5DJUB

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
NKFNKEVLVARQEIYWLPNLNWEQKFAFISSLTNDPSQSANLLAEAKKLNGAQPP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Engineered protein, Zdk3 affibody
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 20
structure length 55
sequence length 55
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djuB00
4GOFA 3ZDMA 4EYYQ 1EC5A 2JWDA 1LT1A 4NPDA 4NPFX 2P58A 5EFWB 2KS1B 2R44A 1H0TB 5DJTB 1OVRA 2KIKA 5DJUB 1U7JA 4ZMDA 1EDJA 1JM0A 5K5GB 2WMMA 4HB1A 3PH0A 3FXDA 2KUBA 4ASVA 2HR3A 1LP1B 4ASWA 2M0BA 4K3AA 2M5AA 1Y47A 1OVUA 3MHVA 4BXLA 4JBZA 2B87B 1OVVA 1EDKA 1FC2C 1S3JA 1ZXGA 4NPEA 4GODA 2UWJE 1NVOA 2RKLA 2K3RA 4IOIH 4CPGA 4WWIA 2Q1KA 1BDCA 1LP1A 4K35A 5C39A 3FXEA 1H0TA 2LXCB 1X0TA 1Q2NA 2B87A 2KI7B 1BDDA 2KZJA 3RGUA 4HKZH 5CBNA 3MZWB 2KZIA 4GOEA 2SPZA 1EDIA 4MN4C 1DEEG 3QWOC 2LR2A 1MFTA 4ZNCA 1JMBA 3S1KA 2ZAEB 4KJMA 1U7MA 2B89A 5CBOA 2M5AB 2LXBA 4HJGH 1EDLA 2OTKE 1ZW0A 1SS1A 2I8DA 2QVAA 2QRXA 2B88A
chains in the Genus database with same CATH superfamily
2AEMA 3RK2D 1KFMA 2BEQD 5DJTB 1YJNP 2WZ7A 5H2FE 1LJ2A 3AE1C 2WTYA 1EDJA 4D6TG 5BU8B 1SQVE 1PP9E 3L73G 2D2CD 2M0BA 1LT9A 2XU6A 3KPEA 1VQMP 1OVUA 2JWAA 1ZRTE 1WRGA 3TF5A 1WT6A 1NWQA 4GODA 2UWJE 3S9OA 4R4LA 1NKNA 1M1JC 1SP4A 2E75D 3Q3DA 1X9VA 1IK9A 2B87A 1IO4A 1NO4A 2XV5A 3HD7B 4MN4C 1YHQP 2AEJA 3EFFK 4I7ZC 3Q5RA 1BE3D 2NPSA 2O01H 1ZOYC 4Z1MH 3H1HG 2MKVA 2O1JA 2BCCG 3H1JE 3PHLA 1LTAC 1R5SA 2LXBA 3CC2P 1EXIA 1BCCE 1L4AA 1GK6A 2QM7A 3VMZA 4M3LA 5L8RJ 1LT1A 3V2QA 1QVGO 1VF5B 2Y0EA 3A5TA 2WSFJ 2AXTE 1NTKE 5CHXA 4I6MC 1Q82Q 4IFMA 5CMZA 1E5WA 2KIKA 4WY4C 5CCHD 3A2AA 3OA7A 1JY2N 1N7SD 3TNUB 2A06D 4Y28J 1NTZE 2OYOA 2J5UA 3S4RA 1JM0A 5BVZA 2WMMA 3C1LA 2RMZA 2QJKC 3CWBG 2YKPA 2FXOA 3IF4A 3H1ID 1VQ9P 4UB8H 1YQ4C 3CMAP 2M5AA 1NJIQ 2ZVOB 4H13B 1NVOA 1JY2O 3WMM0 4OWFA 3L72G 2E74B 4UB8E 1BDCA 1KFNA 1W2BO 1SQBD 4YTPC 1H89A 2KZJA 3L73J 1EDIA 1PGJA 2XZRA 1S72P 3S1KA 2E76B 3K5BA 2ZT9B 1U7MA 3LIDA 4C7RA 1LWUA 2Z5HA 1A02J 5CBOA 1S4XA 1MV8A 2OTKE 1AVOA 1M90Q 4Y99C 1URQB 5AVSB 3H1LD 5KLVE 1OX3A 4PV1C 1L0LE 1N7SA 1SQBJ 3AEDC 5CJ4A 2R44A 1Q7YQ 2AEFA 1KD1Q 1T8ZA 1L2PA 2YIUB 1OW6A 1SQPG 3HTKA 2L5GB 1SQVD 2W27A 1JTHA 3PH0A 2KUBA 2G8YA 2KOGA 1OW7A 4XA4A 1YITP 1GL2C 4W7YA 1ZRTD 4IFFA 3USSA 3HD7D 1USDA 1MFZA 3V2RA 1SFCB 2GUSA 1IC2A 1N73C 3H1LJ 2ZYGA 3AEFC 1GTWA 1NHLA 4RO0A 1SQXG 3H1KE 1SLQA 5GTHE 2KI7B 3CWBJ 3AEEC 5KLIB 3TGUG 1VF5D 2SPZA 1FZGA 3L71G 1NTME 1VQ8P 2PGDA 2XNDH 1JMBA 1HUCA 4LLHA 3I55P 2N9BA 1NKZB 1RF0A 2V7QH 3L72J 1FZCA 1SS1A 2FYZA 1KB9H 3AE4C 2JKVA 1VDFA 1N2DC 3AEAC 1NTKD 1L0NG 4H13D 1J1DB 2WWWA 3E1RA 1HF9A 1KB9E 2E74D 1RQVA 2M3BA 2IZ1A 3PJSK 1NTZD 1QX8A 1LGHB 2JR8A 3L35A 1AJYA 3Q2YA 5CCGC 1NU1G 1YYCA 2H8PD 2H89C 1PPJG 2OYIA 2V4HA 1HH0A 2WPSA 4YPCA 3M06A 1Y47A 3Q5PA 1PL5A 2B87B 2NZ2A 2E76D 2ZT9D 1KILC 1MZ9A 1GD2E 2HPCA 1VQ6P 2VRSA 2W6BA 2JDIH 5M1BA 1EZVG 1RF1A 2HFED 1URQD 5AW5B 1X0TA 1KB9I 3MUDC 1QL1A 2C0XA 1L4AB 4HKZH 3TNUA 5CBNA 5BU5A 3L70G 2W8ZA 3L4FA 1VQ5P 3H32A 3RL0B 1FZBA 1XTGB 3MD0A 1YJWP 3B4SA 1YI2P 1LTTC 2IYOA 2XKMA 1KQSO 4IL6X 1JCDA 3A7OA 4PD4H 2ZXXA 5AVXB 3GHGA 2FYUE 2Z4EA 3U59A 1SQXJ 5KLVD 1JMMA 3L75E 2KK7A 1OWAA 1BGYE 1G1JA 1JEKA 3UIAA 1NYHA 2RH0A 3VMAA 1GW4A 3L37A 3V5BA 1SQPK 1LTSC 1CI6A 5E79H 2OTLP 4JPZB 3M9QA 5KTBA 1H88A 1YTZI 3MHVA 3D6ZA 3PTZA 1DD4A 2GUVA 1SQQD 2Y0CA 5AVUB 2KB7P 1L0NJ 1LTIC 3CMEP 2Y9YA 1LT9C 4CPGA 2FXPA 3WU2H 1IJDB 2CPSA 1SQXK 1J1EB 2Q7CA 1M1JB 2E43A 2P2UA 1S5LH 4OGQC 1KC8Q 3WU2E 1NTMD 4OH8B 4D6TE 3RBZA 2GA1A 4EDFA 1S5LE 3GF7A 3Q5SA 1SQQJ 2HG5D 1S1CX 1SFCA 2Y9ZA 2JEEA 4H0LC 1JY3N 1YTZT 2NPSC 3HTKB 3SSUA 4AYCA 1JTHB 1FZEA 1T3UA 3I5CA 1L0NK 1BE3G 1KB9D 3RK2C 3HUSB 3L70J 4JQ0D 2A45I 3LW5H 2POHA 1IFNA 1IFMA 4RKUJ 3CCEP 1P84H 3B5NA 1JUNA 1OW8A 4HYTB 1X8YA 3M0DC 1U7JA 3CC7P 3P32A 1JY3O 2ZYAA 5APXA 1NU1K 1L4AD 5B5EE 1P84E 4K3AA 2WPRA 3H1HE 2D2CC 2BCCE 3RL0D 3GMAA 1OVVA 1ZXGA 1R5LA 2A06G 1W2EA 4WWIA 2JO1A 2Q1KA 3SWYA 4K35A 1S5LX 2N1TA 2E75C 3H1IG 2YNYA 3F5HA 3L74J 1S9KE 1FZCB 4U3FE 2QJPC 5KJ7A 2KLUA 4QMAA 2WSEJ 2WPQA 5AW1B 4BRYA 4YXDC 3CXHH 3VOPA 1JY2P 2BASA 3R4YA 1VQPP 1IFIA 2H88C 2WPVB 4U7JA 2FYUD 1SQBG 3CXHE 3U1AA 2LKMA 3L75D 1BGYD 2OYHC 2R5DA 3L72E 5B66H 1FOSE 3A0BH 3MGNA 2OYIB 3VN0A 1RE4A 3AEGC 5B66E 3A0BE 1KQFB 1NAFA 4C7NB 2MJZA 5CCHC 2I1JA 1SVFA 1RE3C 2ZXEB 1N7SC 4W80A 2HPCB 1HTLC 3RK3D 3H1LG 3V4WA 1RF1B 1K05A 1FC2C 2IFMA 3R2PA 1BE3J 1TU3F 2QJYB 3H32B 4TT3H 3SWFA 1LP1A 2FFDA 2BEZF 3CCQP 3IAOA 1KQGB 2PP6A 1Q2NA 2WT7B 4H44B 1BSNA 3SFEC 4L74A 3W68A 4D6TD 1GMJA 1SQPE 3GHGB 4GOEA 1GDTA 3QWOC 2ZFCA 5APWA 2FXMA 3KYQA 1QEXA 2IBZE 4A7PA 1DH3A 1AVYA 1CSBA 1YQ3C 2E5YA 2I8DA 2Q5UA 1IK7A 4DOJA 3NMDA 3WUUA 3H1IJ 3HRNA 2AXCA 1M8OB 1CI6B 3CCVP 2YKOA 1SQXE 1M1JA 3JSVC 3G4SP 3G3ZA 1KN7A 2XDJA 3IFMA 3HE5B 4RESB 2OTJP 3TGUE 3L71E 3D71A 2ZVNB 1AQTA 2K88A 2Q9IA 2KLVA 1KORA 3H1HD 2BCCD 1FOSF 2P10A 2IBZI 1OMIA 2FY8A 2K1AA 3HD7C 3TSIA 3G9RA 3IN6A 3N7NA 5APUA 1RQUA 1PP9D 1GZLA 2RN0A 3ITKA 3W67A 1S9KD 3HUSA 3CL3D 3OJAB 4U3FD 5AW8B 1DIPA 3BCCE 2GM4A 4WY4A 1VF5C 3A0HH 1NU1E 4TLFA 1RH5B 1PPJE 2G3AA 5APQA 4HJGH 3CX5H 2K37A 3V2PA 1SQVJ 3PP5A 3NTNA 1SQBK 2IX7C 3B5NB 3A0HE 1FJKA 3FX0A 4IFDK 4EYYQ 1WMKA 2JWDA 2R32A 3CX5E 4ZKUA 1EZVE 3H1JD 1LTJC 1BCCD 1GU4A 4H13C 2YKQA 2O1KA 4GT1A 2E74C 3L70E 5APTA 4HB1A 3OAKA 4H44D 4ASVA 1HWTC 1H8AA 2N1TB 3VYIA 1FS0E 3L36A 1MKMA 1K73Q 4XE5B 1X22A 1VQKP 2YMYA 5KKZB 1NOHA 1PIXA 3GW6A 3H1JJ 2E76C 4L75A 1PGPA 2ZT9C 4BRYB 1BCCJ 1JNMA 3CX5I 3MIWA 3FXEA 3O6QB 2O01J 1URQC 4RJTA 3Q1MA 1OXZA 4C7NA 2L91A 3RBXA 1IFDA 2R5BA 1SQQG 1PGQA 3MZWB 4JYBA 1NTKJ 3TYYA 4OGQB 1MFTA 1YBKA 2IBZD 2ZAEB 4KJMA 1NTZJ 2M3EA 1GL2A 5AVRB 1FDMA 3GLMA 2PFXA 2QRXA 1T3JA 2QG4A 2B88A 1FDIA 3EQ2A 5AW3B 1NTMG 1VQ7P 2P67A 2M8RA 1EC5A 1N7LA 5CJ0A 3M0AA 2W6JH 1H0TB 3G6EP 1T2KD 1G1IA 5AVTB 1OVRA 3RK2B 2WT7A 4ZKPA 3TGUD 5AW9B 3L71D 1CW5A 5AW4B 2QE7H 1L0LD 3BASA 1XTCC 1SFCD 2WSFH 1LP1B 3LIEA 2FFDB 4PD4E 1YJ9P 3IR9A 5KLIC 2R3SA 1AA0A 2Y0DA 1EQ7A 4JBZA 3C8VA 1ZR4A 1RY3A 5KAIH 2K9JB 1J2JB 1S3JA 3CPWO 3VTPC 3A3YB 3CLQA 3L74G 3N4XA 1HGVA 3AE6C 3B5ND 3M9HA 1BE3E 1JY3P 5KAIE 3AE5C 1NGMB 5KLVJ 3BCCD 3HE5A 1L0LJ 5E79E 3RGUA 1Q81Q 1K8AQ 1NU1D 2J59M 3AE2C 1G2CA 1LTBC 2C0WA 1HBWA 4PD4I 3V6IA 5CCGA 1BSHA 2QM8A 3H1KD 1KTMA 1QLED 4KHXA 1VQNP 1YIJP 1AV1A 3F89A 5AVVB 2N1TD 3KHUA 1JO5A 2A06E 4GOFA 3CX5D 3ZDMA 1KILA 4NPDA 4NPFX 2P58A 3L73E 1QL2A 2KS1B 2C9LY 2IZ0A 4I7ZB 4AQRD 3H1IE 5KJ7D 2IYPA 2QIWA 3EWKA 2WSCJ 2FYUG 3MUDA 2WVRA 2KSEA 3L75G 2FYNC 3H1KJ 3CCSP 3CCUP 2HR3A 3EFGA 5APYA 2P7JA 1L4AC 2DW3A 4WVZA 1NTMJ 4LGDE 3RL0C 1NAYA 1ZMEC 1SQBE 1M7LA 2P1JA 4W7ZA 3B8EB 4WY4B 2YXRB 3T97B 3WUTA 2O3JA 3E7KA 1AFOA 2QJKB 2IDBA 1PZQA 2FBWC 3JC22 1SQQK 5H2FH 2KZIA 2OGUA 1D7MA 3AE9C 1DEEG 5TJHA 3H1LE 1ZR2A 1FBMA 2A45G 4R4MA 2B89A 2E5TA 2KSJA 4UB6H 1M57D 4JYCA 2OQQA 1Z56A 4N78E 1E79H 4DCKA 1KZUB 3M91A 1NTMK 4UB6E 1S2EA 3CWBE 2W90A 2OARA 2ZYDA 2KNCB 2HYNA 1P84I 3O6QA 1W5CE 1DD3A 4OVNF 1QGKB 5GTIH 3TK1A 1KYOH 1J1EC 4PD4D 4Y99B 2WSSH 1LWUC 5GTIE 3RK3C 4PV1B 1KYOE 3AE8C 1IFPA 3PRJA 2K3RA 3FGAD 1M56D 3V2NA 5C39A 1JOCA 1OZHA 1A02F 2FYUJ 1Y9BA 1H0TA 3ABVC 3L75J 1BGYJ 3GG2A 1GL2B 2AXTH 4AUWA 3CXHI 1N73B 3HUSC 3M0DA 1SQVG 1PP9G 2K9YA 4GIFA 2HLOA 1PGOA 3FWNA 1KYOI 4DZOA 4U3FG 1VQ4P 4O9BA 2K9JA 3CCLP 5AW7B 3KQGA 3L73D 4EIJA 1K04A 3NFQA 1PV3A 3GF3A 3B71A 4WY4D 4B86A 2H43A 2FYUK 1LTJB 3BVHA 1M1KQ 3HE4A 3U1CA 3QH9A 1RF0C 3BATA 1IZNB 4XFJA 1FZCC 3MTUE 3H1JG 2FKWB 4L73A 4D6TJ 1BCCG 3D6YA 1GW3A 3H6PA 1KILE 1OFCX 4IOIH 2QA4P 1FAVA 1P84D 1AQ5A 2OYHA 3P8CE 3O8ZA 1G2CB 5APSA 2KS1A 1NTKG 4HH2A 5AVQB 1BDDA 1FZFA 2ITAA 1CZQA 3CCJP 3OW2O 1UIXA 1NTZG 3P8MC 1LNQA 2IPPA 2OYIC 5CCHA 4JF7A 1RE3A 1KILB 1MUUA 1Q86Q 1L0NE 1EDLA 4N6JA 1USEA 4N78D 2KXPB 3LW5J 2YO2A 1KV4A 4N3YB 3VMXA 3H1HJ 3C9IA 1ZLLA 2BCCJ 3CWBD 4PV1D 4I2LC 3M9BA 1RF1C 3T97A 2Z5IA 1Y8AA 4WBAA 1DEBA 2O01N 2IBZG 5AVZB 1VQOP 2WSCH 1HJBA 3CXHD 2QJYC 2KYVA 1PP9J 2HODB 1SQQE 1UIIA 3L72D 5GTHH 5K5GB 1VQLP 3SWKA 3FXDA 2CPBA 2Q3IA 1GL2D 4U3FJ 1HJ0A 1HVVA 4H44C 2R3CA 1KYOD 3AE7C 1ZN5A 3I56P 2QEXP 3GHGC 5AVWB 3RL0g 2C9NY 1FJPA 1Q90D 2CK3H 2RKLA 2IFNA 5KLVG 3KDPB 1L0LG 3BRVB 2KNCA 2YMKA 2H7HA 1HGZA 4EI2A 4IL6H 5TISH 3AE3C 2LR2A 2J58A 1SQVK 1JCCA 2B9BA 4L76A 1N8RQ 3CCMP 1QVFO 1LT9B 1EZVI 2JP3A 4IL6E 2QSIA 1FU1A 5TISE 1ZP0C 1SQPD 5AVYB 3BCCG 2QVAA 3TDKA 3HD7A 2WSEH 3L74E 4YXWH 1ZV8A 5EFWB 2WITA 3II6A 3JCUH 4GDOA 1GU5A 2Q3EA 3KXDA 2YIUC 3H1KG 3H25A 3KZIH 1T2KC 1T6AA 1NH4A 5DJUB 2E42A 1K9MQ 3NXSA 2KP8A 2I1KA 3JCUE 4ZMDA 1JB0J 1N73A 5CCGD 4H0LB 4EOTA 1SQXD 2NPSB 3KZIE 2PAJA 2FYNB 1SQPJ 1SFCC 4BXLA 4DJGA 1FDOA 2WQYC 5AW6B 1KILD 3PLNA 4LC1A 3BRTB 4NPEA 5APVA 4I1LA 3D70A 3P8CD 1NTKK 2LXCB 4DT0A 3B5NC 3WUVA 1LTGC 1LTJA 2D2CB 4PJ0H 3VMYA 1NTZK 1VPCA 5KAFH 1KMIZ 1L0ND 4BWNA 4ZNCA 4C46A 3E1IA 3TGUJ 4PJ0E 3L71J 2M5AB 5KAFE 2YXQB 4WB4A 2YO3A 1ZW0A 3P7KA 2E75B 2JJLA 1GK4A 2N1TC 2QJPB 1J1DC 1PPJD 3HE4B 2NRGA 3CD6P 3RK3E 2ZJSE 4KT0J 5KKZC 2W6AA 3AEBC 5KJ7C 1URQA 2A45H 3VP9A 1DX7A 2XNXA 1EZVD 3SFDC 1FZAA 1VL2A 4ASWA 1N86A 2OYHB 3BCCJ 1LWUB 1PFIA 1EXJA 2PRRA 3RK3B 1NU1J 1EDKA 3L70D 2W83C 2Q6QA 1RHZB 3G71P 1U57A 5KLVK 1BGYG 1L0LK 1IFJA 1KQLA 1N7SB 1RE4C 4OGQD 3VP8A 2HODA 3CCRP 1OIPA 3V4QA 1R8EA 2N9YB 3CC4P 1FE6A 3FWLA 3MP7B 5AW2B 4H0LD 5B5EH 5AW0B 1X79B 3AECC 2NPSD 2V7QJ 4GKGA 3L74D 3CI9A 2FFDC
chains in the Genus database with same CATH topology
4GOFA 3ZDMA 4EYYQ 1EC5A 2JWDA 1LT1A 4NPDA 4NPFX 2P58A 5EFWB 2KS1B 2R44A 1H0TB 5DJTB 1OVRA 2KIKA 5DJUB 1U7JA 4ZMDA 1EDJA 1JM0A 5K5GB 2WMMA 4HB1A 3PH0A 3FXDA 2KUBA 4ASVA 2HR3A 1LP1B 4ASWA 2M0BA 4K3AA 2M5AA 1Y47A 1OVUA 3MHVA 4BXLA 4JBZA 2B87B 1OVVA 1EDKA 1FC2C 1S3JA 1ZXGA 4NPEA 4GODA 2UWJE 1NVOA 2RKLA 2K3RA 4IOIH 4CPGA 4WWIA 2Q1KA 1BDCA 1LP1A 4K35A 5C39A 3FXEA 1H0TA 2LXCB 1X0TA 1Q2NA 2B87A 2KI7B 1BDDA 2KZJA 3RGUA 4HKZH 5CBNA 3MZWB 2KZIA 4GOEA 2SPZA 1EDIA 4MN4C 1DEEG 3QWOC 2LR2A 1MFTA 4ZNCA 1JMBA 3S1KA 2ZAEB 4KJMA 1U7MA 2B89A 5CBOA 2M5AB 2LXBA 4HJGH 1EDLA 2OTKE 1ZW0A 1SS1A 2I8DA 2QVAA 2QRXA 2B88A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4GOF A;  3ZDM A;  4EYY Q;  1EC5 A;  2JWD A;  1LT1 A;  4NPD A;  4NPF X;  2P58 A;  5EFW B;  2KS1 B;  2R44 A;  1H0T B;  5DJT B;  1OVR A;  2KIK A;  5DJU B;  1U7J A;  4ZMD A;  1EDJ A;  1JM0 A;  5K5G B;  2WMM A;  4HB1 A;  3PH0 A;  3FXD A;  2KUB A;  4ASV A;  2HR3 A;  1LP1 B;  4ASW A;  2M0B A;  4K3A A;  2M5A A;  1Y47 A;  1OVU A;  3MHV A;  4BXL A;  4JBZ A;  2B87 B;  1OVV A;  1EDK A;  1FC2 C;  1S3J A;  1ZXG A;  4NPE A;  4GOD A;  2UWJ E;  1NVO A;  2RKL A;  2K3R A;  4IOI H;  4CPG A;  4WWI A;  2Q1K A;  1BDC A;  1LP1 A;  4K35 A;  5C39 A;  3FXE A;  1H0T A;  2LXC B;  1X0T A;  1Q2N A;  2B87 A;  2KI7 B;  1BDD A;  2KZJ A;  3RGU A;  4HKZ H;  5CBN A;  3MZW B;  2KZI A;  4GOE A;  2SPZ A;  1EDI A;  4MN4 C;  1DEE G;  3QWO C;  2LR2 A;  1MFT A;  4ZNC A;  1JMB A;  3S1K A;  2ZAE B;  4KJM A;  1U7M A;  2B89 A;  5CBO A;  2M5A B;  2LXB A;  4HJG H;  1EDL A;  2OTK E;  1ZW0 A;  1SS1 A;  2I8D A;  2QVA A;  2QRX A;  2B88 A; 
#chains in the Genus database with same CATH topology
 2AEM A;  3RK2 D;  1KFM A;  2BEQ D;  5DJT B;  1YJN P;  2WZ7 A;  5H2F E;  1LJ2 A;  3AE1 C;  2WTY A;  1EDJ A;  4D6T G;  5BU8 B;  1SQV E;  1PP9 E;  3L73 G;  2D2C D;  2M0B A;  1LT9 A;  2XU6 A;  3KPE A;  1VQM P;  1OVU A;  2JWA A;  1ZRT E;  1WRG A;  3TF5 A;  1WT6 A;  1NWQ A;  4GOD A;  2UWJ E;  3S9O A;  4R4L A;  1NKN A;  1M1J C;  1SP4 A;  2E75 D;  3Q3D A;  1X9V A;  1IK9 A;  2B87 A;  1IO4 A;  1NO4 A;  2XV5 A;  3HD7 B;  4MN4 C;  1YHQ P;  2AEJ A;  3EFF K;  4I7Z C;  3Q5R A;  1BE3 D;  2NPS A;  2O01 H;  1ZOY C;  4Z1M H;  3H1H G;  2MKV A;  2O1J A;  2BCC G;  3H1J E;  3PHL A;  1LTA C;  1R5S A;  2LXB A;  3CC2 P;  1EXI A;  1BCC E;  1L4A A;  1GK6 A;  2QM7 A;  3VMZ A;  4M3L A;  5L8R J;  1LT1 A;  3V2Q A;  1QVG O;  1VF5 B;  2Y0E A;  3A5T A;  2WSF J;  2AXT E;  1NTK E;  5CHX A;  4I6M C;  1Q82 Q;  4IFM A;  5CMZ A;  1E5W A;  2KIK A;  4WY4 C;  5CCH D;  3A2A A;  3OA7 A;  1JY2 N;  1N7S D;  3TNU B;  2A06 D;  4Y28 J;  1NTZ E;  2OYO A;  2J5U A;  3S4R A;  1JM0 A;  5BVZ A;  2WMM A;  3C1L A;  2RMZ A;  2QJK C;  3CWB G;  2YKP A;  2FXO A;  3IF4 A;  3H1I D;  1VQ9 P;  4UB8 H;  1YQ4 C;  3CMA P;  2M5A A;  1NJI Q;  2ZVO B;  4H13 B;  1NVO A;  1JY2 O;  3WMM 0;  4OWF A;  3L72 G;  2E74 B;  4UB8 E;  1BDC A;  1KFN A;  1W2B O;  1SQB D;  4YTP C;  1H89 A;  2KZJ A;  3L73 J;  1EDI A;  1PGJ A;  2XZR A;  1S72 P;  3S1K A;  2E76 B;  3K5B A;  2ZT9 B;  1U7M A;  3LID A;  4C7R A;  1LWU A;  2Z5H A;  1A02 J;  5CBO A;  1S4X A;  1MV8 A;  2OTK E;  1AVO A;  1M90 Q;  4Y99 C;  1URQ B;  5AVS B;  3H1L D;  5KLV E;  1OX3 A;  4PV1 C;  1L0L E;  1N7S A;  1SQB J;  3AED C;  5CJ4 A;  2R44 A;  1Q7Y Q;  2AEF A;  1KD1 Q;  1T8Z A;  1L2P A;  2YIU B;  1OW6 A;  1SQP G;  3HTK A;  2L5G B;  1SQV D;  2W27 A;  1JTH A;  3PH0 A;  2KUB A;  2G8Y A;  2KOG A;  1OW7 A;  4XA4 A;  1YIT P;  1GL2 C;  4W7Y A;  1ZRT D;  4IFF A;  3USS A;  3HD7 D;  1USD A;  1MFZ A;  3V2R A;  1SFC B;  2GUS A;  1IC2 A;  1N73 C;  3H1L J;  2ZYG A;  3AEF C;  1GTW A;  1NHL A;  4RO0 A;  1SQX G;  3H1K E;  1SLQ A;  5GTH E;  2KI7 B;  3CWB J;  3AEE C;  5KLI B;  3TGU G;  1VF5 D;  2SPZ A;  1FZG A;  3L71 G;  1NTM E;  1VQ8 P;  2PGD A;  2XND H;  1JMB A;  1HUC A;  4LLH A;  3I55 P;  2N9B A;  1NKZ B;  1RF0 A;  2V7Q H;  3L72 J;  1FZC A;  1SS1 A;  2FYZ A;  1KB9 H;  3AE4 C;  2JKV A;  1VDF A;  1N2D C;  3AEA C;  1NTK D;  1L0N G;  4H13 D;  1J1D B;  2WWW A;  3E1R A;  1HF9 A;  1KB9 E;  2E74 D;  1RQV A;  2M3B A;  2IZ1 A;  3PJS K;  1NTZ D;  1QX8 A;  1LGH B;  2JR8 A;  3L35 A;  1AJY A;  3Q2Y A;  5CCG C;  1NU1 G;  1YYC A;  2H8P D;  2H89 C;  1PPJ G;  2OYI A;  2V4H A;  1HH0 A;  2WPS A;  4YPC A;  3M06 A;  1Y47 A;  3Q5P A;  1PL5 A;  2B87 B;  2NZ2 A;  2E76 D;  2ZT9 D;  1KIL C;  1MZ9 A;  1GD2 E;  2HPC A;  1VQ6 P;  2VRS A;  2W6B A;  2JDI H;  5M1B A;  1EZV G;  1RF1 A;  2HFE D;  1URQ D;  5AW5 B;  1X0T A;  1KB9 I;  3MUD C;  1QL1 A;  2C0X A;  1L4A B;  4HKZ H;  3TNU A;  5CBN A;  5BU5 A;  3L70 G;  2W8Z A;  3L4F A;  1VQ5 P;  3H32 A;  3RL0 B;  1FZB A;  1XTG B;  3MD0 A;  1YJW P;  3B4S A;  1YI2 P;  1LTT C;  2IYO A;  2XKM A;  1KQS O;  4IL6 X;  1JCD A;  3A7O A;  4PD4 H;  2ZXX A;  5AVX B;  3GHG A;  2FYU E;  2Z4E A;  3U59 A;  1SQX J;  5KLV D;  1JMM A;  3L75 E;  2KK7 A;  1OWA A;  1BGY E;  1G1J A;  1JEK A;  3UIA A;  1NYH A;  2RH0 A;  3VMA A;  1GW4 A;  3L37 A;  3V5B A;  1SQP K;  1LTS C;  1CI6 A;  5E79 H;  2OTL P;  4JPZ B;  3M9Q A;  5KTB A;  1H88 A;  1YTZ I;  3MHV A;  3D6Z A;  3PTZ A;  1DD4 A;  2GUV A;  1SQQ D;  2Y0C A;  5AVU B;  2KB7 P;  1L0N J;  1LTI C;  3CME P;  2Y9Y A;  1LT9 C;  4CPG A;  2FXP A;  3WU2 H;  1IJD B;  2CPS A;  1SQX K;  1J1E B;  2Q7C A;  1M1J B;  2E43 A;  2P2U A;  1S5L H;  4OGQ C;  1KC8 Q;  3WU2 E;  1NTM D;  4OH8 B;  4D6T E;  3RBZ A;  2GA1 A;  4EDF A;  1S5L E;  3GF7 A;  3Q5S A;  1SQQ J;  2HG5 D;  1S1C X;  1SFC A;  2Y9Z A;  2JEE A;  4H0L C;  1JY3 N;  1YTZ T;  2NPS C;  3HTK B;  3SSU A;  4AYC A;  1JTH B;  1FZE A;  1T3U A;  3I5C A;  1L0N K;  1BE3 G;  1KB9 D;  3RK2 C;  3HUS B;  3L70 J;  4JQ0 D;  2A45 I;  3LW5 H;  2POH A;  1IFN A;  1IFM A;  4RKU J;  3CCE P;  1P84 H;  3B5N A;  1JUN A;  1OW8 A;  4HYT B;  1X8Y A;  3M0D C;  1U7J A;  3CC7 P;  3P32 A;  1JY3 O;  2ZYA A;  5APX A;  1NU1 K;  1L4A D;  5B5E E;  1P84 E;  4K3A A;  2WPR A;  3H1H E;  2D2C C;  2BCC E;  3RL0 D;  3GMA A;  1OVV A;  1ZXG A;  1R5L A;  2A06 G;  1W2E A;  4WWI A;  2JO1 A;  2Q1K A;  3SWY A;  4K35 A;  1S5L X;  2N1T A;  2E75 C;  3H1I G;  2YNY A;  3F5H A;  3L74 J;  1S9K E;  1FZC B;  4U3F E;  2QJP C;  5KJ7 A;  2KLU A;  4QMA A;  2WSE J;  2WPQ A;  5AW1 B;  4BRY A;  4YXD C;  3CXH H;  3VOP A;  1JY2 P;  2BAS A;  3R4Y A;  1VQP P;  1IFI A;  2H88 C;  2WPV B;  4U7J A;  2FYU D;  1SQB G;  3CXH E;  3U1A A;  2LKM A;  3L75 D;  1BGY D;  2OYH C;  2R5D A;  3L72 E;  5B66 H;  1FOS E;  3A0B H;  3MGN A;  2OYI B;  3VN0 A;  1RE4 A;  3AEG C;  5B66 E;  3A0B E;  1KQF B;  1NAF A;  4C7N B;  2MJZ A;  5CCH C;  2I1J A;  1SVF A;  1RE3 C;  2ZXE B;  1N7S C;  4W80 A;  2HPC B;  1HTL C;  3RK3 D;  3H1L G;  3V4W A;  1RF1 B;  1K05 A;  1FC2 C;  2IFM A;  3R2P A;  1BE3 J;  1TU3 F;  2QJY B;  3H32 B;  4TT3 H;  3SWF A;  1LP1 A;  2FFD A;  2BEZ F;  3CCQ P;  3IAO A;  1KQG B;  2PP6 A;  1Q2N A;  2WT7 B;  4H44 B;  1BSN A;  3SFE C;  4L74 A;  3W68 A;  4D6T D;  1GMJ A;  1SQP E;  3GHG B;  4GOE A;  1GDT A;  3QWO C;  2ZFC A;  5APW A;  2FXM A;  3KYQ A;  1QEX A;  2IBZ E;  4A7P A;  1DH3 A;  1AVY A;  1CSB A;  1YQ3 C;  2E5Y A;  2I8D A;  2Q5U A;  1IK7 A;  4DOJ A;  3NMD A;  3WUU A;  3H1I J;  3HRN A;  2AXC A;  1M8O B;  1CI6 B;  3CCV P;  2YKO A;  1SQX E;  1M1J A;  3JSV C;  3G4S P;  3G3Z A;  1KN7 A;  2XDJ A;  3IFM A;  3HE5 B;  4RES B;  2OTJ P;  3TGU E;  3L71 E;  3D71 A;  2ZVN B;  1AQT A;  2K88 A;  2Q9I A;  2KLV A;  1KOR A;  3H1H D;  2BCC D;  1FOS F;  2P10 A;  2IBZ I;  1OMI A;  2FY8 A;  2K1A A;  3HD7 C;  3TSI A;  3G9R A;  3IN6 A;  3N7N A;  5APU A;  1RQU A;  1PP9 D;  1GZL A;  2RN0 A;  3ITK A;  3W67 A;  1S9K D;  3HUS A;  3CL3 D;  3OJA B;  4U3F D;  5AW8 B;  1DIP A;  3BCC E;  2GM4 A;  4WY4 A;  1VF5 C;  3A0H H;  1NU1 E;  4TLF A;  1RH5 B;  1PPJ E;  2G3A A;  5APQ A;  4HJG H;  3CX5 H;  2K37 A;  3V2P A;  1SQV J;  3PP5 A;  3NTN A;  1SQB K;  2IX7 C;  3B5N B;  3A0H E;  1FJK A;  3FX0 A;  4IFD K;  4EYY Q;  1WMK A;  2JWD A;  2R32 A;  3CX5 E;  4ZKU A;  1EZV E;  3H1J D;  1LTJ C;  1BCC D;  1GU4 A;  4H13 C;  2YKQ A;  2O1K A;  4GT1 A;  2E74 C;  3L70 E;  5APT A;  4HB1 A;  3OAK A;  4H44 D;  4ASV A;  1HWT C;  1H8A A;  2N1T B;  3VYI A;  1FS0 E;  3L36 A;  1MKM A;  1K73 Q;  4XE5 B;  1X22 A;  1VQK P;  2YMY A;  5KKZ B;  1NOH A;  1PIX A;  3GW6 A;  3H1J J;  2E76 C;  4L75 A;  1PGP A;  2ZT9 C;  4BRY B;  1BCC J;  1JNM A;  3CX5 I;  3MIW A;  3FXE A;  3O6Q B;  2O01 J;  1URQ C;  4RJT A;  3Q1M A;  1OXZ A;  4C7N A;  2L91 A;  3RBX A;  1IFD A;  2R5B A;  1SQQ G;  1PGQ A;  3MZW B;  4JYB A;  1NTK J;  3TYY A;  4OGQ B;  1MFT A;  1YBK A;  2IBZ D;  2ZAE B;  4KJM A;  1NTZ J;  2M3E A;  1GL2 A;  5AVR B;  1FDM A;  3GLM A;  2PFX A;  2QRX A;  1T3J A;  2QG4 A;  2B88 A;  1FDI A;  3EQ2 A;  5AW3 B;  1NTM G;  1VQ7 P;  2P67 A;  2M8R A;  1EC5 A;  1N7L A;  5CJ0 A;  3M0A A;  2W6J H;  1H0T B;  3G6E P;  1T2K D;  1G1I A;  5AVT B;  1OVR A;  3RK2 B;  2WT7 A;  4ZKP A;  3TGU D;  5AW9 B;  3L71 D;  1CW5 A;  5AW4 B;  2QE7 H;  1L0L D;  3BAS A;  1XTC C;  1SFC D;  2WSF H;  1LP1 B;  3LIE A;  2FFD B;  4PD4 E;  1YJ9 P;  3IR9 A;  5KLI C;  2R3S A;  1AA0 A;  2Y0D A;  1EQ7 A;  4JBZ A;  3C8V A;  1ZR4 A;  1RY3 A;  5KAI H;  2K9J B;  1J2J B;  1S3J A;  3CPW O;  3VTP C;  3A3Y B;  3CLQ A;  3L74 G;  3N4X A;  1HGV A;  3AE6 C;  3B5N D;  3M9H A;  1BE3 E;  1JY3 P;  5KAI E;  3AE5 C;  1NGM B;  5KLV J;  3BCC D;  3HE5 A;  1L0L J;  5E79 E;  3RGU A;  1Q81 Q;  1K8A Q;  1NU1 D;  2J59 M;  3AE2 C;  1G2C A;  1LTB C;  2C0W A;  1HBW A;  4PD4 I;  3V6I A;  5CCG A;  1BSH A;  2QM8 A;  3H1K D;  1KTM A;  1QLE D;  4KHX A;  1VQN P;  1YIJ P;  1AV1 A;  3F89 A;  5AVV B;  2N1T D;  3KHU A;  1JO5 A;  2A06 E;  4GOF A;  3CX5 D;  3ZDM A;  1KIL A;  4NPD A;  4NPF X;  2P58 A;  3L73 E;  1QL2 A;  2KS1 B;  2C9L Y;  2IZ0 A;  4I7Z B;  4AQR D;  3H1I E;  5KJ7 D;  2IYP A;  2QIW A;  3EWK A;  2WSC J;  2FYU G;  3MUD A;  2WVR A;  2KSE A;  3L75 G;  2FYN C;  3H1K J;  3CCS P;  3CCU P;  2HR3 A;  3EFG A;  5APY A;  2P7J A;  1L4A C;  2DW3 A;  4WVZ A;  1NTM J;  4LGD E;  3RL0 C;  1NAY A;  1ZME C;  1SQB E;  1M7L A;  2P1J A;  4W7Z A;  3B8E B;  4WY4 B;  2YXR B;  3T97 B;  3WUT A;  2O3J A;  3E7K A;  1AFO A;  2QJK B;  2IDB A;  1PZQ A;  2FBW C;  3JC2 2;  1SQQ K;  5H2F H;  2KZI A;  2OGU A;  1D7M A;  3AE9 C;  1DEE G;  5TJH A;  3H1L E;  1ZR2 A;  1FBM A;  2A45 G;  4R4M A;  2B89 A;  2E5T A;  2KSJ A;  4UB6 H;  1M57 D;  4JYC A;  2OQQ A;  1Z56 A;  4N78 E;  1E79 H;  4DCK A;  1KZU B;  3M91 A;  1NTM K;  4UB6 E;  1S2E A;  3CWB E;  2W90 A;  2OAR A;  2ZYD A;  2KNC B;  2HYN A;  1P84 I;  3O6Q A;  1W5C E;  1DD3 A;  4OVN F;  1QGK B;  5GTI H;  3TK1 A;  1KYO H;  1J1E C;  4PD4 D;  4Y99 B;  2WSS H;  1LWU C;  5GTI E;  3RK3 C;  4PV1 B;  1KYO E;  3AE8 C;  1IFP A;  3PRJ A;  2K3R A;  3FGA D;  1M56 D;  3V2N A;  5C39 A;  1JOC A;  1OZH A;  1A02 F;  2FYU J;  1Y9B A;  1H0T A;  3ABV C;  3L75 J;  1BGY J;  3GG2 A;  1GL2 B;  2AXT H;  4AUW A;  3CXH I;  1N73 B;  3HUS C;  3M0D A;  1SQV G;  1PP9 G;  2K9Y A;  4GIF A;  2HLO A;  1PGO A;  3FWN A;  1KYO I;  4DZO A;  4U3F G;  1VQ4 P;  4O9B A;  2K9J A;  3CCL P;  5AW7 B;  3KQG A;  3L73 D;  4EIJ A;  1K04 A;  3NFQ A;  1PV3 A;  3GF3 A;  3B71 A;  4WY4 D;  4B86 A;  2H43 A;  2FYU K;  1LTJ B;  3BVH A;  1M1K Q;  3HE4 A;  3U1C A;  3QH9 A;  1RF0 C;  3BAT A;  1IZN B;  4XFJ A;  1FZC C;  3MTU E;  3H1J G;  2FKW B;  4L73 A;  4D6T J;  1BCC G;  3D6Y A;  1GW3 A;  3H6P A;  1KIL E;  1OFC X;  4IOI H;  2QA4 P;  1FAV A;  1P84 D;  1AQ5 A;  2OYH A;  3P8C E;  3O8Z A;  1G2C B;  5APS A;  2KS1 A;  1NTK G;  4HH2 A;  5AVQ B;  1BDD A;  1FZF A;  2ITA A;  1CZQ A;  3CCJ P;  3OW2 O;  1UIX A;  1NTZ G;  3P8M C;  1LNQ A;  2IPP A;  2OYI C;  5CCH A;  4JF7 A;  1RE3 A;  1KIL B;  1MUU A;  1Q86 Q;  1L0N E;  1EDL A;  4N6J A;  1USE A;  4N78 D;  2KXP B;  3LW5 J;  2YO2 A;  1KV4 A;  4N3Y B;  3VMX A;  3H1H J;  3C9I A;  1ZLL A;  2BCC J;  3CWB D;  4PV1 D;  4I2L C;  3M9B A;  1RF1 C;  3T97 A;  2Z5I A;  1Y8A A;  4WBA A;  1DEB A;  2O01 N;  2IBZ G;  5AVZ B;  1VQO P;  2WSC H;  1HJB A;  3CXH D;  2QJY C;  2KYV A;  1PP9 J;  2HOD B;  1SQQ E;  1UII A;  3L72 D;  5GTH H;  5K5G B;  1VQL P;  3SWK A;  3FXD A;  2CPB A;  2Q3I A;  1GL2 D;  4U3F J;  1HJ0 A;  1HVV A;  4H44 C;  2R3C A;  1KYO D;  3AE7 C;  1ZN5 A;  3I56 P;  2QEX P;  3GHG C;  5AVW B;  3RL0 g;  2C9N Y;  1FJP A;  1Q90 D;  2CK3 H;  2RKL A;  2IFN A;  5KLV G;  3KDP B;  1L0L G;  3BRV B;  2KNC A;  2YMK A;  2H7H A;  1HGZ A;  4EI2 A;  4IL6 H;  5TIS H;  3AE3 C;  2LR2 A;  2J58 A;  1SQV K;  1JCC A;  2B9B A;  4L76 A;  1N8R Q;  3CCM P;  1QVF O;  1LT9 B;  1EZV I;  2JP3 A;  4IL6 E;  2QSI A;  1FU1 A;  5TIS E;  1ZP0 C;  1SQP D;  5AVY B;  3BCC G;  2QVA A;  3TDK A;  3HD7 A;  2WSE H;  3L74 E;  4YXW H;  1ZV8 A;  5EFW B;  2WIT A;  3II6 A;  3JCU H;  4GDO A;  1GU5 A;  2Q3E A;  3KXD A;  2YIU C;  3H1K G;  3H25 A;  3KZI H;  1T2K C;  1T6A A;  1NH4 A;  5DJU B;  2E42 A;  1K9M Q;  3NXS A;  2KP8 A;  2I1K A;  3JCU E;  4ZMD A;  1JB0 J;  1N73 A;  5CCG D;  4H0L B;  4EOT A;  1SQX D;  2NPS B;  3KZI E;  2PAJ A;  2FYN B;  1SQP J;  1SFC C;  4BXL A;  4DJG A;  1FDO A;  2WQY C;  5AW6 B;  1KIL D;  3PLN A;  4LC1 A;  3BRT B;  4NPE A;  5APV A;  4I1L A;  3D70 A;  3P8C D;  1NTK K;  2LXC B;  4DT0 A;  3B5N C;  3WUV A;  1LTG C;  1LTJ A;  2D2C B;  4PJ0 H;  3VMY A;  1NTZ K;  1VPC A;  5KAF H;  1KMI Z;  1L0N D;  4BWN A;  4ZNC A;  4C46 A;  3E1I A;  3TGU J;  4PJ0 E;  3L71 J;  2M5A B;  5KAF E;  2YXQ B;  4WB4 A;  2YO3 A;  1ZW0 A;  3P7K A;  2E75 B;  2JJL A;  1GK4 A;  2N1T C;  2QJP B;  1J1D C;  1PPJ D;  3HE4 B;  2NRG A;  3CD6 P;  3RK3 E;  2ZJS E;  4KT0 J;  5KKZ C;  2W6A A;  3AEB C;  5KJ7 C;  1URQ A;  2A45 H;  3VP9 A;  1DX7 A;  2XNX A;  1EZV D;  3SFD C;  1FZA A;  1VL2 A;  4ASW A;  1N86 A;  2OYH B;  3BCC J;  1LWU B;  1PFI A;  1EXJ A;  2PRR A;  3RK3 B;  1NU1 J;  1EDK A;  3L70 D;  2W83 C;  2Q6Q A;  1RHZ B;  3G71 P;  1U57 A;  5KLV K;  1BGY G;  1L0L K;  1IFJ A;  1KQL A;  1N7S B;  1RE4 C;  4OGQ D;  3VP8 A;  2HOD A;  3CCR P;  1OIP A;  3V4Q A;  1R8E A;  2N9Y B;  3CC4 P;  1FE6 A;  3FWL A;  3MP7 B;  5AW2 B;  4H0L D;  5B5E H;  5AW0 B;  1X79 B;  3AEC C;  2NPS D;  2V7Q J;  4GKG A;  3L74 D;  3CI9 A;  2FFD C; 
#chains in the Genus database with same CATH homology
 4GOF A;  3ZDM A;  4EYY Q;  1EC5 A;  2JWD A;  1LT1 A;  4NPD A;  4NPF X;  2P58 A;  5EFW B;  2KS1 B;  2R44 A;  1H0T B;  5DJT B;  1OVR A;  2KIK A;  5DJU B;  1U7J A;  4ZMD A;  1EDJ A;  1JM0 A;  5K5G B;  2WMM A;  4HB1 A;  3PH0 A;  3FXD A;  2KUB A;  4ASV A;  2HR3 A;  1LP1 B;  4ASW A;  2M0B A;  4K3A A;  2M5A A;  1Y47 A;  1OVU A;  3MHV A;  4BXL A;  4JBZ A;  2B87 B;  1OVV A;  1EDK A;  1FC2 C;  1S3J A;  1ZXG A;  4NPE A;  4GOD A;  2UWJ E;  1NVO A;  2RKL A;  2K3R A;  4IOI H;  4CPG A;  4WWI A;  2Q1K A;  1BDC A;  1LP1 A;  4K35 A;  5C39 A;  3FXE A;  1H0T A;  2LXC B;  1X0T A;  1Q2N A;  2B87 A;  2KI7 B;  1BDD A;  2KZJ A;  3RGU A;  4HKZ H;  5CBN A;  3MZW B;  2KZI A;  4GOE A;  2SPZ A;  1EDI A;  4MN4 C;  1DEE G;  3QWO C;  2LR2 A;  1MFT A;  4ZNC A;  1JMB A;  3S1K A;  2ZAE B;  4KJM A;  1U7M A;  2B89 A;  5CBO A;  2M5A B;  2LXB A;  4HJG H;  1EDL A;  2OTK E;  1ZW0 A;  1SS1 A;  2I8D A;  2QVA A;  2QRX A;  2B88 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...