3UIAA

Structural determinants of trimerization specificity in hiv-1 gp41 protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
QARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGLKQIQARILAVERYLKDQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein 41
publication title Structural Determinants of Trimerization Specificity in HIV-1 gp41 Protein
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3uiaA00
3V4QA 1MFZA 2IPPA 5APXA 2YNYA 3A7OA 2Q7CA 3VMZA 2Z5HA 1HWTC 2E43A 3L37A 4EOTA 4LC1A 3TK1A 3T97A 4RESB 4I6MC 3KQGA 3VTPC 1MUUA 1FOSE 4C46A 5APYA 4AUWA 1A02J 1J2JB 2VRSA 5APQA 2Z5IA 3M91A 5AVUB 1CSBA 2WT7B 5AW4B 4GT1A 3P7KA 5AW2B 3TNUB 5AW9B 1H8AA 2Q3IA 3B8EB 3OAKA 1CI6B 1GTWA 2ZFCA 4C7NB 5AW8B 4DZOA 2N9BA 3O8ZA 2WWWA 3VYIA 1GU5A 1CZQA 3P8MC 3IR9A 4JYCA 3A5TA 4HYTB 5AVSB 1G2CB 1S9KD 2R32A 1GZLA 2WTYA 5AW6B 5AVTB 1IO4A 3NMDA 2R5DA 2XU6A 3TNUA 3HE4B 5AVWB 2QM8A 2YO2A 3NFQA 1OWAA 1CI6A 5AVVB 2P67A 4C7NA 2W27A 1S9KE 5AVRB 1MV8A 2WPSA 4I2LC 5APWA 5AW3B 2P2UA 4JYBA 4B86A 1YYCA 2JJLA 5AW7B 1T2KC 3HE5B 5AVQB 3VMXA 1SP4A 3HE4A 1DH3A 1GD2E 2XZRA 2W6AA 1FOSF 3NXSA 4AQRD 2QM7A 2R3CA 5AW1B 3P32A 3UIAA 4AYCA 5AW5B 1OXZA 2WT7A 3KDPB 5AVZB 2KP8A 3M0AA 3M9HA 2E42A 2C9LY 3MGNA 4M3LA 3M06A 3NTNA 5APUA 2BASA 1H88A 3LIDA 1GK4A 3M9BA 3LIEA 3MD0A 1HBWA 5APTA 1X8YA 3I5CA 3M0DA 5APVA 1HUCA 5AVYB 3V4WA 2H7HA 2C9NY 1H89A 4XE5B 1T2KD 3V5BA 1NWQA 3L36A 2Q5UA 3A3YB 1A02F 1GK6A 5APSA 1SLQA 2WPRA 3L35A 5AW0B 4KHXA 5AVXB 3SWFA 3VMYA 2YO3A 2XV5A 3TYYA 2ZXEB 1JNMA 1FAVA 3HE5A 3HTKA 4GKGA 2WPQA 3VN0A 2R5BA 1NAFA 1JUNA 3A2AA 2P7JA 5CMZA 1HJBA 1GU4A 1KQLA
chains in the Genus database with same CATH superfamily
3QH9A 2I1KA 2Q7CA 1HWTC 3FGAD 2FFDB 1HGVA 1TU3F 3KQGA 1EXIA 2WSEJ 5AVUB 2P1JA 4PJ0H 3OAKA 3A0BH 2FYNB 3VP9A 2N1TD 1ZXGA 2J58A 1OWAA 1R8EA 3L75J 1OX3A 1MV8A 2B87B 1BE3G 3W68A 3Q1MA 3M9QA 2YMKA 5AVQB 5B66H 2YKOA 2KLVA 4LLHA 3W67A 1W2EA 2R3CA 1DEEG 1T3UA 2E42A 5APUA 3Q5SA 1IC2A 3CMEP 3PLNA 1WRGA 2QSIA 3H1HD 1G2CA 3RGUA 3TGUE 4H44B 1ZLLA 4DT0A 1KMIZ 5GTIH 4TT3H 1LP1A 1NU1J 3TGUG 3H1KJ 4KHXA 5DJTB 3L74E 2H43A 2JR8A 1YJNP 1YBKA 1LTSC 3A0HE 3G71P 3L70G 4ASVA 1YITP 2O1JA 3L74G 2NPSB 4H0LD 4W80A 1NKZB 2RKLA 3CI9A 3TK1A 5GTHE 3FXEA 3BCCJ 1Q81Q 4L75A 2IFNA 2QRXA 3AE5C 4WY4D 1ZP0C 2Z5IA 3HRNA 3M91A 4I7ZC 1DEBA 1KB9E 3AEAC 2KB7P 1M1JC 1BE3D 1OIPA 2M5AB 3KZIH 2PGDA 1EDLA 3GF7A 1G2CB 3TDKA 1L0LJ 1N7SD 2A45G 5AVWB 1GL2C 1NVOA 1AQTA 4OH8B 1MZ9A 4C7NA 1GW4A 1LP1B 2QJPC 2R3SA 2WPSA 1Q86Q 3GMAA 3H1IE 3PJSK 3RL0D 1KC8Q 5KKZB 1FJKA 2D2CB 1RE4C 1SQXE 1M1JA 3V2RA 3H1IG 1LT1A 3S4RA 2E76C 5AW5B 2V4HA 3CWBE 5AVZB 3L70J 1GL2A 5KAFE 2JP3A 3CWBG 3TGUD 1RQVA 1PGJA 2E74B 2Y0EA 3B5NA 5AVYB 2H7HA 3F89A 3KYQA 1QGKB 1RE4A 3L74D 1KYOH 1EC5A 2KS1B 1OVUA 2G8YA 3SWFA 4GKGA 1VF5D 3C8VA 1D7MA 2JDIH 4KJMA 2K3RA 2RMZA 1JOCA 4I7ZB 4D6TJ 3AEBC 2PRRA 2QE7H 3U1CA 5CCGD 1KB9D 1CSBA 4GT1A 3LW5J 1KILC 1GL2B 2QJPB 3O8ZA 1ZN5A 4HYTB 2XNDH 2KUBA 3B5NB 2WSFJ 5AVTB 3TNUA 3H1ID 1LTBC 5AVVB 3O6QA 1KORA 1SQPK 2W27A 5AVRB 1VQPP 4I2LC 2E76B 3AE2C 1Q7YQ 1SQXD 4OVNF 4WB4A 4JYBA 1KILA 1HH0A 1T2KC 2ZXXA 3CWBD 3CPWO 1HJ0A 2AEFA 1L0NK 2QM7A 3BASA 1OXZA 2WT7A 1S5LE 2M8RA 3KDPB 3CMAP 3GW6A 3RK2D 3ZDMA 5KAIH 1IZNB 2CPSA 3TF5A 3Q5PA 1BGYG 4Y99C 5KAFH 4N78E 3CL3D 1FU1A 1DD4A 2P7JA 3OA7A 3H6PA 1URQC 4C7RA 3O6QB 3A7OA 3JCUE 3VMZA 2Z5HA 1FZFA 1KILB 2BEZF 1FZEA 3JSVC 4RESB 3RBZA 1N8RQ 4I6MC 1PGOA 5CJ0A 2WMMA 3SWKA 2RN0A 3RK2C 1NTKE 2WT7B 1UIXA 3PRJA 1URQA 5E79H 1YIJP 4DZOA 2K88A 1VQ4P 1CZQA 2O01N 1R5LA 1SQBJ 2WVRA 2MJZA 1M90Q 1BCCJ 1T8ZA 2WITA 4UB6H 2KOGA 1VQ8P 4JBZA 1VQNP 5KTBA 5M1BA 4Y28J 1W2BO 4IOIH 1VQ7P 2YIUB 1H88A 5KLVJ 1BGYD 3CC4P 3II6A 4Y99B 2ZYAA 1AV1A 3CX5H 1P84H 1FDIA 1URQB 2QJYB 2Q5UA 2B9BA 1J1DC 2H8PD 4IFFA 5KLIC 1HGZA 3AEEC 3V4QA 1JCCA 1YI2P 1NTKD 3R2PA 4AUWA 3L73E 2E75D 1SQPE 1ZMEC 1S5LX 1G1JA 1H8AA 3B8EB 3L73G 4PJ0E 1SQPG 1X79B 2YXQB 1OW7A 1GU5A 2FYZA 1CI6A 1LT9C 2SPZA 2JO1A 4BXLA 2POHA 1DH3A 3L72J 3PHLA 1NH4A 1FOSF 1QX8A 3NXSA 2UWJE 4DOJA 2M3BA 2C9LY 3MGNA 1IFMA 4U7JA 2OARA 1M56D 3BRVB 1LGHB 5APTA 1N7LA 4RO0A 2IYPA 1LTAC 5KLIB 2M3EA 5APVA 2Q3EA 1Y8AA 4U3FJ 2C9NY 1YTZI 1FS0E 3WUUA 1SQVJ 3E1IA 2L5GB 3H1LG 5GTIE 3D71A 1NAFA 2KK7A 2CK3H 1LTJB 1KTMA 1Q2NA 1SQXK 3BVHA 3L73D 1L0NJ 4NPEA 1SQPD 3HD7C 1XTGB 4BRYA 1J1EC 3CCVP 5AW8B 1FJPA 3U59A 2WWWA 4H13D 4EYYQ 2OTKE 2WSCH 4HB1A 3KZIE 3HD7A 3TSIA 3FWNA 2AEJA 5APWA 2IFMA 3V2PA 1Q82Q 1G1IA 1T6AA 3CCLP 4JQ0D 3H1LJ 4HJGH 3CXHH 1KQSO 1FE6A 3AEFC 2V7QH 1YQ3C 2OTJP 2QEXP 3H1LD 5CJ4A 3E1RA 1OFCX 4H13C 3AE6C 3H1JE 4BRYB 4DJGA 1JY3N 1JTHA 4GOFA 5CHXA 3H1HJ 2NRGA 1KYOE 2JKVA 1NOHA 3HTKA 3RL0g 3HD7B 2ZYDA 1HJBA 5KJ7D 1L4AD 4XA4A 2N1TC 3L37A 5EFWB 3T97A 1PGPA 1VQ9P 2WSEH 1NAYA 1SFCD 3F5HA 3S9OA 1S4XA 2BCCE 2ZFCA 3MUDC 1M8OB 2N1TA 3AE7C 2BCCG 1FZCC 2WTYA 2E43A 2XU6A 1KFMA 1BE3J 3JC22 2YMYA 3NFQA 1JTHB 2LKMA 1XTCC 3V6IA 3CCMP 3CCJP 1FDOA 1HTLC 2HFED 3MUDA 2W90A 1SFCC 2HR3A 1X9VA 1R5SA 3P32A 1FZCA 1RHZB 3T97B 5BVZA 4JPZB 3BRTB 1NTKK 3L71E 4H0LC 1JY2O 3L71G 2LXBA 2XNXA 4XE5B 3TGUJ 5KAIE 1E79H 1KYOD 1AJYA 1A02F 4WY4C 3N7NA 1SQXG 2ZT9D 1LWUC 3L74J 1QL1A 2KIKA 1RE3C 1JB0J 4OGQD 4Z1MH 1YQ4C 2IDBA 2PAJA 1MFZA 2IPPA 3KPEA 1N7SC 1RF0C 2IZ0A 1NKNA 3WUTA 2Q6QA 1ZR2A 1VQKP 3RK3E 3N4XA 1S3JA 4WY4A 2IX7C 3GHGC 1IK7A 2BCCD 1AA0A 2OYOA 3RL0C 2KYVA 1NO4A 2M0BA 1LWUA 2ZVNB 2AXTH 1FZCB 3P8CE 1GW3A 1RE3A 1CW5A 4GODA 1GTWA 4C7NB 5B5EH 3H32A 5E79E 3Q5RA 1N7SA 1RF0A 3C9IA 5CBOA 2QM8A 1M1JB 4OGQC 3GHGA 3KXDA 2Y0CA 4R4MA 2QVAA 2GUSA 4B86A 3H1IJ 2Z4EA 2KZJA 1ZV8A 1LJ2A 4UB6E 1SQXJ 4H0LB 1VF5C 3L71D 1FZGA 3CWBJ 1NTME 3BATA 5K5GB 4WY4B 5CCHD 1YTZT 1LWUB 3CX5E 2BEQD 2FYUK 1QL2A 1KQFB 1P84E 2WPRA 5CCGC 5AVXB 4WVZA 1N7SB 4O9BA 1Y47A 4IL6E 1NTZE 2WPQA 3VOPA 2R5BA 3FX0A 2PP6A 3MP7B 1KYOI 1SQQK 2KXPB 3GHGB 3RK3D 1MFTA 2JWAA 5CCGA 3P8CD 3IFMA 5CCHC 3LW5H 5APQA 1JO5A 3AE4C 2J59M 3Q3DA 3TNUB 2IZ1A 1PGQA 2Y9ZA 2FXMA 1AQ5A 1JY3P 2R44A 1VQ6P 1N73C 1QVGO 1M1KQ 3A5TA 3H25A 2IBZE 1Z56A 3MIWA 3NMDA 4PV1D 1GDTA 5CCHA 2W8ZA 1VF5B 2Q1KA 2ITAA 1NTKG 3HE4A 1IK9A 1N86A 1GD2E 1U7MA 1N73A 3Q2YA 2B89A 2KP8A 3AE8C 1N2DC 4M3LA 1GK4A 4QMAA 1ZR4A 1PIXA 3CX5D 1P84D 1WMKA 1BGYJ 2O3JA 2HPCA 4PV1C 4UB8H 3AECC 1W5CE 1AVYA 3L36A 3A3YB 1GK6A 1NTZD 3HUSC 2FXPA 2XKMA 1KQLA 5H2FH 4GOEA 1YHQP 4LC1A 4N78D 1NU1K 1FOSE 4IL6H 1VPCA 1H0TA 3HUSA 2Q9IA 1NTKJ 5AW9B 2Q3IA 1IFDA 3E7KA 2E5YA 1BSNA 2IBZD 2WPVB 3RK2B 4EI2A 1M7LA 1OMIA 4TLFA 4JYCA 3R4YA 2YKPA 1PP9E 2WSSH 1S9KE 1JMMA 2FY8A 4BWNA 1PP9G 1EZVI 2W6BA 4IL6X 1K04A 3C1LA 2MKVA 2FYUE 2WZ7A 4I1LA 2PFXA 2ZVOB 3NTNA 3CXHE 2FYUG 1EDJA 3M9BA 4ZKPA 1X8YA 1SQQE 2FXOA 1H0TB 3HUSB 2O01J 1AVOA 1SQQG 1HVVA 2E75C 1SLQA 3CX5I 1P84I 2ZXEB 3VN0A 1RF1C 1RY3A 4R4LA 2QG4A 4GIFA 1X0TA 5CMZA 3WU2H 1LT9A 1J1DB 3AE3C 1DIPA 2O1KA 2W83C 1JM0A 5TISE 4W7ZA 3S1KA 4EOTA 3VP8A 4L76A 3G6EP 3D6ZA 1FC2C 4C46A 4CPGA 2VRSA 3L73J 1OVRA 5AW4B 1RF1A 3P7KA 1SQPJ 3M0DC 1IJDB 3AE1C 1CI6B 4H44D 2OGUA 1FZBA 2N9BA 4IFMA 1PP9D 3P8MC 1S9KD 1IO4A 1OZHA 3L75E 1QEXA 2IBZI 1PPJE 1ZRTE 2NPSD 3L75G 2JJLA 2FYUD 1PPJG 1SP4A 4N6JA 3IN6A 1LT9B 1WT6A 4IFDK 3CXHD 2B87A 3GF3A 1MKMA 1KZUB 3M0AA 4L74A 1SQQD 1T3JA 2ZYGA 3K5BA 3MD0A 2WQYC 1HBWA 4MN4C 2L91A 3B4SA 3WMM0 1LTIC 1RF1B 3V5BA 4EDFA 1NU1E 3H1KE 2Y9YA 1K9MQ 3TYYA 2NPSC 3HE5A 4N3YB 1NU1G 3H1KG 3A2AA 1S1CX 1NJIQ 3CCUP 2D2CD 2H89C 1VQOP 3IAOA 3I56P 3BCCE 1BE3E 4ZKUA 3H1JG 3BCCG 1PFIA 2NPSA 1NTMK 3CCRP 2E74D 1HF9A 3EFFK 2AXTE 5TISH 2FKWB 4A7PA 3SWYA 3L75D 5B5EE 1QVFO 1L0LE 1J1EB 1PPJD 1ZRTD 2R5DA 5KKZC 1L0LG 2D2CC 1NTZK 2M5AA 4KT0J 2B88A 1YYCA 3PTZA 2OQQA 5AW7B 3HE5B 1U7JA 2YXRB 1SQBK 5L8RJ 1JEKA 1GMJA 3L70E 1KILE 2HLOA 4K35A 2OTLP 2E74C 3M06A 5KJ7C 1GL2D 5TJHA 3SFDC 1L4AC 3CXHI 1L2PA 2E5TA 2GA1A 3PP5A 3HTKB 2P10A 1HUCA 1NU1D 3WUVA 3H1KD 1K8AQ 1KV4A 2OYIC 1BSHA 2JWDA 3B5ND 3H1JJ 5CBNA 3EWKA 3CCQP 4H13B 2KSEA 5KLVK 2QA4P 2E76D 2A06E 5KJ7A 4RJTA 2KLUA 3H1JD 1L4AA 4YTPC 3BCCD 2KS1A 2QIWA 2A06G 4D6TE 4ZMDA 2OYIA 1SFCA 2OYHC 2N1TB 1A02J 4D6TG 2HODA 3B71A 1EDKA 4NPFX 4LGDE 2GUVA 3B5NC 2W6JH 1L0LD 1OW6A 2BCCJ 3L4FA 3VYIA 3SSUA 1K05A 2P58A 1GZLA 5AW6B 5C39A 3D70A 2C0XA 2OYHA 2G3AA 1VDFA 5AW3B 2I8DA 2DW3A 1JCDA 2AXCA 3OW2O 3VMXA 3L70D 1KILD 1L4AB 3D6YA 2W6AA 4YXDC 1KN7A 1AFOA 2ZT9C 4AYCA 1JY3O 4HKZH 3MTUE 2OYIB 1SFCB 2JEEA 1EZVE 3L71J 1NGMB 2HODB 3G4SP 3AEDC 1EZVG 2KZIA 3G9RA 1T2KD 2CPBA 2A06D 1LNQA 4UB8E 3L35A 1VQ5P 3A0HH 3VMYA 1JNMA 2J5UA 4WWIA 2OYHB 2C0WA 4D6TD 2I1JA 4YXWH 5APXA 2YNYA 1NTMG 5GTHH 5BU8B 5H2FE 3FXDA 3MZWB 1SQVK 2K37A 1BDCA 4PD4E 1KFNA 3H32B 5APYA 1IFNA 1JY2P 1KB9H 5AW2B 4K3AA 2A45H 2HYNA 3CC7P 1NTZG 1URQD 3RL0B 1SQBE 3G3ZA 5DJUB 3VMAA 5AVSB 1USEA 2AEMA 1SQBG 2P67A 2ZT9B 1BCCE 3AE9C 1X22A 1BGYE 4OGQB 2KNCA 1KD1Q 1DD3A 1BCCG 2WSFH 2YIUC 3AEGC 2GM4A 3UIAA 1EZVD 4WBAA 5KLVE 3EQ2A 1NTMJ 3V2NA 1IFJA 2IBZG 2QJYC 3RK3C 5KLVG 3ITKA 1RH5B 3CLQA 3V4WA 1S72P 4RKUJ 1NWQA 1E5WA 1JMBA 4OWFA 4GDOA 1NTMD 3RBXA 5AW0B 2HG5D 4XFJA 2XV5A 1NTZJ 3SFEC 3WU2E 4HH2A 4PD4D 1KB9I 1RQUA 2A45I 1IFIA 1KQGB 2KNCB 1MUUA 3QWOC 4ZNCA 2IYOA 3PH0A 1SQBD 3GLMA 1VQLP 1FZAA 1DX7A 2FBWC 2K9JA 4JF7A 4W7YA 2N9YB 2NZ2A 4PD4H 3CC2P 1EXJA 2YKQA 2R32A 3KHUA 1BCCD 3HE4B 2YO2A 4NPDA 1FBMA 1N73B 2P2UA 1SS1A 1LTGC 3L72E 2XZRA 3CD6P 1SVFA 1S5LH 3RK3B 3I55P 5KLVD 4ASWA 5AW1B 1PZQA 3GG2A 3L72G 3CCEP 2HPCB 3LIDA 3LIEA 1EDIA 1Q90D 2H88C 4U3FE 2K9YA 1PV3A 3V2QA 1LTTC 1SQVE 1NYHA 1EQ7A 1L0LK 4U3FG 1S2EA 2K9JB 1LTJC 2ZAEB 2YO3A 1SQVG 4PV1B 1JUNA 1IFPA 1L0ND 1GU4A 3JCUH 1Y9BA 3U1AA 3IF4A 1OW8A 3A0BE 2QJKC 1L0NE 2RH0A 2LR2A 3VTPC 1VQMP 2K1AA 1J2JB 1L0NG 1LTJA 4PD4I 1QLED 1PL5A 3OJAB 2XDJA 2KI7B 1OVVA 2FFDC 3MHVA 2KSJA 5B66E 3IR9A 1NHLA 1YJ9P 2Y0DA 3FWLA 4EIJA 3USSA 1M57D 1ZOYC 1PP9J 3EFGA 3HD7D 2FYNC 2WSCJ 3CCSP 3L72D 3ABVC 1UIIA 4L73A 2ZJSE 2FFDA 3H1LE 2LXCB 1VL2A 4AQRD 2FYUJ 3M9HA 2BASA 1U57A 4U3FD 2O01H 2V7QJ 4YPCA 3I5CA 1SQVD 1BDDA 1SQQJ 4DCKA 3M0DA 1USDA 1H89A 3H1HE 5APSA 1YJWP 5BU5A 1FDMA 2QJKB 1FAVA 3H1HG 4H44C 1JY2N 1K73Q 2E75B 1ZW0A
chains in the Genus database with same CATH topology
3V4QA 1JCCA 2I1KA 3RK3D 2Q7CA 1HWTC 2OYIA 2FFDB 1HGVA 3R2PA 1SFCA 2OYHC 3KQGA 5CCGA 3P8CD 2N1TB 3IFMA 3LW5H 5CCHC 4AUWA 1A02J 2HODA 5APQA 1JO5A 5AVUB 4LGDE 2P1JA 1G1JA 2J59M 3TNUB 1H8AA 3B8EB 2GUVA 3OAKA 3B5NC 3L4FA 1X79B 3VYIA 2FXMA 1GU5A 1AQ5A 1JY3P 3VP9A 1N73C 2N1TD 2J58A 3A5TA 1GZLA 1Z56A 3MIWA 5AW6B 3NMDA 2C0XA 2OYHA 1OWAA 1GDTA 2FYZA 1CI6A 5CCHA 1MV8A 1LT9C 1VDFA 5AW3B 1JCDA 3M9QA 2POHA 5AVQB 3VMXA 1KILD 2YKOA 2KLVA 1IK9A 3HE4A 1N86A 4LLHA 1DH3A 1GD2E 1L4AB 2W6AA 1NH4A 1FOSF 3NXSA 1W2EA 4DOJA 2R3CA 1AFOA 1N73A 4AYCA 1JY3O 2KP8A 2M3BA 1T3UA 3MTUE 2E42A 1N2DC 2C9LY 3MGNA 1IFMA 4M3LA 2OYIB 5APUA 1GK4A 1IC2A 2OARA 1SFCB 2JEEA 3BRVB 5APTA 1LGHB 1ZR4A 1N7LA 1WRGA 2HODB 1LTAC 5APVA 1G2CA 2HPCA 2C9NY 1ZLLA 1T2KD 1YTZI 3L36A 3A3YB 1GK6A 3E1IA 2CPBA 2L5GB 3L35A 4KHXA 3VMYA 2H43A 3HUSC 1JNMA 1LTSC 1NAFA 2OYHB 2C0WA 2XKMA 2O1JA 1KQLA 2I1JA 1LTJB 5APXA 2YNYA 2NPSB 5BU8B 4W80A 1SQXK 1SQVK 3BVHA 1NKZB 3CI9A 4LC1A 3TK1A 4N78D 1NU1K 3HD7C 2IFNA 1FOSE 1KFNA 3H32B 5APYA 4WY4D 1IFNA 2Z5IA 3HRNA 3M91A 1VPCA 1XTGB 1JY2P 3HUSA 2Q9IA 5AW2B 5AW9B 1J1EC 2Q3IA 2A45H 1DEBA 1IFDA 2HYNA 5AW8B 2KB7P 1FJPA 1M1JC 3U59A 1URQD 3RK2B 3RL0B 2WWWA 1M7LA 3G3ZA 4JYCA 5AVSB 1G2CB 2YKPA 1N7SD 2WSCH 2A45G 3HD7A 5AVWB 3TSIA 1GL2C 4OH8B 1MZ9A 2P67A 4C7NA 1GW4A 1S9KE 2WPSA 5APWA 1JMMA 2IFMA 3RL0D 3V2PA 2W6BA 1G1IA 1FJKA 1RE4C 3V2RA 1M1JA 2WSFH 2GM4A 2WZ7A 4I1LA 3UIAA 5AW5B 4WBAA 5AVZB 3NTNA 1GL2A 3EQ2A 3M9BA 3V2NA 1IFJA 4ZKPA 3RK3C 1X8YA 5CJ4A 3HUSB 3CLQA 3B5NA 5AVYB 3V4WA 2H7HA 3KYQA 1RE4A 1E5WA 1JY3N 1JTHA 1NWQA 1HVVA 5CHXA 1SLQA 5AW0B 2HG5D 3SWFA 2XV5A 1NOHA 2ZXEB 4GKGA 3HTKA 3VN0A 1RF1C 1RY3A 4GIFA 3HD7B 5CMZA 1HJBA 1LT9A 5KJ7D 1J1DB 1L4AD 4XA4A 2N1TC 4HH2A 2O1KA 1JOCA 3L37A 4W7ZA 4EOTA 3VP8A 3T97A 2A45I 1IFIA 2WSEH 1MUUA 4C46A 1SFCD 2VRSA 3U1CA 5CCGD 1CSBA 5AW4B 4GT1A 1RF1A 3P7KA 3M0DC 1KILC 1IJDB 1GL2B 1CI6B 1FZAA 2ZFCA 1FZBA 1DX7A 2N9BA 3O8ZA 4JF7A 4IFMA 2N1TA 4W7YA 3P8MC 1ZN5A 4HYTB 2YKQA 3B5NB 2R32A 1S9KD 1FZCC 2WTYA 5AVTB 1IO4A 2E43A 2XU6A 1KFMA 3HE4B 3TNUA 2YO2A 2YMYA 3NFQA 1LTBC 1JTHB 2LKMA 1XTCC 5AVVB 1FBMA 1SQPK 2W27A 1N73B 5AVRB 4I2LC 2P2UA 4WB4A 4JYBA 2NPSD 2JJLA 1KILA 1HH0A 1T2KC 1LTGC 1SP4A 1HTLC 2HFED 3MUDA 4N6JA 2XZRA 1LT9B 1SVFA 1WT6A 3RK3B 1SFCC 4IFDK 1L0NK 2QM7A 5AW1B 1X9VA 3P32A 3BASA 1OXZA 2WT7A 3KDPB 2M8RA 1KZUB 3M0AA 1FZCA 2HPCB 1T3JA 5BVZA 3LIDA 3MD0A 3LIEA 3BRTB 1NTKK 1HBWA 1JY2O 3RK2D 3WMM0 1LTIC 2CPSA 1RF1B 2XNXA 3V2QA 4XE5B 1LTTC 3V5BA 1EQ7A 1A02F 1L0LK 4Y99C 4WY4C 3N7NA 1LTJC 2YO3A 4N78E 3CL3D 3TYYA 2NPSC 1LWUC 3HE5A 1QL1A 4N3YB 1FU1A 1RE3C 1JUNA 3A2AA 2P7JA 3OA7A 3H6PA 1URQC 1GU4A 4C7RA 2PAJA 3U1AA 1MFZA 2IPPA 3KPEA 3A7OA 3VMZA 2Z5HA 1N7SC 1RF0C 1FZFA 1KILB 1NKNA 1FZEA 4RESB 1ZR2A 4I6MC 3N4XA 4WY4A 5CJ0A 3VTPC 2IX7C 4ZKUA 3GHGC 1J2JB 1LTJA 3RK2C 2KYVA 1NO4A 3RL0C 2NPSA 1NTMK 1PFIA 1LWUA 3OJAB 2XDJA 2WT7B 1FZCB 3P8CE 1GW3A 1RE3A 1CW5A 2FFDC 1URQA 1GTWA 4C7NB 2KSJA 2FKWB 4DZOA 3H32A 3SWYA 1CZQA 3IR9A 1N7SA 1NHLA 1RF0A 1J1EB 3C9IA 4EIJA 2R5DA 2QM8A 1M1JB 3EFGA 3GHGA 3HD7D 2MJZA 1NTZK 2GUSA 1T8ZA 1YYCA 4B86A 2WITA 5AW7B 2Z4EA 3HE5B 2FFDA 1ZV8A 2KOGA 1SQBK 4AQRD 5KTBA 2HLOA 1FZGA 3M9HA 3M06A 2BASA 1H88A 3II6A 5KJ7C 3BATA 2O01H 1GL2D 4Y99B 4WY4B 1L4AC 5CCHD 3I5CA 3M0DA 3PP5A 1YTZT 1LWUB 3HTKB 1HUCA 1H89A 2OYIC 3B5ND 2FYUK 1URQB 1QL2A 2Q5UA 5APSA 2WPRA 5CCGC 1J1DC 2H8PD 5AVXB 5BU5A 4IFFA 5KLVK 1N7SB 1FDMA 1HGZA 4O9BA 1FAVA 2WPQA 3VOPA 2R5BA 2PP6A 1JY2N 5KJ7A 1SQQK 1L4AA 3GHGB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4Q A;  1MFZ A;  2IPP A;  5APX A;  2YNY A;  3A7O A;  2Q7C A;  3VMZ A;  2Z5H A;  1HWT C;  2E43 A;  3L37 A;  4EOT A;  4LC1 A;  3TK1 A;  3T97 A;  4RES B;  4I6M C;  3KQG A;  3VTP C;  1MUU A;  1FOS E;  4C46 A;  5APY A;  4AUW A;  1A02 J;  1J2J B;  2VRS A;  5APQ A;  2Z5I A;  3M91 A;  5AVU B;  1CSB A;  2WT7 B;  5AW4 B;  4GT1 A;  3P7K A;  5AW2 B;  3TNU B;  5AW9 B;  1H8A A;  2Q3I A;  3B8E B;  3OAK A;  1CI6 B;  1GTW A;  2ZFC A;  4C7N B;  5AW8 B;  4DZO A;  2N9B A;  3O8Z A;  2WWW A;  3VYI A;  1GU5 A;  1CZQ A;  3P8M C;  3IR9 A;  4JYC A;  3A5T A;  4HYT B;  5AVS B;  1G2C B;  1S9K D;  2R32 A;  1GZL A;  2WTY A;  5AW6 B;  5AVT B;  1IO4 A;  3NMD A;  2R5D A;  2XU6 A;  3TNU A;  3HE4 B;  5AVW B;  2QM8 A;  2YO2 A;  3NFQ A;  1OWA A;  1CI6 A;  5AVV B;  2P67 A;  4C7N A;  2W27 A;  1S9K E;  5AVR B;  1MV8 A;  2WPS A;  4I2L C;  5APW A;  5AW3 B;  2P2U A;  4JYB A;  4B86 A;  1YYC A;  2JJL A;  5AW7 B;  1T2K C;  3HE5 B;  5AVQ B;  3VMX A;  1SP4 A;  3HE4 A;  1DH3 A;  1GD2 E;  2XZR A;  2W6A A;  1FOS F;  3NXS A;  4AQR D;  2QM7 A;  2R3C A;  5AW1 B;  3P32 A;  3UIA A;  4AYC A;  5AW5 B;  1OXZ A;  2WT7 A;  3KDP B;  5AVZ B;  2KP8 A;  3M0A A;  3M9H A;  2E42 A;  2C9L Y;  3MGN A;  4M3L A;  3M06 A;  3NTN A;  5APU A;  2BAS A;  1H88 A;  3LID A;  1GK4 A;  3M9B A;  3LIE A;  3MD0 A;  1HBW A;  5APT A;  1X8Y A;  3I5C A;  3M0D A;  5APV A;  1HUC A;  5AVY B;  3V4W A;  2H7H A;  2C9N Y;  1H89 A;  4XE5 B;  1T2K D;  3V5B A;  1NWQ A;  3L36 A;  2Q5U A;  3A3Y B;  1A02 F;  1GK6 A;  5APS A;  1SLQ A;  2WPR A;  3L35 A;  5AW0 B;  4KHX A;  5AVX B;  3SWF A;  3VMY A;  2YO3 A;  2XV5 A;  3TYY A;  2ZXE B;  1JNM A;  1FAV A;  3HE5 A;  3HTK A;  4GKG A;  2WPQ A;  3VN0 A;  2R5B A;  1NAF A;  1JUN A;  3A2A A;  2P7J A;  5CMZ A;  1HJB A;  1GU4 A;  1KQL A; 
#chains in the Genus database with same CATH topology
 3QH9 A;  2I1K A;  2Q7C A;  1HWT C;  3FGA D;  2FFD B;  1HGV A;  1TU3 F;  3KQG A;  1EXI A;  2WSE J;  5AVU B;  2P1J A;  4PJ0 H;  3OAK A;  3A0B H;  2FYN B;  3VP9 A;  2N1T D;  1ZXG A;  2J58 A;  1OWA A;  1R8E A;  3L75 J;  1OX3 A;  1MV8 A;  2B87 B;  1BE3 G;  3W68 A;  3Q1M A;  3M9Q A;  2YMK A;  5AVQ B;  5B66 H;  2YKO A;  2KLV A;  4LLH A;  3W67 A;  1W2E A;  2R3C A;  1DEE G;  1T3U A;  2E42 A;  5APU A;  3Q5S A;  1IC2 A;  3CME P;  3PLN A;  1WRG A;  2QSI A;  3H1H D;  1G2C A;  3RGU A;  3TGU E;  4H44 B;  1ZLL A;  4DT0 A;  1KMI Z;  5GTI H;  4TT3 H;  1LP1 A;  1NU1 J;  3TGU G;  3H1K J;  4KHX A;  5DJT B;  3L74 E;  2H43 A;  2JR8 A;  1YJN P;  1YBK A;  1LTS C;  3A0H E;  3G71 P;  3L70 G;  4ASV A;  1YIT P;  2O1J A;  3L74 G;  2NPS B;  4H0L D;  4W80 A;  1NKZ B;  2RKL A;  3CI9 A;  3TK1 A;  5GTH E;  3FXE A;  3BCC J;  1Q81 Q;  4L75 A;  2IFN A;  2QRX A;  3AE5 C;  4WY4 D;  1ZP0 C;  2Z5I A;  3HRN A;  3M91 A;  4I7Z C;  1DEB A;  1KB9 E;  3AEA C;  2KB7 P;  1M1J C;  1BE3 D;  1OIP A;  2M5A B;  3KZI H;  2PGD A;  1EDL A;  3GF7 A;  1G2C B;  3TDK A;  1L0L J;  1N7S D;  2A45 G;  5AVW B;  1GL2 C;  1NVO A;  1AQT A;  4OH8 B;  1MZ9 A;  4C7N A;  1GW4 A;  1LP1 B;  2QJP C;  2R3S A;  2WPS A;  1Q86 Q;  3GMA A;  3H1I E;  3PJS K;  3RL0 D;  1KC8 Q;  5KKZ B;  1FJK A;  2D2C B;  1RE4 C;  1SQX E;  1M1J A;  3V2R A;  3H1I G;  1LT1 A;  3S4R A;  2E76 C;  5AW5 B;  2V4H A;  3CWB E;  5AVZ B;  3L70 J;  1GL2 A;  5KAF E;  2JP3 A;  3CWB G;  3TGU D;  1RQV A;  1PGJ A;  2E74 B;  2Y0E A;  3B5N A;  5AVY B;  2H7H A;  3F89 A;  3KYQ A;  1QGK B;  1RE4 A;  3L74 D;  1KYO H;  1EC5 A;  2KS1 B;  1OVU A;  2G8Y A;  3SWF A;  4GKG A;  1VF5 D;  3C8V A;  1D7M A;  2JDI H;  4KJM A;  2K3R A;  2RMZ A;  1JOC A;  4I7Z B;  4D6T J;  3AEB C;  2PRR A;  2QE7 H;  3U1C A;  5CCG D;  1KB9 D;  1CSB A;  4GT1 A;  3LW5 J;  1KIL C;  1GL2 B;  2QJP B;  3O8Z A;  1ZN5 A;  4HYT B;  2XND H;  2KUB A;  3B5N B;  2WSF J;  5AVT B;  3TNU A;  3H1I D;  1LTB C;  5AVV B;  3O6Q A;  1KOR A;  1SQP K;  2W27 A;  5AVR B;  1VQP P;  4I2L C;  2E76 B;  3AE2 C;  1Q7Y Q;  1SQX D;  4OVN F;  4WB4 A;  4JYB A;  1KIL A;  1HH0 A;  1T2K C;  2ZXX A;  3CWB D;  3CPW O;  1HJ0 A;  2AEF A;  1L0N K;  2QM7 A;  3BAS A;  1OXZ A;  2WT7 A;  1S5L E;  2M8R A;  3KDP B;  3CMA P;  3GW6 A;  3RK2 D;  3ZDM A;  5KAI H;  1IZN B;  2CPS A;  3TF5 A;  3Q5P A;  1BGY G;  4Y99 C;  5KAF H;  4N78 E;  3CL3 D;  1FU1 A;  1DD4 A;  2P7J A;  3OA7 A;  3H6P A;  1URQ C;  4C7R A;  3O6Q B;  3A7O A;  3JCU E;  3VMZ A;  2Z5H A;  1FZF A;  1KIL B;  2BEZ F;  1FZE A;  3JSV C;  4RES B;  3RBZ A;  1N8R Q;  4I6M C;  1PGO A;  5CJ0 A;  2WMM A;  3SWK A;  2RN0 A;  3RK2 C;  1NTK E;  2WT7 B;  1UIX A;  3PRJ A;  1URQ A;  5E79 H;  1YIJ P;  4DZO A;  2K88 A;  1VQ4 P;  1CZQ A;  2O01 N;  1R5L A;  1SQB J;  2WVR A;  2MJZ A;  1M90 Q;  1BCC J;  1T8Z A;  2WIT A;  4UB6 H;  2KOG A;  1VQ8 P;  4JBZ A;  1VQN P;  5KTB A;  5M1B A;  4Y28 J;  1W2B O;  4IOI H;  1VQ7 P;  2YIU B;  1H88 A;  5KLV J;  1BGY D;  3CC4 P;  3II6 A;  4Y99 B;  2ZYA A;  1AV1 A;  3CX5 H;  1P84 H;  1FDI A;  1URQ B;  2QJY B;  2Q5U A;  2B9B A;  1J1D C;  2H8P D;  4IFF A;  5KLI C;  1HGZ A;  3AEE C;  3V4Q A;  1JCC A;  1YI2 P;  1NTK D;  3R2P A;  4AUW A;  3L73 E;  2E75 D;  1SQP E;  1ZME C;  1S5L X;  1G1J A;  1H8A A;  3B8E B;  3L73 G;  4PJ0 E;  1SQP G;  1X79 B;  2YXQ B;  1OW7 A;  1GU5 A;  2FYZ A;  1CI6 A;  1LT9 C;  2SPZ A;  2JO1 A;  4BXL A;  2POH A;  1DH3 A;  3L72 J;  3PHL A;  1NH4 A;  1FOS F;  1QX8 A;  3NXS A;  2UWJ E;  4DOJ A;  2M3B A;  2C9L Y;  3MGN A;  1IFM A;  4U7J A;  2OAR A;  1M56 D;  3BRV B;  1LGH B;  5APT A;  1N7L A;  4RO0 A;  2IYP A;  1LTA C;  5KLI B;  2M3E A;  5APV A;  2Q3E A;  1Y8A A;  4U3F J;  2C9N Y;  1YTZ I;  1FS0 E;  3WUU A;  1SQV J;  3E1I A;  2L5G B;  3H1L G;  5GTI E;  3D71 A;  1NAF A;  2KK7 A;  2CK3 H;  1LTJ B;  1KTM A;  1Q2N A;  1SQX K;  3BVH A;  3L73 D;  1L0N J;  4NPE A;  1SQP D;  3HD7 C;  1XTG B;  4BRY A;  1J1E C;  3CCV P;  5AW8 B;  1FJP A;  3U59 A;  2WWW A;  4H13 D;  4EYY Q;  2OTK E;  2WSC H;  4HB1 A;  3KZI E;  3HD7 A;  3TSI A;  3FWN A;  2AEJ A;  5APW A;  2IFM A;  3V2P A;  1Q82 Q;  1G1I A;  1T6A A;  3CCL P;  4JQ0 D;  3H1L J;  4HJG H;  3CXH H;  1KQS O;  1FE6 A;  3AEF C;  2V7Q H;  1YQ3 C;  2OTJ P;  2QEX P;  3H1L D;  5CJ4 A;  3E1R A;  1OFC X;  4H13 C;  3AE6 C;  3H1J E;  4BRY B;  4DJG A;  1JY3 N;  1JTH A;  4GOF A;  5CHX A;  3H1H J;  2NRG A;  1KYO E;  2JKV A;  1NOH A;  3HTK A;  3RL0 g;  3HD7 B;  2ZYD A;  1HJB A;  5KJ7 D;  1L4A D;  4XA4 A;  2N1T C;  3L37 A;  5EFW B;  3T97 A;  1PGP A;  1VQ9 P;  2WSE H;  1NAY A;  1SFC D;  3F5H A;  3S9O A;  1S4X A;  2BCC E;  2ZFC A;  3MUD C;  1M8O B;  2N1T A;  3AE7 C;  2BCC G;  1FZC C;  2WTY A;  2E43 A;  2XU6 A;  1KFM A;  1BE3 J;  3JC2 2;  2YMY A;  3NFQ A;  1JTH B;  2LKM A;  1XTC C;  3V6I A;  3CCM P;  3CCJ P;  1FDO A;  1HTL C;  2HFE D;  3MUD A;  2W90 A;  1SFC C;  2HR3 A;  1X9V A;  1R5S A;  3P32 A;  1FZC A;  1RHZ B;  3T97 B;  5BVZ A;  4JPZ B;  3BRT B;  1NTK K;  3L71 E;  4H0L C;  1JY2 O;  3L71 G;  2LXB A;  2XNX A;  4XE5 B;  3TGU J;  5KAI E;  1E79 H;  1KYO D;  1AJY A;  1A02 F;  4WY4 C;  3N7N A;  1SQX G;  2ZT9 D;  1LWU C;  3L74 J;  1QL1 A;  2KIK A;  1RE3 C;  1JB0 J;  4OGQ D;  4Z1M H;  1YQ4 C;  2IDB A;  2PAJ A;  1MFZ A;  2IPP A;  3KPE A;  1N7S C;  1RF0 C;  2IZ0 A;  1NKN A;  3WUT A;  2Q6Q A;  1ZR2 A;  1VQK P;  3RK3 E;  3N4X A;  1S3J A;  4WY4 A;  2IX7 C;  3GHG C;  1IK7 A;  2BCC D;  1AA0 A;  2OYO A;  3RL0 C;  2KYV A;  1NO4 A;  2M0B A;  1LWU A;  2ZVN B;  2AXT H;  1FZC B;  3P8C E;  1GW3 A;  1RE3 A;  1CW5 A;  4GOD A;  1GTW A;  4C7N B;  5B5E H;  3H32 A;  5E79 E;  3Q5R A;  1N7S A;  1RF0 A;  3C9I A;  5CBO A;  2QM8 A;  1M1J B;  4OGQ C;  3GHG A;  3KXD A;  2Y0C A;  4R4M A;  2QVA A;  2GUS A;  4B86 A;  3H1I J;  2Z4E A;  2KZJ A;  1ZV8 A;  1LJ2 A;  4UB6 E;  1SQX J;  4H0L B;  1VF5 C;  3L71 D;  1FZG A;  3CWB J;  1NTM E;  3BAT A;  5K5G B;  4WY4 B;  5CCH D;  1YTZ T;  1LWU B;  3CX5 E;  2BEQ D;  2FYU K;  1QL2 A;  1KQF B;  1P84 E;  2WPR A;  5CCG C;  5AVX B;  4WVZ A;  1N7S B;  4O9B A;  1Y47 A;  4IL6 E;  1NTZ E;  2WPQ A;  3VOP A;  2R5B A;  3FX0 A;  2PP6 A;  3MP7 B;  1KYO I;  1SQQ K;  2KXP B;  3GHG B;  3RK3 D;  1MFT A;  2JWA A;  5CCG A;  3P8C D;  3IFM A;  5CCH C;  3LW5 H;  5APQ A;  1JO5 A;  3AE4 C;  2J59 M;  3Q3D A;  3TNU B;  2IZ1 A;  1PGQ A;  2Y9Z A;  2FXM A;  1AQ5 A;  1JY3 P;  2R44 A;  1VQ6 P;  1N73 C;  1QVG O;  1M1K Q;  3A5T A;  3H25 A;  2IBZ E;  1Z56 A;  3MIW A;  3NMD A;  4PV1 D;  1GDT A;  5CCH A;  2W8Z A;  1VF5 B;  2Q1K A;  2ITA A;  1NTK G;  3HE4 A;  1IK9 A;  1N86 A;  1GD2 E;  1U7M A;  1N73 A;  3Q2Y A;  2B89 A;  2KP8 A;  3AE8 C;  1N2D C;  4M3L A;  1GK4 A;  4QMA A;  1ZR4 A;  1PIX A;  3CX5 D;  1P84 D;  1WMK A;  1BGY J;  2O3J A;  2HPC A;  4PV1 C;  4UB8 H;  3AEC C;  1W5C E;  1AVY A;  3L36 A;  3A3Y B;  1GK6 A;  1NTZ D;  3HUS C;  2FXP A;  2XKM A;  1KQL A;  5H2F H;  4GOE A;  1YHQ P;  4LC1 A;  4N78 D;  1NU1 K;  1FOS E;  4IL6 H;  1VPC A;  1H0T A;  3HUS A;  2Q9I A;  1NTK J;  5AW9 B;  2Q3I A;  1IFD A;  3E7K A;  2E5Y A;  1BSN A;  2IBZ D;  2WPV B;  3RK2 B;  4EI2 A;  1M7L A;  1OMI A;  4TLF A;  4JYC A;  3R4Y A;  2YKP A;  1PP9 E;  2WSS H;  1S9K E;  1JMM A;  2FY8 A;  4BWN A;  1PP9 G;  1EZV I;  2W6B A;  4IL6 X;  1K04 A;  3C1L A;  2MKV A;  2FYU E;  2WZ7 A;  4I1L A;  2PFX A;  2ZVO B;  3NTN A;  3CXH E;  2FYU G;  1EDJ A;  3M9B A;  4ZKP A;  1X8Y A;  1SQQ E;  2FXO A;  1H0T B;  3HUS B;  2O01 J;  1AVO A;  1SQQ G;  1HVV A;  2E75 C;  1SLQ A;  3CX5 I;  1P84 I;  2ZXE B;  3VN0 A;  1RF1 C;  1RY3 A;  4R4L A;  2QG4 A;  4GIF A;  1X0T A;  5CMZ A;  3WU2 H;  1LT9 A;  1J1D B;  3AE3 C;  1DIP A;  2O1K A;  2W83 C;  1JM0 A;  5TIS E;  4W7Z A;  3S1K A;  4EOT A;  3VP8 A;  4L76 A;  3G6E P;  3D6Z A;  1FC2 C;  4C46 A;  4CPG A;  2VRS A;  3L73 J;  1OVR A;  5AW4 B;  1RF1 A;  3P7K A;  1SQP J;  3M0D C;  1IJD B;  3AE1 C;  1CI6 B;  4H44 D;  2OGU A;  1FZB A;  2N9B A;  4IFM A;  1PP9 D;  3P8M C;  1S9K D;  1IO4 A;  1OZH A;  3L75 E;  1QEX A;  2IBZ I;  1PPJ E;  1ZRT E;  2NPS D;  3L75 G;  2JJL A;  2FYU D;  1PPJ G;  1SP4 A;  4N6J A;  3IN6 A;  1LT9 B;  1WT6 A;  4IFD K;  3CXH D;  2B87 A;  3GF3 A;  1MKM A;  1KZU B;  3M0A A;  4L74 A;  1SQQ D;  1T3J A;  2ZYG A;  3K5B A;  3MD0 A;  2WQY C;  1HBW A;  4MN4 C;  2L91 A;  3B4S A;  3WMM 0;  1LTI C;  1RF1 B;  3V5B A;  4EDF A;  1NU1 E;  3H1K E;  2Y9Y A;  1K9M Q;  3TYY A;  2NPS C;  3HE5 A;  4N3Y B;  1NU1 G;  3H1K G;  3A2A A;  1S1C X;  1NJI Q;  3CCU P;  2D2C D;  2H89 C;  1VQO P;  3IAO A;  3I56 P;  3BCC E;  1BE3 E;  4ZKU A;  3H1J G;  3BCC G;  1PFI A;  2NPS A;  1NTM K;  3CCR P;  2E74 D;  1HF9 A;  3EFF K;  2AXT E;  5TIS H;  2FKW B;  4A7P A;  3SWY A;  3L75 D;  5B5E E;  1QVF O;  1L0L E;  1J1E B;  1PPJ D;  1ZRT D;  2R5D A;  5KKZ C;  1L0L G;  2D2C C;  1NTZ K;  2M5A A;  4KT0 J;  2B88 A;  1YYC A;  3PTZ A;  2OQQ A;  5AW7 B;  3HE5 B;  1U7J A;  2YXR B;  1SQB K;  5L8R J;  1JEK A;  1GMJ A;  3L70 E;  1KIL E;  2HLO A;  4K35 A;  2OTL P;  2E74 C;  3M06 A;  5KJ7 C;  1GL2 D;  5TJH A;  3SFD C;  1L4A C;  3CXH I;  1L2P A;  2E5T A;  2GA1 A;  3PP5 A;  3HTK B;  2P10 A;  1HUC A;  1NU1 D;  3WUV A;  3H1K D;  1K8A Q;  1KV4 A;  2OYI C;  1BSH A;  2JWD A;  3B5N D;  3H1J J;  5CBN A;  3EWK A;  3CCQ P;  4H13 B;  2KSE A;  5KLV K;  2QA4 P;  2E76 D;  2A06 E;  5KJ7 A;  4RJT A;  2KLU A;  3H1J D;  1L4A A;  4YTP C;  3BCC D;  2KS1 A;  2QIW A;  2A06 G;  4D6T E;  4ZMD A;  2OYI A;  1SFC A;  2OYH C;  2N1T B;  1A02 J;  4D6T G;  2HOD A;  3B71 A;  1EDK A;  4NPF X;  4LGD E;  2GUV A;  3B5N C;  2W6J H;  1L0L D;  1OW6 A;  2BCC J;  3L4F A;  3VYI A;  3SSU A;  1K05 A;  2P58 A;  1GZL A;  5AW6 B;  5C39 A;  3D70 A;  2C0X A;  2OYH A;  2G3A A;  1VDF A;  5AW3 B;  2I8D A;  2DW3 A;  1JCD A;  2AXC A;  3OW2 O;  3VMX A;  3L70 D;  1KIL D;  1L4A B;  3D6Y A;  2W6A A;  4YXD C;  1KN7 A;  1AFO A;  2ZT9 C;  4AYC A;  1JY3 O;  4HKZ H;  3MTU E;  2OYI B;  1SFC B;  2JEE A;  1EZV E;  3L71 J;  1NGM B;  2HOD B;  3G4S P;  3AED C;  1EZV G;  2KZI A;  3G9R A;  1T2K D;  2CPB A;  2A06 D;  1LNQ A;  4UB8 E;  3L35 A;  1VQ5 P;  3A0H H;  3VMY A;  1JNM A;  2J5U A;  4WWI A;  2OYH B;  2C0W A;  4D6T D;  2I1J A;  4YXW H;  5APX A;  2YNY A;  1NTM G;  5GTH H;  5BU8 B;  5H2F E;  3FXD A;  3MZW B;  1SQV K;  2K37 A;  1BDC A;  4PD4 E;  1KFN A;  3H32 B;  5APY A;  1IFN A;  1JY2 P;  1KB9 H;  5AW2 B;  4K3A A;  2A45 H;  2HYN A;  3CC7 P;  1NTZ G;  1URQ D;  3RL0 B;  1SQB E;  3G3Z A;  5DJU B;  3VMA A;  5AVS B;  1USE A;  2AEM A;  1SQB G;  2P67 A;  2ZT9 B;  1BCC E;  3AE9 C;  1X22 A;  1BGY E;  4OGQ B;  2KNC A;  1KD1 Q;  1DD3 A;  1BCC G;  2WSF H;  2YIU C;  3AEG C;  2GM4 A;  3UIA A;  1EZV D;  4WBA A;  5KLV E;  3EQ2 A;  1NTM J;  3V2N A;  1IFJ A;  2IBZ G;  2QJY C;  3RK3 C;  5KLV G;  3ITK A;  1RH5 B;  3CLQ A;  3V4W A;  1S72 P;  4RKU J;  1NWQ A;  1E5W A;  1JMB A;  4OWF A;  4GDO A;  1NTM D;  3RBX A;  5AW0 B;  2HG5 D;  4XFJ A;  2XV5 A;  1NTZ J;  3SFE C;  3WU2 E;  4HH2 A;  4PD4 D;  1KB9 I;  1RQU A;  2A45 I;  1IFI A;  1KQG B;  2KNC B;  1MUU A;  3QWO C;  4ZNC A;  2IYO A;  3PH0 A;  1SQB D;  3GLM A;  1VQL P;  1FZA A;  1DX7 A;  2FBW C;  2K9J A;  4JF7 A;  4W7Y A;  2N9Y B;  2NZ2 A;  4PD4 H;  3CC2 P;  1EXJ A;  2YKQ A;  2R32 A;  3KHU A;  1BCC D;  3HE4 B;  2YO2 A;  4NPD A;  1FBM A;  1N73 B;  2P2U A;  1SS1 A;  1LTG C;  3L72 E;  2XZR A;  3CD6 P;  1SVF A;  1S5L H;  3RK3 B;  3I55 P;  5KLV D;  4ASW A;  5AW1 B;  1PZQ A;  3GG2 A;  3L72 G;  3CCE P;  2HPC B;  3LID A;  3LIE A;  1EDI A;  1Q90 D;  2H88 C;  4U3F E;  2K9Y A;  1PV3 A;  3V2Q A;  1LTT C;  1SQV E;  1NYH A;  1EQ7 A;  1L0L K;  4U3F G;  1S2E A;  2K9J B;  1LTJ C;  2ZAE B;  2YO3 A;  1SQV G;  4PV1 B;  1JUN A;  1IFP A;  1L0N D;  1GU4 A;  3JCU H;  1Y9B A;  3U1A A;  3IF4 A;  1OW8 A;  3A0B E;  2QJK C;  1L0N E;  2RH0 A;  2LR2 A;  3VTP C;  1VQM P;  2K1A A;  1J2J B;  1L0N G;  1LTJ A;  4PD4 I;  1QLE D;  1PL5 A;  3OJA B;  2XDJ A;  2KI7 B;  1OVV A;  2FFD C;  3MHV A;  2KSJ A;  5B66 E;  3IR9 A;  1NHL A;  1YJ9 P;  2Y0D A;  3FWL A;  4EIJ A;  3USS A;  1M57 D;  1ZOY C;  1PP9 J;  3EFG A;  3HD7 D;  2FYN C;  2WSC J;  3CCS P;  3L72 D;  3ABV C;  1UII A;  4L73 A;  2ZJS E;  2FFD A;  3H1L E;  2LXC B;  1VL2 A;  4AQR D;  2FYU J;  3M9H A;  2BAS A;  1U57 A;  4U3F D;  2O01 H;  2V7Q J;  4YPC A;  3I5C A;  1SQV D;  1BDD A;  1SQQ J;  4DCK A;  3M0D A;  1USD A;  1H89 A;  3H1H E;  5APS A;  1YJW P;  5BU5 A;  1FDM A;  2QJK B;  1FAV A;  3H1H G;  4H44 C;  1JY2 N;  1K73 Q;  2E75 B;  1ZW0 A; 
#chains in the Genus database with same CATH homology
 3V4Q A;  1JCC A;  2I1K A;  3RK3 D;  2Q7C A;  1HWT C;  2OYI A;  2FFD B;  1HGV A;  3R2P A;  1SFC A;  2OYH C;  3KQG A;  5CCG A;  3P8C D;  2N1T B;  3IFM A;  3LW5 H;  5CCH C;  4AUW A;  1A02 J;  2HOD A;  5APQ A;  1JO5 A;  5AVU B;  4LGD E;  2P1J A;  1G1J A;  2J59 M;  3TNU B;  1H8A A;  3B8E B;  2GUV A;  3OAK A;  3B5N C;  3L4F A;  1X79 B;  3VYI A;  2FXM A;  1GU5 A;  1AQ5 A;  1JY3 P;  3VP9 A;  1N73 C;  2N1T D;  2J58 A;  3A5T A;  1GZL A;  1Z56 A;  3MIW A;  5AW6 B;  3NMD A;  2C0X A;  2OYH A;  1OWA A;  1GDT A;  2FYZ A;  1CI6 A;  5CCH A;  1MV8 A;  1LT9 C;  1VDF A;  5AW3 B;  1JCD A;  3M9Q A;  2POH A;  5AVQ B;  3VMX A;  1KIL D;  2YKO A;  2KLV A;  1IK9 A;  3HE4 A;  1N86 A;  4LLH A;  1DH3 A;  1GD2 E;  1L4A B;  2W6A A;  1NH4 A;  1FOS F;  3NXS A;  1W2E A;  4DOJ A;  2R3C A;  1AFO A;  1N73 A;  4AYC A;  1JY3 O;  2KP8 A;  2M3B A;  1T3U A;  3MTU E;  2E42 A;  1N2D C;  2C9L Y;  3MGN A;  1IFM A;  4M3L A;  2OYI B;  5APU A;  1GK4 A;  1IC2 A;  2OAR A;  1SFC B;  2JEE A;  3BRV B;  5APT A;  1LGH B;  1ZR4 A;  1N7L A;  1WRG A;  2HOD B;  1LTA C;  5APV A;  1G2C A;  2HPC A;  2C9N Y;  1ZLL A;  1T2K D;  1YTZ I;  3L36 A;  3A3Y B;  1GK6 A;  3E1I A;  2CPB A;  2L5G B;  3L35 A;  4KHX A;  3VMY A;  2H43 A;  3HUS C;  1JNM A;  1LTS C;  1NAF A;  2OYH B;  2C0W A;  2XKM A;  2O1J A;  1KQL A;  2I1J A;  1LTJ B;  5APX A;  2YNY A;  2NPS B;  5BU8 B;  4W80 A;  1SQX K;  1SQV K;  3BVH A;  1NKZ B;  3CI9 A;  4LC1 A;  3TK1 A;  4N78 D;  1NU1 K;  3HD7 C;  2IFN A;  1FOS E;  1KFN A;  3H32 B;  5APY A;  4WY4 D;  1IFN A;  2Z5I A;  3HRN A;  3M91 A;  1VPC A;  1XTG B;  1JY2 P;  3HUS A;  2Q9I A;  5AW2 B;  5AW9 B;  1J1E C;  2Q3I A;  2A45 H;  1DEB A;  1IFD A;  2HYN A;  5AW8 B;  2KB7 P;  1FJP A;  1M1J C;  3U59 A;  1URQ D;  3RK2 B;  3RL0 B;  2WWW A;  1M7L A;  3G3Z A;  4JYC A;  5AVS B;  1G2C B;  2YKP A;  1N7S D;  2WSC H;  2A45 G;  3HD7 A;  5AVW B;  3TSI A;  1GL2 C;  4OH8 B;  1MZ9 A;  2P67 A;  4C7N A;  1GW4 A;  1S9K E;  2WPS A;  5APW A;  1JMM A;  2IFM A;  3RL0 D;  3V2P A;  2W6B A;  1G1I A;  1FJK A;  1RE4 C;  3V2R A;  1M1J A;  2WSF H;  2GM4 A;  2WZ7 A;  4I1L A;  3UIA A;  5AW5 B;  4WBA A;  5AVZ B;  3NTN A;  1GL2 A;  3EQ2 A;  3M9B A;  3V2N A;  1IFJ A;  4ZKP A;  3RK3 C;  1X8Y A;  5CJ4 A;  3HUS B;  3CLQ A;  3B5N A;  5AVY B;  3V4W A;  2H7H A;  3KYQ A;  1RE4 A;  1E5W A;  1JY3 N;  1JTH A;  1NWQ A;  1HVV A;  5CHX A;  1SLQ A;  5AW0 B;  2HG5 D;  3SWF A;  2XV5 A;  1NOH A;  2ZXE B;  4GKG A;  3HTK A;  3VN0 A;  1RF1 C;  1RY3 A;  4GIF A;  3HD7 B;  5CMZ A;  1HJB A;  1LT9 A;  5KJ7 D;  1J1D B;  1L4A D;  4XA4 A;  2N1T C;  4HH2 A;  2O1K A;  1JOC A;  3L37 A;  4W7Z A;  4EOT A;  3VP8 A;  3T97 A;  2A45 I;  1IFI A;  2WSE H;  1MUU A;  4C46 A;  1SFC D;  2VRS A;  3U1C A;  5CCG D;  1CSB A;  5AW4 B;  4GT1 A;  1RF1 A;  3P7K A;  3M0D C;  1KIL C;  1IJD B;  1GL2 B;  1CI6 B;  1FZA A;  2ZFC A;  1FZB A;  1DX7 A;  2N9B A;  3O8Z A;  4JF7 A;  4IFM A;  2N1T A;  4W7Y A;  3P8M C;  1ZN5 A;  4HYT B;  2YKQ A;  3B5N B;  2R32 A;  1S9K D;  1FZC C;  2WTY A;  5AVT B;  1IO4 A;  2E43 A;  2XU6 A;  1KFM A;  3HE4 B;  3TNU A;  2YO2 A;  2YMY A;  3NFQ A;  1LTB C;  1JTH B;  2LKM A;  1XTC C;  5AVV B;  1FBM A;  1SQP K;  2W27 A;  1N73 B;  5AVR B;  4I2L C;  2P2U A;  4WB4 A;  4JYB A;  2NPS D;  2JJL A;  1KIL A;  1HH0 A;  1T2K C;  1LTG C;  1SP4 A;  1HTL C;  2HFE D;  3MUD A;  4N6J A;  2XZR A;  1LT9 B;  1SVF A;  1WT6 A;  3RK3 B;  1SFC C;  4IFD K;  1L0N K;  2QM7 A;  5AW1 B;  1X9V A;  3P32 A;  3BAS A;  1OXZ A;  2WT7 A;  3KDP B;  2M8R A;  1KZU B;  3M0A A;  1FZC A;  2HPC B;  1T3J A;  5BVZ A;  3LID A;  3MD0 A;  3LIE A;  3BRT B;  1NTK K;  1HBW A;  1JY2 O;  3RK2 D;  3WMM 0;  1LTI C;  2CPS A;  1RF1 B;  2XNX A;  3V2Q A;  4XE5 B;  1LTT C;  3V5B A;  1EQ7 A;  1A02 F;  1L0L K;  4Y99 C;  4WY4 C;  3N7N A;  1LTJ C;  2YO3 A;  4N78 E;  3CL3 D;  3TYY A;  2NPS C;  1LWU C;  3HE5 A;  1QL1 A;  4N3Y B;  1FU1 A;  1RE3 C;  1JUN A;  3A2A A;  2P7J A;  3OA7 A;  3H6P A;  1URQ C;  1GU4 A;  4C7R A;  2PAJ A;  3U1A A;  1MFZ A;  2IPP A;  3KPE A;  3A7O A;  3VMZ A;  2Z5H A;  1N7S C;  1RF0 C;  1FZF A;  1KIL B;  1NKN A;  1FZE A;  4RES B;  1ZR2 A;  4I6M C;  3N4X A;  4WY4 A;  5CJ0 A;  3VTP C;  2IX7 C;  4ZKU A;  3GHG C;  1J2J B;  1LTJ A;  3RK2 C;  2KYV A;  1NO4 A;  3RL0 C;  2NPS A;  1NTM K;  1PFI A;  1LWU A;  3OJA B;  2XDJ A;  2WT7 B;  1FZC B;  3P8C E;  1GW3 A;  1RE3 A;  1CW5 A;  2FFD C;  1URQ A;  1GTW A;  4C7N B;  2KSJ A;  2FKW B;  4DZO A;  3H32 A;  3SWY A;  1CZQ A;  3IR9 A;  1N7S A;  1NHL A;  1RF0 A;  1J1E B;  3C9I A;  4EIJ A;  2R5D A;  2QM8 A;  1M1J B;  3EFG A;  3GHG A;  3HD7 D;  2MJZ A;  1NTZ K;  2GUS A;  1T8Z A;  1YYC A;  4B86 A;  2WIT A;  5AW7 B;  2Z4E A;  3HE5 B;  2FFD A;  1ZV8 A;  2KOG A;  1SQB K;  4AQR D;  5KTB A;  2HLO A;  1FZG A;  3M9H A;  3M06 A;  2BAS A;  1H88 A;  3II6 A;  5KJ7 C;  3BAT A;  2O01 H;  1GL2 D;  4Y99 B;  4WY4 B;  1L4A C;  5CCH D;  3I5C A;  3M0D A;  3PP5 A;  1YTZ T;  1LWU B;  3HTK B;  1HUC A;  1H89 A;  2OYI C;  3B5N D;  2FYU K;  1URQ B;  1QL2 A;  2Q5U A;  5APS A;  2WPR A;  5CCG C;  1J1D C;  2H8P D;  5AVX B;  5BU5 A;  4IFF A;  5KLV K;  1N7S B;  1FDM A;  1HGZ A;  4O9B A;  1FAV A;  2WPQ A;  3VOP A;  2R5B A;  2PP6 A;  1JY2 N;  5KJ7 A;  1SQQ K;  1L4A A;  3GHG B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...