3UIAA

Structural determinants of trimerization specificity in hiv-1 gp41 protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
QARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGLKQIQARILAVERYLKDQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Determinants of Trimerization Specificity in HIV-1 gp41 Protein
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
molecule keywords Glycoprotein 41
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3uiaA00
2JJLA 5CMZA 3UIAA 5AVQB 1NWQA 1S9KE 5AW5B 5AW7B 3L35A 2P67A 2XU6A 3M0AA 3HE5B 2C9LY 3M06A 2R5BA 4B86A 2YO3A 3T97A 1MFZA 4M3LA 3VTPC 2Q5UA 3V4QA 2W27A 5AVXB 1CZQA 3TYYA 1HBWA 5AVRB 2YO2A 5AW1B 2QM7A 2WTYA 2BASA 2R32A 2WPSA 3P8MC 1MUUA 3NXSA 3A7OA 2YNYA 3A2AA 3VYIA 5APXA 4GKGA 5AW8B 3M9BA 2XV5A 3I5CA 1X8YA 4DZOA 1FOSF 2E42A 5APWA 3MGNA 1GZLA 3NFQA 3B8EB 1G2CB 4KHXA 2KP8A 5APUA 5AW9B 1HWTC 2WPQA 2R3CA 3VMXA 3LIEA 2ZFCA 2C9NY 3KQGA 3HE4B 1GU4A 2P2UA 3VN0A 2Z5HA 2Z5IA 4GT1A 5AW4B 5APYA 3V5BA 1H8AA 3NMDA 3TK1A 2XZRA 1J2JB 3HTKA 1GK6A 1JUNA 2W6AA 1NAFA 5AW2B 1IO4A 2H7HA 5AW0B 3KDPB 4I2LC 1SP4A 5AVTB 5AVYB 3A5TA 1HUCA 2R5DA 2E43A 3TNUA 4JYCA 1CSBA 1H88A 3M91A 1CI6A 1S9KD 1FOSE 1SLQA 1FAVA 2P7JA 4AYCA 3VMZA 2WPRA 5APSA 2WWWA 4C7NA 3OAKA 1A02J 5AW6B 1T2KC 1DH3A 2WT7B 4LC1A 5AVVB 5AVWB 1HJBA 3HE5A 2Q7CA 3MD0A 5AVSB 3HE4A 1CI6B 3NTNA 2VRSA 1GTWA 2IPPA 1OWAA 5AVZB 5AVUB 3P32A 4I6MC 3LIDA 2QM8A 1OXZA 3M0DA 4JYBA 5APQA 5APTA 5AW3B 3IR9A 3SWFA 2WT7A 1T2KD 1JNMA 4C46A 5APVA 4AQRD 1GK4A 2Q3IA 3VMYA 1GD2E 4XE5B 4RESB 3TNUB 3A3YB 3L36A 4EOTA 4AUWA 1YYCA 3V4WA 1MV8A 2ZXEB 1GU5A 3L37A 2N9BA 3O8ZA 1A02F 1H89A 3M9HA 1KQLA 4HYTB 4C7NB 3P7KA
chains in the Genus database with same CATH superfamily
1BCCE 3P8MC 4NPEA 1FS0E 1NU1G 1NU1D 2KIKA 4YXWH 1VF5D 3JCUH 1K04A 1KQSO 1EDKA 5AW5B 1ZRTE 3FXEA 3KZIE 2NPSC 1S9KE 1A02F 1HJ0A 3BCCE 1PGOA 2JKVA 3HE5B 2QEXP 4B86A 4WVZA 2BCCE 3AEGC 3T97A 1P84H 5AVXB 4UB6H 1CZQA 3H1HJ 3KHUA 3CCQP 3PHLA 5AVRB 2OYOA 2WTYA 3GG2A 1IC2A 2BASA 2OTKE 2B89A 3AECC 4WB4A 3RK3C 1M1KQ 2HPCA 3NXSA 2K9JA 1FZEA 2N1TC 3A2AA 2O01J 4RO0A 4DT0A 5APXA 1XTGB 1RF1A 1PP9J 2Y0CA 4GKGA 1SQPG 1SQPD 2E5TA 1K73Q 5AW8B 2FFDC 2J59M 1QX8A 2JDIH 2GM4A 1X8YA 1LP1B 1M90Q 2OYIB 1IFJA 1T6AA 2ZYAA 1RF0A 3WU2E 3PH0A 4N78E 4MN4C 1EXJA 1M1JA 4TT3H 2PGDA 5KAFE 4WY4D 3MGNA 3NFQA 3JSVC 3RBXA 4Z1MH 1JY2O 2IBZD 2IBZG 5KKZB 3L72J 3I56P 1FZCA 2WZ7A 2FFDB 5AW9B 1RF1B 1JTHA 4UB6E 3S9OA 1AQTA 2FYZA 1IFPA 2ZFCA 1JY2N 4H13B 2KS1A 1LGHB 3FGAD 2NPSA 3HE4B 3H1LE 4LLHA 1AQ5A 3L75E 3CXHE 2XKMA 3L73G 3L73D 2Z5IA 3P8CD 1SQQJ 1KB9E 3CLQA 4BXLA 3A0BH 5CCGD 2QG4A 1BCCJ 2H89C 1RY3A 4XFJA 2E75C 3CXHH 3SSUA 3V5BA 2J5UA 1KC8Q 1GW4A 1IFIA 1M8OB 3V2RA 5CJ4A 1IZNB 1SQXK 2XZRA 3HTKA 1VQNP 1BE3J 1FZBA 2I1KA 4ZMDA 1S72P 2W6AA 2Q1KA 1JEKA 5AW2B 3SFDC 1X22A 1IJDB 2PAJA 3F89A 1G1IA 4OH8B 2WVRA 1MZ9A 1SP4A 1OW6A 4H0LD 4I2LC 5AVTB 1HUCA 2R44A 2R5DA 4EIJA 1EC5A 2WSFH 3L73J 1DIPA 4JYCA 1CSBA 1KZUB 4GOEA 1CI6A 1JMMA 3L72E 2B87A 2P7JA 2NRGA 4PJ0E 5C39A 3TGUJ 4AYCA 5TJHA 1FJPA 3CCSP 4ASWA 3JC22 1K9MQ 1RE3A 3S4RA 2E76D 3H1IG 3H1ID 3C1LA 3H1JJ 1SQVD 1SQVG 4WY4A 1J1DC 3B5NC 3H6PA 1FBMA 1L0NE 1EDJA 2IZ1A 2KYVA 2MKVA 1FDIA 1PV3A 4LC1A 5AVWB 2A45H 1HJBA 3G6EP 3CX5I 1N8RQ 1SQBJ 1S2EA 2QJKC 2E75B 3IAOA 3D70A 1E79H 2B87B 5KKZC 2NPSD 3H1KE 1LT9B 3CC2P 2FXMA 3B5NB 3VMAA 2N9YB 3G3ZA 1EZVE 3RGUA 3MZWB 5CCGA 3P32A 1L0LK 2C0WA 1QEXA 2HFED 1ZXGA 2KNCA 2RH0A 3M0DA 2Q6QA 4JYBA 3TDKA 1T8ZA 1SQBK 1PPJE 2BCCG 2BCCD 1K8AQ 4K3AA 2IBZE 1EZVD 1EZVG 1ZN5A 1WMKA 1SQBD 1G1JA 1SQBG 2Q3IA 2V4HA 3MUDC 4ZKPA 4ZNCA 2CPBA 1Q81Q 1HGZA 2YMYA 1TU3F 1YYCA 3H32B 1Y9BA 3TSIA 5BU8B 3CX5E 2OYIC 1BSHA 1VQ7P 1MV8A 2N9BA 3PJSK 1H89A 1URQB 2RMZA 4GODA 1GL2D 1RE4A 1N86A 2OQQA 4L74A 2OGUA 2R3SA 3OJAB 2SPZA 3CL3D 1WT6A 1OVUA 3CC4P 1VF5B 4PD4I 3G9RA 1BGYJ 4L75A 4U3FG 4U3FD 5KJ7C 5GTIH 1QGKB 3GHGB 3QH9A 5AVQB 5EFWB 5AW7B 2P67A 2QJKB 2XU6A 3AE1C 3WUTA 2C9LY 4I1LA 1KYOH 4LGDE 4OWFA 4H13C 1EQ7A 1LP1A 1PP9E 1MFZA 2AEJA 3E1RA 4M3LA 1VQOP 2D2CD 2Q5UA 3V4QA 1Q86Q 1S1CX 5M1BA 1RF1C 2UWJE 1KFMA 1UIXA 3TYYA 1M1JB 2LR2A 4GIFA 5E79H 1YIJP 3W68A 3PLNA 2W83C 1KILD 1L4AD 1W2BO 1E5WA 2V7QJ 2R32A 1LTJC 2QE7H 1LTIC 1BCCG 1BCCD 1MUUA 2WPSA 1GL2C 3JCUE 2GA1A 3A7OA 1ZRTD 3VYIA 3FWLA 1JTHB 3U1AA 1JB0J 1HGVA 3CI9A 3QWOC 4WBAA 5E79E 1YJ9P 3FXDA 3G71P 3I5CA 1YQ3C 3B4SA 2AEMA 4PJ0H 2KZIA 3USSA 1NTZE 4OVNF 3BRTB 2E75D 2ITAA 3GHGC 4UB8E 5DJUB 1KFNA 2FKWB 3KYQA 3CC7P 1NHLA 4RKUJ 2P10A 3B8EB 1VF5C 2D2CB 4XA4A 2IYPA 4KHXA 3MUDA 2KP8A 2E5YA 2KZJA 1Q7YQ 1GL2A 1HWTC 4D6TJ 3CXHI 3VMXA 3LIEA 2BCCJ 1H0TA 1KQGB 1YI2P 1NTZK 1SQQE 2Z5HA 1KTMA 2YIUC 1JOCA 4GT1A 4PV1B 3MHVA 3S1KA 2W8ZA 3H1LJ 2IFMA 2E74D 2LXBA 3L70J 3BRVB 1ZW0A 5APYA 4EDFA 1J1EC 3IN6A 3NMDA 4DOJA 1NJIQ 1J2JB 2AXTE 2FYUK 3CXHD 2ZT9B 3CWBJ 3KXDA 4NPFX 3EFFK 4H44D 3H1HG 1GL2B 3H1HD 3I55P 4WY4B 1YITP 2JO1A 1YQ4C 4K35A 1KILA 1L4AA 1RE3C 4GDOA 3HRNA 2Z4EA 1PP9G 1PP9D 3H1LG 3H1LD 5AVYB 3A5TA 3L74D 1AV1A 3L74G 1L2PA 2WSCJ 3TNUA 2E43A 2FYUE 3D6YA 2KSEA 3KPEA 2M5AA 5CJ0A 1VQ6P 3CX5H 1N7SD 1KV4A 1J1EB 1SLQA 1JMBA 1X9VA 2Y9YA 3Q3DA 3RK3B 1AFOA 1SQXE 1LTTC 2O1KA 3B5NA 3RL0B 2WWWA 1NKNA 3OW2O 3CCUP 3LW5H 4OGQD 2KNCB 1NTKK 1NYHA 1KQFB 2QVAA 3WMM0 4HH2A 4H0LC 1URQC 3HE5A 3OA7A 2Q7CA 3MD0A 4I7ZB 3BVHA 1SQVJ 2NPSB 2G3AA 3HE4A 1SFCA 4Y99C 3AE3C 1S5LH 1JY3N 1NGMB 1KB9I 1OFCX 2POHA 5KLVJ 1GTWA 3EFGA 3CD6P 3RBZA 4NPDA 1NU1K 3AEEC 1S5LX 4IL6E 2V7QH 1N7SB 5AVZB 2OYHB 5AVUB 5CCHC 3LIDA 1DD3A 1KD1Q 2HPCB 3VP9A 1FZAA 3FX0A 2WSSH 1NU1E 1OMIA 2AXCA 2E76B 4I7ZC 3VOPA 2WT7A 3L74E 1VDFA 3U59A 2WSEJ 1FZGA 1GK4A 1L0LE 3RK2D 3RL0g 1LWUC 2I1JA 3BCCG 2K1AA 2HODA 3BCCD 1Z56A 1MFTA 3C8VA 4N6JA 4RESB 1BE3G 1BE3D 2H8PD 3A3YB 3L36A 3CPWO 4AUWA 5B5EE 1N2DC 4JF7A 5GTHE 1URQD 1VQPP 1VL2A 2ZXEB 3RL0C 2KB7P 3O8ZA 3R4YA 3WUVA 1QVGO 4BWNA 3L4FA 3A0HH 1N7SA 1RQUA 3M9HA 1KQLA 3L71J 4HKZH 1NO4A 3H25A 5KAIE 2FY8A 1ZV8A 4IFFA 1JM0A 1NTME 1Q90D 2JJLA 2QRXA 2BEQD 3A0HE 3B5ND 4JPZB 4W7ZA 1YJNP 3HD7B 1PIXA 3L72D 3L72G 2A06G 2A06D 2AXTH 3Q2YA 1DX7A 3M0AA 1AVOA 2Q9IA 3MIWA 3M06A 2R5BA 4WY4C 1YBKA 1OW7A 3VTPC 3H1IE 2OTJP 1VQ4P 2W27A 2YMKA 3E1IA 3ITKA 1KORA 1SFCD 3PP5A 2A45G 2FYUD 2FYUG 2XDJA 3CWBD 3CWBG 4BRYB 4YTPC 1YTZT 2J58A 1JY3P 2QM7A 2E74C 1NTMK 3RL0D 2YIUB 5H2FH 3SWYA 3L70G 1T3UA 2JWAA 3L70D 1NAYA 3V2NA 1VQLP 2YNYA 2K9YA 1EXIA 1U7JA 2IBZI 4PD4D 1XTCC 2PP6A 3VMYA 1KILE 2IYOA 1LWUA 2XV5A 3M9BA 2WPVB 1BDDA 2ZAEB 2C0XA 3M0DC 4AQRD 1AVYA 1LTBC 3MP7B 1H0TB 4DZOA 2D2CC 1FOSF 2E42A 1LT9C 2FBWC 5APWA 4YPCA 3GF3A 1QL1A 4DJGA 3Q5RA 1URQA 1JY3O 2JR8A 2H88C 4O9BA 2KOGA 2WSEH 1FZFA 2FYNC 2K3RA 3AEBC 4U3FJ 4RJTA 3Q1MA 3H1JD 2P1JA 3H1JG 3RK3E 1R5SA 2JEEA 2R3CA 2OYHC 4JQ0D 2C9NY 1ZOYC 1K05A 3KQGA 2LXCB 3H1KJ 2PRRA 4H13D 2MJZA 1NTZD 1NTZG 2E76C 3KZIH 5KJ7A 1SQVK 1L4AC 1WRGA 1JCCA 4Y99B 1M57D 3CCMP 1BDCA 1DEBA 3AEDC 1NTKD 1NTKG 2Y0EA 1RHZB 1NKZB 4U3FE 2KK7A 5BVZA 5KLIC 4CPGA 2N1TB 4GOFA 1IO4A 2BEZF 1LJ2A 3V2PA 3CCVP 2H7HA 3GF7A 3IFMA 3O6QB 4W7YA 5AW0B 3HD7C 3KDPB 1PPJD 1PPJG 3AE6C 1Q82Q 1VQ5P 2ZVNB 3LW5J 3RK2C 1VQ9P 1L0LJ 3H32A 4H0LB 1LTJA 5B66H 3CMAP 1N73C 3U1CA 3M91A 3AE9C 1JY2P 2A45I 2ZJSE 1FAVA 1S9KD 2OYIA 1FOSE 3H1KD 3H1KG 4UB8H 5KLVD 5KLVG 2HYNA 5BU5A 5APSA 1USDA 5CCGC 3WU2H 2N1TA 4C7NA 1A02J 2L5GB 2E74B 5CBNA 1JO5A 2WQYC 1NTKJ 3L74J 1ZR2A 1T2KC 1FZCB 3GHGA 4WWIA 2WT7B 1P84D 1GDTA 2KSJA 1SQVE 1SQQD 1SQQG 3CCJP 2KS1B 1RQVA 5AVSB 1N73A 3CCEP 2QJPC 1L0NG 1L0ND 1NOHA 4KJMA 4TLFA 3TF5A 2YKOA 3NTNA 2FYNB 2HLOA 2YKPA 1QL2A 1HVVA 2RKLA 1SVFA 3M9QA 4HB1A 1FZCC 1VQ8P 5KJ7D 4PD4H 3Q5SA 1SQBE 3F5HA 1ZR4A 4I6MC 2QSIA 2IDBA 1OXZA 2QM8A 3AE8C 3BASA 3HUSC 4IOIH 1X0TA 2K9JB 3N4XA 5APQA 5APTA 3AE7C 3RK2B 1JNMA 1N7LA 2AEFA 2M0BA 4C46A 3HD7A 2CPSA 5CHXA 1HF9A 2FYUJ 3N7NA 3V6IA 1KN7A 1N73B 3H1JE 3RK3D 2JWDA 1DD4A 2KXPB 3TNUB 4EOTA 1IFNA 1J1DB 2M5AB 1SQXJ 1SQPJ 1LTGC 5B5EH 5KLIB 1JCDA 2YKQA 2ZXXA 4OGQC 3HUSB 3TGUE 3CMEP 3AE4C 1KB9D 3P8CE 3MTUE 2KI7B 3H1IJ 4HYTB 3VP8A 4BRYA 3CCLP 5KAIH 4IFDK 1OVRA 2FFDA 3SWKA 3Q5PA 2OARA 2XNXA 1R5LA 3II6A 2N1TD 1BSNA 3L70E 4JBZA 5CMZA 3UIAA 1NWQA 2QJPB 2YXRB 1L0LD 1AA0A 1L0LG 3L35A 5TISE 2KLUA 1EDIA 3CWBE 5KLVE 1ZMEC 3AE5C 1NVOA 2YO3A 3L75D 3L75G 4DCKA 4D6TE 3PTZA 3L71E 4ZKUA 1FE6A 1FDOA 1LNQA 1X79B 1U57A 2NZ2A 3ABVC 4N78D 3W67A 5K5GB 5KAFH 2Y9ZA 4R4LA 1HBWA 2M3EA 2YO2A 5AW1B 2CK3H 5CCHD 2KLVA 2HR3A 1CW5A 3PRJA 4L76A 1QVFO 1NH4A 1OVVA 2Y0DA 2QJYC 2XNDH 5H2FE 1OX3A 1KILB 3E7KA 1HTLC 2B88A 4IFMA 1AJYA 2A06E 4ASVA 3B71A 2ZVOB 1FC2C 1S3JA 1IK9A 1OW8A 2HODB 1KYOI 1P84E 2FXOA 3HD7D 2HG5D 1PZQA 4N3YB 3T97B 2WSCH 5KLVK 1SQPE 1BGYE 4H44C 5L8RJ 1PGQA 1KYOD 1SFCC 1EDLA 1GZLA 1SQXG 1SQXD 5CBOA 1USEA 1G2CB 1HH0A 2O1JA 1Q2NA 1RH5B 4U7JA 5APUA 4Y28J 1BGYG 1BGYD 2DW3A 2FXPA 2G8YA 2LKMA 2W6JH 1PL5A 2IX7C 2WPQA 3O6QA 1SQQK 4OGQB 1N7SC 4W80A 3D6ZA 2H43A 1GMJA 2OTLP 1SFCB 1GU4A 2K37A 1IK7A 2P2UA 1FDMA 2ZYGA 3VN0A 1YJWP 2O3JA 3A0BE 1RE4C 1SQPK 3H1HE 3R2PA 5AW4B 1R8EA 1SS1A 1YHQP 4PV1D 1KYOE 1P84I 1H8AA 2GUSA 1LT1A 1EZVI 3TK1A 2L91A 1PGPA 2PFXA 2I8DA 1GK6A 2RN0A 2OYHA 1G2CA 1L0NJ 1JUNA 2Q3EA 1NAFA 2WMMA 3D71A 1ZP0C 1FU1A 2B9BA 1M56D 1GW3A 1NTKE 3V2QA 1L0NK 5CCHA 1M7LA 3AEAC 5GTHH 1KB9H 4EI2A 3ZDMA 1LWUB 1IFMA 1OZHA 1T3JA 1H88A 1NU1J 1YTZI 5KTBA 3VMZA 2IZ0A 1PFIA 2WPRA 3EWKA 3EQ2A 3AE2C 3HTKB 1Y8AA 4A7PA 3L71D 3L71G 1IFDA 1ZLLA 3OAKA 3WUUA 1S5LE 4IL6X 5AW6B 4D6TD 4D6TG 4YXDC 4HJGH 1W2EA 4PV1C 4PD4E 5DJTB 4C7RA 3FWNA 3AEFC 1DH3A 1M1JC 1KMIZ 2KUBA 2QIWA 2WITA 3GLMA 5AVVB 5TISH 2GUVA 3K5BA 4IL6H 4KT0J 3L73E 1MKMA 1VPCA 1DEEG 1D7MA 1LTSC 2ZYDA 1VQMP 1CI6B 2M3BA 3CCRP 2VRSA 2ZT9D 2IPPA 2O01N 2QA4P 4H44B 1QLED 2M8RA 1PGJA 1LTAC 1U7MA 2W6BA 3GMAA 3HUSA 3SFEC 3TGUG 2IFNA 1RF0C 1NTZJ 1OWAA 3TGUD 1NTMJ 3G4SP 4EYYQ 2K88A 3BATA 5AW3B 3GW6A 3IR9A 3SWFA 1T2KD 1VQKP 3BCCJ 4L73A 5APVA 1KILC 5GTIE 1L4AB 2QJYB 1FJKA 1OIPA 1GD2E 3L75J 4XE5B 1UIIA 5B66E 2P58A 2W90A 2YXQB 1LTJB 3V4WA 1S4XA 4QMAA 1LT9A 1NTMG 1NTMD 3C9IA 1GU5A 3L37A 2JP3A 1BE3E 2WSFJ 2ZT9C 3IF4A 4C7NB 1W5CE 3CX5D 4R4MA 1Y47A 2O01H 3P7KA
chains in the Genus database with same CATH topology
1S9KE 5AW5B 2NPSC 3HE5B 4B86A 3T97A 5AVXB 1CZQA 5AVRB 2WTYA 1IC2A 2BASA 4WB4A 3RK3C 2HPCA 3NXSA 1FZEA 2N1TC 3A2AA 1RF1A 5APXA 1XTGB 2FFDC 4GKGA 5AW8B 2J59M 2GM4A 1X8YA 2OYIB 1IFJA 1RF0A 4N78E 1M1JA 4WY4D 3MGNA 3NFQA 1JY2O 1FZCA 2WZ7A 2FFDB 5AW9B 1RF1B 1JTHA 2FYZA 2ZFCA 1JY2N 4LLHA 1LGHB 2NPSA 3HE4B 1AQ5A 2XKMA 2Z5IA 3P8CD 3CLQA 5CCGD 1RY3A 3V5BA 1GW4A 1IFIA 3V2RA 5CJ4A 1SQXK 2XZRA 3HTKA 1FZBA 2I1KA 2W6AA 5AW2B 1IJDB 2PAJA 1G1IA 4OH8B 1MZ9A 1SP4A 4I2LC 5AVTB 1HUCA 2R5DA 4EIJA 2WSFH 4JYCA 1CSBA 1KZUB 1DX7A 1CI6A 1JMMA 2P7JA 4AYCA 1RE3A 4WY4A 1J1DC 3B5NC 3H6PA 1FBMA 2KYVA 4LC1A 5AVWB 2A45H 1HJBA 2NPSD 1LT9B 2FXMA 3B5NB 3G3ZA 5CCGA 3P32A 1L0LK 2C0WA 2HFED 3M0DA 4JYBA 1T8ZA 1SQBK 4AQRD 1ZN5A 2Q3IA 1G1JA 4ZKPA 2CPBA 1HGZA 2YMYA 3H32B 1YYCA 5BU8B 3TSIA 2OYIC 1MV8A 2N9BA 1H89A 1URQB 1GL2D 1RE4A 1N86A 3OJAB 3CL3D 1WT6A 5KJ7C 3GHGB 5AVQB 5AW7B 2P67A 2XU6A 2C9LY 4I1LA 4LGDE 1EQ7A 1MFZA 4M3LA 2Q5UA 3V4QA 1RF1C 1KFMA 3TYYA 1M1JB 4GIFA 1KILD 1L4AD 1E5WA 2R32A 1LTJC 2WPSA 1LTIC 3P8MC 1MUUA 1GL2C 3A7OA 3VYIA 1JTHB 3U1AA 3CI9A 1HGVA 4WBAA 3I5CA 3BRTB 3GHGC 1KFNA 2FKWB 3KYQA 1NHLA 3B8EB 4XA4A 4KHXA 3MUDA 2KP8A 1GL2A 1HWTC 3VMXA 3LIEA 1NTZK 2Z5HA 4GT1A 1JOCA 2IFMA 5APYA 3BRVB 1J1EC 3NMDA 4DOJA 1J2JB 2FYUK 1GL2B 4WY4B 1KILA 1L4AA 1RE3C 3HRNA 2Z4EA 5AVYB 3A5TA 2E43A 3TNUA 3KPEA 5CJ0A 1N7SD 1J1EB 1SLQA 1X9VA 3RK3B 1AFOA 1LTTC 2O1KA 3B5NA 3RL0B 2WWWA 1NKNA 3LW5H 1NTKK 3WMM0 4HH2A 1URQC 3HE5A 3OA7A 2Q7CA 3MD0A 3BVHA 2NPSB 3HE4A 1SFCA 4Y99C 1JY3N 2POHA 1GTWA 3EFGA 1NU1K 2OYHB 5AVZB 1N7SB 5AVUB 5CCHC 3LIDA 2HPCB 3VP9A 1FZAA 2WT7A 3VOPA 1FJPA 3U59A 1VDFA 1FZGA 1GK4A 3RK2D 3VMYA 1LWUC 2I1JA 2HODA 1Z56A 4N6JA 4RESB 3A3YB 3L36A 2H8PD 4AUWA 1N2DC 1URQD 2ZXEB 3RL0C 2KB7P 3O8ZA 1A02F 3L4FA 1N7SA 3M9HA 1KQLA 1NO4A 1ZV8A 4IFFA 2JJLA 3B5ND 4W7ZA 3HD7B 3M0AA 2Q9IA 3MIWA 3M06A 2R5BA 4WY4C 3VTPC 2W27A 3E1IA 3PP5A 1SFCD 2A45G 2XDJA 1YTZT 2J58A 1JY3P 2QM7A 1NTMK 3RL0D 3SWYA 1T3UA 3V2NA 2YNYA 1XTCC 2PP6A 3M9BA 1LWUA 2XV5A 3M0DC 2C0XA 1LTBC 4DZOA 1FOSF 2E42A 1LT9C 5APWA 1QL1A 1URQA 1JY3O 1FZFA 4O9BA 2KOGA 2WSEH 2P1JA 2JEEA 2R3CA 2OYHC 2C9NY 3KQGA 2MJZA 5KJ7A 1SQVK 1L4AC 1WRGA 1JCCA 4Y99B 1DEBA 1NKZB 5BVZA 2N1TB 1IO4A 3V2PA 2H7HA 3IFMA 4W7YA 5AW0B 3HD7C 3KDPB 3RK2C 3H32A 1N73C 1LTJA 3U1CA 3M91A 1S9KD 1JY2P 2A45I 2OYIA 1FAVA 1FOSE 2HYNA 5BU5A 5APSA 5CCGC 4C7NA 2N1TA 1A02J 2L5GB 1JO5A 1FZCB 1ZR2A 1T2KC 3GHGA 2WT7B 1GDTA 2KSJA 5AVSB 1N73A 1NOHA 2YKOA 3NTNA 2HLOA 2YKPA 1QL2A 1HVVA 1SVFA 3M9QA 1FZCC 5KJ7D 1ZR4A 4I6MC 2QM8A 1OXZA 3BASA 3HUSC 5APQA 5APTA 3N4XA 3RK2B 1JNMA 1N7LA 4C46A 3HD7A 2CPSA 5CHXA 3N7NA 1N73B 3RK3D 3TNUB 4EOTA 1IFNA 1J1DB 1LTGC 1JCDA 2YKQA 3HUSB 3P8CE 3MTUE 3VP8A 4HYTB 4IFDK 2FFDA 2OARA 2XNXA 3II6A 2N1TD 5CMZA 3UIAA 1NWQA 3L35A 2YO3A 4ZKUA 1X79B 4N78D 1HBWA 2YO2A 5AW1B 5CCHD 2KLVA 1CW5A 1NH4A 1KILB 4IFMA 1HTLC 1IK9A 2HODB 3HD7D 2HG5D 4N3YB 2WSCH 5KLVK 1SFCC 1GZLA 1G2CB 1HH0A 2O1JA 5APUA 2LKMA 2WPQA 4W80A 2IX7C 1SQQK 1N7SC 2H43A 1SFCB 1GU4A 2P2UA 1FDMA 3VN0A 1RE4C 1SQPK 3R2PA 5AW4B 1H8AA 2GUSA 2OYHA 3TK1A 1GK6A 1G2CA 1JUNA 1NAFA 1FU1A 3V2QA 1GW3A 5CCHA 1L0NK 1M7LA 1LWUB 1IFMA 1T3JA 1H88A 1YTZI 5KTBA 3VMZA 1PFIA 2WPRA 3EQ2A 3HTKB 1IFDA 1ZLLA 3OAKA 5AW6B 1W2EA 4C7RA 1DH3A 1M1JC 2WITA 5AVVB 2GUVA 1VPCA 1LTSC 1CI6B 2M3BA 2VRSA 2IPPA 2M8RA 1LTAC 3HUSA 2W6BA 2IFNA 1RF0C 1OWAA 3BATA 5AW3B 3IR9A 3SWFA 1T2KD 5APVA 1KILC 1L4AB 1FJKA 1GD2E 4XE5B 3V4WA 1LTJB 1LT9A 3C9IA 1GU5A 3L37A 4C7NB 4JF7A 2O01H 3P7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2JJL A;  5CMZ A;  3UIA A;  5AVQ B;  1NWQ A;  1S9K E;  5AW5 B;  5AW7 B;  3L35 A;  2P67 A;  2XU6 A;  3M0A A;  3HE5 B;  2C9L Y;  3M06 A;  2R5B A;  4B86 A;  2YO3 A;  3T97 A;  1MFZ A;  4M3L A;  3VTP C;  2Q5U A;  3V4Q A;  2W27 A;  5AVX B;  1CZQ A;  3TYY A;  1HBW A;  5AVR B;  2YO2 A;  5AW1 B;  2QM7 A;  2WTY A;  2BAS A;  2R32 A;  2WPS A;  3P8M C;  1MUU A;  3NXS A;  3A7O A;  2YNY A;  3A2A A;  3VYI A;  5APX A;  4GKG A;  5AW8 B;  3M9B A;  2XV5 A;  3I5C A;  1X8Y A;  4DZO A;  1FOS F;  2E42 A;  5APW A;  3MGN A;  1GZL A;  3NFQ A;  3B8E B;  1G2C B;  4KHX A;  2KP8 A;  5APU A;  5AW9 B;  1HWT C;  2WPQ A;  2R3C A;  3VMX A;  3LIE A;  2ZFC A;  2C9N Y;  3KQG A;  3HE4 B;  1GU4 A;  2P2U A;  3VN0 A;  2Z5H A;  2Z5I A;  4GT1 A;  5AW4 B;  5APY A;  3V5B A;  1H8A A;  3NMD A;  3TK1 A;  2XZR A;  1J2J B;  3HTK A;  1GK6 A;  1JUN A;  2W6A A;  1NAF A;  5AW2 B;  1IO4 A;  2H7H A;  5AW0 B;  3KDP B;  4I2L C;  1SP4 A;  5AVT B;  5AVY B;  3A5T A;  1HUC A;  2R5D A;  2E43 A;  3TNU A;  4JYC A;  1CSB A;  1H88 A;  3M91 A;  1CI6 A;  1S9K D;  1FOS E;  1SLQ A;  1FAV A;  2P7J A;  4AYC A;  3VMZ A;  2WPR A;  5APS A;  2WWW A;  4C7N A;  3OAK A;  1A02 J;  5AW6 B;  1T2K C;  1DH3 A;  2WT7 B;  4LC1 A;  5AVV B;  5AVW B;  1HJB A;  3HE5 A;  2Q7C A;  3MD0 A;  5AVS B;  3HE4 A;  1CI6 B;  3NTN A;  2VRS A;  1GTW A;  2IPP A;  1OWA A;  5AVZ B;  5AVU B;  3P32 A;  4I6M C;  3LID A;  2QM8 A;  1OXZ A;  3M0D A;  4JYB A;  5APQ A;  5APT A;  5AW3 B;  3IR9 A;  3SWF A;  2WT7 A;  1T2K D;  1JNM A;  4C46 A;  5APV A;  4AQR D;  1GK4 A;  2Q3I A;  3VMY A;  1GD2 E;  4XE5 B;  4RES B;  3TNU B;  3A3Y B;  3L36 A;  4EOT A;  4AUW A;  1YYC A;  3V4W A;  1MV8 A;  2ZXE B;  1GU5 A;  3L37 A;  2N9B A;  3O8Z A;  1A02 F;  1H89 A;  3M9H A;  1KQL A;  4HYT B;  4C7N B;  3P7K A; 
#chains in the Genus database with same CATH topology
 1BCC E;  3P8M C;  4NPE A;  1FS0 E;  1NU1 G;  1NU1 D;  2KIK A;  4YXW H;  1VF5 D;  3JCU H;  1K04 A;  1KQS O;  1EDK A;  5AW5 B;  1ZRT E;  3FXE A;  3KZI E;  2NPS C;  1S9K E;  1A02 F;  1HJ0 A;  3BCC E;  1PGO A;  2JKV A;  3HE5 B;  2QEX P;  4B86 A;  4WVZ A;  2BCC E;  3AEG C;  3T97 A;  1P84 H;  5AVX B;  4UB6 H;  1CZQ A;  3H1H J;  3KHU A;  3CCQ P;  3PHL A;  5AVR B;  2OYO A;  2WTY A;  3GG2 A;  1IC2 A;  2BAS A;  2OTK E;  2B89 A;  3AEC C;  4WB4 A;  3RK3 C;  1M1K Q;  2HPC A;  3NXS A;  2K9J A;  1FZE A;  2N1T C;  3A2A A;  2O01 J;  4RO0 A;  4DT0 A;  5APX A;  1XTG B;  1RF1 A;  1PP9 J;  2Y0C A;  4GKG A;  1SQP G;  1SQP D;  2E5T A;  1K73 Q;  5AW8 B;  2FFD C;  2J59 M;  1QX8 A;  2JDI H;  2GM4 A;  1X8Y A;  1LP1 B;  1M90 Q;  2OYI B;  1IFJ A;  1T6A A;  2ZYA A;  1RF0 A;  3WU2 E;  3PH0 A;  4N78 E;  4MN4 C;  1EXJ A;  1M1J A;  4TT3 H;  2PGD A;  5KAF E;  4WY4 D;  3MGN A;  3NFQ A;  3JSV C;  3RBX A;  4Z1M H;  1JY2 O;  2IBZ D;  2IBZ G;  5KKZ B;  3L72 J;  3I56 P;  1FZC A;  2WZ7 A;  2FFD B;  5AW9 B;  1RF1 B;  1JTH A;  4UB6 E;  3S9O A;  1AQT A;  2FYZ A;  1IFP A;  2ZFC A;  1JY2 N;  4H13 B;  2KS1 A;  1LGH B;  3FGA D;  2NPS A;  3HE4 B;  3H1L E;  4LLH A;  1AQ5 A;  3L75 E;  3CXH E;  2XKM A;  3L73 G;  3L73 D;  2Z5I A;  3P8C D;  1SQQ J;  1KB9 E;  3CLQ A;  4BXL A;  3A0B H;  5CCG D;  2QG4 A;  1BCC J;  2H89 C;  1RY3 A;  4XFJ A;  2E75 C;  3CXH H;  3SSU A;  3V5B A;  2J5U A;  1KC8 Q;  1GW4 A;  1IFI A;  1M8O B;  3V2R A;  5CJ4 A;  1IZN B;  1SQX K;  2XZR A;  3HTK A;  1VQN P;  1BE3 J;  1FZB A;  2I1K A;  4ZMD A;  1S72 P;  2W6A A;  2Q1K A;  1JEK A;  5AW2 B;  3SFD C;  1X22 A;  1IJD B;  2PAJ A;  3F89 A;  1G1I A;  4OH8 B;  2WVR A;  1MZ9 A;  1SP4 A;  1OW6 A;  4H0L D;  4I2L C;  5AVT B;  1HUC A;  2R44 A;  2R5D A;  4EIJ A;  1EC5 A;  2WSF H;  3L73 J;  1DIP A;  4JYC A;  1CSB A;  1KZU B;  4GOE A;  1CI6 A;  1JMM A;  3L72 E;  2B87 A;  2P7J A;  2NRG A;  4PJ0 E;  5C39 A;  3TGU J;  4AYC A;  5TJH A;  1FJP A;  3CCS P;  4ASW A;  3JC2 2;  1K9M Q;  1RE3 A;  3S4R A;  2E76 D;  3H1I G;  3H1I D;  3C1L A;  3H1J J;  1SQV D;  1SQV G;  4WY4 A;  1J1D C;  3B5N C;  3H6P A;  1FBM A;  1L0N E;  1EDJ A;  2IZ1 A;  2KYV A;  2MKV A;  1FDI A;  1PV3 A;  4LC1 A;  5AVW B;  2A45 H;  1HJB A;  3G6E P;  3CX5 I;  1N8R Q;  1SQB J;  1S2E A;  2QJK C;  2E75 B;  3IAO A;  3D70 A;  1E79 H;  2B87 B;  5KKZ C;  2NPS D;  3H1K E;  1LT9 B;  3CC2 P;  2FXM A;  3B5N B;  3VMA A;  2N9Y B;  3G3Z A;  1EZV E;  3RGU A;  3MZW B;  5CCG A;  3P32 A;  1L0L K;  2C0W A;  1QEX A;  2HFE D;  1ZXG A;  2KNC A;  2RH0 A;  3M0D A;  2Q6Q A;  4JYB A;  3TDK A;  1T8Z A;  1SQB K;  1PPJ E;  2BCC G;  2BCC D;  1K8A Q;  4K3A A;  2IBZ E;  1EZV D;  1EZV G;  1ZN5 A;  1WMK A;  1SQB D;  1G1J A;  1SQB G;  2Q3I A;  2V4H A;  3MUD C;  4ZKP A;  4ZNC A;  2CPB A;  1Q81 Q;  1HGZ A;  2YMY A;  1TU3 F;  1YYC A;  3H32 B;  1Y9B A;  3TSI A;  5BU8 B;  3CX5 E;  2OYI C;  1BSH A;  1VQ7 P;  1MV8 A;  2N9B A;  3PJS K;  1H89 A;  1URQ B;  2RMZ A;  4GOD A;  1GL2 D;  1RE4 A;  1N86 A;  2OQQ A;  4L74 A;  2OGU A;  2R3S A;  3OJA B;  2SPZ A;  3CL3 D;  1WT6 A;  1OVU A;  3CC4 P;  1VF5 B;  4PD4 I;  3G9R A;  1BGY J;  4L75 A;  4U3F G;  4U3F D;  5KJ7 C;  5GTI H;  1QGK B;  3GHG B;  3QH9 A;  5AVQ B;  5EFW B;  5AW7 B;  2P67 A;  2QJK B;  2XU6 A;  3AE1 C;  3WUT A;  2C9L Y;  4I1L A;  1KYO H;  4LGD E;  4OWF A;  4H13 C;  1EQ7 A;  1LP1 A;  1PP9 E;  1MFZ A;  2AEJ A;  3E1R A;  4M3L A;  1VQO P;  2D2C D;  2Q5U A;  3V4Q A;  1Q86 Q;  1S1C X;  5M1B A;  1RF1 C;  2UWJ E;  1KFM A;  1UIX A;  3TYY A;  1M1J B;  2LR2 A;  4GIF A;  5E79 H;  1YIJ P;  3W68 A;  3PLN A;  2W83 C;  1KIL D;  1L4A D;  1W2B O;  1E5W A;  2V7Q J;  2R32 A;  1LTJ C;  2QE7 H;  1LTI C;  1BCC G;  1BCC D;  1MUU A;  2WPS A;  1GL2 C;  3JCU E;  2GA1 A;  3A7O A;  1ZRT D;  3VYI A;  3FWL A;  1JTH B;  3U1A A;  1JB0 J;  1HGV A;  3CI9 A;  3QWO C;  4WBA A;  5E79 E;  1YJ9 P;  3FXD A;  3G71 P;  3I5C A;  1YQ3 C;  3B4S A;  2AEM A;  4PJ0 H;  2KZI A;  3USS A;  1NTZ E;  4OVN F;  3BRT B;  2E75 D;  2ITA A;  3GHG C;  4UB8 E;  5DJU B;  1KFN A;  2FKW B;  3KYQ A;  3CC7 P;  1NHL A;  4RKU J;  2P10 A;  3B8E B;  1VF5 C;  2D2C B;  4XA4 A;  2IYP A;  4KHX A;  3MUD A;  2KP8 A;  2E5Y A;  2KZJ A;  1Q7Y Q;  1GL2 A;  1HWT C;  4D6T J;  3CXH I;  3VMX A;  3LIE A;  2BCC J;  1H0T A;  1KQG B;  1YI2 P;  1NTZ K;  1SQQ E;  2Z5H A;  1KTM A;  2YIU C;  1JOC A;  4GT1 A;  4PV1 B;  3MHV A;  3S1K A;  2W8Z A;  3H1L J;  2IFM A;  2E74 D;  2LXB A;  3L70 J;  3BRV B;  1ZW0 A;  5APY A;  4EDF A;  1J1E C;  3IN6 A;  3NMD A;  4DOJ A;  1NJI Q;  1J2J B;  2AXT E;  2FYU K;  3CXH D;  2ZT9 B;  3CWB J;  3KXD A;  4NPF X;  3EFF K;  4H44 D;  3H1H G;  1GL2 B;  3H1H D;  3I55 P;  4WY4 B;  1YIT P;  2JO1 A;  1YQ4 C;  4K35 A;  1KIL A;  1L4A A;  1RE3 C;  4GDO A;  3HRN A;  2Z4E A;  1PP9 G;  1PP9 D;  3H1L G;  3H1L D;  5AVY B;  3A5T A;  3L74 D;  1AV1 A;  3L74 G;  1L2P A;  2WSC J;  3TNU A;  2E43 A;  2FYU E;  3D6Y A;  2KSE A;  3KPE A;  2M5A A;  5CJ0 A;  1VQ6 P;  3CX5 H;  1N7S D;  1KV4 A;  1J1E B;  1SLQ A;  1JMB A;  1X9V A;  2Y9Y A;  3Q3D A;  3RK3 B;  1AFO A;  1SQX E;  1LTT C;  2O1K A;  3B5N A;  3RL0 B;  2WWW A;  1NKN A;  3OW2 O;  3CCU P;  3LW5 H;  4OGQ D;  2KNC B;  1NTK K;  1NYH A;  1KQF B;  2QVA A;  3WMM 0;  4HH2 A;  4H0L C;  1URQ C;  3HE5 A;  3OA7 A;  2Q7C A;  3MD0 A;  4I7Z B;  3BVH A;  1SQV J;  2NPS B;  2G3A A;  3HE4 A;  1SFC A;  4Y99 C;  3AE3 C;  1S5L H;  1JY3 N;  1NGM B;  1KB9 I;  1OFC X;  2POH A;  5KLV J;  1GTW A;  3EFG A;  3CD6 P;  3RBZ A;  4NPD A;  1NU1 K;  3AEE C;  1S5L X;  4IL6 E;  2V7Q H;  1N7S B;  5AVZ B;  2OYH B;  5AVU B;  5CCH C;  3LID A;  1DD3 A;  1KD1 Q;  2HPC B;  3VP9 A;  1FZA A;  3FX0 A;  2WSS H;  1NU1 E;  1OMI A;  2AXC A;  2E76 B;  4I7Z C;  3VOP A;  2WT7 A;  3L74 E;  1VDF A;  3U59 A;  2WSE J;  1FZG A;  1GK4 A;  1L0L E;  3RK2 D;  3RL0 g;  1LWU C;  2I1J A;  3BCC G;  2K1A A;  2HOD A;  3BCC D;  1Z56 A;  1MFT A;  3C8V A;  4N6J A;  4RES B;  1BE3 G;  1BE3 D;  2H8P D;  3A3Y B;  3L36 A;  3CPW O;  4AUW A;  5B5E E;  1N2D C;  4JF7 A;  5GTH E;  1URQ D;  1VQP P;  1VL2 A;  2ZXE B;  3RL0 C;  2KB7 P;  3O8Z A;  3R4Y A;  3WUV A;  1QVG O;  4BWN A;  3L4F A;  3A0H H;  1N7S A;  1RQU A;  3M9H A;  1KQL A;  3L71 J;  4HKZ H;  1NO4 A;  3H25 A;  5KAI E;  2FY8 A;  1ZV8 A;  4IFF A;  1JM0 A;  1NTM E;  1Q90 D;  2JJL A;  2QRX A;  2BEQ D;  3A0H E;  3B5N D;  4JPZ B;  4W7Z A;  1YJN P;  3HD7 B;  1PIX A;  3L72 D;  3L72 G;  2A06 G;  2A06 D;  2AXT H;  3Q2Y A;  1DX7 A;  3M0A A;  1AVO A;  2Q9I A;  3MIW A;  3M06 A;  2R5B A;  4WY4 C;  1YBK A;  1OW7 A;  3VTP C;  3H1I E;  2OTJ P;  1VQ4 P;  2W27 A;  2YMK A;  3E1I A;  3ITK A;  1KOR A;  1SFC D;  3PP5 A;  2A45 G;  2FYU D;  2FYU G;  2XDJ A;  3CWB D;  3CWB G;  4BRY B;  4YTP C;  1YTZ T;  2J58 A;  1JY3 P;  2QM7 A;  2E74 C;  1NTM K;  3RL0 D;  2YIU B;  5H2F H;  3SWY A;  3L70 G;  1T3U A;  2JWA A;  3L70 D;  1NAY A;  3V2N A;  1VQL P;  2YNY A;  2K9Y A;  1EXI A;  1U7J A;  2IBZ I;  4PD4 D;  1XTC C;  2PP6 A;  3VMY A;  1KIL E;  2IYO A;  1LWU A;  2XV5 A;  3M9B A;  2WPV B;  1BDD A;  2ZAE B;  2C0X A;  3M0D C;  4AQR D;  1AVY A;  1LTB C;  3MP7 B;  1H0T B;  4DZO A;  2D2C C;  1FOS F;  2E42 A;  1LT9 C;  2FBW C;  5APW A;  4YPC A;  3GF3 A;  1QL1 A;  4DJG A;  3Q5R A;  1URQ A;  1JY3 O;  2JR8 A;  2H88 C;  4O9B A;  2KOG A;  2WSE H;  1FZF A;  2FYN C;  2K3R A;  3AEB C;  4U3F J;  4RJT A;  3Q1M A;  3H1J D;  2P1J A;  3H1J G;  3RK3 E;  1R5S A;  2JEE A;  2R3C A;  2OYH C;  4JQ0 D;  2C9N Y;  1ZOY C;  1K05 A;  3KQG A;  2LXC B;  3H1K J;  2PRR A;  4H13 D;  2MJZ A;  1NTZ D;  1NTZ G;  2E76 C;  3KZI H;  5KJ7 A;  1SQV K;  1L4A C;  1WRG A;  1JCC A;  4Y99 B;  1M57 D;  3CCM P;  1BDC A;  1DEB A;  3AED C;  1NTK D;  1NTK G;  2Y0E A;  1RHZ B;  1NKZ B;  4U3F E;  2KK7 A;  5BVZ A;  5KLI C;  4CPG A;  2N1T B;  4GOF A;  1IO4 A;  2BEZ F;  1LJ2 A;  3V2P A;  3CCV P;  2H7H A;  3GF7 A;  3IFM A;  3O6Q B;  4W7Y A;  5AW0 B;  3HD7 C;  3KDP B;  1PPJ D;  1PPJ G;  3AE6 C;  1Q82 Q;  1VQ5 P;  2ZVN B;  3LW5 J;  3RK2 C;  1VQ9 P;  1L0L J;  3H32 A;  4H0L B;  1LTJ A;  5B66 H;  3CMA P;  1N73 C;  3U1C A;  3M91 A;  3AE9 C;  1JY2 P;  2A45 I;  2ZJS E;  1FAV A;  1S9K D;  2OYI A;  1FOS E;  3H1K D;  3H1K G;  4UB8 H;  5KLV D;  5KLV G;  2HYN A;  5BU5 A;  5APS A;  1USD A;  5CCG C;  3WU2 H;  2N1T A;  4C7N A;  1A02 J;  2L5G B;  2E74 B;  5CBN A;  1JO5 A;  2WQY C;  1NTK J;  3L74 J;  1ZR2 A;  1T2K C;  1FZC B;  3GHG A;  4WWI A;  2WT7 B;  1P84 D;  1GDT A;  2KSJ A;  1SQV E;  1SQQ D;  1SQQ G;  3CCJ P;  2KS1 B;  1RQV A;  5AVS B;  1N73 A;  3CCE P;  2QJP C;  1L0N G;  1L0N D;  1NOH A;  4KJM A;  4TLF A;  3TF5 A;  2YKO A;  3NTN A;  2FYN B;  2HLO A;  2YKP A;  1QL2 A;  1HVV A;  2RKL A;  1SVF A;  3M9Q A;  4HB1 A;  1FZC C;  1VQ8 P;  5KJ7 D;  4PD4 H;  3Q5S A;  1SQB E;  3F5H A;  1ZR4 A;  4I6M C;  2QSI A;  2IDB A;  1OXZ A;  2QM8 A;  3AE8 C;  3BAS A;  3HUS C;  4IOI H;  1X0T A;  2K9J B;  3N4X A;  5APQ A;  5APT A;  3AE7 C;  3RK2 B;  1JNM A;  1N7L A;  2AEF A;  2M0B A;  4C46 A;  3HD7 A;  2CPS A;  5CHX A;  1HF9 A;  2FYU J;  3N7N A;  3V6I A;  1KN7 A;  1N73 B;  3H1J E;  3RK3 D;  2JWD A;  1DD4 A;  2KXP B;  3TNU B;  4EOT A;  1IFN A;  1J1D B;  2M5A B;  1SQX J;  1SQP J;  1LTG C;  5B5E H;  5KLI B;  1JCD A;  2YKQ A;  2ZXX A;  4OGQ C;  3HUS B;  3TGU E;  3CME P;  3AE4 C;  1KB9 D;  3P8C E;  3MTU E;  2KI7 B;  3H1I J;  4HYT B;  3VP8 A;  4BRY A;  3CCL P;  5KAI H;  4IFD K;  1OVR A;  2FFD A;  3SWK A;  3Q5P A;  2OAR A;  2XNX A;  1R5L A;  3II6 A;  2N1T D;  1BSN A;  3L70 E;  4JBZ A;  5CMZ A;  3UIA A;  1NWQ A;  2QJP B;  2YXR B;  1L0L D;  1AA0 A;  1L0L G;  3L35 A;  5TIS E;  2KLU A;  1EDI A;  3CWB E;  5KLV E;  1ZME C;  3AE5 C;  1NVO A;  2YO3 A;  3L75 D;  3L75 G;  4DCK A;  4D6T E;  3PTZ A;  3L71 E;  4ZKU A;  1FE6 A;  1FDO A;  1LNQ A;  1X79 B;  1U57 A;  2NZ2 A;  3ABV C;  4N78 D;  3W67 A;  5K5G B;  5KAF H;  2Y9Z A;  4R4L A;  1HBW A;  2M3E A;  2YO2 A;  5AW1 B;  2CK3 H;  5CCH D;  2KLV A;  2HR3 A;  1CW5 A;  3PRJ A;  4L76 A;  1QVF O;  1NH4 A;  1OVV A;  2Y0D A;  2QJY C;  2XND H;  5H2F E;  1OX3 A;  1KIL B;  3E7K A;  1HTL C;  2B88 A;  4IFM A;  1AJY A;  2A06 E;  4ASV A;  3B71 A;  2ZVO B;  1FC2 C;  1S3J A;  1IK9 A;  1OW8 A;  2HOD B;  1KYO I;  1P84 E;  2FXO A;  3HD7 D;  2HG5 D;  1PZQ A;  4N3Y B;  3T97 B;  2WSC H;  5KLV K;  1SQP E;  1BGY E;  4H44 C;  5L8R J;  1PGQ A;  1KYO D;  1SFC C;  1EDL A;  1GZL A;  1SQX G;  1SQX D;  5CBO A;  1USE A;  1G2C B;  1HH0 A;  2O1J A;  1Q2N A;  1RH5 B;  4U7J A;  5APU A;  4Y28 J;  1BGY G;  1BGY D;  2DW3 A;  2FXP A;  2G8Y A;  2LKM A;  2W6J H;  1PL5 A;  2IX7 C;  2WPQ A;  3O6Q A;  1SQQ K;  4OGQ B;  1N7S C;  4W80 A;  3D6Z A;  2H43 A;  1GMJ A;  2OTL P;  1SFC B;  1GU4 A;  2K37 A;  1IK7 A;  2P2U A;  1FDM A;  2ZYG A;  3VN0 A;  1YJW P;  2O3J A;  3A0B E;  1RE4 C;  1SQP K;  3H1H E;  3R2P A;  5AW4 B;  1R8E A;  1SS1 A;  1YHQ P;  4PV1 D;  1KYO E;  1P84 I;  1H8A A;  2GUS A;  1LT1 A;  1EZV I;  3TK1 A;  2L91 A;  1PGP A;  2PFX A;  2I8D A;  1GK6 A;  2RN0 A;  2OYH A;  1G2C A;  1L0N J;  1JUN A;  2Q3E A;  1NAF A;  2WMM A;  3D71 A;  1ZP0 C;  1FU1 A;  2B9B A;  1M56 D;  1GW3 A;  1NTK E;  3V2Q A;  1L0N K;  5CCH A;  1M7L A;  3AEA C;  5GTH H;  1KB9 H;  4EI2 A;  3ZDM A;  1LWU B;  1IFM A;  1OZH A;  1T3J A;  1H88 A;  1NU1 J;  1YTZ I;  5KTB A;  3VMZ A;  2IZ0 A;  1PFI A;  2WPR A;  3EWK A;  3EQ2 A;  3AE2 C;  3HTK B;  1Y8A A;  4A7P A;  3L71 D;  3L71 G;  1IFD A;  1ZLL A;  3OAK A;  3WUU A;  1S5L E;  4IL6 X;  5AW6 B;  4D6T D;  4D6T G;  4YXD C;  4HJG H;  1W2E A;  4PV1 C;  4PD4 E;  5DJT B;  4C7R A;  3FWN A;  3AEF C;  1DH3 A;  1M1J C;  1KMI Z;  2KUB A;  2QIW A;  2WIT A;  3GLM A;  5AVV B;  5TIS H;  2GUV A;  3K5B A;  4IL6 H;  4KT0 J;  3L73 E;  1MKM A;  1VPC A;  1DEE G;  1D7M A;  1LTS C;  2ZYD A;  1VQM P;  1CI6 B;  2M3B A;  3CCR P;  2VRS A;  2ZT9 D;  2IPP A;  2O01 N;  2QA4 P;  4H44 B;  1QLE D;  2M8R A;  1PGJ A;  1LTA C;  1U7M A;  2W6B A;  3GMA A;  3HUS A;  3SFE C;  3TGU G;  2IFN A;  1RF0 C;  1NTZ J;  1OWA A;  3TGU D;  1NTM J;  3G4S P;  4EYY Q;  2K88 A;  3BAT A;  5AW3 B;  3GW6 A;  3IR9 A;  3SWF A;  1T2K D;  1VQK P;  3BCC J;  4L73 A;  5APV A;  1KIL C;  5GTI E;  1L4A B;  2QJY B;  1FJK A;  1OIP A;  1GD2 E;  3L75 J;  4XE5 B;  1UII A;  5B66 E;  2P58 A;  2W90 A;  2YXQ B;  1LTJ B;  3V4W A;  1S4X A;  4QMA A;  1LT9 A;  1NTM G;  1NTM D;  3C9I A;  1GU5 A;  3L37 A;  2JP3 A;  1BE3 E;  2WSF J;  2ZT9 C;  3IF4 A;  4C7N B;  1W5C E;  3CX5 D;  4R4M A;  1Y47 A;  2O01 H;  3P7K A; 
#chains in the Genus database with same CATH homology
 1S9K E;  5AW5 B;  2NPS C;  3HE5 B;  4B86 A;  3T97 A;  5AVX B;  1CZQ A;  5AVR B;  2WTY A;  1IC2 A;  2BAS A;  4WB4 A;  3RK3 C;  2HPC A;  3NXS A;  1FZE A;  2N1T C;  3A2A A;  1RF1 A;  5APX A;  1XTG B;  2FFD C;  4GKG A;  5AW8 B;  2J59 M;  2GM4 A;  1X8Y A;  2OYI B;  1IFJ A;  1RF0 A;  4N78 E;  1M1J A;  4WY4 D;  3MGN A;  3NFQ A;  1JY2 O;  1FZC A;  2WZ7 A;  2FFD B;  5AW9 B;  1RF1 B;  1JTH A;  2FYZ A;  2ZFC A;  1JY2 N;  4LLH A;  1LGH B;  2NPS A;  3HE4 B;  1AQ5 A;  2XKM A;  2Z5I A;  3P8C D;  3CLQ A;  5CCG D;  1RY3 A;  3V5B A;  1GW4 A;  1IFI A;  3V2R A;  5CJ4 A;  1SQX K;  2XZR A;  3HTK A;  1FZB A;  2I1K A;  2W6A A;  5AW2 B;  1IJD B;  2PAJ A;  1G1I A;  4OH8 B;  1MZ9 A;  1SP4 A;  4I2L C;  5AVT B;  1HUC A;  2R5D A;  4EIJ A;  2WSF H;  4JYC A;  1CSB A;  1KZU B;  1DX7 A;  1CI6 A;  1JMM A;  2P7J A;  4AYC A;  1RE3 A;  4WY4 A;  1J1D C;  3B5N C;  3H6P A;  1FBM A;  2KYV A;  4LC1 A;  5AVW B;  2A45 H;  1HJB A;  2NPS D;  1LT9 B;  2FXM A;  3B5N B;  3G3Z A;  5CCG A;  3P32 A;  1L0L K;  2C0W A;  2HFE D;  3M0D A;  4JYB A;  1T8Z A;  1SQB K;  4AQR D;  1ZN5 A;  2Q3I A;  1G1J A;  4ZKP A;  2CPB A;  1HGZ A;  2YMY A;  3H32 B;  1YYC A;  5BU8 B;  3TSI A;  2OYI C;  1MV8 A;  2N9B A;  1H89 A;  1URQ B;  1GL2 D;  1RE4 A;  1N86 A;  3OJA B;  3CL3 D;  1WT6 A;  5KJ7 C;  3GHG B;  5AVQ B;  5AW7 B;  2P67 A;  2XU6 A;  2C9L Y;  4I1L A;  4LGD E;  1EQ7 A;  1MFZ A;  4M3L A;  2Q5U A;  3V4Q A;  1RF1 C;  1KFM A;  3TYY A;  1M1J B;  4GIF A;  1KIL D;  1L4A D;  1E5W A;  2R32 A;  1LTJ C;  2WPS A;  1LTI C;  3P8M C;  1MUU A;  1GL2 C;  3A7O A;  3VYI A;  1JTH B;  3U1A A;  3CI9 A;  1HGV A;  4WBA A;  3I5C A;  3BRT B;  3GHG C;  1KFN A;  2FKW B;  3KYQ A;  1NHL A;  3B8E B;  4XA4 A;  4KHX A;  3MUD A;  2KP8 A;  1GL2 A;  1HWT C;  3VMX A;  3LIE A;  1NTZ K;  2Z5H A;  4GT1 A;  1JOC A;  2IFM A;  5APY A;  3BRV B;  1J1E C;  3NMD A;  4DOJ A;  1J2J B;  2FYU K;  1GL2 B;  4WY4 B;  1KIL A;  1L4A A;  1RE3 C;  3HRN A;  2Z4E A;  5AVY B;  3A5T A;  2E43 A;  3TNU A;  3KPE A;  5CJ0 A;  1N7S D;  1J1E B;  1SLQ A;  1X9V A;  3RK3 B;  1AFO A;  1LTT C;  2O1K A;  3B5N A;  3RL0 B;  2WWW A;  1NKN A;  3LW5 H;  1NTK K;  3WMM 0;  4HH2 A;  1URQ C;  3HE5 A;  3OA7 A;  2Q7C A;  3MD0 A;  3BVH A;  2NPS B;  3HE4 A;  1SFC A;  4Y99 C;  1JY3 N;  2POH A;  1GTW A;  3EFG A;  1NU1 K;  2OYH B;  5AVZ B;  1N7S B;  5AVU B;  5CCH C;  3LID A;  2HPC B;  3VP9 A;  1FZA A;  2WT7 A;  3VOP A;  1FJP A;  3U59 A;  1VDF A;  1FZG A;  1GK4 A;  3RK2 D;  3VMY A;  1LWU C;  2I1J A;  2HOD A;  1Z56 A;  4N6J A;  4RES B;  3A3Y B;  3L36 A;  2H8P D;  4AUW A;  1N2D C;  1URQ D;  2ZXE B;  3RL0 C;  2KB7 P;  3O8Z A;  1A02 F;  3L4F A;  1N7S A;  3M9H A;  1KQL A;  1NO4 A;  1ZV8 A;  4IFF A;  2JJL A;  3B5N D;  4W7Z A;  3HD7 B;  3M0A A;  2Q9I A;  3MIW A;  3M06 A;  2R5B A;  4WY4 C;  3VTP C;  2W27 A;  3E1I A;  3PP5 A;  1SFC D;  2A45 G;  2XDJ A;  1YTZ T;  2J58 A;  1JY3 P;  2QM7 A;  1NTM K;  3RL0 D;  3SWY A;  1T3U A;  3V2N A;  2YNY A;  1XTC C;  2PP6 A;  3M9B A;  1LWU A;  2XV5 A;  3M0D C;  2C0X A;  1LTB C;  4DZO A;  1FOS F;  2E42 A;  1LT9 C;  5APW A;  1QL1 A;  1URQ A;  1JY3 O;  1FZF A;  4O9B A;  2KOG A;  2WSE H;  2P1J A;  2JEE A;  2R3C A;  2OYH C;  2C9N Y;  3KQG A;  2MJZ A;  5KJ7 A;  1SQV K;  1L4A C;  1WRG A;  1JCC A;  4Y99 B;  1DEB A;  1NKZ B;  5BVZ A;  2N1T B;  1IO4 A;  3V2P A;  2H7H A;  3IFM A;  4W7Y A;  5AW0 B;  3HD7 C;  3KDP B;  3RK2 C;  3H32 A;  1N73 C;  1LTJ A;  3U1C A;  3M91 A;  1S9K D;  1JY2 P;  2A45 I;  2OYI A;  1FAV A;  1FOS E;  2HYN A;  5BU5 A;  5APS A;  5CCG C;  4C7N A;  2N1T A;  1A02 J;  2L5G B;  1JO5 A;  1FZC B;  1ZR2 A;  1T2K C;  3GHG A;  2WT7 B;  1GDT A;  2KSJ A;  5AVS B;  1N73 A;  1NOH A;  2YKO A;  3NTN A;  2HLO A;  2YKP A;  1QL2 A;  1HVV A;  1SVF A;  3M9Q A;  1FZC C;  5KJ7 D;  1ZR4 A;  4I6M C;  2QM8 A;  1OXZ A;  3BAS A;  3HUS C;  5APQ A;  5APT A;  3N4X A;  3RK2 B;  1JNM A;  1N7L A;  4C46 A;  3HD7 A;  2CPS A;  5CHX A;  3N7N A;  1N73 B;  3RK3 D;  3TNU B;  4EOT A;  1IFN A;  1J1D B;  1LTG C;  1JCD A;  2YKQ A;  3HUS B;  3P8C E;  3MTU E;  3VP8 A;  4HYT B;  4IFD K;  2FFD A;  2OAR A;  2XNX A;  3II6 A;  2N1T D;  5CMZ A;  3UIA A;  1NWQ A;  3L35 A;  2YO3 A;  4ZKU A;  1X79 B;  4N78 D;  1HBW A;  2YO2 A;  5AW1 B;  5CCH D;  2KLV A;  1CW5 A;  1NH4 A;  1KIL B;  4IFM A;  1HTL C;  1IK9 A;  2HOD B;  3HD7 D;  2HG5 D;  4N3Y B;  2WSC H;  5KLV K;  1SFC C;  1GZL A;  1G2C B;  1HH0 A;  2O1J A;  5APU A;  2LKM A;  2WPQ A;  4W80 A;  2IX7 C;  1SQQ K;  1N7S C;  2H43 A;  1SFC B;  1GU4 A;  2P2U A;  1FDM A;  3VN0 A;  1RE4 C;  1SQP K;  3R2P A;  5AW4 B;  1H8A A;  2GUS A;  2OYH A;  3TK1 A;  1GK6 A;  1G2C A;  1JUN A;  1NAF A;  1FU1 A;  3V2Q A;  1GW3 A;  5CCH A;  1L0N K;  1M7L A;  1LWU B;  1IFM A;  1T3J A;  1H88 A;  1YTZ I;  5KTB A;  3VMZ A;  1PFI A;  2WPR A;  3EQ2 A;  3HTK B;  1IFD A;  1ZLL A;  3OAK A;  5AW6 B;  1W2E A;  4C7R A;  1DH3 A;  1M1J C;  2WIT A;  5AVV B;  2GUV A;  1VPC A;  1LTS C;  1CI6 B;  2M3B A;  2VRS A;  2IPP A;  2M8R A;  1LTA C;  3HUS A;  2W6B A;  2IFN A;  1RF0 C;  1OWA A;  3BAT A;  5AW3 B;  3IR9 A;  3SWF A;  1T2K D;  5APV A;  1KIL C;  1L4A B;  1FJK A;  1GD2 E;  4XE5 B;  3V4W A;  1LTJ B;  1LT9 A;  3C9I A;  1GU5 A;  3L37 A;  4C7N B;  4JF7 A;  2O01 H;  3P7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...