1M56B 3H1IJ 3FD9A 1PD3A 4LFBB 3BABA 1N73B 2V7QJ 1AP6A 1GTWA 4QE7A 4XDJA 1RM1C 4WBAA 3FKSG 2X6BA 4DJGA 1BHAA 4DUZB 3R4YA 1AVMA 3HPLC 3EVKA 2WLIA 4JI1O 3AG4C 3Q2YA 2CH7B 1NVPB 1KB9H 3H1IE 1BGYJ 1HJBA 2NR5A 5AVVB 3JCUH 1BL8A 1USEA 2ZAEB 1SQQE 5AW6B 3EHBB 5IT9N 4JQ0D 2F43G 3CCRV 2G8YA 2HLOA 1VP7A 1M1KW 4X1KA 5DJTB 3ABMB 1BGYE 3C9IA 2K9YA 1FZCC 2KOGA 3IAYA 3RFRA 3L37A 5B5EZ 1SVFA 5BMVB 1CI6A 2P4KA 3I5DA 3JARA 1P4RA 1MOFA 1FDIA 3BCCJ 2XT9A 4RQEA 3ETEA 2ZVOB 3H1JE 2QTSA 1H8EG 4CH6A 5KMGA 4PA6A 3EFGA 1M1KQ 5CA1A 5AW4B 4IT5A 2BE3A 1LTAC 3BCCE 4XFJA 2YO2A 2WA3A 2E75C 2F93B 4YXDC 5LHHA 4GZRB 1YJNP 4O2AB 3JD3A 1HNZO 1LUVA 1KILA 2L91A 2OTKE 4RAIA 5D5QA 3AE9C 3A0HZ 3ZHUA 1R3LC 1PL0A 4B3MO 3CX5E 1VQMP 5CA0A 1JFFB 5L3FA 3ZHVA 2LXBA 4DV3B 4LH7A 2K9JA 5B5EH 2Y0CA 1NTKK 2V1DA 5JCOA 4PHZA 1B04A 5JJNB 3AEDC 2KNCA 5M1BA 2KP8A 5EZYA 4BIZA 4P9OA 4JI0B 4LF8B 1KQLA 1RQVA 3MZWB 3CXHF 1PP9H 1ZP0C 2QJ1A 1W0KG 2QWQB 1D5AA 5LMNB 4DR5O 4LF6O 3B5NB 4PDVA 4YXWH 1N73A 3SDLA 4G2KA 1WPXA 1VQOV 2W27A 2W6AA 4OH8B 1JNMA 1S5LZ 4DRXB 2WPSA 1YZBA 3RK2C 4DR2O 3M99B 3LIEA 2FKWB 4FPPA 3H1HJ 2CH7A 1N7LA 2ZD9A 1VQ6V 5BVZA 3A0HH 3CPWU 3HKEB 3MDSA 4PD4D 2Y9YA 2KSDA 3CRCA 2N1TD 1VF7A 4H44C 3AE8C 1WN7A 2EULA 1ZLLA 1RE3C 5APYA 2WWWA 1KP3A 4HNAB 1ZAUA 3WB0A 1L4AC 3H1HE 4H0LC 1DF5A 1AI7A 1KYOD 4LC1A 2X7RB 1JY3N 4PELA 4YXWG 1MZEA 1TUBB 4HBNA 1NTKH 3A0RA 3BRTB 1JO5A 5LBQA 1PGQA 5BMVA 1M57D 3TF5A 1QX8A 4WFBV 1SQVD 3C8VA 2UWJE 1JY3P 1M4UA 3A0BZ 4Z1MH 2B5UA 2EJRA 3SYPA 2RKLA 5EIBD 2YIDA 4K8ZA 2JGDB 4N3YB 1KYOF 2IM9A 2KB1A 1S5LH 3CCSP 3ASNC 3AEFC 4QPJA 1JMBA 3CPWO 2A45I 1AJQA 3ABVC 1QHTA 3KXDA 1IX9A 3HRNA 2Q3IA 4O2AA 5L8RJ 3CHXA 4ZI7B 3W67A 1SESA 2J58A 2QKAA 2ZXWB 3TXQA 1XMOO 3GWOA 3LDEA 1DTOA 4DV7B 2Q6QA 2IBZI 3ABTA 4X64B 1SQXH 1TAEA 2CDYA 5B1BC 3RYHB 1JFFA 3ZMTA 1ZSPA 4UCOA 4DV4O 1T3JA 3AG1B 1H2SB 3A0BH 4NPDA 4KFMA 4YIPA 5IDJA 1B6QA 4D7SA 3CWBD 5IYZB 3CRMA 4KUMA 3KYQA 2E76C 1J2JB 4FM2A 4RJTA 2ITDC 3X2QC 1YQ4C 1XILA 3B5NA 2BEQD 4JV5O 5TISE 3V2QA 5IWAO 2B9BA 1IBLO 4ZBMA 4MT8A 3AEGC 3U1CA 4ZKIA 4L8JA 1IJDB 5EYPB 3H1KJ 2QJKC 2JIZG 4DRXA 1HP8A 4JZGA 1RF1B 2OCCC 3IC9A 1SQXG 4I7ZC 1A02J 4W7YA 1NI8A 2VWJA 3AE6C 2Y69C 5H9CA 3B8NA 4JF3A 3L4FA 2FTKA 3H1KE 3HKEA 2J59M 1JCCA 3KCXA 2PFXA 4JI4O 1FXKC 3SPCA 3AE5C 2CK3H 4LCUC 2OTJP 4HNAA 3SJBC 3TDKA 3CC2P 1URQC 1XOUA 4LH6A 3IC7A 4I4TB 2NLJC 4WVZA 2O1JA 1ZV8A 3NR7A 1YHQP 2Q7HA 1TUBA 4NB5A 3G4SV 1HVVA 2WSEJ 1PGJA 3L36A 2O1KA 2Y4TA 1NAFA 2WQYC 4TWKA 1JJ2U 1NTMH 2Q0AA 1GL2C 3OW2U 5LP6B 1YJNV 2AGAA 1YXBA 2K1EA 1KD1W 3E35A 1Q7YW 3CXHH 4RESB 4WY4C 1RHZB 2ARHA 2JGDA 4LGDE 3OT7A 5E1AC 4JI6B 1DD4A 1MUUA 5AVRB 2EILB 2P06A 3E8HA 1M8OB 2DW3A 5DEDA 1VQMV 2NZ2A 4D6TD 2DN9A 1SFCC 4EKWA 1L0LH 3IFXA 1S76D 1SQVK 1LWUB 4MVRA 3L71D 2Z5HA 4R4LA 1QVGU 3CMAV 1QL2A 4ZI7A 1SS3A 3M0AA 1KD1Q 1P49A 3FXEA 3EWKA 1J1DB 2Z5IA 2W6IG 2P7TC 5FL7G 1D5NA 3P3NA 5B66E 2LGQA 3L74H 3RYHA 2NPSD 1HTLC 3D6ZA 3AG7A 2QR4A 3OW2O 2V4DA 2ZE7A 4NXNO 3PHLA 1OVUA 3WG7C 3RYFB 3JSVC 4LFAO 3LNNA 1L0LG
chains in the Genus database with same CATH topology
1K05A 1OW7A 2ZT9B 2E74C 5L8RJ 2JP3A 1AJYA 1Y9BA 2D2CC 1FDIA 3SFDC 3AEEC 1EXIA 3FGAD 3AE7C 3D71A 3Q1MA 3G9RA 4H13D 1OMIA 4U7JA 3T97B 1OW6A 1WMKA 2FYNC 1YQ3C 4R4MA 3Q5SA 4RKUJ 4XFJA 4H44B 2E75C 4YXDC 4PV1C 3AE4C 2BEZF 3AEAC 1VF5D 2IDBA 2E76C 1HJ0A 2H88C 3AE3C 3AE9C 1UIXA 1YQ4C 2BEQD 1DIPA 2OQQA 1DD3A 2E74B 2D2CB 2P10A 2QJPC 3AEGC 3RK3E 3D70A 2QJKC 4KT0J 1ZMEC 4OGQC 3IN6A 4I7ZC 4H44D 3AE6C 1PL5A 4H13C 3SFEC 1K04A 3AEDC 1VL2A 1ZRTE 4H0LD 1KTMA 5M1BA 3AE2C 1ZOYC 1PIXA 2E75B 2FXPA 2ZT9D 1RQVA 4PV1B 1KMIZ 1ZP0C 3AE5C 1OW8A 2WPVB 5KKZC 2E76B 3AE1C 2H89C 3Q5RA 1VF5C 1TU3F 1FDOA 4YTPC 1RQUA 3B71A 4Y28J 2WSEJ 1S5LX 4GDOA 3RL0g 1S1CX 2WQYC 4OGQB 1R8EA 1NYHA 1MKMA 4I7ZB 2O01J 3GLMA 1NGMB 1IK7A 2YIUC 4H13B 2QIWA 3LW5J 4H44C 3IAOA 3AE8C 2J5UA 2WSFJ 1DD4A 4IL6X 1KQFB 2QJYC 3GMAA 4H0LC 2NZ2A 2E74D 2D2CD 1KILE 2V7QJ 1HF9A 1JB0J 1Q90D 3Q5PA 2ZT9C 3AECC 4OGQD 3R4YA 1VF5B 4R4LA 2MKVA 1U57A 5KLIC 3GF7A 1KORA 3C8VA 3Q2YA 2QSIA 4Z1MH 3D6YA 3Q3DA 3EWKA 3H25A 2YMKA 2E75D 4PV1D 3GF3A 3S9OA 2FBWC 2G3AA 2G8YA 3D6ZA 2WSCJ 3AEFC 2E76D 3AEBC 2K9YA 1KQGB 1EXJA 4TT3H 3O6QA 4H0LB 1GMJA 3ABVC 1PV3A 2JO1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1Q90 D;  2E76 B;  2ZT9 B;  5L8R J;  1VF5 B;  2E74 B;  2D2C B;  2QJP C;  5KLI C;  4Y28 J;  2WSE J;  3C8V A;  1S5L X;  2QJK C;  4KT0 J;  2QSI A;  4OGQ B;  4I7Z B;  2O01 J;  2FYN C;  5KKZ C;  4RKU J;  2YIU C;  4H13 B;  2QIW A;  3LW5 J;  1ZRT E;  4H44 B;  2WSC J;  2WSF J;  2E75 B;  4IL6 X;  2K9Y A;  4PV1 B;  2QJY C;  4H0L B;  1JB0 J;  2WPV B; 
#chains in the Genus database with same CATH topology
 5H2F E;  4PD4 H;  2ZDI C;  1L0N K;  3PP5 A;  1JCH A;  2P90 A;  5IYZ A;  2H7H A;  2O3J A;  3G80 A;  5CMU A;  1EFR G;  1E1R G;  2UUC O;  3W7T A;  2JK5 C;  4H13 D;  2ZIO A;  2RJZ A;  4U3F H;  2OYQ A;  1KYO H;  4DW0 A;  1QVG O;  1KV4 A;  3FX0 A;  1BQ0 A;  3K5O A;  2FYN C;  2AEJ A;  1KKD A;  1RF1 A;  2YXH A;  4KXR A;  3UKM A;  1P84 I;  1S3J A;  3BAS A;  1DGS A;  2Q6A A;  1ROP A;  1BE3 D;  1YJW V;  4HYO A;  2X6C A;  1ZL8 B;  4LF5 B;  1PFI A;  1K4C C;  2ODM A;  2WT7 B;  1PNK A;  1YYC A;  5L3E A;  2ZYD A;  1SZT A;  4O4H B;  5EC2 C;  4MS2 A;  2LXC B;  3HTK B;  4XDK A;  5L3G A;  4KT0 J;  4DV0 B;  3CCS V;  4OX9 B;  1CSB A;  5AW8 B;  3CX5 F;  2JKV A;  2QA4 P;  3SYO A;  1IFJ A;  3RGU A;  3BA8 A;  4FLW A;  1HUC A;  5JJJ B;  1XI1 A;  1L0N H;  4IHJ B;  3ABM C;  3OEE G;  1RE4 A;  5LP6 A;  3QH9 A;  2M7W A;  2ZT9 D;  3FYI B;  4MVM A;  3JAM N;  3HKB B;  2XV5 A;  4YY3 O;  3BA9 A;  2P2U A;  2LO1 A;  4DV5 B;  2FYU G;  1U7J A;  3B71 A;  3BAA A;  1LWU A;  1AFO A;  2IH3 C;  1H2M A;  3USS A;  1FU1 A;  1JR9 A;  2A06 H;  1E79 G;  1MKM A;  3A8T A;  3JD0 A;  4JI3 B;  3R66 A;  4A5U B;  1ZXG A;  1FJP A;  4DV1 B;  5AG2 A;  5B1N A;  1Q5O A;  5H5N A;  2ZCE A;  1R6K A;  4J10 A;  1G6U A;  5KJ7 C;  5HFM A;  1VQK P;  1WP7 A;  2ZFC A;  1KP2 A;  1SQB D;  1N36 O;  2AEM A;  3Q5P A;  2BCC G;  3AEC C;  3RYF A;  1LTJ B;  2Q69 A;  1GN4 A;  4IL6 E;  3SSU A;  2Y9Z A;  1W5C E;  3QO5 A;  2UXD O;  3ZJZ A;  5C39 A;  3M7M X;  2EIN B;  2OTJ V;  3CC2 V;  3RVY A;  1BCC J;  5LGN A;  1YF2 A;  5EBW C;  2WSC J;  1EN4 A;  3VMA A;  3AEB C;  2QE7 H;  1WRG A;  3E1I A;  2UUB B;  3F5H A;  4F6E A;  2C9L Y;  3BRC A;  1Y67 A;  1IBK B;  3BRV B;  3OFN G;  1AB3 A;  1AR1 B;  3FB7 C;  1ZL8 A;  5D5P A;  1EZJ A;  1BCC E;  3QG5 A;  3SYC A;  2WT7 A;  1FXH A;  4UCR A;  3H1I H;  2L5G B;  4O4H A;  3G9R A;  2JEU A;  2V7Q H;  3HTK A;  1HR0 B;  5LL6 Y;  1IXB A;  2BOB C;  4JAU A;  1XBL A;  3VBB A;  2UU9 B;  1GO3 F;  4GUN A;  5KLV J;  1VQ4 P;  4FFB B;  3V4Q A;  3KDP B;  3O8Z A;  3S1K A;  4O4I B;  4RQF A;  1NO4 A;  2FXO A;  1BGY H;  2Q0O C;  2YI8 A;  4AQY B;  4IHJ A;  3CP1 A;  4PV1 C;  3PJS K;  3B4S A;  1L8D A;  3JAS B;  1SRY A;  5KLV E;  2Q7E A;  5TJH A;  4DR4 O;  1LUW A;  4OWF A;  1HNW B;  3HKB A;  1YVW A;  5KAF E;  1DIP A;  4B08 A;  3FB8 C;  4H33 A;  4RUF A;  3H1I G;  3FB5 C;  1NH2 D;  3S4R A;  2WVR A;  1GM7 A;  4LFB O;  5AW0 B;  1SQQ G;  1HBW A;  3CCU P;  4ZOL B;  4GYC B;  1PL5 A;  1LTT C;  3IGA C;  4A7P A;  3BCC H;  3C3S A;  3VOU A;  3CI9 A;  1IO4 A;  2P5O A;  1G1X B;  2R3C A;  1ZOY C;  3L75 E;  2E42 A;  4DK0 A;  2YIC A;  1ZR4 A;  1OW8 A;  4J7Z A;  4AI8 A;  3SWY A;  1J1E B;  1A02 F;  4JPR A;  1N0J A;  3CX5 H;  1S0V A;  3OMI B;  4X62 B;  3C90 A;  1LTJ A;  3H1J G;  4ASW A;  3L70 D;  2UXN A;  1M93 A;  2R44 A;  2GM4 A;  4DV6 O;  5GTH E;  1S9K D;  1I94 O;  4X1Y B;  5CBN A;  2CGN A;  1XNQ O;  1XL4 A;  3BCC G;  2R3S A;  4DR7 O;  1GN3 A;  2NRG A;  2HFE C;  1QBZ A;  1PL4 A;  1N32 O;  3MIW A;  3CRR A;  1KB9 D;  3K57 A;  4Q20 A;  3SPJ A;  4O4L B;  1JB0 J;  2K88 A;  1F4M A;  2QA4 V;  5AVU B;  1SA0 B;  2XAS A;  2ZKO A;  1ZR2 A;  3CXH I;  4NXM O;  4N21 A;  1Q81 W;  2AZ2 A;  3M8A A;  1CEZ A;  2Z5U A;  4J7J A;  1N7S C;  2WAM A;  2YIU B;  1P84 D;  1TGO A;  1SQF A;  2QKS A;  5EBL C;  4FFB A;  5DM6 V;  3H1H H;  3K3W A;  2EIM C;  4ICG A;  2QJY B;  4KL1 A;  3F89 A;  1NTZ J;  3CL3 D;  2B89 A;  1X9V A;  1Q81 Q;  1I5Y A;  2KQX A;  2N04 A;  3JAS A;  2E74 C;  2D2C C;  2YIB A;  1FAF A;  5BXZ A;  1V55 C;  1EXI A;  1P84 F;  4PA3 A;  3ABL C;  1NTZ E;  5LMN O;  1VQK V;  4DR3 O;  3NTN A;  1JVM A;  5LP6 C;  3SGI A;  2W8Z A;  1AV1 A;  4ZOL A;  5BU5 A;  5TIS Z;  1VQP P;  3I56 P;  2DOS A;  5J2T B;  3OTO O;  3G6E P;  2IBZ H;  4IIJ B;  4X65 O;  3H1H G;  4U7O A;  2N1T B;  2Q8V A;  5IYD O;  3WUV A;  3V2R A;  3AE3 C;  4JI7 B;  4BXL A;  1IVS A;  2Y0D A;  1GU5 A;  1K5S A;  1KU9 A;  2CGO A;  3VN0 A;  5GW7 A;  4K0K O;  3D70 A;  1QR8 A;  5KLI B;  3MGN A;  2DYR C;  1HNX B;  1GM9 A;  1M57 B;  3M9H A;  2UXX A;  3O9O A;  4TQD A;  3SWK A;  4FLZ A;  1FJG B;  1PP9 D;  4X1Y A;  2Z0A A;  1M1J B;  3WMM 0;  1Z2G A;  2WLK A;  2POH A;  3D36 A;  1VQ7 P;  2HVJ C;  2QM8 A;  2R70 A;  1GKF A;  2BCC J;  2KK7 A;  1OHH G;  1PNM A;  3OEH G;  1N33 O;  5TIS H;  3UCS C;  4O4L A;  4XDL A;  1Y8A A;  1VQ4 V;  2DJV A;  2QJP B;  5IY5 C;  1X0T A;  4P9P A;  1X79 B;  3VMX A;  2H43 A;  3CCE P;  3CJH B;  1SA0 A;  3DC5 A;  5BZB A;  4TV8 B;  3E89 A;  1N34 O;  1MFT A;  4WWI A;  1RPR A;  4Y99 B;  3H1K H;  2DYS C;  5KUM A;  1NTK D;  1H8H G;  3MTU E;  4NTY A;  3VTP C;  2WLJ A;  1S2E A;  3MUD C;  1KIL E;  3SJQ C;  2KSE A;  5B66 Z;  2WIT A;  1GW4 A;  3CCU V;  1OVV A;  3JAK B;  4B7K A;  3CD6 P;  2UUA O;  3ABK B;  3CWB E;  1TVK B;  2B87 B;  1VF6 A;  4YJ3 B;  2QSI A;  4WFG A;  3K5B A;  4ZMD A;  4X1I B;  2SPZ A;  5AW9 B;  5AW2 B;  2E75 D;  1YIT P;  5LHG A;  1GW3 A;  5IJ9 B;  1OVR A;  2ADP A;  1IDS A;  5CBO A;  2IYP A;  2ZJS E;  1FYJ A;  5CJ0 A;  4B3T B;  4Q6G A;  3ZCC A;  1X8Y A;  5J2T A;  2XNX A;  3Q4H B;  1GK9 A;  4IIJ A;  4FM0 A;  5IYB O;  4JBZ A;  2KB7 P;  5LOV B;  1AA0 A;  2N1T A;  1GK6 A;  3CCM V;  1SQX D;  1X4T A;  1VQL V;  1SQQ J;  2R5D A;  1LTI C;  3OMA B;  2YC0 A;  4JZ2 A;  4EFB A;  1XMQ B;  2K1A A;  3V4W A;  4BRY B;  4Z2W A;  1OCO B;  3U10 A;  3UO3 A;  4GCZ A;  2EBO A;  3T97 B;  4YHH B;  4ZNC A;  1K4D C;  5B66 H;  1OCR C;  1DF4 A;  1JY3 O;  5KAI Z;  4UVC A;  2K3R A;  3O6Q B;  1M1J A;  2ZE8 A;  1L2P A;  4CPG A;  3AE4 C;  5E79 H;  4MW8 A;  3H1J J;  4XE5 B;  2M6Y A;  3KCY A;  3QO8 A;  1LT1 A;  3ZMS A;  1SLQ A;  3SYA A;  1P84 H;  5LA6 B;  4W7Z A;  3RK2 D;  1JUN A;  1CZQ A;  1DD3 A;  1Q6H A;  4MTO A;  4ZKP A;  3HD7 C;  4BIU A;  1S72 V;  2EIJ B;  2W0X A;  2LFS A;  2IX7 C;  4CZZ A;  4H44 D;  3CJH A;  3KZI E;  4DYL A;  3F5W C;  4TV8 A;  4O4J B;  1M5I A;  4M3L A;  1L4A D;  3M0D C;  4H0L D;  4E2L A;  1KQS U;  1KFM A;  1PIX A;  4I6M C;  3WFV A;  1NU1 E;  2NPS B;  3ETD A;  3H9V A;  2WPV B;  1GDT A;  2RMK B;  4UB8 E;  1K34 A;  1K7D A;  1NTM D;  1YBK A;  2A7W A;  2HG5 C;  2PI5 A;  5KAI H;  3RT3 C;  4JI8 O;  4XA4 A;  1EZV E;  3JAK A;  3CXH D;  3I55 P;  1NHL A;  1S1C X;  1AR4 A;  3G6E V;  1TVK A;  3NXS A;  1NYH A;  2B87 A;  4YJ3 A;  2V4H A;  4TLF A;  1ARO P;  3T1C A;  3P8C E;  3OAK A;  1SQP J;  1S5H C;  3MD0 A;  4H13 B;  4X1I A;  2HYN A;  1L0L D;  4IL6 Z;  4UB6 Z;  4JYA B;  1PM9 A;  5IJ9 A;  2QRX A;  3U59 A;  1WA8 B;  2JDI H;  2XU6 A;  4X66 B;  3CX5 I;  2OYI C;  1VAR A;  2ZNJ A;  2KKW A;  1W2B U;  1SQP E;  1KQS O;  4NYK A;  1PPJ E;  3Q4H A;  5IJ0 B;  2PTM A;  1MMM A;  4B3R O;  3N2G B;  1YTF D;  2KZI A;  5B3S B;  5LOV A;  3P32 A;  2HJF C;  3L74 D;  1OCC C;  5LMU B;  2IYO A;  2MW2 B;  4WFE A;  1VQ7 V;  1Y47 A;  2Q9L A;  4BRY A;  4LF4 O;  1NKD A;  3TSI A;  2UXC B;  4QGP A;  4B86 A;  4I50 B;  3T97 A;  2GHY A;  1LJ2 A;  1MSD A;  3CCQ P;  4LF9 B;  3VQV A;  2JDI G;  5CN0 A;  1IFD A;  2E76 D;  3LSS A;  1TA8 A;  1FZA A;  2R32 A;  3CCE V;  3O6Q A;  1SQX K;  5APW A;  4C7R A;  3ZBH A;  2JO1 A;  1Q8I A;  1IFI A;  4U3F D;  2K9P A;  2ZT9 B;  4IL6 H;  4UB6 H;  3ZHQ A;  5GTI E;  5AW7 B;  1DX7 A;  5LA6 A;  2I1J A;  1W2B O;  2WLM A;  3ML0 A;  2PI4 A;  1FFT B;  3BFR A;  1LTB C;  2ZYA A;  2PYL A;  5CCH C;  4GKK B;  2YKP A;  4DV5 O;  3AK3 A;  4DR6 B;  3SJA C;  3AG2 B;  2E5L O;  4O4J A;  2WPR A;  3CD6 V;  1RY3 A;  4OPA A;  3VQY A;  1URQ D;  2BTQ B;  2FYU D;  1LP1 B;  3CCJ P;  1XNR B;  3FXD A;  4H37 A;  1F7Y A;  1WAZ A;  1U7M A;  2NPS A;  2QWR B;  2RDC A;  2WSC H;  2XZR A;  3BPZ A;  1P7B A;  3V2N A;  1GL2 D;  4X8A A;  1L0N D;  4ZKU A;  3JD2 A;  1ZME C;  2AXT E;  4TUY B;  4WY4 D;  2JWD A;  1OCZ B;  4R6Z A;  1F4N A;  1MZF A;  3VMY A;  1JMK C;  4KHP O;  3A3Y B;  2ILM A;  4LBE C;  5KHJ A;  2ADQ B;  3CCV P;  1SFC D;  1QCE A;  4X20 B;  1WA8 A;  1NZ6 A;  3ZMV A;  5KLV H;  1NTM K;  2OYH C;  1OZH A;  3ZS8 C;  4AQR D;  2HKO A;  1ZTE A;  1BCC G;  2A06 D;  3Q5R A;  1VF5 C;  1TU3 F;  1SP4 A;  2IFM A;  1RQU A;  5IJ0 A;  3A2A A;  1VQ9 P;  2R5B A;  4G27 B;  3N2G A;  1Y4M A;  3L72 J;  3ICX A;  1S5L X;  2FY8 A;  1YIJ P;  1I0H A;  3PN1 A;  4L75 A;  3B8E B;  3APO A;  1L0L K;  4GOD A;  4DXW A;  2Y0P A;  3ASO B;  4I50 A;  1NT2 B;  4I55 B;  3L72 E;  3L35 A;  1N86 A;  4GX1 A;  3RW0 A;  2OIG A;  3GMA A;  2P6J A;  1W0J G;  3L73 G;  2UU9 O;  2IZ1 A;  5KLV G;  3UIA A;  5B1A B;  4EB6 B;  5C8Y B;  4BR6 A;  1HGV A;  2JR8 A;  5KKZ B;  1NWQ A;  2D3O W;  4OGQ D;  1G1I A;  3OTF A;  1YJ9 P;  2KZJ A;  2MKV A;  5KLI C;  4AQY O;  2KIK A;  4WCE V;  2YMY A;  3MAQ A;  2LR2 A;  4NVP A;  2NN4 A;  2C0X A;  1NH2 B;  4FIP C;  2OGU A;  2Q68 A;  2P58 A;  2Q7G A;  4EOT A;  3VQX A;  1SC5 B;  3L75 G;  3P8M C;  1QLE C;  5EFW B;  2YS8 A;  1HWT C;  3H1I D;  3I55 V;  1UPG A;  2VRZ A;  2BTQ A;  4YJ2 B;  1NVP D;  1LP1 A;  1OX3 A;  2QKC A;  2OYO A;  4DK1 A;  1SQQ D;  4W4L A;  2JP3 A;  3G3Z A;  1R6T A;  4U7N A;  2IJJ A;  3E1R A;  1BGY D;  3T1Y O;  5APS A;  2A79 B;  4HZ3 A;  4FZ1 A;  1Q7Y Q;  2R9R B;  3AG3 B;  2YXR B;  1Q3E A;  2ZNI A;  2WSS G;  1TUE B;  2VWK A;  1M7L A;  1QR9 A;  4TUY A;  1DH3 A;  2XAG A;  4X62 O;  3RL0 C;  4RWU A;  2FYU K;  2YSU B;  1AJN A;  1V54 B;  2YIA A;  2LFR A;  4LFC O;  1KIL C;  1S9K E;  1K9M W;  3H1J D;  5KA6 A;  3GHG B;  2H88 C;  4X20 A;  5L3B A;  3RK3 B;  3VYI A;  1XEQ A;  2CPS A;  3RK3 E;  1M9N A;  3BCC D;  1KB9 E;  1N4C A;  1LR1 A;  1NTZ H;  4OGQ C;  5JCO C;  1NVO A;  1HNZ B;  1RF0 A;  5EYP A;  3H1L J;  3AEI A;  5KJ7 D;  2E3C A;  4EDF A;  2NNU A;  4B3M B;  1K9M Q;  1KTM A;  3K5N A;  3JYC A;  3W7U A;  2YKO A;  4C7N B;  2W6B A;  3CX5 D;  3GWK C;  1M56 C;  1R73 A;  4I55 A;  2PYJ A;  1PNL A;  1N73 C;  3DC6 A;  1NKN A;  3H1L E;  3T1H O;  1G4Y B;  4FM1 A;  5C8Y A;  4EB6 A;  4Y28 J;  2B1G A;  2FYU H;  4I4T A;  1NTZ G;  4QIW F;  4IFD K;  2CTQ A;  2M0B A;  5DN6 G;  3AK2 A;  4DR5 B;  4LF6 B;  2EIK B;  4L87 A;  3FAV B;  2JWA A;  3CCJ V;  1E79 H;  1LT9 B;  3B5N D;  4IFF A;  1FZE A;  3M9B A;  4RUE A;  3SR2 C;  3OAA G;  5IE9 A;  2DE0 X;  3KG2 A;  2LGW A;  3FYE B;  4DR2 B;  3EQ2 A;  2A3Q A;  2OCH A;  3B40 A;  1GRJ A;  4O2B B;  3ZRV A;  1JTH B;  1IFN A;  4LP8 A;  2BCC H;  4I0X B;  4YJ2 A;  1BHB A;  2ATK C;  2YDE A;  5CBH A;  3VMZ A;  3CC4 P;  4NTW A;  4FZ0 A;  2IJH A;  1KOR A;  1UFI A;  1JCD A;  4UCV A;  1ZRT D;  5H6R A;  3HE4 B;  4B7E A;  4JTD B;  3ZHT A;  2PGG A;  3D6Y A;  1QQC A;  5CCG A;  3H1H D;  5B5E E;  2YMK A;  5EBM C;  2CUG A;  1EM1 A;  4PV1 D;  1MSW D;  3GF3 A;  4JI5 O;  3TCU A;  2W0F C;  3WU2 E;  3W7W A;  4F4L A;  1PP9 E;  3W68 A;  1SQQ K;  1YIJ V;  4IFM A;  3HB3 B;  3K5M A;  4C7U A;  1RM1 B;  2BSK B;  5K1X A;  2VQF O;  3GHG A;  2QTO A;  4WBN B;  1CXZ B;  1ORQ C;  1Q43 A;  4DV2 O;  3AG4 B;  3FGA D;  3SWF A;  3Q1M A;  2QWN B;  2IBZ D;  1V9P A;  2B9Z A;  4WB4 A;  1FOS E;  4OVN F;  4DR1 B;  3TGU J;  2RMZ A;  1I5X A;  1YCI A;  3WUU A;  3I5C A;  2OAR A;  3STL C;  2ZR3 A;  2WLL B;  3K9A A;  1XMO B;  2MJZ A;  2AW9 A;  1YJ9 V;  2I1K A;  1YHQ V;  1K97 A;  3B5N C;  4C7N A;  2IDB A;  1XTC C;  5KHG A;  1HJ0 A;  3TGU E;  3E8G A;  5FLX N;  2BAS A;  4QPK A;  1N8R W;  1X59 A;  4DUY O;  3CWB G;  2ZQM A;  2P10 A;  1IBM O;  2HHH O;  2N74 A;  5KHK A;  3IN6 A;  2XND G;  5A9G A;  3B2E E;  2HFE D;  2LKM A;  3RYI B;  3A5T A;  2M3E A;  1SQQ H;  1NQT A;  2XAJ A;  3TET A;  4MVS A;  4JV5 B;  3L73 J;  3HUS B;  3FAV A;  5IWA B;  1IBL B;  1S5L E;  4GIF A;  2Y48 A;  2PY5 A;  1FS0 E;  1Q6I A;  4DCK A;  1IFM A;  1LT9 A;  2E75 B;  1H2L A;  3J7A U;  2Q7C A;  3ZHS A;  1N8R Q;  2F4V B;  1WB8 A;  5KUK A;  4B3S O;  3L73 E;  1GM8 A;  4O2B A;  3T2M A;  4N78 D;  1JTH A;  2QEX P;  5JVD B;  3OA7 A;  4IYI A;  4IOI H;  4J80 A;  3SPG A;  4I0X A;  3H1K D;  1K5Q A;  4GDO A;  3H1J H;  2LW7 A;  4W4K A;  1N7S D;  3WB1 A;  5KA5 A;  2DMX A;  3GLM A;  3HE4 A;  3L75 J;  3PH0 A;  2ZIM A;  3L9D A;  3OUF A;  4DUZ O;  4UCU A;  4TOI A;  3RWR D;  5BY1 A;  2PF4 E;  3IF4 A;  4L73 A;  2K37 A;  1J95 A;  5EK0 A;  3A0B E;  1FC2 C;  1BSH A;  5APT A;  4YHH O;  2E74 D;  4JAV A;  3T4Z A;  2D2C D;  4AYC A;  2RH0 A;  5AVW B;  3U1A A;  5DJU B;  2ZXW C;  1EZV H;  3E83 A;  4D6T G;  2BSK A;  1KN7 A;  4GKJ B;  1D7M A;  3H32 B;  3RK2 B;  4WBN A;  3L71 G;  2ZE5 A;  4UVA A;  2GTA A;  5LXT B;  4J41 A;  4JTC B;  2I8D A;  3AG1 C;  3STZ C;  1I08 A;  4TT3 G;  4W80 A;  1NU1 G;  3IR9 A;  1EBO A;  4K3A A;  2WLL A;  2IPP A;  1L4A B;  4H0L B;  1PV3 A;  2JVD A;  1PPJ H;  2CE4 A;  4ABM A;  1OWA A;  1H2G A;  1EZV G;  3HR0 A;  1NKZ B;  3B77 A;  3D8C A;  1WB7 A;  1FZG A;  1RF1 C;  4DZO A;  1YEW A;  4YIO A;  4F6R B;  4FLT A;  1CP9 A;  4LFA B;  1MV8 A;  1RFY A;  5JJE B;  1GK4 A;  3Q5S A;  4GX2 A;  3UM7 A;  3RYI A;  1THZ A;  5L3D A;  5LGT A;  1IC2 A;  2UUC B;  3ASN B;  3HUS A;  3CC4 V;  4J42 A;  4O4I A;  4QNH B;  1EDL A;  3ZRS A;  4DV3 O;  1SQP G;  1PPJ G;  2N9Y B;  1VQN P;  2E43 A;  1JJO A;  4J11 A;  1IK9 A;  2WPD G;  4GOF A;  2XUM A;  3HKC B;  4NPF X;  4JI0 O;  4LF8 O;  1EN5 A;  5JVD A;  1YTF B;  2E5T A;  3K06 A;  2N05 A;  1RE4 C;  5B1B B;  5AVS B;  4EI2 A;  1FD9 A;  1R3J C;  2JGU A;  3K0G A;  3UQ8 A;  1ZLZ A;  2GTS A;  4UFZ A;  4BWA A;  2P7J A;  5LMU O;  1QVF U;  1P7G A;  2EIL C;  3OR7 C;  1WLE A;  3PLN A;  3GVM A;  1BQZ A;  2OT5 A;  2E76 B;  3CLQ A;  2F95 B;  4PD4 E;  1DEE G;  1LWU C;  1K3E A;  3X2Q B;  4L76 A;  1VQ5 P;  4YTP C;  2H8P C;  3ZN1 A;  2IH1 C;  1GAX A;  4J7K A;  1SQV J;  4NTX A;  4LR3 A;  3QO7 A;  1KYO E;  3AG3 C;  1J1D C;  5AVQ B;  3H32 A;  1KEC A;  2DWD C;  3H01 A;  4I7Z B;  4JYC A;  4YY3 B;  2KLV A;  3K9S A;  3FX7 A;  4DW1 A;  1PKX A;  1WJZ A;  1AQ5 A;  1SQV E;  2FYZ A;  3E8B A;  3A7O A;  5LXT A;  1BSN A;  4FMT A;  4LWS B;  1FXK B;  1Z5V A;  4NR1 A;  4CC6 A;  2RN0 A;  5GON B;  1RE3 A;  1QVF O;  3RK3 C;  1L4A A;  1KC8 W;  1N0N A;  4K8X A;  1URQ B;  3FWL A;  2A45 G;  4NKG B;  3O65 A;  1SQB G;  2Q5U A;  1FPO A;  4PI0 A;  3JSN A;  1KUQ A;  3K03 A;  1XNR O;  1GN2 A;  4WFF A;  3Q3D A;  1N36 B;  4ASU G;  3QTC A;  1GL2 B;  3H25 A;  3CRA A;  1Y76 B;  2QSA A;  4BW5 A;  1FZB A;  4F6R A;  5APV A;  4BWN A;  1L0N E;  4MSW C;  2W83 C;  5FPR A;  2G3A A;  1VIB A;  4WY4 B;  1Z5W A;  3K58 A;  1XL6 A;  1VQ6 P;  4DV7 O;  2UXD B;  1B3Q A;  3CWB J;  1KQG B;  1KC8 Q;  2IFN A;  3RBX A;  4X64 O;  1GMJ A;  1XDC A;  2OWO A;  5BR8 B;  3K79 A;  3BY6 A;  1SFC B;  3HD7 D;  4HH2 A;  3JD4 A;  1ZUQ A;  3J81 N;  4QMA A;  4HB1 A;  5AW1 B;  2KSJ A;  3HKC A;  2A06 E;  4N23 A;  2YXL A;  3AK1 A;  2WLN A;  4P30 A;  4BIO A;  1EN6 A;  2VQE B;  5H2F Z;  2AXC A;  1FBM A;  4CBC A;  3L72 G;  3S3X A;  3S3W A;  1MA1 A;  1FOS F;  2WSE H;  1JOY A;  1BCC D;  3MP7 B;  2BTO A;  1Y66 A;  1Y6X A;  2VRS A;  3N27 A;  3JSL A;  1JMM A;  3WG7 B;  2HG5 D;  2WPQ A;  2C2A A;  2IZ0 A;  2YKQ A;  4J9Z B;  3N7N A;  1XUQ A;  1H0T B;  1COW G;  2W6J H;  2RCV A;  2K9J B;  2LQT A;  1BDD A;  3P7K A;  3CE2 A;  4OXS A;  5ITZ B;  4DR4 B;  4CC5 A;  3MHV A;  5KLV D;  2YUA A;  3CSX A;  4MTF A;  3SFE C;  2WMM A;  3E22 B;  2QWO B;  1GN6 A;  4GOE A;  4AIL C;  1BS3 A;  1G8M A;  3JAL B;  2HPC B;  2Q73 A;  2HVK C;  4D6T J;  3V5B A;  1FAV A;  3CRQ A;  4LWS A;  1FXK A;  2DQ3 A;  4GT1 A;  3SJC C;  3U11 A;  2ZM6 B;  1LTJ C;  3L71 J;  5H2F H;  5GON A;  2W6J G;  1EDJ A;  2AHZ A;  1EDI A;  1SKV A;  1H89 A;  1URQ A;  1KKC A;  4JI6 O;  3DGE A;  4D6T E;  2M5A B;  2ZE6 A;  2EIN C;  3L75 D;  3ZHR A;  1NU1 J;  4P2Z A;  1S5J A;  3EXA A;  3L70 G;  1KZU B;  3L71 E;  5BU8 B;  1NGM B;  1VQN V;  2QIW A;  1EDK A;  1GL2 A;  3LW5 J;  3K0D A;  3NMD A;  1Y76 A;  2JS5 A;  2WSF J;  5APQ A;  2KXP B;  3W7X A;  4WY4 A;  2X6A A;  4DV6 B;  4C46 A;  3BHP A;  1I94 B;  3H1L H;  4JYY A;  5AW5 B;  1XNQ B;  4TSF G;  1OXZ A;  3OR6 C;  3E2E A;  4DR7 B;  4PA7 A;  2HOD B;  1VMG A;  4PDM A;  2CTR A;  1AVY A;  2L35 A;  3CB2 A;  1SFC A;  3WU2 Z;  1U57 A;  5CCH D;  1N32 B;  2W90 A;  2WZ7 A;  4RO2 A;  2HP8 A;  2WTY A;  1VQP V;  3I56 V;  4JI2 B;  1ZX3 A;  2EX3 A;  3OJA B;  3F7Y C;  3B09 A;  3N4X A;  3HUS C;  3G4S P;  1AQT A;  1GZL A;  1JOC A;  2O01 N;  1Q6U A;  3KQG A;  1NOH A;  1VQ5 V;  1CPY A;  1WPB A;  4NXM B;  2YO3 A;  1HW7 A;  1BE3 J;  1EZV I;  1XHX A;  4JPZ B;  5CBG A;  2IJI A;  3H1L G;  4KJM A;  1H2N A;  1H38 A;  1NH4 A;  2KS1 B;  5LGU A;  3CME P;  1FJK A;  1QNM A;  2ZXX A;  4FLX A;  1NBM G;  3SFD C;  3APQ A;  3LSQ A;  1OIP A;  1XRE A;  1OZ0 A;  4PJ0 E;  3G67 A;  2ZDI A;  1BE3 E;  1H0T A;  2F66 C;  1AI6 A;  4ZIB A;  3PRJ A;  3ZDM A;  4LF5 O;  3CMA P;  2GUZ B;  4L74 A;  2UXB B;  5ITZ A;  3WU2 H;  3R65 A;  3JAT B;  5KHI A;  2OIE A;  3E22 A;  4DV0 O;  2RNB A;  2BEZ F;  4OX9 O;  3M06 A;  1VF5 D;  3JAL A;  4IGG A;  4DR3 B;  2BOC C;  5APX A;  2HPC A;  1HDJ A;  1J1E C;  1NTZ D;  2JS3 A;  1ZW0 A;  4MTX A;  2QM7 A;  2H94 A;  1MNG A;  5CB4 B;  3OTO B;  5KHH A;  2KUB A;  3ETQ A;  4X65 B;  1BDC A;  2HJD A;  3DXR B;  3ETG A;  2QGN A;  3IFM A;  2ZXE B;  5KLV K;  2LJ2 A;  3D36 C;  4AHC A;  3OD4 A;  2M5A A;  4EYY Q;  5KAF Z;  3ABU A;  1Z56 A;  1RH5 B;  3C3T A;  1ZRT E;  2QG4 A;  4K0K B;  1S77 D;  1PP9 G;  2LP7 A;  4PV1 B;  2XHB A;  1SQB J;  3TGU H;  4QJF B;  5KX5 B;  3AE1 C;  4RO0 A;  4JI3 O;  1W59 A;  1BCC H;  2XOK G;  4DV1 O;  3R2P A;  1YJW P;  4TV9 B;  4PD4 F;  1YIT V;  2ITA A;  1AR5 A;  2HOD A;  3CS5 A;  1SZX A;  1SQB E;  3ZX6 A;  3U0Z A;  2HR3 A;  2AHY A;  2DQ0 A;  1R5S A;  2O01 J;  2ETN A;  3FFQ A;  4TQF A;  1B06 A;  1N33 B;  3M9Q A;  2YIU C;  3MHH C;  1QLE D;  4I1L A;  3SPI A;  4LF7 B;  3DSQ A;  2IJK A;  5JH7 B;  2BCC D;  2IBZ E;  3VP8 A;  4IL6 X;  2VS0 A;  1BZK A;  1F51 A;  2QJY C;  1J5E B;  5AVZ B;  3CC7 P;  3TGU G;  5GTH Z;  5KJ7 A;  1AP5 A;  3L73 H;  4DR1 O;  1GH6 A;  1N34 B;  1NTK G;  1MG1 A;  2PZS A;  2PP6 A;  5KAF H;  2CPB A;  1VF6 C;  1US6 A;  2GBO A;  2KS1 A;  1JA8 A;  2DWE C;  1O9G A;  2IW5 A;  2Q5Z A;  3ZRX A;  4Z1M G;  1FKA O;  2X0L A;  4PA4 A;  4AUW A;  2UUB O;  4GKG A;  4JYB A;  3WUT A;  3RL0 D;  3LDD A;  3BAT A;  1IBK O;  4UVB A;  1KIL D;  1UJW B;  2UUA B;  1FS0 G;  1OV9 A;  2GUZ A;  2Q1K A;  3IJ4 A;  2JEE A;  2N1T C;  3L75 H;  3JAT A;  1HR0 O;  1AI4 A;  3BVO A;  3TNU B;  1F23 A;  1G2C B;  2PAJ A;  2QVA A;  1KBH A;  1HH0 A;  4X89 A;  1PV0 A;  1NAY A;  3CEI A;  2YXQ B;  3KPE A;  2O57 A;  2F4V O;  4U3J B;  5CB4 A;  1M57 C;  4U7J A;  5GTH H;  4N78 E;  2RN9 A;  3DXR A;  2YI9 A;  1YQ3 C;  1U97 A;  3OUS A;  1M1J C;  1HNW O;  1BSM A;  4I9W A;  1MZ9 A;  1M56 D;  1N7S B;  2WSS H;  2E5Y A;  4HJG H;  5EIB C;  1VQ8 P;  5A2Q N;  3K04 A;  1K73 W;  4JI1 B;  2A9H A;  2C0W A;  2F23 A;  1NTZ K;  1R5L A;  2EIM B;  3AEA C;  5IYC O;  5HFL A;  1T6A A;  2ZYG A;  1DK1 A;  1IXM A;  2E74 B;  2KG7 B;  5KX5 A;  2D2C B;  2QJP C;  4Z1V A;  3NFQ A;  3G71 P;  3L70 J;  2M3B A;  4WFH A;  1V55 B;  3G6B A;  4TV9 A;  1KFN A;  4UV8 A;  3KKY A;  3ABL B;  4XBF A;  4X88 A;  1SER A;  4I2L C;  1K73 Q;  3EFF K;  4Y99 C;  1H88 A;  2EZO A;  1L1F A;  2P22 C;  1K04 A;  3CME V;  3L70 E;  2Q3E A;  3AE2 C;  2B1I A;  1VEW A;  4CH3 A;  4GKJ O;  3CCL P;  2CK3 G;  2F1M A;  2XTA A;  4K35 A;  5JH7 A;  4E4E A;  2KYV A;  5J2U B;  2A0L A;  4MW3 A;  4HAM A;  4LLH A;  3ZIA G;  2Q67 A;  3ABK C;  1LTS C;  4R8C A;  3RGB A;  1PZQ A;  2FXM A;  1NTM G;  3ZED A;  3CCQ V;  1H2K A;  2Y4U A;  2DYR B;  4YPC A;  4DT0 A;  1R8E A;  1SQG A;  3JCU E;  1NU1 D;  2Y0E A;  3DTU B;  1IK7 A;  1AJP A;  2LW1 A;  2P4V A;  4JI8 B;  4FFK A;  3N2K B;  5CHX A;  1EZV D;  1XQ8 A;  1KB9 I;  2AZ0 A;  5E79 E;  5FNV B;  2IU0 A;  4X9Q A;  2PRR A;  1Q90 D;  1P84 E;  3TNU A;  1Q82 W;  5CA3 A;  1G2C A;  3P8C D;  3QWO C;  2OTL P;  1HGZ A;  1S4X A;  5IY5 B;  4MVZ A;  1OCO C;  3RYC B;  1Q2N A;  4JGS A;  1K8A W;  2KLU A;  4U3J A;  4GX5 A;  5K1P A;  1W2E A;  3L74 G;  4B3R B;  1SQV H;  1SQP D;  1PPJ D;  1PGO A;  3LDC A;  3LUT B;  2DYS B;  1N7S A;  1Q82 Q;  2IU3 A;  1EXJ A;  1T5E A;  4LF4 B;  2HEP A;  4UV9 A;  1FXV A;  2JRI A;  3LID A;  5F2V O;  3II6 A;  4MVU A;  1WP8 A;  1Y9B A;  5KAI E;  2FFD B;  1H8A A;  1K8A Q;  3ZN0 A;  2EIJ C;  4CH5 A;  2KG7 A;  3C1L A;  4U3F G;  2Z3Y A;  1OJH A;  3ZRW B;  1OMI A;  1ZN5 A;  3CCV V;  3FWN A;  3FB6 C;  1OW6 A;  4I9Q A;  1PP9 J;  1SS1 A;  3CC7 V;  4JI7 O;  1SQV G;  5K5G B;  3TJT A;  1K33 A;  1NJI W;  2AEF A;  2YEV B;  3V6I A;  2NPS C;  1HNX O;  1VQ9 V;  3TXS A;  3PTZ A;  2FB5 A;  3CYO A;  4QE9 A;  1FJG O;  3QNE A;  5J2U A;  1O9H A;  3GG2 A;  2OQQ A;  5JWP A;  4HKZ H;  4CS4 A;  1JX9 A;  2E5L B;  3CWB H;  1RPO A;  4FVM A;  3GW6 A;  3D3I A;  5DEC A;  5AVX B;  1SET A;  3BEH A;  2RQ6 A;  3UT5 B;  1NJI Q;  2XND H;  4IYH A;  4CH4 A;  1L0N G;  4H13 C;  1EQ7 A;  4D7T A;  3A0H E;  1OCR B;  1NS1 A;  1T2K D;  1NTK J;  2P1J A;  4FLV A;  3OGC C;  4WF9 V;  1KMI Z;  2XAQ A;  2G38 A;  1FZC B;  3N2K A;  1ENV A;  3KZI Z;  2QWP B;  5H6Q A;  4EEQ A;  2H89 C;  5FNV A;  5APU A;  4KHP B;  1YSC A;  5B3S C;  1QU7 A;  3RVZ A;  1NTK E;  4UB6 E;  1ZWI C;  4DV4 B;  1MAB G;  1VQ8 V;  3HD7 B;  2A06 G;  1NU1 K;  2ZVN B;  2JJ2 G;  1A32 A;  5BR8 O;  2QDO A;  4G28 B;  3RYC A;  1E5W A;  4JTA B;  4UB8 Z;  1JPX A;  4EIJ A;  4LNU B;  3G71 V;  5FPO A;  2GUS A;  2VQE O;  2ZT9 C;  1SQX J;  3MUD A;  1Y74 B;  1RSO B;  4NPE A;  2YNY A;  4PDL A;  2FML A;  1R3K C;  3F7V C;  4R7C A;  2FFD A;  4D6T H;  1JM0 A;  4B3T O;  2WLH A;  1XTG B;  3L72 D;  4JI4 B;  3CXC U;  3RN4 A;  3CCL V;  4MVO A;  1I7F A;  1SQP K;  3KZI H;  1SQX E;  3L71 H;  3ZRW A;  5C93 A;  5B1O A;  1LTG C;  2CTP A;  3S9O A;  4UUJ C;  4DOJ A;  3AG2 C;  2QE7 G;  4PJ0 Z;  4GX0 A;  3UO2 A;  1XMQ O;  1FFX B;  1OFC X;  1AI5 A;  2XKM A;  4I5S A;  1FDM A;  2OYI B;  5CBF A;  4TT3 H;  1NU1 H;  2H3O A;  1T2K C;  2YEV A;  2R9A A;  4ZHQ B;  1WT6 A;  1JEK A;  3OMN B;  1K05 A;  3D3Q A;  3LW5 H;  1OW7 A;  3LNM B;  4JF7 A;  4UB8 H;  2HLD G;  2N9B A;  3SPH A;  2WSF H;  1IFP A;  3E7K A;  2V7Q G;  3ZMZ A;  1JY2 O;  3D71 A;  1OCC B;  1XHZ A;  1R3I C;  4EFE A;  1OCZ C;  2ZM6 O;  1WMK A;  3E8F A;  3H6P A;  5AVY B;  4R4M A;  2EJ7 A;  3UT5 A;  4RKU J;  3ITK A;  1BGY G;  3A2F A;  3JD1 A;  2GUV A;  2FL4 A;  3JAW B;  2R9I A;  4H44 B;  5GTI Z;  2EZP A;  4FLU A;  2GA1 A;  5AW3 B;  3W7S A;  2OTL V;  2XAH A;  2FKX A;  3P3P A;  3T1Y B;  1QEX A;  1YI2 P;  4UCT A;  2ITC C;  2H8P D;  5AVT B;  2JEX A;  5CCG D;  1R6N A;  5LYJ B;  1FZF A;  1SQP H;  1NTM J;  1Q86 W;  1UII A;  1FZC A;  3HKD B;  4R50 A;  3BVH A;  4PI2 A;  4PJ0 H;  4WFA V;  1X22 A;  1BE3 H;  1RP3 B;  4LFC B;  1RF0 C;  3HE5 B;  4FK5 C;  1SF9 A;  1IUR A;  3CCM P;  1VQL P;  4NXN B;  3HD7 A;  1NTM E;  3OE7 G;  3TK1 A;  4BW9 A;  3ASO C;  1L0L J;  3VQW A;  4KHX A;  1LNQ A;  3CXH E;  3M91 A;  1SQB K;  1DEB A;  2M8R A;  1NR7 A;  1Q86 Q;  5EC1 C;  3RK3 D;  2CAZ C;  4JI2 O;  3M0D A;  4JAA A;  2AXT Z;  3RBZ A;  5B1A C;  4LNU A;  5KKZ C;  3CCR P;  1L0L E;  1M90 W;  1URF A;  1QLN A;  5CJ4 A;  1FDO A;  1T3U A;  3E86 A;  1BE3 G;  5GTI H;  4JYA O;  3L74 J;  4CS3 A;  4X66 O;  2PGD A;  1Y74 A;  1RSO A;  3F5T A;  3RL0 g;  2ZIN A;  5JQG B;  4GLX A;  1KB9 F;  3H1L D;  4UCS A;  3T1H B;  1S72 P;  1R1B A;  5J9P C;  1GD2 E;  3L74 E;  1QGK B;  1WNS A;  3LSU A;  3IAO A;  1JQ0 A;  2J5U A;  3B8M A;  3QVN A;  1KQF B;  1M90 Q;  2B88 A;  1IZ3 A;  2R72 A;  1FE6 A;  3K08 A;  1FFX A;  4MVQ A;  1HF9 A;  2UXC O;  4U3F J;  2OYH B;  2OYI A;  4N6J A;  4ZHQ A;  2UXB O;  1VF5 B;  2C9N Y;  4MTG A;  2A45 H;  4LF9 O;  3GF7 A;  5CCG C;  3VP9 A;  5CMZ A;  1SQB H;  2QM4 A;  1USD A;  2GV9 A;  2MK3 A;  4CS2 A;  2AXT H;  2KI7 B;  1AVO A;  2QJK B;  3JC2 2;  4HYT B;  4U3F E;  1VPC A;  1MFZ A;  2Z4E A;  2OCC B;  1QL1 A;  1E1Q G;  2JJL A;  4OPH A;  4PD4 I;  2FBW C;  2Y69 B;  1D2D A;  2JJ1 G;  1V54 C;  2P67 A;  1G1J A;  1JY2 N;  2FYU J;  2O01 H;  3JAW A;  3SYQ A;  3GHG C;  1KYO I;  2ZR2 A;  1NR1 A;  1K92 A;  2WLI B;  4PA9 A;  4GKK O;  1JY2 P;  1GTO A;  3P30 A;  4JI5 B;  1AJY A;  5LYJ A;  1YTZ I;  4DR6 O;  1VDF A;  1YDX A;  2Q9I A;  3AEE C;  1L0N J;  2FYU E;  2XAF A;  1PGP A;  3HKD A;  3AE7 C;  3JCZ A;  4FLY A;  3HE5 A;  3J80 N;  3KHU A;  1VQO P;  1BMF G;  3VOP A;  3K5L A;  4X1K B;  2Y0I A;  2VQF B;  5CCH A;  2IBZ G;  1GU4 A;  3OGI B;  1U96 A;  3L72 H;  3QF7 A;  4DV2 B;  1N2D C;  5L3C A;  2QEX V;  1QLE B;  1CI6 B;  3JAR B;  2WA4 A;  2CTW A;  1UIX A;  2DW4 A;  2BCC E;  2GSM B;  3ZMU A;  3TYY A;  1T8Z A;  4LF7 O;  3THO A;  2Q4P A;  5KMG B;  3GB7 C;  5CA1 B;  4FJC C;  1J5E O;  1IZN B;  1CW5 A;  3MHS C;  3T4D A;  1GMG A;  2EIK C;  3WB2 A;  1LGH B;  5JQG A;  1LT9 C;  3TGU D;  4DUY B;  4JAS A;  4J9Y B;  5LHI A;  1VL2 A;  1IBM B;  3RL0 B;  2HHH B;  4UXN A;  4O9B A;  1KIL B;  2FXP A;  1DLB A;  1AIL A;  3JCU Z;  2FFD C;  1EC5 A;  5CA0 B;  2PUS A;  2OYH A;  2L6L A;  4MN4 C;  4ASV A;  5KTB A;  3K59 A;  3V2P A;  4BAY A;  1BT8 A;  1YTZ T;  5E79 Z;  4OGQ B;  4DO2 A;  1HWY A;  4B3S B;  2GDS A;  3OM3 B;  1YI2 V;  2KNC B;  3H1K G;  2FYN B;  5EZY B;  3L70 H;  3L73 D;  4PDR A;  4KP4 A;  2YXY A;  2YIB D;  2XDJ A;  1M56 B;  3H1I J;  3FD9 A;  1PD3 A;  4LFB B;  3BAB A;  1N73 B;  2V7Q J;  1AP6 A;  1GTW A;  4QE7 A;  4XDJ A;  1RM1 C;  4WBA A;  3FKS G;  2X6B A;  4DJG A;  1BHA A;  4DUZ B;  3R4Y A;  1AVM A;  3HPL C;  3EVK A;  2WLI A;  4JI1 O;  3AG4 C;  3Q2Y A;  2CH7 B;  1NVP B;  1KB9 H;  3H1I E;  1BGY J;  1HJB A;  2NR5 A;  5AVV B;  3JCU H;  1BL8 A;  1USE A;  2ZAE B;  1SQQ E;  5AW6 B;  3EHB B;  5IT9 N;  4JQ0 D;  2F43 G;  3CCR V;  2G8Y A;  2HLO A;  1VP7 A;  1M1K W;  4X1K A;  5DJT B;  3ABM B;  1BGY E;  3C9I A;  2K9Y A;  1FZC C;  2KOG A;  3IAY A;  3RFR A;  3L37 A;  5B5E Z;  1SVF A;  5BMV B;  1CI6 A;  2P4K A;  3I5D A;  3JAR A;  1P4R A;  1MOF A;  1FDI A;  3BCC J;  2XT9 A;  4RQE A;  3ETE A;  2ZVO B;  3H1J E;  2QTS A;  1H8E G;  4CH6 A;  5KMG A;  4PA6 A;  3EFG A;  1M1K Q;  5CA1 A;  5AW4 B;  4IT5 A;  2BE3 A;  1LTA C;  3BCC E;  4XFJ A;  2YO2 A;  2WA3 A;  2E75 C;  2F93 B;  4YXD C;  5LHH A;  4GZR B;  1YJN P;  4O2A B;  3JD3 A;  1HNZ O;  1LUV A;  1KIL A;  2L91 A;  2OTK E;  4RAI A;  5D5Q A;  3AE9 C;  3A0H Z;  3ZHU A;  1R3L C;  1PL0 A;  4B3M O;  3CX5 E;  1VQM P;  5CA0 A;  1JFF B;  5L3F A;  3ZHV A;  2LXB A;  4DV3 B;  4LH7 A;  2K9J A;  5B5E H;  2Y0C A;  1NTK K;  2V1D A;  5JCO A;  4PHZ A;  1B04 A;  5JJN B;  3AED C;  2KNC A;  5M1B A;  2KP8 A;  5EZY A;  4BIZ A;  4P9O A;  4JI0 B;  4LF8 B;  1KQL A;  1RQV A;  3MZW B;  3CXH F;  1PP9 H;  1ZP0 C;  2QJ1 A;  1W0K G;  2QWQ B;  1D5A A;  5LMN B;  4DR5 O;  4LF6 O;  3B5N B;  4PDV A;  4YXW H;  1N73 A;  3SDL A;  4G2K A;  1WPX A;  1VQO V;  2W27 A;  2W6A A;  4OH8 B;  1JNM A;  1S5L Z;  4DRX B;  2WPS A;  1YZB A;  3RK2 C;  4DR2 O;  3M99 B;  3LIE A;  2FKW B;  4FPP A;  3H1H J;  2CH7 A;  1N7L A;  2ZD9 A;  1VQ6 V;  5BVZ A;  3A0H H;  3CPW U;  3HKE B;  3MDS A;  4PD4 D;  2Y9Y A;  2KSD A;  3CRC A;  2N1T D;  1VF7 A;  4H44 C;  3AE8 C;  1WN7 A;  2EUL A;  1ZLL A;  1RE3 C;  5APY A;  2WWW A;  1KP3 A;  4HNA B;  1ZAU A;  3WB0 A;  1L4A C;  3H1H E;  4H0L C;  1DF5 A;  1AI7 A;  1KYO D;  4LC1 A;  2X7R B;  1JY3 N;  4PEL A;  4YXW G;  1MZE A;  1TUB B;  4HBN A;  1NTK H;  3A0R A;  3BRT B;  1JO5 A;  5LBQ A;  1PGQ A;  5BMV A;  1M57 D;  3TF5 A;  1QX8 A;  4WFB V;  1SQV D;  3C8V A;  2UWJ E;  1JY3 P;  1M4U A;  3A0B Z;  4Z1M H;  2B5U A;  2EJR A;  3SYP A;  2RKL A;  5EIB D;  2YID A;  4K8Z A;  2JGD B;  4N3Y B;  1KYO F;  2IM9 A;  2KB1 A;  1S5L H;  3CCS P;  3ASN C;  3AEF C;  4QPJ A;  1JMB A;  3CPW O;  2A45 I;  1AJQ A;  3ABV C;  1QHT A;  3KXD A;  1IX9 A;  3HRN A;  2Q3I A;  4O2A A;  5L8R J;  3CHX A;  4ZI7 B;  3W67 A;  1SES A;  2J58 A;  2QKA A;  2ZXW B;  3TXQ A;  1XMO O;  3GWO A;  3LDE A;  1DTO A;  4DV7 B;  2Q6Q A;  2IBZ I;  3ABT A;  4X64 B;  1SQX H;  1TAE A;  2CDY A;  5B1B C;  3RYH B;  1JFF A;  3ZMT A;  1ZSP A;  4UCO A;  4DV4 O;  1T3J A;  3AG1 B;  1H2S B;  3A0B H;  4NPD A;  4KFM A;  4YIP A;  5IDJ A;  1B6Q A;  4D7S A;  3CWB D;  5IYZ B;  3CRM A;  4KUM A;  3KYQ A;  2E76 C;  1J2J B;  4FM2 A;  4RJT A;  2ITD C;  3X2Q C;  1YQ4 C;  1XIL A;  3B5N A;  2BEQ D;  4JV5 O;  5TIS E;  3V2Q A;  5IWA O;  2B9B A;  1IBL O;  4ZBM A;  4MT8 A;  3AEG C;  3U1C A;  4ZKI A;  4L8J A;  1IJD B;  5EYP B;  3H1K J;  2QJK C;  2JIZ G;  4DRX A;  1HP8 A;  4JZG A;  1RF1 B;  2OCC C;  3IC9 A;  1SQX G;  4I7Z C;  1A02 J;  4W7Y A;  1NI8 A;  2VWJ A;  3AE6 C;  2Y69 C;  5H9C A;  3B8N A;  4JF3 A;  3L4F A;  2FTK A;  3H1K E;  3HKE A;  2J59 M;  1JCC A;  3KCX A;  2PFX A;  4JI4 O;  1FXK C;  3SPC A;  3AE5 C;  2CK3 H;  4LCU C;  2OTJ P;  4HNA A;  3SJB C;  3TDK A;  3CC2 P;  1URQ C;  1XOU A;  4LH6 A;  3IC7 A;  4I4T B;  2NLJ C;  4WVZ A;  2O1J A;  1ZV8 A;  3NR7 A;  1YHQ P;  2Q7H A;  1TUB A;  4NB5 A;  3G4S V;  1HVV A;  2WSE J;  1PGJ A;  3L36 A;  2O1K A;  2Y4T A;  1NAF A;  2WQY C;  4TWK A;  1JJ2 U;  1NTM H;  2Q0A A;  1GL2 C;  3OW2 U;  5LP6 B;  1YJN V;  2AGA A;  1YXB A;  2K1E A;  1KD1 W;  3E35 A;  1Q7Y W;  3CXH H;  4RES B;  4WY4 C;  1RHZ B;  2ARH A;  2JGD A;  4LGD E;  3OT7 A;  5E1A C;  4JI6 B;  1DD4 A;  1MUU A;  5AVR B;  2EIL B;  2P06 A;  3E8H A;  1M8O B;  2DW3 A;  5DED A;  1VQM V;  2NZ2 A;  4D6T D;  2DN9 A;  1SFC C;  4EKW A;  1L0L H;  3IFX A;  1S76 D;  1SQV K;  1LWU B;  4MVR A;  3L71 D;  2Z5H A;  4R4L A;  1QVG U;  3CMA V;  1QL2 A;  4ZI7 A;  1SS3 A;  3M0A A;  1KD1 Q;  1P49 A;  3FXE A;  3EWK A;  1J1D B;  2Z5I A;  2W6I G;  2P7T C;  5FL7 G;  1D5N A;  3P3N A;  5B66 E;  2LGQ A;  3L74 H;  3RYH A;  2NPS D;  1HTL C;  3D6Z A;  3AG7 A;  2QR4 A;  3OW2 O;  2V4D A;  2ZE7 A;  4NXN O;  3PHL A;  1OVU A;  3WG7 C;  3RYF B;  3JSV C;  4LFA O;  3LNN A;  1L0L G; 
#chains in the Genus database with same CATH homology
 1K05 A;  1OW7 A;  2ZT9 B;  2E74 C;  5L8R J;  2JP3 A;  1AJY A;  1Y9B A;  2D2C C;  1FDI A;  3SFD C;  3AEE C;  1EXI A;  3FGA D;  3AE7 C;  3D71 A;  3Q1M A;  3G9R A;  4H13 D;  1OMI A;  4U7J A;  3T97 B;  1OW6 A;  1WMK A;  2FYN C;  1YQ3 C;  4R4M A;  3Q5S A;  4RKU J;  4XFJ A;  4H44 B;  2E75 C;  4YXD C;  4PV1 C;  3AE4 C;  2BEZ F;  3AEA C;  1VF5 D;  2IDB A;  2E76 C;  1HJ0 A;  2H88 C;  3AE3 C;  3AE9 C;  1UIX A;  1YQ4 C;  2BEQ D;  1DIP A;  2OQQ A;  1DD3 A;  2E74 B;  2D2C B;  2P10 A;  2QJP C;  3AEG C;  3RK3 E;  3D70 A;  2QJK C;  4KT0 J;  1ZME C;  4OGQ C;  3IN6 A;  4I7Z C;  4H44 D;  3AE6 C;  1PL5 A;  4H13 C;  3SFE C;  1K04 A;  3AED C;  1VL2 A;  1ZRT E;  4H0L D;  1KTM A;  5M1B A;  3AE2 C;  1ZOY C;  1PIX A;  2E75 B;  2FXP A;  2ZT9 D;  1RQV A;  4PV1 B;  1KMI Z;  1ZP0 C;  3AE5 C;  1OW8 A;  2WPV B;  5KKZ C;  2E76 B;  3AE1 C;  2H89 C;  3Q5R A;  1VF5 C;  1TU3 F;  1FDO A;  4YTP C;  1RQU A;  3B71 A;  4Y28 J;  2WSE J;  1S5L X;  4GDO A;  3RL0 g;  1S1C X;  2WQY C;  4OGQ B;  1R8E A;  1NYH A;  1MKM A;  4I7Z B;  2O01 J;  3GLM A;  1NGM B;  1IK7 A;  2YIU C;  4H13 B;  2QIW A;  3LW5 J;  4H44 C;  3IAO A;  3AE8 C;  2J5U A;  2WSF J;  1DD4 A;  4IL6 X;  1KQF B;  2QJY C;  3GMA A;  4H0L C;  2NZ2 A;  2E74 D;  2D2C D;  1KIL E;  2V7Q J;  1HF9 A;  1JB0 J;  1Q90 D;  3Q5P A;  2ZT9 C;  3AEC C;  4OGQ D;  3R4Y A;  1VF5 B;  4R4L A;  2MKV A;  1U57 A;  5KLI C;  3GF7 A;  1KOR A;  3C8V A;  3Q2Y A;  2QSI A;  4Z1M H;  3D6Y A;  3Q3D A;  3EWK A;  3H25 A;  2YMK A;  2E75 D;  4PV1 D;  3GF3 A;  3S9O A;  2FBW C;  2G3A A;  2G8Y A;  3D6Z A;  2WSC J;  3AEF C;  2E76 D;  3AEB C;  2K9Y A;  1KQG B;  1EXJ A;  4TT3 H;  3O6Q A;  4H0L B;  1GMJ A;  3ABV C;  1PV3 A;  2JO1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...