5DJUB

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
NKFNKEVLVARQEIYWLPNLNWEQKFAFISSLTNDPSQSANLLAEAKKLNGAQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
molecule keywords Engineered protein, Zdk3 affibody
total genus 20
structure length 55
sequence length 55
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djuB00
2KZJA 2B88A 2K3RA 4ZMDA 5K5GB 2QVAA 2WMMA 4NPEA 1BDDA 1U7MA 4BXLA 4ZNCA 1ZW0A 1EDLA 1S3JA 2Q1KA 4NPDA 4CPGA 4K3AA 1EDKA 5DJUB 4KJMA 1X0TA 3S1KA 4K35A 1BDCA 4ASWA 4EYYQ 2RKLA 2LXBA 1DEEG 2KIKA 1Y47A 2B87A 2OTKE 2UWJE 2ZAEB 4GOEA 2KS1B 1LP1B 4NPFX 4HB1A 2R44A 5CBOA 1OVUA 2KI7B 1NVOA 1MFTA 3ZDMA 2KZIA 1SS1A 1Q2NA 5EFWB 3RGUA 2HR3A 3PH0A 3FXEA 1OVRA 2M0BA 3QWOC 1EC5A 3MZWB 1OVVA 2P58A 2I8DA 2B87B 1U7JA 1JM0A 2KUBA 2LXCB 1JMBA 4ASVA 2M5AA 1FC2C 1LT1A 1LP1A 3FXDA 2JWDA 4JBZA 5C39A 4GOFA 4HKZH 2B89A 2M5AB 2LR2A 5CBNA 2SPZA 4GODA 5DJTB 4WWIA 1EDIA 4MN4C 1ZXGA 1H0TA 4IOIH 2QRXA 3MHVA 4HJGH 1H0TB 1EDJA
chains in the Genus database with same CATH superfamily
1OFCX 1KFNA 1URQD 3WU2H 1NTKG 5TISH 1LWUA 3OJAB 2Q9IA 1GK4A 2JEEA 5AW1B 1RF1B 1GZLA 3AEGC 3K5BA 2QJYC 1JY2N 1RHZB 1KFMA 2KSEA 3AE1C 4PD4H 5KAIE 3MUDC 4C46A 4DOJA 5B5EE 5CJ4A 5KJ7A 1LT9B 3H1LD 5AW5B 1P84E 3JC22 1PZQA 4IFFA 3CCRP 1KTMA 1S2EA 4NPEA 3USSA 3IF4A 2J5UA 1BDDA 1U7MA 3GLMA 1T3JA 4Y28J 3L75G 2IBZD 1L0NJ 2FYNC 5AVXB 1N7SB 1NU1G 3P32A 1FZEA 1NTZJ 5GTIE 1JUNA 2FYZA 2WSFJ 4YPCA 1S3JA 2QJKB 3A0HE 4CPGA 1EZVI 2HG5D 3NMDA 1HVVA 5AW9B 1Q81Q 2ZVNB 1YIJP 3NXSA 3OAKA 2FFDA 2OTLP 3CX5D 4JQ0D 3M9QA 3IAOA 1A02J 3BCCG 1IC2A 3CX5I 5CCGC 1BDCA 4W7YA 1KQSO 3PP5A 1N7SA 3RK2C 3CCVP 1KV4A 1HF9A 1SFCC 5BU5A 3TSIA 1CI6B 1W2EA 1SQQG 2FYUG 2P10A 3CC7P 2FKWB 2ZT9C 2FXOA 4EYYQ 1IFJA 1BGYE 1H89A 2NPSC 1H88A 3BRVB 1DEEG 2KIKA 2OTKE 3BCCE 3E1IA 3L71E 1K05A 3CPWO 1YJ9P 4RKUJ 5KKZB 2FYNB 1ZRTE 1URQB 2E74C 3AE9C 1SVFA 1NTZG 4N6JA 2YXRB 4HB1A 5CBOA 1M90Q 1KN7A 1FJKA 1OVUA 1PPJD 1SLQA 1L0NK 1JMMA 1NVOA 1FU1A 2KI7B 2PP6A 2ZXEB 2ZXXA 2K9JB 4XFJA 2OYIC 4DT0A 4IL6X 2QG4A 1NGMB 1IFMA 1JTHA 3EWKA 4PJ0E 2N1TA 1JY3N 1K9MQ 1LWUB 2Q7CA 2VRSA 5TJHA 4JF7A 3L70E 2N1TC 1R5LA 2KS1A 3AEFC 3GF7A 3FXEA 3I56P 2V7QH 2WSCJ 4KHXA 2BASA 3ITKA 2Q3IA 3A0HH 5B5EH 1KILE 3MZWB 1OZHA 3SFEC 1MUUA 1LTIC 2E76B 2XZRA 3E1RA 2HYNA 3GF3A 3W68A 2W27A 4PD4I 2H43A 1U7JA 3AEBC 1Q82Q 1JM0A 2POHA 2C0WA 2A45I 4H0LD 1SQXK 1JMBA 2A06D 2M3BA 3N7NA 2WPRA 1J1DC 1M56D 2H7HA 1SQPD 1GMJA 5CCHA 5H2FH 1IFDA 1S1CX 2Y9ZA 3AEEC 3L74D 4BRYA 5KKZC 4D6TE 1RQUA 3L72D 4EI2A 3CCJP 4OWFA 1VF5D 2E5TA 1ZV8A 1G1IA 1OW6A 1NKNA 2WQYC 1RQVA 1ZR4A 1VQOP 4IFDK 4H0LB 4HYTB 1GW4A 1J1DB 1NYHA 3M06A 1HTLC 1SQXJ 1GK6A 5CHXA 2H89C 1PGJA 1NKZB 2WVRA 3G3ZA 1L0LE 4U3FD 1FOSE 3TGUJ 4PV1C 1RF1C 5AVSB 2O1KA 1JY2P 1AJYA 4KT0J 1VQ8P 1BE3G 2G3AA 2P67A 4L76A 5DJTB 1Q90D 4AQRD 1EDIA 3G6EP 3PTZA 3JCUE 2M8RA 3BATA 4IL6H 1FZBA 1GL2B 3RL0B 3Q5PA 1JY3O 1ZXGA 1D7MA 3II6A 2WWWA 3L75J 2AEJA 3CWBG 4H13C 4H13D 4A7PA 1OWAA 3VYIA 2Z5HA 3WUTA 1VQ9P 1EZVG 1SQBJ 2FFDC 2KK7A 1VQLP 1UIXA 3P8CE 3V5BA 1XTCC 1S72P 3OW2O 1FZGA 5GTHE 1KYOH 4ZMDA 1NTMG 2P1JA 1RF0C 1GDTA 1LTJA 3HUSC 4L73A 1EDJA 4WB4A 3BCCJ 1Q7YQ 1ZP0C 1SQBD 4LGDE 3TGUG 1LGHB 1IFIA 3GW6A 1JCCA 3BRTB 2J58A 3H1IE 3VP8A 1H8AA 3R2PA 1NO4A 1GL2C 1NTKE 3H1HJ 1FZCC 1NTZE 1PP9G 1QEXA 2YNYA 2WMMA 2WSEJ 1J2JB 3CX5E 3LW5H 3P8CD 5KLIB 1GD2E 1VQKP 1AFOA 2RN0A 2OTJP 2YO2A 1KILB 1OIPA 1PP9D 1U57A 1BSNA 3BASA 1IFNA 2P7JA 5KLVJ 1HJ0A 4I1LA 1HUCA 3TK1A 4U3FJ 2W8ZA 1K8AQ 3RK2B 5KTBA 1FJPA 1EDLA 2HPCB 4AUWA 1SQXD 2OARA 2YIUB 4PJ0H 3M0AA 2K9YA 4PD4D 5KLVE 3HRNA 3IN6A 3CX5H 2ZJSE 5DJUB 1OMIA 5M1BA 1X0TA 2ZYDA 3S1KA 1ZN5A 1BSHA 3KXDA 3CL3D 2FYUK 3VN0A 1P84I 1ZRTD 3B5NC 3IFMA 5APYA 3CCUP 3RBXA 2Y0DA 1EZVD 1GL2D 2IZ0A 5BVZA 5AVTB 4N78E 1WMKA 2Y0CA 3AE4C 3CWBD 5B66H 1KMIZ 1L2PA 3H6PA 5AVWB 1PGOA 5AVRB 2W6JH 1KQFB 3HUSB 1AQ5A 5AVVB 2H8PD 2L5GB 2LXBA 3H1HD 2UWJE 5APQA 1BE3D 3TNUB 3CC2P 4TLFA 2R3SA 1KQLA 1SQXG 2KS1B 3B4SA 3QH9A 3PHLA 2IDBA 4JYCA 1JO5A 3L35A 3T97B 1LNQA 1SQQK 1M57D 2N1TB 4L74A 2CPSA 4N3YB 2AEFA 3TNUA 3CCLP 2CK3H 3R4YA 2O01N 5AVYB 2KZIA 1GTWA 3RGUA 1JEKA 1SQPG 4H44B 1GU5A 3HE5B 1YTZI 1VPCA 4ZKUA 1SQBG 5GTIH 4RJTA 2OQQA 2YKPA 2D2CB 1L4AB 1NTMD 2JP3A 3U59A 1P84H 1EC5A 2W6BA 1HH0A 2GM4A 2Z5IA 1RE3A 3HD7C 3Q1MA 4D6TJ 4GT1A 3JCUH 1CI6A 2WSEH 3H1JE 4I2LC 2HODA 4PV1D 5AW4B 3HE4B 2KUBA 1SQPK 3RK3C 2E42A 3CD6P 3KQGA 5CMZA 1J1EC 2D2CD 4BRYB 1NU1E 2M5AA 2D2CC 3MP7B 5B66E 3A3YB 2A45H 3RL0g 2WT7B 1LP1A 1SQXE 1T3UA 1QGKB 3FXDA 2JKVA 3B5ND 4JBZA 5CJ0A 2Q5UA 5C39A 2OYIB 3GMAA 2P2UA 2JJLA 2W90A 2C9NY 4GOFA 3I55P 2PFXA 3M0DA 3P8MC 2HODB 1S4XA 2IPPA 1AV1A 3B5NA 3KPEA 2I1KA 2ZT9D 5AW2B 2M5AB 2GUVA 2FY8A 1N73C 2YO3A 2FYUE 1NTZD 2CPBA 4OH8B 4W80A 2OYIA 3S4RA 2J59M 1DX7A 2GUSA 2W6AA 4O9BA 1VQNP 1Y9BA 3H1HG 1GW3A 4DZOA 2O3JA 4OVNF 3MIWA 1T8ZA 2Q6QA 2YIUC 4I7ZB 5AW0B 1BGYJ 3CXHD 3L72G 3GHGB 1SFCB 1L0NE 3JSVC 3L74G 3VMAA 1JY3P 2NRGA 4MN4C 1S9KD 1FDOA 1MFZA 1SQVJ 3S9OA 2Y9YA 3L36A 1AA0A 2IBZE 2JDIH 2E76C 2KLVA 4IOIH 2QRXA 4Y99B 1H0TA 3AE7C 4PD4E 2BCCE 3MHVA 2QJPC 2IYOA 2YKQA 1BCCE 4Z1MH 1YHQP 2BEZF 3IR9A 3H1LE 1FZCB 5CCGA 1VF5C 1N7SC 1VQ7P 2OYHB 2ITAA 4IL6E 3V2RA 1IJDB 2KZJA 2QIWA 1SQVK 1VL2A 1ZLLA 1NAFA 2B88A 1NHLA 2QE7H 5E79E 1RY3A 2K3RA 2KNCB 2RMZA 3AE6C 4N78D 1S5LE 1ZOYC 2WPVB 1QL1A 1BE3J 2ZYGA 4UB8H 2I1JA 1FDIA 1N86A 3Q3DA 2E5YA 1YQ4C 2JWAA 1OW7A 5GTHH 2ZFCA 4DCKA 1R5SA 2KYVA 3ABVC 2FFDB 1E5WA 1LTJC 4YTPC 4BXLA 1VQ6P 1KC8Q 2QM7A 2WITA 3AEDC 1ZW0A 2WSFH 3G71P 3TGUD 3CWBE 1QVGO 2MJZA 3U1CA 4C7NA 3PRJA 3EFGA 3Q2YA 1YQ3C 3M0DC 2NPSB 5KJ7C 2WSSH 2Q1KA 1JCDA 1T2KD 1EXJA 2KOGA 1EDKA 3V2NA 1LTSC 2N9YB 1PP9E 1M1JC 1MKMA 3D70A 4K35A 2IX7C 5L8RJ 3H25A 3VTPC 3D6YA 2BCCG 1UIIA 1KQGB 3L74J 2K37A 3MTUE 4EIJA 1KB9I 3TF5A 1FE6A 1SQQD 3H1KJ 1SQPJ 2A45G 4H0LC 1PP9J 2IZ1A 3RBZA 3AE5C 3CMAP 1QVFO 3LIEA 2HLOA 3H1IJ 3AE3C 4H13B 1KORA 2RKLA 1RF1A 1EXIA 5AVQB 3N4XA 2E75D 1Y47A 2B87A 2K88A 1EZVE 4WY4B 2G8YA 4U3FG 3T97A 1NTMJ 2IYPA 3AECC 4NPFX 2XNXA 2R44A 5E79H 3L4FA 1SQQE 3SSUA 2N1TD 1AQTA 3H32B 4YXWH 3L72E 4H44C 1JB0J 1S5LH 1H0TB 3WUVA 1KYOI 1KYOD 5APVA 3KYQA 1LTTC 1URQA 1AVOA 3CLQA 4EOTA 1MFTA 3ZDMA 2R3CA 2WTYA 2M3EA 1JNMA 1Q2NA 1IO4A 2YKOA 2KNCA 4WBAA 2A06G 3H32A 2YMKA 4UB6E 3VMXA 1NOHA 1OVRA 1FOSF 2R5DA 1ZR2A 3C1LA 1OW8A 1SQVE 5AW6B 2Q3EA 2V7QJ 3M9HA 2Y0EA 3QWOC 3KHUA 4XA4A 3TYYA 1K73Q 1OVVA 2P58A 2NZ2A 1RH5B 2B9BA 3CCQP 4PV1B 2I8DA 5AVZB 1GU4A 2B87B 1YJNP 1BCCJ 2E76D 1IZNB 1M8OB 5KAFE 1BGYG 1PGQA 2WT7A 2JR8A 4C7NB 1RE3C 1YYCA 3HD7A 1HGVA 2FBWC 2WPSA 1URQC 3Q5SA 4UB6H 1KZUB 1VDFA 2IBZG 3H1JG 1SQBK 2R32A 1N2DC 3C9IA 3CWBJ 2JWDA 3L70J 4R4LA 4XE5B 2R5BA 3VMZA 3NFQA 1LTGC 3B5NB 4DJGA 1MZ9A 3LIDA 2QM8A 2IFNA 4LLHA 4OGQC 5APTA 1BE3E 4OGQD 4U7JA 1N73B 1LT9A 3LW5J 1PGPA 1FZAA 1L4AC 3O8ZA 1NTZK 5CCHD 5KAFH 3D6ZA 1PPJG 3F5HA 1M1JA 2XV5A 3FWLA 2QJYB 3PLNA 5CBNA 3OA7A 1HWTC 1YTZT 3M91A 1FZCA 2SPZA 3FGAD 1KILC 5KLVD 2E74B 3P7KA 1M1KQ 1FDMA 4WWIA 4RESB 4GKGA 1KYOE 2QJKC 2FXMA 1OXZA 1QL2A 3V6IA 3H1LJ 2WSCH 2FYUD 3H1JJ 2KXPB 3RK3D 1NWQA 3BVHA 1PIXA 4AYCA 1HGZA 3HD7B 1LTJB 1L0NG 3L74E 1YBKA 2E74D 3H1IG 1T6AA 2W83C 3L71G 3MUDA 1JY2O 1N7LA 3V4QA 2PRRA 3BCCD 1SQPE 4GDOA 3PJSK 3L73J 3RL0D 1DIPA 3KZIH 3CMEP 2QSIA 4RO0A 1XTGB 5APSA 2ZVOB 3G4SP 3V2QA 2QA4P 1LTBC 3B8EB 1NU1D 4LC1A 3MGNA 1NTMK 3M9BA 1HJBA 1IK9A 3L73E 1FBMA 1KB9E 3L75D 2E75B 1SQVD 2AXTE 3CXHI 3E7KA 3RK2D 2QVAA 3WUUA 2BEQD 3EQ2A 4L75A 5K5GB 1RE4C 2PAJA 3D71A 3H1LG 1QLED 1PL5A 2H88C 1K04A 1SQVG 3FWNA 4ZNCA 1LJ2A 2GA1A 1DEBA 3CCEP 3TGUE 2KP8A 5AW7B 3SWYA 2YXQB 1VQMP 1LT9C 1NTKD 1USDA 3A2AA 3SWKA 3CC4P 1GL2A 1KB9D 3GHGC 3L75E 4NPDA 4K3AA 3WMM0 1NAYA 1SFCA 2OYOA 4D6TG 4I6MC 4ZKPA 3UIAA 4KJMA 3AE2C 2WZ7A 3G9RA 2HPCA 1YITP 3HUSA 3GG2A 1G1JA 1JOCA 1VF5B 2FXPA 2HFED 4BWNA 3CCSP 3L71D 1MV8A 1OX3A 4ASWA 1L0ND 1S9KE 2AXCA 2O01H 4YXDC 2E43A 1SFCD 1RE4A 2A06E 2IFMA 1IFPA 3FX0A 4TT3H 1NTME 3C8VA 3EFFK 3KDPB 3A0BH 4IFMA 4QMAA 3A0BE 1G2CA 3L37A 4Y99C 3RK3E 1BCCD 3A5TA 3HE4A 1NJIQ 2MKVA 3H1HE 2LKMA 2OYHA 2ZAEB 3L73G 4GOEA 1DD3A 2C0XA 1NH4A 2O1JA 2XDJA 3I5CA 3CI9A 1L0LG 3A7OA 5KLVK 2Z4EA 3SWFA 1NU1J 1LP1B 3L70G 5TISE 1X8YA 3WU2E 3SFDC 1KILA 2IBZI 1M7LA 3L70D 3HTKA 4OGQB 4C7RA 2AXTH 5KLIC 1L0LD 1KB9H 2O01J 2PGDA 4R4MA 1X9VA 3HE5A 4U3FE 3U1AA 5BU8B 1N7SD 1LWUC 3L73D 2XKMA 1E79H 2QEXP 4JPZB 1KD1Q 1YJWP 1FZFA 2BCCJ 2KLUA 2QJPB 1VQ5P 1KILD 1L4AA 1TU3F 3NTNA 1VQPP 1SS1A 3H1KG 5EFWB 1NTKK 1YI2P 2FYUJ 3H1JD 2HR3A 3PH0A 1L0LJ 3HTKB 4EDFA 1CZQA 1Z56A 1Q86Q 1BGYD 2M0BA 5CCHC 4I7ZC 2K9JA 1J1EB 5APXA 1G2CB 3AEAC 2WPQA 2NPSD 4B86A 4M3LA 3O6QA 1JTHB 3HD7D 3RK3B 5AW8B 1R8EA 4WVZA 4JYBA 2K1AA 4H44D 3CXHH 2DW3A 1PPJE 1T2KC 2LXCB 3H1ID 5KJ7D 2ZT9B 5APUA 2N9BA 1IK7A 1SQBE 2XU6A 4ASVA 1FC2C 1LT1A 5KAIH 1P84D 3H1KD 1N73A 1SQQJ 1EQ7A 2XNDH 5CCGD 1A02F 3L71J 1X22A 4WY4A 3L72J 1FS0E 4HH2A 5AVUB 5AW3B 1M1JB 3B71A 1CSBA 4HKZH 2B89A 4W7ZA 3CXHE 3Q5RA 1WRGA 4WY4C 2OYHC 1L0LK 3MD0A 4WY4D 3V4WA 1QX8A 1NTKJ 1SP4A 3AE8C 3VP9A 2C9LY 3H1KE 1W5CE 2LR2A 3CCMP 1USEA 1CW5A 1W2BO 4GODA 5APWA 1BCCG 2V4HA 1VQ4P 1S5LX 3VMYA 1DD4A 3O6QB 1N8RQ 1NU1K 2NPSA 1DH3A 1LTAC 2RH0A 2JO1A 2AEMA 1X79B 3VOPA 1WT6A 3F89A 1FAVA 4UB8E 1PV3A 1PFIA 5H2FE 1ZMEC 2BCCD 2KSJA 3GHGA 1HBWA 1L4AD 1AVYA 4GIFA 2L91A 3KZIE 5KLVG 4HJGH 3TDKA 2ZYAA 2KB7P 3RL0C 2YMYA 3W67A 4D6TD 2E75C 2OGUA 1Y8AA 1RF0A 3V2PA
chains in the Genus database with same CATH topology
2KZJA 2B88A 2K3RA 4ZMDA 5K5GB 2QVAA 2WMMA 4NPEA 1BDDA 1U7MA 4BXLA 4ZNCA 1ZW0A 1EDLA 1S3JA 2Q1KA 4NPDA 4CPGA 4K3AA 1EDKA 5DJUB 4KJMA 1X0TA 3S1KA 4K35A 1BDCA 4ASWA 4EYYQ 2RKLA 2LXBA 1DEEG 2KIKA 1Y47A 2B87A 2OTKE 2UWJE 2ZAEB 4GOEA 2KS1B 1LP1B 4NPFX 4HB1A 2R44A 5CBOA 1OVUA 2KI7B 1NVOA 1MFTA 3ZDMA 2KZIA 1SS1A 1Q2NA 5EFWB 3RGUA 2HR3A 3PH0A 3FXEA 1OVRA 2M0BA 3QWOC 1EC5A 3MZWB 1OVVA 2P58A 2I8DA 2B87B 1U7JA 1JM0A 2KUBA 2LXCB 1JMBA 4ASVA 2M5AA 1FC2C 1LT1A 1LP1A 3FXDA 2JWDA 4JBZA 5C39A 4GOFA 4HKZH 2B89A 2M5AB 2LR2A 5CBNA 2SPZA 4GODA 5DJTB 4WWIA 1EDIA 4MN4C 1ZXGA 1H0TA 4IOIH 2QRXA 3MHVA 4HJGH 1H0TB 1EDJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2KZJ A;  2B88 A;  2K3R A;  4ZMD A;  5K5G B;  2QVA A;  2WMM A;  4NPE A;  1BDD A;  1U7M A;  4BXL A;  4ZNC A;  1ZW0 A;  1EDL A;  1S3J A;  2Q1K A;  4NPD A;  4CPG A;  4K3A A;  1EDK A;  5DJU B;  4KJM A;  1X0T A;  3S1K A;  4K35 A;  1BDC A;  4ASW A;  4EYY Q;  2RKL A;  2LXB A;  1DEE G;  2KIK A;  1Y47 A;  2B87 A;  2OTK E;  2UWJ E;  2ZAE B;  4GOE A;  2KS1 B;  1LP1 B;  4NPF X;  4HB1 A;  2R44 A;  5CBO A;  1OVU A;  2KI7 B;  1NVO A;  1MFT A;  3ZDM A;  2KZI A;  1SS1 A;  1Q2N A;  5EFW B;  3RGU A;  2HR3 A;  3PH0 A;  3FXE A;  1OVR A;  2M0B A;  3QWO C;  1EC5 A;  3MZW B;  1OVV A;  2P58 A;  2I8D A;  2B87 B;  1U7J A;  1JM0 A;  2KUB A;  2LXC B;  1JMB A;  4ASV A;  2M5A A;  1FC2 C;  1LT1 A;  1LP1 A;  3FXD A;  2JWD A;  4JBZ A;  5C39 A;  4GOF A;  4HKZ H;  2B89 A;  2M5A B;  2LR2 A;  5CBN A;  2SPZ A;  4GOD A;  5DJT B;  4WWI A;  1EDI A;  4MN4 C;  1ZXG A;  1H0T A;  4IOI H;  2QRX A;  3MHV A;  4HJG H;  1H0T B;  1EDJ A; 
#chains in the Genus database with same CATH topology
 1OFC X;  1KFN A;  1URQ D;  3WU2 H;  1NTK G;  5TIS H;  1LWU A;  3OJA B;  2Q9I A;  1GK4 A;  2JEE A;  5AW1 B;  1RF1 B;  1GZL A;  3AEG C;  3K5B A;  2QJY C;  1JY2 N;  1RHZ B;  1KFM A;  2KSE A;  3AE1 C;  4PD4 H;  5KAI E;  3MUD C;  4C46 A;  4DOJ A;  5B5E E;  5CJ4 A;  5KJ7 A;  1LT9 B;  3H1L D;  5AW5 B;  1P84 E;  3JC2 2;  1PZQ A;  4IFF A;  3CCR P;  1KTM A;  1S2E A;  4NPE A;  3USS A;  3IF4 A;  2J5U A;  1BDD A;  1U7M A;  3GLM A;  1T3J A;  4Y28 J;  3L75 G;  2IBZ D;  1L0N J;  2FYN C;  5AVX B;  1N7S B;  1NU1 G;  3P32 A;  1FZE A;  1NTZ J;  5GTI E;  1JUN A;  2FYZ A;  2WSF J;  4YPC A;  1S3J A;  2QJK B;  3A0H E;  4CPG A;  1EZV I;  2HG5 D;  3NMD A;  1HVV A;  5AW9 B;  1Q81 Q;  2ZVN B;  1YIJ P;  3NXS A;  3OAK A;  2FFD A;  2OTL P;  3CX5 D;  4JQ0 D;  3M9Q A;  3IAO A;  1A02 J;  3BCC G;  1IC2 A;  3CX5 I;  5CCG C;  1BDC A;  4W7Y A;  1KQS O;  3PP5 A;  1N7S A;  3RK2 C;  3CCV P;  1KV4 A;  1HF9 A;  1SFC C;  5BU5 A;  3TSI A;  1CI6 B;  1W2E A;  1SQQ G;  2FYU G;  2P10 A;  3CC7 P;  2FKW B;  2ZT9 C;  2FXO A;  4EYY Q;  1IFJ A;  1BGY E;  1H89 A;  2NPS C;  1H88 A;  3BRV B;  1DEE G;  2KIK A;  2OTK E;  3BCC E;  3E1I A;  3L71 E;  1K05 A;  3CPW O;  1YJ9 P;  4RKU J;  5KKZ B;  2FYN B;  1ZRT E;  1URQ B;  2E74 C;  3AE9 C;  1SVF A;  1NTZ G;  4N6J A;  2YXR B;  4HB1 A;  5CBO A;  1M90 Q;  1KN7 A;  1FJK A;  1OVU A;  1PPJ D;  1SLQ A;  1L0N K;  1JMM A;  1NVO A;  1FU1 A;  2KI7 B;  2PP6 A;  2ZXE B;  2ZXX A;  2K9J B;  4XFJ A;  2OYI C;  4DT0 A;  4IL6 X;  2QG4 A;  1NGM B;  1IFM A;  1JTH A;  3EWK A;  4PJ0 E;  2N1T A;  1JY3 N;  1K9M Q;  1LWU B;  2Q7C A;  2VRS A;  5TJH A;  4JF7 A;  3L70 E;  2N1T C;  1R5L A;  2KS1 A;  3AEF C;  3GF7 A;  3FXE A;  3I56 P;  2V7Q H;  2WSC J;  4KHX A;  2BAS A;  3ITK A;  2Q3I A;  3A0H H;  5B5E H;  1KIL E;  3MZW B;  1OZH A;  3SFE C;  1MUU A;  1LTI C;  2E76 B;  2XZR A;  3E1R A;  2HYN A;  3GF3 A;  3W68 A;  2W27 A;  4PD4 I;  2H43 A;  1U7J A;  3AEB C;  1Q82 Q;  1JM0 A;  2POH A;  2C0W A;  2A45 I;  4H0L D;  1SQX K;  1JMB A;  2A06 D;  2M3B A;  3N7N A;  2WPR A;  1J1D C;  1M56 D;  2H7H A;  1SQP D;  1GMJ A;  5CCH A;  5H2F H;  1IFD A;  1S1C X;  2Y9Z A;  3AEE C;  3L74 D;  4BRY A;  5KKZ C;  4D6T E;  1RQU A;  3L72 D;  4EI2 A;  3CCJ P;  4OWF A;  1VF5 D;  2E5T A;  1ZV8 A;  1G1I A;  1OW6 A;  1NKN A;  2WQY C;  1RQV A;  1ZR4 A;  1VQO P;  4IFD K;  4H0L B;  4HYT B;  1GW4 A;  1J1D B;  1NYH A;  3M06 A;  1HTL C;  1SQX J;  1GK6 A;  5CHX A;  2H89 C;  1PGJ A;  1NKZ B;  2WVR A;  3G3Z A;  1L0L E;  4U3F D;  1FOS E;  3TGU J;  4PV1 C;  1RF1 C;  5AVS B;  2O1K A;  1JY2 P;  1AJY A;  4KT0 J;  1VQ8 P;  1BE3 G;  2G3A A;  2P67 A;  4L76 A;  5DJT B;  1Q90 D;  4AQR D;  1EDI A;  3G6E P;  3PTZ A;  3JCU E;  2M8R A;  3BAT A;  4IL6 H;  1FZB A;  1GL2 B;  3RL0 B;  3Q5P A;  1JY3 O;  1ZXG A;  1D7M A;  3II6 A;  2WWW A;  3L75 J;  2AEJ A;  3CWB G;  4H13 C;  4H13 D;  4A7P A;  1OWA A;  3VYI A;  2Z5H A;  3WUT A;  1VQ9 P;  1EZV G;  1SQB J;  2FFD C;  2KK7 A;  1VQL P;  1UIX A;  3P8C E;  3V5B A;  1XTC C;  1S72 P;  3OW2 O;  1FZG A;  5GTH E;  1KYO H;  4ZMD A;  1NTM G;  2P1J A;  1RF0 C;  1GDT A;  1LTJ A;  3HUS C;  4L73 A;  1EDJ A;  4WB4 A;  3BCC J;  1Q7Y Q;  1ZP0 C;  1SQB D;  4LGD E;  3TGU G;  1LGH B;  1IFI A;  3GW6 A;  1JCC A;  3BRT B;  2J58 A;  3H1I E;  3VP8 A;  1H8A A;  3R2P A;  1NO4 A;  1GL2 C;  1NTK E;  3H1H J;  1FZC C;  1NTZ E;  1PP9 G;  1QEX A;  2YNY A;  2WMM A;  2WSE J;  1J2J B;  3CX5 E;  3LW5 H;  3P8C D;  5KLI B;  1GD2 E;  1VQK P;  1AFO A;  2RN0 A;  2OTJ P;  2YO2 A;  1KIL B;  1OIP A;  1PP9 D;  1U57 A;  1BSN A;  3BAS A;  1IFN A;  2P7J A;  5KLV J;  1HJ0 A;  4I1L A;  1HUC A;  3TK1 A;  4U3F J;  2W8Z A;  1K8A Q;  3RK2 B;  5KTB A;  1FJP A;  1EDL A;  2HPC B;  4AUW A;  1SQX D;  2OAR A;  2YIU B;  4PJ0 H;  3M0A A;  2K9Y A;  4PD4 D;  5KLV E;  3HRN A;  3IN6 A;  3CX5 H;  2ZJS E;  5DJU B;  1OMI A;  5M1B A;  1X0T A;  2ZYD A;  3S1K A;  1ZN5 A;  1BSH A;  3KXD A;  3CL3 D;  2FYU K;  3VN0 A;  1P84 I;  1ZRT D;  3B5N C;  3IFM A;  5APY A;  3CCU P;  3RBX A;  2Y0D A;  1EZV D;  1GL2 D;  2IZ0 A;  5BVZ A;  5AVT B;  4N78 E;  1WMK A;  2Y0C A;  3AE4 C;  3CWB D;  5B66 H;  1KMI Z;  1L2P A;  3H6P A;  5AVW B;  1PGO A;  5AVR B;  2W6J H;  1KQF B;  3HUS B;  1AQ5 A;  5AVV B;  2H8P D;  2L5G B;  2LXB A;  3H1H D;  2UWJ E;  5APQ A;  1BE3 D;  3TNU B;  3CC2 P;  4TLF A;  2R3S A;  1KQL A;  1SQX G;  2KS1 B;  3B4S A;  3QH9 A;  3PHL A;  2IDB A;  4JYC A;  1JO5 A;  3L35 A;  3T97 B;  1LNQ A;  1SQQ K;  1M57 D;  2N1T B;  4L74 A;  2CPS A;  4N3Y B;  2AEF A;  3TNU A;  3CCL P;  2CK3 H;  3R4Y A;  2O01 N;  5AVY B;  2KZI A;  1GTW A;  3RGU A;  1JEK A;  1SQP G;  4H44 B;  1GU5 A;  3HE5 B;  1YTZ I;  1VPC A;  4ZKU A;  1SQB G;  5GTI H;  4RJT A;  2OQQ A;  2YKP A;  2D2C B;  1L4A B;  1NTM D;  2JP3 A;  3U59 A;  1P84 H;  1EC5 A;  2W6B A;  1HH0 A;  2GM4 A;  2Z5I A;  1RE3 A;  3HD7 C;  3Q1M A;  4D6T J;  4GT1 A;  3JCU H;  1CI6 A;  2WSE H;  3H1J E;  4I2L C;  2HOD A;  4PV1 D;  5AW4 B;  3HE4 B;  2KUB A;  1SQP K;  3RK3 C;  2E42 A;  3CD6 P;  3KQG A;  5CMZ A;  1J1E C;  2D2C D;  4BRY B;  1NU1 E;  2M5A A;  2D2C C;  3MP7 B;  5B66 E;  3A3Y B;  2A45 H;  3RL0 g;  2WT7 B;  1LP1 A;  1SQX E;  1T3U A;  1QGK B;  3FXD A;  2JKV A;  3B5N D;  4JBZ A;  5CJ0 A;  2Q5U A;  5C39 A;  2OYI B;  3GMA A;  2P2U A;  2JJL A;  2W90 A;  2C9N Y;  4GOF A;  3I55 P;  2PFX A;  3M0D A;  3P8M C;  2HOD B;  1S4X A;  2IPP A;  1AV1 A;  3B5N A;  3KPE A;  2I1K A;  2ZT9 D;  5AW2 B;  2M5A B;  2GUV A;  2FY8 A;  1N73 C;  2YO3 A;  2FYU E;  1NTZ D;  2CPB A;  4OH8 B;  4W80 A;  2OYI A;  3S4R A;  2J59 M;  1DX7 A;  2GUS A;  2W6A A;  4O9B A;  1VQN P;  1Y9B A;  3H1H G;  1GW3 A;  4DZO A;  2O3J A;  4OVN F;  3MIW A;  1T8Z A;  2Q6Q A;  2YIU C;  4I7Z B;  5AW0 B;  1BGY J;  3CXH D;  3L72 G;  3GHG B;  1SFC B;  1L0N E;  3JSV C;  3L74 G;  3VMA A;  1JY3 P;  2NRG A;  4MN4 C;  1S9K D;  1FDO A;  1MFZ A;  1SQV J;  3S9O A;  2Y9Y A;  3L36 A;  1AA0 A;  2IBZ E;  2JDI H;  2E76 C;  2KLV A;  4IOI H;  2QRX A;  4Y99 B;  1H0T A;  3AE7 C;  4PD4 E;  2BCC E;  3MHV A;  2QJP C;  2IYO A;  2YKQ A;  1BCC E;  4Z1M H;  1YHQ P;  2BEZ F;  3IR9 A;  3H1L E;  1FZC B;  5CCG A;  1VF5 C;  1N7S C;  1VQ7 P;  2OYH B;  2ITA A;  4IL6 E;  3V2R A;  1IJD B;  2KZJ A;  2QIW A;  1SQV K;  1VL2 A;  1ZLL A;  1NAF A;  2B88 A;  1NHL A;  2QE7 H;  5E79 E;  1RY3 A;  2K3R A;  2KNC B;  2RMZ A;  3AE6 C;  4N78 D;  1S5L E;  1ZOY C;  2WPV B;  1QL1 A;  1BE3 J;  2ZYG A;  4UB8 H;  2I1J A;  1FDI A;  1N86 A;  3Q3D A;  2E5Y A;  1YQ4 C;  2JWA A;  1OW7 A;  5GTH H;  2ZFC A;  4DCK A;  1R5S A;  2KYV A;  3ABV C;  2FFD B;  1E5W A;  1LTJ C;  4YTP C;  4BXL A;  1VQ6 P;  1KC8 Q;  2QM7 A;  2WIT A;  3AED C;  1ZW0 A;  2WSF H;  3G71 P;  3TGU D;  3CWB E;  1QVG O;  2MJZ A;  3U1C A;  4C7N A;  3PRJ A;  3EFG A;  3Q2Y A;  1YQ3 C;  3M0D C;  2NPS B;  5KJ7 C;  2WSS H;  2Q1K A;  1JCD A;  1T2K D;  1EXJ A;  2KOG A;  1EDK A;  3V2N A;  1LTS C;  2N9Y B;  1PP9 E;  1M1J C;  1MKM A;  3D70 A;  4K35 A;  2IX7 C;  5L8R J;  3H25 A;  3VTP C;  3D6Y A;  2BCC G;  1UII A;  1KQG B;  3L74 J;  2K37 A;  3MTU E;  4EIJ A;  1KB9 I;  3TF5 A;  1FE6 A;  1SQQ D;  3H1K J;  1SQP J;  2A45 G;  4H0L C;  1PP9 J;  2IZ1 A;  3RBZ A;  3AE5 C;  3CMA P;  1QVF O;  3LIE A;  2HLO A;  3H1I J;  3AE3 C;  4H13 B;  1KOR A;  2RKL A;  1RF1 A;  1EXI A;  5AVQ B;  3N4X A;  2E75 D;  1Y47 A;  2B87 A;  2K88 A;  1EZV E;  4WY4 B;  2G8Y A;  4U3F G;  3T97 A;  1NTM J;  2IYP A;  3AEC C;  4NPF X;  2XNX A;  2R44 A;  5E79 H;  3L4F A;  1SQQ E;  3SSU A;  2N1T D;  1AQT A;  3H32 B;  4YXW H;  3L72 E;  4H44 C;  1JB0 J;  1S5L H;  1H0T B;  3WUV A;  1KYO I;  1KYO D;  5APV A;  3KYQ A;  1LTT C;  1URQ A;  1AVO A;  3CLQ A;  4EOT A;  1MFT A;  3ZDM A;  2R3C A;  2WTY A;  2M3E A;  1JNM A;  1Q2N A;  1IO4 A;  2YKO A;  2KNC A;  4WBA A;  2A06 G;  3H32 A;  2YMK A;  4UB6 E;  3VMX A;  1NOH A;  1OVR A;  1FOS F;  2R5D A;  1ZR2 A;  3C1L A;  1OW8 A;  1SQV E;  5AW6 B;  2Q3E A;  2V7Q J;  3M9H A;  2Y0E A;  3QWO C;  3KHU A;  4XA4 A;  3TYY A;  1K73 Q;  1OVV A;  2P58 A;  2NZ2 A;  1RH5 B;  2B9B A;  3CCQ P;  4PV1 B;  2I8D A;  5AVZ B;  1GU4 A;  2B87 B;  1YJN P;  1BCC J;  2E76 D;  1IZN B;  1M8O B;  5KAF E;  1BGY G;  1PGQ A;  2WT7 A;  2JR8 A;  4C7N B;  1RE3 C;  1YYC A;  3HD7 A;  1HGV A;  2FBW C;  2WPS A;  1URQ C;  3Q5S A;  4UB6 H;  1KZU B;  1VDF A;  2IBZ G;  3H1J G;  1SQB K;  2R32 A;  1N2D C;  3C9I A;  3CWB J;  2JWD A;  3L70 J;  4R4L A;  4XE5 B;  2R5B A;  3VMZ A;  3NFQ A;  1LTG C;  3B5N B;  4DJG A;  1MZ9 A;  3LID A;  2QM8 A;  2IFN A;  4LLH A;  4OGQ C;  5APT A;  1BE3 E;  4OGQ D;  4U7J A;  1N73 B;  1LT9 A;  3LW5 J;  1PGP A;  1FZA A;  1L4A C;  3O8Z A;  1NTZ K;  5CCH D;  5KAF H;  3D6Z A;  1PPJ G;  3F5H A;  1M1J A;  2XV5 A;  3FWL A;  2QJY B;  3PLN A;  5CBN A;  3OA7 A;  1HWT C;  1YTZ T;  3M91 A;  1FZC A;  2SPZ A;  3FGA D;  1KIL C;  5KLV D;  2E74 B;  3P7K A;  1M1K Q;  1FDM A;  4WWI A;  4RES B;  4GKG A;  1KYO E;  2QJK C;  2FXM A;  1OXZ A;  1QL2 A;  3V6I A;  3H1L J;  2WSC H;  2FYU D;  3H1J J;  2KXP B;  3RK3 D;  1NWQ A;  3BVH A;  1PIX A;  4AYC A;  1HGZ A;  3HD7 B;  1LTJ B;  1L0N G;  3L74 E;  1YBK A;  2E74 D;  3H1I G;  1T6A A;  2W83 C;  3L71 G;  3MUD A;  1JY2 O;  1N7L A;  3V4Q A;  2PRR A;  3BCC D;  1SQP E;  4GDO A;  3PJS K;  3L73 J;  3RL0 D;  1DIP A;  3KZI H;  3CME P;  2QSI A;  4RO0 A;  1XTG B;  5APS A;  2ZVO B;  3G4S P;  3V2Q A;  2QA4 P;  1LTB C;  3B8E B;  1NU1 D;  4LC1 A;  3MGN A;  1NTM K;  3M9B A;  1HJB A;  1IK9 A;  3L73 E;  1FBM A;  1KB9 E;  3L75 D;  2E75 B;  1SQV D;  2AXT E;  3CXH I;  3E7K A;  3RK2 D;  2QVA A;  3WUU A;  2BEQ D;  3EQ2 A;  4L75 A;  5K5G B;  1RE4 C;  2PAJ A;  3D71 A;  3H1L G;  1QLE D;  1PL5 A;  2H88 C;  1K04 A;  1SQV G;  3FWN A;  4ZNC A;  1LJ2 A;  2GA1 A;  1DEB A;  3CCE P;  3TGU E;  2KP8 A;  5AW7 B;  3SWY A;  2YXQ B;  1VQM P;  1LT9 C;  1NTK D;  1USD A;  3A2A A;  3SWK A;  3CC4 P;  1GL2 A;  1KB9 D;  3GHG C;  3L75 E;  4NPD A;  4K3A A;  3WMM 0;  1NAY A;  1SFC A;  2OYO A;  4D6T G;  4I6M C;  4ZKP A;  3UIA A;  4KJM A;  3AE2 C;  2WZ7 A;  3G9R A;  2HPC A;  1YIT P;  3HUS A;  3GG2 A;  1G1J A;  1JOC A;  1VF5 B;  2FXP A;  2HFE D;  4BWN A;  3CCS P;  3L71 D;  1MV8 A;  1OX3 A;  4ASW A;  1L0N D;  1S9K E;  2AXC A;  2O01 H;  4YXD C;  2E43 A;  1SFC D;  1RE4 A;  2A06 E;  2IFM A;  1IFP A;  3FX0 A;  4TT3 H;  1NTM E;  3C8V A;  3EFF K;  3KDP B;  3A0B H;  4IFM A;  4QMA A;  3A0B E;  1G2C A;  3L37 A;  4Y99 C;  3RK3 E;  1BCC D;  3A5T A;  3HE4 A;  1NJI Q;  2MKV A;  3H1H E;  2LKM A;  2OYH A;  2ZAE B;  3L73 G;  4GOE A;  1DD3 A;  2C0X A;  1NH4 A;  2O1J A;  2XDJ A;  3I5C A;  3CI9 A;  1L0L G;  3A7O A;  5KLV K;  2Z4E A;  3SWF A;  1NU1 J;  1LP1 B;  3L70 G;  5TIS E;  1X8Y A;  3WU2 E;  3SFD C;  1KIL A;  2IBZ I;  1M7L A;  3L70 D;  3HTK A;  4OGQ B;  4C7R A;  2AXT H;  5KLI C;  1L0L D;  1KB9 H;  2O01 J;  2PGD A;  4R4M A;  1X9V A;  3HE5 A;  4U3F E;  3U1A A;  5BU8 B;  1N7S D;  1LWU C;  3L73 D;  2XKM A;  1E79 H;  2QEX P;  4JPZ B;  1KD1 Q;  1YJW P;  1FZF A;  2BCC J;  2KLU A;  2QJP B;  1VQ5 P;  1KIL D;  1L4A A;  1TU3 F;  3NTN A;  1VQP P;  1SS1 A;  3H1K G;  5EFW B;  1NTK K;  1YI2 P;  2FYU J;  3H1J D;  2HR3 A;  3PH0 A;  1L0L J;  3HTK B;  4EDF A;  1CZQ A;  1Z56 A;  1Q86 Q;  1BGY D;  2M0B A;  5CCH C;  4I7Z C;  2K9J A;  1J1E B;  5APX A;  1G2C B;  3AEA C;  2WPQ A;  2NPS D;  4B86 A;  4M3L A;  3O6Q A;  1JTH B;  3HD7 D;  3RK3 B;  5AW8 B;  1R8E A;  4WVZ A;  4JYB A;  2K1A A;  4H44 D;  3CXH H;  2DW3 A;  1PPJ E;  1T2K C;  2LXC B;  3H1I D;  5KJ7 D;  2ZT9 B;  5APU A;  2N9B A;  1IK7 A;  1SQB E;  2XU6 A;  4ASV A;  1FC2 C;  1LT1 A;  5KAI H;  1P84 D;  3H1K D;  1N73 A;  1SQQ J;  1EQ7 A;  2XND H;  5CCG D;  1A02 F;  3L71 J;  1X22 A;  4WY4 A;  3L72 J;  1FS0 E;  4HH2 A;  5AVU B;  5AW3 B;  1M1J B;  3B71 A;  1CSB A;  4HKZ H;  2B89 A;  4W7Z A;  3CXH E;  3Q5R A;  1WRG A;  4WY4 C;  2OYH C;  1L0L K;  3MD0 A;  4WY4 D;  3V4W A;  1QX8 A;  1NTK J;  1SP4 A;  3AE8 C;  3VP9 A;  2C9L Y;  3H1K E;  1W5C E;  2LR2 A;  3CCM P;  1USE A;  1CW5 A;  1W2B O;  4GOD A;  5APW A;  1BCC G;  2V4H A;  1VQ4 P;  1S5L X;  3VMY A;  1DD4 A;  3O6Q B;  1N8R Q;  1NU1 K;  2NPS A;  1DH3 A;  1LTA C;  2RH0 A;  2JO1 A;  2AEM A;  1X79 B;  3VOP A;  1WT6 A;  3F89 A;  1FAV A;  4UB8 E;  1PV3 A;  1PFI A;  5H2F E;  1ZME C;  2BCC D;  2KSJ A;  3GHG A;  1HBW A;  1L4A D;  1AVY A;  4GIF A;  2L91 A;  3KZI E;  5KLV G;  4HJG H;  3TDK A;  2ZYA A;  2KB7 P;  3RL0 C;  2YMY A;  3W67 A;  4D6T D;  2E75 C;  2OGU A;  1Y8A A;  1RF0 A;  3V2P A; 
#chains in the Genus database with same CATH homology
 2KZJ A;  2B88 A;  2K3R A;  4ZMD A;  5K5G B;  2QVA A;  2WMM A;  4NPE A;  1BDD A;  1U7M A;  4BXL A;  4ZNC A;  1ZW0 A;  1EDL A;  1S3J A;  2Q1K A;  4NPD A;  4CPG A;  4K3A A;  1EDK A;  5DJU B;  4KJM A;  1X0T A;  3S1K A;  4K35 A;  1BDC A;  4ASW A;  4EYY Q;  2RKL A;  2LXB A;  1DEE G;  2KIK A;  1Y47 A;  2B87 A;  2OTK E;  2UWJ E;  2ZAE B;  4GOE A;  2KS1 B;  1LP1 B;  4NPF X;  4HB1 A;  2R44 A;  5CBO A;  1OVU A;  2KI7 B;  1NVO A;  1MFT A;  3ZDM A;  2KZI A;  1SS1 A;  1Q2N A;  5EFW B;  3RGU A;  2HR3 A;  3PH0 A;  3FXE A;  1OVR A;  2M0B A;  3QWO C;  1EC5 A;  3MZW B;  1OVV A;  2P58 A;  2I8D A;  2B87 B;  1U7J A;  1JM0 A;  2KUB A;  2LXC B;  1JMB A;  4ASV A;  2M5A A;  1FC2 C;  1LT1 A;  1LP1 A;  3FXD A;  2JWD A;  4JBZ A;  5C39 A;  4GOF A;  4HKZ H;  2B89 A;  2M5A B;  2LR2 A;  5CBN A;  2SPZ A;  4GOD A;  5DJT B;  4WWI A;  1EDI A;  4MN4 C;  1ZXG A;  1H0T A;  4IOI H;  2QRX A;  3MHV A;  4HJG H;  1H0T B;  1EDJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...