1VF5B

Crystal structure of cytochrome b6f complex from m.laminosus
Total Genus 29
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
29
sequence length
138
structure length
138
Chain Sequence
LAKGMGHNYYGEPAWPNDLLYVFPVVIMGTFACIVALSVLDPAMVGEPANPFATPLEILPEWYLYPVFQILRSLPNKLLGVLLMASVPLGLILVPFIENVNKFQNPFRRPVATTIFLFGTLVTIWLGIGAALPLDKTL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME B6
publication title Structure of the Cytochrome B6F Complex of Oxygenic Photosynthesis: Tuning the Cavity
pubmed doi rcsb
molecule tags Photosynthesis
total genus 29
structure length 138
sequence length 138
chains with identical sequence O
ec nomenclature
pdb deposition date 2004-04-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00032 Cytochrom_B_C Cytochrome b(C-terminal)/b6/petD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.980 Mainly Alpha Orthogonal Bundle Helix Hairpins plastocyanin oxidoreductase 1vf5B02
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1vf5B01
2E75B 1VF5B 5KKZC 4H44B 2WPVB 2QJYC 4RKUJ 4H13B 4H0LB 2ZT9B 1S5LX 2FYNC 2QJPC 2K9YA 2YIUC 4OGQB 1ZRTE 2E76B 4IL6X 5KLIC 2WSFJ 4KT0J 2O01J 4I7ZB 2WSCJ 1Q90D 2QSIA 5L8RJ 1JB0J 2QJKC 4Y28J 3C8VA 2WSEJ 2QIWA 2D2CB 3LW5J 4PV1B 2E74B
chains in the Genus database with same CATH superfamily
3WUTA 3LSSA 2D2CC 2ITAA 4J9YB 1W0JG 2QJYC 3LDCA 3PP5A 3H1IJ 3MUDA 5FL7G 2HODA 2RMKB 4YJ3A 2Q68A 4KL1A 1XTGB 3ZX6A 4YXWG 1G2CA 3B5NC 3RFRA 3D3IA 5KMGA 2BCCJ 5AVTB 4JI6B 3ZCCA 5B66H 4LLHA 2DYRC 3V2RA 1JTHA 2M5AB 1VQ4P 4DR4B 2ZXWC 3JYCA 2K9PA 4EFEA 4UCVA 4PA3A 2ADQB 3WUVA 3MAQA 1HUCA 1YSCA 3L73H 1XMOB 2IJJA 5D5PA 3ZHTA 1SQPH 1BDDA 2DMXA 2CUGA 1HR0B 1R3JC 1G1IA 1DK1A 4N78E 3L70G 1GZLA 3A3YB 1IBLO 3BVHA 2D2CD 3FWNA 2WLIB 1NTZD 3G80A 2M3EA 3VMXA 2IZ0A 3QO8A 1KQSU 3ASNB 4LP8A 3Q5SA 1KKCA 2KQXA 5GTIE 1B3QA 1E79H 5IY5C 1T2KC 5KHKA 2UXNA 2PGGA 5APSA 3P3PA 1M56C 2UXCB 3RVZA 2KNCA 3CC7V 1Q82W 1LWUC 3TGUJ 4DR7B 1BQZA 3D6ZA 2ZM6B 2BOCC 1N36B 1XDCA 4X64O 2H7HA 5AW3B 2IBZE 1JMBA 3ZJZA 1VQLV 5LMNB 3JCUE 4R4LA 1S9KE 4B3RB 3WB0A 2HHHB 4WY4B 3K5LA 3OD4A 1NAYA 1PD3A 2WSFJ 1TUBB 1KYOI 3RK3D 3FGAD 1PP9J 3T97B 1VQMP 2FYNB 4NVPA 2VQFB 1FXKC 3L74E 2ZYAA 2FKXA 1AQ5A 1ZXGA 2YXQB 1TGOA 4QMAA 1YIJP 1N7SC 1SC5B 4RUFA 3THOA 4CH5A 4LFBB 2J59M 5JCOC 2FYZA 1SFCA 3ZHUA 1T2KD 1VF7A 5L3BA 3ASOB 4JTAB 4Z1MG 4K8XA 1R3IC 1RF0A 1NGMB 2DYSC 2Z0AA 1X22A 3BCCJ 4ZOLB 1R5SA 2HG5C 5CA0B 5TISE 5AVQB 1FJPA 3K04A 5F2VO 1PPJH 1LTGC 1HP8A 3GVMA 4GT1A 4FLUA 3CX5E 2FXMA 2Z5HA 4DR3O 1XMQB 2PP6A 2ZE6A 1FJGB 4LFAB 4PD4D 1VQ7P 1VQ6P 5JJEB 1NWQA 4TLFA 3T4DA 3AEEC 3MHHC 3WG7B 1L4AA 1FS0G 2BCCG 2YIBA 3VOUA 2NPSA 3JARB 3L4FA 4C46A 3G6EP 1N73C 3SPCA 2AXTH 1PNLA 5IYDO 4F4LA 4ABMA 1YJ9P 1Z5VA 3J80N 1N8RW 4OH8B 1YJNV 2OYOA 3A7OA 3FKSG 2QJ1A 4JAVA 2EIMB 1NOHA 1NTZJ 2WTYA 3N2GB 5CCGA 1N7SD 1RQVA 1VQ8P 2QM8A 4JI1B 5BU8B 2JVDA 2V4DA 5CJ4A 1M1KW 2E75C 3B09A 4G27B 3HR0A 4YHHO 4JI2O 2QVAA 2A3QA 1GK6A 2ZD9A 2OQQA 4WFHA 2QGNA 4MW8A 3ABMB 3H32B 3IN6A 3KCXA 2HG5D 5LP6A 1IFPA 4DR1O 3A2AA 5DJUB 4X1IA 1K5SA 5B1BB 4JF7A 2AZ2A 1R6TA 3CRAA 3OUSA 1YHQP 3OA7A 2ETNA 1HTLC 1LTSC 3C90A 2SPZA 1LGHB 1EN6A 1BL8A 1VQMV 2M5AA 4UB8H 3QO5A 3OEHG 2IU3A 3L35A 1X79B 3CX5F 1P84F 4OX9O 1JY3P 3AE7C 4UFZA 5KJ7A 3L73D 1WA8B 4B7EA 1LTBC 3TGUG 1IBMB 1GN4A 2ZDIC 2JS5A 1PV0A 1Q90D 2IFMA 2QEXP 4D7TA 3LDDA 4MTGA 1K97A 1NYHA 4W7ZA 5E79E 1CPYA 1AP6A 2NRGA 2FYUH 2RH0A 3H1HE 2F95B 2FFDC 1D5NA 2UUCO 2YKOA 4JI6O 1QL2A 1WAZA 1TUEB 2FL4A 2R9AA 1PP9G 4YIPA 2MKVA 2YEVA 1ORQC 3E1IA 3G6EV 2HLOA 3Q4HB 1JY3O 3BFRA 4TQFA 3RL0g 4DR4O 1MZEA 3JAKB 2WPQA 1AI7A 3G9RA 1YJ9V 1NTMH 2LJ2A 1KUQA 1NR1A 3IJ4A 1CSBA 5H2FH 2CPBA 4RO0A 2CK3H 1XMOO 1DLBA 3CB2A 1IFIA 4PJ0E 3CPWU 2EIJB 1VQ8V 2WMMA 3HB3B 2WITA 4Y99C 3ABKB 3QNEA 2A45H 5DN6G 2YXRB 3BCCG 4WY4A 1M4UA 1GL2A 2XOKG 2DE0X 3JATA 4U3JA 3BRVB 1F7YA 4R8CA 1AB3A 5KLVH 3V6IA 1ZAUA 2Q7HA 4P9OA 3CWBH 2FXPA 2OT5A 4U7NA 3D8CA 1QVGO 1AR4A 3CHXA 4HYOA 1VARA 1GU5A 2H88C 1NTZK 1YHQV 4K0KB 3L74G 2A06G 1WP7A 3VP9A 4LCUC 4QPJA 1H8EG 1XOUA 2XTAA 3TF5A 1FZEA 4O4JB 2UXCO 2W27A 4FFBA 1SQXH 1GU4A 1Y76B 4DR7O 1ZR2A 1JPXA 4ZOLA 1JOCA 1N36O 1SQBE 5LA6A 3OMAB 1SQQH 1LT9B 3TDKA 2YDEA 3SPJA 3SJAC 2NNUA 5LMNO 4UCOA 1IFNA 1PPJD 1ZV8A 1YQ3C 1GMJA 4B3RO 5B1AC 2HHHO 2JWDA 2Y4TA 4RUEA 1AA0A 2IYOA 1FE6A 1DD3A 5LBQA 3JSLA 3MD0A 1IJDB 3CCLP 2YKQA 1SQPJ 5CBHA 1L0LE 4I50B 1KFMA 1OCCB 2FY8A 1WPBA 2GV9A 2VQFO 1YQ4C 4XDLA 2KZJA 1H0TA 4Q20A 2B87B 3QVNA 4DV0B 4GKJB 1F4NA 3N2GA 4LFBO 2ZIOA 4RAIA 1RE4A 2N1TA 4HB1A 2DQ0A 3T4ZA 4KHPB 4JI3B 3CLQA 4DW0A 1BGYE 1HNZB 4O2AB 2CPSA 3L72H 4DRXA 1JO5A 3R4YA 2E42A 1L0NE 1X59A 3L9DA 3SYCA 3L71E 5IWAB 1XMQO 1R5LA 4LFAO 2RQ6A 4RWUA 1QLNA 4GZRB 3OJAB 1NH4A 1VEWA 4AILC 5JJNB 2Z5UA 3VQYA 3VQWA 2UXDB 1H2KA 4RKUJ 3SFDC 1RF1C 1OZ0A 3H1LH 1EDLA 2OTLP 2HYNA 2XHBA 2BOBC 3JSVC 1AP5A 4H13C 2Q8VA 2ITCC 2FTKA 4JAUA 4NTXA 1Q81Q 4B86A 2Y69C 4KT0J 1DD4A 1WA8A 3W67A 2HLDG 4LNUB 4JI1O 1W59A 3HUSB 3GLMA 4QE7A 1EZVD 2E5TA 1XREA 2QM7A 4X62B 2ZVOB 3FB8C 3KPEA 2L91A 2UXXA 3RGBA 3J7AU 3L75J 2IZ1A 2ZAEB 3DSQA 3CE2A 3FB7C 1IK9A 5APWA 1E1RG 3V4WA 4XDJA 3B5NB 2FYUD 3EWKA 4KP4A 2QKCA 1ZLZA 1KYOF 2AGAA 4P2ZA 3RW0A 2KLVA 1KMIZ 1R8EA 1GM7A 2P7JA 1N0NA 2Q67A 4NPDA 3A5TA 2QKAA 3F7VC 4M3LA 3A0BE 4GOFA 1VQKV 1NTMD 2UUAB 2PI4A 4H13D 2JGDB 4FJCC 2ZQMA 3H1JE 3M9HA 4MTOA 1XBLA 5B3SB 4H44B 4LF7B 1W2BU 1IBMO 2WSCH 5K1PA 3CCSP 3UT5B 1K34A 1SQPK 5E79Z 3APOA 3ZMTA 5LGNA 4L87A 1Y4MA 5KLVD 1JJ2U 4P9PA 3CWBD 2Z4EA 5H9CA 2P10A 2DJVA 3PTZA 3ETGA 2E43A 1CZQA 3VYIA 3E89A 1ZX3A 1SQPG 1VQPP 3H1KH 1OWAA 1NTKH 2P67A 4O4JA 1IDSA 3NXSA 2OTLV 5KAFH 3FAVB 1H2MA 4TWKA 3AE8C 3D36C 2R3SA 3J81N 1AILA 4PJ0Z 1SQXD 2YS8A 1LT9A 3JASB 5CJ0A 2OYIC 5KAIH 1SQQD 1JJOA 4WVZA 3SPIA 3K5BA 3II6A 4LF8B 4PHZA 3BHPA 2ZINA 1RH5B 1EN5A 4B3MB 1H8HG 1I5YA 2YIDA 5J9PC 3G4SP 4I50A 3C3TA 1RPRA 1GH6A 4FLYA 1L0LG 3I5DA 1NH2D 1URQA 2DN9A 4K0KO 4GX5A 4MVUA 4WFGA 3VOPA 1Y47A 2B87A 1NU1H 1GN6A 2ZE7A 3M0AA 5B1OA 3AE3C 5GTHH 1H88A 1NAFA 2AZ0A 2PYJA 4OGQC 2WLNA 4JTCB 1DEEG 4O2AA 4ZMDA 1LUWA 1Q43A 4NPEA 5DEDA 4O4LB 4HYTB 4LFCB 3R66A 3R65A 5DECA 1KILE 3E7KA 4F6RB 3AE5C 5AW1B 1EN4A 3CCSV 2I1KA 5IYZA 2YMYA 1SRYA 2Y0EA 1IXBA 4J41A 3L71G 3HE4A 3L75G 4YJ3B 1N32B 1XL6A 4R7CA 3K59A 2XT9A 1OZHA 1G2CB 4H0LC 3VMYA 3CC4P 2K88A 2GM4A 3ML0A 3H1LD 4NTYA 4XDKA 2G3AA 2XZRA 4FLZA 2NN4A 2IH3C 5C8YB 3MTUE 3RK2C 5GTIH 1VQ5V 4IIJB 1JTHB 4DV0O 4GKJO 1EC5A 2C0XA 3U1AA 5CBGA 2QJKC 5KLVJ 4O2BB 1GTOA 3CWBJ 4LNUA 5A2QN 2HPCB 1MKMA 4KHPO 3HUSA 2O57A 2Q6QA 2F43G 2QM4A 1OIPA 1UPGA 2HJFC 1HNZO 2P1JA 2JJ2G 4G28B 4R4MA 5AVZB 3ZRXA 2IBZH 4CS3A 3L70E 1SQVH 3E86A 3JSNA 4J7KA 2WSEH 3ZN0A 4W4LA 3Q3DA 3I55V 2EJRA 1SQXJ 1XTCC 5IWAO 3B5NA 3X2QB 3M91A 5CA3A 2K9JA 4LH7A 1ZR4A 2X0LA 4GUNA 3VQVA 3ZMSA 2LFRA 4D6TH 1KD1W 2ZIMA 4ICGA 3G4SV 1AQTA 4EOTA 2YI9A 1JEKA 1VIBA 5EIBD 2UXDO 1F51A 1XI1A 1MZFA 2PF4E 1HWYA 2PUSA 4BWNA 2QIWA 1N4CA 2POHA 1DF5A 4H0LD 3SGIA 2QWQB 1UIIA 1VF5B 2JGDA 2IW5A 3AE6C 4PV1C 4DV7B 3K5NA 4EYYQ 3JALB 4AQYB 1WN7A 2KNCB 3ZS8C 1K33A 2Q4PA 3H1JG 3NTNA 4DOJA 2KI7B 2GTAA 2LW7A 4X62O 1IFMA 3DTUB 3K5OA 2VRSA 1WNSA 2Z5IA 5TISH 4I7ZB 1IFDA 2H8PC 1LTJC 3MHVA 5B1NA 4BIUA 1JB0J 2W83C 1M1JC 3BVOA 2CGOA 3CX5H 4FZ0A 1P84H 4IFDK 3CCJV 4X65B 3RN4A 1EDIA 3JD3A 4CH6A 4PA4A 3L72J 3A0BZ 3K3WA 2FYUK 4J10A 1WRGA 2O01H 1MG1A 3CC4V 4L74A 1X8YA 1S0VA 4U3FD 4BW5A 1LWUA 3HKCA 3JASA 2UUAO 1ZRTE 3E8HA 2ZNJA 1SFCB 5APXA 3A0HH 1NTMK 2BE3A 5B5EH 1HBWA 1QU7A 4LF7O 1JY2P 2W90A 1HF9A 4DV1B 4PA6A 3RL0B 1NJIQ 3SDLA 4TT3H 5AVUB 1AI5A 2B5UA 3H1IE 5EZYB 4DK1A 2E5YA 3H01A 2IM9A 2BEQD 1RP3B 4UCUA 2V1DA 1RFYA 1FXKA 4BIZA 3KZIH 1SS3A 3C9IA 2K1EA 4B08A 3BABA 2BCCE 3CCRV 5KLVK 1IO4A 2RJZA 4WCEV 1F4MA 1NU1D 2NPSB 1FOSF 3CCMP 5JCOA 2LQTA 4LC1A 3TJTA 4LF5B 1K5QA 1A32A 2Z3YA 1KB9E 1JY2O 3CWBG 4JYYA 1GK4A 3UO3A 1VF6C 4HAMA 1SQXK 4O4LA 4F6EA 1OW8A 1PKXA 5FNVB 2XNXA 4LF8O 2KB1A 4B3SB 3G71P 1LJ2A 2QSAA 5LP6B 1YTFD 4B3MO 4X1IB 1NVPB 3LW5H 4LF4O 2UUCB 2E5LB 2WSCJ 2KIKA 3AG3C 4UCRA 2HKOA 3SYPA 5C8YA 2H43A 1M5IA 1JX9A 3SFEC 4IIJA 4BRYA 4UVBA 3W68A 4WFFA 4O2BA 4LF6B 5JWPA 4NPFX 4JYBA 2E74B 3ITKA 2HPCA 3WFVA 3E83A 3HKBA 3SYQA 2KYVA 5KTBA 1IZNB 3TGUE 1HJ0A 3B8EB 2GTSA 4EIJA 3H1KJ 3OAKA 3Q5PA 1M9NA 4PA7A 2UXBO 4X89A 1R1BA 3IAYA 3EHBB 1NTKJ 1SESA 4LFCO 4JI4B 2IBZD 4JV5B 1SQVD 3M0DC 4CC6A 3RK3C 4DV3B 2EBOA 2OGUA 1FXHA 1Y67A 4PDMA 3VMAA 1S9KD 1FDMA 3G3ZA 2Q9IA 2DQ3A 1N32O 2CAZC 4D6TD 1HNWB 1EBOA 3HD7C 3FFQA 1BCCJ 3AEBC 1LNQA 1PP9E 4IOIH 3N27A 1V54B 4DCKA 2D3OW 3L72G 1TVKA 4E4EA 2OIGA 2WPVB 1QVFO 4O4HB 1Y6XA 2YEVB 2PZSA 4EDFA 2YIUB 2OYHC 4WFBV 3JALA 2K9YA 1I94B 2VWKA 4IL6X 2WLJA 3AG1C 3AK3A 4IL6E 1K04A 4MT8A 1K7DA 3BCCE 1Q7YW 2R3CA 1ZMEC 1MFZA 1NU1J 1EXIA 1RM1C 1QBZA 4DR5B 1PGJA 3OW2O 1GL2B 2UUBB 1UFIA 3BY6A 3D71A 4RQFA 3JATB 4U3JB 1BE3H 3CX5D 1P84D 3G71V 1KILB 2BEZF 1D2DA 1K3EA 2O01N 1LTIC 1MFTA 2G38A 2OCCC 2A06E 2LXCB 5CN0A 1Y9BA 4FZ1A 3HD7D 5KLIC 4EKWA 3O6QB 2WSSG 3V2NA 2ZE8A 1K8AQ 1VQ4V 4DV7O 2I1JA 5AVXB 1NTZE 3OTOB 4H44D 4AQYO 4FFBB 2PFXA 4I0XB 2BTOA 1KYOH 1PZQA 2C0WA 5LA6B 3WB2A 1T8ZA 1FZCC 1MA1A 1O9HA 3AEAC 4LF9B 3OAAG 4XFJA 1SLQA 2KKWA 1BZKA 4WBAA 3K0DA 4BIOA 2P22C 4DV4B 5EZYA 4FLWA 1S5LX 3GHGC 3F5WC 3H1IG 1FBMA 2Q9LA 2WPRA 4X65O 1NS1A 4UB6H 4CS2A 1YITP 4CPGA 1V55B 5LHHA 1FJKA 1SQVJ 5J2TB 2WSEJ 4J80A 1H0TB 2R5DA 3JAWB 2G8YA 3ABLB 4ZHQB 5HFLA 1NTKK 3K79A 4AQRD 3E2EA 5JVDA 4D6TJ 4I55B 1ZTEA 2N1TB 1I7FA 3KQGA 4PDVA 4DUYB 3KDPB 1K73Q 1GN2A 1XNQB 2HR3A 1E5WA 3LIDA 2Y9YA 5FNVA 2WLLA 1R73A 2CGNA 3BA9A 4DV1O 4DRXB 1H38A 3H1KG 5C93A 3AG2B 1H2SB 2Q1KA 1NTKG 3UM7A 2X6AA 4O9BA 2GDSA 1G4YB 2W0XA 1FFTB 3CXCU 4JI7B 1BT8A 2V4HA 4ZKPA 2WLKA 4IHJA 4QJFB 1PM9A 1R3LC 1VL2A 3V2QA 2VRZA 4MVZA 2F23A 1BCCG 2BTQA 4CS4A 3QH9A 1QLEB 1TA8A 3E8BA 4JI0B 4RO2A 5CHXA 3EXAA 1OMIA 1MNGA 2JEXA 4KUMA 4LF5O 1PL4A 1YIJV 2AW9A 1NU1K 5APQA 5AVWB 4UCSA 2PRRA 4PD4E 2XAQA 3F7YC 1G6UA 3DC5A 2XASA 2O01J 5KX5A 1EZVH 3E8GA 3AG7A 1T3UA 5GONA 4I5SA 4PELA 5APTA 2P5OA 3E22A 5JQGA 4P30A 3BEHA 1RQUA 1Z56A 2JJLA 1AR1B 3CCEP 2VQEB 5LMUB 4B3SO 2EILC 3AEFC 1EFRG 2JEEA 5KAIZ 2JS3A 1OCRC 1CP9A 4LR3A 3SWKA 5AVYB 4GX0A 1G8MA 1RF1A 1VQ7V 4MSWC 4UUJC 2E5LO 1VQ6V 3ZRSA 5L3GA 2WPDG 3Q2YA 4O4HA 3U0ZA 1MABG 1YITV 1JM0A 3APQA 1NKDA 1RHZB 1OCZC 1PGQA 3BATA 2JDIG 3CCQP 4U7OA 1KC8W 4LF6O 2Q5ZA 1OX3A 3M9QA 2EIKC 2KLUA 4GDOA 1M8OB 1OCOC 2O1KA 2HFEC 4LH6A 1BHAA 4TQDA 1VDFA 3FX7A 5AG2A 1J1EC 4DZOA 3FWLA 3FXDA 1SQBD 3WB1A 5H6RA 1XL4A 4JI4O 5GTHZ 1BSMA 1OVRA 4JV5O 2WQYC 1A02J 4DV3O 1BE3D 1KILA 1SQVK 3V2PA 5EYPB 3KXDA 3S1KA 2X6CA 3N4XA 1HNWO 1SQPE 3KYQA 1PNMA 3NR7A 1JR9A 2R32A 3KG2A 2H94A 1VF5D 1RF0C 1T3JA 2YO3A 3O6QA 2YXYA 1M57B 5IJ0A 4HKZH 4JPRA 3SWFA 3AG4B 5KKZB 1FDIA 4IL6Z 4YIOA 1I94O 4I0XA 2JK5C 1BQ0A 5CMZA 3N2KB 2AXCA 1NTZG 2AEJA 1KYOD 1AR5A 1AI6A 3MIWA 4GLXA 1CW5A 3OEEG 4DR5O 1BGYD 2HFED 4C7RA 1XQ8A 4ZKUA 2F4VB 2EINB 2Q6AA 2UUBO 1L4AC 3TNUA 2QEXV 2JR8A 1H2NA 2JO1A 3S3WA 3L73J 3ABUA 2EZPA 3OGIB 2GBOA 2Q7CA 3H9VA 4MVOA 2W6JG 1HNXO 4DJGA 4R50A 1IC2A 4YXWH 3A8TA 1KU9A 3CI9A 1FAFA 5J2TA 5CCHA 2NZ2A 3MP7B 1URQB 2QDOA 3JAWA 1M90W 3DC6A 4ZHQA 1GW3A 3D36A 4KXRA 1SFCD 4JQ0D 4I55A 1Y74A 1V9PA 2QJPB 1YJWP 2ZT9B 1L2PA 2XAJA 2OYIA 3OTOO 3OR6C 1MSDA 1Q82Q 2P7TC 2BSKA 2KZIA 2E76B 2LGWA 2OYQA 1TU3F 2ITDC 2IX7C 1NKZB 4LF9O 4KFMA 4FLTA 4L75A 3ZDMA 1PIXA 1L1FA 1H8AA 3AEDC 1YYCA 1S5LZ 4EFBA 4DV4O 4OVNF 3L75E 3L70H 5IYZB 4JF3A 1YTZI 2KP8A 3CXHI 1U96A 4TSFG 3HE4B 5CB4A 1L4AD 3ETDA 2YIBD 2NPSD 4UCTA 4MN4C 4YTPC 5AW2B 2W6AA 2ZKOA 5AW0B 1BE3J 1WLEA 4FM2A 3OW2U 5CCGD 3W7XA 2N9YB 4DT0A 4I1LA 4JPZB 1GTWA 1NR7A 5IYCO 3Q5RA 4MVSA 3W7TA 4DUYO 4TOIA 1XNQO 5FLXN 4MVMA 2WT7A 1D7MA 2D2CB 3ASNC 2XAHA 2GUZB 4K3AA 2QJYB 3TXQA 4K8ZA 4ZNCA 1NVPD 3RVYA 4GCZA 1DH3A 3AE1C 4YY3B 5L3CA 2KSEA 3FYEB 3UKMA 3ZHSA 3K57A 3JD1A 1JY3N 2OARA 4JBZA 4JI7O 4GYCB 2K9JB 4X1YB 5IT9N 1T6AA 4FFKA 3CCLV 1K9MW 2DYRB 2AHYA 4X20B 2WVRA 1URFA 3RYFA 4JI0O 1L8DA 4BW9A 2ZXWB 3ZN1A 1N8RQ 5KJ7D 3UQ8A 1JCDA 1IXMA 2Q3IA 4WY4C 2L35A 2GUSA 4DV5B 1YJWV 2PI5A 4Z1MH 3W7WA 1MV8A 3CSXA 1USEA 1M1KQ 1YVWA 2QRXA 4OWFA 3IGAC 2N04A 4UB8E 3RYCA 2FYNC 2MW2B 4FLXA 1Q86W 1KZUB 3HE5A 5APUA 3SYOA 2XV5A 2VQEO 1S5HC 5LMUO 1S76D 4HNAA 5EYPA 3WU2Z 2Y48A 1NHLA 3W7SA 3I56P 3OR7C 2IJHA 3CEIA 1KB9I 3L73G 1FZAA 3MZWB 1FXVA 3M7MX 2M7WA 4N6JA 5EFWB 3L37A 5IY5B 4QGPA 4U3FH 1YBKA 1M56B 1MOFA 3CP1A 2DW3A 3LIEA 3N2KA 1LWUB 3SR2C 2Y0IA 3HKCB 2P58A 2P4VA 1AJQA 5B66Z 1DIPA 2P90A 4ZBMA 1VQOP 4WY4D 1GL2D 4WFAV 1LTJA 1FYJA 1E79G 3WG7C 1Q8IA 2R5BA 2O1JA 1W0KG 1KKDA 4ZKIA 3TSIA 1KQLA 5H2FE 1B06A 3KHUA 1GRJA 1KQSO 4LF4B 2EIMC 2VS0A 4DUZB 2RN0A 2MJZA 4PI0A 1FXKB 3E8FA 1U7JA 5D5QA 3P8MC 4NXMB 4BWAA 1KQFB 3CJHA 2XU6A 3P8CE 1YDXA 1N7SB 5LOVA 2XAFA 3ABMC 5IJ9B 2FYUJ 2WPSA 5KLVE 4LBEC 3CWBE 3K9SA 2ZYDA 1B04A 5L3DA 3ZRWA 5B1BC 2JKVA 2DYSB 3O65A 2JIZG 5KHGA 3TGUH 2UXBB 1U7MA 4MW3A 2F4VO 2ZVNB 4BR6A 1NTMJ 5EIBC 3L70D 3OM3B 1SQXE 2YUAA 4FIPC 1FU1A 4X1KB 1S4XA 2Y0PA 3QTCA 1N73B 1KORA 2CDYA 1PP9H 1VQPV 4BRYB 1JVMA 1PPJG 2W6BA 2N1TD 2B1GA 2Q7EA 1YI2P 1OXZA 5IYBO 5BVZA 1VF6A 1AVMA 3IAOA 1EXJA 3HKBB 2E75B 5J2UB 2Q0AA 1QVGU 1US6A 1OV9A 5E1AC 2GUZA 1VQOV 2GA1A 1R3KC 3CS5A 3BCCH 5AW6B 3V5BA 1XILA 3JCUH 1U97A 3M06A 3PJSK 3CC2P 1OHHG 4I2LC 2RMZA 4W80A 4X1YA 5EBMC 2YICA 1SQQJ 4LGDE 2W0FC 2QSIA 2QKSA 1QLED 4X20A 2F93B 3L72E 3ETEA 4TV8B 2M0BA 3GG2A 3L74H 2A06H 2EIJC 4A5UB 1TVKB 3ABKC 2Q73A 2QTSA 2GUVA 1FDOA 3CXHE 1Q5OA 1VPCA 1EZJA 3LUTB 1S1CX 1P4RA 2QE7H 3CD6P 1XHXA 1FPOA 3AK2A 2AXTZ 1ZRTD 2QA4P 1PNKA 3E35A 1E1QG 1OFCX 3M0DA 3VP8A 2KOGA 3R2PA 4PI2A 2I8DA 1BDCA 2ZFCA 5L8RJ 3FD9A 1FFXA 3VN0A 4OPAA 4YY3O 1K05A 3AEIA 1QNMA 3FX0A 4NYKA 3M9BA 1BMFG 4EB6B 2FFDB 1RPOA 3CMEP 3HPLC 1GD2E 1I5XA 1HGVA 3AE4C 1LT9C 1EZVG 1NKNA 2B89A 3K06A 2OYHA 3K03A 2B9ZA 2LP7A 3SJCC 4LWSB 2PAJA 3TXSA 3SSUA 5M1BA 1RSOB 2KUBA 3DXRA 2CTRA 5BY1A 4DV5O 2FYUG 4YXDC 2R72A 3U10A 1IVSA 3H1LJ 4UB8Z 3K08A 2YXLA 4Y99B 1X0TA 2PY5A 5BU5A 4MVRA 1N0JA 4DV2B 4X66B 4U7JA 2ILMA 4FLVA 3FXEA 3GWKC 1BSNA 4I9WA 1NTMG 3CC2V 3CXHF 3HTKB 4PD4I 3CMAP 2CK3G 4UV9A 1NQTA 3T1CA 1M57D 1SQFA 4MTXA 1KV4A 1N7SA 2A45G 1NT2B 5DM6V 2ZR2A 5IJ9A 1LR1A 4D7SA 5K1XA 1J5EB 2ADPA 2Q0OC 5KLVG 5JVDB 4GKKB 1FZCA 3ZEDA 1B6QA 3CPWO 5APVA 3TGUD 3H1KE 2P06A 1GN3A 1GDTA 2KB7P 4IFFA 1WMKA 2QA4V 1NTKE 1SQQK 2WLLB 1GM8A 5B1AB 3GHGA 5H2FZ 3CYOA 2DOSA 3UIAA 5EC1C 2FBWC 4MS2A 1N34B 4N78D 3CC7P 4X1KA 4JAAA 3MDSA 1SQXG 1LUVA 3O9OA 2C2AA 5E79H 5KAIE 1GM9A 2Y9ZA 1URQD 3BRCA 4DUZO 1BCCE 3ZHRA 1N73A 2V7QH 4IHJB 2NR5A 1SQQG 3H1HH 3CMEV 4NXMO 5KHIA 1PP9D 3HUSC 2BTQB 2ZT9D 4J11A 2B1IA 5DJTB 3CRMA 3M99B 4AHCA 4NKGB 5BMVA 5JJJB 1NO4A 1OW6A 2E76D 3LDEA 3ZHVA 1Q6HA 5LGUA 4EEQA 5J2UA 1N7LA 3JD4A 4GIFA 3VMZA 1HDJA 1IX9A 2ZR3A 3LNMB 1JCCA 4JGSA 3T2MA 3S4RA 4DR2B 4PJ0H 3D70A 5KX5B 4U3FJ 3W7UA 1NU1E 4FMTA 3BCCD 5GONB 5LXTB 3E22B 5JQGB 3P7KA 5GTHE 1JFFB 4IT5A 5BR8B 5LYJA 2O3JA 2B9BA 2RCVA 2NLJC 1KB9F 2M6YA 5AVSB 1RF1B 4TV8A 3CMAV 3Q1MA 4FK5C 1QQCA 4WBNA 4H13B 2JWAA 5B3SC 1ZUQA 4RQEA 1O9GA 3OMIB 2A06D 2KK7A 3L74D 4ZIBA 4H44C 5AW4B 4TUYB 2C9NY 5BXZA 3RYHB 3CCMV 2Y69B 4WF9V 2KS1A 1AVOA 3HKDB 2QG4A 2JEUA 2X6BA 4JYCA 1J1DC 3IC9A 1QL1A 1RE3C 2HVKC 3GF7A 1ZOYC 4ZI7A 2EJ7A 1AV1A 2ZDIA 1Q3EA 1G1JA 1SQBH 3HRNA 1DF4A 4DV6B 3H1LG 3NFQA 3B8MA 1H2GA 2KSJA 2YXHA 3B5ND 3K5MA 1JA8A 1GK9A 1YJNP 3P32A 1CEZA 2EX3A 5CBNA 1NZ6A 2AHZA 4EB6A 2FFDA 1HNXB 1FKAO 2ATKC 5APYA 5LHGA 1L0LH 1K92A 4NB5A 3F5HA 1NVOA 4LWSA 1LP1A 4MTFA 1SQVE 1RSOA 5IJ0B 1JNMA 2H3OA 1XUQA 1PGPA 2GHYA 3HKEB 1DX7A 4D6TE 3CCVP 1AJYA 1HVVA 4OPHA 3B71A 4YJ2A 3ZBHA 1BGYH 3LNNA 5KHJA 1Q81W 1Q2NA 1L0NH 4BAYA 1NH2B 4DR6B 1S5LE 4K35A 3HTKA 3TNUB 4AYCA 3L71H 3L75H 4Z1VA 2YKPA 1YCIA 5H5NA 2R44A 2YMKA 5HFMA 1KD1Q 2EULA 1M56D 2QWOB 1JY2N 2IH1C 1SERA 1WB8A 4YPCA 2OTJP 1BHBA 2A9HA 5JH7B 3JD2A 3IF4A 5AW7B 1P84E 1Y74B 3RK3E 1M7LA 1Q6UA 4WB4A 2OYIB 3MUDC 4N23A 4IYHA 3ZRVA 2PGDA 1THZA 1IZ3A 2ARHA 2BSKB 4JI8O 1W2BO 4H37A 3L74J 5IDJA 2K3RA 4I4TA 3CRQA 2QR4A 4DV2O 4X66O 2QWRB 2L5GB 4U3FG 1HH0A 5AW9B 1HWTC 3JCZA 1GW4A 3A0HE 4W7YA 5B5EE 2XUMA 5CB4B 1SA0A 3H1HD 1ENVA 1QCEA 3KCYA 2H89C 2M3BA 5K5GB 4C7NB 1IK7A 4HH2A 5EBLC 2KG7B 2B88A 3A0BH 1WB7A 4OGQB 1J5EO 3D3QA 1SVFA 4GKKO 3KZIE 1FD9A 3X2QC 1UIXA 3FB5C 3P3NA 1FZGA 3H1JH 5KAFZ 3CCVV 1ZN5A 2WT7B 2Y4UA 4MVQA 5LXTA 1EZVI 3RBZA 3O8ZA 1NU1G 1JFFA 2XAGA 3RYIB 1JOYA 5KA6A 1N34O 3NMDA 3ZHQA 2JJ1G 3WUUA 1LTTC 1JQ0A 3WU2E 1VF5C 4H0LB 5GW7A 1IFJA 3AE2C 1XHZA 2XNDH 2ZXXA 1SQPD 2CTQA 1SZTA 4TUYA 4B3TB 1BSHA 3RK2B 1W5CE 3RYHA 2W8ZA 3TCUA 1CXZB 2AEFA 3RYFB 3HKDA 2OTJV 2QJKB 2E75D 2Q7GA 2F66C 4CZZA 4I7ZC 1SZXA 2L6LA 2WLIA 3ZMVA 2YO2A 3CCUP 2N05A 5B66E 4B7KA 1W2EA 4DR2O 1ZP0C 3E1RA 2A45I 3B2EE 2YNYA 3RYCB 3HE5B 3BAAA 5CA1B 4NXNB 3SPHA 5H6QA 3SWYA 3MHSC 4HNAB 5BR8O 3L73E 1J95A 2AEMA 4PD4F 1IURA 1PL0A 1SFCC 1YXBA 1L0LD 2QTOA 1QR8A 4Z2WA 3B4SA 5KUKA 2IBZG 4J42A 1HR0O 2JRIA 1SQVG 3RL0C 3HKEA 3K0GA 3LW5J 4PV1B 2YI8A 2E3CA 2LR2A 1A02F 1TUBA 3FB6C 5AW8B 4D6TG 2V7QJ 3QO7A 3H1HJ 3T97A 5GTIZ 4GODA 1Y66A 4DV6O 3CRCA 1LTJB 2LO1A 1ZL8B 1M1JB 2NPSC 2ZJSE 1GKFA 3CCEV 1L0ND 3C3SA 3L36A 3L71D 3L75D 1CI6B 2QE7G 4RESB 1EDKA 3GMAA 4N21A 2LKMA 4QNHB 4O4IB 5FPRA 2ZM6O 3RT3C 5CA0A 2Y0DA 5CCGC 2Q69A 3H6PA 4EI2A 3JCUZ 5JH7A 3JD0A 3CJHB 3SJQC 3OMNB 1YTZT 1I0HA 1AJPA 2Q3EA 2UU9B 4Q6GA 1YZBA 3CCQV 1BE3E 4AI8A 1SP4A 1PFIA 5CBOA 5LOVB 2HP8A 5EBWC 3AE9C 1P7GA 5LP6C 3RL0D 3ZRWB 4CBCA 2C9LY 2HJDA 2IDBA 4KHXA 2OCHA 1BS3A 3EFFK 4KJMA 1YTFB 3CCUV 1Q7YQ 3JARA 2FB5A 3BPZA 4PDRA 3OGCC 4FVMA 1FC2C 2RN9A 4CH3A 4QIWF 1QVFU 1ZW0A 1VQKP 4DR6O 1K4DC 4L8JA 3TETA 2FMLA 4JI5B 2E74C 4HJGH 4HZ3A 1KYOE 3U59A 1H89A 1PL5A 4J7JA 5AVRB 1SQBJ 1KN7A 2X7RB 3F89A 5TISZ 3TYYA 4C7NA 5KJ7C 5LHIA 2N9BA 2XKMA 2ZE5A 3OT7A 4IFMA 1PPJE 2IJKA 2KG7A 4XE5B 1R6NA 4TT3G 1ZLLA 3H32A 3SJBC 1D5AA 1KECA 3GF3A 2F1MA 5TJHA 4GX2A 2CH7B 3U1CA 5ITZB 4ASVA 3CXHH 5L3EA 1FJGO 1KFNA 4UB6E 4NR1A 5L3FA 1L0LJ 3WMM0 1MZ9A 3D6YA 3H1JD 1S3JA 2RKLA 2AXTE 3RYIA 4X88A 4X9QA 1V54C 2R9RB 3TK1A 4JYAB 3C1LA 3BASA 3A0RA 1MMMA 3USSA 3A0HZ 2N74A 5B5EZ 3T1HB 2YIUC 2IFNA 2FXOA 1K4CC 2WA4A 3GWOA 3JAMN 3AEGC 2FKWB 2XDJA 1VQ9V 2P2UA 3AG3B 3ICXA 1BGYJ 3ABVC 2E74D 4W4KA 1SETA 1NJIW 3PH0A 3S9OA 1L0NJ 4UXNA 2WSSH 3KZIZ 3L71J 2LGQA 1GL2C 4L73A 5KHHA 2ODMA 1COWG 5FPOA 3VTPC 2YSUB 3RBXA 1KILC 3QG5A 1OVVA 2V7QG 1ROPA 4DW1A 3H1HG 3ETQA 3B40A 1H2LA 4DXWA 5CA1A 3OFNG 4PDLA 3RK3B 1AROP 1DTOA 5EC2C 1EM1A 3Q4HA 1YEWA 4XA4A 1PGOA 3JAKA 1FFXB 2VWJA 3H1IH 2P6JA 3OUFA 1RY3A 2J58A 2RNBA 4HBNA 4UVAA 1SQGA 3HD7B 3EQ2A 4TV9B 5IE9A 2PTMA 1XEQA 3ASOC 1EZVE 3T1YB 3ABTA 2BCCH 1S5JA 3F5TA 1S72P 1AFOA 4B3TO 3M8AA 3JC22 2OYHB 4N3YB 4ASWA 3P8CD 1EDJA 1MSWD 1ZWIC 2A7WA 1J1DB 2FYUE 1MUUA 3DXRB 2WLMA 3AG1B 1AVYA 3ZMUA 4GOEA 1R6KA 1KB9H 3CL3D 3AK1A 1RM1B 2ZNIA 4GX1A 1QHTA 1EQ7A 1N86A 1V55C 1KTMA 1ZL8A 2YC0A 1M1JA 1Z2GA 1LT1A 3BA8A 1VQ5P 1SQBK 2WWWA 1KILD 4NXNO 1DGSA 1NTME 5CCHC 1VP7A 1CI6A 3ABLC 1Y76A 4O4IA 1KQGB 2K1AA 1IBKB 1ZSPA 3RWRD 2OCCB 1UJWB 1HGZA 1RE4C 3B8NA 3H1JJ 2N1TC 2WZ7A 1J2JB 4IGGA 1XNRB 2RDCA 1N33B 1BCCH 1SQBG 3P30A 3N7NA 5KLIB 1L0LK 3MGNA 1NI8A 1OW7A 3I55P 3AG2C 1KC8Q 2J5UA 2W6IG 1DEBA 1GMGA 1BE3G 1FZBA 3A2FA 1GO3F 1FAVA 4J7ZA 1SS1A 1KP2A 2CE4A 1FZCB 5KA5A 3SYAA 2LFSA 4IYIA 1VQNP 3RGUA 3H25A 5LGTA 4QE9A 3OTFA 2R70A 2WAMA 2A79B 4PA9A 3S3XA 1X4TA 2KXPB 1QLEC 3OE7G 3GHGB 1HJBA 1QGKB 3I56V 1L0NK 1SQQE 2WSFH 5CCHD 2IJIA 4I9QA 2HVJC 1U57A 2BASA 2QWPB 3L72D 1OVUA 1BGYG 4RJTA 1S72V 2JDIH 2UU9O 1HW7A 2CH7A 5ITZA 3U11A 3STZC 5BMVB 1L0NG 3CCJP 1IBLB 3EFGA 3CXHD 2IU0A 2DWEC 2HODB 2KSDA 3GB7C 4IL6H 5KMGB 4JZGA 2P4KA 4GKGA 2A0LA 2CTPA 2IBZI 1GAXA 4QPKA 1WT6A 3KKYA 1Q6IA 1K8AW 2M8RA 2DWDC 1P7BA 1KP3A 4E2LA 4JI5O 1F23A 5LYJB 1Y8AA 4Y28J 2Q5UA 1T5EA 4FM1A 4AUWA 4NTWA 4X64B 2LXBA 4JI3O 3PRJA 3VBBA 2GSMB 2OIEA 1I08A 5AW5B 4WBNB 3UO2A 1WJZA 4OGQD 1M90Q 5AVVB 4UVCA 2LW1A 4UB6Z 2KS1B 2HEPA 2JP3A 1NTZH 1JCHA 4ZI7B 3CCRP 4DYLA 3H1LE 4FM0A 3G67A 1VQNV 2EILB 4JYAO 3C8VA 4DO2A 1OCRB 3IFXA 1M57C 3HD7A 3T1HO 3H1ID 4TV9A 3CX5I 1P84I 3IR9A 3AG4C 5KKZC 1S5LH 2W6JH 3BRTB 5BZBA 1OJHA 1K73W 3RK2D 1G1XB 5EK0A 4BXLA 3PHLA 4JASA 2JGUA 3LSUA 2MK3A 2BCCD 5LL6Y 1OCZB 3UT5A 3QWOC 1FOSE 4XBFA 1LP1B 3FYIB 3L70J 2ZXEB 1WP8A 1RE3A 4L76A 2EIKB 1JMKC 4H33A 3QF7A 1S77D 2EINC 3V4QA 4DR3B 1OCOB 3CRRA 1YI2V 5C39A 1AI4A 1JMMA 1KB9D 1LTAC 4JI8B 1J1EB 3K9AA 5CBFA 4YJ2B 2DW4A 1OCCC 2XNDG 3SPGA 4I6MC 1USDA 4R6ZA 1Z5WA 2QWNB 1S2EA 2OWOA 2ZCEA 3H1KD 2YIAA 1NTKD 1URQC 3FAVA 4WWIA 3UCSC 3LSQA 2IYPA 3GW6A 2CTWA 3PN1A 4FPPA 3ZIAG 4CH4A 3EVKA 2OTKE 2QJPC 2ZT9C 1VQ9P 3G6BA 1QX8A 5CMUA 2ZYGA 1VMGA 3PLNA 4C7UA 4YHHB 3T1YO 4JI2B 1BCCD 2E76C 1K9MQ 4PV1D 4JTDB 4DK0A 5A9GA 2WA3A 2Y0CA 3STLC 4DR1B 1SKVA 1YF2A 2UWJE 1X9VA 2PYLA 4J9ZB 3CD6V 1WPXA 4CC5A 4PD4H 1M93A 4X8AA 1KBHA 1QEXA 3IFMA 3IC7A 3K58A 2H8PD 1PV3A 1N2DC 1FS0E 4UV8A 4U3FE 1NBMG 3VQXA 4A7PA 1P49A 5KAFE 1FZFA 3ZMZA 1JUNA 1Q86Q 1L4AB 4I4TB 1SF9A 4JZ2A 1QR9A 3B77A 2EZOA 3AECC 2R9IA 4G2KA 5KUMA 4ASUG 4OX9B 2IPPA 4OXSA 1TAEA 1IBKO 2WLHA 2K37A 3WU2H 1VQLP 3I5CA 3DGEA 1SA0B 1XNRO 1AJNA 1N33O 4WFEA 4F6RA
chains in the Genus database with same CATH topology
2D2CC 3Q1MA 4OGQD 3AE4C 2H89C 2BEZF 2QJYC 2BEQD 4H13B 1IK7A 4H44C 1KQFB 4YTPC 3EWKA 2FXPA 3Q2YA 4H0LC 1Y9BA 1KMIZ 5M1BA 2JP3A 4OGQB 2H88C 3AEEC 3AE9C 1R8EA 2G3AA 3GF7A 5KLIC 1ZOYC 2IDBA 1UIXA 4YXDC 3Q5RA 4GDOA 2QJKC 4H44D 1KTMA 3C8VA 1MKMA 4H13D 2D2CB 4U7JA 1OW8A 3AEAC 1RQVA 5KKZC 4XFJA 4H44B 1KQGB 2E74C 2WQYC 4R4MA 2E75C 3AE1C 1VF5C 1PL5A 4H0LB 1S5LX 3AE2C 3Q3DA 2OQQA 1YQ3C 1GMJA 3IN6A 1DD3A 1OW7A 1KORA 2J5UA 2P10A 3GF3A 2D2CD 2E75D 2WSCJ 1VF5D 3O6QA 4I7ZC 3SFEC 2WSEJ 1YQ4C 2QIWA 3Q5SA 2G8YA 4H0LD 1FDIA 3H25A 3IAOA 3B71A 1EXJA 3D6YA 2E74B 1AJYA 2E75B 1VF5B 1ZP0C 3AE6C 4PV1C 4Z1MH 3AE8C 1WMKA 1HJ0A 3AE7C 2FYNC 2QJPC 3D6ZA 3Q5PA 2ZT9C 2YIUC 2FBWC 3AEGC 2JO1A 2E76C 4I7ZB 1U57A 2YMKA 4PV1D 3R4YA 1Q90D 2QSIA 2E74D 1JB0J 3ABVC 4R4LA 1NYHA 3S9OA 2ZT9D 3AEBC 1VL2A 3LW5J 4PV1B 2NZ2A 2WSFJ 1FDOA 3FGAD 2WPVB 1OW6A 3SFDC 2E76D 4RKUJ 3RK3E 1PV3A 3T97B 1OMIA 1S1CX 2V7QJ 2ZT9B 2MKVA 4H13C 2K9YA 3AE3C 1DIPA 3RL0g 1ZRTE 3D70A 2E76B 4IL6X 3AECC 3G9RA 4KT0J 1DD4A 1K04A 1TU3F 4OGQC 2O01J 1ZMEC 5L8RJ 1PIXA 1HF9A 1EXIA 3AEDC 4Y28J 3GLMA 1NGMB 1K05A 1RQUA 3GMAA 1KILE 4TT3H 3AE5C 3D71A 3AEFC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2E75 B;  1VF5 B;  5KKZ C;  4H44 B;  2WPV B;  2QJY C;  4RKU J;  4H13 B;  4H0L B;  2ZT9 B;  1S5L X;  2FYN C;  2QJP C;  2K9Y A;  2YIU C;  4OGQ B;  1ZRT E;  2E76 B;  4IL6 X;  5KLI C;  2WSF J;  4KT0 J;  2O01 J;  4I7Z B;  2WSC J;  1Q90 D;  2QSI A;  5L8R J;  1JB0 J;  2QJK C;  4Y28 J;  3C8V A;  2WSE J;  2QIW A;  2D2C B;  3LW5 J;  4PV1 B;  2E74 B; 
#chains in the Genus database with same CATH topology
 3WUT A;  3LSS A;  2D2C C;  2ITA A;  4J9Y B;  1W0J G;  2QJY C;  3LDC A;  3PP5 A;  3H1I J;  3MUD A;  5FL7 G;  2HOD A;  2RMK B;  4YJ3 A;  2Q68 A;  4KL1 A;  1XTG B;  3ZX6 A;  4YXW G;  1G2C A;  3B5N C;  3RFR A;  3D3I A;  5KMG A;  2BCC J;  5AVT B;  4JI6 B;  3ZCC A;  5B66 H;  4LLH A;  2DYR C;  3V2R A;  1JTH A;  2M5A B;  1VQ4 P;  4DR4 B;  2ZXW C;  3JYC A;  2K9P A;  4EFE A;  4UCV A;  4PA3 A;  2ADQ B;  3WUV A;  3MAQ A;  1HUC A;  1YSC A;  3L73 H;  1XMO B;  2IJJ A;  5D5P A;  3ZHT A;  1SQP H;  1BDD A;  2DMX A;  2CUG A;  1HR0 B;  1R3J C;  1G1I A;  1DK1 A;  4N78 E;  3L70 G;  1GZL A;  3A3Y B;  1IBL O;  3BVH A;  2D2C D;  3FWN A;  2WLI B;  1NTZ D;  3G80 A;  2M3E A;  3VMX A;  2IZ0 A;  3QO8 A;  1KQS U;  3ASN B;  4LP8 A;  3Q5S A;  1KKC A;  2KQX A;  5GTI E;  1B3Q A;  1E79 H;  5IY5 C;  1T2K C;  5KHK A;  2UXN A;  2PGG A;  5APS A;  3P3P A;  1M56 C;  2UXC B;  3RVZ A;  2KNC A;  3CC7 V;  1Q82 W;  1LWU C;  3TGU J;  4DR7 B;  1BQZ A;  3D6Z A;  2ZM6 B;  2BOC C;  1N36 B;  1XDC A;  4X64 O;  2H7H A;  5AW3 B;  2IBZ E;  1JMB A;  3ZJZ A;  1VQL V;  5LMN B;  3JCU E;  4R4L A;  1S9K E;  4B3R B;  3WB0 A;  2HHH B;  4WY4 B;  3K5L A;  3OD4 A;  1NAY A;  1PD3 A;  2WSF J;  1TUB B;  1KYO I;  3RK3 D;  3FGA D;  1PP9 J;  3T97 B;  1VQM P;  2FYN B;  4NVP A;  2VQF B;  1FXK C;  3L74 E;  2ZYA A;  2FKX A;  1AQ5 A;  1ZXG A;  2YXQ B;  1TGO A;  4QMA A;  1YIJ P;  1N7S C;  1SC5 B;  4RUF A;  3THO A;  4CH5 A;  4LFB B;  2J59 M;  5JCO C;  2FYZ A;  1SFC A;  3ZHU A;  1T2K D;  1VF7 A;  5L3B A;  3ASO B;  4JTA B;  4Z1M G;  4K8X A;  1R3I C;  1RF0 A;  1NGM B;  2DYS C;  2Z0A A;  1X22 A;  3BCC J;  4ZOL B;  1R5S A;  2HG5 C;  5CA0 B;  5TIS E;  5AVQ B;  1FJP A;  3K04 A;  5F2V O;  1PPJ H;  1LTG C;  1HP8 A;  3GVM A;  4GT1 A;  4FLU A;  3CX5 E;  2FXM A;  2Z5H A;  4DR3 O;  1XMQ B;  2PP6 A;  2ZE6 A;  1FJG B;  4LFA B;  4PD4 D;  1VQ7 P;  1VQ6 P;  5JJE B;  1NWQ A;  4TLF A;  3T4D A;  3AEE C;  3MHH C;  3WG7 B;  1L4A A;  1FS0 G;  2BCC G;  2YIB A;  3VOU A;  2NPS A;  3JAR B;  3L4F A;  4C46 A;  3G6E P;  1N73 C;  3SPC A;  2AXT H;  1PNL A;  5IYD O;  4F4L A;  4ABM A;  1YJ9 P;  1Z5V A;  3J80 N;  1N8R W;  4OH8 B;  1YJN V;  2OYO A;  3A7O A;  3FKS G;  2QJ1 A;  4JAV A;  2EIM B;  1NOH A;  1NTZ J;  2WTY A;  3N2G B;  5CCG A;  1N7S D;  1RQV A;  1VQ8 P;  2QM8 A;  4JI1 B;  5BU8 B;  2JVD A;  2V4D A;  5CJ4 A;  1M1K W;  2E75 C;  3B09 A;  4G27 B;  3HR0 A;  4YHH O;  4JI2 O;  2QVA A;  2A3Q A;  1GK6 A;  2ZD9 A;  2OQQ A;  4WFH A;  2QGN A;  4MW8 A;  3ABM B;  3H32 B;  3IN6 A;  3KCX A;  2HG5 D;  5LP6 A;  1IFP A;  4DR1 O;  3A2A A;  5DJU B;  4X1I A;  1K5S A;  5B1B B;  4JF7 A;  2AZ2 A;  1R6T A;  3CRA A;  3OUS A;  1YHQ P;  3OA7 A;  2ETN A;  1HTL C;  1LTS C;  3C90 A;  2SPZ A;  1LGH B;  1EN6 A;  1BL8 A;  1VQM V;  2M5A A;  4UB8 H;  3QO5 A;  3OEH G;  2IU3 A;  3L35 A;  1X79 B;  3CX5 F;  1P84 F;  4OX9 O;  1JY3 P;  3AE7 C;  4UFZ A;  5KJ7 A;  3L73 D;  1WA8 B;  4B7E A;  1LTB C;  3TGU G;  1IBM B;  1GN4 A;  2ZDI C;  2JS5 A;  1PV0 A;  1Q90 D;  2IFM A;  2QEX P;  4D7T A;  3LDD A;  4MTG A;  1K97 A;  1NYH A;  4W7Z A;  5E79 E;  1CPY A;  1AP6 A;  2NRG A;  2FYU H;  2RH0 A;  3H1H E;  2F95 B;  2FFD C;  1D5N A;  2UUC O;  2YKO A;  4JI6 O;  1QL2 A;  1WAZ A;  1TUE B;  2FL4 A;  2R9A A;  1PP9 G;  4YIP A;  2MKV A;  2YEV A;  1ORQ C;  3E1I A;  3G6E V;  2HLO A;  3Q4H B;  1JY3 O;  3BFR A;  4TQF A;  3RL0 g;  4DR4 O;  1MZE A;  3JAK B;  2WPQ A;  1AI7 A;  3G9R A;  1YJ9 V;  1NTM H;  2LJ2 A;  1KUQ A;  1NR1 A;  3IJ4 A;  1CSB A;  5H2F H;  2CPB A;  4RO0 A;  2CK3 H;  1XMO O;  1DLB A;  3CB2 A;  1IFI A;  4PJ0 E;  3CPW U;  2EIJ B;  1VQ8 V;  2WMM A;  3HB3 B;  2WIT A;  4Y99 C;  3ABK B;  3QNE A;  2A45 H;  5DN6 G;  2YXR B;  3BCC G;  4WY4 A;  1M4U A;  1GL2 A;  2XOK G;  2DE0 X;  3JAT A;  4U3J A;  3BRV B;  1F7Y A;  4R8C A;  1AB3 A;  5KLV H;  3V6I A;  1ZAU A;  2Q7H A;  4P9O A;  3CWB H;  2FXP A;  2OT5 A;  4U7N A;  3D8C A;  1QVG O;  1AR4 A;  3CHX A;  4HYO A;  1VAR A;  1GU5 A;  2H88 C;  1NTZ K;  1YHQ V;  4K0K B;  3L74 G;  2A06 G;  1WP7 A;  3VP9 A;  4LCU C;  4QPJ A;  1H8E G;  1XOU A;  2XTA A;  3TF5 A;  1FZE A;  4O4J B;  2UXC O;  2W27 A;  4FFB A;  1SQX H;  1GU4 A;  1Y76 B;  4DR7 O;  1ZR2 A;  1JPX A;  4ZOL A;  1JOC A;  1N36 O;  1SQB E;  5LA6 A;  3OMA B;  1SQQ H;  1LT9 B;  3TDK A;  2YDE A;  3SPJ A;  3SJA C;  2NNU A;  5LMN O;  4UCO A;  1IFN A;  1PPJ D;  1ZV8 A;  1YQ3 C;  1GMJ A;  4B3R O;  5B1A C;  2HHH O;  2JWD A;  2Y4T A;  4RUE A;  1AA0 A;  2IYO A;  1FE6 A;  1DD3 A;  5LBQ A;  3JSL A;  3MD0 A;  1IJD B;  3CCL P;  2YKQ A;  1SQP J;  5CBH A;  1L0L E;  4I50 B;  1KFM A;  1OCC B;  2FY8 A;  1WPB A;  2GV9 A;  2VQF O;  1YQ4 C;  4XDL A;  2KZJ A;  1H0T A;  4Q20 A;  2B87 B;  3QVN A;  4DV0 B;  4GKJ B;  1F4N A;  3N2G A;  4LFB O;  2ZIO A;  4RAI A;  1RE4 A;  2N1T A;  4HB1 A;  2DQ0 A;  3T4Z A;  4KHP B;  4JI3 B;  3CLQ A;  4DW0 A;  1BGY E;  1HNZ B;  4O2A B;  2CPS A;  3L72 H;  4DRX A;  1JO5 A;  3R4Y A;  2E42 A;  1L0N E;  1X59 A;  3L9D A;  3SYC A;  3L71 E;  5IWA B;  1XMQ O;  1R5L A;  4LFA O;  2RQ6 A;  4RWU A;  1QLN A;  4GZR B;  3OJA B;  1NH4 A;  1VEW A;  4AIL C;  5JJN B;  2Z5U A;  3VQY A;  3VQW A;  2UXD B;  1H2K A;  4RKU J;  3SFD C;  1RF1 C;  1OZ0 A;  3H1L H;  1EDL A;  2OTL P;  2HYN A;  2XHB A;  2BOB C;  3JSV C;  1AP5 A;  4H13 C;  2Q8V A;  2ITC C;  2FTK A;  4JAU A;  4NTX A;  1Q81 Q;  4B86 A;  2Y69 C;  4KT0 J;  1DD4 A;  1WA8 A;  3W67 A;  2HLD G;  4LNU B;  4JI1 O;  1W59 A;  3HUS B;  3GLM A;  4QE7 A;  1EZV D;  2E5T A;  1XRE A;  2QM7 A;  4X62 B;  2ZVO B;  3FB8 C;  3KPE A;  2L91 A;  2UXX A;  3RGB A;  3J7A U;  3L75 J;  2IZ1 A;  2ZAE B;  3DSQ A;  3CE2 A;  3FB7 C;  1IK9 A;  5APW A;  1E1R G;  3V4W A;  4XDJ A;  3B5N B;  2FYU D;  3EWK A;  4KP4 A;  2QKC A;  1ZLZ A;  1KYO F;  2AGA A;  4P2Z A;  3RW0 A;  2KLV A;  1KMI Z;  1R8E A;  1GM7 A;  2P7J A;  1N0N A;  2Q67 A;  4NPD A;  3A5T A;  2QKA A;  3F7V C;  4M3L A;  3A0B E;  4GOF A;  1VQK V;  1NTM D;  2UUA B;  2PI4 A;  4H13 D;  2JGD B;  4FJC C;  2ZQM A;  3H1J E;  3M9H A;  4MTO A;  1XBL A;  5B3S B;  4H44 B;  4LF7 B;  1W2B U;  1IBM O;  2WSC H;  5K1P A;  3CCS P;  3UT5 B;  1K34 A;  1SQP K;  5E79 Z;  3APO A;  3ZMT A;  5LGN A;  4L87 A;  1Y4M A;  5KLV D;  1JJ2 U;  4P9P A;  3CWB D;  2Z4E A;  5H9C A;  2P10 A;  2DJV A;  3PTZ A;  3ETG A;  2E43 A;  1CZQ A;  3VYI A;  3E89 A;  1ZX3 A;  1SQP G;  1VQP P;  3H1K H;  1OWA A;  1NTK H;  2P67 A;  4O4J A;  1IDS A;  3NXS A;  2OTL V;  5KAF H;  3FAV B;  1H2M A;  4TWK A;  3AE8 C;  3D36 C;  2R3S A;  3J81 N;  1AIL A;  4PJ0 Z;  1SQX D;  2YS8 A;  1LT9 A;  3JAS B;  5CJ0 A;  2OYI C;  5KAI H;  1SQQ D;  1JJO A;  4WVZ A;  3SPI A;  3K5B A;  3II6 A;  4LF8 B;  4PHZ A;  3BHP A;  2ZIN A;  1RH5 B;  1EN5 A;  4B3M B;  1H8H G;  1I5Y A;  2YID A;  5J9P C;  3G4S P;  4I50 A;  3C3T A;  1RPR A;  1GH6 A;  4FLY A;  1L0L G;  3I5D A;  1NH2 D;  1URQ A;  2DN9 A;  4K0K O;  4GX5 A;  4MVU A;  4WFG A;  3VOP A;  1Y47 A;  2B87 A;  1NU1 H;  1GN6 A;  2ZE7 A;  3M0A A;  5B1O A;  3AE3 C;  5GTH H;  1H88 A;  1NAF A;  2AZ0 A;  2PYJ A;  4OGQ C;  2WLN A;  4JTC B;  1DEE G;  4O2A A;  4ZMD A;  1LUW A;  1Q43 A;  4NPE A;  5DED A;  4O4L B;  4HYT B;  4LFC B;  3R66 A;  3R65 A;  5DEC A;  1KIL E;  3E7K A;  4F6R B;  3AE5 C;  5AW1 B;  1EN4 A;  3CCS V;  2I1K A;  5IYZ A;  2YMY A;  1SRY A;  2Y0E A;  1IXB A;  4J41 A;  3L71 G;  3HE4 A;  3L75 G;  4YJ3 B;  1N32 B;  1XL6 A;  4R7C A;  3K59 A;  2XT9 A;  1OZH A;  1G2C B;  4H0L C;  3VMY A;  3CC4 P;  2K88 A;  2GM4 A;  3ML0 A;  3H1L D;  4NTY A;  4XDK A;  2G3A A;  2XZR A;  4FLZ A;  2NN4 A;  2IH3 C;  5C8Y B;  3MTU E;  3RK2 C;  5GTI H;  1VQ5 V;  4IIJ B;  1JTH B;  4DV0 O;  4GKJ O;  1EC5 A;  2C0X A;  3U1A A;  5CBG A;  2QJK C;  5KLV J;  4O2B B;  1GTO A;  3CWB J;  4LNU A;  5A2Q N;  2HPC B;  1MKM A;  4KHP O;  3HUS A;  2O57 A;  2Q6Q A;  2F43 G;  2QM4 A;  1OIP A;  1UPG A;  2HJF C;  1HNZ O;  2P1J A;  2JJ2 G;  4G28 B;  4R4M A;  5AVZ B;  3ZRX A;  2IBZ H;  4CS3 A;  3L70 E;  1SQV H;  3E86 A;  3JSN A;  4J7K A;  2WSE H;  3ZN0 A;  4W4L A;  3Q3D A;  3I55 V;  2EJR A;  1SQX J;  1XTC C;  5IWA O;  3B5N A;  3X2Q B;  3M91 A;  5CA3 A;  2K9J A;  4LH7 A;  1ZR4 A;  2X0L A;  4GUN A;  3VQV A;  3ZMS A;  2LFR A;  4D6T H;  1KD1 W;  2ZIM A;  4ICG A;  3G4S V;  1AQT A;  4EOT A;  2YI9 A;  1JEK A;  1VIB A;  5EIB D;  2UXD O;  1F51 A;  1XI1 A;  1MZF A;  2PF4 E;  1HWY A;  2PUS A;  4BWN A;  2QIW A;  1N4C A;  2POH A;  1DF5 A;  4H0L D;  3SGI A;  2QWQ B;  1UII A;  1VF5 B;  2JGD A;  2IW5 A;  3AE6 C;  4PV1 C;  4DV7 B;  3K5N A;  4EYY Q;  3JAL B;  4AQY B;  1WN7 A;  2KNC B;  3ZS8 C;  1K33 A;  2Q4P A;  3H1J G;  3NTN A;  4DOJ A;  2KI7 B;  2GTA A;  2LW7 A;  4X62 O;  1IFM A;  3DTU B;  3K5O A;  2VRS A;  1WNS A;  2Z5I A;  5TIS H;  4I7Z B;  1IFD A;  2H8P C;  1LTJ C;  3MHV A;  5B1N A;  4BIU A;  1JB0 J;  2W83 C;  1M1J C;  3BVO A;  2CGO A;  3CX5 H;  4FZ0 A;  1P84 H;  4IFD K;  3CCJ V;  4X65 B;  3RN4 A;  1EDI A;  3JD3 A;  4CH6 A;  4PA4 A;  3L72 J;  3A0B Z;  3K3W A;  2FYU K;  4J10 A;  1WRG A;  2O01 H;  1MG1 A;  3CC4 V;  4L74 A;  1X8Y A;  1S0V A;  4U3F D;  4BW5 A;  1LWU A;  3HKC A;  3JAS A;  2UUA O;  1ZRT E;  3E8H A;  2ZNJ A;  1SFC B;  5APX A;  3A0H H;  1NTM K;  2BE3 A;  5B5E H;  1HBW A;  1QU7 A;  4LF7 O;  1JY2 P;  2W90 A;  1HF9 A;  4DV1 B;  4PA6 A;  3RL0 B;  1NJI Q;  3SDL A;  4TT3 H;  5AVU B;  1AI5 A;  2B5U A;  3H1I E;  5EZY B;  4DK1 A;  2E5Y A;  3H01 A;  2IM9 A;  2BEQ D;  1RP3 B;  4UCU A;  2V1D A;  1RFY A;  1FXK A;  4BIZ A;  3KZI H;  1SS3 A;  3C9I A;  2K1E A;  4B08 A;  3BAB A;  2BCC E;  3CCR V;  5KLV K;  1IO4 A;  2RJZ A;  4WCE V;  1F4M A;  1NU1 D;  2NPS B;  1FOS F;  3CCM P;  5JCO A;  2LQT A;  4LC1 A;  3TJT A;  4LF5 B;  1K5Q A;  1A32 A;  2Z3Y A;  1KB9 E;  1JY2 O;  3CWB G;  4JYY A;  1GK4 A;  3UO3 A;  1VF6 C;  4HAM A;  1SQX K;  4O4L A;  4F6E A;  1OW8 A;  1PKX A;  5FNV B;  2XNX A;  4LF8 O;  2KB1 A;  4B3S B;  3G71 P;  1LJ2 A;  2QSA A;  5LP6 B;  1YTF D;  4B3M O;  4X1I B;  1NVP B;  3LW5 H;  4LF4 O;  2UUC B;  2E5L B;  2WSC J;  2KIK A;  3AG3 C;  4UCR A;  2HKO A;  3SYP A;  5C8Y A;  2H43 A;  1M5I A;  1JX9 A;  3SFE C;  4IIJ A;  4BRY A;  4UVB A;  3W68 A;  4WFF A;  4O2B A;  4LF6 B;  5JWP A;  4NPF X;  4JYB A;  2E74 B;  3ITK A;  2HPC A;  3WFV A;  3E83 A;  3HKB A;  3SYQ A;  2KYV A;  5KTB A;  1IZN B;  3TGU E;  1HJ0 A;  3B8E B;  2GTS A;  4EIJ A;  3H1K J;  3OAK A;  3Q5P A;  1M9N A;  4PA7 A;  2UXB O;  4X89 A;  1R1B A;  3IAY A;  3EHB B;  1NTK J;  1SES A;  4LFC O;  4JI4 B;  2IBZ D;  4JV5 B;  1SQV D;  3M0D C;  4CC6 A;  3RK3 C;  4DV3 B;  2EBO A;  2OGU A;  1FXH A;  1Y67 A;  4PDM A;  3VMA A;  1S9K D;  1FDM A;  3G3Z A;  2Q9I A;  2DQ3 A;  1N32 O;  2CAZ C;  4D6T D;  1HNW B;  1EBO A;  3HD7 C;  3FFQ A;  1BCC J;  3AEB C;  1LNQ A;  1PP9 E;  4IOI H;  3N27 A;  1V54 B;  4DCK A;  2D3O W;  3L72 G;  1TVK A;  4E4E A;  2OIG A;  2WPV B;  1QVF O;  4O4H B;  1Y6X A;  2YEV B;  2PZS A;  4EDF A;  2YIU B;  2OYH C;  4WFB V;  3JAL A;  2K9Y A;  1I94 B;  2VWK A;  4IL6 X;  2WLJ A;  3AG1 C;  3AK3 A;  4IL6 E;  1K04 A;  4MT8 A;  1K7D A;  3BCC E;  1Q7Y W;  2R3C A;  1ZME C;  1MFZ A;  1NU1 J;  1EXI A;  1RM1 C;  1QBZ A;  4DR5 B;  1PGJ A;  3OW2 O;  1GL2 B;  2UUB B;  1UFI A;  3BY6 A;  3D71 A;  4RQF A;  3JAT B;  4U3J B;  1BE3 H;  3CX5 D;  1P84 D;  3G71 V;  1KIL B;  2BEZ F;  1D2D A;  1K3E A;  2O01 N;  1LTI C;  1MFT A;  2G38 A;  2OCC C;  2A06 E;  2LXC B;  5CN0 A;  1Y9B A;  4FZ1 A;  3HD7 D;  5KLI C;  4EKW A;  3O6Q B;  2WSS G;  3V2N A;  2ZE8 A;  1K8A Q;  1VQ4 V;  4DV7 O;  2I1J A;  5AVX B;  1NTZ E;  3OTO B;  4H44 D;  4AQY O;  4FFB B;  2PFX A;  4I0X B;  2BTO A;  1KYO H;  1PZQ A;  2C0W A;  5LA6 B;  3WB2 A;  1T8Z A;  1FZC C;  1MA1 A;  1O9H A;  3AEA C;  4LF9 B;  3OAA G;  4XFJ A;  1SLQ A;  2KKW A;  1BZK A;  4WBA A;  3K0D A;  4BIO A;  2P22 C;  4DV4 B;  5EZY A;  4FLW A;  1S5L X;  3GHG C;  3F5W C;  3H1I G;  1FBM A;  2Q9L A;  2WPR A;  4X65 O;  1NS1 A;  4UB6 H;  4CS2 A;  1YIT P;  4CPG A;  1V55 B;  5LHH A;  1FJK A;  1SQV J;  5J2T B;  2WSE J;  4J80 A;  1H0T B;  2R5D A;  3JAW B;  2G8Y A;  3ABL B;  4ZHQ B;  5HFL A;  1NTK K;  3K79 A;  4AQR D;  3E2E A;  5JVD A;  4D6T J;  4I55 B;  1ZTE A;  2N1T B;  1I7F A;  3KQG A;  4PDV A;  4DUY B;  3KDP B;  1K73 Q;  1GN2 A;  1XNQ B;  2HR3 A;  1E5W A;  3LID A;  2Y9Y A;  5FNV A;  2WLL A;  1R73 A;  2CGN A;  3BA9 A;  4DV1 O;  4DRX B;  1H38 A;  3H1K G;  5C93 A;  3AG2 B;  1H2S B;  2Q1K A;  1NTK G;  3UM7 A;  2X6A A;  4O9B A;  2GDS A;  1G4Y B;  2W0X A;  1FFT B;  3CXC U;  4JI7 B;  1BT8 A;  2V4H A;  4ZKP A;  2WLK A;  4IHJ A;  4QJF B;  1PM9 A;  1R3L C;  1VL2 A;  3V2Q A;  2VRZ A;  4MVZ A;  2F23 A;  1BCC G;  2BTQ A;  4CS4 A;  3QH9 A;  1QLE B;  1TA8 A;  3E8B A;  4JI0 B;  4RO2 A;  5CHX A;  3EXA A;  1OMI A;  1MNG A;  2JEX A;  4KUM A;  4LF5 O;  1PL4 A;  1YIJ V;  2AW9 A;  1NU1 K;  5APQ A;  5AVW B;  4UCS A;  2PRR A;  4PD4 E;  2XAQ A;  3F7Y C;  1G6U A;  3DC5 A;  2XAS A;  2O01 J;  5KX5 A;  1EZV H;  3E8G A;  3AG7 A;  1T3U A;  5GON A;  4I5S A;  4PEL A;  5APT A;  2P5O A;  3E22 A;  5JQG A;  4P30 A;  3BEH A;  1RQU A;  1Z56 A;  2JJL A;  1AR1 B;  3CCE P;  2VQE B;  5LMU B;  4B3S O;  2EIL C;  3AEF C;  1EFR G;  2JEE A;  5KAI Z;  2JS3 A;  1OCR C;  1CP9 A;  4LR3 A;  3SWK A;  5AVY B;  4GX0 A;  1G8M A;  1RF1 A;  1VQ7 V;  4MSW C;  4UUJ C;  2E5L O;  1VQ6 V;  3ZRS A;  5L3G A;  2WPD G;  3Q2Y A;  4O4H A;  3U0Z A;  1MAB G;  1YIT V;  1JM0 A;  3APQ A;  1NKD A;  1RHZ B;  1OCZ C;  1PGQ A;  3BAT A;  2JDI G;  3CCQ P;  4U7O A;  1KC8 W;  4LF6 O;  2Q5Z A;  1OX3 A;  3M9Q A;  2EIK C;  2KLU A;  4GDO A;  1M8O B;  1OCO C;  2O1K A;  2HFE C;  4LH6 A;  1BHA A;  4TQD A;  1VDF A;  3FX7 A;  5AG2 A;  1J1E C;  4DZO A;  3FWL A;  3FXD A;  1SQB D;  3WB1 A;  5H6R A;  1XL4 A;  4JI4 O;  5GTH Z;  1BSM A;  1OVR A;  4JV5 O;  2WQY C;  1A02 J;  4DV3 O;  1BE3 D;  1KIL A;  1SQV K;  3V2P A;  5EYP B;  3KXD A;  3S1K A;  2X6C A;  3N4X A;  1HNW O;  1SQP E;  3KYQ A;  1PNM A;  3NR7 A;  1JR9 A;  2R32 A;  3KG2 A;  2H94 A;  1VF5 D;  1RF0 C;  1T3J A;  2YO3 A;  3O6Q A;  2YXY A;  1M57 B;  5IJ0 A;  4HKZ H;  4JPR A;  3SWF A;  3AG4 B;  5KKZ B;  1FDI A;  4IL6 Z;  4YIO A;  1I94 O;  4I0X A;  2JK5 C;  1BQ0 A;  5CMZ A;  3N2K B;  2AXC A;  1NTZ G;  2AEJ A;  1KYO D;  1AR5 A;  1AI6 A;  3MIW A;  4GLX A;  1CW5 A;  3OEE G;  4DR5 O;  1BGY D;  2HFE D;  4C7R A;  1XQ8 A;  4ZKU A;  2F4V B;  2EIN B;  2Q6A A;  2UUB O;  1L4A C;  3TNU A;  2QEX V;  2JR8 A;  1H2N A;  2JO1 A;  3S3W A;  3L73 J;  3ABU A;  2EZP A;  3OGI B;  2GBO A;  2Q7C A;  3H9V A;  4MVO A;  2W6J G;  1HNX O;  4DJG A;  4R50 A;  1IC2 A;  4YXW H;  3A8T A;  1KU9 A;  3CI9 A;  1FAF A;  5J2T A;  5CCH A;  2NZ2 A;  3MP7 B;  1URQ B;  2QDO A;  3JAW A;  1M90 W;  3DC6 A;  4ZHQ A;  1GW3 A;  3D36 A;  4KXR A;  1SFC D;  4JQ0 D;  4I55 A;  1Y74 A;  1V9P A;  2QJP B;  1YJW P;  2ZT9 B;  1L2P A;  2XAJ A;  2OYI A;  3OTO O;  3OR6 C;  1MSD A;  1Q82 Q;  2P7T C;  2BSK A;  2KZI A;  2E76 B;  2LGW A;  2OYQ A;  1TU3 F;  2ITD C;  2IX7 C;  1NKZ B;  4LF9 O;  4KFM A;  4FLT A;  4L75 A;  3ZDM A;  1PIX A;  1L1F A;  1H8A A;  3AED C;  1YYC A;  1S5L Z;  4EFB A;  4DV4 O;  4OVN F;  3L75 E;  3L70 H;  5IYZ B;  4JF3 A;  1YTZ I;  2KP8 A;  3CXH I;  1U96 A;  4TSF G;  3HE4 B;  5CB4 A;  1L4A D;  3ETD A;  2YIB D;  2NPS D;  4UCT A;  4MN4 C;  4YTP C;  5AW2 B;  2W6A A;  2ZKO A;  5AW0 B;  1BE3 J;  1WLE A;  4FM2 A;  3OW2 U;  5CCG D;  3W7X A;  2N9Y B;  4DT0 A;  4I1L A;  4JPZ B;  1GTW A;  1NR7 A;  5IYC O;  3Q5R A;  4MVS A;  3W7T A;  4DUY O;  4TOI A;  1XNQ O;  5FLX N;  4MVM A;  2WT7 A;  1D7M A;  2D2C B;  3ASN C;  2XAH A;  2GUZ B;  4K3A A;  2QJY B;  3TXQ A;  4K8Z A;  4ZNC A;  1NVP D;  3RVY A;  4GCZ A;  1DH3 A;  3AE1 C;  4YY3 B;  5L3C A;  2KSE A;  3FYE B;  3UKM A;  3ZHS A;  3K57 A;  3JD1 A;  1JY3 N;  2OAR A;  4JBZ A;  4JI7 O;  4GYC B;  2K9J B;  4X1Y B;  5IT9 N;  1T6A A;  4FFK A;  3CCL V;  1K9M W;  2DYR B;  2AHY A;  4X20 B;  2WVR A;  1URF A;  3RYF A;  4JI0 O;  1L8D A;  4BW9 A;  2ZXW B;  3ZN1 A;  1N8R Q;  5KJ7 D;  3UQ8 A;  1JCD A;  1IXM A;  2Q3I A;  4WY4 C;  2L35 A;  2GUS A;  4DV5 B;  1YJW V;  2PI5 A;  4Z1M H;  3W7W A;  1MV8 A;  3CSX A;  1USE A;  1M1K Q;  1YVW A;  2QRX A;  4OWF A;  3IGA C;  2N04 A;  4UB8 E;  3RYC A;  2FYN C;  2MW2 B;  4FLX A;  1Q86 W;  1KZU B;  3HE5 A;  5APU A;  3SYO A;  2XV5 A;  2VQE O;  1S5H C;  5LMU O;  1S76 D;  4HNA A;  5EYP A;  3WU2 Z;  2Y48 A;  1NHL A;  3W7S A;  3I56 P;  3OR7 C;  2IJH A;  3CEI A;  1KB9 I;  3L73 G;  1FZA A;  3MZW B;  1FXV A;  3M7M X;  2M7W A;  4N6J A;  5EFW B;  3L37 A;  5IY5 B;  4QGP A;  4U3F H;  1YBK A;  1M56 B;  1MOF A;  3CP1 A;  2DW3 A;  3LIE A;  3N2K A;  1LWU B;  3SR2 C;  2Y0I A;  3HKC B;  2P58 A;  2P4V A;  1AJQ A;  5B66 Z;  1DIP A;  2P90 A;  4ZBM A;  1VQO P;  4WY4 D;  1GL2 D;  4WFA V;  1LTJ A;  1FYJ A;  1E79 G;  3WG7 C;  1Q8I A;  2R5B A;  2O1J A;  1W0K G;  1KKD A;  4ZKI A;  3TSI A;  1KQL A;  5H2F E;  1B06 A;  3KHU A;  1GRJ A;  1KQS O;  4LF4 B;  2EIM C;  2VS0 A;  4DUZ B;  2RN0 A;  2MJZ A;  4PI0 A;  1FXK B;  3E8F A;  1U7J A;  5D5Q A;  3P8M C;  4NXM B;  4BWA A;  1KQF B;  3CJH A;  2XU6 A;  3P8C E;  1YDX A;  1N7S B;  5LOV A;  2XAF A;  3ABM C;  5IJ9 B;  2FYU J;  2WPS A;  5KLV E;  4LBE C;  3CWB E;  3K9S A;  2ZYD A;  1B04 A;  5L3D A;  3ZRW A;  5B1B C;  2JKV A;  2DYS B;  3O65 A;  2JIZ G;  5KHG A;  3TGU H;  2UXB B;  1U7M A;  4MW3 A;  2F4V O;  2ZVN B;  4BR6 A;  1NTM J;  5EIB C;  3L70 D;  3OM3 B;  1SQX E;  2YUA A;  4FIP C;  1FU1 A;  4X1K B;  1S4X A;  2Y0P A;  3QTC A;  1N73 B;  1KOR A;  2CDY A;  1PP9 H;  1VQP V;  4BRY B;  1JVM A;  1PPJ G;  2W6B A;  2N1T D;  2B1G A;  2Q7E A;  1YI2 P;  1OXZ A;  5IYB O;  5BVZ A;  1VF6 A;  1AVM A;  3IAO A;  1EXJ A;  3HKB B;  2E75 B;  5J2U B;  2Q0A A;  1QVG U;  1US6 A;  1OV9 A;  5E1A C;  2GUZ A;  1VQO V;  2GA1 A;  1R3K C;  3CS5 A;  3BCC H;  5AW6 B;  3V5B A;  1XIL A;  3JCU H;  1U97 A;  3M06 A;  3PJS K;  3CC2 P;  1OHH G;  4I2L C;  2RMZ A;  4W80 A;  4X1Y A;  5EBM C;  2YIC A;  1SQQ J;  4LGD E;  2W0F C;  2QSI A;  2QKS A;  1QLE D;  4X20 A;  2F93 B;  3L72 E;  3ETE A;  4TV8 B;  2M0B A;  3GG2 A;  3L74 H;  2A06 H;  2EIJ C;  4A5U B;  1TVK B;  3ABK C;  2Q73 A;  2QTS A;  2GUV A;  1FDO A;  3CXH E;  1Q5O A;  1VPC A;  1EZJ A;  3LUT B;  1S1C X;  1P4R A;  2QE7 H;  3CD6 P;  1XHX A;  1FPO A;  3AK2 A;  2AXT Z;  1ZRT D;  2QA4 P;  1PNK A;  3E35 A;  1E1Q G;  1OFC X;  3M0D A;  3VP8 A;  2KOG A;  3R2P A;  4PI2 A;  2I8D A;  1BDC A;  2ZFC A;  5L8R J;  3FD9 A;  1FFX A;  3VN0 A;  4OPA A;  4YY3 O;  1K05 A;  3AEI A;  1QNM A;  3FX0 A;  4NYK A;  3M9B A;  1BMF G;  4EB6 B;  2FFD B;  1RPO A;  3CME P;  3HPL C;  1GD2 E;  1I5X A;  1HGV A;  3AE4 C;  1LT9 C;  1EZV G;  1NKN A;  2B89 A;  3K06 A;  2OYH A;  3K03 A;  2B9Z A;  2LP7 A;  3SJC C;  4LWS B;  2PAJ A;  3TXS A;  3SSU A;  5M1B A;  1RSO B;  2KUB A;  3DXR A;  2CTR A;  5BY1 A;  4DV5 O;  2FYU G;  4YXD C;  2R72 A;  3U10 A;  1IVS A;  3H1L J;  4UB8 Z;  3K08 A;  2YXL A;  4Y99 B;  1X0T A;  2PY5 A;  5BU5 A;  4MVR A;  1N0J A;  4DV2 B;  4X66 B;  4U7J A;  2ILM A;  4FLV A;  3FXE A;  3GWK C;  1BSN A;  4I9W A;  1NTM G;  3CC2 V;  3CXH F;  3HTK B;  4PD4 I;  3CMA P;  2CK3 G;  4UV9 A;  1NQT A;  3T1C A;  1M57 D;  1SQF A;  4MTX A;  1KV4 A;  1N7S A;  2A45 G;  1NT2 B;  5DM6 V;  2ZR2 A;  5IJ9 A;  1LR1 A;  4D7S A;  5K1X A;  1J5E B;  2ADP A;  2Q0O C;  5KLV G;  5JVD B;  4GKK B;  1FZC A;  3ZED A;  1B6Q A;  3CPW O;  5APV A;  3TGU D;  3H1K E;  2P06 A;  1GN3 A;  1GDT A;  2KB7 P;  4IFF A;  1WMK A;  2QA4 V;  1NTK E;  1SQQ K;  2WLL B;  1GM8 A;  5B1A B;  3GHG A;  5H2F Z;  3CYO A;  2DOS A;  3UIA A;  5EC1 C;  2FBW C;  4MS2 A;  1N34 B;  4N78 D;  3CC7 P;  4X1K A;  4JAA A;  3MDS A;  1SQX G;  1LUV A;  3O9O A;  2C2A A;  5E79 H;  5KAI E;  1GM9 A;  2Y9Z A;  1URQ D;  3BRC A;  4DUZ O;  1BCC E;  3ZHR A;  1N73 A;  2V7Q H;  4IHJ B;  2NR5 A;  1SQQ G;  3H1H H;  3CME V;  4NXM O;  5KHI A;  1PP9 D;  3HUS C;  2BTQ B;  2ZT9 D;  4J11 A;  2B1I A;  5DJT B;  3CRM A;  3M99 B;  4AHC A;  4NKG B;  5BMV A;  5JJJ B;  1NO4 A;  1OW6 A;  2E76 D;  3LDE A;  3ZHV A;  1Q6H A;  5LGU A;  4EEQ A;  5J2U A;  1N7L A;  3JD4 A;  4GIF A;  3VMZ A;  1HDJ A;  1IX9 A;  2ZR3 A;  3LNM B;  1JCC A;  4JGS A;  3T2M A;  3S4R A;  4DR2 B;  4PJ0 H;  3D70 A;  5KX5 B;  4U3F J;  3W7U A;  1NU1 E;  4FMT A;  3BCC D;  5GON B;  5LXT B;  3E22 B;  5JQG B;  3P7K A;  5GTH E;  1JFF B;  4IT5 A;  5BR8 B;  5LYJ A;  2O3J A;  2B9B A;  2RCV A;  2NLJ C;  1KB9 F;  2M6Y A;  5AVS B;  1RF1 B;  4TV8 A;  3CMA V;  3Q1M A;  4FK5 C;  1QQC A;  4WBN A;  4H13 B;  2JWA A;  5B3S C;  1ZUQ A;  4RQE A;  1O9G A;  3OMI B;  2A06 D;  2KK7 A;  3L74 D;  4ZIB A;  4H44 C;  5AW4 B;  4TUY B;  2C9N Y;  5BXZ A;  3RYH B;  3CCM V;  2Y69 B;  4WF9 V;  2KS1 A;  1AVO A;  3HKD B;  2QG4 A;  2JEU A;  2X6B A;  4JYC A;  1J1D C;  3IC9 A;  1QL1 A;  1RE3 C;  2HVK C;  3GF7 A;  1ZOY C;  4ZI7 A;  2EJ7 A;  1AV1 A;  2ZDI A;  1Q3E A;  1G1J A;  1SQB H;  3HRN A;  1DF4 A;  4DV6 B;  3H1L G;  3NFQ A;  3B8M A;  1H2G A;  2KSJ A;  2YXH A;  3B5N D;  3K5M A;  1JA8 A;  1GK9 A;  1YJN P;  3P32 A;  1CEZ A;  2EX3 A;  5CBN A;  1NZ6 A;  2AHZ A;  4EB6 A;  2FFD A;  1HNX B;  1FKA O;  2ATK C;  5APY A;  5LHG A;  1L0L H;  1K92 A;  4NB5 A;  3F5H A;  1NVO A;  4LWS A;  1LP1 A;  4MTF A;  1SQV E;  1RSO A;  5IJ0 B;  1JNM A;  2H3O A;  1XUQ A;  1PGP A;  2GHY A;  3HKE B;  1DX7 A;  4D6T E;  3CCV P;  1AJY A;  1HVV A;  4OPH A;  3B71 A;  4YJ2 A;  3ZBH A;  1BGY H;  3LNN A;  5KHJ A;  1Q81 W;  1Q2N A;  1L0N H;  4BAY A;  1NH2 B;  4DR6 B;  1S5L E;  4K35 A;  3HTK A;  3TNU B;  4AYC A;  3L71 H;  3L75 H;  4Z1V A;  2YKP A;  1YCI A;  5H5N A;  2R44 A;  2YMK A;  5HFM A;  1KD1 Q;  2EUL A;  1M56 D;  2QWO B;  1JY2 N;  2IH1 C;  1SER A;  1WB8 A;  4YPC A;  2OTJ P;  1BHB A;  2A9H A;  5JH7 B;  3JD2 A;  3IF4 A;  5AW7 B;  1P84 E;  1Y74 B;  3RK3 E;  1M7L A;  1Q6U A;  4WB4 A;  2OYI B;  3MUD C;  4N23 A;  4IYH A;  3ZRV A;  2PGD A;  1THZ A;  1IZ3 A;  2ARH A;  2BSK B;  4JI8 O;  1W2B O;  4H37 A;  3L74 J;  5IDJ A;  2K3R A;  4I4T A;  3CRQ A;  2QR4 A;  4DV2 O;  4X66 O;  2QWR B;  2L5G B;  4U3F G;  1HH0 A;  5AW9 B;  1HWT C;  3JCZ A;  1GW4 A;  3A0H E;  4W7Y A;  5B5E E;  2XUM A;  5CB4 B;  1SA0 A;  3H1H D;  1ENV A;  1QCE A;  3KCY A;  2H89 C;  2M3B A;  5K5G B;  4C7N B;  1IK7 A;  4HH2 A;  5EBL C;  2KG7 B;  2B88 A;  3A0B H;  1WB7 A;  4OGQ B;  1J5E O;  3D3Q A;  1SVF A;  4GKK O;  3KZI E;  1FD9 A;  3X2Q C;  1UIX A;  3FB5 C;  3P3N A;  1FZG A;  3H1J H;  5KAF Z;  3CCV V;  1ZN5 A;  2WT7 B;  2Y4U A;  4MVQ A;  5LXT A;  1EZV I;  3RBZ A;  3O8Z A;  1NU1 G;  1JFF A;  2XAG A;  3RYI B;  1JOY A;  5KA6 A;  1N34 O;  3NMD A;  3ZHQ A;  2JJ1 G;  3WUU A;  1LTT C;  1JQ0 A;  3WU2 E;  1VF5 C;  4H0L B;  5GW7 A;  1IFJ A;  3AE2 C;  1XHZ A;  2XND H;  2ZXX A;  1SQP D;  2CTQ A;  1SZT A;  4TUY A;  4B3T B;  1BSH A;  3RK2 B;  1W5C E;  3RYH A;  2W8Z A;  3TCU A;  1CXZ B;  2AEF A;  3RYF B;  3HKD A;  2OTJ V;  2QJK B;  2E75 D;  2Q7G A;  2F66 C;  4CZZ A;  4I7Z C;  1SZX A;  2L6L A;  2WLI A;  3ZMV A;  2YO2 A;  3CCU P;  2N05 A;  5B66 E;  4B7K A;  1W2E A;  4DR2 O;  1ZP0 C;  3E1R A;  2A45 I;  3B2E E;  2YNY A;  3RYC B;  3HE5 B;  3BAA A;  5CA1 B;  4NXN B;  3SPH A;  5H6Q A;  3SWY A;  3MHS C;  4HNA B;  5BR8 O;  3L73 E;  1J95 A;  2AEM A;  4PD4 F;  1IUR A;  1PL0 A;  1SFC C;  1YXB A;  1L0L D;  2QTO A;  1QR8 A;  4Z2W A;  3B4S A;  5KUK A;  2IBZ G;  4J42 A;  1HR0 O;  2JRI A;  1SQV G;  3RL0 C;  3HKE A;  3K0G A;  3LW5 J;  4PV1 B;  2YI8 A;  2E3C A;  2LR2 A;  1A02 F;  1TUB A;  3FB6 C;  5AW8 B;  4D6T G;  2V7Q J;  3QO7 A;  3H1H J;  3T97 A;  5GTI Z;  4GOD A;  1Y66 A;  4DV6 O;  3CRC A;  1LTJ B;  2LO1 A;  1ZL8 B;  1M1J B;  2NPS C;  2ZJS E;  1GKF A;  3CCE V;  1L0N D;  3C3S A;  3L36 A;  3L71 D;  3L75 D;  1CI6 B;  2QE7 G;  4RES B;  1EDK A;  3GMA A;  4N21 A;  2LKM A;  4QNH B;  4O4I B;  5FPR A;  2ZM6 O;  3RT3 C;  5CA0 A;  2Y0D A;  5CCG C;  2Q69 A;  3H6P A;  4EI2 A;  3JCU Z;  5JH7 A;  3JD0 A;  3CJH B;  3SJQ C;  3OMN B;  1YTZ T;  1I0H A;  1AJP A;  2Q3E A;  2UU9 B;  4Q6G A;  1YZB A;  3CCQ V;  1BE3 E;  4AI8 A;  1SP4 A;  1PFI A;  5CBO A;  5LOV B;  2HP8 A;  5EBW C;  3AE9 C;  1P7G A;  5LP6 C;  3RL0 D;  3ZRW B;  4CBC A;  2C9L Y;  2HJD A;  2IDB A;  4KHX A;  2OCH A;  1BS3 A;  3EFF K;  4KJM A;  1YTF B;  3CCU V;  1Q7Y Q;  3JAR A;  2FB5 A;  3BPZ A;  4PDR A;  3OGC C;  4FVM A;  1FC2 C;  2RN9 A;  4CH3 A;  4QIW F;  1QVF U;  1ZW0 A;  1VQK P;  4DR6 O;  1K4D C;  4L8J A;  3TET A;  2FML A;  4JI5 B;  2E74 C;  4HJG H;  4HZ3 A;  1KYO E;  3U59 A;  1H89 A;  1PL5 A;  4J7J A;  5AVR B;  1SQB J;  1KN7 A;  2X7R B;  3F89 A;  5TIS Z;  3TYY A;  4C7N A;  5KJ7 C;  5LHI A;  2N9B A;  2XKM A;  2ZE5 A;  3OT7 A;  4IFM A;  1PPJ E;  2IJK A;  2KG7 A;  4XE5 B;  1R6N A;  4TT3 G;  1ZLL A;  3H32 A;  3SJB C;  1D5A A;  1KEC A;  3GF3 A;  2F1M A;  5TJH A;  4GX2 A;  2CH7 B;  3U1C A;  5ITZ B;  4ASV A;  3CXH H;  5L3E A;  1FJG O;  1KFN A;  4UB6 E;  4NR1 A;  5L3F A;  1L0L J;  3WMM 0;  1MZ9 A;  3D6Y A;  3H1J D;  1S3J A;  2RKL A;  2AXT E;  3RYI A;  4X88 A;  4X9Q A;  1V54 C;  2R9R B;  3TK1 A;  4JYA B;  3C1L A;  3BAS A;  3A0R A;  1MMM A;  3USS A;  3A0H Z;  2N74 A;  5B5E Z;  3T1H B;  2YIU C;  2IFN A;  2FXO A;  1K4C C;  2WA4 A;  3GWO A;  3JAM N;  3AEG C;  2FKW B;  2XDJ A;  1VQ9 V;  2P2U A;  3AG3 B;  3ICX A;  1BGY J;  3ABV C;  2E74 D;  4W4K A;  1SET A;  1NJI W;  3PH0 A;  3S9O A;  1L0N J;  4UXN A;  2WSS H;  3KZI Z;  3L71 J;  2LGQ A;  1GL2 C;  4L73 A;  5KHH A;  2ODM A;  1COW G;  5FPO A;  3VTP C;  2YSU B;  3RBX A;  1KIL C;  3QG5 A;  1OVV A;  2V7Q G;  1ROP A;  4DW1 A;  3H1H G;  3ETQ A;  3B40 A;  1H2L A;  4DXW A;  5CA1 A;  3OFN G;  4PDL A;  3RK3 B;  1ARO P;  1DTO A;  5EC2 C;  1EM1 A;  3Q4H A;  1YEW A;  4XA4 A;  1PGO A;  3JAK A;  1FFX B;  2VWJ A;  3H1I H;  2P6J A;  3OUF A;  1RY3 A;  2J58 A;  2RNB A;  4HBN A;  4UVA A;  1SQG A;  3HD7 B;  3EQ2 A;  4TV9 B;  5IE9 A;  2PTM A;  1XEQ A;  3ASO C;  1EZV E;  3T1Y B;  3ABT A;  2BCC H;  1S5J A;  3F5T A;  1S72 P;  1AFO A;  4B3T O;  3M8A A;  3JC2 2;  2OYH B;  4N3Y B;  4ASW A;  3P8C D;  1EDJ A;  1MSW D;  1ZWI C;  2A7W A;  1J1D B;  2FYU E;  1MUU A;  3DXR B;  2WLM A;  3AG1 B;  1AVY A;  3ZMU A;  4GOE A;  1R6K A;  1KB9 H;  3CL3 D;  3AK1 A;  1RM1 B;  2ZNI A;  4GX1 A;  1QHT A;  1EQ7 A;  1N86 A;  1V55 C;  1KTM A;  1ZL8 A;  2YC0 A;  1M1J A;  1Z2G A;  1LT1 A;  3BA8 A;  1VQ5 P;  1SQB K;  2WWW A;  1KIL D;  4NXN O;  1DGS A;  1NTM E;  5CCH C;  1VP7 A;  1CI6 A;  3ABL C;  1Y76 A;  4O4I A;  1KQG B;  2K1A A;  1IBK B;  1ZSP A;  3RWR D;  2OCC B;  1UJW B;  1HGZ A;  1RE4 C;  3B8N A;  3H1J J;  2N1T C;  2WZ7 A;  1J2J B;  4IGG A;  1XNR B;  2RDC A;  1N33 B;  1BCC H;  1SQB G;  3P30 A;  3N7N A;  5KLI B;  1L0L K;  3MGN A;  1NI8 A;  1OW7 A;  3I55 P;  3AG2 C;  1KC8 Q;  2J5U A;  2W6I G;  1DEB A;  1GMG A;  1BE3 G;  1FZB A;  3A2F A;  1GO3 F;  1FAV A;  4J7Z A;  1SS1 A;  1KP2 A;  2CE4 A;  1FZC B;  5KA5 A;  3SYA A;  2LFS A;  4IYI A;  1VQN P;  3RGU A;  3H25 A;  5LGT A;  4QE9 A;  3OTF A;  2R70 A;  2WAM A;  2A79 B;  4PA9 A;  3S3X A;  1X4T A;  2KXP B;  1QLE C;  3OE7 G;  3GHG B;  1HJB A;  1QGK B;  3I56 V;  1L0N K;  1SQQ E;  2WSF H;  5CCH D;  2IJI A;  4I9Q A;  2HVJ C;  1U57 A;  2BAS A;  2QWP B;  3L72 D;  1OVU A;  1BGY G;  4RJT A;  1S72 V;  2JDI H;  2UU9 O;  1HW7 A;  2CH7 A;  5ITZ A;  3U11 A;  3STZ C;  5BMV B;  1L0N G;  3CCJ P;  1IBL B;  3EFG A;  3CXH D;  2IU0 A;  2DWE C;  2HOD B;  2KSD A;  3GB7 C;  4IL6 H;  5KMG B;  4JZG A;  2P4K A;  4GKG A;  2A0L A;  2CTP A;  2IBZ I;  1GAX A;  4QPK A;  1WT6 A;  3KKY A;  1Q6I A;  1K8A W;  2M8R A;  2DWD C;  1P7B A;  1KP3 A;  4E2L A;  4JI5 O;  1F23 A;  5LYJ B;  1Y8A A;  4Y28 J;  2Q5U A;  1T5E A;  4FM1 A;  4AUW A;  4NTW A;  4X64 B;  2LXB A;  4JI3 O;  3PRJ A;  3VBB A;  2GSM B;  2OIE A;  1I08 A;  5AW5 B;  4WBN B;  3UO2 A;  1WJZ A;  4OGQ D;  1M90 Q;  5AVV B;  4UVC A;  2LW1 A;  4UB6 Z;  2KS1 B;  2HEP A;  2JP3 A;  1NTZ H;  1JCH A;  4ZI7 B;  3CCR P;  4DYL A;  3H1L E;  4FM0 A;  3G67 A;  1VQN V;  2EIL B;  4JYA O;  3C8V A;  4DO2 A;  1OCR B;  3IFX A;  1M57 C;  3HD7 A;  3T1H O;  3H1I D;  4TV9 A;  3CX5 I;  1P84 I;  3IR9 A;  3AG4 C;  5KKZ C;  1S5L H;  2W6J H;  3BRT B;  5BZB A;  1OJH A;  1K73 W;  3RK2 D;  1G1X B;  5EK0 A;  4BXL A;  3PHL A;  4JAS A;  2JGU A;  3LSU A;  2MK3 A;  2BCC D;  5LL6 Y;  1OCZ B;  3UT5 A;  3QWO C;  1FOS E;  4XBF A;  1LP1 B;  3FYI B;  3L70 J;  2ZXE B;  1WP8 A;  1RE3 A;  4L76 A;  2EIK B;  1JMK C;  4H33 A;  3QF7 A;  1S77 D;  2EIN C;  3V4Q A;  4DR3 B;  1OCO B;  3CRR A;  1YI2 V;  5C39 A;  1AI4 A;  1JMM A;  1KB9 D;  1LTA C;  4JI8 B;  1J1E B;  3K9A A;  5CBF A;  4YJ2 B;  2DW4 A;  1OCC C;  2XND G;  3SPG A;  4I6M C;  1USD A;  4R6Z A;  1Z5W A;  2QWN B;  1S2E A;  2OWO A;  2ZCE A;  3H1K D;  2YIA A;  1NTK D;  1URQ C;  3FAV A;  4WWI A;  3UCS C;  3LSQ A;  2IYP A;  3GW6 A;  2CTW A;  3PN1 A;  4FPP A;  3ZIA G;  4CH4 A;  3EVK A;  2OTK E;  2QJP C;  2ZT9 C;  1VQ9 P;  3G6B A;  1QX8 A;  5CMU A;  2ZYG A;  1VMG A;  3PLN A;  4C7U A;  4YHH B;  3T1Y O;  4JI2 B;  1BCC D;  2E76 C;  1K9M Q;  4PV1 D;  4JTD B;  4DK0 A;  5A9G A;  2WA3 A;  2Y0C A;  3STL C;  4DR1 B;  1SKV A;  1YF2 A;  2UWJ E;  1X9V A;  2PYL A;  4J9Z B;  3CD6 V;  1WPX A;  4CC5 A;  4PD4 H;  1M93 A;  4X8A A;  1KBH A;  1QEX A;  3IFM A;  3IC7 A;  3K58 A;  2H8P D;  1PV3 A;  1N2D C;  1FS0 E;  4UV8 A;  4U3F E;  1NBM G;  3VQX A;  4A7P A;  1P49 A;  5KAF E;  1FZF A;  3ZMZ A;  1JUN A;  1Q86 Q;  1L4A B;  4I4T B;  1SF9 A;  4JZ2 A;  1QR9 A;  3B77 A;  2EZO A;  3AEC C;  2R9I A;  4G2K A;  5KUM A;  4ASU G;  4OX9 B;  2IPP A;  4OXS A;  1TAE A;  1IBK O;  2WLH A;  2K37 A;  3WU2 H;  1VQL P;  3I5C A;  3DGE A;  1SA0 B;  1XNR O;  1AJN A;  1N33 O;  4WFE A;  4F6R A; 
#chains in the Genus database with same CATH homology
 2D2C C;  3Q1M A;  4OGQ D;  3AE4 C;  2H89 C;  2BEZ F;  2QJY C;  2BEQ D;  4H13 B;  1IK7 A;  4H44 C;  1KQF B;  4YTP C;  3EWK A;  2FXP A;  3Q2Y A;  4H0L C;  1Y9B A;  1KMI Z;  5M1B A;  2JP3 A;  4OGQ B;  2H88 C;  3AEE C;  3AE9 C;  1R8E A;  2G3A A;  3GF7 A;  5KLI C;  1ZOY C;  2IDB A;  1UIX A;  4YXD C;  3Q5R A;  4GDO A;  2QJK C;  4H44 D;  1KTM A;  3C8V A;  1MKM A;  4H13 D;  2D2C B;  4U7J A;  1OW8 A;  3AEA C;  1RQV A;  5KKZ C;  4XFJ A;  4H44 B;  1KQG B;  2E74 C;  2WQY C;  4R4M A;  2E75 C;  3AE1 C;  1VF5 C;  1PL5 A;  4H0L B;  1S5L X;  3AE2 C;  3Q3D A;  2OQQ A;  1YQ3 C;  1GMJ A;  3IN6 A;  1DD3 A;  1OW7 A;  1KOR A;  2J5U A;  2P10 A;  3GF3 A;  2D2C D;  2E75 D;  2WSC J;  1VF5 D;  3O6Q A;  4I7Z C;  3SFE C;  2WSE J;  1YQ4 C;  2QIW A;  3Q5S A;  2G8Y A;  4H0L D;  1FDI A;  3H25 A;  3IAO A;  3B71 A;  1EXJ A;  3D6Y A;  2E74 B;  1AJY A;  2E75 B;  1VF5 B;  1ZP0 C;  3AE6 C;  4PV1 C;  4Z1M H;  3AE8 C;  1WMK A;  1HJ0 A;  3AE7 C;  2FYN C;  2QJP C;  3D6Z A;  3Q5P A;  2ZT9 C;  2YIU C;  2FBW C;  3AEG C;  2JO1 A;  2E76 C;  4I7Z B;  1U57 A;  2YMK A;  4PV1 D;  3R4Y A;  1Q90 D;  2QSI A;  2E74 D;  1JB0 J;  3ABV C;  4R4L A;  1NYH A;  3S9O A;  2ZT9 D;  3AEB C;  1VL2 A;  3LW5 J;  4PV1 B;  2NZ2 A;  2WSF J;  1FDO A;  3FGA D;  2WPV B;  1OW6 A;  3SFD C;  2E76 D;  4RKU J;  3RK3 E;  1PV3 A;  3T97 B;  1OMI A;  1S1C X;  2V7Q J;  2ZT9 B;  2MKV A;  4H13 C;  2K9Y A;  3AE3 C;  1DIP A;  3RL0 g;  1ZRT E;  3D70 A;  2E76 B;  4IL6 X;  3AEC C;  3G9R A;  4KT0 J;  1DD4 A;  1K04 A;  1TU3 F;  4OGQ C;  2O01 J;  1ZME C;  5L8R J;  1PIX A;  1HF9 A;  1EXI A;  3AED C;  4Y28 J;  3GLM A;  1NGM B;  1K05 A;  1RQU A;  3GMA A;  1KIL E;  4TT3 H;  3AE5 C;  3D71 A;  3AEF C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...