1IJDB

Crystallographic structure of the lh3 complex from rhodopseudomonas acidophila strain 7050
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
40
structure length
40
Chain Sequence
AEVLTSEQAEELHKHVIDGTRVFLVIAAIAHFLAFTLTPW
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords LIGHT-HARVESTING PROTEIN B-800/820, ALPHA CHAIN
publication title The crystallographic structure of the B800-820 LH3 light-harvesting complex from the purple bacteria Rhodopseudomonas acidophila strain 7050.
pubmed doi rcsb
total genus 13
structure length 40
sequence length 40
chains with identical sequence D, F
ec nomenclature
pdb deposition date 2001-04-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00556 LHC Antenna complex alpha/beta subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.250 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ijdB00
3WMM0 1DX7A 1IJDB 1KZUB 2FKWB 1JMMA 1NKZB 1JO5A 1WRGA 1LGHB
chains in the Genus database with same CATH superfamily
4HKZH 3ABVC 1G1JA 3BCCE 2D2CB 3N4XA 3PRJA 2QJPC 2QVAA 1J1DC 5KKZC 4BXLA 1NTZD 4U3FE 3G3ZA 2QM7A 2P10A 3Q2YA 3BCCJ 1Z56A 4N78D 1SQQD 1T2KC 4IOIH 1L0NG 3S4RA 1GL2B 1KZUB 1RY3A 5BU5A 2ZVNB 4ZKUA 1JTHB 2FYZA 4HH2A 1SQPK 3CCVP 1ZV8A 1X0TA 3L72E 1S5LE 4U3FD 2ZYAA 3EQ2A 3GMAA 1YI2P 1ZLLA 1NTME 3C9IA 1RQUA 2KP8A 1IK9A 2NPSD 3KZIH 3L72J 1BSNA 1S5LX 1VQKP 3AEEC 2OYIC 1KYOI 1SQXE 1AQ5A 4H0LD 1NTMJ 3II6A 3R4YA 3W67A 3HE5A 3CCUP 2AEFA 2KSEA 1SQXJ 1NU1E 3BATA 2V4HA 2P58A 3CXHE 2CPSA 3M0DC 2L5GB 1KILD 2AXTE 1NU1J 1M56D 2FYUD 1GK4A 2R3CA 3FWNA 1JEKA 2LXBA 2IBZD 3FGAD 3RGUA 2KZJA 3AE8C 2Q1KA 1BDCA 1LTSC 1OXZA 2FBWC 3CPWO 3I56P 4H13B 3L73G 1E5WA 1ZOYC 4ZNCA 5GTIE 2E74B 1AFOA 2OTKE 1SQPJ 1OW7A 2O1KA 2P7JA 3GF7A 1LTGC 4EOTA 3SWKA 1NGMB 2N9YB 1IZNB 1IFPA 3D70A 3GG2A 4I6MC 2PRRA 3CX5E 1EZVD 4WB4A 2A45I 4OWFA 2I8DA 2FYNC 3BRVB 3H1JD 4IFDK 1HF9A 3NXSA 2JO1A 4PD4H 1SFCC 4EIJA 1QX8A 1FJPA 1U57A 2E76B 1T8ZA 1N7SB 2I1JA 2N1TC 4N6JA 3CX5D 1JB0J 2B9BA 3H1KG 1L0LE 2H7HA 2E42A 2OTJP 4Y99B 5APWA 4W7ZA 3L74D 5KLVK 5KLIC 3G4SP 4PV1C 2Y0DA 4W7YA 3H6PA 5KTBA 2K9JB 2P2UA 2O01J 1KFMA 5KJ7D 1L0LD 1H0TB 1M8OB 3N7NA 4N3YB 5B66E 1BCCG 4M3LA 2WVRA 3D6YA 3L36A 1URQA 3RL0C 3AEFC 5E79E 2G8YA 1SLQA 2RH0A 1S9KD 2JEEA 4H13D 1KQLA 1IFJA 1VQ6P 1EQ7A 1HGVA 1GDTA 3TGUD 3S9OA 1RF1C 4OVNF 2FKWB 2RMZA 3JCUE 3L70J 2QM8A 3NFQA 1USEA 1HWTC 1W2EA 2QJPB 1J1DB 5KKZB 3FXDA 2J5UA 2QEXP 1PPJD 1PGJA 3TNUA 1DIPA 2AEMA 2WT7A 3P8CE 4C46A 5KLVE 1OW6A 5CJ4A 3WUTA 2E76D 3M91A 4UB8H 1SQBD 1N7SD 3H1HE 1SQVE 2J58A 5KLVJ 4JQ0D 1FDIA 1LWUC 1FZFA 4B86A 3H1HJ 1EZVI 1PGQA 1SQVJ 3Q5RA 2NRGA 1NTKK 1NKNA 1BE3E 1OIPA 5KAFE 1BGYJ 3U1AA 4BRYB 2OYIB 1HH0A 1NKZB 3AECC 4XA4A 1VPCA 3OA7A 1VF5C 1PV3A 1BE3J 3CX5I 1L4AD 1OVUA 2O01N 1M7LA 1NVOA 1IJDB 2C0WA 2Y9YA 2K3RA 2MJZA 5APTA 3WU2H 1GD2E 3BVHA 2ZYGA 3LW5H 5B5EH 2M8RA 2FXOA 3L71G 4WY4C 1YTZI 3M06A 1R5LA 2JR8A 2JP3A 1PFIA 1Y8AA 1Y47A 1RE4C 4DZOA 4Z1MH 5AW4B 2E75C 5BVZA 3FX0A 3B4SA 2JWDA 1JY3N 2NPSA 1MZ9A 1PP9E 1T2KD 3CCJP 1NTKE 1W5CE 3HD7B 1BDDA 1PP9J 1M1KQ 1IFIA 2W6AA 5AVVB 5M1BA 1NTKJ 5CJ0A 2KIKA 4IL6E 4H44C 2R3SA 2FYNB 3R2PA 5BU8B 1EXJA 1SFCB 1KYOE 4IL6X 4PJ0E 2BCCG 4D6TE 3KDPB 4AUWA 3OW2O 2N1TB 3AE1C 5CBNA 4D6TJ 1NTZK 3CMEP 2LKMA 1VQNP 5KLIB 2ZAEB 4PV1B 2Y9ZA 2HR3A 2K37A 2XDJA 1VQOP 1R5SA 1A02J 1N86A 5AVWB 2KLVA 3CWBG 1GL2A 5AW8B 2WPQA 1L0ND 4EDFA 1FAVA 3RL0B 5AVZB 1FZCA 1NH4A 3WMM0 3V2NA 1IC2A 1J2JB 4NPDA 3AEBC 1CSBA 1CI6B 3Q5PA 3MGNA 1S4XA 3RL0g 4AQRD 1FZEA 3MZWB 1G2CB 5AW2B 3CC2P 1OX3A 4UB6E 3L75E 4QMAA 2IFMA 4ZKPA 1NTMK 1OW8A 1RF1B 5EFWB 1VQ9P 4K35A 1SQXK 3L75J 3AE3C 1YQ3C 1HUCA 2FYUK 3HUSB 3VMXA 3ZDMA 2W8ZA 1K05A 3RK3C 2HODA 1NU1K 3MUDA 1NTZE 4XFJA 1K73Q 1SFCD 3L37A 3O8ZA 4N78E 5AW5B 1SQQE 3VP8A 3CCRP 3O6QA 1S72P 3D71A 4GOFA 1LTTC 3A0HH 1NTZJ 2B89A 2N1TD 1SQQJ 2AXCA 1LWUB 1N7LA 2E5YA 1N73A 4PV1D 2RN0A 2C9NY 2WPSA 1HBWA 1IO4A 4IFMA 4U3FJ 3L73D 3MD0A 1VF5B 4DOJA 2KSJA 3CCQP 1FE6A 1AJYA 2V7QH 2KYVA 2WMMA 4GT1A 3WUVA 3RL0D 2GUSA 3EWKA 1KN7A 1FDOA 1KILE 4WWIA 2N9BA 2IFNA 1FBMA 3MTUE 1GW3A 1FOSF 2KOGA 5GTHH 4OGQC 4KJMA 1EC5A 1YITP 2FYUE 2A06G 1PIXA 2AEJA 4LLHA 4L73A 1QVFO 2BEQD 5AVSB 2KLUA 2IBZE 2JJLA 4WY4B 2FYUJ 3V2QA 3WUUA 5KAIH 2YXQB 1DH3A 2H8PD 3TYYA 1E79H 5AVYB 3H1KD 2R5BA 2OGUA 1URQC 2IPPA 2PP6A 3AE2C 3CCMP 2Q5UA 2E75B 1L0LK 2K9YA 2UWJE 4PD4E 3H1LG 1JNMA 3P7KA 2K9JA 2OYOA 2ZFCA 1JY2N 3H1IG 4Y28J 5CBOA 1M1JB 3LIEA 1LT1A 1NAYA 3HTKB 1JCCA 1FZGA 3T97B 2Q9IA 4LGDE 2KS1B 1BCCD 4NPEA 4PD4D 2Z5IA 2JKVA 1EZVE 1YTZT 4H44B 2A45G 2FXMA 3B5ND 3GF3A 2XNXA 3H1JE 1GTWA 1SP4A 1DD4A 3AEAC 3IN6A 3VN0A 2BEZF 1R8EA 1PL5A 1VF5D 2QIWA 4EYYQ 1QGKB 2P1JA 3H1JJ 3H32A 5K5GB 3CC7P 1HTLC 3BCCG 5CCHA 1RF0A 2B87B 3L74E 4LC1A 3D6ZA 3EFFK 4WBAA 5APXA 1SQBK 3CXHH 3L74J 3SSUA 2Z4EA 3GHGA 2H88C 3P32A 1YJ9P 1KQGB 2YMYA 3L72G 4WY4D 1X79B 4IFFA 5H2FE 2KXPB 1NTMG 1L0LJ 3A5TA 1GU5A 3VP9A 1IFDA 1YJNP 2WSCH 1KV4A 1SQVK 1SQXG 3F5HA 1S9KE 2E75D 2E43A 2Q3IA 1P84D 4UB8E 3M0AA 3TGUE 1NU1G 3SFEC 3M9QA 5GTIH 1X22A 3TK1A 1GZLA 1L4AB 1AV1A 1EDLA 2GUVA 3TGUJ 4CPGA 1Q86Q 2XZRA 1NYHA 2YIUC 4H44D 3USSA 2I1KA 3RK3B 3L71E 3VMZA 2OARA 1LP1A 1HJBA 1Q90D 1PPJE 1YJWP 3KHUA 2IBZI 1K9MQ 1FDMA 1P84H 1SQBE 3KYQA 4W80A 1GMJA 2JDIH 3IR9A 2KNCB 5CCGA 3L71D 5TISE 1SQPG 4PD4I 1SQBJ 2DW3A 1NWQA 3NTNA 2WITA 1J1EC 1DD3A 2O3JA 5B5EE 1KFNA 2QG4A 3HD7A 2KI7B 1K8AQ 3EFGA 3AE4C 3FXEA 3B5NC 2FFDA 2QRXA 5CMZA 1N8RQ 3M9HA 5C39A 2IYPA 3SWFA 2WTYA 2D2CC 1KB9D 2WSEJ 4OGQB 1N2DC 1U7MA 1OVRA 2WSFJ 3CI9A 1Q82Q 1KORA 2FXPA 2BCCD 2QA4P 1KD1Q 1LTJA 1FJKA 1OMIA 2N1TA 1CW5A 1GL2C 1JMBA 4TLFA 3PP5A 2OYHA 1LT9A 2ZYDA 1URQB 4C7NB 1FZCC 3RK3D 1QEXA 3JCUH 1Q7YQ 3RBZA 3PHLA 2ZVOB 1NO4A 1UIXA 1RE3C 1KB9H 3VMYA 3KXDA 5AW6B 1ZR4A 3CCLP 4TT3H 3JC22 3Q5SA 3CWBD 2Q7CA 1K04A 1LJ2A 3A7OA 3VTPC 3L70G 1CI6A 4DT0A 3B71A 3MUDC 3G9RA 3TNUB 4I1LA 4I7ZC 1X9VA 2YO2A 5CHXA 3PH0A 1RF1A 2KUBA 1MFTA 2HFED 1PGPA 3Q1MA 2WPRA 1KILA 2W6JH 2YNYA 1QVGO 3HUSA 3FWLA 1FS0E 1N73C 3I55P 5KLVG 4OGQD 2POHA 2GM4A 4YXDC 3CC4P 2B88A 3IAOA 4KHXA 2W83C 1H88A 3TSIA 3H1HG 1SQVG 1JY3O 4WVZA 2M3BA 3PLNA 2E74C 1KTMA 3HE4B 4NPFX 1BGYG 1L0NE 1PZQA 1ZRTD 1SQQK 4MN4C 1AVYA 1LWUA 1BE3G 1URQD 4HB1A 4O9BA 1L0NJ 1VL2A 2ZT9C 3H25A 4JPZB 4JYCA 3CCEP 2ZXEB 1JTHA 2ZXXA 2YO3A 4GDOA 1KMIZ 2W27A 1RH5B 4JF7A 1FZAA 1ZN5A 3PJSK 4JBZA 4Y99C 1ZXGA 2IZ0A 1M90Q 3V5BA 4L75A 1D7MA 4DCKA 3A0BH 3W68A 3A3YB 3CL3D 5DJTB 3AEGC 1USDA 5DJUB 2A06D 2HLOA 2M5AB 1KQFB 3KZIE 5AW3B 2V7QJ 1JOCA 5GTHE 3VOPA 3P8MC 3TDKA 1PP9G 1J1EB 2E5TA 1NTKG 5KJ7A 4C7RA 3H1LD 3L73E 1RHZB 3CLQA 5KAIE 2K88A 1EXIA 1M1JA 3RBXA 2Z5HA 1OVVA 3H1ID 3VYIA 2NZ2A 3L73J 1YQ4C 5CCHC 3B5NB 3S1KA 3V4WA 2BASA 1RF0C 2KS1A 3G6EP 5AVQB 4D6TG 2QJYC 1NAFA 1YIJP 1VQLP 3VMAA 2Y0EA 3GHGC 2P67A 3L4FA 1VQMP 4UB6H 4GOEA 3BCCD 4L74A 2B87A 3H1KE 3AE7C 1WMKA 3BASA 1FZCB 2IZ1A 4GIFA 2G3AA 1DX7A 3M9BA 3RK2D 1YYCA 2IDBA 1Q2NA 3H1KJ 1ZR2A 2A45H 1N7SA 1GK6A 1A02F 2WWWA 2W6BA 2H89C 1MKMA 3L72D 2M3EA 3TF5A 1MV8A 3ITKA 1BCCE 2HPCB 1NTMD 3GW6A 1WRGA 3L75G 2HODB 4ASWA 1BCCJ 1SQXD 3HRNA 1T6AA 4I7ZB 1H0TA 3GLMA 3O6QB 1IFNA 1NU1D 3F89A 1L4AA 3CXHD 2XV5A 1NTZG 5CCGC 3L35A 5AVUB 1N73B 1S5LH 1NOHA 4R4MA 1SQQG 4YPCA 2D2CD 2WSCJ 3BRTB 4AYCA 1SQPE 1NHLA 2QSIA 1XTCC 4YXWH 3E1IA 1JCDA 2HG5D 1AA0A 1JY2O 1GL2D 4U3FG 3HD7C 2KNCA 3G71P 1FZBA 1OFCX 2FFDC 3AEDC 2CPBA 1SQPD 2Q6QA 5AVTB 2AXTH 4RO0A 1DEEG 2ZT9B 5APQA 3E7KA 1P84E 1QL2A 3HE5B 1LNQA 3SFDC 3CMAP 5AW1B 1LTJC 3SWYA 5APUA 3V4QA 3MHVA 4GKGA 1VQPP 1S2EA 2WQYC 2OYHC 1LT9C 2FYUG 3C1LA 2OYIA 4BRYA 4DJGA 1MFZA 2YKQA 2IX7C 1T3JA 3MIWA 4ZMDA 4OH8B 2IBZG 3U1CA 2Y0CA 3OJAB 2PFXA 3M0DA 2KZIA 1Y9BA 3V2RA 2QJKC 3RK2C 4C7NA 1HGZA 1YBKA 3CX5H 2OTLP 2YKPA 1SS1A 3CD6P 1H8AA 2NPSC 4EI2A 2H43A 3L71J 5AVRB 2CK3H 3IFMA 5APVA 4H0LC 2Q3EA 3KPEA 2E74D 4GODA 3L70E 3MP7B 1EZVG 3H32B 1HJ0A 1GU4A 1MUUA 3AE5C 3CXHI 1RQVA 1KILC 2QE7H 3H1JG 1ZW0A 5AW7B 3WU2E 1IFMA 5H2FH 2O01H 3HUSC 2QJYB 1BSHA 1KB9E 1LGHB 1SVFA 4BWNA 1S1CX 1JY3P 2ZT9D 3L70D 1FU1A 3LW5J 2BCCE 4ASVA 1QLED 4L76A 3GHGB 3L74G 5B66H 4HJGH 5APYA 2BCCJ 3K5BA 2WSSH 1KQSO 1ZP0C 5E79H 1BGYE 1SFCA 3RK3E 1HVVA 1NJIQ 4I2LC 1VQ4P 2ITAA 1YHQP 2XNDH 1L0LG 3P8CD 5KLVD 3AE9C 1EDKA 2KK7A 2SPZA 3H1HD 5AW9B 3B8EB 1SQVD 4K3AA 3HE4A 2WZ7A 4JYBA 3CWBE 2ZJSE 1BGYD 3LIDA 4KT0J 3UIAA 4A7PA 1L0NK 1QL1A 3CWBJ 1BE3D 3JSVC 2YXRB 3TGUG 5TISH 1P84I 1JUNA 1LP1B 1W2BO 2M0BA 2IYOA 1H89A 4XE5B 1GW4A 1LTIC 1OWAA 5CCHD 4RESB 2FY8A 1PPJG 3E1RA 2W90A 1G2CA 2WSEH 3OAKA 2WT7B 1L2PA 2WSFH 1SQBG 5KAFH 4R4LA 5KJ7C 1CZQA 1AVOA 1AQTA 2XU6A 2M5AA 1M1JC 2VRSA 1ZRTE 4U7JA 3I5CA 2YMKA 2LXCB 2FFDB 2R32A 1WT6A 1M57D 1OZHA 2LR2A 3A0BE 4H13C 1EDIA 1X8YA 1PP9D 1IK7A 1EDJA 1NTKD 5TJHA 1KC8Q 1FOSE 1T3UA 2MKVA 2OQQA 1DEBA 1S3JA 2RKLA 2WPVB 5L8RJ 1LTJB 2KB7P 1PGOA 3B5NA 1FC2C 2OYHB 4YTPC 5AW0B 1U7JA 1KB9I 1LT9B 2PAJA 2C9LY 1G1IA 3A0HE 4RJTA 1UIIA 2HYNA 2YKOA 1KYOD 1JM0A 1JO5A 1TU3F 1VQ8P 4D6TD 3CCSP 1VQ7P 3Q3DA 2E76C 1LTAC 2PGDA 1N7SC 2A06E 2JWAA 2C0XA 2YIUB 3A2AA 2O1JA 2GA1A 4HYTB 3C8VA 5AVXB 2QJKB 3RK2B 3KQGA 5CCGD 2XKMA 3U59A 3QH9A 3V2PA 2NPSB 4IL6H 3IF4A 1RE3A 4RKUJ 2J59M 3H1LE 4H0LB 2R5DA 5APSA 1KYOH 1JMMA 4PJ0H 4WY4A 1ZMEC 3H1IE 1VQ5P 3H1LJ 3HD7D 3PTZA 1RE4A 2R44A 2L91A 3QWOC 1KILB 1L4AC 1Q81Q 2HPCA 3H1IJ 3V6IA 1VDFA 1XTGB 3NMDA 3AE6C 3L75D 1LTBC 3HTKA 2K1AA 1JY2P 3T97A
chains in the Genus database with same CATH topology
2HG5D 1G1JA 3N4XA 1JY2O 3R2PA 5BU8B 1GL2D 1SFCB 3HD7C 1KFNA 1J1DC 3HD7A 3KDPB 3G3ZA 1FZBA 2QM7A 3EFGA 1Z56A 4AUWA 4N78D 2FFDC 2N1TB 2CPBA 5AVTB 1T2KC 3B5NC 2FFDA 5CMZA 1GL2B 3M9HA 1KZUB 1NTZK 1RY3A 3SWFA 5APQA 5BU5A 2WTYA 4ZKUA 1JTHB 2FYZA 4HH2A 1QL2A 2LKMA 3HE5B 1N2DC 1SQPK 1ZV8A 3CI9A 2XDJA 3EQ2A 1A02J 1N86A 5AW1B 1LTJC 5AVWB 1ZLLA 3SWYA 3C9IA 2KLVA 5APUA 3V4QA 4GKGA 1LTJA 2KP8A 1IK9A 1FJKA 2NPSD 2N1TA 1CW5A 1GL2C 2OYHC 2OYIC 3PP5A 1LT9C 1GL2A 5AW8B 2WPQA 2OYHA 1AQ5A 2OYIA 1LT9A 1URQB 4C7NB 3II6A 1MFZA 1FAVA 2YKQA 3RL0B 1FZCC 3HE5A 2IX7C 5AVZB 1T3JA 3MIWA 3RK3D 4OH8B 1FZCA 1NH4A 1NO4A 3WMM0 3BATA 1RE3C 3V2NA 1IC2A 1J2JB 1CSBA 3VMYA 3U1CA 1CI6B 3MGNA 5AW6B 1ZR4A 4AQRD 1FZEA 2CPSA 3M0DC 2L5GB 1KILD 3OJAB 1G2CB 5AW2B 3M0DA 1JCDA 2IFMA 3V2RA 4ZKPA 1NTMK 3RK2C 4C7NA 1HGZA 2Q7CA 1GK4A 1RF1B 2YKPA 2R3CA 1H8AA 3A7OA 2NPSC 2H43A 3VTPC 1SQXK 5AVRB 3IFMA 1HUCA 5APVA 2FYUK 3HUSB 1CI6A 3VMXA 1LTSC 3KPEA 3RK3C 2HODA 1NU1K 3MUDA 3TNUB 4I1LA 1OXZA 1X9VA 3H32B 2YO2A 1SFCD 5CHXA 1GU4A 3L37A 1MUUA 3O8ZA 4N78E 5AW5B 3VP8A 1RF1A 1E5WA 2HFED 1KILC 1LTTC 2WPRA 5AW7B 1KILA 1IFMA 2N1TD 1AFOA 2O01H 3HUSC 1LGHB 2YNYA 1SVFA 3HUSA 2O1KA 2P7JA 1LTGC 4EOTA 1JY3P 1LWUB 1N73C 1N7LA 1FU1A 2POHA 2GM4A 1N73A 4KHXA 1H88A 3TSIA 4I6MC 3GHGB 2C9NY 2WPSA 1JY3O 1HBWA 2M3BA 1IO4A 4IFMA 4WB4A 5APYA 2A45I 3HE4B 3MD0A 4DOJA 3BRVB 4IFDK 3NXSA 1SQQK 1SFCC 2KSJA 4EIJA 1FJPA 1SFCA 1HVVA 4I2LC 1LWUA 1URQD 2KYVA 4O9BA 4GT1A 1T8ZA 1N7SB 3RL0D 2GUSA 3P8CD 2I1JA 2N1TC 4N6JA 2H7HA 2E42A 5AW9B 2N9BA 2IFNA 1FBMA 4Y99B 3MTUE 5APWA 3B8EB 1GW3A 1FOSF 4W7ZA 2KOGA 4JYCA 3HE4A 5KLVK 2ZXEB 2WZ7A 1JTHA 4JYBA 2YO3A 3LIDA 4W7YA 3H6PA 3UIAA 5KTBA 2P2UA 2W27A 4LLHA 1L0NK 5AVSB 4JF7A 1QL1A 1KFMA 2JJLA 1FZAA 4WY4B 1ZN5A 3V2QA 1DH3A 5KJ7D 2H8PD 3TYYA 3N7NA 4N3YB 1JUNA 4Y99C 5AVYB 2R5BA 1H89A 4M3LA 3V5BA 1URQC 2IPPA 2PP6A 4XE5B 3L36A 2Q5UA 1GW4A 1URQA 3RL0C 1L0LK 1LTIC 1JNMA 1OWAA 1SLQA 3A3YB 3CL3D 3P7KA 1S9KD 5CCHD 2JEEA 2HLOA 4RESB 2ZFCA 1JY2N 1KQLA 1IFJA 1M1JB 3LIEA 1EQ7A 1HGVA 1GDTA 3HTKB 5AW3B 1G2CA 1JOCA 2WSEH 1JCCA 3OAKA 1FZGA 2WT7B 3VOPA 2Q9IA 3P8MC 2WSFH 4LGDE 1RF1C 1J1EB 2Z5IA 2FKWB 5KJ7C 1YTZT 1CZQA 3NFQA 2QM8A 2A45G 5KJ7A 2FXMA 3B5ND 4C7RA 1HWTC 1W2EA 2XU6A 1M1JC 2VRSA 2XNXA 1GTWA 1J1DB 3CLQA 1SP4A 1M1JA 3I5CA 2Z5HA 3VN0A 3VYIA 3TNUA 2FFDB 2P1JA 2R32A 2WT7A 5CCHC 3B5NB 3H32A 3V4WA 1WT6A 3P8CE 4C46A 5CJ4A 1HTLC 2BASA 1RF0C 5CCHA 5AVQB 1RF0A 1X8YA 3M91A 1N7SD 2J58A 1FOSE 4LC1A 1T3UA 1NAFA 1DEBA 4WBAA 1LWUC 1FZFA 5APXA 4B86A 1SQBK 1LTJB 2KB7P 1NTKK 2Z4EA 3GHGC 3B5NA 2P67A 1NKNA 3L4FA 2OYHB 5AW0B 2PAJA 3GHGA 1LT9B 3U1AA 3P32A 2OYIB 2C9LY 1HH0A 1NKZB 2YMYA 1G1IA 4XA4A 4WY4D 1X79B 4IFFA 1VPCA 3OA7A 2HYNA 2YKOA 3BASA 1FZCB 4GIFA 1JO5A 1DX7A 3M9BA 3A5TA 1GU5A 3RK2D 1YYCA 3VP9A 1IFDA 1LTAC 2WSCH 1ZR2A 1SQVK 1S9KE 1N7SC 2A45H 1N7SA 2C0XA 1GK6A 1L4AD 3A2AA 2O1JA 1M7LA 1A02F 2E43A 4HYTB 5AVXB 1IJDB 2C0WA 2Q3IA 2WWWA 2W6BA 3M0AA 3RK2B 3KQGA 5CCGD 2XKMA 2MJZA 5APTA 3U59A 3M9QA 3V2PA 1MV8A 2NPSB 3TK1A 3BVHA 1GD2E 2HPCB 1GZLA 1L4AB 3LW5H 1RE3A 2GUVA 1WRGA 2M8RA 2J59M 2XZRA 2R5DA 4WY4C 5APSA 1JMMA 1YTZI 2HODB 4WY4A 3M06A 2I1KA 3HRNA 3RK3B 3VMZA 1PFIA 2OARA 1HJBA 1RE4C 4DZOA 3HD7D 5AW4B 1RE4A 1IFNA 5BVZA 1KILB 1JY3N 1L4AC 2NPSA 1MZ9A 2HPCA 1L4AA 1FDMA 1T2KD 3KYQA 4W80A 2XV5A 3IR9A 5CCGC 1VDFA 1XTGB 3L35A 3HD7B 3NMDA 5AVUB 1N73B 5CCGA 1NOHA 1LTBC 1IFIA 2W6AA 3HTKA 1NWQA 5AVVB 3BRTB 3NTNA 1JY2P 4AYCA 1NHLA 2WITA 5CJ0A 3T97A 1XTCC 1J1EC 3E1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WMM 0;  1DX7 A;  1IJD B;  1KZU B;  2FKW B;  1JMM A;  1NKZ B;  1JO5 A;  1WRG A;  1LGH B; 
#chains in the Genus database with same CATH topology
 4HKZ H;  3ABV C;  1G1J A;  3BCC E;  2D2C B;  3N4X A;  3PRJ A;  2QJP C;  2QVA A;  1J1D C;  5KKZ C;  4BXL A;  1NTZ D;  4U3F E;  3G3Z A;  2QM7 A;  2P10 A;  3Q2Y A;  3BCC J;  1Z56 A;  4N78 D;  1SQQ D;  1T2K C;  4IOI H;  1L0N G;  3S4R A;  1GL2 B;  1KZU B;  1RY3 A;  5BU5 A;  2ZVN B;  4ZKU A;  1JTH B;  2FYZ A;  4HH2 A;  1SQP K;  3CCV P;  1ZV8 A;  1X0T A;  3L72 E;  1S5L E;  4U3F D;  2ZYA A;  3EQ2 A;  3GMA A;  1YI2 P;  1ZLL A;  1NTM E;  3C9I A;  1RQU A;  2KP8 A;  1IK9 A;  2NPS D;  3KZI H;  3L72 J;  1BSN A;  1S5L X;  1VQK P;  3AEE C;  2OYI C;  1KYO I;  1SQX E;  1AQ5 A;  4H0L D;  1NTM J;  3II6 A;  3R4Y A;  3W67 A;  3HE5 A;  3CCU P;  2AEF A;  2KSE A;  1SQX J;  1NU1 E;  3BAT A;  2V4H A;  2P58 A;  3CXH E;  2CPS A;  3M0D C;  2L5G B;  1KIL D;  2AXT E;  1NU1 J;  1M56 D;  2FYU D;  1GK4 A;  2R3C A;  3FWN A;  1JEK A;  2LXB A;  2IBZ D;  3FGA D;  3RGU A;  2KZJ A;  3AE8 C;  2Q1K A;  1BDC A;  1LTS C;  1OXZ A;  2FBW C;  3CPW O;  3I56 P;  4H13 B;  3L73 G;  1E5W A;  1ZOY C;  4ZNC A;  5GTI E;  2E74 B;  1AFO A;  2OTK E;  1SQP J;  1OW7 A;  2O1K A;  2P7J A;  3GF7 A;  1LTG C;  4EOT A;  3SWK A;  1NGM B;  2N9Y B;  1IZN B;  1IFP A;  3D70 A;  3GG2 A;  4I6M C;  2PRR A;  3CX5 E;  1EZV D;  4WB4 A;  2A45 I;  4OWF A;  2I8D A;  2FYN C;  3BRV B;  3H1J D;  4IFD K;  1HF9 A;  3NXS A;  2JO1 A;  4PD4 H;  1SFC C;  4EIJ A;  1QX8 A;  1FJP A;  1U57 A;  2E76 B;  1T8Z A;  1N7S B;  2I1J A;  2N1T C;  4N6J A;  3CX5 D;  1JB0 J;  2B9B A;  3H1K G;  1L0L E;  2H7H A;  2E42 A;  2OTJ P;  4Y99 B;  5APW A;  4W7Z A;  3L74 D;  5KLV K;  5KLI C;  3G4S P;  4PV1 C;  2Y0D A;  4W7Y A;  3H6P A;  5KTB A;  2K9J B;  2P2U A;  2O01 J;  1KFM A;  5KJ7 D;  1L0L D;  1H0T B;  1M8O B;  3N7N A;  4N3Y B;  5B66 E;  1BCC G;  4M3L A;  2WVR A;  3D6Y A;  3L36 A;  1URQ A;  3RL0 C;  3AEF C;  5E79 E;  2G8Y A;  1SLQ A;  2RH0 A;  1S9K D;  2JEE A;  4H13 D;  1KQL A;  1IFJ A;  1VQ6 P;  1EQ7 A;  1HGV A;  1GDT A;  3TGU D;  3S9O A;  1RF1 C;  4OVN F;  2FKW B;  2RMZ A;  3JCU E;  3L70 J;  2QM8 A;  3NFQ A;  1USE A;  1HWT C;  1W2E A;  2QJP B;  1J1D B;  5KKZ B;  3FXD A;  2J5U A;  2QEX P;  1PPJ D;  1PGJ A;  3TNU A;  1DIP A;  2AEM A;  2WT7 A;  3P8C E;  4C46 A;  5KLV E;  1OW6 A;  5CJ4 A;  3WUT A;  2E76 D;  3M91 A;  4UB8 H;  1SQB D;  1N7S D;  3H1H E;  1SQV E;  2J58 A;  5KLV J;  4JQ0 D;  1FDI A;  1LWU C;  1FZF A;  4B86 A;  3H1H J;  1EZV I;  1PGQ A;  1SQV J;  3Q5R A;  2NRG A;  1NTK K;  1NKN A;  1BE3 E;  1OIP A;  5KAF E;  1BGY J;  3U1A A;  4BRY B;  2OYI B;  1HH0 A;  1NKZ B;  3AEC C;  4XA4 A;  1VPC A;  3OA7 A;  1VF5 C;  1PV3 A;  1BE3 J;  3CX5 I;  1L4A D;  1OVU A;  2O01 N;  1M7L A;  1NVO A;  1IJD B;  2C0W A;  2Y9Y A;  2K3R A;  2MJZ A;  5APT A;  3WU2 H;  1GD2 E;  3BVH A;  2ZYG A;  3LW5 H;  5B5E H;  2M8R A;  2FXO A;  3L71 G;  4WY4 C;  1YTZ I;  3M06 A;  1R5L A;  2JR8 A;  2JP3 A;  1PFI A;  1Y8A A;  1Y47 A;  1RE4 C;  4DZO A;  4Z1M H;  5AW4 B;  2E75 C;  5BVZ A;  3FX0 A;  3B4S A;  2JWD A;  1JY3 N;  2NPS A;  1MZ9 A;  1PP9 E;  1T2K D;  3CCJ P;  1NTK E;  1W5C E;  3HD7 B;  1BDD A;  1PP9 J;  1M1K Q;  1IFI A;  2W6A A;  5AVV B;  5M1B A;  1NTK J;  5CJ0 A;  2KIK A;  4IL6 E;  4H44 C;  2R3S A;  2FYN B;  3R2P A;  5BU8 B;  1EXJ A;  1SFC B;  1KYO E;  4IL6 X;  4PJ0 E;  2BCC G;  4D6T E;  3KDP B;  4AUW A;  3OW2 O;  2N1T B;  3AE1 C;  5CBN A;  4D6T J;  1NTZ K;  3CME P;  2LKM A;  1VQN P;  5KLI B;  2ZAE B;  4PV1 B;  2Y9Z A;  2HR3 A;  2K37 A;  2XDJ A;  1VQO P;  1R5S A;  1A02 J;  1N86 A;  5AVW B;  2KLV A;  3CWB G;  1GL2 A;  5AW8 B;  2WPQ A;  1L0N D;  4EDF A;  1FAV A;  3RL0 B;  5AVZ B;  1FZC A;  1NH4 A;  3WMM 0;  3V2N A;  1IC2 A;  1J2J B;  4NPD A;  3AEB C;  1CSB A;  1CI6 B;  3Q5P A;  3MGN A;  1S4X A;  3RL0 g;  4AQR D;  1FZE A;  3MZW B;  1G2C B;  5AW2 B;  3CC2 P;  1OX3 A;  4UB6 E;  3L75 E;  4QMA A;  2IFM A;  4ZKP A;  1NTM K;  1OW8 A;  1RF1 B;  5EFW B;  1VQ9 P;  4K35 A;  1SQX K;  3L75 J;  3AE3 C;  1YQ3 C;  1HUC A;  2FYU K;  3HUS B;  3VMX A;  3ZDM A;  2W8Z A;  1K05 A;  3RK3 C;  2HOD A;  1NU1 K;  3MUD A;  1NTZ E;  4XFJ A;  1K73 Q;  1SFC D;  3L37 A;  3O8Z A;  4N78 E;  5AW5 B;  1SQQ E;  3VP8 A;  3CCR P;  3O6Q A;  1S72 P;  3D71 A;  4GOF A;  1LTT C;  3A0H H;  1NTZ J;  2B89 A;  2N1T D;  1SQQ J;  2AXC A;  1LWU B;  1N7L A;  2E5Y A;  1N73 A;  4PV1 D;  2RN0 A;  2C9N Y;  2WPS A;  1HBW A;  1IO4 A;  4IFM A;  4U3F J;  3L73 D;  3MD0 A;  1VF5 B;  4DOJ A;  2KSJ A;  3CCQ P;  1FE6 A;  1AJY A;  2V7Q H;  2KYV A;  2WMM A;  4GT1 A;  3WUV A;  3RL0 D;  2GUS A;  3EWK A;  1KN7 A;  1FDO A;  1KIL E;  4WWI A;  2N9B A;  2IFN A;  1FBM A;  3MTU E;  1GW3 A;  1FOS F;  2KOG A;  5GTH H;  4OGQ C;  4KJM A;  1EC5 A;  1YIT P;  2FYU E;  2A06 G;  1PIX A;  2AEJ A;  4LLH A;  4L73 A;  1QVF O;  2BEQ D;  5AVS B;  2KLU A;  2IBZ E;  2JJL A;  4WY4 B;  2FYU J;  3V2Q A;  3WUU A;  5KAI H;  2YXQ B;  1DH3 A;  2H8P D;  3TYY A;  1E79 H;  5AVY B;  3H1K D;  2R5B A;  2OGU A;  1URQ C;  2IPP A;  2PP6 A;  3AE2 C;  3CCM P;  2Q5U A;  2E75 B;  1L0L K;  2K9Y A;  2UWJ E;  4PD4 E;  3H1L G;  1JNM A;  3P7K A;  2K9J A;  2OYO A;  2ZFC A;  1JY2 N;  3H1I G;  4Y28 J;  5CBO A;  1M1J B;  3LIE A;  1LT1 A;  1NAY A;  3HTK B;  1JCC A;  1FZG A;  3T97 B;  2Q9I A;  4LGD E;  2KS1 B;  1BCC D;  4NPE A;  4PD4 D;  2Z5I A;  2JKV A;  1EZV E;  1YTZ T;  4H44 B;  2A45 G;  2FXM A;  3B5N D;  3GF3 A;  2XNX A;  3H1J E;  1GTW A;  1SP4 A;  1DD4 A;  3AEA C;  3IN6 A;  3VN0 A;  2BEZ F;  1R8E A;  1PL5 A;  1VF5 D;  2QIW A;  4EYY Q;  1QGK B;  2P1J A;  3H1J J;  3H32 A;  5K5G B;  3CC7 P;  1HTL C;  3BCC G;  5CCH A;  1RF0 A;  2B87 B;  3L74 E;  4LC1 A;  3D6Z A;  3EFF K;  4WBA A;  5APX A;  1SQB K;  3CXH H;  3L74 J;  3SSU A;  2Z4E A;  3GHG A;  2H88 C;  3P32 A;  1YJ9 P;  1KQG B;  2YMY A;  3L72 G;  4WY4 D;  1X79 B;  4IFF A;  5H2F E;  2KXP B;  1NTM G;  1L0L J;  3A5T A;  1GU5 A;  3VP9 A;  1IFD A;  1YJN P;  2WSC H;  1KV4 A;  1SQV K;  1SQX G;  3F5H A;  1S9K E;  2E75 D;  2E43 A;  2Q3I A;  1P84 D;  4UB8 E;  3M0A A;  3TGU E;  1NU1 G;  3SFE C;  3M9Q A;  5GTI H;  1X22 A;  3TK1 A;  1GZL A;  1L4A B;  1AV1 A;  1EDL A;  2GUV A;  3TGU J;  4CPG A;  1Q86 Q;  2XZR A;  1NYH A;  2YIU C;  4H44 D;  3USS A;  2I1K A;  3RK3 B;  3L71 E;  3VMZ A;  2OAR A;  1LP1 A;  1HJB A;  1Q90 D;  1PPJ E;  1YJW P;  3KHU A;  2IBZ I;  1K9M Q;  1FDM A;  1P84 H;  1SQB E;  3KYQ A;  4W80 A;  1GMJ A;  2JDI H;  3IR9 A;  2KNC B;  5CCG A;  3L71 D;  5TIS E;  1SQP G;  4PD4 I;  1SQB J;  2DW3 A;  1NWQ A;  3NTN A;  2WIT A;  1J1E C;  1DD3 A;  2O3J A;  5B5E E;  1KFN A;  2QG4 A;  3HD7 A;  2KI7 B;  1K8A Q;  3EFG A;  3AE4 C;  3FXE A;  3B5N C;  2FFD A;  2QRX A;  5CMZ A;  1N8R Q;  3M9H A;  5C39 A;  2IYP A;  3SWF A;  2WTY A;  2D2C C;  1KB9 D;  2WSE J;  4OGQ B;  1N2D C;  1U7M A;  1OVR A;  2WSF J;  3CI9 A;  1Q82 Q;  1KOR A;  2FXP A;  2BCC D;  2QA4 P;  1KD1 Q;  1LTJ A;  1FJK A;  1OMI A;  2N1T A;  1CW5 A;  1GL2 C;  1JMB A;  4TLF A;  3PP5 A;  2OYH A;  1LT9 A;  2ZYD A;  1URQ B;  4C7N B;  1FZC C;  3RK3 D;  1QEX A;  3JCU H;  1Q7Y Q;  3RBZ A;  3PHL A;  2ZVO B;  1NO4 A;  1UIX A;  1RE3 C;  1KB9 H;  3VMY A;  3KXD A;  5AW6 B;  1ZR4 A;  3CCL P;  4TT3 H;  3JC2 2;  3Q5S A;  3CWB D;  2Q7C A;  1K04 A;  1LJ2 A;  3A7O A;  3VTP C;  3L70 G;  1CI6 A;  4DT0 A;  3B71 A;  3MUD C;  3G9R A;  3TNU B;  4I1L A;  4I7Z C;  1X9V A;  2YO2 A;  5CHX A;  3PH0 A;  1RF1 A;  2KUB A;  1MFT A;  2HFE D;  1PGP A;  3Q1M A;  2WPR A;  1KIL A;  2W6J H;  2YNY A;  1QVG O;  3HUS A;  3FWL A;  1FS0 E;  1N73 C;  3I55 P;  5KLV G;  4OGQ D;  2POH A;  2GM4 A;  4YXD C;  3CC4 P;  2B88 A;  3IAO A;  4KHX A;  2W83 C;  1H88 A;  3TSI A;  3H1H G;  1SQV G;  1JY3 O;  4WVZ A;  2M3B A;  3PLN A;  2E74 C;  1KTM A;  3HE4 B;  4NPF X;  1BGY G;  1L0N E;  1PZQ A;  1ZRT D;  1SQQ K;  4MN4 C;  1AVY A;  1LWU A;  1BE3 G;  1URQ D;  4HB1 A;  4O9B A;  1L0N J;  1VL2 A;  2ZT9 C;  3H25 A;  4JPZ B;  4JYC A;  3CCE P;  2ZXE B;  1JTH A;  2ZXX A;  2YO3 A;  4GDO A;  1KMI Z;  2W27 A;  1RH5 B;  4JF7 A;  1FZA A;  1ZN5 A;  3PJS K;  4JBZ A;  4Y99 C;  1ZXG A;  2IZ0 A;  1M90 Q;  3V5B A;  4L75 A;  1D7M A;  4DCK A;  3A0B H;  3W68 A;  3A3Y B;  3CL3 D;  5DJT B;  3AEG C;  1USD A;  5DJU B;  2A06 D;  2HLO A;  2M5A B;  1KQF B;  3KZI E;  5AW3 B;  2V7Q J;  1JOC A;  5GTH E;  3VOP A;  3P8M C;  3TDK A;  1PP9 G;  1J1E B;  2E5T A;  1NTK G;  5KJ7 A;  4C7R A;  3H1L D;  3L73 E;  1RHZ B;  3CLQ A;  5KAI E;  2K88 A;  1EXI A;  1M1J A;  3RBX A;  2Z5H A;  1OVV A;  3H1I D;  3VYI A;  2NZ2 A;  3L73 J;  1YQ4 C;  5CCH C;  3B5N B;  3S1K A;  3V4W A;  2BAS A;  1RF0 C;  2KS1 A;  3G6E P;  5AVQ B;  4D6T G;  2QJY C;  1NAF A;  1YIJ P;  1VQL P;  3VMA A;  2Y0E A;  3GHG C;  2P67 A;  3L4F A;  1VQM P;  4UB6 H;  4GOE A;  3BCC D;  4L74 A;  2B87 A;  3H1K E;  3AE7 C;  1WMK A;  3BAS A;  1FZC B;  2IZ1 A;  4GIF A;  2G3A A;  1DX7 A;  3M9B A;  3RK2 D;  1YYC A;  2IDB A;  1Q2N A;  3H1K J;  1ZR2 A;  2A45 H;  1N7S A;  1GK6 A;  1A02 F;  2WWW A;  2W6B A;  2H89 C;  1MKM A;  3L72 D;  2M3E A;  3TF5 A;  1MV8 A;  3ITK A;  1BCC E;  2HPC B;  1NTM D;  3GW6 A;  1WRG A;  3L75 G;  2HOD B;  4ASW A;  1BCC J;  1SQX D;  3HRN A;  1T6A A;  4I7Z B;  1H0T A;  3GLM A;  3O6Q B;  1IFN A;  1NU1 D;  3F89 A;  1L4A A;  3CXH D;  2XV5 A;  1NTZ G;  5CCG C;  3L35 A;  5AVU B;  1N73 B;  1S5L H;  1NOH A;  4R4M A;  1SQQ G;  4YPC A;  2D2C D;  2WSC J;  3BRT B;  4AYC A;  1SQP E;  1NHL A;  2QSI A;  1XTC C;  4YXW H;  3E1I A;  1JCD A;  2HG5 D;  1AA0 A;  1JY2 O;  1GL2 D;  4U3F G;  3HD7 C;  2KNC A;  3G71 P;  1FZB A;  1OFC X;  2FFD C;  3AED C;  2CPB A;  1SQP D;  2Q6Q A;  5AVT B;  2AXT H;  4RO0 A;  1DEE G;  2ZT9 B;  5APQ A;  3E7K A;  1P84 E;  1QL2 A;  3HE5 B;  1LNQ A;  3SFD C;  3CMA P;  5AW1 B;  1LTJ C;  3SWY A;  5APU A;  3V4Q A;  3MHV A;  4GKG A;  1VQP P;  1S2E A;  2WQY C;  2OYH C;  1LT9 C;  2FYU G;  3C1L A;  2OYI A;  4BRY A;  4DJG A;  1MFZ A;  2YKQ A;  2IX7 C;  1T3J A;  3MIW A;  4ZMD A;  4OH8 B;  2IBZ G;  3U1C A;  2Y0C A;  3OJA B;  2PFX A;  3M0D A;  2KZI A;  1Y9B A;  3V2R A;  2QJK C;  3RK2 C;  4C7N A;  1HGZ A;  1YBK A;  3CX5 H;  2OTL P;  2YKP A;  1SS1 A;  3CD6 P;  1H8A A;  2NPS C;  4EI2 A;  2H43 A;  3L71 J;  5AVR B;  2CK3 H;  3IFM A;  5APV A;  4H0L C;  2Q3E A;  3KPE A;  2E74 D;  4GOD A;  3L70 E;  3MP7 B;  1EZV G;  3H32 B;  1HJ0 A;  1GU4 A;  1MUU A;  3AE5 C;  3CXH I;  1RQV A;  1KIL C;  2QE7 H;  3H1J G;  1ZW0 A;  5AW7 B;  3WU2 E;  1IFM A;  5H2F H;  2O01 H;  3HUS C;  2QJY B;  1BSH A;  1KB9 E;  1LGH B;  1SVF A;  4BWN A;  1S1C X;  1JY3 P;  2ZT9 D;  3L70 D;  1FU1 A;  3LW5 J;  2BCC E;  4ASV A;  1QLE D;  4L76 A;  3GHG B;  3L74 G;  5B66 H;  4HJG H;  5APY A;  2BCC J;  3K5B A;  2WSS H;  1KQS O;  1ZP0 C;  5E79 H;  1BGY E;  1SFC A;  3RK3 E;  1HVV A;  1NJI Q;  4I2L C;  1VQ4 P;  2ITA A;  1YHQ P;  2XND H;  1L0L G;  3P8C D;  5KLV D;  3AE9 C;  1EDK A;  2KK7 A;  2SPZ A;  3H1H D;  5AW9 B;  3B8E B;  1SQV D;  4K3A A;  3HE4 A;  2WZ7 A;  4JYB A;  3CWB E;  2ZJS E;  1BGY D;  3LID A;  4KT0 J;  3UIA A;  4A7P A;  1L0N K;  1QL1 A;  3CWB J;  1BE3 D;  3JSV C;  2YXR B;  3TGU G;  5TIS H;  1P84 I;  1JUN A;  1LP1 B;  1W2B O;  2M0B A;  2IYO A;  1H89 A;  4XE5 B;  1GW4 A;  1LTI C;  1OWA A;  5CCH D;  4RES B;  2FY8 A;  1PPJ G;  3E1R A;  2W90 A;  1G2C A;  2WSE H;  3OAK A;  2WT7 B;  1L2P A;  2WSF H;  1SQB G;  5KAF H;  4R4L A;  5KJ7 C;  1CZQ A;  1AVO A;  1AQT A;  2XU6 A;  2M5A A;  1M1J C;  2VRS A;  1ZRT E;  4U7J A;  3I5C A;  2YMK A;  2LXC B;  2FFD B;  2R32 A;  1WT6 A;  1M57 D;  1OZH A;  2LR2 A;  3A0B E;  4H13 C;  1EDI A;  1X8Y A;  1PP9 D;  1IK7 A;  1EDJ A;  1NTK D;  5TJH A;  1KC8 Q;  1FOS E;  1T3U A;  2MKV A;  2OQQ A;  1DEB A;  1S3J A;  2RKL A;  2WPV B;  5L8R J;  1LTJ B;  2KB7 P;  1PGO A;  3B5N A;  1FC2 C;  2OYH B;  4YTP C;  5AW0 B;  1U7J A;  1KB9 I;  1LT9 B;  2PAJ A;  2C9L Y;  1G1I A;  3A0H E;  4RJT A;  1UII A;  2HYN A;  2YKO A;  1KYO D;  1JM0 A;  1JO5 A;  1TU3 F;  1VQ8 P;  4D6T D;  3CCS P;  1VQ7 P;  3Q3D A;  2E76 C;  1LTA C;  2PGD A;  1N7S C;  2A06 E;  2JWA A;  2C0X A;  2YIU B;  3A2A A;  2O1J A;  2GA1 A;  4HYT B;  3C8V A;  5AVX B;  2QJK B;  3RK2 B;  3KQG A;  5CCG D;  2XKM A;  3U59 A;  3QH9 A;  3V2P A;  2NPS B;  4IL6 H;  3IF4 A;  1RE3 A;  4RKU J;  2J59 M;  3H1L E;  4H0L B;  2R5D A;  5APS A;  1KYO H;  1JMM A;  4PJ0 H;  4WY4 A;  1ZME C;  3H1I E;  1VQ5 P;  3H1L J;  3HD7 D;  3PTZ A;  1RE4 A;  2R44 A;  2L91 A;  3QWO C;  1KIL B;  1L4A C;  1Q81 Q;  2HPC A;  3H1I J;  3V6I A;  1VDF A;  1XTG B;  3NMD A;  3AE6 C;  3L75 D;  1LTB C;  3HTK A;  2K1A A;  1JY2 P;  3T97 A; 
#chains in the Genus database with same CATH homology
 2HG5 D;  1G1J A;  3N4X A;  1JY2 O;  3R2P A;  5BU8 B;  1GL2 D;  1SFC B;  3HD7 C;  1KFN A;  1J1D C;  3HD7 A;  3KDP B;  3G3Z A;  1FZB A;  2QM7 A;  3EFG A;  1Z56 A;  4AUW A;  4N78 D;  2FFD C;  2N1T B;  2CPB A;  5AVT B;  1T2K C;  3B5N C;  2FFD A;  5CMZ A;  1GL2 B;  3M9H A;  1KZU B;  1NTZ K;  1RY3 A;  3SWF A;  5APQ A;  5BU5 A;  2WTY A;  4ZKU A;  1JTH B;  2FYZ A;  4HH2 A;  1QL2 A;  2LKM A;  3HE5 B;  1N2D C;  1SQP K;  1ZV8 A;  3CI9 A;  2XDJ A;  3EQ2 A;  1A02 J;  1N86 A;  5AW1 B;  1LTJ C;  5AVW B;  1ZLL A;  3SWY A;  3C9I A;  2KLV A;  5APU A;  3V4Q A;  4GKG A;  1LTJ A;  2KP8 A;  1IK9 A;  1FJK A;  2NPS D;  2N1T A;  1CW5 A;  1GL2 C;  2OYH C;  2OYI C;  3PP5 A;  1LT9 C;  1GL2 A;  5AW8 B;  2WPQ A;  2OYH A;  1AQ5 A;  2OYI A;  1LT9 A;  1URQ B;  4C7N B;  3II6 A;  1MFZ A;  1FAV A;  2YKQ A;  3RL0 B;  1FZC C;  3HE5 A;  2IX7 C;  5AVZ B;  1T3J A;  3MIW A;  3RK3 D;  4OH8 B;  1FZC A;  1NH4 A;  1NO4 A;  3WMM 0;  3BAT A;  1RE3 C;  3V2N A;  1IC2 A;  1J2J B;  1CSB A;  3VMY A;  3U1C A;  1CI6 B;  3MGN A;  5AW6 B;  1ZR4 A;  4AQR D;  1FZE A;  2CPS A;  3M0D C;  2L5G B;  1KIL D;  3OJA B;  1G2C B;  5AW2 B;  3M0D A;  1JCD A;  2IFM A;  3V2R A;  4ZKP A;  1NTM K;  3RK2 C;  4C7N A;  1HGZ A;  2Q7C A;  1GK4 A;  1RF1 B;  2YKP A;  2R3C A;  1H8A A;  3A7O A;  2NPS C;  2H43 A;  3VTP C;  1SQX K;  5AVR B;  3IFM A;  1HUC A;  5APV A;  2FYU K;  3HUS B;  1CI6 A;  3VMX A;  1LTS C;  3KPE A;  3RK3 C;  2HOD A;  1NU1 K;  3MUD A;  3TNU B;  4I1L A;  1OXZ A;  1X9V A;  3H32 B;  2YO2 A;  1SFC D;  5CHX A;  1GU4 A;  3L37 A;  1MUU A;  3O8Z A;  4N78 E;  5AW5 B;  3VP8 A;  1RF1 A;  1E5W A;  2HFE D;  1KIL C;  1LTT C;  2WPR A;  5AW7 B;  1KIL A;  1IFM A;  2N1T D;  1AFO A;  2O01 H;  3HUS C;  1LGH B;  2YNY A;  1SVF A;  3HUS A;  2O1K A;  2P7J A;  1LTG C;  4EOT A;  1JY3 P;  1LWU B;  1N73 C;  1N7L A;  1FU1 A;  2POH A;  2GM4 A;  1N73 A;  4KHX A;  1H88 A;  3TSI A;  4I6M C;  3GHG B;  2C9N Y;  2WPS A;  1JY3 O;  1HBW A;  2M3B A;  1IO4 A;  4IFM A;  4WB4 A;  5APY A;  2A45 I;  3HE4 B;  3MD0 A;  4DOJ A;  3BRV B;  4IFD K;  3NXS A;  1SQQ K;  1SFC C;  2KSJ A;  4EIJ A;  1FJP A;  1SFC A;  1HVV A;  4I2L C;  1LWU A;  1URQ D;  2KYV A;  4O9B A;  4GT1 A;  1T8Z A;  1N7S B;  3RL0 D;  2GUS A;  3P8C D;  2I1J A;  2N1T C;  4N6J A;  2H7H A;  2E42 A;  5AW9 B;  2N9B A;  2IFN A;  1FBM A;  4Y99 B;  3MTU E;  5APW A;  3B8E B;  1GW3 A;  1FOS F;  4W7Z A;  2KOG A;  4JYC A;  3HE4 A;  5KLV K;  2ZXE B;  2WZ7 A;  1JTH A;  4JYB A;  2YO3 A;  3LID A;  4W7Y A;  3H6P A;  3UIA A;  5KTB A;  2P2U A;  2W27 A;  4LLH A;  1L0N K;  5AVS B;  4JF7 A;  1QL1 A;  1KFM A;  2JJL A;  1FZA A;  4WY4 B;  1ZN5 A;  3V2Q A;  1DH3 A;  5KJ7 D;  2H8P D;  3TYY A;  3N7N A;  4N3Y B;  1JUN A;  4Y99 C;  5AVY B;  2R5B A;  1H89 A;  4M3L A;  3V5B A;  1URQ C;  2IPP A;  2PP6 A;  4XE5 B;  3L36 A;  2Q5U A;  1GW4 A;  1URQ A;  3RL0 C;  1L0L K;  1LTI C;  1JNM A;  1OWA A;  1SLQ A;  3A3Y B;  3CL3 D;  3P7K A;  1S9K D;  5CCH D;  2JEE A;  2HLO A;  4RES B;  2ZFC A;  1JY2 N;  1KQL A;  1IFJ A;  1M1J B;  3LIE A;  1EQ7 A;  1HGV A;  1GDT A;  3HTK B;  5AW3 B;  1G2C A;  1JOC A;  2WSE H;  1JCC A;  3OAK A;  1FZG A;  2WT7 B;  3VOP A;  2Q9I A;  3P8M C;  2WSF H;  4LGD E;  1RF1 C;  1J1E B;  2Z5I A;  2FKW B;  5KJ7 C;  1YTZ T;  1CZQ A;  3NFQ A;  2QM8 A;  2A45 G;  5KJ7 A;  2FXM A;  3B5N D;  4C7R A;  1HWT C;  1W2E A;  2XU6 A;  1M1J C;  2VRS A;  2XNX A;  1GTW A;  1J1D B;  3CLQ A;  1SP4 A;  1M1J A;  3I5C A;  2Z5H A;  3VN0 A;  3VYI A;  3TNU A;  2FFD B;  2P1J A;  2R32 A;  2WT7 A;  5CCH C;  3B5N B;  3H32 A;  3V4W A;  1WT6 A;  3P8C E;  4C46 A;  5CJ4 A;  1HTL C;  2BAS A;  1RF0 C;  5CCH A;  5AVQ B;  1RF0 A;  1X8Y A;  3M91 A;  1N7S D;  2J58 A;  1FOS E;  4LC1 A;  1T3U A;  1NAF A;  1DEB A;  4WBA A;  1LWU C;  1FZF A;  5APX A;  4B86 A;  1SQB K;  1LTJ B;  2KB7 P;  1NTK K;  2Z4E A;  3GHG C;  3B5N A;  2P67 A;  1NKN A;  3L4F A;  2OYH B;  5AW0 B;  2PAJ A;  3GHG A;  1LT9 B;  3U1A A;  3P32 A;  2OYI B;  2C9L Y;  1HH0 A;  1NKZ B;  2YMY A;  1G1I A;  4XA4 A;  4WY4 D;  1X79 B;  4IFF A;  1VPC A;  3OA7 A;  2HYN A;  2YKO A;  3BAS A;  1FZC B;  4GIF A;  1JO5 A;  1DX7 A;  3M9B A;  3A5T A;  1GU5 A;  3RK2 D;  1YYC A;  3VP9 A;  1IFD A;  1LTA C;  2WSC H;  1ZR2 A;  1SQV K;  1S9K E;  1N7S C;  2A45 H;  1N7S A;  2C0X A;  1GK6 A;  1L4A D;  3A2A A;  2O1J A;  1M7L A;  1A02 F;  2E43 A;  4HYT B;  5AVX B;  1IJD B;  2C0W A;  2Q3I A;  2WWW A;  2W6B A;  3M0A A;  3RK2 B;  3KQG A;  5CCG D;  2XKM A;  2MJZ A;  5APT A;  3U59 A;  3M9Q A;  3V2P A;  1MV8 A;  2NPS B;  3TK1 A;  3BVH A;  1GD2 E;  2HPC B;  1GZL A;  1L4A B;  3LW5 H;  1RE3 A;  2GUV A;  1WRG A;  2M8R A;  2J59 M;  2XZR A;  2R5D A;  4WY4 C;  5APS A;  1JMM A;  1YTZ I;  2HOD B;  4WY4 A;  3M06 A;  2I1K A;  3HRN A;  3RK3 B;  3VMZ A;  1PFI A;  2OAR A;  1HJB A;  1RE4 C;  4DZO A;  3HD7 D;  5AW4 B;  1RE4 A;  1IFN A;  5BVZ A;  1KIL B;  1JY3 N;  1L4A C;  2NPS A;  1MZ9 A;  2HPC A;  1L4A A;  1FDM A;  1T2K D;  3KYQ A;  4W80 A;  2XV5 A;  3IR9 A;  5CCG C;  1VDF A;  1XTG B;  3L35 A;  3HD7 B;  3NMD A;  5AVU B;  1N73 B;  5CCG A;  1NOH A;  1LTB C;  1IFI A;  2W6A A;  3HTK A;  1NWQ A;  5AVV B;  3BRT B;  3NTN A;  1JY2 P;  4AYC A;  1NHL A;  2WIT A;  5CJ0 A;  3T97 A;  1XTC C;  1J1E C;  3E1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...