3UIAA

Structural determinants of trimerization specificity in hiv-1 gp41 protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
QARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGLKQIQARILAVERYLKDQQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords Glycoprotein 41
publication title Structural Determinants of Trimerization Specificity in HIV-1 gp41 Protein
rcsb
source organism Human immunodeficiency virus type 1
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3uiaA00
5AVWB 2Q3IA 3P7KA 4DZOA 3A5TA 1GK6A 1CI6A 3KDPB 5AW4B 2P2UA 2BASA 1MFZA 2QM7A 1NAFA 4AYCA 1HWTC 1FAVA 1H88A 2VRSA 5APQA 3L36A 3MD0A 2R5BA 2R5DA 1G2CB 2WWWA 3V5BA 1JNMA 4RESB 2Z5HA 1A02F 5AW5B 2ZXEB 1GU5A 4M3LA 1GTWA 1GU4A 2ZFCA 5AVUB 3TK1A 4B86A 2Q5UA 2YNYA 1S9KE 5AW0B 3SWFA 2Z5IA 1GD2E 2R32A 5AW8B 1CZQA 1X8YA 1SLQA 1MV8A 2WPSA 1FOSE 2C9LY 1A02J 1T2KC 4C7NB 3A3YB 5AVYB 5AVSB 3HE5A 5APVA 3VTPC 2WT7A 2YO3A 1MUUA 3KQGA 3LIDA 5APXA 3VMXA 1J2JB 3LIEA 2W27A 3TNUB 1GZLA 1HUCA 5AVTB 5APTA 1T2KD 4AQRD 1HJBA 2JJLA 1GK4A 2XU6A 1HBWA 4XE5B 5AW6B 5AVRB 3I5CA 3NXSA 3VYIA 5AW3B 4C7NA 2QM8A 1H89A 5APWA 5AW9B 3M91A 4EOTA 3MGNA 1DH3A 3NFQA 1IO4A 2WPQA 2H7HA 3T97A 3A7OA 1OXZA 5AW7B 1H8AA 5CMZA 3TNUA 5APUA 5AVVB 2N9BA 1FOSF 4KHXA 5AVXB 1CSBA 1S9KD 2IPPA 3M0DA 2E42A 2Q7CA 3HE4B 2YO2A 4GT1A 4LC1A 1SP4A 2P67A 3P32A 2P7JA 3NMDA 3A2AA 3TYYA 3VMYA 3IR9A 3M9HA 4I2LC 1CI6B 5AW1B 1OWAA 2W6AA 5AVZB 1JUNA 2R3CA 2XV5A 4C46A 3V4QA 2XZRA 3HE5B 5APYA 3M0AA 3M9BA 2KP8A 3B8EB 3L35A 2WT7B 4JYBA 3VMZA 4AUWA 3VN0A 3UIAA 5AVQB 3O8ZA 3V4WA 5APSA 5AW2B 3HTKA 1KQLA 4GKGA 2E43A 1NWQA 3P8MC 3HE4A 4HYTB 2WPRA 2WTYA 3L37A 3M06A 4I6MC 2C9NY 1YYCA 3NTNA 3OAKA 4JYCA
chains in the Genus database with same CATH superfamily
5AVWB 3SWKA 1T6AA 2K9JA 1KILD 5KLVE 3BRTB 3TDKA 3CXHD 2QJKB 2W6JH 3SFDC 2WWWA 2JKVA 3N7NA 2KNCB 3K5BA 1P84D 1AJYA 1WMKA 2WSFH 4IL6E 1NTZG 2M8RA 2ZVOB 3H1HJ 1HGZA 1SLQA 4DT0A 2QJPC 2ZYGA 4NPDA 1SQVD 1G2CA 5KJ7C 5CBNA 1ZN5A 4AQRD 2Y0CA 3H1IJ 2RMZA 1FZGA 2A06G 1JY3P 3CX5D 1X22A 4L73A 1EDLA 1NU1E 1P84H 4Y99B 3U1AA 5EFWB 3CXHI 2NPSC 3EWKA 4EIJA 1IO4A 1Q81Q 2NZ2A 2Y9ZA 1XTGB 1YIJP 3CWBE 3CMAP 1OW6A 2KLUA 1NJIQ 1GL2A 3VP8A 5M1BA 2XNDH 1NTKD 3M9QA 3JCUH 3PJSK 2E5YA 2FXMA 1QEXA 2P1JA 3CX5H 1FE6A 5CBOA 2FYNC 1MZ9A 3O8ZA 1L0LK 1PGJA 1KILC 1JCCA 4N6JA 1YYCA 2GUVA 3W67A 2W6BA 3A5TA 1FZBA 1S2EA 1S5LE 3H1LD 4W80A 3O6QA 1PP9J 4I7ZB 3MD0A 3BASA 3V5BA 2WSEH 1N7SB 2ZXEB 1LTBC 1BE3D 1JCDA 2E76B 1AA0A 4EI2A 2W8ZA 2K88A 3P8CE 5AVSB 3S1KA 1JY3O 4IL6X 4GOEA 2HFED 3LIEA 4WB4A 1SQPK 2ZYDA 2YMKA 1AVOA 1SS1A 5DJTB 3B5NA 3I5CA 3MZWB 1OVVA 2HLOA 3IAOA 3L75J 1QL1A 3L70D 2BCCD 5AVXB 1L0LG 1KFNA 2P67A 3P32A 1S72P 3H1JG 5C39A 3BVHA 3VMYA 1KZUB 3EFFK 4JF7A 2KP8A 1YJ9P 1OVRA 5CCGC 4UB8E 4Z1MH 1BCCE 2B88A 2Y0EA 4GDOA 2IBZG 2ZAEB 2Q3EA 3CI9A 4R4MA 3JC22 1KB9E 1NAFA 3BCCE 3C9IA 1ZV8A 1NKZB 1SQPG 1H0TB 1S5LX 2P10A 3TK1A 1OVUA 1Q2NA 2XNXA 1S9KE 3TSIA 2QVAA 2KS1B 1EZVG 4XA4A 1FOSE 3GF7A 3FXDA 4C7NB 1NH4A 1ZRTE 3VTPC 3E7KA 1ZR2A 1JY2P 4OWFA 5APTA 3EFGA 4D6TE 1NVOA 3V6IA 4U3FD 1N7SD 1T3JA 1QVFO 3CCEP 1VQ7P 1OZHA 3D71A 2ZXXA 1NYHA 1KILE 2FBWC 2ZJSE 1HTLC 1LWUA 4MN4C 2WPQA 1S3JA 1LTJB 4DJGA 4H13B 1L0NK 2FKWB 2IPPA 1J1DB 3L71J 1OX3A 4R4LA 1SP4A 4Y99C 4LLHA 1YQ3C 2A45H 1P84E 1RF0A 1ZW0A 1PL5A 1VQMP 4C46A 2OTJP 4HJGH 3HRNA 3MUDC 2Q1KA 1L4AB 1SQVE 2OARA 1LTGC 4GKGA 2KUBA 1KQFB 1JMBA 3JCUE 2N1TB 1NTMK 1JM0A 4CPGA 3CX5E 2VRSA 2OYHA 2O1KA 2HODB 4OGQB 1KQGB 2Z5HA 4JPZB 4TT3H 3V2PA 1JY2O 4ZKPA 1NU1D 4I7ZC 4NPEA 3ZDMA 2O01H 3HE5A 1NTKE 1N7SC 3T97B 2QJPB 2W27A 2PP6A 4IOIH 2E76C 1L0NG 5AVRB 3NXSA 5CJ4A 1RHZB 1H89A 3WUTA 3NFQA 3H1LE 1NTZJ 2N9BA 2ITAA 3L73G 2KIKA 2FYUK 1LGHB 1HJ0A 1M90Q 1BE3E 1YITP 1NTMG 3M0AA 3H32A 1SQBD 1VQ5P 1U7MA 1VQLP 1FZAA 5APSA 1M1JA 2WQYC 4H13D 1M8OB 2W90A 4UB6H 3NTNA 2OYIA 4NPFX 3SSUA 2GUSA 1EDKA 2QRXA 1RQUA 2O1JA 4PV1C 1HWTC 1YBKA 3AE7C 3LW5J 2B87B 2PGDA 3R4YA 1L4AD 3L70E 1GU5A 1LTSC 2CK3H 2V7QJ 1RY3A 4ASWA 1GL2B 1IZNB 2PRRA 3AE4C 1QVGO 1DEEG 2R3SA 1VQ4P 3L71D 3CCRP 2PFXA 3GHGA 2WITA 5AVTB 4OGQD 4JBZA 4XE5B 3H1HE 2FYUG 3FWNA 2QM8A 1QL2A 2O01N 2B9BA 1FZCA 1H8AA 1FOSF 3V2RA 1HGVA 3HTKB 4XFJA 5CCHD 2Q7CA 3HE4B 1RE4C 1YI2P 4EYYQ 5GTHH 3GW6A 1KB9D 2ZT9B 2WSCH 2WPVB 5AW1B 4H13C 4JYBA 1KV4A 1J1DC 1JY3N 1N2DC 1KQLA 2D2CB 3CCVP 2NPSD 4IFDK 4U3FE 1Q7YQ 4WY4B 1GK6A 2B89A 3Q5PA 1L4AC 2BASA 1L0LJ 3G4SP 2HG5D 2R5DA 1JTHA 2WSSH 1RE3C 3H1JJ 2QG4A 3FGAD 5H2FH 1PGPA 2N1TC 4U7JA 4B86A 3RK2B 1SQXD 1SQVK 2R32A 1KB9I 4OGQC 4ZKUA 4TLFA 2V4HA 3KQGA 3RK3B 3E1RA 1GZLA 2E74C 3BATA 1GK4A 5KJ7A 1LT9B 2I8DA 3H1KG 4D6TG 3VYIA 3L74G 2KB7P 3ITKA 1IFMA 3L72G 1SQPJ 3GF3A 4EOTA 5CCHC 2FFDC 2H7HA 3G71P 2OGUA 1HVVA 2L91A 3VOPA 1IFIA 1NTKK 4RJTA 1BGYG 2ZVNB 3L75E 3N4XA 4W7YA 3CC7P 2GM4A 2RKLA 3CLQA 1HF9A 2POHA 4YXDC 2JDIH 2IZ0A 4JQ0D 3WUVA 1P84I 1KILA 4JYCA 2IFNA 4DCKA 2HPCA 1CI6A 3TGUG 2ZT9D 2R5BA 4O9BA 3VMAA 4UB6E 1PZQA 4K3AA 2D2CD 1G1JA 1W2EA 4OVNF 4BRYA 1RF1A 4PJ0H 1BSHA 3CX5I 2YKOA 5CCGD 3AE2C 4WY4D 1YHQP 3G9RA 3F89A 1QLED 1HH0A 5APVA 4ZMDA 5APXA 4RO0A 1GL2C 4N3YB 1SQQK 2KZJA 1NTKG 4L74A 2I1KA 1SQBE 4N78D 2BEZF 3QH9A 1DEBA 5APWA 1WT6A 2IDBA 3Q2YA 3TNUA 2K1AA 3RK3D 3AEGC 5L8RJ 1L0LD 2J58A 1JY2N 1IFPA 1OWAA 1T3UA 3H1JD 3HE5B 1L0NJ 3B8EB 4GODA 2I1JA 3VMZA 1BE3G 4H0LB 2YXQB 1N73B 1QX8A 3L71E 1IJDB 4EDFA 2ZT9C 3GMAA 5GTHE 3VP9A 4DZOA 3CL3D 1NOHA 2IBZD 2D2CC 3L73J 2LR2A 2MJZA 4PV1B 1SQQG 1KC8Q 4HH2A 3H1HD 4WY4C 1NTMJ 1GU4A 1SQPD 5AW0B 4DOJA 2IFMA 1ZMEC 1NO4A 2H8PD 1ZOYC 2WPSA 2BCCG 2L5GB 3A3YB 3AEFC 1EZVD 3H32B 3H1ID 1FS0E 2KYVA 5H2FE 1HUCA 3RK2C 1FDMA 1K8AQ 2KNCA 1BSNA 1RQVA 3CCMP 3OW2O 1J1EB 1AFOA 3W68A 3RK3C 3OJAB 3E1IA 4YTPC 3TF5A 1LT9C 3M0DC 5KLVK 1CSBA 2AXCA 2M3EA 3AE3C 4L75A 2WZ7A 2E76D 2M3BA 3II6A 1SQXE 4I2LC 5BU5A 5CHXA 2M5AB 3V4QA 3AEEC 1NKNA 1NTZE 3GHGB 1JO5A 2FYUJ 5B66H 2ZYAA 2CPSA 2R44A 3RBZA 4C7RA 2JR8A 1VQKP 2QSIA 1OW7A 1PP9D 1T8ZA 2M0BA 1IFDA 1EXJA 2OYOA 1MKMA 1M56D 1FZCB 4U3FG 1VQOP 1IFJA 2A06E 4RESB 3BRVB 4H0LD 1NU1K 2A45I 2Q6QA 2XDJA 4M3LA 2LKMA 1VQPP 1SFCB 2PAJA 1PPJG 1PGOA 1MV8A 5B5EH 3HD7B 5AVYB 2H89C 1M1KQ 3PH0A 2E75B 5E79H 1EXIA 5KLVG 1IC2A 1T2KD 1N7SA 4YXWH 4PV1D 1RF0C 3B71A 1LP1B 4PJ0E 2SPZA 2J5UA 2KK7A 1YJWP 3L75D 1L0ND 2E74B 3KXDA 1K9MQ 3H6PA 3IFMA 5GTIH 1TU3F 1Q86Q 1URQB 1OIPA 1Y47A 3CD6P 3M91A 2RN0A 2H88C 2FFDB 1R5SA 3L4FA 1X0TA 3IR9A 2K9JB 1SQBK 3L73D 3M9HA 2K37A 3R2PA 3AEDC 5APYA 1Q90D 4PD4D 1NTMD 1FDOA 2QA4P 3H1KJ 3UIAA 4KJMA 1YQ4C 4D6TJ 1NU1G 3L74J 3L72J 3OAKA 4N78E 4H0LC 3CWBG 1N73C 1G2CB 1BGYJ 5DJUB 1DX7A 3KPEA 4H44C 4ASVA 4ZNCA 1W5CE 3RL0B 3RK3E 2ZFCA 4PD4H 4IFFA 2YNYA 2C9LY 1WRGA 1X9VA 1T2KC 1L0LE 2YO3A 4WWIA 3V2QA 3VMXA 1GW3A 3H1JE 1OW8A 2KSJA 1H0TA 3C8VA 3TGUJ 4QMAA 1AV1A 5AW6B 1SFCD 1KMIZ 1FDIA 4C7NA 2FYUD 1EDIA 2HYNA 2N1TD 1M1JC 3HD7D 3CCSP 2IBZE 5AVVB 1KYOD 3WU2H 1D7MA 1J1EC 3MP7B 1G1IA 1SVFA 3NMDA 2H43A 2E74D 3AE9C 1SQPE 2JEEA 4W7ZA 3O6QB 2XZRA 1URQD 4K35A 1NTKJ 1AQ5A 2WSEJ 4AUWA 1LTJA 5AVQB 1EZVE 2LXCB 3HUSA 3H1IE 4HYTB 3M06A 2C9NY 1CW5A 1ZLLA 1Y8AA 1KYOH 3GHGC 1LTTC 3S9OA 5B66E 3FWLA 2KXPB 1L4AA 1SQXK 2OQQA 2JWDA 2NRGA 1VQ8P 2N9YB 2XKMA 1RE3A 2Q5UA 3C1LA 3SWFA 1E5WA 3B5NB 1FZCC 1BE3J 1IK9A 4WVZA 1BCCG 2HODA 2WT7A 1SFCC 2JJLA 2XU6A 3BCCG 3RL0D 3HD7C 3GG2A 2YIUC 5B5EE 3EQ2A 1Y9BA 2E75C 1PIXA 2K3RA 2G3AA 1PP9E 1NTZD 5E79E 5AW9B 1SQQJ 1PGQA 1MFTA 3MGNA 3L74D 3T97A 2Y9YA 3L72D 5CCHA 3Q5SA 5CJ0A 3B4SA 2BCCJ 2YO2A 1BDDA 1URQC 1R8EA 5GTIE 1GL2D 2AEMA 3A2AA 1LT1A 3QWOC 2J59M 4GOFA 2Z4EA 2XV5A 1BGYD 1W2BO 2A06D 1LNQA 2P58A 1SQXG 2NPSA 1N8RQ 5BU8B 1IK7A 1ZXGA 2KZIA 2WPRA 2WTYA 1AQTA 1VL2A 2Q3IA 3WMM0 2P2UA 1L0NE 2YMYA 4BXLA 4Y28J 3TGUD 2FY8A 3U59A 5TISH 1A02F 3CXHH 2CPBA 3Q3DA 1SQVG 1FZFA 2O3JA 1YTZI 1FC2C 2B87A 2Y0DA 3L73E 1Z56A 3LIDA 4I1LA 1LWUB 3RL0C 3LW5H 3I55P 3AE1C 1PFIA 4PD4E 1NTME 1YTZT 3JSVC 2V7QH 2QEXP 4U3FJ 1GDTA 3B5ND 1N7LA 3CCUP 1EQ7A 3KZIH 2IX7C 3WUUA 1K73Q 1S4XA 3RK2D 2P7JA 5KLVJ 2DW3A 3SFEC 3L35A 2YKQA 2OYHB 1UIIA 1FJPA 3WU2E 3VN0A 1ZP0C 3HTKA 1RF1C 3HE4A 3L37A 3H1LG 2AEJA 3IF4A 3CPWO 2LXBA 3P7KA 3Q1MA 2O01J 5TJHA 5AW4B 2QM7A 2RH0A 1FAVA 1E79H 3L36A 5APQA 2FYUE 1JNMA 3PHLA 1FU1A 3I56P 3FX0A 1KYOE 2GA1A 3A0HH 5AVUB 1NGMB 2E5TA 1SQQD 5CCGA 1CZQA 1FBMA 4WY4A 4H44B 1UIXA 1NU1J 1MUUA 1J2JB 1DIPA 4L76A 1KTMA 2QJYB 3B5NC 3AE6C 1HBWA 3CCQP 1NHLA 3CWBJ 3G3ZA 4RKUJ 3L70G 5AW3B 2JO1A 1ZR4A 3PLNA 3KYQA 3A7OA 1OFCX 1M1JB 1LT9A 3M0DA 1DD3A 2MKVA 1EC5A 3D6YA 2OTKE 2OYIB 1VPCA 1VF5B 1K04A 1USDA 3RL0g 3M9BA 2IBZI 1GW4A 1LTIC 3H1HG 2KOGA 1DD4A 5KAIH 1BDCA 5AW2B 2KI7B 3SWYA 3P8MC 1JOCA 1SQBJ 4I6MC 3ABVC 2QJKC 1YJNP 1U57A 5KKZB 4WBAA 3H1IG 2KSEA 4LGDE 1MFZA 3GLMA 3H1KE 1EZVI 2IYOA 3L74E 1U7JA 3MUDA 3L72E 1LTAC 1GTWA 3A0BH 1X8YA 2JP3A 3FXEA 1VQNP 2A45G 1PPJD 5TISE 5KAFH 3CXHE 1BGYE 2OTLP 3HUSB 2BEQD 5KLVD 4HB1A 2Q9IA 4GIFA 2WSCJ 3H25A 1LWUC 2IYPA 4H44D 2YIUB 1JEKA 1NAYA 1OXZA 5CMZA 2AXTH 1PP9G 3TGUE 2AEFA 1BCCJ 2FYZA 4LC1A 1L2PA 5KLIB 3U1CA 5AVZB 1JUNA 2YXRB 3RBXA 3KZIE 2WT7B 3BCCJ 1JTHB 3D6ZA 1USEA 3MHVA 2W83C 3PRJA 1M7LA 2QIWA 3D70A 3V4WA 4IL6H 2OYHC 3KDPB 1FJKA 1N86A 1VF5D 1N73A 3CWBD 1VQ9P 2WVRA 3L75G 5AW5B 1QGKB 3AEBC 2WSFJ 3RGUA 1PV3A 1JMMA 5AW8B 3CC4P 2WMMA 1JB0J 1SQXJ 3V2NA 3AE8C 1VQ6P 4BWNA 2NPSB 3A0HE 3MIWA 3CC2P 1M57D 2HR3A 3USSA 1AVYA 3IN6A 3KHUA 3CMEP 1K05A 2QJYC 1DH3A 3AECC 5APUA 1S1CX 4PD4I 4KHXA 1SQVJ 3PTZA 1GMJA 3AE5C 3P8CD 2FYNB 4GT1A 1KD1Q 2UWJE 1KILB 2KS1A 3TYYA 2HPCB 2FXPA 1CI6B 1SQQE 1SQBG 2R3CA 1S5LH 3G6EP 2E75D 2C0XA 2E43A 2OYIC 2BCCE 5KTBA 1VF5C 5BVZA 4BRYB 4IFMA 1RF1B 2M5AA 1RE4A 1VDFA 5KAIE 4AYCA 1H88A 1LJ2A 4YPCA 1KQSO 4A7PA 1OMIA 5KKZC 2Z5IA 1GD2E 3AEAC 2K9YA 3L71G 1A02J 5K5GB 1RH5B 3H1LJ 1BCCD 3TNUB 3OA7A 1HJBA 1KYOI 3A0BE 5KJ7D 1NTZK 1SFCA 2IZ1A 2YKPA 3PP5A 3S4RA 3BCCD 3F5HA 2N1TA 1Q82Q 3HD7A 1LTJC 2JWAA 5KAFE 2KLVA 3MTUE 3HUSC 5AW7B 1FZEA 4HKZH 1S9KD 1LP1A 2E42A 3CCLP 4UB8H 3CCJP 1ZRTD 1KORA 1IFNA 1X79B 2C0WA 1URQA 2W6AA 3H1KD 1KFMA 3Q5RA 4D6TD 2AXTE 1KB9H 2G8YA 1PPJE 4KT0J 1KN7A 1EDJA 1XTCC 5KLIC 1R5LA 1NWQA 2FFDA 3L70J 4OH8B 2FXOA 2QE7H
chains in the Genus database with same CATH topology
5AVWB 3P7KA 2GUSA 1KILD 1T8ZA 1IFDA 3BRTB 5AW4B 2O1JA 2QM7A 1HWTC 1FAVA 2OYIA 1FZCB 5APQA 3L36A 1IFJA 2WWWA 1JNMA 4RESB 3BRVB 1L4AD 1NU1K 2A45I 1FU1A 3N7NA 1GU5A 1LTSC 2XDJA 4M3LA 1RY3A 2LKMA 1GL2B 5AVUB 2WSFH 1SFCB 2M8RA 5CCGA 2PAJA 1CZQA 1FBMA 1HGZA 4WY4A 1SLQA 1MV8A 3HD7B 5AVYB 1MUUA 1G2CA 5KJ7C 1J2JB 3GHGA 2WITA 1IC2A 1ZN5A 5AVTB 1T2KD 4AQRD 1N7SA 3B5NC 1RF0C 1HBWA 1NHLA 1FZGA 4XE5B 3G3ZA 1JY3P 3H6PA 3IFMA 5AW3B 2QM8A 1URQB 1ZR4A 4Y99B 1QL2A 3U1AA 3M91A 2NPSC 1FZCA 3KYQA 4EIJA 1IO4A 3A7OA 1H8AA 1FOSF 3V2RA 1HGVA 1XTGB 1M1JB 3HTKB 1LT9A 3M0DA 5CCHD 2Q7CA 2FFDB 3HE4B 1GL2A 3L4FA 1RE4C 3VP8A 2OYIB 1VPCA 3IR9A 3M9HA 1SQBK 2WSCH 3M9QA 5AW1B 3R2PA 5APYA 2FXMA 3M9BA 2P1JA 1GW4A 1LTIC 4JYBA 2KOGA 1J1DC 3UIAA 1JY3N 1MZ9A 1N2DC 3O8ZA 1L0LK 5AW2B 1KQLA 1KILC 3SWYA 3P8MC 1JCCA 1JOCA 2NPSD 4I6MC 4N6JA 4IFDK 1YYCA 2GUVA 3OAKA 2W6BA 4WY4B 4N78E 4WBAA 1FZBA 1GK6A 3A5TA 4W80A 1N73C 1L4AC 2BASA 4LGDE 1MFZA 2HG5D 3MD0A 2R5DA 3BASA 1JTHA 1G2CB 3V5BA 1RE3C 2WSEH 1DX7A 1N7SB 2ZXEB 3KPEA 1LTBC 3MUDA 3RL0B 2N1TC 1LTAC 1GTWA 2ZFCA 4B86A 1JCDA 4IFFA 3RK2B 2YNYA 1SQVK 2R32A 1X8YA 3P8CE 2C9LY 1WRGA 1X9VA 1T2KC 4ZKUA 2A45G 5AVSB 2YO3A 3KQGA 3V2QA 1JY3O 3VMXA 3RK3B 1GW3A 2HFED 3LIEA 1GZLA 4WB4A 1SQPK 2KSJA 3HUSB 3BATA 1GK4A 5KJ7A 1LT9B 5AW6B 2Q9IA 3B5NA 4GIFA 3I5CA 1SFCD 3VYIA 2HLOA 1LWUC 2KB7P 4C7NA 1IFMA 2HYNA 2N1TD 4EOTA 1M1JC 1QL1A 3HD7D 5CCHC 2FFDC 2H7HA 1OXZA 5CMZA 1HVVA 5AVVB 5AVXB 3VOPA 1IFIA 1J1EC 1NTKK 1KFNA 1G1IA 2FYZA 4LC1A 1SVFA 2P67A 3P32A 3BVHA 3NMDA 2H43A 3U1CA 3VMYA 1KZUB 2JEEA 4W7ZA 3N4XA 5AVZB 1JUNA 4W7YA 2XZRA 1URQD 4JF7A 2KP8A 2WT7B 1AQ5A 2GM4A 4AUWA 1LTJA 1JTHB 3CLQA 5AVQB 2POHA 5CCGC 3HUSA 4HYTB 1M7LA 3M06A 2C9NY 1CW5A 1ZLLA 1KILA 3V4WA 4JYCA 2IFNA 2HPCA 2OYHC 1CI6A 3KDPB 3CI9A 1FJKA 3GHGC 1LTTC 1NAFA 1N86A 2R5BA 1N73A 1L4AA 4O9BA 3C9IA 1ZV8A 1NKZB 1SQXK 5AW5B 2XKMA 3TK1A 1G1JA 1RE3A 1W2EA 2Q5UA 2XNXA 1S9KE 3SWFA 1E5WA 3TSIA 3B5NB 1JMMA 5AW8B 1RF1A 1FZCC 4XA4A 1FOSE 2YKOA 5CCGD 4WY4D 1IK9A 1NH4A 3V2NA 4C7NB 1HH0A 5APVA 3VTPC 2HODA 2WT7A 5APXA 1ZR2A 1JY2P 1GL2C 5APTA 1SFCC 3EFGA 2NPSB 4N3YB 1SQQK 2JJLA 2XU6A 2I1KA 1N7SD 1T3JA 4N78D 3MIWA 3RL0D 3HD7C 3EQ2A 1DEBA 5APWA 1WT6A 5AW9B 3MGNA 1DH3A 1HTLC 1LWUA 2WPQA 3T97A 3TNUA 5APUA 1LTJB 3RK3D 5CCHA 4KHXA 1L0NK 2FKWB 2IPPA 1J1DB 5CJ0A 3P8CD 2YO2A 4GT1A 1URQC 1SP4A 4Y99C 4LLHA 2A45H 1KILB 1GL2D 2J58A 1JY2N 1RF0A 3TYYA 3A2AA 2HPCB 1CI6B 1OWAA 2J59M 2Z4EA 2R3CA 2XV5A 4C46A 1T3UA 3HE5B 3B8EB 3HRNA 2I1JA 3VMZA 1N73B 1L4AB 2OARA 1LTGC 2C0XA 2NPSA 4GKGA 2E43A 2OYIC 5BU8B 5KTBA 2WPRA 2WTYA 1IJDB 5BVZA 3VP9A 2Q3IA 3WMM0 4IFMA 1RF1B 4DZOA 2N1TB 1NTMK 3CL3D 1NOHA 2P2UA 1RE4A 1VDFA 4AYCA 1H88A 2VRSA 2OYHA 2O1KA 2YMYA 2HODB 3U59A 2MJZA 2Z5HA 1A02F 4HH2A 2CPBA 4WY4C 3V2PA 1GU4A 5AW0B 1JY2O 2Z5IA 4ZKPA 1GD2E 4DOJA 1FZFA 2IFMA 1NO4A 2H8PD 2WPSA 1A02J 2O01H 2L5GB 1YTZI 3A3YB 3HE5A 1N7SC 1Z56A 3LIDA 4I1LA 3H32B 1LWUB 3RL0C 3LW5H 2KYVA 2W27A 3TNUB 2PP6A 1HUCA 3RK2C 3OA7A 1HJBA 1FDMA 1PFIA 1YTZT 5KJ7D 1NTZK 1SFCA 2YKPA 5AVRB 3NXSA 1J1EB 1AFOA 1GDTA 3PP5A 3B5ND 5CJ4A 2N1TA 3RK3C 3HD7A 1LTJC 3OJAB 1H89A 3E1IA 2KLVA 3MTUE 1N7LA 3HUSC 3NFQA 1EQ7A 1LT9C 5AW7B 3M0DC 1FZEA 5KLVK 2IX7C 2N9BA 1CSBA 1S9KD 2E42A 2FYUK 1LGHB 2WZ7A 3RK2D 2P7JA 1IFNA 1X79B 2M3BA 3II6A 2C0WA 4I2LC 1URQA 5BU5A 2W6AA 5CHXA 1KFMA 3V4QA 3M0AA 3L35A 2YKQA 2OYHB 1NKNA 3H32A 1FJPA 3GHGB 3VN0A 1JO5A 1FZAA 5APSA 1M1JA 1XTCC 2CPSA 3HTKA 1RF1C 1NWQA 2FFDA 3HE4A 4OH8B 3L37A 4C7RA 3NTNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVW B;  2Q3I A;  3P7K A;  4DZO A;  3A5T A;  1GK6 A;  1CI6 A;  3KDP B;  5AW4 B;  2P2U A;  2BAS A;  1MFZ A;  2QM7 A;  1NAF A;  4AYC A;  1HWT C;  1FAV A;  1H88 A;  2VRS A;  5APQ A;  3L36 A;  3MD0 A;  2R5B A;  2R5D A;  1G2C B;  2WWW A;  3V5B A;  1JNM A;  4RES B;  2Z5H A;  1A02 F;  5AW5 B;  2ZXE B;  1GU5 A;  4M3L A;  1GTW A;  1GU4 A;  2ZFC A;  5AVU B;  3TK1 A;  4B86 A;  2Q5U A;  2YNY A;  1S9K E;  5AW0 B;  3SWF A;  2Z5I A;  1GD2 E;  2R32 A;  5AW8 B;  1CZQ A;  1X8Y A;  1SLQ A;  1MV8 A;  2WPS A;  1FOS E;  2C9L Y;  1A02 J;  1T2K C;  4C7N B;  3A3Y B;  5AVY B;  5AVS B;  3HE5 A;  5APV A;  3VTP C;  2WT7 A;  2YO3 A;  1MUU A;  3KQG A;  3LID A;  5APX A;  3VMX A;  1J2J B;  3LIE A;  2W27 A;  3TNU B;  1GZL A;  1HUC A;  5AVT B;  5APT A;  1T2K D;  4AQR D;  1HJB A;  2JJL A;  1GK4 A;  2XU6 A;  1HBW A;  4XE5 B;  5AW6 B;  5AVR B;  3I5C A;  3NXS A;  3VYI A;  5AW3 B;  4C7N A;  2QM8 A;  1H89 A;  5APW A;  5AW9 B;  3M91 A;  4EOT A;  3MGN A;  1DH3 A;  3NFQ A;  1IO4 A;  2WPQ A;  2H7H A;  3T97 A;  3A7O A;  1OXZ A;  5AW7 B;  1H8A A;  5CMZ A;  3TNU A;  5APU A;  5AVV B;  2N9B A;  1FOS F;  4KHX A;  5AVX B;  1CSB A;  1S9K D;  2IPP A;  3M0D A;  2E42 A;  2Q7C A;  3HE4 B;  2YO2 A;  4GT1 A;  4LC1 A;  1SP4 A;  2P67 A;  3P32 A;  2P7J A;  3NMD A;  3A2A A;  3TYY A;  3VMY A;  3IR9 A;  3M9H A;  4I2L C;  1CI6 B;  5AW1 B;  1OWA A;  2W6A A;  5AVZ B;  1JUN A;  2R3C A;  2XV5 A;  4C46 A;  3V4Q A;  2XZR A;  3HE5 B;  5APY A;  3M0A A;  3M9B A;  2KP8 A;  3B8E B;  3L35 A;  2WT7 B;  4JYB A;  3VMZ A;  4AUW A;  3VN0 A;  3UIA A;  5AVQ B;  3O8Z A;  3V4W A;  5APS A;  5AW2 B;  3HTK A;  1KQL A;  4GKG A;  2E43 A;  1NWQ A;  3P8M C;  3HE4 A;  4HYT B;  2WPR A;  2WTY A;  3L37 A;  3M06 A;  4I6M C;  2C9N Y;  1YYC A;  3NTN A;  3OAK A;  4JYC A; 
#chains in the Genus database with same CATH topology
 5AVW B;  3SWK A;  1T6A A;  2K9J A;  1KIL D;  5KLV E;  3BRT B;  3TDK A;  3CXH D;  2QJK B;  2W6J H;  3SFD C;  2WWW A;  2JKV A;  3N7N A;  2KNC B;  3K5B A;  1P84 D;  1AJY A;  1WMK A;  2WSF H;  4IL6 E;  1NTZ G;  2M8R A;  2ZVO B;  3H1H J;  1HGZ A;  1SLQ A;  4DT0 A;  2QJP C;  2ZYG A;  4NPD A;  1SQV D;  1G2C A;  5KJ7 C;  5CBN A;  1ZN5 A;  4AQR D;  2Y0C A;  3H1I J;  2RMZ A;  1FZG A;  2A06 G;  1JY3 P;  3CX5 D;  1X22 A;  4L73 A;  1EDL A;  1NU1 E;  1P84 H;  4Y99 B;  3U1A A;  5EFW B;  3CXH I;  2NPS C;  3EWK A;  4EIJ A;  1IO4 A;  1Q81 Q;  2NZ2 A;  2Y9Z A;  1XTG B;  1YIJ P;  3CWB E;  3CMA P;  1OW6 A;  2KLU A;  1NJI Q;  1GL2 A;  3VP8 A;  5M1B A;  2XND H;  1NTK D;  3M9Q A;  3JCU H;  3PJS K;  2E5Y A;  2FXM A;  1QEX A;  2P1J A;  3CX5 H;  1FE6 A;  5CBO A;  2FYN C;  1MZ9 A;  3O8Z A;  1L0L K;  1PGJ A;  1KIL C;  1JCC A;  4N6J A;  1YYC A;  2GUV A;  3W67 A;  2W6B A;  3A5T A;  1FZB A;  1S2E A;  1S5L E;  3H1L D;  4W80 A;  3O6Q A;  1PP9 J;  4I7Z B;  3MD0 A;  3BAS A;  3V5B A;  2WSE H;  1N7S B;  2ZXE B;  1LTB C;  1BE3 D;  1JCD A;  2E76 B;  1AA0 A;  4EI2 A;  2W8Z A;  2K88 A;  3P8C E;  5AVS B;  3S1K A;  1JY3 O;  4IL6 X;  4GOE A;  2HFE D;  3LIE A;  4WB4 A;  1SQP K;  2ZYD A;  2YMK A;  1AVO A;  1SS1 A;  5DJT B;  3B5N A;  3I5C A;  3MZW B;  1OVV A;  2HLO A;  3IAO A;  3L75 J;  1QL1 A;  3L70 D;  2BCC D;  5AVX B;  1L0L G;  1KFN A;  2P67 A;  3P32 A;  1S72 P;  3H1J G;  5C39 A;  3BVH A;  3VMY A;  1KZU B;  3EFF K;  4JF7 A;  2KP8 A;  1YJ9 P;  1OVR A;  5CCG C;  4UB8 E;  4Z1M H;  1BCC E;  2B88 A;  2Y0E A;  4GDO A;  2IBZ G;  2ZAE B;  2Q3E A;  3CI9 A;  4R4M A;  3JC2 2;  1KB9 E;  1NAF A;  3BCC E;  3C9I A;  1ZV8 A;  1NKZ B;  1SQP G;  1H0T B;  1S5L X;  2P10 A;  3TK1 A;  1OVU A;  1Q2N A;  2XNX A;  1S9K E;  3TSI A;  2QVA A;  2KS1 B;  1EZV G;  4XA4 A;  1FOS E;  3GF7 A;  3FXD A;  4C7N B;  1NH4 A;  1ZRT E;  3VTP C;  3E7K A;  1ZR2 A;  1JY2 P;  4OWF A;  5APT A;  3EFG A;  4D6T E;  1NVO A;  3V6I A;  4U3F D;  1N7S D;  1T3J A;  1QVF O;  3CCE P;  1VQ7 P;  1OZH A;  3D71 A;  2ZXX A;  1NYH A;  1KIL E;  2FBW C;  2ZJS E;  1HTL C;  1LWU A;  4MN4 C;  2WPQ A;  1S3J A;  1LTJ B;  4DJG A;  4H13 B;  1L0N K;  2FKW B;  2IPP A;  1J1D B;  3L71 J;  1OX3 A;  4R4L A;  1SP4 A;  4Y99 C;  4LLH A;  1YQ3 C;  2A45 H;  1P84 E;  1RF0 A;  1ZW0 A;  1PL5 A;  1VQM P;  4C46 A;  2OTJ P;  4HJG H;  3HRN A;  3MUD C;  2Q1K A;  1L4A B;  1SQV E;  2OAR A;  1LTG C;  4GKG A;  2KUB A;  1KQF B;  1JMB A;  3JCU E;  2N1T B;  1NTM K;  1JM0 A;  4CPG A;  3CX5 E;  2VRS A;  2OYH A;  2O1K A;  2HOD B;  4OGQ B;  1KQG B;  2Z5H A;  4JPZ B;  4TT3 H;  3V2P A;  1JY2 O;  4ZKP A;  1NU1 D;  4I7Z C;  4NPE A;  3ZDM A;  2O01 H;  3HE5 A;  1NTK E;  1N7S C;  3T97 B;  2QJP B;  2W27 A;  2PP6 A;  4IOI H;  2E76 C;  1L0N G;  5AVR B;  3NXS A;  5CJ4 A;  1RHZ B;  1H89 A;  3WUT A;  3NFQ A;  3H1L E;  1NTZ J;  2N9B A;  2ITA A;  3L73 G;  2KIK A;  2FYU K;  1LGH B;  1HJ0 A;  1M90 Q;  1BE3 E;  1YIT P;  1NTM G;  3M0A A;  3H32 A;  1SQB D;  1VQ5 P;  1U7M A;  1VQL P;  1FZA A;  5APS A;  1M1J A;  2WQY C;  4H13 D;  1M8O B;  2W90 A;  4UB6 H;  3NTN A;  2OYI A;  4NPF X;  3SSU A;  2GUS A;  1EDK A;  2QRX A;  1RQU A;  2O1J A;  4PV1 C;  1HWT C;  1YBK A;  3AE7 C;  3LW5 J;  2B87 B;  2PGD A;  3R4Y A;  1L4A D;  3L70 E;  1GU5 A;  1LTS C;  2CK3 H;  2V7Q J;  1RY3 A;  4ASW A;  1GL2 B;  1IZN B;  2PRR A;  3AE4 C;  1QVG O;  1DEE G;  2R3S A;  1VQ4 P;  3L71 D;  3CCR P;  2PFX A;  3GHG A;  2WIT A;  5AVT B;  4OGQ D;  4JBZ A;  4XE5 B;  3H1H E;  2FYU G;  3FWN A;  2QM8 A;  1QL2 A;  2O01 N;  2B9B A;  1FZC A;  1H8A A;  1FOS F;  3V2R A;  1HGV A;  3HTK B;  4XFJ A;  5CCH D;  2Q7C A;  3HE4 B;  1RE4 C;  1YI2 P;  4EYY Q;  5GTH H;  3GW6 A;  1KB9 D;  2ZT9 B;  2WSC H;  2WPV B;  5AW1 B;  4H13 C;  4JYB A;  1KV4 A;  1J1D C;  1JY3 N;  1N2D C;  1KQL A;  2D2C B;  3CCV P;  2NPS D;  4IFD K;  4U3F E;  1Q7Y Q;  4WY4 B;  1GK6 A;  2B89 A;  3Q5P A;  1L4A C;  2BAS A;  1L0L J;  3G4S P;  2HG5 D;  2R5D A;  1JTH A;  2WSS H;  1RE3 C;  3H1J J;  2QG4 A;  3FGA D;  5H2F H;  1PGP A;  2N1T C;  4U7J A;  4B86 A;  3RK2 B;  1SQX D;  1SQV K;  2R32 A;  1KB9 I;  4OGQ C;  4ZKU A;  4TLF A;  2V4H A;  3KQG A;  3RK3 B;  3E1R A;  1GZL A;  2E74 C;  3BAT A;  1GK4 A;  5KJ7 A;  1LT9 B;  2I8D A;  3H1K G;  4D6T G;  3VYI A;  3L74 G;  2KB7 P;  3ITK A;  1IFM A;  3L72 G;  1SQP J;  3GF3 A;  4EOT A;  5CCH C;  2FFD C;  2H7H A;  3G71 P;  2OGU A;  1HVV A;  2L91 A;  3VOP A;  1IFI A;  1NTK K;  4RJT A;  1BGY G;  2ZVN B;  3L75 E;  3N4X A;  4W7Y A;  3CC7 P;  2GM4 A;  2RKL A;  3CLQ A;  1HF9 A;  2POH A;  4YXD C;  2JDI H;  2IZ0 A;  4JQ0 D;  3WUV A;  1P84 I;  1KIL A;  4JYC A;  2IFN A;  4DCK A;  2HPC A;  1CI6 A;  3TGU G;  2ZT9 D;  2R5B A;  4O9B A;  3VMA A;  4UB6 E;  1PZQ A;  4K3A A;  2D2C D;  1G1J A;  1W2E A;  4OVN F;  4BRY A;  1RF1 A;  4PJ0 H;  1BSH A;  3CX5 I;  2YKO A;  5CCG D;  3AE2 C;  4WY4 D;  1YHQ P;  3G9R A;  3F89 A;  1QLE D;  1HH0 A;  5APV A;  4ZMD A;  5APX A;  4RO0 A;  1GL2 C;  4N3Y B;  1SQQ K;  2KZJ A;  1NTK G;  4L74 A;  2I1K A;  1SQB E;  4N78 D;  2BEZ F;  3QH9 A;  1DEB A;  5APW A;  1WT6 A;  2IDB A;  3Q2Y A;  3TNU A;  2K1A A;  3RK3 D;  3AEG C;  5L8R J;  1L0L D;  2J58 A;  1JY2 N;  1IFP A;  1OWA A;  1T3U A;  3H1J D;  3HE5 B;  1L0N J;  3B8E B;  4GOD A;  2I1J A;  3VMZ A;  1BE3 G;  4H0L B;  2YXQ B;  1N73 B;  1QX8 A;  3L71 E;  1IJD B;  4EDF A;  2ZT9 C;  3GMA A;  5GTH E;  3VP9 A;  4DZO A;  3CL3 D;  1NOH A;  2IBZ D;  2D2C C;  3L73 J;  2LR2 A;  2MJZ A;  4PV1 B;  1SQQ G;  1KC8 Q;  4HH2 A;  3H1H D;  4WY4 C;  1NTM J;  1GU4 A;  1SQP D;  5AW0 B;  4DOJ A;  2IFM A;  1ZME C;  1NO4 A;  2H8P D;  1ZOY C;  2WPS A;  2BCC G;  2L5G B;  3A3Y B;  3AEF C;  1EZV D;  3H32 B;  3H1I D;  1FS0 E;  2KYV A;  5H2F E;  1HUC A;  3RK2 C;  1FDM A;  1K8A Q;  2KNC A;  1BSN A;  1RQV A;  3CCM P;  3OW2 O;  1J1E B;  1AFO A;  3W68 A;  3RK3 C;  3OJA B;  3E1I A;  4YTP C;  3TF5 A;  1LT9 C;  3M0D C;  5KLV K;  1CSB A;  2AXC A;  2M3E A;  3AE3 C;  4L75 A;  2WZ7 A;  2E76 D;  2M3B A;  3II6 A;  1SQX E;  4I2L C;  5BU5 A;  5CHX A;  2M5A B;  3V4Q A;  3AEE C;  1NKN A;  1NTZ E;  3GHG B;  1JO5 A;  2FYU J;  5B66 H;  2ZYA A;  2CPS A;  2R44 A;  3RBZ A;  4C7R A;  2JR8 A;  1VQK P;  2QSI A;  1OW7 A;  1PP9 D;  1T8Z A;  2M0B A;  1IFD A;  1EXJ A;  2OYO A;  1MKM A;  1M56 D;  1FZC B;  4U3F G;  1VQO P;  1IFJ A;  2A06 E;  4RES B;  3BRV B;  4H0L D;  1NU1 K;  2A45 I;  2Q6Q A;  2XDJ A;  4M3L A;  2LKM A;  1VQP P;  1SFC B;  2PAJ A;  1PPJ G;  1PGO A;  1MV8 A;  5B5E H;  3HD7 B;  5AVY B;  2H89 C;  1M1K Q;  3PH0 A;  2E75 B;  5E79 H;  1EXI A;  5KLV G;  1IC2 A;  1T2K D;  1N7S A;  4YXW H;  4PV1 D;  1RF0 C;  3B71 A;  1LP1 B;  4PJ0 E;  2SPZ A;  2J5U A;  2KK7 A;  1YJW P;  3L75 D;  1L0N D;  2E74 B;  3KXD A;  1K9M Q;  3H6P A;  3IFM A;  5GTI H;  1TU3 F;  1Q86 Q;  1URQ B;  1OIP A;  1Y47 A;  3CD6 P;  3M91 A;  2RN0 A;  2H88 C;  2FFD B;  1R5S A;  3L4F A;  1X0T A;  3IR9 A;  2K9J B;  1SQB K;  3L73 D;  3M9H A;  2K37 A;  3R2P A;  3AED C;  5APY A;  1Q90 D;  4PD4 D;  1NTM D;  1FDO A;  2QA4 P;  3H1K J;  3UIA A;  4KJM A;  1YQ4 C;  4D6T J;  1NU1 G;  3L74 J;  3L72 J;  3OAK A;  4N78 E;  4H0L C;  3CWB G;  1N73 C;  1G2C B;  1BGY J;  5DJU B;  1DX7 A;  3KPE A;  4H44 C;  4ASV A;  4ZNC A;  1W5C E;  3RL0 B;  3RK3 E;  2ZFC A;  4PD4 H;  4IFF A;  2YNY A;  2C9L Y;  1WRG A;  1X9V A;  1T2K C;  1L0L E;  2YO3 A;  4WWI A;  3V2Q A;  3VMX A;  1GW3 A;  3H1J E;  1OW8 A;  2KSJ A;  1H0T A;  3C8V A;  3TGU J;  4QMA A;  1AV1 A;  5AW6 B;  1SFC D;  1KMI Z;  1FDI A;  4C7N A;  2FYU D;  1EDI A;  2HYN A;  2N1T D;  1M1J C;  3HD7 D;  3CCS P;  2IBZ E;  5AVV B;  1KYO D;  3WU2 H;  1D7M A;  1J1E C;  3MP7 B;  1G1I A;  1SVF A;  3NMD A;  2H43 A;  2E74 D;  3AE9 C;  1SQP E;  2JEE A;  4W7Z A;  3O6Q B;  2XZR A;  1URQ D;  4K35 A;  1NTK J;  1AQ5 A;  2WSE J;  4AUW A;  1LTJ A;  5AVQ B;  1EZV E;  2LXC B;  3HUS A;  3H1I E;  4HYT B;  3M06 A;  2C9N Y;  1CW5 A;  1ZLL A;  1Y8A A;  1KYO H;  3GHG C;  1LTT C;  3S9O A;  5B66 E;  3FWL A;  2KXP B;  1L4A A;  1SQX K;  2OQQ A;  2JWD A;  2NRG A;  1VQ8 P;  2N9Y B;  2XKM A;  1RE3 A;  2Q5U A;  3C1L A;  3SWF A;  1E5W A;  3B5N B;  1FZC C;  1BE3 J;  1IK9 A;  4WVZ A;  1BCC G;  2HOD A;  2WT7 A;  1SFC C;  2JJL A;  2XU6 A;  3BCC G;  3RL0 D;  3HD7 C;  3GG2 A;  2YIU C;  5B5E E;  3EQ2 A;  1Y9B A;  2E75 C;  1PIX A;  2K3R A;  2G3A A;  1PP9 E;  1NTZ D;  5E79 E;  5AW9 B;  1SQQ J;  1PGQ A;  1MFT A;  3MGN A;  3L74 D;  3T97 A;  2Y9Y A;  3L72 D;  5CCH A;  3Q5S A;  5CJ0 A;  3B4S A;  2BCC J;  2YO2 A;  1BDD A;  1URQ C;  1R8E A;  5GTI E;  1GL2 D;  2AEM A;  3A2A A;  1LT1 A;  3QWO C;  2J59 M;  4GOF A;  2Z4E A;  2XV5 A;  1BGY D;  1W2B O;  2A06 D;  1LNQ A;  2P58 A;  1SQX G;  2NPS A;  1N8R Q;  5BU8 B;  1IK7 A;  1ZXG A;  2KZI A;  2WPR A;  2WTY A;  1AQT A;  1VL2 A;  2Q3I A;  3WMM 0;  2P2U A;  1L0N E;  2YMY A;  4BXL A;  4Y28 J;  3TGU D;  2FY8 A;  3U59 A;  5TIS H;  1A02 F;  3CXH H;  2CPB A;  3Q3D A;  1SQV G;  1FZF A;  2O3J A;  1YTZ I;  1FC2 C;  2B87 A;  2Y0D A;  3L73 E;  1Z56 A;  3LID A;  4I1L A;  1LWU B;  3RL0 C;  3LW5 H;  3I55 P;  3AE1 C;  1PFI A;  4PD4 E;  1NTM E;  1YTZ T;  3JSV C;  2V7Q H;  2QEX P;  4U3F J;  1GDT A;  3B5N D;  1N7L A;  3CCU P;  1EQ7 A;  3KZI H;  2IX7 C;  3WUU A;  1K73 Q;  1S4X A;  3RK2 D;  2P7J A;  5KLV J;  2DW3 A;  3SFE C;  3L35 A;  2YKQ A;  2OYH B;  1UII A;  1FJP A;  3WU2 E;  3VN0 A;  1ZP0 C;  3HTK A;  1RF1 C;  3HE4 A;  3L37 A;  3H1L G;  2AEJ A;  3IF4 A;  3CPW O;  2LXB A;  3P7K A;  3Q1M A;  2O01 J;  5TJH A;  5AW4 B;  2QM7 A;  2RH0 A;  1FAV A;  1E79 H;  3L36 A;  5APQ A;  2FYU E;  1JNM A;  3PHL A;  1FU1 A;  3I56 P;  3FX0 A;  1KYO E;  2GA1 A;  3A0H H;  5AVU B;  1NGM B;  2E5T A;  1SQQ D;  5CCG A;  1CZQ A;  1FBM A;  4WY4 A;  4H44 B;  1UIX A;  1NU1 J;  1MUU A;  1J2J B;  1DIP A;  4L76 A;  1KTM A;  2QJY B;  3B5N C;  3AE6 C;  1HBW A;  3CCQ P;  1NHL A;  3CWB J;  3G3Z A;  4RKU J;  3L70 G;  5AW3 B;  2JO1 A;  1ZR4 A;  3PLN A;  3KYQ A;  3A7O A;  1OFC X;  1M1J B;  1LT9 A;  3M0D A;  1DD3 A;  2MKV A;  1EC5 A;  3D6Y A;  2OTK E;  2OYI B;  1VPC A;  1VF5 B;  1K04 A;  1USD A;  3RL0 g;  3M9B A;  2IBZ I;  1GW4 A;  1LTI C;  3H1H G;  2KOG A;  1DD4 A;  5KAI H;  1BDC A;  5AW2 B;  2KI7 B;  3SWY A;  3P8M C;  1JOC A;  1SQB J;  4I6M C;  3ABV C;  2QJK C;  1YJN P;  1U57 A;  5KKZ B;  4WBA A;  3H1I G;  2KSE A;  4LGD E;  1MFZ A;  3GLM A;  3H1K E;  1EZV I;  2IYO A;  3L74 E;  1U7J A;  3MUD A;  3L72 E;  1LTA C;  1GTW A;  3A0B H;  1X8Y A;  2JP3 A;  3FXE A;  1VQN P;  2A45 G;  1PPJ D;  5TIS E;  5KAF H;  3CXH E;  1BGY E;  2OTL P;  3HUS B;  2BEQ D;  5KLV D;  4HB1 A;  2Q9I A;  4GIF A;  2WSC J;  3H25 A;  1LWU C;  2IYP A;  4H44 D;  2YIU B;  1JEK A;  1NAY A;  1OXZ A;  5CMZ A;  2AXT H;  1PP9 G;  3TGU E;  2AEF A;  1BCC J;  2FYZ A;  4LC1 A;  1L2P A;  5KLI B;  3U1C A;  5AVZ B;  1JUN A;  2YXR B;  3RBX A;  3KZI E;  2WT7 B;  3BCC J;  1JTH B;  3D6Z A;  1USE A;  3MHV A;  2W83 C;  3PRJ A;  1M7L A;  2QIW A;  3D70 A;  3V4W A;  4IL6 H;  2OYH C;  3KDP B;  1FJK A;  1N86 A;  1VF5 D;  1N73 A;  3CWB D;  1VQ9 P;  2WVR A;  3L75 G;  5AW5 B;  1QGK B;  3AEB C;  2WSF J;  3RGU A;  1PV3 A;  1JMM A;  5AW8 B;  3CC4 P;  2WMM A;  1JB0 J;  1SQX J;  3V2N A;  3AE8 C;  1VQ6 P;  4BWN A;  2NPS B;  3A0H E;  3MIW A;  3CC2 P;  1M57 D;  2HR3 A;  3USS A;  1AVY A;  3IN6 A;  3KHU A;  3CME P;  1K05 A;  2QJY C;  1DH3 A;  3AEC C;  5APU A;  1S1C X;  4PD4 I;  4KHX A;  1SQV J;  3PTZ A;  1GMJ A;  3AE5 C;  3P8C D;  2FYN B;  4GT1 A;  1KD1 Q;  2UWJ E;  1KIL B;  2KS1 A;  3TYY A;  2HPC B;  2FXP A;  1CI6 B;  1SQQ E;  1SQB G;  2R3C A;  1S5L H;  3G6E P;  2E75 D;  2C0X A;  2E43 A;  2OYI C;  2BCC E;  5KTB A;  1VF5 C;  5BVZ A;  4BRY B;  4IFM A;  1RF1 B;  2M5A A;  1RE4 A;  1VDF A;  5KAI E;  4AYC A;  1H88 A;  1LJ2 A;  4YPC A;  1KQS O;  4A7P A;  1OMI A;  5KKZ C;  2Z5I A;  1GD2 E;  3AEA C;  2K9Y A;  3L71 G;  1A02 J;  5K5G B;  1RH5 B;  3H1L J;  1BCC D;  3TNU B;  3OA7 A;  1HJB A;  1KYO I;  3A0B E;  5KJ7 D;  1NTZ K;  1SFC A;  2IZ1 A;  2YKP A;  3PP5 A;  3S4R A;  3BCC D;  3F5H A;  2N1T A;  1Q82 Q;  3HD7 A;  1LTJ C;  2JWA A;  5KAF E;  2KLV A;  3MTU E;  3HUS C;  5AW7 B;  1FZE A;  4HKZ H;  1S9K D;  1LP1 A;  2E42 A;  3CCL P;  4UB8 H;  3CCJ P;  1ZRT D;  1KOR A;  1IFN A;  1X79 B;  2C0W A;  1URQ A;  2W6A A;  3H1K D;  1KFM A;  3Q5R A;  4D6T D;  2AXT E;  1KB9 H;  2G8Y A;  1PPJ E;  4KT0 J;  1KN7 A;  1EDJ A;  1XTC C;  5KLI C;  1R5L A;  1NWQ A;  2FFD A;  3L70 J;  4OH8 B;  2FXO A;  2QE7 H; 
#chains in the Genus database with same CATH homology
 5AVW B;  3P7K A;  2GUS A;  1KIL D;  1T8Z A;  1IFD A;  3BRT B;  5AW4 B;  2O1J A;  2QM7 A;  1HWT C;  1FAV A;  2OYI A;  1FZC B;  5APQ A;  3L36 A;  1IFJ A;  2WWW A;  1JNM A;  4RES B;  3BRV B;  1L4A D;  1NU1 K;  2A45 I;  1FU1 A;  3N7N A;  1GU5 A;  1LTS C;  2XDJ A;  4M3L A;  1RY3 A;  2LKM A;  1GL2 B;  5AVU B;  2WSF H;  1SFC B;  2M8R A;  5CCG A;  2PAJ A;  1CZQ A;  1FBM A;  1HGZ A;  4WY4 A;  1SLQ A;  1MV8 A;  3HD7 B;  5AVY B;  1MUU A;  1G2C A;  5KJ7 C;  1J2J B;  3GHG A;  2WIT A;  1IC2 A;  1ZN5 A;  5AVT B;  1T2K D;  4AQR D;  1N7S A;  3B5N C;  1RF0 C;  1HBW A;  1NHL A;  1FZG A;  4XE5 B;  3G3Z A;  1JY3 P;  3H6P A;  3IFM A;  5AW3 B;  2QM8 A;  1URQ B;  1ZR4 A;  4Y99 B;  1QL2 A;  3U1A A;  3M91 A;  2NPS C;  1FZC A;  3KYQ A;  4EIJ A;  1IO4 A;  3A7O A;  1H8A A;  1FOS F;  3V2R A;  1HGV A;  1XTG B;  1M1J B;  3HTK B;  1LT9 A;  3M0D A;  5CCH D;  2Q7C A;  2FFD B;  3HE4 B;  1GL2 A;  3L4F A;  1RE4 C;  3VP8 A;  2OYI B;  1VPC A;  3IR9 A;  3M9H A;  1SQB K;  2WSC H;  3M9Q A;  5AW1 B;  3R2P A;  5APY A;  2FXM A;  3M9B A;  2P1J A;  1GW4 A;  1LTI C;  4JYB A;  2KOG A;  1J1D C;  3UIA A;  1JY3 N;  1MZ9 A;  1N2D C;  3O8Z A;  1L0L K;  5AW2 B;  1KQL A;  1KIL C;  3SWY A;  3P8M C;  1JCC A;  1JOC A;  2NPS D;  4I6M C;  4N6J A;  4IFD K;  1YYC A;  2GUV A;  3OAK A;  2W6B A;  4WY4 B;  4N78 E;  4WBA A;  1FZB A;  1GK6 A;  3A5T A;  4W80 A;  1N73 C;  1L4A C;  2BAS A;  4LGD E;  1MFZ A;  2HG5 D;  3MD0 A;  2R5D A;  3BAS A;  1JTH A;  1G2C B;  3V5B A;  1RE3 C;  2WSE H;  1DX7 A;  1N7S B;  2ZXE B;  3KPE A;  1LTB C;  3MUD A;  3RL0 B;  2N1T C;  1LTA C;  1GTW A;  2ZFC A;  4B86 A;  1JCD A;  4IFF A;  3RK2 B;  2YNY A;  1SQV K;  2R32 A;  1X8Y A;  3P8C E;  2C9L Y;  1WRG A;  1X9V A;  1T2K C;  4ZKU A;  2A45 G;  5AVS B;  2YO3 A;  3KQG A;  3V2Q A;  1JY3 O;  3VMX A;  3RK3 B;  1GW3 A;  2HFE D;  3LIE A;  1GZL A;  4WB4 A;  1SQP K;  2KSJ A;  3HUS B;  3BAT A;  1GK4 A;  5KJ7 A;  1LT9 B;  5AW6 B;  2Q9I A;  3B5N A;  4GIF A;  3I5C A;  1SFC D;  3VYI A;  2HLO A;  1LWU C;  2KB7 P;  4C7N A;  1IFM A;  2HYN A;  2N1T D;  4EOT A;  1M1J C;  1QL1 A;  3HD7 D;  5CCH C;  2FFD C;  2H7H A;  1OXZ A;  5CMZ A;  1HVV A;  5AVV B;  5AVX B;  3VOP A;  1IFI A;  1J1E C;  1NTK K;  1KFN A;  1G1I A;  2FYZ A;  4LC1 A;  1SVF A;  2P67 A;  3P32 A;  3BVH A;  3NMD A;  2H43 A;  3U1C A;  3VMY A;  1KZU B;  2JEE A;  4W7Z A;  3N4X A;  5AVZ B;  1JUN A;  4W7Y A;  2XZR A;  1URQ D;  4JF7 A;  2KP8 A;  2WT7 B;  1AQ5 A;  2GM4 A;  4AUW A;  1LTJ A;  1JTH B;  3CLQ A;  5AVQ B;  2POH A;  5CCG C;  3HUS A;  4HYT B;  1M7L A;  3M06 A;  2C9N Y;  1CW5 A;  1ZLL A;  1KIL A;  3V4W A;  4JYC A;  2IFN A;  2HPC A;  2OYH C;  1CI6 A;  3KDP B;  3CI9 A;  1FJK A;  3GHG C;  1LTT C;  1NAF A;  1N86 A;  2R5B A;  1N73 A;  1L4A A;  4O9B A;  3C9I A;  1ZV8 A;  1NKZ B;  1SQX K;  5AW5 B;  2XKM A;  3TK1 A;  1G1J A;  1RE3 A;  1W2E A;  2Q5U A;  2XNX A;  1S9K E;  3SWF A;  1E5W A;  3TSI A;  3B5N B;  1JMM A;  5AW8 B;  1RF1 A;  1FZC C;  4XA4 A;  1FOS E;  2YKO A;  5CCG D;  4WY4 D;  1IK9 A;  1NH4 A;  3V2N A;  4C7N B;  1HH0 A;  5APV A;  3VTP C;  2HOD A;  2WT7 A;  5APX A;  1ZR2 A;  1JY2 P;  1GL2 C;  5APT A;  1SFC C;  3EFG A;  2NPS B;  4N3Y B;  1SQQ K;  2JJL A;  2XU6 A;  2I1K A;  1N7S D;  1T3J A;  4N78 D;  3MIW A;  3RL0 D;  3HD7 C;  3EQ2 A;  1DEB A;  5APW A;  1WT6 A;  5AW9 B;  3MGN A;  1DH3 A;  1HTL C;  1LWU A;  2WPQ A;  3T97 A;  3TNU A;  5APU A;  1LTJ B;  3RK3 D;  5CCH A;  4KHX A;  1L0N K;  2FKW B;  2IPP A;  1J1D B;  5CJ0 A;  3P8C D;  2YO2 A;  4GT1 A;  1URQ C;  1SP4 A;  4Y99 C;  4LLH A;  2A45 H;  1KIL B;  1GL2 D;  2J58 A;  1JY2 N;  1RF0 A;  3TYY A;  3A2A A;  2HPC B;  1CI6 B;  1OWA A;  2J59 M;  2Z4E A;  2R3C A;  2XV5 A;  4C46 A;  1T3U A;  3HE5 B;  3B8E B;  3HRN A;  2I1J A;  3VMZ A;  1N73 B;  1L4A B;  2OAR A;  1LTG C;  2C0X A;  2NPS A;  4GKG A;  2E43 A;  2OYI C;  5BU8 B;  5KTB A;  2WPR A;  2WTY A;  1IJD B;  5BVZ A;  3VP9 A;  2Q3I A;  3WMM 0;  4IFM A;  1RF1 B;  4DZO A;  2N1T B;  1NTM K;  3CL3 D;  1NOH A;  2P2U A;  1RE4 A;  1VDF A;  4AYC A;  1H88 A;  2VRS A;  2OYH A;  2O1K A;  2YMY A;  2HOD B;  3U59 A;  2MJZ A;  2Z5H A;  1A02 F;  4HH2 A;  2CPB A;  4WY4 C;  3V2P A;  1GU4 A;  5AW0 B;  1JY2 O;  2Z5I A;  4ZKP A;  1GD2 E;  4DOJ A;  1FZF A;  2IFM A;  1NO4 A;  2H8P D;  2WPS A;  1A02 J;  2O01 H;  2L5G B;  1YTZ I;  3A3Y B;  3HE5 A;  1N7S C;  1Z56 A;  3LID A;  4I1L A;  3H32 B;  1LWU B;  3RL0 C;  3LW5 H;  2KYV A;  2W27 A;  3TNU B;  2PP6 A;  1HUC A;  3RK2 C;  3OA7 A;  1HJB A;  1FDM A;  1PFI A;  1YTZ T;  5KJ7 D;  1NTZ K;  1SFC A;  2YKP A;  5AVR B;  3NXS A;  1J1E B;  1AFO A;  1GDT A;  3PP5 A;  3B5N D;  5CJ4 A;  2N1T A;  3RK3 C;  3HD7 A;  1LTJ C;  3OJA B;  1H89 A;  3E1I A;  2KLV A;  3MTU E;  1N7L A;  3HUS C;  3NFQ A;  1EQ7 A;  1LT9 C;  5AW7 B;  3M0D C;  1FZE A;  5KLV K;  2IX7 C;  2N9B A;  1CSB A;  1S9K D;  2E42 A;  2FYU K;  1LGH B;  2WZ7 A;  3RK2 D;  2P7J A;  1IFN A;  1X79 B;  2M3B A;  3II6 A;  2C0W A;  4I2L C;  1URQ A;  5BU5 A;  2W6A A;  5CHX A;  1KFM A;  3V4Q A;  3M0A A;  3L35 A;  2YKQ A;  2OYH B;  1NKN A;  3H32 A;  1FJP A;  3GHG B;  3VN0 A;  1JO5 A;  1FZA A;  5APS A;  1M1J A;  1XTC C;  2CPS A;  3HTK A;  1RF1 C;  1NWQ A;  2FFD A;  3HE4 A;  4OH8 B;  3L37 A;  4C7R A;  3NTN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...