3UIAA

Structural determinants of trimerization specificity in hiv-1 gp41 protein
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
53
structure length
53
Chain Sequence
b'QARQLLSGIVQQQNNLLRAIEAQQHLLQLTVWGLKQIQARILAVERYLKDQQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glycoprotein 41
publication title Structural Determinants of Trimerization Specificity in HIV-1 gp41 Protein
rcsb
source organism Human immunodeficiency virus type 1
molecule tags Viral protein
total genus 24
structure length 53
sequence length 53
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2011-11-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3uiaA00
5CMZA 5AVYB 3SWFA 2QM7A 1YYCA 2XZRA 4JYCA 5AW9B 4C7NA 1MUUA 5AW0B 3V4QA 2KP8A 4C46A 3HE5A 1GTWA 3L37A 1H88A 1CZQA 3HTKA 4GKGA 3MGNA 1HWTC 2W27A 3VTPC 5AW4B 5AVXB 1HJBA 5AVWB 2WTYA 1X8YA 3LIDA 3L36A 3LIEA 2P67A 3KDPB 3M0DA 1OXZA 3UIAA 4AQRD 5APQA 4AYCA 1GD2E 1CI6B 4LC1A 3VN0A 3B8EB 1OWAA 3VMYA 2JJLA 2E43A 1SP4A 3O8ZA 5APTA 5APVA 5APUA 5AVQB 3TNUB 1G2CB 3TYYA 1H89A 1MV8A 2N9BA 3OAKA 1IO4A 2Z5HA 5AW1B 1FAVA 3A5TA 4EOTA 2P2UA 1FOSE 2R5DA 2E42A 2H7HA 2YO2A 3A7OA 1HUCA 2C9NY 2Z5IA 2R32A 2P7JA 4B86A 1GU5A 1HBWA 1A02J 2WT7A 2WPRA 2VRSA 4C7NB 5AVRB 5AW5B 1T2KC 2WWWA 4XE5B 5AW2B 1GK4A 2R5BA 3I5CA 3HE5B 4HYTB 1KQLA 3A3YB 5AW8B 2C9LY 1H8AA 1S9KE 1MFZA 1GZLA 4AUWA 3V4WA 3NTNA 2WPQA 1DH3A 3NFQA 5AVZB 3IR9A 3M06A 3NXSA 1JNMA 3T97A 1JUNA 3KQGA 2Q5UA 5AW3B 4DZOA 5AVUB 4GT1A 3M0AA 2XV5A 3A2AA 2W6AA 3M9HA 3P32A 5AW6B 2WPSA 2ZXEB 1CSBA 1J2JB 3VYIA 5APXA 3HE4A 1SLQA 3L35A 5APYA 2BASA 2QM8A 2ZFCA 2XU6A 4M3LA 3M91A 2YO3A 5AVVB 5APSA 2R3CA 2IPPA 2Q3IA 3M9BA 4KHXA 5AVSB 4JYBA 3MD0A 4I6MC 2WT7B 5AVTB 1A02F 5APWA 1CI6A 3HE4B 1NWQA 4RESB 3V5BA 5AW7B 4I2LC 2Q7CA 3VMZA 1S9KD 1GU4A 2YNYA 3VMXA 3TNUA 1NAFA 3NMDA 1FOSF 3P7KA 3TK1A 1GK6A 1T2KD 3P8MC
chains in the Genus database with same CATH superfamily
2FBWC 2AEFA 1M90Q 1M8OB 1JY3N 2OYHC 5CJ0A 1VQOP 2OYIC 3HUSA 1FC2C 1FZFA 1VQLP 1EDIA 2B9BA 2KS1A 1PP9D 3PRJA 1RE4A 3KDPB 1AVYA 1WMKA 1JCCA 5KTBA 1IO4A 1MV8A 1RQVA 3H1IJ 1VQ6P 4EOTA 1SQVD 2AXCA 2FYZA 4KJMA 4MN4C 1GU5A 1HF9A 3GMAA 4DT0A 3VP8A 1LTGC 1W2BO 2WSFJ 2M5AB 3AECC 2QJYC 3AEGC 2IBZD 4ZNCA 3IR9A 3NXSA 2E5YA 3HD7B 5AVUB 3D6YA 3P8CE 1KFNA 3P32A 2O1KA 2FFDA 1JY2O 3HE4A 4LLHA 3AE2C 2JEEA 1W2EA 2E74C 4N78E 3F5HA 1GDTA 1L4AC 4H44D 3L73D 2YNYA 1URQA 1G2CA 3VP9A 5E79H 1VDFA 2KI7B 1YYCA 1RF1A 2KSEA 1T8ZA 3AEDC 5GTHE 3Q1MA 3CCJP 3RK3E 1S4XA 1SQBD 3V4QA 2XDJA 2FXMA 3BCCJ 5C39A 3MGNA 1GW4A 5CCGD 3L75D 3TF5A 1R5SA 3M9QA 3BCCE 4UB8E 3UIAA 2J58A 3A0BH 2ZXXA 2ZVNB 3CWBE 2IX7C 1IK7A 1OWAA 1PPJD 5K5GB 3FX0A 2OYHA 1HVVA 2E76C 2E42A 3JCUE 2LR2A 1LWUC 1EZVD 4WY4D 1IFIA 2ZAEB 3Q5SA 4W7ZA 2XNXA 2YIUB 1H8AA 1AQTA 3V4WA 3NTNA 5BU5A 3SSUA 4EIJA 2HLOA 1EXIA 2O01J 2Z4EA 4GT1A 4TLFA 3AE3C 1IC2A 3CL3D 3E1RA 3EFFK 1WT6A 2YO3A 1ZLLA 1ZRTE 5KLVD 3Q5RA 1OFCX 1H0TB 1CI6A 2KLVA 1OVVA 3H32B 2O1JA 5H2FH 1DEEG 1FOSF 3PHLA 1NU1D 1T2KD 4IFMA 2IYPA 1SQQJ 1LT1A 1ZP0C 3E1IA 1GTWA 1UIXA 4IL6E 4GKGA 3VTPC 3TGUG 2KIKA 3JSVC 2W6BA 1FZCB 2A45I 1M1JC 1XTCC 1KILE 4CPGA 5APQA 4JPZB 2Q9IA 4R4MA 2D2CB 3VMYA 5GTHH 1JY3P 1N7SD 1FAVA 2BCCG 1QL2A 2W83C 2C9NY 3CCRP 1RE3C 1NTZK 4DJGA 1YJ9P 3H6PA 4EYYQ 1NTZG 2OTKE 3H1KD 3RL0B 1FDOA 5B66H 1JNMA 3T97A 1JUNA 4BWNA 3B5NB 3IAOA 3M9HA 1YHQP 1L0NK 2KLUA 1G1JA 4N3YB 1YJWP 4O9BA 3FXDA 5KKZC 2OYOA 1NTMJ 3M9BA 4KHXA 3II6A 2N9YB 3HE4B 3L70D 1BDDA 1ZV8A 1KD1Q 2K9JB 1WRGA 2J59M 1IFPA 5AW9B 1KFMA 1L0LK 5L8RJ 1H88A 3PH0A 2ZYDA 4PD4E 2PP6A 4H44C 2HODB 3H1LG 4OGQB 1KILB 2YKOA 4C7RA 1DEBA 3AE8C 5APTA 1SS1A 3H1JJ 2P2UA 5CCGC 4IL6H 3CCUP 1HBWA 3FGAD 4C7NB 2FY8A 3TGUE 5AW5B 2OYHB 2OYIB 1BGYG 2QVAA 1PP9G 1FDMA 1K8AQ 2KUBA 2WPQA 4H0LB 2BCCJ 2NPSB 2Q5UA 1SQVK 4R4LA 5KAFH 4WY4C 1SQVG 1RH5B 1N86A 2AEMA 2BCCE 3G6EP 5APXA 1U7JA 3O6QB 3W68A 2IDBA 2QJPB 1FDIA 1SQPD 2I1KA 1NTZE 1BCCJ 4ZMDA 2IBZG 5APWA 3V5BA 5CCHD 1LP1B 2HFED 2FYNB 3TNUA 2HPCB 3NMDA 1L0NJ 1GK6A 2QJYB 5AVYB 2OGUA 4H13D 1NOHA 3HUSC 1PGJA 1YI2P 3PJSK 1S72P 1ZR4A 4YXDC 1HJBA 4ASVA 4EDFA 3G71P 3AE4C 3N7NA 3L73G 2E74B 3L71J 5CBNA 2CPSA 1L4AB 3VN0A 1SQBK 1YTZI 3CXHD 1SQBG 1L0LJ 3A5TA 1VQ7P 2R5DA 2YO2A 3H1HJ 3A7OA 2V4HA 3HRNA 2CK3H 2N1TB 3L75G 2Q6QA 1L0LE 3R2PA 4AUWA 4DOJA 3HTKB 2H89C 4NPEA 4IOIH 3H1LE 3CXHI 4WBAA 5AVZB 1KB9I 1XTGB 3KQGA 4IFDK 1FZEA 1N7SC 1PPJG 2YKQA 2XKMA 2QSIA 2XV5A 1OW7A 1LTBC 2C0XA 5CCGA 3CI9A 1PP9J 1EZVG 2P1JA 1KV4A 3M91A 1AA0A 2R3CA 1GL2D 5AVSB 1LWUB 1PP9E 1X0TA 1DX7A 1M57D 1S9KD 1SQVJ 5E79E 1X79B 1NAFA 2I1JA 2E75D 4WY4A 3PLNA 4D6TD 3RGUA 1RF1C 1SQVE 3AE5C 3CXHH 2QG4A 4PJ0E 1BE3D 1PL5A 3GLMA 4C46A 5KLVK 1QVGO 1SFCB 2WSCH 2AXTH 5KLVG 1NU1K 2IBZE 3A0BE 1W5CE 2E5TA 4AYCA 2W90A 1NU1G 3MHVA 5CBOA 4YXWH 3RL0g 5AVQB 2N9BA 1D7MA 2B89A 2M8RA 1HUCA 2P7JA 2WSEH 1QL1A 1BGYD 4XE5B 4HYTB 1LT9B 2W6JH 1KQLA 2C9LY 3L73E 2KNCA 1SQBJ 3NFQA 1AQ5A 1M1JB 1VF5B 3HD7D 3L75J 1SQBE 3CD6P 1J1DC 4PV1D 3G9RA 1OVRA 1NTKD 3Q3DA 2QM8A 1LGHB 1T3JA 1N73C 4K3AA 3CX5D 1JCDA 3L75E 1JMMA 2V7QJ 4JYBA 3H1KG 1M56D 5H2FE 3N4XA 1N7SA 4TT3H 3VMXA 4HKZH 1IZNB 1K9MQ 1PPJE 1VQKP 5CMZA 3CX5I 1EZVE 2JWAA 1Y8AA 3B71A 3LW5H 1HGVA 2SPZA 1G1IA 1KYOI 5AVXB 5AVWB 2B87A 3L70G 3LIDA 2QRXA 2P67A 3LIEA 2ZT9B 1S3JA 1R5LA 4H13C 4N6JA 2HG5D 2YXRB 3L74D 4PJ0H 1SVFA 1LTJB 1FOSE 4OWFA 3CWBJ 2BEQD 4OH8B 2KK7A 2WT7A 2P58A 2FYUD 3CX5H 5KLVE 3I5CA 5B66E 1DH3A 1VQNP 1JY2P 1NU1E 1NKZB 1Q2NA 1N7LA 3H1ID 1Z56A 4A7PA 3SWKA 1VQ9P 4I1LA 3S1KA 2KZIA 1CSBA 2QEXP 3IF4A 4IL6X 1ZMEC 3H25A 4EI2A 1GMJA 1FE6A 1HTLC 2IFNA 1J1EC 1PGQA 3AEEC 1RQUA 5AW7B 1ZOYC 1FZAA 2GUSA 3MZWB 1JOCA 3U1AA 1EC5A 4DCKA 1PFIA 1KQGB 3S9OA 1SQPK 4GIFA 1PV3A 1N73A 3KPEA 1GL2C 3HE5A 3BRVB 4WY4B 3PTZA 1SQPG 4BRYB 2Y0EA 4L73A 3CMAP 3H1KE 1AV1A 1QLED 2E75C 1SQXD 2Y0CA 3USSA 3TSIA 1USEA 4UB6H 2QA4P 2D2CD 3RK3B 1NKNA 1PIXA 2Y9ZA 1JTHA 2WSFH 5CCHA 4B86A 3OW2O 1GK4A 3HUSB 1FBMA 3L70E 3WMM0 1IFJA 2IZ0A 3Q2YA 2BEZF 4RJTA 2KS1B 5KAFE 3RK2D 3RL0D 3CC7P 1DD3A 4GODA 2KNCB 3B5ND 2BASA 2M3BA 5DJTB 2RMZA 4LGDE 5AVTB 2MKVA 5KAIH 2FXOA 2A45H 3ABVC 3HD7C 2RN0A 3P7KA 1U57A 2QJKB 4PV1C 3F89A 2QM7A 1OZHA 1Q86Q 3BASA 2K37A 2WITA 4GOEA 2FFDB 2OTLP 3SFDC 2RH0A 3L36A 2KB7P 1SQQD 4D6TG 1GD2E 4NPDA 2J5UA 3I55P 3D6ZA 5KJ7D 2JJLA 1URQB 1S5LE 1G2CB 5CJ4A 3CPWO 1GL2A 3E7KA 5TJHA 1BE3G 1T6AA 1PGPA 1RF1B 1FJPA 1YQ3C 2JKVA 1SQPE 1MKMA 1YTZT 1KTMA 1IFDA 2O01H 2A06D 5B5EH 3V2QA 3TGUJ 4H0LD 2NPSD 1NJIQ 2WMMA 1J2JB 1ZXGA 5KLIC 1JMBA 2YIUC 1NHLA 1PGOA 3U1CA 2Y0DA 1KMIZ 1L2PA 3V6IA 3TK1A 1NTKK 4K35A 3CXHE 1NTZJ 3CC2P 4U3FD 3WU2H 2IFMA 3I56P 2XZRA 1NTKG 3L72D 1NTMD 1IFMA 1RHZB 1BSNA 2AXTE 1Q90D 2JDIH 3HD7A 2Q1KA 2R3SA 2WSEJ 1CI6B 4IFFA 5APUA 1Q81Q 3A0HH 5AW1B 1N8RQ 1X22A 1A02J 4PD4I 4D6TJ 1T2KC 2WWWA 2YMKA 1AJYA 1S9KE 2N1TD 1JY2N 1CW5A 1FZGA 1BE3J 4D6TE 1GW3A 4Y28J 2D2CC 1OIPA 3H1JD 1KB9D 1S5LH 3L74G 3AEFC 2FYUK 1BE3E 3H1LJ 3L35A 1SLQA 5APYA 3G4SP 2IYOA 4L76A 2XU6A 4ZKPA 2FYUG 4M3LA 1UIIA 2WZ7A 4I6MC 1EDKA 3RK2C 2W8ZA 4WWIA 4HJGH 3H1IG 3KZIH 3LW5J 1NAYA 3KXDA 2NRGA 1BGYJ 3B5NC 3EWKA 3GF7A 3T97B 5DJUB 1R8EA 2E76B 4JYCA 4RKUJ 1BGYE 1K05A 1BCCD 1BDCA 2KYVA 2POHA 5AW4B 1S2EA 2WTYA 1SFCD 4WVZA 1X8YA 1L0ND 1FZBA 1NTKJ 2JP3A 2AEJA 2ZYAA 2PFXA 5BVZA 3V2PA 1KB9H 2E43A 1AFOA 4YPCA 3O8ZA 5APVA 1KN7A 1NTKE 2GM4A 2Z5IA 3K5BA 2R32A 3CX5E 2YMYA 1H0TA 3L71D 4JBZA 5AVRB 3IFMA 3S4RA 1SQXK 3A3YB 3OA7A 4I7ZC 5KJ7C 2A45G 1SQXG 1LTTC 3OJAB 3CCQP 2E75B 5AW3B 1NVOA 3H1HD 3M0AA 1HH0A 1QVFO 2G3AA 3L73J 2H88C 3SWYA 1VF5D 3C1LA 4Y99C 4BXLA 1FZCA 3GF3A 3CC4P 3FWLA 1BSHA 3L74J 2CPBA 1AVOA 1IJDB 4H0LC 4I2LC 5BU8B 2NPSC 1N2DC 5GTIE 3EFGA 2FYUJ 3L74E 1VPCA 3D70A 2HR3A 5AW0B 2QJPC 2FYUE 3GHGC 2W27A 4HB1A 1KYOD 1K73Q 1VL2A 5TISH 2FYNC 1JEKA 3B5NA 3H1IE 1EDLA 3R4YA 4XA4A 4LC1A 2ZT9D 3Q5PA 4UB6E 1YIJP 1P84D 3TNUB 2O3JA 4PV1B 5CCHC 1JO5A 1OW8A 4ASWA 5KKZB 1JB0J 1SQQK 4W80A 1Q7YQ 2KSJA 2IBZI 1FS0E 1P84I 1SQQG 3QH9A 2K9JA 2PGDA 1K04A 2OARA 5KLVJ 3AE1C 1NU1J 3C9IA 4ZKUA 1SQXJ 2HODA 2N1TC 5AVVB 3CCEP 5KJ7A 2IPPA 2Q3IA 2L91A 5KAIE 1KYOH 3PP5A 2A06G 3MD0A 3AE6C 1KILA 4H44B 1SQXE 4RESB 1QX8A 1U7MA 1MZ9A 3P8MC 1IK9A 3SWFA 1P84H 3CCLP 3AE9C 3P8CD 1ZN5A 3CCVP 4C7NA 2OYIA 3L37A 1CZQA 2NZ2A 2Y9YA 3VMAA 2NPSA 1RY3A 4N78D 5KLIB 2OQQA 4JQ0D 1E5WA 1OXZA 5GTIH 1NTMK 3B8EB 4W7YA 4U3FG 3H1KJ 3O6QA 3L4FA 1NTMG 3L72G 1EZVI 2LXCB 3GHGA 3RK3D 1SFCC 2C0WA 1JY3O 1LP1A 5B5EE 1GZLA 3AE7C 2HPCA 3M06A 3KHUA 1HJ0A 1Y47A 3BCCD 4DZOA 3C8VA 2GA1A 1Q82Q 3L70J 3CWBD 5EFWB 3A2AA 3W67A 4GDOA 1ZW0A 5AW6B 1VQ8P 1FU1A 2V7QH 1LTSC 2GUVA 2B88A 3MUDC 3MIWA 1LT9C 3CMEP 1YITP 2H43A 1SQQE 1L4AA 2Q7CA 1GU4A 3H1JG 3GW6A 1VF5C 1S5LX 3WU2E 2M3EA 2ZJSE 4YTPC 2LKMA 2N1TA 1MUUA 1OMIA 2ITAA 3HTKA 2HYNA 1HWTC 2L5GB 2FKWB 3KYQA 2A06E 2ZVOB 1KQFB 1ZRTD 1YJNP 4AQRD 1KZUB 1VQPP 1Y9BA 4UB8H 3U59A 2ZYGA 1N7SB 3RK2B 3A0HE 3IN6A 2UWJE 1DD4A 1URQD 2H7HA 1BCCG 1LWUA 1TU3F 3JCUH 1EQ7A 1L0NG 1HGZA 3G3ZA 2YKPA 2I8DA 4U3FJ 3BVHA 3L72J 2ZT9C 3GG2A 3MTUE 1VQ5P 4OGQD 2B87B 2G8YA 1KILD 1SQPJ 1NYHA 2P10A 3VOPA 1NGMB 3ITKA 4U3FE 3L72E 1NTME 3SFEC 1LTJC 1SFCA 2Q3EA 2ZXEB 1IFNA 3L71G 5APSA 3D71A 1KC8Q 2QIWA 2WT7B 1USDA 1KORA 2PAJA 1NWQA 3KZIE 3WUTA 1L0LG 2DW3A 4OVNF 4JF7A 1JM0A 4I7ZB 3H1HG 3M0DC 1LJ2A 3MUDA 1LT9A 4L75A 4Y99B 3V2NA 2WSCJ 1M1JA 2QE7H 2JO1A 1QEXA 2RKLA 3H1JE 1KB9E 3FXEA 3AEBC 2JWDA 1YBKA 5M1BA 4KT0J 1MFTA 3TYYA 2WPVB 1H89A 3OAKA 1QGKB 2Z5HA 3EQ2A 2M5AA 2YXQB 2KZJA 3RBXA 1J1DB 3V2RA 1OX3A 3B4SA 1X9VA 1RE3A 1N73B 4GOFA 4U7JA 4PD4D 2XNDH 3HE5B 1MFZA 2PRRA 4XFJA 2E74D 3GHGB 2FXPA 1LTIC 1L4AD 2WVRA 2R44A 1RF0C 2W6AA 1YQ4C 1OW6A 3RK3C 5CHXA 1DIPA 1BCCE 2KXPB 2LXBA 3WUVA 1VQMP 1E79H 1FZCC 2WQYC 1JTHB 1L0NE 4Z1MH 3BRTB 3QWOC 3TGUD 3MP7B 2JR8A 1EDJA 3WUUA 3VMZA 2K3RA 1RE4C 4WB4A 2M0BA 1LTJA 4H13B 1S1CX 2KOGA 1KQSO 3CCMP 1LNQA 1ZR2A 2BCCD 2KP8A 2E76D 3L71E 3RL0C 2K88A 3TDKA 4PD4H 4QMAA 1VQ4P 5TISE 1LTAC 1M7LA 2H8PD 1NTZD 3M0DA 2K1AA 3FWNA 3H1HE 2QJKC 2OTJP 1SP4A 1OVUA 3CCSP 3CLQA 2FFDC 2WPRA 2VRSA 5AW2B 2R5BA 5AW8B 1J1EB 3RBZA 3JC22 4NPFX 4L74A 1URQC 1PZQA 4RO0A 2WPSA 3BATA 4BRYA 3VYIA 2IZ1A 1M1KQ 3H32A 2ZFCA 1GL2B 1EXJA 1KYOE 2O01N 4OGQC 1KILC 2K9YA 1L0LD 1A02F 4HH2A 1NH4A 2MJZA 1FJKA 3BCCG 2WSSH 1RF0A 3AEAC 3H1LD 1T3UA 1NO4A 1P84E 3CWBG 3ZDMA
chains in the Genus database with same CATH topology
1IK9A 5AVYB 3SWFA 2QM7A 3P8CD 1ZN5A 1JY3N 2OYHC 4C7NA 3BASA 1NOHA 3HUSC 5CJ0A 2OYIC 3HUSA 2OYIA 3L37A 1CZQA 1ZR4A 2WITA 2FFDB 1FZFA 1HJBA 2NPSA 1RY3A 4N78D 3L36A 3N7NA 1RE4A 1E5WA 2KB7P 3KDPB 1OXZA 2CPSA 1GD2E 5KJ7D 1L4AB 1NTMK 3VN0A 1SQBK 3B8EB 4W7YA 1JCCA 5KTBA 2JJLA 1YTZI 1URQB 1G2CB 3L4FA 1IO4A 1MV8A 5CJ4A 1GL2A 3A5TA 4EOTA 2FYZA 2R5DA 2YO2A 3GHGA 3A7OA 3RK3D 1RF1B 1SFCC 3HRNA 1FJPA 1GU5A 1YTZT 2C0WA 2N1TB 1JY3O 3R2PA 3VP8A 1LTGC 1IFDA 2O01H 1GZLA 4AUWA 4DOJA 2HPCA 3HTKB 5AVZB 3IR9A 3M06A 4WBAA 3V2QA 1XTGB 3NXSA 3HD7B 3KQGA 4IFDK 1FZEA 1N7SC 4DZOA 2YKQA 5AVUB 2XKMA 2NPSD 2XV5A 3A2AA 3P8CE 1LTBC 2C0XA 1KFNA 3P32A 5CCGA 3CI9A 5AW6B 2O1KA 2FFDA 1JY2O 1FU1A 1J2JB 3HE4A 2P1JA 4LLHA 1LTSC 2GUVA 2JEEA 3M91A 1W2EA 2R3CA 3MIWA 1LT9C 4N78E 1GL2D 5AVSB 1LWUB 1NHLA 3U1CA 1DX7A 1GDTA 1L4AC 2H43A 1L4AA 1S9KD 2Q7CA 1GU4A 2YNYA 1X79B 1URQA 1NAFA 1G2CA 2I1JA 4WY4A 3TK1A 3VP9A 1VDFA 1NTKK 1YYCA 1RF1C 1RF1A 2IFMA 1T8ZA 2XZRA 2LKMA 2N1TA 1MUUA 3V4QA 2XDJA 1IFMA 4C46A 2FXMA 5KLVK 1SFCB 2WSCH 3HTKA 2HYNA 3MGNA 1HWTC 1GW4A 2L5GB 5CCGD 2FKWB 3KYQA 1NU1K 3HD7A 3M9QA 3UIAA 4AQRD 2J58A 1KZUB 4AYCA 3U59A 1CI6B 2IX7C 1N7SB 1OWAA 3RK2B 4IFFA 2OYHA 1HVVA 5APUA 5AVQB 2N9BA 5AW1B 2M8RA 2E42A 1URQD 2H7HA 1HUCA 1LWUC 4WY4D 1LWUA 1IFIA 2P7JA 2WSEH 1A02J 1QL1A 1EQ7A 1T2KC 2WWWA 4XE5B 4W7ZA 4HYTB 2XNXA 1HGZA 1LT9B 1KQLA 2YKPA 3G3ZA 2C9LY 1H8AA 1S9KE 3BVHA 2N1TD 1JY2N 3V4WA 1CW5A 3NTNA 5BU5A 1FZGA 3MTUE 3NFQA 4EIJA 2HLOA 1KILD 1GW3A 1AQ5A 3VOPA 2Z4EA 1M1JB 4GT1A 3HD7D 1IC2A 1LTJC 2FYUK 1SFCA 2ZXEB 3CL3D 1J1DC 3L35A 1SLQA 5APYA 2QM8A 2XU6A 4ZKPA 1IFNA 1LGHB 4M3LA 1WT6A 1T3JA 2YO3A 1N73C 5APSA 1JCDA 2WZ7A 1JMMA 1ZLLA 4JYBA 4I6MC 2WT7B 2PAJA 1CI6A 2KLVA 3N4XA 1NWQA 3H32B 3RK2C 1N7SA 2O1JA 4JF7A 3VMXA 1FOSF 3M0DC 1T2KD 3B5NC 4IFMA 5CMZA 4JYCA 3MUDA 3E1IA 1LT9A 1GTWA 3LW5H 1HGVA 2KYVA 2POHA 1G1IA 4GKGA 4Y99B 3VTPC 5AW4B 5AVXB 3V2NA 5AVWB 2WTYA 1SFCD 1X8YA 2W6BA 3LIDA 1FZCB 2A45I 1M1JC 1XTCC 2P67A 3LIEA 1FZBA 1M1JA 5APQA 5BVZA 3V2PA 2Q9IA 3VMYA 2E43A 4N6JA 1AFOA 2HG5D 3O8ZA 5APVA 3TYYA 1H89A 3OAKA 1JY3P 1N7SD 2Z5HA 1FAVA 1SVFA 3EQ2A 2GM4A 1LTJB 1FOSE 1QL2A 1J1DB 2C9NY 3V2RA 2Z5IA 4OH8B 2R32A 2WT7A 2YMYA 1RE3C 1NTZK 1X9VA 1RE3A 3H6PA 5AVRB 3IFMA 1N73B 1SQXK 3I5CA 3HE5B 3A3YB 3OA7A 1MFZA 5KJ7C 2A45G 3GHGB 1DH3A 3RL0B 1JY2P 1LTIC 1LTTC 3OJAB 1JNMA 1L4AD 1NKZB 3T97A 1N7LA 1JUNA 5AW3B 1Z56A 3B5NB 3M0AA 1HH0A 1RF0C 2W6AA 3M9HA 4I1LA 3RK3C 5CHXA 1L0NK 3SWYA 1G1JA 1CSBA 4Y99C 4N3YB 4O9BA 1FZCC 1FZCA 1JTHB 1HTLC 2IFNA 1J1EC 3M9BA 4KHXA 3II6A 3BRTB 2CPBA 3HE4B 1IJDB 5AW7B 4I2LC 3VMZA 5BU8B 1FZAA 2NPSC 2GUSA 1N2DC 1ZV8A 1RE4C 4WB4A 3EFGA 1LTJA 1VPCA 1JOCA 3U1AA 1WRGA 2J59M 2KOGA 1PFIA 5AW9B 1SQPK 4GIFA 1N73A 1ZR2A 1KFMA 3KPEA 1GL2C 2KP8A 5AW0B 3HE5A 3BRVB 4WY4B 1L0LK 1H88A 3GHGC 2W27A 3RL0C 2PP6A 2HODB 1LTAC 1M7LA 2H8PD 3M0DA 3B5NA 1KILB 4XA4A 4LC1A 2YKOA 3TSIA 4C7RA 1DEBA 1SP4A 5APTA 3TNUB 3RK3B 1NKNA 2P2UA 1JTHA 3CLQA 5CCGC 5CCHC 2WSFH 5CCHA 1JO5A 4B86A 2FFDC 1HBWA 2WPRA 2VRSA 4C7NB 1SQQK 5AW5B 2OYHB 4W80A 5AW2B 1GK4A 2R5BA 3HUSB 1FBMA 5AW8B 2OYIB 1J1EB 2KSJA 1FDMA 3WMM0 1IFJA 2WPQA 2NPSB 2OARA 2Q5UA 1SQVK 3RL0D 3RK2D 1URQC 4WY4C 1N86A 2WPSA 3BATA 3B5ND 3VYIA 5APXA 3C9IA 4ZKUA 3H32A 2BASA 2ZFCA 2M3BA 1GL2B 2HODA 2N1TC 5AVVB 4LGDE 5KJ7A 2IPPA 2Q3IA 2I1KA 3PP5A 1KILC 3MD0A 1KILA 5AVTB 1A02F 4HH2A 5APWA 4RESB 1NH4A 3V5BA 2MJZA 1FJKA 5CCHD 2HFED 2A45H 3HD7C 3TNUA 1RF0A 2HPCB 3NMDA 3P7KA 1T3UA 1NO4A 1MZ9A 1GK6A 3P8MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5CMZ A;  5AVY B;  3SWF A;  2QM7 A;  1YYC A;  2XZR A;  4JYC A;  5AW9 B;  4C7N A;  1MUU A;  5AW0 B;  3V4Q A;  2KP8 A;  4C46 A;  3HE5 A;  1GTW A;  3L37 A;  1H88 A;  1CZQ A;  3HTK A;  4GKG A;  3MGN A;  1HWT C;  2W27 A;  3VTP C;  5AW4 B;  5AVX B;  1HJB A;  5AVW B;  2WTY A;  1X8Y A;  3LID A;  3L36 A;  3LIE A;  2P67 A;  3KDP B;  3M0D A;  1OXZ A;  3UIA A;  4AQR D;  5APQ A;  4AYC A;  1GD2 E;  1CI6 B;  4LC1 A;  3VN0 A;  3B8E B;  1OWA A;  3VMY A;  2JJL A;  2E43 A;  1SP4 A;  3O8Z A;  5APT A;  5APV A;  5APU A;  5AVQ B;  3TNU B;  1G2C B;  3TYY A;  1H89 A;  1MV8 A;  2N9B A;  3OAK A;  1IO4 A;  2Z5H A;  5AW1 B;  1FAV A;  3A5T A;  4EOT A;  2P2U A;  1FOS E;  2R5D A;  2E42 A;  2H7H A;  2YO2 A;  3A7O A;  1HUC A;  2C9N Y;  2Z5I A;  2R32 A;  2P7J A;  4B86 A;  1GU5 A;  1HBW A;  1A02 J;  2WT7 A;  2WPR A;  2VRS A;  4C7N B;  5AVR B;  5AW5 B;  1T2K C;  2WWW A;  4XE5 B;  5AW2 B;  1GK4 A;  2R5B A;  3I5C A;  3HE5 B;  4HYT B;  1KQL A;  3A3Y B;  5AW8 B;  2C9L Y;  1H8A A;  1S9K E;  1MFZ A;  1GZL A;  4AUW A;  3V4W A;  3NTN A;  2WPQ A;  1DH3 A;  3NFQ A;  5AVZ B;  3IR9 A;  3M06 A;  3NXS A;  1JNM A;  3T97 A;  1JUN A;  3KQG A;  2Q5U A;  5AW3 B;  4DZO A;  5AVU B;  4GT1 A;  3M0A A;  2XV5 A;  3A2A A;  2W6A A;  3M9H A;  3P32 A;  5AW6 B;  2WPS A;  2ZXE B;  1CSB A;  1J2J B;  3VYI A;  5APX A;  3HE4 A;  1SLQ A;  3L35 A;  5APY A;  2BAS A;  2QM8 A;  2ZFC A;  2XU6 A;  4M3L A;  3M91 A;  2YO3 A;  5AVV B;  5APS A;  2R3C A;  2IPP A;  2Q3I A;  3M9B A;  4KHX A;  5AVS B;  4JYB A;  3MD0 A;  4I6M C;  2WT7 B;  5AVT B;  1A02 F;  5APW A;  1CI6 A;  3HE4 B;  1NWQ A;  4RES B;  3V5B A;  5AW7 B;  4I2L C;  2Q7C A;  3VMZ A;  1S9K D;  1GU4 A;  2YNY A;  3VMX A;  3TNU A;  1NAF A;  3NMD A;  1FOS F;  3P7K A;  3TK1 A;  1GK6 A;  1T2K D;  3P8M C; 
#chains in the Genus database with same CATH topology
 2FBW C;  2AEF A;  1M90 Q;  1M8O B;  1JY3 N;  2OYH C;  5CJ0 A;  1VQO P;  2OYI C;  3HUS A;  1FC2 C;  1FZF A;  1VQL P;  1EDI A;  2B9B A;  2KS1 A;  1PP9 D;  3PRJ A;  1RE4 A;  3KDP B;  1AVY A;  1WMK A;  1JCC A;  5KTB A;  1IO4 A;  1MV8 A;  1RQV A;  3H1I J;  1VQ6 P;  4EOT A;  1SQV D;  2AXC A;  2FYZ A;  4KJM A;  4MN4 C;  1GU5 A;  1HF9 A;  3GMA A;  4DT0 A;  3VP8 A;  1LTG C;  1W2B O;  2WSF J;  2M5A B;  3AEC C;  2QJY C;  3AEG C;  2IBZ D;  4ZNC A;  3IR9 A;  3NXS A;  2E5Y A;  3HD7 B;  5AVU B;  3D6Y A;  3P8C E;  1KFN A;  3P32 A;  2O1K A;  2FFD A;  1JY2 O;  3HE4 A;  4LLH A;  3AE2 C;  2JEE A;  1W2E A;  2E74 C;  4N78 E;  3F5H A;  1GDT A;  1L4A C;  4H44 D;  3L73 D;  2YNY A;  1URQ A;  1G2C A;  3VP9 A;  5E79 H;  1VDF A;  2KI7 B;  1YYC A;  1RF1 A;  2KSE A;  1T8Z A;  3AED C;  5GTH E;  3Q1M A;  3CCJ P;  3RK3 E;  1S4X A;  1SQB D;  3V4Q A;  2XDJ A;  2FXM A;  3BCC J;  5C39 A;  3MGN A;  1GW4 A;  5CCG D;  3L75 D;  3TF5 A;  1R5S A;  3M9Q A;  3BCC E;  4UB8 E;  3UIA A;  2J58 A;  3A0B H;  2ZXX A;  2ZVN B;  3CWB E;  2IX7 C;  1IK7 A;  1OWA A;  1PPJ D;  5K5G B;  3FX0 A;  2OYH A;  1HVV A;  2E76 C;  2E42 A;  3JCU E;  2LR2 A;  1LWU C;  1EZV D;  4WY4 D;  1IFI A;  2ZAE B;  3Q5S A;  4W7Z A;  2XNX A;  2YIU B;  1H8A A;  1AQT A;  3V4W A;  3NTN A;  5BU5 A;  3SSU A;  4EIJ A;  2HLO A;  1EXI A;  2O01 J;  2Z4E A;  4GT1 A;  4TLF A;  3AE3 C;  1IC2 A;  3CL3 D;  3E1R A;  3EFF K;  1WT6 A;  2YO3 A;  1ZLL A;  1ZRT E;  5KLV D;  3Q5R A;  1OFC X;  1H0T B;  1CI6 A;  2KLV A;  1OVV A;  3H32 B;  2O1J A;  5H2F H;  1DEE G;  1FOS F;  3PHL A;  1NU1 D;  1T2K D;  4IFM A;  2IYP A;  1SQQ J;  1LT1 A;  1ZP0 C;  3E1I A;  1GTW A;  1UIX A;  4IL6 E;  4GKG A;  3VTP C;  3TGU G;  2KIK A;  3JSV C;  2W6B A;  1FZC B;  2A45 I;  1M1J C;  1XTC C;  1KIL E;  4CPG A;  5APQ A;  4JPZ B;  2Q9I A;  4R4M A;  2D2C B;  3VMY A;  5GTH H;  1JY3 P;  1N7S D;  1FAV A;  2BCC G;  1QL2 A;  2W83 C;  2C9N Y;  3CCR P;  1RE3 C;  1NTZ K;  4DJG A;  1YJ9 P;  3H6P A;  4EYY Q;  1NTZ G;  2OTK E;  3H1K D;  3RL0 B;  1FDO A;  5B66 H;  1JNM A;  3T97 A;  1JUN A;  4BWN A;  3B5N B;  3IAO A;  3M9H A;  1YHQ P;  1L0N K;  2KLU A;  1G1J A;  4N3Y B;  1YJW P;  4O9B A;  3FXD A;  5KKZ C;  2OYO A;  1NTM J;  3M9B A;  4KHX A;  3II6 A;  2N9Y B;  3HE4 B;  3L70 D;  1BDD A;  1ZV8 A;  1KD1 Q;  2K9J B;  1WRG A;  2J59 M;  1IFP A;  5AW9 B;  1KFM A;  1L0L K;  5L8R J;  1H88 A;  3PH0 A;  2ZYD A;  4PD4 E;  2PP6 A;  4H44 C;  2HOD B;  3H1L G;  4OGQ B;  1KIL B;  2YKO A;  4C7R A;  1DEB A;  3AE8 C;  5APT A;  1SS1 A;  3H1J J;  2P2U A;  5CCG C;  4IL6 H;  3CCU P;  1HBW A;  3FGA D;  4C7N B;  2FY8 A;  3TGU E;  5AW5 B;  2OYH B;  2OYI B;  1BGY G;  2QVA A;  1PP9 G;  1FDM A;  1K8A Q;  2KUB A;  2WPQ A;  4H0L B;  2BCC J;  2NPS B;  2Q5U A;  1SQV K;  4R4L A;  5KAF H;  4WY4 C;  1SQV G;  1RH5 B;  1N86 A;  2AEM A;  2BCC E;  3G6E P;  5APX A;  1U7J A;  3O6Q B;  3W68 A;  2IDB A;  2QJP B;  1FDI A;  1SQP D;  2I1K A;  1NTZ E;  1BCC J;  4ZMD A;  2IBZ G;  5APW A;  3V5B A;  5CCH D;  1LP1 B;  2HFE D;  2FYN B;  3TNU A;  2HPC B;  3NMD A;  1L0N J;  1GK6 A;  2QJY B;  5AVY B;  2OGU A;  4H13 D;  1NOH A;  3HUS C;  1PGJ A;  1YI2 P;  3PJS K;  1S72 P;  1ZR4 A;  4YXD C;  1HJB A;  4ASV A;  4EDF A;  3G71 P;  3AE4 C;  3N7N A;  3L73 G;  2E74 B;  3L71 J;  5CBN A;  2CPS A;  1L4A B;  3VN0 A;  1SQB K;  1YTZ I;  3CXH D;  1SQB G;  1L0L J;  3A5T A;  1VQ7 P;  2R5D A;  2YO2 A;  3H1H J;  3A7O A;  2V4H A;  3HRN A;  2CK3 H;  2N1T B;  3L75 G;  2Q6Q A;  1L0L E;  3R2P A;  4AUW A;  4DOJ A;  3HTK B;  2H89 C;  4NPE A;  4IOI H;  3H1L E;  3CXH I;  4WBA A;  5AVZ B;  1KB9 I;  1XTG B;  3KQG A;  4IFD K;  1FZE A;  1N7S C;  1PPJ G;  2YKQ A;  2XKM A;  2QSI A;  2XV5 A;  1OW7 A;  1LTB C;  2C0X A;  5CCG A;  3CI9 A;  1PP9 J;  1EZV G;  2P1J A;  1KV4 A;  3M91 A;  1AA0 A;  2R3C A;  1GL2 D;  5AVS B;  1LWU B;  1PP9 E;  1X0T A;  1DX7 A;  1M57 D;  1S9K D;  1SQV J;  5E79 E;  1X79 B;  1NAF A;  2I1J A;  2E75 D;  4WY4 A;  3PLN A;  4D6T D;  3RGU A;  1RF1 C;  1SQV E;  3AE5 C;  3CXH H;  2QG4 A;  4PJ0 E;  1BE3 D;  1PL5 A;  3GLM A;  4C46 A;  5KLV K;  1QVG O;  1SFC B;  2WSC H;  2AXT H;  5KLV G;  1NU1 K;  2IBZ E;  3A0B E;  1W5C E;  2E5T A;  4AYC A;  2W90 A;  1NU1 G;  3MHV A;  5CBO A;  4YXW H;  3RL0 g;  5AVQ B;  2N9B A;  1D7M A;  2B89 A;  2M8R A;  1HUC A;  2P7J A;  2WSE H;  1QL1 A;  1BGY D;  4XE5 B;  4HYT B;  1LT9 B;  2W6J H;  1KQL A;  2C9L Y;  3L73 E;  2KNC A;  1SQB J;  3NFQ A;  1AQ5 A;  1M1J B;  1VF5 B;  3HD7 D;  3L75 J;  1SQB E;  3CD6 P;  1J1D C;  4PV1 D;  3G9R A;  1OVR A;  1NTK D;  3Q3D A;  2QM8 A;  1LGH B;  1T3J A;  1N73 C;  4K3A A;  3CX5 D;  1JCD A;  3L75 E;  1JMM A;  2V7Q J;  4JYB A;  3H1K G;  1M56 D;  5H2F E;  3N4X A;  1N7S A;  4TT3 H;  3VMX A;  4HKZ H;  1IZN B;  1K9M Q;  1PPJ E;  1VQK P;  5CMZ A;  3CX5 I;  1EZV E;  2JWA A;  1Y8A A;  3B71 A;  3LW5 H;  1HGV A;  2SPZ A;  1G1I A;  1KYO I;  5AVX B;  5AVW B;  2B87 A;  3L70 G;  3LID A;  2QRX A;  2P67 A;  3LIE A;  2ZT9 B;  1S3J A;  1R5L A;  4H13 C;  4N6J A;  2HG5 D;  2YXR B;  3L74 D;  4PJ0 H;  1SVF A;  1LTJ B;  1FOS E;  4OWF A;  3CWB J;  2BEQ D;  4OH8 B;  2KK7 A;  2WT7 A;  2P58 A;  2FYU D;  3CX5 H;  5KLV E;  3I5C A;  5B66 E;  1DH3 A;  1VQN P;  1JY2 P;  1NU1 E;  1NKZ B;  1Q2N A;  1N7L A;  3H1I D;  1Z56 A;  4A7P A;  3SWK A;  1VQ9 P;  4I1L A;  3S1K A;  2KZI A;  1CSB A;  2QEX P;  3IF4 A;  4IL6 X;  1ZME C;  3H25 A;  4EI2 A;  1GMJ A;  1FE6 A;  1HTL C;  2IFN A;  1J1E C;  1PGQ A;  3AEE C;  1RQU A;  5AW7 B;  1ZOY C;  1FZA A;  2GUS A;  3MZW B;  1JOC A;  3U1A A;  1EC5 A;  4DCK A;  1PFI A;  1KQG B;  3S9O A;  1SQP K;  4GIF A;  1PV3 A;  1N73 A;  3KPE A;  1GL2 C;  3HE5 A;  3BRV B;  4WY4 B;  3PTZ A;  1SQP G;  4BRY B;  2Y0E A;  4L73 A;  3CMA P;  3H1K E;  1AV1 A;  1QLE D;  2E75 C;  1SQX D;  2Y0C A;  3USS A;  3TSI A;  1USE A;  4UB6 H;  2QA4 P;  2D2C D;  3RK3 B;  1NKN A;  1PIX A;  2Y9Z A;  1JTH A;  2WSF H;  5CCH A;  4B86 A;  3OW2 O;  1GK4 A;  3HUS B;  1FBM A;  3L70 E;  3WMM 0;  1IFJ A;  2IZ0 A;  3Q2Y A;  2BEZ F;  4RJT A;  2KS1 B;  5KAF E;  3RK2 D;  3RL0 D;  3CC7 P;  1DD3 A;  4GOD A;  2KNC B;  3B5N D;  2BAS A;  2M3B A;  5DJT B;  2RMZ A;  4LGD E;  5AVT B;  2MKV A;  5KAI H;  2FXO A;  2A45 H;  3ABV C;  3HD7 C;  2RN0 A;  3P7K A;  1U57 A;  2QJK B;  4PV1 C;  3F89 A;  2QM7 A;  1OZH A;  1Q86 Q;  3BAS A;  2K37 A;  2WIT A;  4GOE A;  2FFD B;  2OTL P;  3SFD C;  2RH0 A;  3L36 A;  2KB7 P;  1SQQ D;  4D6T G;  1GD2 E;  4NPD A;  2J5U A;  3I55 P;  3D6Z A;  5KJ7 D;  2JJL A;  1URQ B;  1S5L E;  1G2C B;  5CJ4 A;  3CPW O;  1GL2 A;  3E7K A;  5TJH A;  1BE3 G;  1T6A A;  1PGP A;  1RF1 B;  1FJP A;  1YQ3 C;  2JKV A;  1SQP E;  1MKM A;  1YTZ T;  1KTM A;  1IFD A;  2O01 H;  2A06 D;  5B5E H;  3V2Q A;  3TGU J;  4H0L D;  2NPS D;  1NJI Q;  2WMM A;  1J2J B;  1ZXG A;  5KLI C;  1JMB A;  2YIU C;  1NHL A;  1PGO A;  3U1C A;  2Y0D A;  1KMI Z;  1L2P A;  3V6I A;  3TK1 A;  1NTK K;  4K35 A;  3CXH E;  1NTZ J;  3CC2 P;  4U3F D;  3WU2 H;  2IFM A;  3I56 P;  2XZR A;  1NTK G;  3L72 D;  1NTM D;  1IFM A;  1RHZ B;  1BSN A;  2AXT E;  1Q90 D;  2JDI H;  3HD7 A;  2Q1K A;  2R3S A;  2WSE J;  1CI6 B;  4IFF A;  5APU A;  1Q81 Q;  3A0H H;  5AW1 B;  1N8R Q;  1X22 A;  1A02 J;  4PD4 I;  4D6T J;  1T2K C;  2WWW A;  2YMK A;  1AJY A;  1S9K E;  2N1T D;  1JY2 N;  1CW5 A;  1FZG A;  1BE3 J;  4D6T E;  1GW3 A;  4Y28 J;  2D2C C;  1OIP A;  3H1J D;  1KB9 D;  1S5L H;  3L74 G;  3AEF C;  2FYU K;  1BE3 E;  3H1L J;  3L35 A;  1SLQ A;  5APY A;  3G4S P;  2IYO A;  4L76 A;  2XU6 A;  4ZKP A;  2FYU G;  4M3L A;  1UII A;  2WZ7 A;  4I6M C;  1EDK A;  3RK2 C;  2W8Z A;  4WWI A;  4HJG H;  3H1I G;  3KZI H;  3LW5 J;  1NAY A;  3KXD A;  2NRG A;  1BGY J;  3B5N C;  3EWK A;  3GF7 A;  3T97 B;  5DJU B;  1R8E A;  2E76 B;  4JYC A;  4RKU J;  1BGY E;  1K05 A;  1BCC D;  1BDC A;  2KYV A;  2POH A;  5AW4 B;  1S2E A;  2WTY A;  1SFC D;  4WVZ A;  1X8Y A;  1L0N D;  1FZB A;  1NTK J;  2JP3 A;  2AEJ A;  2ZYA A;  2PFX A;  5BVZ A;  3V2P A;  1KB9 H;  2E43 A;  1AFO A;  4YPC A;  3O8Z A;  5APV A;  1KN7 A;  1NTK E;  2GM4 A;  2Z5I A;  3K5B A;  2R32 A;  3CX5 E;  2YMY A;  1H0T A;  3L71 D;  4JBZ A;  5AVR B;  3IFM A;  3S4R A;  1SQX K;  3A3Y B;  3OA7 A;  4I7Z C;  5KJ7 C;  2A45 G;  1SQX G;  1LTT C;  3OJA B;  3CCQ P;  2E75 B;  5AW3 B;  1NVO A;  3H1H D;  3M0A A;  1HH0 A;  1QVF O;  2G3A A;  3L73 J;  2H88 C;  3SWY A;  1VF5 D;  3C1L A;  4Y99 C;  4BXL A;  1FZC A;  3GF3 A;  3CC4 P;  3FWL A;  1BSH A;  3L74 J;  2CPB A;  1AVO A;  1IJD B;  4H0L C;  4I2L C;  5BU8 B;  2NPS C;  1N2D C;  5GTI E;  3EFG A;  2FYU J;  3L74 E;  1VPC A;  3D70 A;  2HR3 A;  5AW0 B;  2QJP C;  2FYU E;  3GHG C;  2W27 A;  4HB1 A;  1KYO D;  1K73 Q;  1VL2 A;  5TIS H;  2FYN C;  1JEK A;  3B5N A;  3H1I E;  1EDL A;  3R4Y A;  4XA4 A;  4LC1 A;  2ZT9 D;  3Q5P A;  4UB6 E;  1YIJ P;  1P84 D;  3TNU B;  2O3J A;  4PV1 B;  5CCH C;  1JO5 A;  1OW8 A;  4ASW A;  5KKZ B;  1JB0 J;  1SQQ K;  4W80 A;  1Q7Y Q;  2KSJ A;  2IBZ I;  1FS0 E;  1P84 I;  1SQQ G;  3QH9 A;  2K9J A;  2PGD A;  1K04 A;  2OAR A;  5KLV J;  3AE1 C;  1NU1 J;  3C9I A;  4ZKU A;  1SQX J;  2HOD A;  2N1T C;  5AVV B;  3CCE P;  5KJ7 A;  2IPP A;  2Q3I A;  2L91 A;  5KAI E;  1KYO H;  3PP5 A;  2A06 G;  3MD0 A;  3AE6 C;  1KIL A;  4H44 B;  1SQX E;  4RES B;  1QX8 A;  1U7M A;  1MZ9 A;  3P8M C;  1IK9 A;  3SWF A;  1P84 H;  3CCL P;  3AE9 C;  3P8C D;  1ZN5 A;  3CCV P;  4C7N A;  2OYI A;  3L37 A;  1CZQ A;  2NZ2 A;  2Y9Y A;  3VMA A;  2NPS A;  1RY3 A;  4N78 D;  5KLI B;  2OQQ A;  4JQ0 D;  1E5W A;  1OXZ A;  5GTI H;  1NTM K;  3B8E B;  4W7Y A;  4U3F G;  3H1K J;  3O6Q A;  3L4F A;  1NTM G;  3L72 G;  1EZV I;  2LXC B;  3GHG A;  3RK3 D;  1SFC C;  2C0W A;  1JY3 O;  1LP1 A;  5B5E E;  1GZL A;  3AE7 C;  2HPC A;  3M06 A;  3KHU A;  1HJ0 A;  1Y47 A;  3BCC D;  4DZO A;  3C8V A;  2GA1 A;  1Q82 Q;  3L70 J;  3CWB D;  5EFW B;  3A2A A;  3W67 A;  4GDO A;  1ZW0 A;  5AW6 B;  1VQ8 P;  1FU1 A;  2V7Q H;  1LTS C;  2GUV A;  2B88 A;  3MUD C;  3MIW A;  1LT9 C;  3CME P;  1YIT P;  2H43 A;  1SQQ E;  1L4A A;  2Q7C A;  1GU4 A;  3H1J G;  3GW6 A;  1VF5 C;  1S5L X;  3WU2 E;  2M3E A;  2ZJS E;  4YTP C;  2LKM A;  2N1T A;  1MUU A;  1OMI A;  2ITA A;  3HTK A;  2HYN A;  1HWT C;  2L5G B;  2FKW B;  3KYQ A;  2A06 E;  2ZVO B;  1KQF B;  1ZRT D;  1YJN P;  4AQR D;  1KZU B;  1VQP P;  1Y9B A;  4UB8 H;  3U59 A;  2ZYG A;  1N7S B;  3RK2 B;  3A0H E;  3IN6 A;  2UWJ E;  1DD4 A;  1URQ D;  2H7H A;  1BCC G;  1LWU A;  1TU3 F;  3JCU H;  1EQ7 A;  1L0N G;  1HGZ A;  3G3Z A;  2YKP A;  2I8D A;  4U3F J;  3BVH A;  3L72 J;  2ZT9 C;  3GG2 A;  3MTU E;  1VQ5 P;  4OGQ D;  2B87 B;  2G8Y A;  1KIL D;  1SQP J;  1NYH A;  2P10 A;  3VOP A;  1NGM B;  3ITK A;  4U3F E;  3L72 E;  1NTM E;  3SFE C;  1LTJ C;  1SFC A;  2Q3E A;  2ZXE B;  1IFN A;  3L71 G;  5APS A;  3D71 A;  1KC8 Q;  2QIW A;  2WT7 B;  1USD A;  1KOR A;  2PAJ A;  1NWQ A;  3KZI E;  3WUT A;  1L0L G;  2DW3 A;  4OVN F;  4JF7 A;  1JM0 A;  4I7Z B;  3H1H G;  3M0D C;  1LJ2 A;  3MUD A;  1LT9 A;  4L75 A;  4Y99 B;  3V2N A;  2WSC J;  1M1J A;  2QE7 H;  2JO1 A;  1QEX A;  2RKL A;  3H1J E;  1KB9 E;  3FXE A;  3AEB C;  2JWD A;  1YBK A;  5M1B A;  4KT0 J;  1MFT A;  3TYY A;  2WPV B;  1H89 A;  3OAK A;  1QGK B;  2Z5H A;  3EQ2 A;  2M5A A;  2YXQ B;  2KZJ A;  3RBX A;  1J1D B;  3V2R A;  1OX3 A;  3B4S A;  1X9V A;  1RE3 A;  1N73 B;  4GOF A;  4U7J A;  4PD4 D;  2XND H;  3HE5 B;  1MFZ A;  2PRR A;  4XFJ A;  2E74 D;  3GHG B;  2FXP A;  1LTI C;  1L4A D;  2WVR A;  2R44 A;  1RF0 C;  2W6A A;  1YQ4 C;  1OW6 A;  3RK3 C;  5CHX A;  1DIP A;  1BCC E;  2KXP B;  2LXB A;  3WUV A;  1VQM P;  1E79 H;  1FZC C;  2WQY C;  1JTH B;  1L0N E;  4Z1M H;  3BRT B;  3QWO C;  3TGU D;  3MP7 B;  2JR8 A;  1EDJ A;  3WUU A;  3VMZ A;  2K3R A;  1RE4 C;  4WB4 A;  2M0B A;  1LTJ A;  4H13 B;  1S1C X;  2KOG A;  1KQS O;  3CCM P;  1LNQ A;  1ZR2 A;  2BCC D;  2KP8 A;  2E76 D;  3L71 E;  3RL0 C;  2K88 A;  3TDK A;  4PD4 H;  4QMA A;  1VQ4 P;  5TIS E;  1LTA C;  1M7L A;  2H8P D;  1NTZ D;  3M0D A;  2K1A A;  3FWN A;  3H1H E;  2QJK C;  2OTJ P;  1SP4 A;  1OVU A;  3CCS P;  3CLQ A;  2FFD C;  2WPR A;  2VRS A;  5AW2 B;  2R5B A;  5AW8 B;  1J1E B;  3RBZ A;  3JC2 2;  4NPF X;  4L74 A;  1URQ C;  1PZQ A;  4RO0 A;  2WPS A;  3BAT A;  4BRY A;  3VYI A;  2IZ1 A;  1M1K Q;  3H32 A;  2ZFC A;  1GL2 B;  1EXJ A;  1KYO E;  2O01 N;  4OGQ C;  1KIL C;  2K9Y A;  1L0L D;  1A02 F;  4HH2 A;  1NH4 A;  2MJZ A;  1FJK A;  3BCC G;  2WSS H;  1RF0 A;  3AEA C;  3H1L D;  1T3U A;  1NO4 A;  1P84 E;  3CWB G;  3ZDM A; 
#chains in the Genus database with same CATH homology
 1IK9 A;  5AVY B;  3SWF A;  2QM7 A;  3P8C D;  1ZN5 A;  1JY3 N;  2OYH C;  4C7N A;  3BAS A;  1NOH A;  3HUS C;  5CJ0 A;  2OYI C;  3HUS A;  2OYI A;  3L37 A;  1CZQ A;  1ZR4 A;  2WIT A;  2FFD B;  1FZF A;  1HJB A;  2NPS A;  1RY3 A;  4N78 D;  3L36 A;  3N7N A;  1RE4 A;  1E5W A;  2KB7 P;  3KDP B;  1OXZ A;  2CPS A;  1GD2 E;  5KJ7 D;  1L4A B;  1NTM K;  3VN0 A;  1SQB K;  3B8E B;  4W7Y A;  1JCC A;  5KTB A;  2JJL A;  1YTZ I;  1URQ B;  1G2C B;  3L4F A;  1IO4 A;  1MV8 A;  5CJ4 A;  1GL2 A;  3A5T A;  4EOT A;  2FYZ A;  2R5D A;  2YO2 A;  3GHG A;  3A7O A;  3RK3 D;  1RF1 B;  1SFC C;  3HRN A;  1FJP A;  1GU5 A;  1YTZ T;  2C0W A;  2N1T B;  1JY3 O;  3R2P A;  3VP8 A;  1LTG C;  1IFD A;  2O01 H;  1GZL A;  4AUW A;  4DOJ A;  2HPC A;  3HTK B;  5AVZ B;  3IR9 A;  3M06 A;  4WBA A;  3V2Q A;  1XTG B;  3NXS A;  3HD7 B;  3KQG A;  4IFD K;  1FZE A;  1N7S C;  4DZO A;  2YKQ A;  5AVU B;  2XKM A;  2NPS D;  2XV5 A;  3A2A A;  3P8C E;  1LTB C;  2C0X A;  1KFN A;  3P32 A;  5CCG A;  3CI9 A;  5AW6 B;  2O1K A;  2FFD A;  1JY2 O;  1FU1 A;  1J2J B;  3HE4 A;  2P1J A;  4LLH A;  1LTS C;  2GUV A;  2JEE A;  3M91 A;  1W2E A;  2R3C A;  3MIW A;  1LT9 C;  4N78 E;  1GL2 D;  5AVS B;  1LWU B;  1NHL A;  3U1C A;  1DX7 A;  1GDT A;  1L4A C;  2H43 A;  1L4A A;  1S9K D;  2Q7C A;  1GU4 A;  2YNY A;  1X79 B;  1URQ A;  1NAF A;  1G2C A;  2I1J A;  4WY4 A;  3TK1 A;  3VP9 A;  1VDF A;  1NTK K;  1YYC A;  1RF1 C;  1RF1 A;  2IFM A;  1T8Z A;  2XZR A;  2LKM A;  2N1T A;  1MUU A;  3V4Q A;  2XDJ A;  1IFM A;  4C46 A;  2FXM A;  5KLV K;  1SFC B;  2WSC H;  3HTK A;  2HYN A;  3MGN A;  1HWT C;  1GW4 A;  2L5G B;  5CCG D;  2FKW B;  3KYQ A;  1NU1 K;  3HD7 A;  3M9Q A;  3UIA A;  4AQR D;  2J58 A;  1KZU B;  4AYC A;  3U59 A;  1CI6 B;  2IX7 C;  1N7S B;  1OWA A;  3RK2 B;  4IFF A;  2OYH A;  1HVV A;  5APU A;  5AVQ B;  2N9B A;  5AW1 B;  2M8R A;  2E42 A;  1URQ D;  2H7H A;  1HUC A;  1LWU C;  4WY4 D;  1LWU A;  1IFI A;  2P7J A;  2WSE H;  1A02 J;  1QL1 A;  1EQ7 A;  1T2K C;  2WWW A;  4XE5 B;  4W7Z A;  4HYT B;  2XNX A;  1HGZ A;  1LT9 B;  1KQL A;  2YKP A;  3G3Z A;  2C9L Y;  1H8A A;  1S9K E;  3BVH A;  2N1T D;  1JY2 N;  3V4W A;  1CW5 A;  3NTN A;  5BU5 A;  1FZG A;  3MTU E;  3NFQ A;  4EIJ A;  2HLO A;  1KIL D;  1GW3 A;  1AQ5 A;  3VOP A;  2Z4E A;  1M1J B;  4GT1 A;  3HD7 D;  1IC2 A;  1LTJ C;  2FYU K;  1SFC A;  2ZXE B;  3CL3 D;  1J1D C;  3L35 A;  1SLQ A;  5APY A;  2QM8 A;  2XU6 A;  4ZKP A;  1IFN A;  1LGH B;  4M3L A;  1WT6 A;  1T3J A;  2YO3 A;  1N73 C;  5APS A;  1JCD A;  2WZ7 A;  1JMM A;  1ZLL A;  4JYB A;  4I6M C;  2WT7 B;  2PAJ A;  1CI6 A;  2KLV A;  3N4X A;  1NWQ A;  3H32 B;  3RK2 C;  1N7S A;  2O1J A;  4JF7 A;  3VMX A;  1FOS F;  3M0D C;  1T2K D;  3B5N C;  4IFM A;  5CMZ A;  4JYC A;  3MUD A;  3E1I A;  1LT9 A;  1GTW A;  3LW5 H;  1HGV A;  2KYV A;  2POH A;  1G1I A;  4GKG A;  4Y99 B;  3VTP C;  5AW4 B;  5AVX B;  3V2N A;  5AVW B;  2WTY A;  1SFC D;  1X8Y A;  2W6B A;  3LID A;  1FZC B;  2A45 I;  1M1J C;  1XTC C;  2P67 A;  3LIE A;  1FZB A;  1M1J A;  5APQ A;  5BVZ A;  3V2P A;  2Q9I A;  3VMY A;  2E43 A;  4N6J A;  1AFO A;  2HG5 D;  3O8Z A;  5APV A;  3TYY A;  1H89 A;  3OAK A;  1JY3 P;  1N7S D;  2Z5H A;  1FAV A;  1SVF A;  3EQ2 A;  2GM4 A;  1LTJ B;  1FOS E;  1QL2 A;  1J1D B;  2C9N Y;  3V2R A;  2Z5I A;  4OH8 B;  2R32 A;  2WT7 A;  2YMY A;  1RE3 C;  1NTZ K;  1X9V A;  1RE3 A;  3H6P A;  5AVR B;  3IFM A;  1N73 B;  1SQX K;  3I5C A;  3HE5 B;  3A3Y B;  3OA7 A;  1MFZ A;  5KJ7 C;  2A45 G;  3GHG B;  1DH3 A;  3RL0 B;  1JY2 P;  1LTI C;  1LTT C;  3OJA B;  1JNM A;  1L4A D;  1NKZ B;  3T97 A;  1N7L A;  1JUN A;  5AW3 B;  1Z56 A;  3B5N B;  3M0A A;  1HH0 A;  1RF0 C;  2W6A A;  3M9H A;  4I1L A;  3RK3 C;  5CHX A;  1L0N K;  3SWY A;  1G1J A;  1CSB A;  4Y99 C;  4N3Y B;  4O9B A;  1FZC C;  1FZC A;  1JTH B;  1HTL C;  2IFN A;  1J1E C;  3M9B A;  4KHX A;  3II6 A;  3BRT B;  2CPB A;  3HE4 B;  1IJD B;  5AW7 B;  4I2L C;  3VMZ A;  5BU8 B;  1FZA A;  2NPS C;  2GUS A;  1N2D C;  1ZV8 A;  1RE4 C;  4WB4 A;  3EFG A;  1LTJ A;  1VPC A;  1JOC A;  3U1A A;  1WRG A;  2J59 M;  2KOG A;  1PFI A;  5AW9 B;  1SQP K;  4GIF A;  1N73 A;  1ZR2 A;  1KFM A;  3KPE A;  1GL2 C;  2KP8 A;  5AW0 B;  3HE5 A;  3BRV B;  4WY4 B;  1L0L K;  1H88 A;  3GHG C;  2W27 A;  3RL0 C;  2PP6 A;  2HOD B;  1LTA C;  1M7L A;  2H8P D;  3M0D A;  3B5N A;  1KIL B;  4XA4 A;  4LC1 A;  2YKO A;  3TSI A;  4C7R A;  1DEB A;  1SP4 A;  5APT A;  3TNU B;  3RK3 B;  1NKN A;  2P2U A;  1JTH A;  3CLQ A;  5CCG C;  5CCH C;  2WSF H;  5CCH A;  1JO5 A;  4B86 A;  2FFD C;  1HBW A;  2WPR A;  2VRS A;  4C7N B;  1SQQ K;  5AW5 B;  2OYH B;  4W80 A;  5AW2 B;  1GK4 A;  2R5B A;  3HUS B;  1FBM A;  5AW8 B;  2OYI B;  1J1E B;  2KSJ A;  1FDM A;  3WMM 0;  1IFJ A;  2WPQ A;  2NPS B;  2OAR A;  2Q5U A;  1SQV K;  3RL0 D;  3RK2 D;  1URQ C;  4WY4 C;  1N86 A;  2WPS A;  3BAT A;  3B5N D;  3VYI A;  5APX A;  3C9I A;  4ZKU A;  3H32 A;  2BAS A;  2ZFC A;  2M3B A;  1GL2 B;  2HOD A;  2N1T C;  5AVV B;  4LGD E;  5KJ7 A;  2IPP A;  2Q3I A;  2I1K A;  3PP5 A;  1KIL C;  3MD0 A;  1KIL A;  5AVT B;  1A02 F;  4HH2 A;  5APW A;  4RES B;  1NH4 A;  3V5B A;  2MJZ A;  1FJK A;  5CCH D;  2HFE D;  2A45 H;  3HD7 C;  3TNU A;  1RF0 A;  2HPC B;  3NMD A;  3P7K A;  1T3U A;  1NO4 A;  1MZ9 A;  1GK6 A;  3P8M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...