5DJUB

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
NKFNKEVLVARQEIYWLPNLNWEQKFAFISSLTNDPSQSANLLAEAKKLNGAQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered protein, Zdk3 affibody
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
total genus 20
structure length 55
sequence length 55
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djuB00
1FC2C 3QWOC 2KZIA 2I8DA 4NPDA 1X0TA 5EFWB 2ZAEB 2RKLA 1OVRA 1SS1A 4HKZH 3S1KA 1OVVA 5C39A 3PH0A 4ASWA 2QVAA 2WMMA 2LXBA 1ZW0A 5DJUB 2Q1KA 2KUBA 3MZWB 4K3AA 1EDKA 2SPZA 4NPFX 2KIKA 4GOEA 1EDIA 5K5GB 2JWDA 1U7MA 3FXDA 4MN4C 4GOFA 4WWIA 1EDJA 1H0TA 4GODA 4HJGH 2P58A 2B88A 4IOIH 1BDCA 2R44A 1H0TB 3MHVA 5CBOA 4NPEA 1NVOA 2M0BA 2LR2A 1Y47A 5CBNA 2KZJA 2LXCB 4ASVA 1EC5A 4KJMA 4K35A 4BXLA 4ZMDA 1OVUA 2UWJE 1LT1A 1DEEG 2KS1B 3FXEA 1Q2NA 2OTKE 1S3JA 1JMBA 2HR3A 3RGUA 1ZXGA 3ZDMA 4CPGA 1MFTA 4JBZA 2M5AA 4HB1A 2K3RA 1LP1B 1BDDA 4ZNCA 2B89A 2B87B 1JM0A 1U7JA 2M5AB 5DJTB 1EDLA 4EYYQ 1LP1A 2QRXA 2KI7B 2B87A
chains in the Genus database with same CATH superfamily
5GTIE 1JUNA 4D6TJ 5APWA 3CC7P 3TF5A 3VMYA 4NPFX 2WVRA 5BU5A 5AW9B 1KZUB 3B71A 1L0NE 5APVA 3AE8C 1SQPG 2MKVA 3W67A 5CCHA 1RF1C 3I55P 1PGQA 2KNCB 1W2EA 3N4XA 2IDBA 1EZVE 2QJKC 1N8RQ 1ZLLA 3LW5J 4WVZA 1HVVA 1PP9G 1JTHB 1NU1E 1Z56A 1LT1A 1HWTC 3I5CA 5BU8B 4XE5B 2BEQD 1HF9A 1Q2NA 1N86A 4R4MA 1HUCA 1S3JA 3B5NA 2RMZA 1S4XA 2Q7CA 2M5AA 3RK3B 1ZMEC 3EWKA 1AVOA 1NKNA 3OA7A 2P1JA 1QX8A 1DD4A 2E76D 5AW0B 3P8CD 1OX3A 1KFMA 1KQGB 2FXPA 3AEBC 1KORA 1LTJB 1OWAA 5AVVB 1RF1A 1ZV8A 1YITP 3L75J 1VQ9P 1J1DC 2Q5UA 2ZT9D 3TGUG 3TYYA 4OGQB 2JEEA 3FWNA 3U1AA 2NRGA 1YBKA 2H88C 4EI2A 1SQPD 2E43A 1SQXJ 1CW5A 2JWAA 1PPJE 3KQGA 5KLIB 3L72E 1S5LH 5KAFE 2W8ZA 4I1LA 2WSEH 3UIAA 3OW2O 4OWFA 2XZRA 2LXCB 3HUSB 4WY4B 2C0XA 3SWYA 2M3BA 4KJMA 5TJHA 3EFGA 1HJBA 1VQ4P 1AQ5A 1GK4A 1PP9D 2ZYDA 3L36A 2H8PD 1L4AD 3H1IE 1JMBA 4N78E 4W80A 1URQB 1FZBA 1JEKA 1IK7A 2JO1A 1NTKG 2FYUG 3VMXA 3V2PA 5APSA 3GHGC 1CZQA 2AXCA 2IFNA 2B87B 3LIDA 1KYOE 3HE4A 2ZJSE 3WUTA 3MTUE 2E76C 2WPSA 5AW8B 3TDKA 4GIFA 1FZCA 3L70G 2QG4A 5CCGD 1GL2A 1X22A 1KILB 1X0TA 1VQ6P 2KYVA 5AVRB 3Q5SA 1MZ9A 2O3JA 1M7LA 3TGUD 1YQ4C 2YIUC 1LTSC 2OYHC 3L74G 4PV1B 2N1TB 3PJSK 2FBWC 5B5EH 1H88A 1KC8Q 1FE6A 4WBAA 1LTAC 3BRTB 1S1CX 1MKMA 1LTBC 5GTHH 3L37A 4BRYA 5CJ0A 1FS0E 5KKZC 1JY2O 4Y99C 2O1KA 3GHGA 3USSA 2HPCB 2JJLA 3H1LE 2D2CC 1T3UA 1PFIA 1SQPJ 2CPSA 3TSIA 2B9BA 1SQBE 3PLNA 1OMIA 1BE3G 4H44D 3CCSP 4I7ZB 1NTKD 2FYUD 2WSCJ 1JMMA 1ZRTD 4DT0A 1PIXA 1SLQA 2BCCG 1CSBA 2HG5D 1GW3A 2OYIC 1QVFO 3L70D 1BGYG 2XNXA 5APXA 2PFXA 2WQYC 1P84D 1J1EC 1KV4A 2P67A 2Z5IA 2K9JA 4ASWA 1G2CA 3F89A 1WMKA 1ZW0A 3JCUH 1Q82Q 2Z4EA 1EDKA 1N2DC 2FYNC 1SQBK 4H13C 3QH9A 1H0TA 2C9NY 3L74D 3O6QB 3AEDC 1S5LE 3NTNA 1NYHA 5CBOA 1NTZJ 3HE5B 1RF0C 3C9IA 4M3LA 2IZ1A 2QE7H 1KQFB 1EC5A 1N73B 5AVYB 5KJ7D 3KYQA 1IJDB 3L71G 1KD1Q 1NTME 1RH5B 2ZVOB 1ZXGA 4H44C 3A5TA 5AVQB 3RL0B 2OYIA 1N7SC 3H1KG 2MJZA 1BE3D 4RKUJ 3CD6P 1BDDA 2WWWA 5BVZA 2E75B 1JM0A 1L0LD 1S9KE 2VRSA 2A06E 4DCKA 3CCJP 2BEZF 2BCCD 2L5GB 3CC2P 1OW8A 1UIIA 1SFCD 1VQLP 3M91A 4C46A 2FKWB 1A02F 1BGYD 1EXJA 5C39A 2ZYGA 2AEFA 2FYUJ 3V5BA 2LXBA 1RF0A 3MZWB 2KIKA 1GU4A 1EDIA 3TNUB 3AE4C 4MN4C 2W6AA 5B5EE 1GW4A 2NPSD 2WT7A 3AEAC 2KNCA 2OQQA 4A7PA 2WITA 2QSIA 2CPBA 1VDFA 2OARA 1GK6A 3Q5RA 1SP4A 2WPRA 3PTZA 4IOIH 3L70J 1BDCA 3D6ZA 5GTHE 2OGUA 2ZT9B 2WSSH 3CCQP 3H25A 1JTHA 5KLVE 1N7SA 5E79H 3H32A 1RQUA 2Y9YA 3CXHH 1QGKB 4ZKUA 3GF7A 4U3FE 3L71D 3L74J 3E1RA 3AE9C 2YKOA 1MV8A 4CPGA 1MFTA 4EOTA 1HGVA 3BCCG 3H1KD 2R5BA 5CCHC 1MFZA 1SQPK 1Q81Q 1L4AB 1W5CE 1LTJA 3AE6C 2WSFJ 2QRXA 2FFDB 3CXHI 1LT9C 5KLVK 1YIJP 2I8DA 2RKLA 1BCCE 1YYCA 3H1HE 1OVVA 3JCUE 3L73E 3CC4P 1BE3J 1IFIA 3HD7C 2QJPC 2Q1KA 4LGDE 3AE3C 2NZ2A 1T2KC 3B5NC 3IFMA 3NMDA 3BASA 2YO3A 4GODA 2P58A 2BCCJ 2HYNA 2DW3A 1FDIA 1SQVE 4BWNA 3H1JG 4WY4A 1QL1A 2XNDH 1BGYJ 3CX5D 3KXDA 2KZJA 3LW5H 1VF5C 4PD4H 3CCVP 5AW1B 4TLFA 2WPQA 1URQA 1GL2D 1NKZB 2OTLP 2CK3H 2I1JA 3P8MC 3EQ2A 1SQQG 3L35A 4AQRD 3L4FA 1LT9A 3BCCD 3RK3E 2B89A 3CL3D 3M0DC 1ZN5A 1KN7A 1KTMA 2L91A 3HD7A 5APUA 2R3CA 4AUWA 2PGDA 1SQVK 1KILA 4PD4I 5TISH 3CCEP 1RQVA 1HH0A 4OVNF 2IBZE 3L71J 3T97B 3WUVA 4Z1MH 1S5LX 1RE4A 3A2AA 2Y0DA 3H1KJ 3C8VA 3BVHA 1PGJA 2N1TA 3M9QA 2PP6A 4GOEA 2O1JA 2IX7C 2M3EA 1KB9H 2E74C 4JYCA 1PGPA 1NTZG 2IYOA 3A3YB 2IZ0A 3H1LJ 1NTKK 3RK2C 2Y9ZA 3O8ZA 2G8YA 1M1JC 5E79E 2HPCA 3H1JD 1FZCC 3CXHE 1PGOA 1GL2C 2YKPA 3M0DA 2UWJE 1IFMA 2KS1B 1KFNA 1T3JA 3SWFA 2KSJA 1KB9I 3G9RA 3D71A 2KB7P 3FGAD 1VQ7P 2POHA 3GG2A 1GD2E 3IF4A 1L0NG 2D2CD 3CWBE 2IYPA 3HTKB 1PV3A 3AEEC 1YQ3C 2XU6A 1LP1A 2RN0A 2OYOA 2JP3A 3CX5I 3S4RA 5AW4B 4D6TE 2KZIA 1KILE 1FZGA 1EZVG 1DEBA 1LWUC 3IAOA 2IPPA 4UB8H 3BCCJ 4PJ0H 1GU5A 1IO4A 1M1JA 1LJ2A 1R5LA 2WSEJ 1VQPP 3O6QA 2WPVB 1SVFA 1NU1G 4RJTA 4GOFA 4WWIA 1YTZI 2IFMA 1SFCB 1X9VA 1NTZD 2A45H 2YXQB 1RHZB 1K05A 1L2PA 3PRJA 4NPEA 3BRVB 1N73A 1L0LK 4H0LC 4PD4E 2GUVA 3AE2C 3F5HA 2Y0CA 2NPSB 1PZQA 1D7MA 2JKVA 4H13D 1OVUA 3Q1MA 3KZIH 3A7OA 2M8RA 2R3SA 2RH0A 3TK1A 4W7ZA 4Y28J 5APTA 1OW6A 2A45I 3H1JJ 3VOPA 1JY3O 1T6AA 2QJYC 3GLMA 1R8EA 2KK7A 1LWUA 4O9BA 3ABVC 1USDA 2J59M 1OW7A 5TISE 3MD0A 1RF1B 1L0ND 2W6BA 3GF3A 1CI6B 2ZFCA 5AW6B 1PPJG 1N7SD 1N7LA 2QJKB 3L75E 3L72G 2ZAEB 4WB4A 1SQQJ 3FX0A 3TNUA 1EZVD 5AW7B 2KUBA 1BSNA 3LIEA 3MUDA 5CMZA 3V4WA 2K88A 1H8AA 1KB9E 4DOJA 1VQKP 3II6A 1SQXE 1NU1D 3CWBG 3JC22 3H1IG 3VTPC 3KDPB 1YJNP 4C7NB 1VQ8P 1NHLA 1DD3A 3P32A 3PHLA 4LC1A 4C7RA 1ZOYC 2P2UA 4YXDC 2KXPB 4DZOA 4AYCA 2H7HA 1QLED 3Q3DA 2C0WA 1HTLC 3FXEA 3MP7B 4OGQD 3SFDC 3RGUA 2K9YA 3HE4B 1J1DB 3CCUP 1YHQP 2Y0EA 1AJYA 5H2FH 1HJ0A 2AEJA 4GT1A 1SQXK 2O01H 4W7YA 1WRGA 1HBWA 1U57A 2YMKA 1EDLA 5AW5B 1FU1A 3M0AA 1KMIZ 3M06A 4U7JA 3ITKA 3D6YA 1JCCA 1PPJD 4HYTB 4UB8E 3L72D 1HGZA 3PP5A 4PJ0E 1XTCC 1URQD 2R5DA 4IFFA 5CCHD 1NGMB 5CCGA 2QM7A 5K5GB 1VQNP 3RK3C 3FWLA 1LNQA 3H1LG 1JY2P 3P8CE 1L0NJ 3N7NA 1NJIQ 4BRYB 3CMEP 1SQBG 3GHGB 3H1ID 4N78D 1P84H 3AE1C 2OTJP 2FXMA 1RY3A 3HD7D 2AEMA 5KAIH 1JY2N 2E76B 1LTJC 1DX7A 1T2KD 3B5ND 1YJWP 2ITAA 1JNMA 1QL2A 1KYOD 3KZIE 1E79H 4ZMDA 1SQPE 4OGQC 1M8OB 2QIWA 3CI9A 4EDFA 1NU1J 1AQTA 3RL0g 5AW3B 2Q3EA 3SFEC 2V7QH 3VP8A 4PV1D 2N1TD 3ZDMA 4JBZA 3OAKA 1PL5A 2K3RA 5KLIC 1VF5D 2YIUB 1ZP0C 2OYHB 1P84I 3G4SP 2C9LY 1PP9E 3HUSC 4WY4C 3T97A 5B66H 2ZYAA 1Y9BA 2K9JB 1G2CB 1VL2A 1BSHA 1XTGB 3V4QA 3AEFC 1Q86Q 5KKZB 1JO5A 2KOGA 4Y99B 3IR9A 1AVYA 1URQC 2WMMA 3AECC 3NXSA 3AEGC 2D2CB 2KSEA 1J2JB 3G71P 3V2NA 2HODB 2JWDA 4IFDK 3FXDA 3W68A 1NTMG 3H1LD 4HJGH 1G1IA 3R2PA 1DIPA 3A0HH 1OXZA 2YXRB 4I6MC 4N6JA 1LTGC 1JOCA 1Y8AA 2ZXEB 3A0BH 3GW6A 2LR2A 2WTYA 3L72J 1YTZT 1S2EA 1KILC 3TGUE 2KS1A 1M1KQ 1AFOA 4QMAA 2OYIB 2A06G 2E74D 1IFNA 1T8ZA 1RE4C 3HUSA 1J1EB 4RESB 4PV1C 2N1TC 3CWBJ 3RK2D 3E1IA 5KJ7A 1AA0A 3H1IJ 2N9YB 1IFJA 5H2FE 3HTKA 1M57D 3E7KA 3M9BA 3RBXA 2FYNB 4H13B 1LTTC 1NTZK 1S72P 1IK9A 1FOSE 1EXIA 1Q90D 3BATA 4L75A 2B87A 3QWOC 4JQ0D 1MUUA 1IFPA 1Q7YQ 1NAYA 4IL6H 5EFWB 4YTPC 1KYOI 1NTKE 2FYUE 4HKZH 5AVUB 3CLQA 1ZRTE 2WT7B 5KLVG 1X8YA 5DJUB 5AVTB 5L8RJ 1YI2P 1NWQA 3RL0D 2SPZA 4I7ZC 1SFCA 2GUSA 4U3FG 5CJ4A 4H44B 2E75D 2PAJA 1N7SB 3H32B 1NTMD 3L70E 4XA4A 1IC2A 1P84E 3CMAP 2E5YA 3U59A 1NVOA 2XV5A 2NPSA 2FYZA 5KAIE 4L76A 1FBMA 1L0NK 4UB6H 1R5SA 4I2LC 1S9KD 3L74E 2XKMA 1K8AQ 1DEEG 2A06D 1OZHA 4EIJA 2FYUK 3SWKA 2W27A 5APQA 1BCCG 3H1HG 1SQBJ 4H0LD 3L73G 1KQSO 4HB1A 3CX5H 2BASA 1NU1K 1CI6A 1LGHB 5B66E 1N73C 2KI7B 1M56D 1SQQD 3WUUA 2YKQA 1NOHA 1VQMP 1SQVG 1BE3E 1GMJA 3RL0C 1L0LE 5KLVD 2YO2A 4K3AA 4N3YB 1FZFA 1U7MA 2I1KA 1YJ9P 3WMM0 3IN6A 2E75C 3WU2H 2AXTH 2BCCE 3VP9A 1WT6A 4C7NA 3A0HE 4U3FD 3A0BE 3I56P 1OFCX 2R44A 3AE7C 1BGYE 4L73A 5AVZB 3NFQA 3MGNA 1LTIC 3Q5PA 2FY8A 5CBNA 2FXOA 1ZR4A 1G1JA 1GTWA 3EFFK 1JB0J 4KT0J 3OJAB 3HE5A 4BXLA 1LT9B 1RE3C 2IBZG 2P10A 3VYIA 1NTMJ 2ZXXA 3SSUA 3MUDC 3U1CA 3V6IA 3HD7B 2QJPB 3C1LA 3B5NB 3AE5C 1BCCD 5KTBA 3H1HD 4ZNCA 3CCLP 2WZ7A 2ZT9C 3R4YA 3L73D 1VQOP 2J5UA 2M5AB 3L71E 1VQ5P 2P7JA 2O01N 2R32A 4IL6E 4YPCA 2WSCH 3HRNA 2HFED 4NPDA 1NO4A 1OVRA 1SS1A 3H1KE 1VF5B 3S1KA 1SQVD 1FDOA 2QVAA 3KPEA 2J58A 3JSVC 3D70A 1L4AC 1GDTA 2HLOA 1RE3A 2FFDC 1VPCA 4JYBA 1Y47A 4ASVA 4UB6E 5KLVJ 2KLUA 3RK3D 1L0LG 3GMAA 3Q2YA 3VN0A 2ZVNB 3VMZA 4B86A 4IFMA 4U3FJ 2HR3A 1PP9J 1IZNB 1FZAA 4D6TG 2IBZD 2H43A 5CCGC 2OYHA 3M9HA 2YNYA 2QEXP 2E42A 3CX5E 3S9OA 5APYA 4GKGA 1LP1B 2H89C 2E74B 1FOSF 5M1BA 1X79B 2W90A 3RK2B 1M1JB 3V2QA 5GTIH 1L4AA 4JF7A 3BCCE 1FZCB 3PH0A 3G3ZA 2HODA 1ZR2A 2FFDA 1BCCJ 1GL2B 3H1HJ 3L73J 1FZEA 3CXHD 4WY4D 3WU2E 2AXTE 2KLVA 4YXWH 4OH8B 4GDOA 2Q9IA 1EDJA 3MIWA 3TGUJ 2N9BA 2W83C 1JCDA 1TU3F 4LLHA 2B88A 3MHVA 1M90Q 2QA4P 4HH2A 3G6EP 1SQVJ 3V2RA 1IFDA 1FJKA 4TT3H 1UIXA 1JY3P 4K35A 3H6PA 1FJPA 2O01J 3CWBD 1FAVA 3CPWO 1LWUB 3L75G 1W2BO 3H1JE 4D6TD 3CCRP 3KHUA 1KILD 1JY3N 3B4SA 2PRRA 1U7JA 1NTKJ 1AV1A 2YMYA 1NTMK 1SQXG 1EZVI 2W6JH 4XFJA 2KP8A 4EYYQ 2E5TA 1EQ7A 1K9MQ 1FC2C 2LKMA 2JDIH 1SQQE 2G3AA 2Q6QA 4H0LB 1DH3A 4ZKPA 4PD4D 2GM4A 5AVXB 5AVWB 2IBZI 2WSFH 1KQLA 5KJ7C 1OIPA 1NH4A 1FDMA 3B8EB 1NAFA 1E5WA 3CCMP 5AVSB 1H0TB 1K04A 3RBZA 2XDJA 2QJYB 2Z5HA 2QM8A 1USEA 2M0BA 5AW2B 5KAFH 2V7QJ 1A02J 4KHXA 4R4LA 2GA1A 1QEXA 5CHXA 1K73Q 1SQQK 1NTZE 1H89A 4DJGA 2OTKE 1SQBD 4IL6X 1SFCC 4JPZB 2Q3IA 3L75D 2V4HA 1GZLA 5DJTB 1KYOH 3VMAA 3K5BA 2K37A 2JR8A 3P7KA 4L74A 1KB9D 1L0LJ 2NPSC 1QVGO 4RO0A 2A45G 2K1AA 1SQXD
chains in the Genus database with same CATH topology
1FC2C 3QWOC 2KZIA 2I8DA 4NPDA 1X0TA 5EFWB 2ZAEB 2RKLA 1OVRA 1SS1A 4HKZH 3S1KA 1OVVA 5C39A 3PH0A 4ASWA 2QVAA 2WMMA 2LXBA 1ZW0A 5DJUB 2Q1KA 2KUBA 3MZWB 4K3AA 1EDKA 2SPZA 4NPFX 2KIKA 4GOEA 1EDIA 5K5GB 2JWDA 1U7MA 3FXDA 4MN4C 4GOFA 4WWIA 1EDJA 1H0TA 4GODA 4HJGH 2P58A 2B88A 4IOIH 1BDCA 2R44A 1H0TB 3MHVA 5CBOA 4NPEA 1NVOA 2M0BA 2LR2A 1Y47A 5CBNA 2KZJA 2LXCB 4ASVA 1EC5A 4KJMA 4K35A 4BXLA 4ZMDA 1OVUA 2UWJE 1LT1A 1DEEG 2KS1B 3FXEA 1Q2NA 2OTKE 1S3JA 1JMBA 2HR3A 3RGUA 1ZXGA 3ZDMA 4CPGA 1MFTA 4JBZA 2M5AA 4HB1A 2K3RA 1LP1B 1BDDA 4ZNCA 2B89A 2B87B 1JM0A 1U7JA 2M5AB 5DJTB 1EDLA 4EYYQ 1LP1A 2QRXA 2KI7B 2B87A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FC2 C;  3QWO C;  2KZI A;  2I8D A;  4NPD A;  1X0T A;  5EFW B;  2ZAE B;  2RKL A;  1OVR A;  1SS1 A;  4HKZ H;  3S1K A;  1OVV A;  5C39 A;  3PH0 A;  4ASW A;  2QVA A;  2WMM A;  2LXB A;  1ZW0 A;  5DJU B;  2Q1K A;  2KUB A;  3MZW B;  4K3A A;  1EDK A;  2SPZ A;  4NPF X;  2KIK A;  4GOE A;  1EDI A;  5K5G B;  2JWD A;  1U7M A;  3FXD A;  4MN4 C;  4GOF A;  4WWI A;  1EDJ A;  1H0T A;  4GOD A;  4HJG H;  2P58 A;  2B88 A;  4IOI H;  1BDC A;  2R44 A;  1H0T B;  3MHV A;  5CBO A;  4NPE A;  1NVO A;  2M0B A;  2LR2 A;  1Y47 A;  5CBN A;  2KZJ A;  2LXC B;  4ASV A;  1EC5 A;  4KJM A;  4K35 A;  4BXL A;  4ZMD A;  1OVU A;  2UWJ E;  1LT1 A;  1DEE G;  2KS1 B;  3FXE A;  1Q2N A;  2OTK E;  1S3J A;  1JMB A;  2HR3 A;  3RGU A;  1ZXG A;  3ZDM A;  4CPG A;  1MFT A;  4JBZ A;  2M5A A;  4HB1 A;  2K3R A;  1LP1 B;  1BDD A;  4ZNC A;  2B89 A;  2B87 B;  1JM0 A;  1U7J A;  2M5A B;  5DJT B;  1EDL A;  4EYY Q;  1LP1 A;  2QRX A;  2KI7 B;  2B87 A; 
#chains in the Genus database with same CATH topology
 5GTI E;  1JUN A;  4D6T J;  5APW A;  3CC7 P;  3TF5 A;  3VMY A;  4NPF X;  2WVR A;  5BU5 A;  5AW9 B;  1KZU B;  3B71 A;  1L0N E;  5APV A;  3AE8 C;  1SQP G;  2MKV A;  3W67 A;  5CCH A;  1RF1 C;  3I55 P;  1PGQ A;  2KNC B;  1W2E A;  3N4X A;  2IDB A;  1EZV E;  2QJK C;  1N8R Q;  1ZLL A;  3LW5 J;  4WVZ A;  1HVV A;  1PP9 G;  1JTH B;  1NU1 E;  1Z56 A;  1LT1 A;  1HWT C;  3I5C A;  5BU8 B;  4XE5 B;  2BEQ D;  1HF9 A;  1Q2N A;  1N86 A;  4R4M A;  1HUC A;  1S3J A;  3B5N A;  2RMZ A;  1S4X A;  2Q7C A;  2M5A A;  3RK3 B;  1ZME C;  3EWK A;  1AVO A;  1NKN A;  3OA7 A;  2P1J A;  1QX8 A;  1DD4 A;  2E76 D;  5AW0 B;  3P8C D;  1OX3 A;  1KFM A;  1KQG B;  2FXP A;  3AEB C;  1KOR A;  1LTJ B;  1OWA A;  5AVV B;  1RF1 A;  1ZV8 A;  1YIT P;  3L75 J;  1VQ9 P;  1J1D C;  2Q5U A;  2ZT9 D;  3TGU G;  3TYY A;  4OGQ B;  2JEE A;  3FWN A;  3U1A A;  2NRG A;  1YBK A;  2H88 C;  4EI2 A;  1SQP D;  2E43 A;  1SQX J;  1CW5 A;  2JWA A;  1PPJ E;  3KQG A;  5KLI B;  3L72 E;  1S5L H;  5KAF E;  2W8Z A;  4I1L A;  2WSE H;  3UIA A;  3OW2 O;  4OWF A;  2XZR A;  2LXC B;  3HUS B;  4WY4 B;  2C0X A;  3SWY A;  2M3B A;  4KJM A;  5TJH A;  3EFG A;  1HJB A;  1VQ4 P;  1AQ5 A;  1GK4 A;  1PP9 D;  2ZYD A;  3L36 A;  2H8P D;  1L4A D;  3H1I E;  1JMB A;  4N78 E;  4W80 A;  1URQ B;  1FZB A;  1JEK A;  1IK7 A;  2JO1 A;  1NTK G;  2FYU G;  3VMX A;  3V2P A;  5APS A;  3GHG C;  1CZQ A;  2AXC A;  2IFN A;  2B87 B;  3LID A;  1KYO E;  3HE4 A;  2ZJS E;  3WUT A;  3MTU E;  2E76 C;  2WPS A;  5AW8 B;  3TDK A;  4GIF A;  1FZC A;  3L70 G;  2QG4 A;  5CCG D;  1GL2 A;  1X22 A;  1KIL B;  1X0T A;  1VQ6 P;  2KYV A;  5AVR B;  3Q5S A;  1MZ9 A;  2O3J A;  1M7L A;  3TGU D;  1YQ4 C;  2YIU C;  1LTS C;  2OYH C;  3L74 G;  4PV1 B;  2N1T B;  3PJS K;  2FBW C;  5B5E H;  1H88 A;  1KC8 Q;  1FE6 A;  4WBA A;  1LTA C;  3BRT B;  1S1C X;  1MKM A;  1LTB C;  5GTH H;  3L37 A;  4BRY A;  5CJ0 A;  1FS0 E;  5KKZ C;  1JY2 O;  4Y99 C;  2O1K A;  3GHG A;  3USS A;  2HPC B;  2JJL A;  3H1L E;  2D2C C;  1T3U A;  1PFI A;  1SQP J;  2CPS A;  3TSI A;  2B9B A;  1SQB E;  3PLN A;  1OMI A;  1BE3 G;  4H44 D;  3CCS P;  4I7Z B;  1NTK D;  2FYU D;  2WSC J;  1JMM A;  1ZRT D;  4DT0 A;  1PIX A;  1SLQ A;  2BCC G;  1CSB A;  2HG5 D;  1GW3 A;  2OYI C;  1QVF O;  3L70 D;  1BGY G;  2XNX A;  5APX A;  2PFX A;  2WQY C;  1P84 D;  1J1E C;  1KV4 A;  2P67 A;  2Z5I A;  2K9J A;  4ASW A;  1G2C A;  3F89 A;  1WMK A;  1ZW0 A;  3JCU H;  1Q82 Q;  2Z4E A;  1EDK A;  1N2D C;  2FYN C;  1SQB K;  4H13 C;  3QH9 A;  1H0T A;  2C9N Y;  3L74 D;  3O6Q B;  3AED C;  1S5L E;  3NTN A;  1NYH A;  5CBO A;  1NTZ J;  3HE5 B;  1RF0 C;  3C9I A;  4M3L A;  2IZ1 A;  2QE7 H;  1KQF B;  1EC5 A;  1N73 B;  5AVY B;  5KJ7 D;  3KYQ A;  1IJD B;  3L71 G;  1KD1 Q;  1NTM E;  1RH5 B;  2ZVO B;  1ZXG A;  4H44 C;  3A5T A;  5AVQ B;  3RL0 B;  2OYI A;  1N7S C;  3H1K G;  2MJZ A;  1BE3 D;  4RKU J;  3CD6 P;  1BDD A;  2WWW A;  5BVZ A;  2E75 B;  1JM0 A;  1L0L D;  1S9K E;  2VRS A;  2A06 E;  4DCK A;  3CCJ P;  2BEZ F;  2BCC D;  2L5G B;  3CC2 P;  1OW8 A;  1UII A;  1SFC D;  1VQL P;  3M91 A;  4C46 A;  2FKW B;  1A02 F;  1BGY D;  1EXJ A;  5C39 A;  2ZYG A;  2AEF A;  2FYU J;  3V5B A;  2LXB A;  1RF0 A;  3MZW B;  2KIK A;  1GU4 A;  1EDI A;  3TNU B;  3AE4 C;  4MN4 C;  2W6A A;  5B5E E;  1GW4 A;  2NPS D;  2WT7 A;  3AEA C;  2KNC A;  2OQQ A;  4A7P A;  2WIT A;  2QSI A;  2CPB A;  1VDF A;  2OAR A;  1GK6 A;  3Q5R A;  1SP4 A;  2WPR A;  3PTZ A;  4IOI H;  3L70 J;  1BDC A;  3D6Z A;  5GTH E;  2OGU A;  2ZT9 B;  2WSS H;  3CCQ P;  3H25 A;  1JTH A;  5KLV E;  1N7S A;  5E79 H;  3H32 A;  1RQU A;  2Y9Y A;  3CXH H;  1QGK B;  4ZKU A;  3GF7 A;  4U3F E;  3L71 D;  3L74 J;  3E1R A;  3AE9 C;  2YKO A;  1MV8 A;  4CPG A;  1MFT A;  4EOT A;  1HGV A;  3BCC G;  3H1K D;  2R5B A;  5CCH C;  1MFZ A;  1SQP K;  1Q81 Q;  1L4A B;  1W5C E;  1LTJ A;  3AE6 C;  2WSF J;  2QRX A;  2FFD B;  3CXH I;  1LT9 C;  5KLV K;  1YIJ P;  2I8D A;  2RKL A;  1BCC E;  1YYC A;  3H1H E;  1OVV A;  3JCU E;  3L73 E;  3CC4 P;  1BE3 J;  1IFI A;  3HD7 C;  2QJP C;  2Q1K A;  4LGD E;  3AE3 C;  2NZ2 A;  1T2K C;  3B5N C;  3IFM A;  3NMD A;  3BAS A;  2YO3 A;  4GOD A;  2P58 A;  2BCC J;  2HYN A;  2DW3 A;  1FDI A;  1SQV E;  4BWN A;  3H1J G;  4WY4 A;  1QL1 A;  2XND H;  1BGY J;  3CX5 D;  3KXD A;  2KZJ A;  3LW5 H;  1VF5 C;  4PD4 H;  3CCV P;  5AW1 B;  4TLF A;  2WPQ A;  1URQ A;  1GL2 D;  1NKZ B;  2OTL P;  2CK3 H;  2I1J A;  3P8M C;  3EQ2 A;  1SQQ G;  3L35 A;  4AQR D;  3L4F A;  1LT9 A;  3BCC D;  3RK3 E;  2B89 A;  3CL3 D;  3M0D C;  1ZN5 A;  1KN7 A;  1KTM A;  2L91 A;  3HD7 A;  5APU A;  2R3C A;  4AUW A;  2PGD A;  1SQV K;  1KIL A;  4PD4 I;  5TIS H;  3CCE P;  1RQV A;  1HH0 A;  4OVN F;  2IBZ E;  3L71 J;  3T97 B;  3WUV A;  4Z1M H;  1S5L X;  1RE4 A;  3A2A A;  2Y0D A;  3H1K J;  3C8V A;  3BVH A;  1PGJ A;  2N1T A;  3M9Q A;  2PP6 A;  4GOE A;  2O1J A;  2IX7 C;  2M3E A;  1KB9 H;  2E74 C;  4JYC A;  1PGP A;  1NTZ G;  2IYO A;  3A3Y B;  2IZ0 A;  3H1L J;  1NTK K;  3RK2 C;  2Y9Z A;  3O8Z A;  2G8Y A;  1M1J C;  5E79 E;  2HPC A;  3H1J D;  1FZC C;  3CXH E;  1PGO A;  1GL2 C;  2YKP A;  3M0D A;  2UWJ E;  1IFM A;  2KS1 B;  1KFN A;  1T3J A;  3SWF A;  2KSJ A;  1KB9 I;  3G9R A;  3D71 A;  2KB7 P;  3FGA D;  1VQ7 P;  2POH A;  3GG2 A;  1GD2 E;  3IF4 A;  1L0N G;  2D2C D;  3CWB E;  2IYP A;  3HTK B;  1PV3 A;  3AEE C;  1YQ3 C;  2XU6 A;  1LP1 A;  2RN0 A;  2OYO A;  2JP3 A;  3CX5 I;  3S4R A;  5AW4 B;  4D6T E;  2KZI A;  1KIL E;  1FZG A;  1EZV G;  1DEB A;  1LWU C;  3IAO A;  2IPP A;  4UB8 H;  3BCC J;  4PJ0 H;  1GU5 A;  1IO4 A;  1M1J A;  1LJ2 A;  1R5L A;  2WSE J;  1VQP P;  3O6Q A;  2WPV B;  1SVF A;  1NU1 G;  4RJT A;  4GOF A;  4WWI A;  1YTZ I;  2IFM A;  1SFC B;  1X9V A;  1NTZ D;  2A45 H;  2YXQ B;  1RHZ B;  1K05 A;  1L2P A;  3PRJ A;  4NPE A;  3BRV B;  1N73 A;  1L0L K;  4H0L C;  4PD4 E;  2GUV A;  3AE2 C;  3F5H A;  2Y0C A;  2NPS B;  1PZQ A;  1D7M A;  2JKV A;  4H13 D;  1OVU A;  3Q1M A;  3KZI H;  3A7O A;  2M8R A;  2R3S A;  2RH0 A;  3TK1 A;  4W7Z A;  4Y28 J;  5APT A;  1OW6 A;  2A45 I;  3H1J J;  3VOP A;  1JY3 O;  1T6A A;  2QJY C;  3GLM A;  1R8E A;  2KK7 A;  1LWU A;  4O9B A;  3ABV C;  1USD A;  2J59 M;  1OW7 A;  5TIS E;  3MD0 A;  1RF1 B;  1L0N D;  2W6B A;  3GF3 A;  1CI6 B;  2ZFC A;  5AW6 B;  1PPJ G;  1N7S D;  1N7L A;  2QJK B;  3L75 E;  3L72 G;  2ZAE B;  4WB4 A;  1SQQ J;  3FX0 A;  3TNU A;  1EZV D;  5AW7 B;  2KUB A;  1BSN A;  3LIE A;  3MUD A;  5CMZ A;  3V4W A;  2K88 A;  1H8A A;  1KB9 E;  4DOJ A;  1VQK P;  3II6 A;  1SQX E;  1NU1 D;  3CWB G;  3JC2 2;  3H1I G;  3VTP C;  3KDP B;  1YJN P;  4C7N B;  1VQ8 P;  1NHL A;  1DD3 A;  3P32 A;  3PHL A;  4LC1 A;  4C7R A;  1ZOY C;  2P2U A;  4YXD C;  2KXP B;  4DZO A;  4AYC A;  2H7H A;  1QLE D;  3Q3D A;  2C0W A;  1HTL C;  3FXE A;  3MP7 B;  4OGQ D;  3SFD C;  3RGU A;  2K9Y A;  3HE4 B;  1J1D B;  3CCU P;  1YHQ P;  2Y0E A;  1AJY A;  5H2F H;  1HJ0 A;  2AEJ A;  4GT1 A;  1SQX K;  2O01 H;  4W7Y A;  1WRG A;  1HBW A;  1U57 A;  2YMK A;  1EDL A;  5AW5 B;  1FU1 A;  3M0A A;  1KMI Z;  3M06 A;  4U7J A;  3ITK A;  3D6Y A;  1JCC A;  1PPJ D;  4HYT B;  4UB8 E;  3L72 D;  1HGZ A;  3PP5 A;  4PJ0 E;  1XTC C;  1URQ D;  2R5D A;  4IFF A;  5CCH D;  1NGM B;  5CCG A;  2QM7 A;  5K5G B;  1VQN P;  3RK3 C;  3FWL A;  1LNQ A;  3H1L G;  1JY2 P;  3P8C E;  1L0N J;  3N7N A;  1NJI Q;  4BRY B;  3CME P;  1SQB G;  3GHG B;  3H1I D;  4N78 D;  1P84 H;  3AE1 C;  2OTJ P;  2FXM A;  1RY3 A;  3HD7 D;  2AEM A;  5KAI H;  1JY2 N;  2E76 B;  1LTJ C;  1DX7 A;  1T2K D;  3B5N D;  1YJW P;  2ITA A;  1JNM A;  1QL2 A;  1KYO D;  3KZI E;  1E79 H;  4ZMD A;  1SQP E;  4OGQ C;  1M8O B;  2QIW A;  3CI9 A;  4EDF A;  1NU1 J;  1AQT A;  3RL0 g;  5AW3 B;  2Q3E A;  3SFE C;  2V7Q H;  3VP8 A;  4PV1 D;  2N1T D;  3ZDM A;  4JBZ A;  3OAK A;  1PL5 A;  2K3R A;  5KLI C;  1VF5 D;  2YIU B;  1ZP0 C;  2OYH B;  1P84 I;  3G4S P;  2C9L Y;  1PP9 E;  3HUS C;  4WY4 C;  3T97 A;  5B66 H;  2ZYA A;  1Y9B A;  2K9J B;  1G2C B;  1VL2 A;  1BSH A;  1XTG B;  3V4Q A;  3AEF C;  1Q86 Q;  5KKZ B;  1JO5 A;  2KOG A;  4Y99 B;  3IR9 A;  1AVY A;  1URQ C;  2WMM A;  3AEC C;  3NXS A;  3AEG C;  2D2C B;  2KSE A;  1J2J B;  3G71 P;  3V2N A;  2HOD B;  2JWD A;  4IFD K;  3FXD A;  3W68 A;  1NTM G;  3H1L D;  4HJG H;  1G1I A;  3R2P A;  1DIP A;  3A0H H;  1OXZ A;  2YXR B;  4I6M C;  4N6J A;  1LTG C;  1JOC A;  1Y8A A;  2ZXE B;  3A0B H;  3GW6 A;  2LR2 A;  2WTY A;  3L72 J;  1YTZ T;  1S2E A;  1KIL C;  3TGU E;  2KS1 A;  1M1K Q;  1AFO A;  4QMA A;  2OYI B;  2A06 G;  2E74 D;  1IFN A;  1T8Z A;  1RE4 C;  3HUS A;  1J1E B;  4RES B;  4PV1 C;  2N1T C;  3CWB J;  3RK2 D;  3E1I A;  5KJ7 A;  1AA0 A;  3H1I J;  2N9Y B;  1IFJ A;  5H2F E;  3HTK A;  1M57 D;  3E7K A;  3M9B A;  3RBX A;  2FYN B;  4H13 B;  1LTT C;  1NTZ K;  1S72 P;  1IK9 A;  1FOS E;  1EXI A;  1Q90 D;  3BAT A;  4L75 A;  2B87 A;  3QWO C;  4JQ0 D;  1MUU A;  1IFP A;  1Q7Y Q;  1NAY A;  4IL6 H;  5EFW B;  4YTP C;  1KYO I;  1NTK E;  2FYU E;  4HKZ H;  5AVU B;  3CLQ A;  1ZRT E;  2WT7 B;  5KLV G;  1X8Y A;  5DJU B;  5AVT B;  5L8R J;  1YI2 P;  1NWQ A;  3RL0 D;  2SPZ A;  4I7Z C;  1SFC A;  2GUS A;  4U3F G;  5CJ4 A;  4H44 B;  2E75 D;  2PAJ A;  1N7S B;  3H32 B;  1NTM D;  3L70 E;  4XA4 A;  1IC2 A;  1P84 E;  3CMA P;  2E5Y A;  3U59 A;  1NVO A;  2XV5 A;  2NPS A;  2FYZ A;  5KAI E;  4L76 A;  1FBM A;  1L0N K;  4UB6 H;  1R5S A;  4I2L C;  1S9K D;  3L74 E;  2XKM A;  1K8A Q;  1DEE G;  2A06 D;  1OZH A;  4EIJ A;  2FYU K;  3SWK A;  2W27 A;  5APQ A;  1BCC G;  3H1H G;  1SQB J;  4H0L D;  3L73 G;  1KQS O;  4HB1 A;  3CX5 H;  2BAS A;  1NU1 K;  1CI6 A;  1LGH B;  5B66 E;  1N73 C;  2KI7 B;  1M56 D;  1SQQ D;  3WUU A;  2YKQ A;  1NOH A;  1VQM P;  1SQV G;  1BE3 E;  1GMJ A;  3RL0 C;  1L0L E;  5KLV D;  2YO2 A;  4K3A A;  4N3Y B;  1FZF A;  1U7M A;  2I1K A;  1YJ9 P;  3WMM 0;  3IN6 A;  2E75 C;  3WU2 H;  2AXT H;  2BCC E;  3VP9 A;  1WT6 A;  4C7N A;  3A0H E;  4U3F D;  3A0B E;  3I56 P;  1OFC X;  2R44 A;  3AE7 C;  1BGY E;  4L73 A;  5AVZ B;  3NFQ A;  3MGN A;  1LTI C;  3Q5P A;  2FY8 A;  5CBN A;  2FXO A;  1ZR4 A;  1G1J A;  1GTW A;  3EFF K;  1JB0 J;  4KT0 J;  3OJA B;  3HE5 A;  4BXL A;  1LT9 B;  1RE3 C;  2IBZ G;  2P10 A;  3VYI A;  1NTM J;  2ZXX A;  3SSU A;  3MUD C;  3U1C A;  3V6I A;  3HD7 B;  2QJP B;  3C1L A;  3B5N B;  3AE5 C;  1BCC D;  5KTB A;  3H1H D;  4ZNC A;  3CCL P;  2WZ7 A;  2ZT9 C;  3R4Y A;  3L73 D;  1VQO P;  2J5U A;  2M5A B;  3L71 E;  1VQ5 P;  2P7J A;  2O01 N;  2R32 A;  4IL6 E;  4YPC A;  2WSC H;  3HRN A;  2HFE D;  4NPD A;  1NO4 A;  1OVR A;  1SS1 A;  3H1K E;  1VF5 B;  3S1K A;  1SQV D;  1FDO A;  2QVA A;  3KPE A;  2J58 A;  3JSV C;  3D70 A;  1L4A C;  1GDT A;  2HLO A;  1RE3 A;  2FFD C;  1VPC A;  4JYB A;  1Y47 A;  4ASV A;  4UB6 E;  5KLV J;  2KLU A;  3RK3 D;  1L0L G;  3GMA A;  3Q2Y A;  3VN0 A;  2ZVN B;  3VMZ A;  4B86 A;  4IFM A;  4U3F J;  2HR3 A;  1PP9 J;  1IZN B;  1FZA A;  4D6T G;  2IBZ D;  2H43 A;  5CCG C;  2OYH A;  3M9H A;  2YNY A;  2QEX P;  2E42 A;  3CX5 E;  3S9O A;  5APY A;  4GKG A;  1LP1 B;  2H89 C;  2E74 B;  1FOS F;  5M1B A;  1X79 B;  2W90 A;  3RK2 B;  1M1J B;  3V2Q A;  5GTI H;  1L4A A;  4JF7 A;  3BCC E;  1FZC B;  3PH0 A;  3G3Z A;  2HOD A;  1ZR2 A;  2FFD A;  1BCC J;  1GL2 B;  3H1H J;  3L73 J;  1FZE A;  3CXH D;  4WY4 D;  3WU2 E;  2AXT E;  2KLV A;  4YXW H;  4OH8 B;  4GDO A;  2Q9I A;  1EDJ A;  3MIW A;  3TGU J;  2N9B A;  2W83 C;  1JCD A;  1TU3 F;  4LLH A;  2B88 A;  3MHV A;  1M90 Q;  2QA4 P;  4HH2 A;  3G6E P;  1SQV J;  3V2R A;  1IFD A;  1FJK A;  4TT3 H;  1UIX A;  1JY3 P;  4K35 A;  3H6P A;  1FJP A;  2O01 J;  3CWB D;  1FAV A;  3CPW O;  1LWU B;  3L75 G;  1W2B O;  3H1J E;  4D6T D;  3CCR P;  3KHU A;  1KIL D;  1JY3 N;  3B4S A;  2PRR A;  1U7J A;  1NTK J;  1AV1 A;  2YMY A;  1NTM K;  1SQX G;  1EZV I;  2W6J H;  4XFJ A;  2KP8 A;  4EYY Q;  2E5T A;  1EQ7 A;  1K9M Q;  1FC2 C;  2LKM A;  2JDI H;  1SQQ E;  2G3A A;  2Q6Q A;  4H0L B;  1DH3 A;  4ZKP A;  4PD4 D;  2GM4 A;  5AVX B;  5AVW B;  2IBZ I;  2WSF H;  1KQL A;  5KJ7 C;  1OIP A;  1NH4 A;  1FDM A;  3B8E B;  1NAF A;  1E5W A;  3CCM P;  5AVS B;  1H0T B;  1K04 A;  3RBZ A;  2XDJ A;  2QJY B;  2Z5H A;  2QM8 A;  1USE A;  2M0B A;  5AW2 B;  5KAF H;  2V7Q J;  1A02 J;  4KHX A;  4R4L A;  2GA1 A;  1QEX A;  5CHX A;  1K73 Q;  1SQQ K;  1NTZ E;  1H89 A;  4DJG A;  2OTK E;  1SQB D;  4IL6 X;  1SFC C;  4JPZ B;  2Q3I A;  3L75 D;  2V4H A;  1GZL A;  5DJT B;  1KYO H;  3VMA A;  3K5B A;  2K37 A;  2JR8 A;  3P7K A;  4L74 A;  1KB9 D;  1L0L J;  2NPS C;  1QVG O;  4RO0 A;  2A45 G;  2K1A A;  1SQX D; 
#chains in the Genus database with same CATH homology
 1FC2 C;  3QWO C;  2KZI A;  2I8D A;  4NPD A;  1X0T A;  5EFW B;  2ZAE B;  2RKL A;  1OVR A;  1SS1 A;  4HKZ H;  3S1K A;  1OVV A;  5C39 A;  3PH0 A;  4ASW A;  2QVA A;  2WMM A;  2LXB A;  1ZW0 A;  5DJU B;  2Q1K A;  2KUB A;  3MZW B;  4K3A A;  1EDK A;  2SPZ A;  4NPF X;  2KIK A;  4GOE A;  1EDI A;  5K5G B;  2JWD A;  1U7M A;  3FXD A;  4MN4 C;  4GOF A;  4WWI A;  1EDJ A;  1H0T A;  4GOD A;  4HJG H;  2P58 A;  2B88 A;  4IOI H;  1BDC A;  2R44 A;  1H0T B;  3MHV A;  5CBO A;  4NPE A;  1NVO A;  2M0B A;  2LR2 A;  1Y47 A;  5CBN A;  2KZJ A;  2LXC B;  4ASV A;  1EC5 A;  4KJM A;  4K35 A;  4BXL A;  4ZMD A;  1OVU A;  2UWJ E;  1LT1 A;  1DEE G;  2KS1 B;  3FXE A;  1Q2N A;  2OTK E;  1S3J A;  1JMB A;  2HR3 A;  3RGU A;  1ZXG A;  3ZDM A;  4CPG A;  1MFT A;  4JBZ A;  2M5A A;  4HB1 A;  2K3R A;  1LP1 B;  1BDD A;  4ZNC A;  2B89 A;  2B87 B;  1JM0 A;  1U7J A;  2M5A B;  5DJT B;  1EDL A;  4EYY Q;  1LP1 A;  2QRX A;  2KI7 B;  2B87 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...