5DJUB

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
NKFNKEVLVARQEIYWLPNLNWEQKFAFISSLTNDPSQSANLLAEAKKLNGAQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
molecule keywords Engineered protein, Zdk3 affibody
total genus 20
structure length 55
sequence length 55
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djuB00
2M5AA 5K5GB 1LP1B 1ZW0A 2WMMA 2SPZA 2KI7B 1BDDA 2KZJA 4NPFX 2OTKE 2M5AB 4IOIH 1LP1A 5C39A 2HR3A 2LXCB 5CBOA 2LXBA 4K35A 4HJGH 1EC5A 2JWDA 3FXEA 4BXLA 1H0TA 5DJUB 1NVOA 3QWOC 4ASWA 2KS1B 4NPEA 3MZWB 1LT1A 4NPDA 3S1KA 2KZIA 2KUBA 1EDJA 1Y47A 2I8DA 1BDCA 3FXDA 4HKZH 2B88A 1SS1A 2ZAEB 1OVVA 1OVUA 1OVRA 2KIKA 1EDLA 4GOEA 1JM0A 2UWJE 5DJTB 1U7JA 1X0TA 5EFWB 4WWIA 2Q1KA 1EDIA 2B87A 4KJMA 4ZMDA 1Q2NA 1EDKA 5CBNA 4K3AA 1DEEG 1U7MA 4MN4C 2B87B 4ASVA 2QVAA 3PH0A 2LR2A 1H0TB 4GOFA 2P58A 2M0BA 3RGUA 4CPGA 1JMBA 4JBZA 3MHVA 2K3RA 1ZXGA 2QRXA 4ZNCA 2B89A 2R44A 3ZDMA 1S3JA 4GODA 4HB1A 1FC2C 4EYYQ 2RKLA 1MFTA
chains in the Genus database with same CATH superfamily
1VL2A 1GDTA 2M5AA 1SQPD 1NU1J 2KSJA 4U3FD 3Q2YA 2IBZD 3V2PA 2Q3IA 1KMIZ 4U3FG 1FE6A 2JWAA 1HTLC 2E5TA 1SQBJ 2XDJA 1QL1A 3AEGC 2YKPA 5APWA 2KI7B 3L72E 3OJAB 2H7HA 2N1TD 1BE3E 2FBWC 1BDDA 2HG5D 3O8ZA 2Q9IA 4Z1MH 1SQQG 1JY3O 1MFZA 1JY2O 1L0LD 2M5AB 2Z5HA 2JJLA 2PAJA 3CI9A 3E1IA 1SQQD 3L70E 4IOIH 3RL0B 3VP8A 4WY4C 1QLED 1T3UA 2HR3A 2LXCB 4YTPC 1FJPA 1YIJP 1EZVI 5KAFE 2LXBA 1R8EA 4O9BA 4DT0A 1EC5A 4BXLA 1SQXK 2QG4A 1LTJB 1SQBE 2YNYA 3BCCE 1FZCA 2PFXA 2GA1A 1UIXA 3P7KA 1S5LX 1X22A 4W7YA 1SQVK 1G1IA 2C0XA 2YXRB 1HGVA 2QJYB 3AE6C 1NTKJ 3H1JG 1GK4A 4M3LA 3L75G 1LTBC 3TK1A 1NH4A 3TF5A 1D7MA 2YKQA 3HTKA 2KS1B 4NPEA 3CCMP 1N8RQ 2Q3EA 3JC22 3L75D 1QVFO 2N9YB 1L4AA 2QM8A 3VMYA 1NJIQ 2J5UA 3EFFK 4LLHA 5CJ0A 5H2FH 1NGMB 1YHQP 3L73G 2OYHB 1M1JA 1Y9BA 1S9KD 2QJKC 5AVYB 3LIEA 1JY2P 1N7LA 3G71P 1FDIA 3BCCJ 4PV1C 5APVA 3QH9A 4WY4A 1WMKA 3CX5H 1VF5B 3H25A 2C9NY 1SS1A 1KQSO 3AEBC 1RF1B 4C7RA 1J1DB 1FZGA 1X8YA 2V4HA 3CXHD 1OVVA 1OVUA 2YO2A 3IN6A 2JR8A 1PGOA 4RKUJ 1OVRA 1N7SB 4YPCA 3IR9A 1L0ND 2QA4P 4H0LD 4WVZA 1NTZG 3L35A 3M0DA 2N1TC 5AVVB 1KFMA 3TSIA 1RF1C 5AW1B 1KQLA 5KLVJ 1GK6A 3F89A 3GHGB 4DOJA 3WMM0 1M1JC 1M8OB 2UWJE 4ZKUA 3V6IA 1H8AA 1ZMEC 1N7SC 1N86A 3RK2D 1VQ8P 1U7JA 2QJPC 1NTKG 1S2EA 3RK3D 4WWIA 4PJ0E 4UB8E 2XNXA 3U1AA 4JYCA 2C0WA 2H8PD 1RE3A 1GMJA 1RF0A 5CHXA 2WPVB 2ZYGA 3TGUG 2R3CA 1LT9A 1PPJE 2E75B 3AE5C 3PP5A 1T8ZA 4I1LA 3T97A 5CCGD 1J2JB 1JY3N 1WT6A 2CK3H 4I6MC 4D6TD 3L74D 1GZLA 1AVYA 1HWTC 1IFIA 2XZRA 1GW3A 3H1HJ 1EDKA 4IL6H 1W5CE 5APSA 1KD1Q 1N2DC 2NPSC 2YIUB 3RBZA 4H13C 3E7KA 3NXSA 1IFPA 1P84E 2BCCE 2G8YA 4U3FE 1PP9J 5AVQB 1PGJA 3T97B 1PZQA 5KLIB 3Q5SA 4JYBA 3P8MC 1ZRTD 2OARA 3VTPC 1VF5C 2LR2A 4L75A 4RJTA 2J59M 4CPGA 5BU8B 1KYOH 2E5YA 4H44B 1BE3G 1LWUC 5AW9B 1JNMA 2WPRA 4Y99B 2OYHC 1SQPK 3B5NC 1ZXGA 2QRXA 3AEEC 1KN7A 2M8RA 3VOPA 1YITP 2H88C 4N6JA 3D71A 3L4FA 5GTHE 1VDFA 3TDKA 2ZFCA 4N3YB 4R4LA 1PP9E 2IBZG 3CL3D 3VYIA 1S72P 2Z4EA 2WSCH 2WSCJ 3AE3C 2OYIC 3CWBG 2WPQA 1PL5A 1A02F 5KKZC 3B5NB 1SFCD 3JSVC 3RBXA 2IX7C 2WTYA 5KAIH 1OWAA 1KFNA 4RO0A 4I7ZC 1OW8A 1IJDB 3AEDC 1P84I 1JY2N 3H1KD 1Y8AA 2E74C 3H1ID 1AJYA 4U7JA 1P84D 3RK3C 1VQ7P 3H32A 1KILA 1LP1B 3HD7B 1T2KC 1OMIA 3L71J 4GT1A 1L4AD 2KOGA 1LWUA 1YBKA 3UIAA 1VQ4P 2D2CB 3VP9A 5BVZA 1NU1E 5AVXB 1M1JB 2FKWB 1W2EA 1M56D 5CCGA 2PP6A 4I7ZB 2QJPB 4TT3H 5KJ7C 2OTKE 4DJGA 1L4AB 1IFDA 2ZT9B 4IFFA 2A45I 2QEXP 1AVOA 2NPSB 4WY4B 5CCHD 3L72J 4R4MA 1LP1A 2ZVOB 2E75C 3SWYA 3AE8C 3VN0A 2E42A 1VQOP 4K35A 1IK7A 2E76C 3HE4B 2FY8A 2WQYC 1GD2E 1OFCX 1URQD 3CX5I 5KTBA 3PHLA 2P10A 5DJUB 1NVOA 3CWBJ 3G9RA 2FYUG 5KAFH 2WITA 2BEZF 4LGDE 2WZ7A 3G6EP 3E1RA 1OZHA 2IBZI 3KPEA 4D6TG 1YJNP 1IFNA 1KILE 2ZYAA 4ASWA 3CCEP 1GTWA 4H44D 2O01N 1RE4A 1K9MQ 1A02J 3VMZA 1JY3P 1FBMA 1QL2A 1LT1A 1SQBG 1YYCA 2FYNB 3OA7A 3S1KA 1RH5B 1NTKE 2E76D 2OGUA 3H1LD 5AW3B 1GL2A 1NAYA 1L0NJ 2OQQA 2RH0A 1G1JA 3A2AA 1LTSC 1LGHB 3HTKB 3MUDC 2Q5UA 3P8CD 1EDJA 2W83C 2I8DA 3H1IE 3N4XA 3RL0g 3TYYA 1GL2D 2E74B 4HKZH 1HUCA 3L71D 3M06A 2WT7A 1S4XA 2I1KA 1J1DC 2W6BA 3CX5E 3KDPB 3O6QB 3CC7P 3CX5D 1PGQA 1SQXD 5B66H 3U1CA 1NU1K 3RL0D 2IFNA 3A0HE 1NTMG 2KIKA 1RE3C 1N73B 2O1JA 3H1LJ 4GOEA 4Y28J 3CCVP 3Q1MA 2JDIH 1OIPA 3BVHA 2N1TB 3I55P 2I1JA 1NTKK 1T6AA 3GW6A 3JCUE 1FDOA 2XU6A 3P32A 2R5DA 3HUSC 1YJWP 3BCCG 4BWNA 2AEFA 1SQVG 1E79H 1URQC 2O1KA 4GKGA 3O6QA 1OW6A 3GF3A 4OWFA 2H43A 3RK2B 2HPCB 3N7NA 5CJ4A 1X0TA 1MZ9A 2Z5IA 3AE1C 3H1JE 3Q5RA 3K5BA 2IYPA 1IO4A 1K04A 2W6JH 3NMDA 1LTTC 1EDIA 4H0LB 1K73Q 3FX0A 3PJSK 3OW2O 1JO5A 1BSNA 2B87A 2FYZA 2N1TA 1HGZA 3A0HH 1PP9G 3AE2C 4N78E 3C8VA 1AQTA 4IL6X 4PJ0H 3H1KE 4UB8H 4YXDC 1PP9D 1KC8Q 1HJ0A 2NRGA 3L72D 2M3BA 4KJMA 2R3SA 1G2CA 2QSIA 1RE4C 4ZMDA 2FYNC 3A7OA 1KILD 2C9LY 4LC1A 4OGQD 5TISH 3WUUA 3AE7C 2KNCB 5CBNA 2JEEA 2K37A 1DEEG 2AXCA 3C1LA 4PV1D 4MN4C 1RF0C 2A06G 3L74J 2B87B 2IFMA 3PTZA 2XNDH 5GTIH 4WBAA 3H1HE 3PH0A 4HH2A 4IL6E 1L2PA 5AW6B 1H0TB 2R5BA 2XV5A 4JF7A 2OYIA 1KV4A 2QIWA 1P84H 2IZ1A 1JMBA 1NU1D 4U3FJ 4H44C 3H1KJ 2K3RA 1DD3A 1OXZA 1FDMA 4N78D 4ZNCA 2PGDA 2KXPB 3CCJP 1PGPA 1ZR4A 2K88A 2KB7P 2R44A 3ITKA 3MP7B 1ZV8A 3ZDMA 3AEFC 4EI2A 3IF4A 4QMAA 3SFDC 1E5WA 1FZCB 1SVFA 2K1AA 4AUWA 3BASA 3L74E 1BGYE 5AVTB 5GTIE 1ZR2A 1FJKA 4DZOA 1Q90D 3IAOA 2OYIB 3LW5H 3LW5J 4ZKPA 4XFJA 1YI2P 2LKMA 2V7QH 2V7QJ 1LNQA 1USDA 2FYUE 3GHGA 2RN0A 3GMAA 2KS1A 4A7PA 4WY4D 1MFTA 1SQXJ 3B71A 1Q81Q 2FFDC 3CXHH 1WRGA 2ITAA 3L75E 4HYTB 5AW5B 4D6TE 1VQKP 3R4YA 3M9HA 1N73C 1GW4A 5AW0B 3RK3B 1ZW0A 2NPSD 3MUDA 1QEXA 2YMKA 2W27A 5AVUB 1LTAC 1NO4A 2VRSA 2Y0DA 1OW7A 1JCCA 2HODA 2SPZA 4PD4H 1ZLLA 2HYNA 1DD4A 1BGYJ 3VMAA 3H32B 3HD7A 2JO1A 5E79H 4NPFX 3CMEP 3CD6P 1S5LE 1RF1A 1T2KD 2FYUJ 5KLVG 3AEAC 3EQ2A 4BRYA 1L0LG 1QX8A 1SQXE 3CXHE 3L75J 4D6TJ 1IFMA 1ZN5A 1NHLA 1SQPG 1N7SA 2FXOA 2P7JA 1JTHA 3KYQA 5CBOA 1VQLP 2JWDA 1BCCG 2WSSH 1RHZB 1Z56A 1XTGB 1ZRTE 1QVGO 4DCKA 3CWBD 2IPPA 1EXIA 1BCCJ 4IFDK 1LT9C 1XTCC 3P8CE 1N73A 1JUNA 3QWOC 3M0AA 3II6A 1X79B 2KSEA 1PFIA 5AW7B 5KLIC 1VF5D 2IBZE 2CPBA 5CMZA 3M0DC 1S5LH 1CZQA 5B5EH 1IK9A 2O3JA 3CWBE 1SQVE 2A45H 2IYOA 1LTJC 1DEBA 1SQQJ 2AXTE 1M7LA 2WWWA 3MZWB 4NPDA 3SFEC 1KB9D 3CCRP 3Q3DA 1EZVD 3OAKA 4UB6E 1YTZI 2QJYC 2KUBA 1VQNP 1Y47A 2N9BA 2J58A 1JOCA 3M9QA 3Q5PA 1KILB 3RK3E 1SQBD 2B88A 1MKMA 2ZAEB 4H13D 1L0NE 1NU1G 4C7NA 2ZXXA 3R2PA 1T3JA 3H6PA 5L8RJ 1LWUB 3S4RA 5B5EE 1Q82Q 4KHXA 1KB9E 1SQPJ 3GF7A 3H1IJ 1KQFB 1BSHA 1KQGB 3CMAP 3BCCD 3TGUJ 1SP4A 1PIXA 1SQVD 2AXTH 2AEJA 2BCCG 2L91A 2WT7B 1IZNB 3WUTA 1CSBA 2A06E 3U59A 1EDLA 1IFJA 2NPSA 3WU2H 2YKOA 4GIFA 3M91A 1FAVA 1K05A 2WVRA 3GG2A 4B86A 5CCHC 5B66E 1AV1A 1JEKA 3PLNA 2G3AA 4AQRD 4YXWH 2KP8A 5KKZB 1NTZK 5KJ7D 1NTKD 2YMYA 3H1LE 2ZXEB 3M9BA 1SLQA 2YXQB 3A3YB 4RESB 3BRVB 5DJTB 5EFWB 3W68A 2Q1KA 3JCUH 3HE4A 2RMZA 1W2BO 3L73E 1KTMA 2CPSA 1RY3A 1NKZB 1KYOD 3L71G 2M3EA 4H0LC 3IFMA 5AVSB 1ZOYC 2P67A 2ZJSE 1S9KE 2FFDA 1NKNA 2K9JB 3L74G 3CXHI 1GL2C 3H1JJ 2Q7CA 2Y9ZA 1CI6B 2KLUA 5APQA 3D70A 3SSUA 1LJ2A 1SFCB 5AVRB 1L0LJ 1L4AC 4C46A 1S1CX 3H1HD 2B9BA 4Y99C 2QJKB 1Q7YQ 2KLVA 3A0BE 1U7MA 3GLMA 2WPSA 1GL2B 2E74D 4ASVA 3L73J 2QVAA 2R32A 5APTA 1M57D 3L70G 2MKVA 5TISE 4GOFA 1AQ5A 1ZP0C 2M0BA 4JQ0D 3A5TA 1L0NK 1H88A 1USEA 3EFGA 3MHVA 4W7ZA 2YIUC 3B4SA 4KT0J 1RQUA 1VQ9P 1H89A 2B89A 1VQMP 2A45G 1L0LE 1SQXG 2XKMA 4TLFA 4BRYB 2H89C 3D6YA 3V4QA 3H1HG 4EIJA 3V2RA 1NTMD 1S3JA 4GODA 4HB1A 5KLVD 1K8AQ 1EZVG 3G4SP 1KB9I 1PPJG 1KORA 2HPCA 4EYYQ 1PPJD 1FOSF 3L72G 3NTNA 1Q86Q 2RKLA 2FXMA 2ZT9D 2W90A 5APXA 5K5GB 2BEQD 3D6ZA 1YTZT 3CC4P 3I56P 2AEMA 1TU3F 3EWKA 3H1KG 3V2QA 2W6AA 1BE3J 2IZ0A 3L37A 2WMMA 2HLOA 5M1BA 1OX3A 2OTLP 1FZFA 3L73D 5KLVK 3L70J 4WB4A 1L0LK 1EQ7A 1G2CB 4IFMA 1DX7A 1VQ6P 2KZJA 1SFCC 1FS0E 3RL0C 2IDBA 4PD4E 3V5BA 2KK7A 2BCCD 4PD4I 5C39A 3HUSB 5E79E 2FYUK 1SQQK 2OYOA 2A06D 1NTMK 1FZEA 2QM7A 4HJGH 1N7SD 2W8ZA 3FXEA 3CPWO 3HE5B 1M1KQ 1AFOA 3B5ND 3MIWA 5AW4B 5CCHA 3LIDA 2MJZA 3W67A 1H0TA 4GDOA 4C7NB 3F5HA 1NAFA 1KYOI 5APUA 1SQBK 2Q6QA 4H13B 5H2FE 3S9OA 1JMMA 1BGYG 2E43A 1VQPP 3CCLP 2E76B 3SWFA 2OTJP 1BCCE 3BRTB 3HE5A 5AVZB 2KZIA 1NOHA 3BATA 1URQA 3AE4C 2P1JA 2L5GB 3NFQA 1YJ9P 1SQVJ 1HBWA 1SQQE 3L70D 1M90Q 2GUVA 1BDCA 4OGQB 3FXDA 1QGKB 1FU1A 4UB6H 3HD7C 1BE3D 2BASA 2KNCA 4L76A 1IC2A 3V2NA 1CI6A 1LTJA 4OH8B 2HODB 2GUSA 2ZYDA 3ABVC 1URQB 2FFDB 1YQ3C 5KLVE 3RK2C 3CCSP 4JPZB 2HFED 4OGQC 3KXDA 5BU5A 1UIIA 1LTGC 1KB9H 1JCDA 1SQPE 2E75D 2ZT9C 1JM0A 2WSEJ 2WSEH 2P2UA 2QE7H 3B5NA 3I5CA 3PRJA 3TGUE 3CCUP 2OYHA 3KZIH 2D2CD 3GHGC 1J1EB 3MTUE 1VQ5P 1HJBA 4XA4A 1EXJA 2D2CC 3WU2E 2DW3A 1FZBA 3C9IA 1VPCA 1MUUA 3CCQP 1HF9A 1JTHB 1BCCD 1NTZJ 3FWLA 3WUVA 1AA0A 1NYHA 3FWNA 3USSA 3L36A 4AYCA 3HD7D 5TJHA 1EZVE 3MGNA 1HH0A 3H1IG 2Y0EA 1RQVA 1PV3A 3G3ZA 3KQGA 5AVWB 2BCCJ 1GU4A 2FXPA 1JB0J 2ZVNB 1DIPA 3VMXA 2FYUD 1Q2NA 3KZIE 3KHUA 3AE9C 1FOSE 1CW5A 2KYVA 1HVVA 1U57A 3CC2P 2K9JA 4L73A 2POHA 5AW8B 3SWKA 1BGYD 4K3AA 1R5SA 1KYOE 1L0NG 4PD4D 1NTZE 1NTME 1DH3A 3H1JD 1SFCA 2WSFJ 2WSFH 5KJ7A 2GM4A 1FZCC 2P58A 1MV8A 3FGAD 2NZ2A 4OVNF 3A0BH 3RGUA 4JBZA 3TNUA 4L74A 2JKVA 5APYA 1LT9B 1NTZD 1R5LA 2JP3A 5GTHH 2PRRA 4PV1B 2YO3A 1FZAA 2Y9YA 3MD0A 3V4WA 3HRNA 4EDFA 1KILC 4XE5B 2Y0CA 4I2LC 5AW2B 1KZUB 5KAIE 2O01J 2O01H 3CLQA 3H1LG 1FC2C 4EOTA 1NWQA 2K9YA 1GU5A 1NTMJ 3TNUB 5CCGC 1J1EC 1LTIC 3HUSA 3AECC 1X9VA 4W80A 3L71E 1YQ4C 3TGUD 3B8EB
chains in the Genus database with same CATH topology
2M5AA 5K5GB 1LP1B 1ZW0A 2WMMA 2SPZA 2KI7B 1BDDA 2KZJA 4NPFX 2OTKE 2M5AB 4IOIH 1LP1A 5C39A 2HR3A 2LXCB 5CBOA 2LXBA 4K35A 4HJGH 1EC5A 2JWDA 3FXEA 4BXLA 1H0TA 5DJUB 1NVOA 3QWOC 4ASWA 2KS1B 4NPEA 3MZWB 1LT1A 4NPDA 3S1KA 2KZIA 2KUBA 1EDJA 1Y47A 2I8DA 1BDCA 3FXDA 4HKZH 2B88A 1SS1A 2ZAEB 1OVVA 1OVUA 1OVRA 2KIKA 1EDLA 4GOEA 1JM0A 2UWJE 5DJTB 1U7JA 1X0TA 5EFWB 4WWIA 2Q1KA 1EDIA 2B87A 4KJMA 4ZMDA 1Q2NA 1EDKA 5CBNA 4K3AA 1DEEG 1U7MA 4MN4C 2B87B 4ASVA 2QVAA 3PH0A 2LR2A 1H0TB 4GOFA 2P58A 2M0BA 3RGUA 4CPGA 1JMBA 4JBZA 3MHVA 2K3RA 1ZXGA 2QRXA 4ZNCA 2B89A 2R44A 3ZDMA 1S3JA 4GODA 4HB1A 1FC2C 4EYYQ 2RKLA 1MFTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M5A A;  5K5G B;  1LP1 B;  1ZW0 A;  2WMM A;  2SPZ A;  2KI7 B;  1BDD A;  2KZJ A;  4NPF X;  2OTK E;  2M5A B;  4IOI H;  1LP1 A;  5C39 A;  2HR3 A;  2LXC B;  5CBO A;  2LXB A;  4K35 A;  4HJG H;  1EC5 A;  2JWD A;  3FXE A;  4BXL A;  1H0T A;  5DJU B;  1NVO A;  3QWO C;  4ASW A;  2KS1 B;  4NPE A;  3MZW B;  1LT1 A;  4NPD A;  3S1K A;  2KZI A;  2KUB A;  1EDJ A;  1Y47 A;  2I8D A;  1BDC A;  3FXD A;  4HKZ H;  2B88 A;  1SS1 A;  2ZAE B;  1OVV A;  1OVU A;  1OVR A;  2KIK A;  1EDL A;  4GOE A;  1JM0 A;  2UWJ E;  5DJT B;  1U7J A;  1X0T A;  5EFW B;  4WWI A;  2Q1K A;  1EDI A;  2B87 A;  4KJM A;  4ZMD A;  1Q2N A;  1EDK A;  5CBN A;  4K3A A;  1DEE G;  1U7M A;  4MN4 C;  2B87 B;  4ASV A;  2QVA A;  3PH0 A;  2LR2 A;  1H0T B;  4GOF A;  2P58 A;  2M0B A;  3RGU A;  4CPG A;  1JMB A;  4JBZ A;  3MHV A;  2K3R A;  1ZXG A;  2QRX A;  4ZNC A;  2B89 A;  2R44 A;  3ZDM A;  1S3J A;  4GOD A;  4HB1 A;  1FC2 C;  4EYY Q;  2RKL A;  1MFT A; 
#chains in the Genus database with same CATH topology
 1VL2 A;  1GDT A;  2M5A A;  1SQP D;  1NU1 J;  2KSJ A;  4U3F D;  3Q2Y A;  2IBZ D;  3V2P A;  2Q3I A;  1KMI Z;  4U3F G;  1FE6 A;  2JWA A;  1HTL C;  2E5T A;  1SQB J;  2XDJ A;  1QL1 A;  3AEG C;  2YKP A;  5APW A;  2KI7 B;  3L72 E;  3OJA B;  2H7H A;  2N1T D;  1BE3 E;  2FBW C;  1BDD A;  2HG5 D;  3O8Z A;  2Q9I A;  4Z1M H;  1SQQ G;  1JY3 O;  1MFZ A;  1JY2 O;  1L0L D;  2M5A B;  2Z5H A;  2JJL A;  2PAJ A;  3CI9 A;  3E1I A;  1SQQ D;  3L70 E;  4IOI H;  3RL0 B;  3VP8 A;  4WY4 C;  1QLE D;  1T3U A;  2HR3 A;  2LXC B;  4YTP C;  1FJP A;  1YIJ P;  1EZV I;  5KAF E;  2LXB A;  1R8E A;  4O9B A;  4DT0 A;  1EC5 A;  4BXL A;  1SQX K;  2QG4 A;  1LTJ B;  1SQB E;  2YNY A;  3BCC E;  1FZC A;  2PFX A;  2GA1 A;  1UIX A;  3P7K A;  1S5L X;  1X22 A;  4W7Y A;  1SQV K;  1G1I A;  2C0X A;  2YXR B;  1HGV A;  2QJY B;  3AE6 C;  1NTK J;  3H1J G;  1GK4 A;  4M3L A;  3L75 G;  1LTB C;  3TK1 A;  1NH4 A;  3TF5 A;  1D7M A;  2YKQ A;  3HTK A;  2KS1 B;  4NPE A;  3CCM P;  1N8R Q;  2Q3E A;  3JC2 2;  3L75 D;  1QVF O;  2N9Y B;  1L4A A;  2QM8 A;  3VMY A;  1NJI Q;  2J5U A;  3EFF K;  4LLH A;  5CJ0 A;  5H2F H;  1NGM B;  1YHQ P;  3L73 G;  2OYH B;  1M1J A;  1Y9B A;  1S9K D;  2QJK C;  5AVY B;  3LIE A;  1JY2 P;  1N7L A;  3G71 P;  1FDI A;  3BCC J;  4PV1 C;  5APV A;  3QH9 A;  4WY4 A;  1WMK A;  3CX5 H;  1VF5 B;  3H25 A;  2C9N Y;  1SS1 A;  1KQS O;  3AEB C;  1RF1 B;  4C7R A;  1J1D B;  1FZG A;  1X8Y A;  2V4H A;  3CXH D;  1OVV A;  1OVU A;  2YO2 A;  3IN6 A;  2JR8 A;  1PGO A;  4RKU J;  1OVR A;  1N7S B;  4YPC A;  3IR9 A;  1L0N D;  2QA4 P;  4H0L D;  4WVZ A;  1NTZ G;  3L35 A;  3M0D A;  2N1T C;  5AVV B;  1KFM A;  3TSI A;  1RF1 C;  5AW1 B;  1KQL A;  5KLV J;  1GK6 A;  3F89 A;  3GHG B;  4DOJ A;  3WMM 0;  1M1J C;  1M8O B;  2UWJ E;  4ZKU A;  3V6I A;  1H8A A;  1ZME C;  1N7S C;  1N86 A;  3RK2 D;  1VQ8 P;  1U7J A;  2QJP C;  1NTK G;  1S2E A;  3RK3 D;  4WWI A;  4PJ0 E;  4UB8 E;  2XNX A;  3U1A A;  4JYC A;  2C0W A;  2H8P D;  1RE3 A;  1GMJ A;  1RF0 A;  5CHX A;  2WPV B;  2ZYG A;  3TGU G;  2R3C A;  1LT9 A;  1PPJ E;  2E75 B;  3AE5 C;  3PP5 A;  1T8Z A;  4I1L A;  3T97 A;  5CCG D;  1J2J B;  1JY3 N;  1WT6 A;  2CK3 H;  4I6M C;  4D6T D;  3L74 D;  1GZL A;  1AVY A;  1HWT C;  1IFI A;  2XZR A;  1GW3 A;  3H1H J;  1EDK A;  4IL6 H;  1W5C E;  5APS A;  1KD1 Q;  1N2D C;  2NPS C;  2YIU B;  3RBZ A;  4H13 C;  3E7K A;  3NXS A;  1IFP A;  1P84 E;  2BCC E;  2G8Y A;  4U3F E;  1PP9 J;  5AVQ B;  1PGJ A;  3T97 B;  1PZQ A;  5KLI B;  3Q5S A;  4JYB A;  3P8M C;  1ZRT D;  2OAR A;  3VTP C;  1VF5 C;  2LR2 A;  4L75 A;  4RJT A;  2J59 M;  4CPG A;  5BU8 B;  1KYO H;  2E5Y A;  4H44 B;  1BE3 G;  1LWU C;  5AW9 B;  1JNM A;  2WPR A;  4Y99 B;  2OYH C;  1SQP K;  3B5N C;  1ZXG A;  2QRX A;  3AEE C;  1KN7 A;  2M8R A;  3VOP A;  1YIT P;  2H88 C;  4N6J A;  3D71 A;  3L4F A;  5GTH E;  1VDF A;  3TDK A;  2ZFC A;  4N3Y B;  4R4L A;  1PP9 E;  2IBZ G;  3CL3 D;  3VYI A;  1S72 P;  2Z4E A;  2WSC H;  2WSC J;  3AE3 C;  2OYI C;  3CWB G;  2WPQ A;  1PL5 A;  1A02 F;  5KKZ C;  3B5N B;  1SFC D;  3JSV C;  3RBX A;  2IX7 C;  2WTY A;  5KAI H;  1OWA A;  1KFN A;  4RO0 A;  4I7Z C;  1OW8 A;  1IJD B;  3AED C;  1P84 I;  1JY2 N;  3H1K D;  1Y8A A;  2E74 C;  3H1I D;  1AJY A;  4U7J A;  1P84 D;  3RK3 C;  1VQ7 P;  3H32 A;  1KIL A;  1LP1 B;  3HD7 B;  1T2K C;  1OMI A;  3L71 J;  4GT1 A;  1L4A D;  2KOG A;  1LWU A;  1YBK A;  3UIA A;  1VQ4 P;  2D2C B;  3VP9 A;  5BVZ A;  1NU1 E;  5AVX B;  1M1J B;  2FKW B;  1W2E A;  1M56 D;  5CCG A;  2PP6 A;  4I7Z B;  2QJP B;  4TT3 H;  5KJ7 C;  2OTK E;  4DJG A;  1L4A B;  1IFD A;  2ZT9 B;  4IFF A;  2A45 I;  2QEX P;  1AVO A;  2NPS B;  4WY4 B;  5CCH D;  3L72 J;  4R4M A;  1LP1 A;  2ZVO B;  2E75 C;  3SWY A;  3AE8 C;  3VN0 A;  2E42 A;  1VQO P;  4K35 A;  1IK7 A;  2E76 C;  3HE4 B;  2FY8 A;  2WQY C;  1GD2 E;  1OFC X;  1URQ D;  3CX5 I;  5KTB A;  3PHL A;  2P10 A;  5DJU B;  1NVO A;  3CWB J;  3G9R A;  2FYU G;  5KAF H;  2WIT A;  2BEZ F;  4LGD E;  2WZ7 A;  3G6E P;  3E1R A;  1OZH A;  2IBZ I;  3KPE A;  4D6T G;  1YJN P;  1IFN A;  1KIL E;  2ZYA A;  4ASW A;  3CCE P;  1GTW A;  4H44 D;  2O01 N;  1RE4 A;  1K9M Q;  1A02 J;  3VMZ A;  1JY3 P;  1FBM A;  1QL2 A;  1LT1 A;  1SQB G;  1YYC A;  2FYN B;  3OA7 A;  3S1K A;  1RH5 B;  1NTK E;  2E76 D;  2OGU A;  3H1L D;  5AW3 B;  1GL2 A;  1NAY A;  1L0N J;  2OQQ A;  2RH0 A;  1G1J A;  3A2A A;  1LTS C;  1LGH B;  3HTK B;  3MUD C;  2Q5U A;  3P8C D;  1EDJ A;  2W83 C;  2I8D A;  3H1I E;  3N4X A;  3RL0 g;  3TYY A;  1GL2 D;  2E74 B;  4HKZ H;  1HUC A;  3L71 D;  3M06 A;  2WT7 A;  1S4X A;  2I1K A;  1J1D C;  2W6B A;  3CX5 E;  3KDP B;  3O6Q B;  3CC7 P;  3CX5 D;  1PGQ A;  1SQX D;  5B66 H;  3U1C A;  1NU1 K;  3RL0 D;  2IFN A;  3A0H E;  1NTM G;  2KIK A;  1RE3 C;  1N73 B;  2O1J A;  3H1L J;  4GOE A;  4Y28 J;  3CCV P;  3Q1M A;  2JDI H;  1OIP A;  3BVH A;  2N1T B;  3I55 P;  2I1J A;  1NTK K;  1T6A A;  3GW6 A;  3JCU E;  1FDO A;  2XU6 A;  3P32 A;  2R5D A;  3HUS C;  1YJW P;  3BCC G;  4BWN A;  2AEF A;  1SQV G;  1E79 H;  1URQ C;  2O1K A;  4GKG A;  3O6Q A;  1OW6 A;  3GF3 A;  4OWF A;  2H43 A;  3RK2 B;  2HPC B;  3N7N A;  5CJ4 A;  1X0T A;  1MZ9 A;  2Z5I A;  3AE1 C;  3H1J E;  3Q5R A;  3K5B A;  2IYP A;  1IO4 A;  1K04 A;  2W6J H;  3NMD A;  1LTT C;  1EDI A;  4H0L B;  1K73 Q;  3FX0 A;  3PJS K;  3OW2 O;  1JO5 A;  1BSN A;  2B87 A;  2FYZ A;  2N1T A;  1HGZ A;  3A0H H;  1PP9 G;  3AE2 C;  4N78 E;  3C8V A;  1AQT A;  4IL6 X;  4PJ0 H;  3H1K E;  4UB8 H;  4YXD C;  1PP9 D;  1KC8 Q;  1HJ0 A;  2NRG A;  3L72 D;  2M3B A;  4KJM A;  2R3S A;  1G2C A;  2QSI A;  1RE4 C;  4ZMD A;  2FYN C;  3A7O A;  1KIL D;  2C9L Y;  4LC1 A;  4OGQ D;  5TIS H;  3WUU A;  3AE7 C;  2KNC B;  5CBN A;  2JEE A;  2K37 A;  1DEE G;  2AXC A;  3C1L A;  4PV1 D;  4MN4 C;  1RF0 C;  2A06 G;  3L74 J;  2B87 B;  2IFM A;  3PTZ A;  2XND H;  5GTI H;  4WBA A;  3H1H E;  3PH0 A;  4HH2 A;  4IL6 E;  1L2P A;  5AW6 B;  1H0T B;  2R5B A;  2XV5 A;  4JF7 A;  2OYI A;  1KV4 A;  2QIW A;  1P84 H;  2IZ1 A;  1JMB A;  1NU1 D;  4U3F J;  4H44 C;  3H1K J;  2K3R A;  1DD3 A;  1OXZ A;  1FDM A;  4N78 D;  4ZNC A;  2PGD A;  2KXP B;  3CCJ P;  1PGP A;  1ZR4 A;  2K88 A;  2KB7 P;  2R44 A;  3ITK A;  3MP7 B;  1ZV8 A;  3ZDM A;  3AEF C;  4EI2 A;  3IF4 A;  4QMA A;  3SFD C;  1E5W A;  1FZC B;  1SVF A;  2K1A A;  4AUW A;  3BAS A;  3L74 E;  1BGY E;  5AVT B;  5GTI E;  1ZR2 A;  1FJK A;  4DZO A;  1Q90 D;  3IAO A;  2OYI B;  3LW5 H;  3LW5 J;  4ZKP A;  4XFJ A;  1YI2 P;  2LKM A;  2V7Q H;  2V7Q J;  1LNQ A;  1USD A;  2FYU E;  3GHG A;  2RN0 A;  3GMA A;  2KS1 A;  4A7P A;  4WY4 D;  1MFT A;  1SQX J;  3B71 A;  1Q81 Q;  2FFD C;  3CXH H;  1WRG A;  2ITA A;  3L75 E;  4HYT B;  5AW5 B;  4D6T E;  1VQK P;  3R4Y A;  3M9H A;  1N73 C;  1GW4 A;  5AW0 B;  3RK3 B;  1ZW0 A;  2NPS D;  3MUD A;  1QEX A;  2YMK A;  2W27 A;  5AVU B;  1LTA C;  1NO4 A;  2VRS A;  2Y0D A;  1OW7 A;  1JCC A;  2HOD A;  2SPZ A;  4PD4 H;  1ZLL A;  2HYN A;  1DD4 A;  1BGY J;  3VMA A;  3H32 B;  3HD7 A;  2JO1 A;  5E79 H;  4NPF X;  3CME P;  3CD6 P;  1S5L E;  1RF1 A;  1T2K D;  2FYU J;  5KLV G;  3AEA C;  3EQ2 A;  4BRY A;  1L0L G;  1QX8 A;  1SQX E;  3CXH E;  3L75 J;  4D6T J;  1IFM A;  1ZN5 A;  1NHL A;  1SQP G;  1N7S A;  2FXO A;  2P7J A;  1JTH A;  3KYQ A;  5CBO A;  1VQL P;  2JWD A;  1BCC G;  2WSS H;  1RHZ B;  1Z56 A;  1XTG B;  1ZRT E;  1QVG O;  4DCK A;  3CWB D;  2IPP A;  1EXI A;  1BCC J;  4IFD K;  1LT9 C;  1XTC C;  3P8C E;  1N73 A;  1JUN A;  3QWO C;  3M0A A;  3II6 A;  1X79 B;  2KSE A;  1PFI A;  5AW7 B;  5KLI C;  1VF5 D;  2IBZ E;  2CPB A;  5CMZ A;  3M0D C;  1S5L H;  1CZQ A;  5B5E H;  1IK9 A;  2O3J A;  3CWB E;  1SQV E;  2A45 H;  2IYO A;  1LTJ C;  1DEB A;  1SQQ J;  2AXT E;  1M7L A;  2WWW A;  3MZW B;  4NPD A;  3SFE C;  1KB9 D;  3CCR P;  3Q3D A;  1EZV D;  3OAK A;  4UB6 E;  1YTZ I;  2QJY C;  2KUB A;  1VQN P;  1Y47 A;  2N9B A;  2J58 A;  1JOC A;  3M9Q A;  3Q5P A;  1KIL B;  3RK3 E;  1SQB D;  2B88 A;  1MKM A;  2ZAE B;  4H13 D;  1L0N E;  1NU1 G;  4C7N A;  2ZXX A;  3R2P A;  1T3J A;  3H6P A;  5L8R J;  1LWU B;  3S4R A;  5B5E E;  1Q82 Q;  4KHX A;  1KB9 E;  1SQP J;  3GF7 A;  3H1I J;  1KQF B;  1BSH A;  1KQG B;  3CMA P;  3BCC D;  3TGU J;  1SP4 A;  1PIX A;  1SQV D;  2AXT H;  2AEJ A;  2BCC G;  2L91 A;  2WT7 B;  1IZN B;  3WUT A;  1CSB A;  2A06 E;  3U59 A;  1EDL A;  1IFJ A;  2NPS A;  3WU2 H;  2YKO A;  4GIF A;  3M91 A;  1FAV A;  1K05 A;  2WVR A;  3GG2 A;  4B86 A;  5CCH C;  5B66 E;  1AV1 A;  1JEK A;  3PLN A;  2G3A A;  4AQR D;  4YXW H;  2KP8 A;  5KKZ B;  1NTZ K;  5KJ7 D;  1NTK D;  2YMY A;  3H1L E;  2ZXE B;  3M9B A;  1SLQ A;  2YXQ B;  3A3Y B;  4RES B;  3BRV B;  5DJT B;  5EFW B;  3W68 A;  2Q1K A;  3JCU H;  3HE4 A;  2RMZ A;  1W2B O;  3L73 E;  1KTM A;  2CPS A;  1RY3 A;  1NKZ B;  1KYO D;  3L71 G;  2M3E A;  4H0L C;  3IFM A;  5AVS B;  1ZOY C;  2P67 A;  2ZJS E;  1S9K E;  2FFD A;  1NKN A;  2K9J B;  3L74 G;  3CXH I;  1GL2 C;  3H1J J;  2Q7C A;  2Y9Z A;  1CI6 B;  2KLU A;  5APQ A;  3D70 A;  3SSU A;  1LJ2 A;  1SFC B;  5AVR B;  1L0L J;  1L4A C;  4C46 A;  1S1C X;  3H1H D;  2B9B A;  4Y99 C;  2QJK B;  1Q7Y Q;  2KLV A;  3A0B E;  1U7M A;  3GLM A;  2WPS A;  1GL2 B;  2E74 D;  4ASV A;  3L73 J;  2QVA A;  2R32 A;  5APT A;  1M57 D;  3L70 G;  2MKV A;  5TIS E;  4GOF A;  1AQ5 A;  1ZP0 C;  2M0B A;  4JQ0 D;  3A5T A;  1L0N K;  1H88 A;  1USE A;  3EFG A;  3MHV A;  4W7Z A;  2YIU C;  3B4S A;  4KT0 J;  1RQU A;  1VQ9 P;  1H89 A;  2B89 A;  1VQM P;  2A45 G;  1L0L E;  1SQX G;  2XKM A;  4TLF A;  4BRY B;  2H89 C;  3D6Y A;  3V4Q A;  3H1H G;  4EIJ A;  3V2R A;  1NTM D;  1S3J A;  4GOD A;  4HB1 A;  5KLV D;  1K8A Q;  1EZV G;  3G4S P;  1KB9 I;  1PPJ G;  1KOR A;  2HPC A;  4EYY Q;  1PPJ D;  1FOS F;  3L72 G;  3NTN A;  1Q86 Q;  2RKL A;  2FXM A;  2ZT9 D;  2W90 A;  5APX A;  5K5G B;  2BEQ D;  3D6Z A;  1YTZ T;  3CC4 P;  3I56 P;  2AEM A;  1TU3 F;  3EWK A;  3H1K G;  3V2Q A;  2W6A A;  1BE3 J;  2IZ0 A;  3L37 A;  2WMM A;  2HLO A;  5M1B A;  1OX3 A;  2OTL P;  1FZF A;  3L73 D;  5KLV K;  3L70 J;  4WB4 A;  1L0L K;  1EQ7 A;  1G2C B;  4IFM A;  1DX7 A;  1VQ6 P;  2KZJ A;  1SFC C;  1FS0 E;  3RL0 C;  2IDB A;  4PD4 E;  3V5B A;  2KK7 A;  2BCC D;  4PD4 I;  5C39 A;  3HUS B;  5E79 E;  2FYU K;  1SQQ K;  2OYO A;  2A06 D;  1NTM K;  1FZE A;  2QM7 A;  4HJG H;  1N7S D;  2W8Z A;  3FXE A;  3CPW O;  3HE5 B;  1M1K Q;  1AFO A;  3B5N D;  3MIW A;  5AW4 B;  5CCH A;  3LID A;  2MJZ A;  3W67 A;  1H0T A;  4GDO A;  4C7N B;  3F5H A;  1NAF A;  1KYO I;  5APU A;  1SQB K;  2Q6Q A;  4H13 B;  5H2F E;  3S9O A;  1JMM A;  1BGY G;  2E43 A;  1VQP P;  3CCL P;  2E76 B;  3SWF A;  2OTJ P;  1BCC E;  3BRT B;  3HE5 A;  5AVZ B;  2KZI A;  1NOH A;  3BAT A;  1URQ A;  3AE4 C;  2P1J A;  2L5G B;  3NFQ A;  1YJ9 P;  1SQV J;  1HBW A;  1SQQ E;  3L70 D;  1M90 Q;  2GUV A;  1BDC A;  4OGQ B;  3FXD A;  1QGK B;  1FU1 A;  4UB6 H;  3HD7 C;  1BE3 D;  2BAS A;  2KNC A;  4L76 A;  1IC2 A;  3V2N A;  1CI6 A;  1LTJ A;  4OH8 B;  2HOD B;  2GUS A;  2ZYD A;  3ABV C;  1URQ B;  2FFD B;  1YQ3 C;  5KLV E;  3RK2 C;  3CCS P;  4JPZ B;  2HFE D;  4OGQ C;  3KXD A;  5BU5 A;  1UII A;  1LTG C;  1KB9 H;  1JCD A;  1SQP E;  2E75 D;  2ZT9 C;  1JM0 A;  2WSE J;  2WSE H;  2P2U A;  2QE7 H;  3B5N A;  3I5C A;  3PRJ A;  3TGU E;  3CCU P;  2OYH A;  3KZI H;  2D2C D;  3GHG C;  1J1E B;  3MTU E;  1VQ5 P;  1HJB A;  4XA4 A;  1EXJ A;  2D2C C;  3WU2 E;  2DW3 A;  1FZB A;  3C9I A;  1VPC A;  1MUU A;  3CCQ P;  1HF9 A;  1JTH B;  1BCC D;  1NTZ J;  3FWL A;  3WUV A;  1AA0 A;  1NYH A;  3FWN A;  3USS A;  3L36 A;  4AYC A;  3HD7 D;  5TJH A;  1EZV E;  3MGN A;  1HH0 A;  3H1I G;  2Y0E A;  1RQV A;  1PV3 A;  3G3Z A;  3KQG A;  5AVW B;  2BCC J;  1GU4 A;  2FXP A;  1JB0 J;  2ZVN B;  1DIP A;  3VMX A;  2FYU D;  1Q2N A;  3KZI E;  3KHU A;  3AE9 C;  1FOS E;  1CW5 A;  2KYV A;  1HVV A;  1U57 A;  3CC2 P;  2K9J A;  4L73 A;  2POH A;  5AW8 B;  3SWK A;  1BGY D;  4K3A A;  1R5S A;  1KYO E;  1L0N G;  4PD4 D;  1NTZ E;  1NTM E;  1DH3 A;  3H1J D;  1SFC A;  2WSF J;  2WSF H;  5KJ7 A;  2GM4 A;  1FZC C;  2P58 A;  1MV8 A;  3FGA D;  2NZ2 A;  4OVN F;  3A0B H;  3RGU A;  4JBZ A;  3TNU A;  4L74 A;  2JKV A;  5APY A;  1LT9 B;  1NTZ D;  1R5L A;  2JP3 A;  5GTH H;  2PRR A;  4PV1 B;  2YO3 A;  1FZA A;  2Y9Y A;  3MD0 A;  3V4W A;  3HRN A;  4EDF A;  1KIL C;  4XE5 B;  2Y0C A;  4I2L C;  5AW2 B;  1KZU B;  5KAI E;  2O01 J;  2O01 H;  3CLQ A;  3H1L G;  1FC2 C;  4EOT A;  1NWQ A;  2K9Y A;  1GU5 A;  1NTM J;  3TNU B;  5CCG C;  1J1E C;  1LTI C;  3HUS A;  3AEC C;  1X9V A;  4W80 A;  3L71 E;  1YQ4 C;  3TGU D;  3B8E B; 
#chains in the Genus database with same CATH homology
 2M5A A;  5K5G B;  1LP1 B;  1ZW0 A;  2WMM A;  2SPZ A;  2KI7 B;  1BDD A;  2KZJ A;  4NPF X;  2OTK E;  2M5A B;  4IOI H;  1LP1 A;  5C39 A;  2HR3 A;  2LXC B;  5CBO A;  2LXB A;  4K35 A;  4HJG H;  1EC5 A;  2JWD A;  3FXE A;  4BXL A;  1H0T A;  5DJU B;  1NVO A;  3QWO C;  4ASW A;  2KS1 B;  4NPE A;  3MZW B;  1LT1 A;  4NPD A;  3S1K A;  2KZI A;  2KUB A;  1EDJ A;  1Y47 A;  2I8D A;  1BDC A;  3FXD A;  4HKZ H;  2B88 A;  1SS1 A;  2ZAE B;  1OVV A;  1OVU A;  1OVR A;  2KIK A;  1EDL A;  4GOE A;  1JM0 A;  2UWJ E;  5DJT B;  1U7J A;  1X0T A;  5EFW B;  4WWI A;  2Q1K A;  1EDI A;  2B87 A;  4KJM A;  4ZMD A;  1Q2N A;  1EDK A;  5CBN A;  4K3A A;  1DEE G;  1U7M A;  4MN4 C;  2B87 B;  4ASV A;  2QVA A;  3PH0 A;  2LR2 A;  1H0T B;  4GOF A;  2P58 A;  2M0B A;  3RGU A;  4CPG A;  1JMB A;  4JBZ A;  3MHV A;  2K3R A;  1ZXG A;  2QRX A;  4ZNC A;  2B89 A;  2R44 A;  3ZDM A;  1S3J A;  4GOD A;  4HB1 A;  1FC2 C;  4EYY Q;  2RKL A;  1MFT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...