5DJUB

Crystal structure of lov2 (c450a) domain in complex with zdk3
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
b'NKFNKEVLVARQEIYWLPNLNWEQKFAFISSLTNDPSQSANLLAEAKKLNGAQPP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Engineered protein, Zdk3 affibody
publication title LOVTRAP: an optogenetic system for photoinduced protein dissociation.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Signaling protein
total genus 20
structure length 55
sequence length 55
chains with identical sequence D
ec nomenclature
pdb deposition date 2015-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 5djuB00
1EC5A 2B87B 1NVOA 4GOEA 2M5AB 4HB1A 1LP1A 2KZJA 4CPGA 2B88A 2QVAA 2LR2A 2M0BA 2KS1B 4K3AA 2R44A 1U7JA 4NPEA 2SPZA 5K5GB 2K3RA 4ASVA 1OVUA 2WMMA 5DJUB 4ASWA 1S3JA 2OTKE 3PH0A 4IOIH 1U7MA 2HR3A 4NPFX 4K35A 3FXEA 1BDCA 2UWJE 4JBZA 2KIKA 1MFTA 2KI7B 4WWIA 1Q2NA 2I8DA 1LP1B 5CBNA 3RGUA 2Q1KA 1DEEG 4HKZH 1EDKA 2KZIA 3QWOC 1X0TA 5EFWB 1JM0A 2ZAEB 1EDIA 1OVVA 3MHVA 1H0TA 1EDJA 1BDDA 1ZW0A 1ZXGA 1SS1A 4HJGH 1JMBA 3ZDMA 1LT1A 2QRXA 4GOFA 2RKLA 2B87A 1EDLA 4NPDA 2M5AA 2JWDA 4GODA 4ZMDA 1FC2C 1H0TB 3MZWB 1OVRA 2B89A 2LXBA 5C39A 2LXCB 2KUBA 5CBOA 4MN4C 2P58A 4BXLA 5DJTB 4ZNCA 1Y47A 4EYYQ 4KJMA 3FXDA 3S1KA
chains in the Genus database with same CATH superfamily
3C9IA 3L71D 2YKOA 2QVAA 3HE4B 3SWYA 4ASVA 2OTJP 1J1DC 1GL2C 1N7SD 2AEFA 4YPCA 3OW2O 1XTCC 2WPRA 1OW7A 2O1KA 2OYIC 1EQ7A 1PP9E 1PP9J 3H1KG 1GU4A 4WWIA 2QG4A 3AEDC 2KB7P 4PV1D 2E75B 1VPCA 1E79H 2NPSD 3IF4A 3CCUP 2Q7CA 4WY4C 1PGQA 1FU1A 3HE5A 3CXHH 3RL0D 1OWAA 1LTJB 2GUVA 2AEJA 1BE3E 4GT1A 4UB6H 3IFMA 1JNMA 3CCQP 4L73A 3L37A 4ZMDA 3L74G 1VQ5P 2Q9IA 1N7SA 2GUSA 4C7NA 1J1DB 1GL2B 3V4QA 1M7LA 3C1LA 2W90A 1L4AD 4L74A 3VYIA 2OYIB 4H44D 1URQC 2FYUD 1E5WA 1EZVI 1LP1A 2HFED 2NPSA 2KLUA 3KPEA 1T6AA 4YTPC 1K9MQ 4NPEA 5KAIH 3MP7B 2QJYB 2BEZF 1SQXJ 2HPCB 1S3JA 2JDIH 3TGUE 1FAVA 5APUA 3TGUJ 1VQ8P 4WY4B 2HYNA 1D7MA 3P8MC 4OGQC 3MUDC 3A0HE 1NU1G 3NMDA 1Y9BA 2O3JA 1YJWP 1BCCG 1NTZK 5AVWB 1HUCA 3L73E 3L73J 1Q7YQ 3MHVA 3L70G 3L75E 1G1IA 3L75J 1FZEA 1A02J 1SQBD 1L4AA 1BDDA 2CPBA 2WSFH 1SS1A 1NKNA 2QRXA 4DOJA 5GTHE 4GIFA 3H1KJ 1RE4A 5BU5A 2AXTH 1LT9A 1EDLA 1HGZA 1URQB 1P84D 1WMKA 3H1HG 1KQSO 5AW6B 2WSEH 3AE1C 1CSBA 3KZIE 3L71G 1K8AQ 3RK3D 3I55P 3QH9A 1OVRA 1M57D 4U3FE 2WSSH 3AEBC 5CBOA 3CL3D 3H6PA 1ZP0C 2Q5UA 4OGQB 3EFFK 2POHA 1IK9A 3V2QA 1RH5B 1LTSC 3FWNA 5AVYB 3JC22 2E5TA 5AVZB 1HJBA 1IC2A 4ZKPA 3PH0A 1NTKD 1U7MA 2QJPC 3EWKA 4PJ0H 1M1JA 3B8EB 1JMMA 3NFQA 3B4SA 2H8PD 4XA4A 5CBNA 1JTHA 4HKZH 3KDPB 5B66H 5CMZA 1SQPK 2R3SA 4H13D 1OXZA 3E7KA 1PGOA 2FBWC 2GA1A 1G2CB 2OQQA 5KKZC 1FZFA 1N8RQ 2WSCH 4TLFA 2FYUG 4JF7A 4PD4I 5APSA 2FFDC 3V2PA 1P84H 1VQ7P 1T2KC 1MKMA 1G1JA 5APYA 2P2UA 4YXWH 3H1LG 4EDFA 3C8VA 2YKQA 1PPJE 2E74D 3VMAA 3AEGC 3GHGA 1L0LK 1S5LH 3V2RA 1BE3D 1SFCC 3H1HJ 1L0ND 4DJGA 3KYQA 4QMAA 1FZCA 5E79H 5KLVD 1GD2E 3V2NA 2E76C 5KJ7C 3CX5H 1ZR2A 2JEEA 1VQ6P 5B5EE 1YYCA 2OTLP 4H0LC 4AYCA 1SQBG 3AEEC 1S72P 5KKZB 1ZOYC 2A06E 2WTYA 2N1TC 2FFDB 2QSIA 1H0TA 3CWBE 1KB9I 4ZKUA 2WSFJ 3CWBJ 1H88A 2KNCA 1KILD 2FXMA 3ZDMA 1X9VA 1NTZE 2M8RA 1X79B 4GOFA 2IBZI 3BCCD 3CCRP 2C9NY 2JJLA 1EZVD 2RH0A 4C46A 1LJ2A 2JWDA 2WSEJ 4OGQD 1S9KE 3P8CE 3CC7P 2PRRA 2E76B 3AE4C 2IPPA 3AE2C 3A0BE 2P58A 2RN0A 2JO1A 4BXLA 3AECC 4H0LB 1NTKG 1CZQA 3FXDA 2B87B 4YXDC 1RHZB 1IFNA 1RF1C 1QVFO 1ZMEC 4N78E 4W7YA 1KILA 2YMYA 1T8ZA 4PJ0E 1YTZT 3L72E 3L35A 3L72J 4K35A 4D6TD 3H1LJ 3OJAB 1SQQD 2UWJE 2K88A 1SQXK 1Y8AA 3U1CA 3D70A 2W83C 5AVRB 5CHXA 1YI2P 4XE5B 3O8ZA 5AVSB 2L91A 2IZ1A 1JY3O 1X0TA 3GLMA 2ZT9C 3H1IE 1UIIA 3H1IJ 3GW6A 1NTMD 1DD4A 5AW7B 4W80A 2R5DA 5TISH 2HODA 3H32B 5AW5B 4I2LC 2FY8A 3TDKA 2ZYAA 5KAFH 4NPDA 4LC1A 2A45I 1PZQA 2Y0EA 3G9RA 1NJIQ 1VQKP 5AVVB 3W68A 2VRSA 1L0NG 3B5ND 1CI6B 3M0AA 5KLVG 1FS0E 5CJ4A 1KYOI 4KHXA 3SFDC 2E75C 2V7QH 3P32A 4CPGA 1R5SA 4Z1MH 4RKUJ 2ZT9B 2H88C 2N9BA 1YITP 4N6JA 3CX5E 1L0LE 2JR8A 3M06A 4ASWA 4O9BA 1KYOE 4UB8H 1KZUB 1MZ9A 1HH0A 1KORA 2WWWA 3BVHA 2ZXEB 3BCCG 3M0DC 5EFWB 3Q1MA 3B5NA 4PD4D 1EZVG 3E1IA 3TNUA 1NAYA 1LTIC 1TU3F 2LKMA 2OYHC 2O01H 1SFCD 1RY3A 2RKLA 1LTAC 3HUSC 4JYBA 2ZVOB 2M5AA 2QJYC 3HD7C 3H25A 1FC2C 1SQVE 1SQVJ 4JPZB 2J5UA 2HLOA 1AJYA 3Q3DA 1BGYD 3KXDA 3H1JD 2QM7A 2KUBA 1WT6A 3BATA 1RE3C 4L75A 2N1TD 4KJMA 1NTZD 4D6TG 1EC5A 3AE7C 1SQQG 2Z5IA 3R4YA 4HB1A 2LR2A 2D2CD 4A7PA 1M8OB 5AW0B 1SFCA 4BRYB 1KB9D 1H89A 4XFJA 2BCCG 3NXSA 2OYHB 1T3UA 1JO5A 3SSUA 1NTMG 4R4LA 5BVZA 2IBZD 3HUSB 1NOHA 2I8DA 3VN0A 1M90Q 1HBWA 3CLQA 1OX3A 1EDKA 1VQ4P 1SQXE 3HD7B 1CW5A 4BWNA 2YKPA 4N78D 4LLHA 5APTA 2WPQA 2WZ7A 1N73C 3TK1A 5AVUB 4EOTA 2R32A 2N1TA 3G4SP 1K05A 4PD4H 4R4MA 5KAFE 1FOSE 4N3YB 2O1JA 3WUTA 1HWTC 1ZRTD 2KXPB 1A02F 5AW1B 1NGMB 2ZFCA 3H1KE 1FZGA 3T97A 2CK3H 2ZT9D 4ZNCA 1VF5C 5GTIH 1SQPD 1MV8A 1KMIZ 2KZJA 1ZLLA 3VMXA 3Q5RA 5L8RJ 5APXA 2KS1B 1PV3A 1RF1A 1AV1A 3ABVC 1JEKA 5M1BA 1N73B 1RF0C 1AQ5A 2HR3A 1EXJA 1NWQA 1BDCA 4JBZA 3F5HA 3FWLA 2WT7B 2Y9YA 3HTKB 3JCUH 4JQ0D 1IZNB 3RGUA 3L74E 3L74J 2KZIA 1QL1A 2Z4EA 3KHUA 4KT0J 3RBZA 2E75D 2OGUA 2K9JA 3CXHI 2O01J 3O6QA 2BEQD 1FDOA 5H2FH 2YIUC 2BCCJ 4HJGH 1L0LD 3GF7A 3ITKA 1VF5B 1KYOD 1BGYG 4HH2A 2KK7A 3H1JG 1KFNA 1JUNA 1OW6A 3P7KA 1FDIA 1SQBK 4WBAA 2FKWB 1S5LX 3V4WA 3HE4A 2FXOA 3CD6P 3A7OA 1AVYA 3CXHE 3VP9A 4B86A 4IL6H 2KSJA 2QE7H 4UB6E 1NU1E 4MN4C 4JYCA 1NU1J 1NO4A 3MGNA 1U57A 1NHLA 4GDOA 5AW3B 1PP9D 1GL2D 1BCCE 1BCCJ 2O01N 1VQMP 3L70E 3L70J 1GZLA 2IBZG 3CCVP 2ZXXA 2SPZA 3WUUA 1VQPP 4IOIH 3MTUE 1PFIA 2XNDH 4L76A 2YIUB 1HTLC 5CCHC 3FXEA 1KQLA 1LWUB 3HD7D 1LTJA 1JCCA 4WY4D 2I1KA 1OMIA 3H1HE 1H8AA 1Q2NA 5KAIE 2Q1KA 1AVOA 1S2EA 2IZ0A 3L71E 3L71J 1FJKA 2JP3A 1N7SC 2W27A 1EDIA 2W8ZA 2QIWA 1JY3N 3EQ2A 3AE8C 1GL2A 1LT1A 3Q2YA 1YJ9P 1ZR4A 1LNQA 4EIJA 1LTTC 4PV1C 1RQVA 2OYIA 1SVFA 2M3BA 1SQPG 1OIPA 5KTBA 1URQD 5AVQB 2J59M 2KYVA 3RL0C 1SQXD 3BRVB 3A3YB 2HPCA 3TGUD 3HE5B 2AXTE 1SQVK 3LW5H 4WY4A 3G6EP 3AE6C 1WRGA 2W6AA 1YTZI 5AW4B 2B88A 2C0XA 1VQNP 3L73D 1KD1Q 3VMYA 5K5GB 2K3RA 1N7SB 2A45G 3L75D 3R2PA 4C7NB 1UIXA 1L4AC 4GKGA 2K9YA 3AEFC 4Y28J 4H44C 1FDMA 3OAKA 1GU5A 4M3LA 3H1KD 1RE4C 1LT9C 4IFFA 4PV1B 1FE6A 1LP1B 2FYUE 3I5CA 3PP5A 2FYUJ 2NPSB 1URQA 2CPSA 1JY2O 5AW9B 3QWOC 3M91A 3MIWA 3H1LE 3RL0B 2GM4A 2H89C 2Y0CA 3D6ZA 4U3FD 1ZW0A 1DD3A 1YQ4C 3SWFA 1IJDB 3Q5SA 2L5GB 5B66E 1DEBA 2WQYC 2OARA 2MJZA 3MUDA 1FZBA 1FZAA 1AFOA 2NZ2A 1PP9G 2YMKA 1NKZB 1P84I 4LGDE 2E5YA 4IL6E 1IK7A 1KQGB 1L2PA 1VQOP 1L4AB 1J1EC 1SQBE 1M1JC 3CC2P 1SQBJ 1DIPA 4H44B 1LGHB 4OH8B 2WSCJ 1LT9B 4WVZA 5APQA 3CMEP 1R5LA 1P84E 3RK3C 2Z5HA 4HYTB 2K37A 1PGPA 1BE3G 1U7JA 3CX5I 3RK3E 1Q81Q 3CCEP 4I6MC 3GF3A 4W7ZA 1N86A 1G2CA 3L4FA 1S5LE 1YBKA 2ZYDA 2M3EA 2E42A 2R3CA 5E79E 3S9OA 2G8YA 5GTHH 1J2JB 2Q3EA 1KTMA 2MKVA 1HF9A 1NTKE 1NTKJ 1ZXGA 1J1EB 1M1JB 1OFCX 2XZRA 3KZIH 4OWFA 1T2KD 1JCDA 1IFMA 1PPJD 2PFXA 3EFGA 3GHGC 3TGUG 2H43A 1BSNA 1RQUA 1GK6A 1JTHB 4H13C 1W2EA 3H1HD 5CCHD 3RK3B 1FZCC 1USDA 1N7LA 2P10A 3LIDA 3L73G 3LW5J 5CCGC 3TSIA 1Q86Q 3L75G 2E76D 5KJ7D 1Y47A 1HJ0A 2QJKC 1NVOA 1NU1K 4H0LD 1GTWA 2Q6QA 1IFJA 2A06D 3PLNA 3USSA 1AQTA 3CWBD 2FFDA 1PL5A 2E74C 3G71P 1MFZA 3WU2H 2KOGA 2KI7B 4U3FG 3GHGB 5CCHA 3WMM0 1MUUA 1HGVA 4H13B 4RJTA 5AVTB 1SP4A 1BE3J 1L0NE 1OW8A 1L0NJ 1FZCB 1QEXA 3HRNA 1S9KD 3P8CD 5KLIC 5KLVE 5KLVJ 1KFMA 5KJ7A 3RK2C 3A5TA 1JMBA 1BSHA 1NYHA 1K04A 2V4HA 2XNXA 2P67A 2B87A 2HG5D 2QJKB 3CMAP 5TJHA 4GODA 5TISE 1KILC 1W5CE 1H0TB 1Z56A 3L72D 2KNCB 3S4RA 2LXBA 2E74B 3H1LD 3N7NA 1IO4A 1KILE 1IFIA 1VQLP 2AXCA 4C7RA 1FOSF 2K1AA 3PHLA 2Y9ZA 3S1KA 2JWAA 3BCCE 3BCCJ 1ZN5A 1K73Q 5B5EH 1FJPA 2FYZA 1EZVE 3CCLP 1GK4A 2IFMA 2M0BA 2R44A 3H1ID 3IR9A 3M9BA 1OVUA 2W6BA 5KLIB 2WMMA 2OTKE 3SFEC 3RK2B 2WITA 5AW2B 2V7QJ 3RBXA 3H32A 5APWA 2YNYA 3U59A 3WUVA 4EI2A 1PPJG 2WPVB 1VQ9P 3CI9A 1KILB 2ZAEB 4UB8E 2FYUK 2ZYGA 3VTPC 1NAFA 1CI6A 4IL6X 4D6TE 4D6TJ 1KB9H 4OVNF 1SQQE 1SQQJ 3VOPA 1YQ3C 2QM8A 4U3FJ 3FGAD 3CPWO 1S4XA 3A0BH 3U1AA 1VL2A 1PIXA 1QLED 3PTZA 1M56D 3RL0g 2BCCE 2NRGA 1LWUC 3CX5D 1IFDA 1NTME 3OA7A 1N2DC 1NTMJ 2A06G 2Y0DA 3B71A 1LTGC 5C39A 3FX0A 1Q82Q 3G3ZA 2HODB 3CWBG 2JKVA 4IFMA 1NTZG 3TF5A 3I56P 4GOEA 2RMZA 3CCJP 1XTGB 2KSEA 3B5NC 4I7ZC 2KP8A 3D71A 2XKMA 3CCMP 1NH4A 1EXIA 2W6JH 3WU2E 2FYNC 4RO0A 3F89A 3VP8A 1DX7A 3V5BA 1DEEG 1JOCA 5CCGD 5CJ0A 1SQVD 3AE5C 4Y99C 1JY2N 1EDJA 1R8EA 3MD0A 4U7JA 2R5BA 2QJPB 3L72G 2PGDA 1NTKK 4WB4A 3BASA 3TYYA 2ZJSE 3IAOA 2A45H 4TT3H 3PJSK 2N9YB 3B5NB 4I7ZB 3M0DA 1T3JA 1JB0J 4PD4E 3TNUB 2IX7C 4BRYA 2B89A 2P1JA 3H1IG 2J58A 2IYOA 1M1KQ 2OYHA 4RESB 2BASA 1GMJA 2NPSC 3PRJA 2FYNB 1AA0A 5CCGA 3HUSA 1KYOH 1GW4A 2IYPA 3RK2D 3K5BA 2M5AB 2XU6A 3D6YA 2AEMA 1KV4A 2PP6A 3HD7A 2P7JA 4AQRD 2YXQB 2WPSA 4Y99B 5GTIE 4NPFX 3M9QA 1BGYE 1BGYJ 3H1JE 3H1JJ 3UIAA 2KIKA 1KC8Q 3KQGA 2G3AA 3CC4P 1RE3A 2D2CC 1NTZJ 3NTNA 1QX8A 1HVVA 3N4XA 2YO2A 5APVA 1SFCB 2YXRB 1QGKB 2XDJA 1L0NK 1KB9E 3Q5PA 3JCUE 2I1JA 5KLVK 2QA4P 1L0LG 1QVGO 4IFDK 1Q90D 2C9LY 3BRTB 2IBZE 1PGJA 1VF5D 1QL2A 3AEAC 4DCKA 3M9HA 5H2FE 2KS1A 2KLVA 3GMAA 1YJNP 3MZWB 3E1RA 1N73A 2IDBA 2N1TB 2YO3A 2IFNA 4EYYQ 1LTBC 2WT7A 1JY2P 2D2CB 3HTKA 4I1LA 3II6A 3CCSP 3GG2A 3L74D 3W67A 4K3AA 1GDTA 1ZRTE 5DJUB 1SLQA 2BCCD 3LIEA 2ITAA 1SQVG 3SWKA 5AVXB 3T97B 2WVRA 2OYOA 1JY3P 3VMZA 2E43A 1MFTA 2Q3IA 2DW3A 1SQPE 1S1CX 1SQPJ 3A2AA 1KN7A 3A0HH 1W2BO 1YHQP 3V6IA 1RF1B 1USEA 1JM0A 3CXHD 1KQFB 1OVVA 3AE3C 5BU8B 1RF0A 1ZV8A 1NU1D 3JSVC 1IFPA 1BCCD 2QEXP 2B9BA 1OZHA 1SQQK 2XV5A 1GW3A 3L70D 1FBMA 4AUWA 3L36A 2FXPA 3IN6A 1DH3A 2C0WA 4DT0A 2K9JB 3O6QB 2PAJA 1SQXG 1X22A 3AE9C 1X8YA 1YIJP 2LXCB 1VDFA 2ZVNB 1LTJC 5AW8B 1LWUA 1L0LJ 4DZOA 5DJTB 1NTMK 2H7HA
chains in the Genus database with same CATH topology
1EC5A 2B87B 1NVOA 4GOEA 2M5AB 4HB1A 1LP1A 2KZJA 4CPGA 2B88A 2QVAA 2LR2A 2M0BA 2KS1B 4K3AA 2R44A 1U7JA 4NPEA 2SPZA 5K5GB 2K3RA 4ASVA 1OVUA 2WMMA 5DJUB 4ASWA 1S3JA 2OTKE 3PH0A 4IOIH 1U7MA 2HR3A 4NPFX 4K35A 3FXEA 1BDCA 2UWJE 4JBZA 2KIKA 1MFTA 2KI7B 4WWIA 1Q2NA 2I8DA 1LP1B 5CBNA 3RGUA 2Q1KA 1DEEG 4HKZH 1EDKA 2KZIA 3QWOC 1X0TA 5EFWB 1JM0A 2ZAEB 1EDIA 1OVVA 3MHVA 1H0TA 1EDJA 1BDDA 1ZW0A 1ZXGA 1SS1A 4HJGH 1JMBA 3ZDMA 1LT1A 2QRXA 4GOFA 2RKLA 2B87A 1EDLA 4NPDA 2M5AA 2JWDA 4GODA 4ZMDA 1FC2C 1H0TB 3MZWB 1OVRA 2B89A 2LXBA 5C39A 2LXCB 2KUBA 5CBOA 4MN4C 2P58A 4BXLA 5DJTB 4ZNCA 1Y47A 4EYYQ 4KJMA 3FXDA 3S1KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1EC5 A;  2B87 B;  1NVO A;  4GOE A;  2M5A B;  4HB1 A;  1LP1 A;  2KZJ A;  4CPG A;  2B88 A;  2QVA A;  2LR2 A;  2M0B A;  2KS1 B;  4K3A A;  2R44 A;  1U7J A;  4NPE A;  2SPZ A;  5K5G B;  2K3R A;  4ASV A;  1OVU A;  2WMM A;  5DJU B;  4ASW A;  1S3J A;  2OTK E;  3PH0 A;  4IOI H;  1U7M A;  2HR3 A;  4NPF X;  4K35 A;  3FXE A;  1BDC A;  2UWJ E;  4JBZ A;  2KIK A;  1MFT A;  2KI7 B;  4WWI A;  1Q2N A;  2I8D A;  1LP1 B;  5CBN A;  3RGU A;  2Q1K A;  1DEE G;  4HKZ H;  1EDK A;  2KZI A;  3QWO C;  1X0T A;  5EFW B;  1JM0 A;  2ZAE B;  1EDI A;  1OVV A;  3MHV A;  1H0T A;  1EDJ A;  1BDD A;  1ZW0 A;  1ZXG A;  1SS1 A;  4HJG H;  1JMB A;  3ZDM A;  1LT1 A;  2QRX A;  4GOF A;  2RKL A;  2B87 A;  1EDL A;  4NPD A;  2M5A A;  2JWD A;  4GOD A;  4ZMD A;  1FC2 C;  1H0T B;  3MZW B;  1OVR A;  2B89 A;  2LXB A;  5C39 A;  2LXC B;  2KUB A;  5CBO A;  4MN4 C;  2P58 A;  4BXL A;  5DJT B;  4ZNC A;  1Y47 A;  4EYY Q;  4KJM A;  3FXD A;  3S1K A; 
#chains in the Genus database with same CATH topology
 3C9I A;  3L71 D;  2YKO A;  2QVA A;  3HE4 B;  3SWY A;  4ASV A;  2OTJ P;  1J1D C;  1GL2 C;  1N7S D;  2AEF A;  4YPC A;  3OW2 O;  1XTC C;  2WPR A;  1OW7 A;  2O1K A;  2OYI C;  1EQ7 A;  1PP9 E;  1PP9 J;  3H1K G;  1GU4 A;  4WWI A;  2QG4 A;  3AED C;  2KB7 P;  4PV1 D;  2E75 B;  1VPC A;  1E79 H;  2NPS D;  3IF4 A;  3CCU P;  2Q7C A;  4WY4 C;  1PGQ A;  1FU1 A;  3HE5 A;  3CXH H;  3RL0 D;  1OWA A;  1LTJ B;  2GUV A;  2AEJ A;  1BE3 E;  4GT1 A;  4UB6 H;  3IFM A;  1JNM A;  3CCQ P;  4L73 A;  3L37 A;  4ZMD A;  3L74 G;  1VQ5 P;  2Q9I A;  1N7S A;  2GUS A;  4C7N A;  1J1D B;  1GL2 B;  3V4Q A;  1M7L A;  3C1L A;  2W90 A;  1L4A D;  4L74 A;  3VYI A;  2OYI B;  4H44 D;  1URQ C;  2FYU D;  1E5W A;  1EZV I;  1LP1 A;  2HFE D;  2NPS A;  2KLU A;  3KPE A;  1T6A A;  4YTP C;  1K9M Q;  4NPE A;  5KAI H;  3MP7 B;  2QJY B;  2BEZ F;  1SQX J;  2HPC B;  1S3J A;  2JDI H;  3TGU E;  1FAV A;  5APU A;  3TGU J;  1VQ8 P;  4WY4 B;  2HYN A;  1D7M A;  3P8M C;  4OGQ C;  3MUD C;  3A0H E;  1NU1 G;  3NMD A;  1Y9B A;  2O3J A;  1YJW P;  1BCC G;  1NTZ K;  5AVW B;  1HUC A;  3L73 E;  3L73 J;  1Q7Y Q;  3MHV A;  3L70 G;  3L75 E;  1G1I A;  3L75 J;  1FZE A;  1A02 J;  1SQB D;  1L4A A;  1BDD A;  2CPB A;  2WSF H;  1SS1 A;  1NKN A;  2QRX A;  4DOJ A;  5GTH E;  4GIF A;  3H1K J;  1RE4 A;  5BU5 A;  2AXT H;  1LT9 A;  1EDL A;  1HGZ A;  1URQ B;  1P84 D;  1WMK A;  3H1H G;  1KQS O;  5AW6 B;  2WSE H;  3AE1 C;  1CSB A;  3KZI E;  3L71 G;  1K8A Q;  3RK3 D;  3I55 P;  3QH9 A;  1OVR A;  1M57 D;  4U3F E;  2WSS H;  3AEB C;  5CBO A;  3CL3 D;  3H6P A;  1ZP0 C;  2Q5U A;  4OGQ B;  3EFF K;  2POH A;  1IK9 A;  3V2Q A;  1RH5 B;  1LTS C;  3FWN A;  5AVY B;  3JC2 2;  2E5T A;  5AVZ B;  1HJB A;  1IC2 A;  4ZKP A;  3PH0 A;  1NTK D;  1U7M A;  2QJP C;  3EWK A;  4PJ0 H;  1M1J A;  3B8E B;  1JMM A;  3NFQ A;  3B4S A;  2H8P D;  4XA4 A;  5CBN A;  1JTH A;  4HKZ H;  3KDP B;  5B66 H;  5CMZ A;  1SQP K;  2R3S A;  4H13 D;  1OXZ A;  3E7K A;  1PGO A;  2FBW C;  2GA1 A;  1G2C B;  2OQQ A;  5KKZ C;  1FZF A;  1N8R Q;  2WSC H;  4TLF A;  2FYU G;  4JF7 A;  4PD4 I;  5APS A;  2FFD C;  3V2P A;  1P84 H;  1VQ7 P;  1T2K C;  1MKM A;  1G1J A;  5APY A;  2P2U A;  4YXW H;  3H1L G;  4EDF A;  3C8V A;  2YKQ A;  1PPJ E;  2E74 D;  3VMA A;  3AEG C;  3GHG A;  1L0L K;  1S5L H;  3V2R A;  1BE3 D;  1SFC C;  3H1H J;  1L0N D;  4DJG A;  3KYQ A;  4QMA A;  1FZC A;  5E79 H;  5KLV D;  1GD2 E;  3V2N A;  2E76 C;  5KJ7 C;  3CX5 H;  1ZR2 A;  2JEE A;  1VQ6 P;  5B5E E;  1YYC A;  2OTL P;  4H0L C;  4AYC A;  1SQB G;  3AEE C;  1S72 P;  5KKZ B;  1ZOY C;  2A06 E;  2WTY A;  2N1T C;  2FFD B;  2QSI A;  1H0T A;  3CWB E;  1KB9 I;  4ZKU A;  2WSF J;  3CWB J;  1H88 A;  2KNC A;  1KIL D;  2FXM A;  3ZDM A;  1X9V A;  1NTZ E;  2M8R A;  1X79 B;  4GOF A;  2IBZ I;  3BCC D;  3CCR P;  2C9N Y;  2JJL A;  1EZV D;  2RH0 A;  4C46 A;  1LJ2 A;  2JWD A;  2WSE J;  4OGQ D;  1S9K E;  3P8C E;  3CC7 P;  2PRR A;  2E76 B;  3AE4 C;  2IPP A;  3AE2 C;  3A0B E;  2P58 A;  2RN0 A;  2JO1 A;  4BXL A;  3AEC C;  4H0L B;  1NTK G;  1CZQ A;  3FXD A;  2B87 B;  4YXD C;  1RHZ B;  1IFN A;  1RF1 C;  1QVF O;  1ZME C;  4N78 E;  4W7Y A;  1KIL A;  2YMY A;  1T8Z A;  4PJ0 E;  1YTZ T;  3L72 E;  3L35 A;  3L72 J;  4K35 A;  4D6T D;  3H1L J;  3OJA B;  1SQQ D;  2UWJ E;  2K88 A;  1SQX K;  1Y8A A;  3U1C A;  3D70 A;  2W83 C;  5AVR B;  5CHX A;  1YI2 P;  4XE5 B;  3O8Z A;  5AVS B;  2L91 A;  2IZ1 A;  1JY3 O;  1X0T A;  3GLM A;  2ZT9 C;  3H1I E;  1UII A;  3H1I J;  3GW6 A;  1NTM D;  1DD4 A;  5AW7 B;  4W80 A;  2R5D A;  5TIS H;  2HOD A;  3H32 B;  5AW5 B;  4I2L C;  2FY8 A;  3TDK A;  2ZYA A;  5KAF H;  4NPD A;  4LC1 A;  2A45 I;  1PZQ A;  2Y0E A;  3G9R A;  1NJI Q;  1VQK P;  5AVV B;  3W68 A;  2VRS A;  1L0N G;  3B5N D;  1CI6 B;  3M0A A;  5KLV G;  1FS0 E;  5CJ4 A;  1KYO I;  4KHX A;  3SFD C;  2E75 C;  2V7Q H;  3P32 A;  4CPG A;  1R5S A;  4Z1M H;  4RKU J;  2ZT9 B;  2H88 C;  2N9B A;  1YIT P;  4N6J A;  3CX5 E;  1L0L E;  2JR8 A;  3M06 A;  4ASW A;  4O9B A;  1KYO E;  4UB8 H;  1KZU B;  1MZ9 A;  1HH0 A;  1KOR A;  2WWW A;  3BVH A;  2ZXE B;  3BCC G;  3M0D C;  5EFW B;  3Q1M A;  3B5N A;  4PD4 D;  1EZV G;  3E1I A;  3TNU A;  1NAY A;  1LTI C;  1TU3 F;  2LKM A;  2OYH C;  2O01 H;  1SFC D;  1RY3 A;  2RKL A;  1LTA C;  3HUS C;  4JYB A;  2ZVO B;  2M5A A;  2QJY C;  3HD7 C;  3H25 A;  1FC2 C;  1SQV E;  1SQV J;  4JPZ B;  2J5U A;  2HLO A;  1AJY A;  3Q3D A;  1BGY D;  3KXD A;  3H1J D;  2QM7 A;  2KUB A;  1WT6 A;  3BAT A;  1RE3 C;  4L75 A;  2N1T D;  4KJM A;  1NTZ D;  4D6T G;  1EC5 A;  3AE7 C;  1SQQ G;  2Z5I A;  3R4Y A;  4HB1 A;  2LR2 A;  2D2C D;  4A7P A;  1M8O B;  5AW0 B;  1SFC A;  4BRY B;  1KB9 D;  1H89 A;  4XFJ A;  2BCC G;  3NXS A;  2OYH B;  1T3U A;  1JO5 A;  3SSU A;  1NTM G;  4R4L A;  5BVZ A;  2IBZ D;  3HUS B;  1NOH A;  2I8D A;  3VN0 A;  1M90 Q;  1HBW A;  3CLQ A;  1OX3 A;  1EDK A;  1VQ4 P;  1SQX E;  3HD7 B;  1CW5 A;  4BWN A;  2YKP A;  4N78 D;  4LLH A;  5APT A;  2WPQ A;  2WZ7 A;  1N73 C;  3TK1 A;  5AVU B;  4EOT A;  2R32 A;  2N1T A;  3G4S P;  1K05 A;  4PD4 H;  4R4M A;  5KAF E;  1FOS E;  4N3Y B;  2O1J A;  3WUT A;  1HWT C;  1ZRT D;  2KXP B;  1A02 F;  5AW1 B;  1NGM B;  2ZFC A;  3H1K E;  1FZG A;  3T97 A;  2CK3 H;  2ZT9 D;  4ZNC A;  1VF5 C;  5GTI H;  1SQP D;  1MV8 A;  1KMI Z;  2KZJ A;  1ZLL A;  3VMX A;  3Q5R A;  5L8R J;  5APX A;  2KS1 B;  1PV3 A;  1RF1 A;  1AV1 A;  3ABV C;  1JEK A;  5M1B A;  1N73 B;  1RF0 C;  1AQ5 A;  2HR3 A;  1EXJ A;  1NWQ A;  1BDC A;  4JBZ A;  3F5H A;  3FWL A;  2WT7 B;  2Y9Y A;  3HTK B;  3JCU H;  4JQ0 D;  1IZN B;  3RGU A;  3L74 E;  3L74 J;  2KZI A;  1QL1 A;  2Z4E A;  3KHU A;  4KT0 J;  3RBZ A;  2E75 D;  2OGU A;  2K9J A;  3CXH I;  2O01 J;  3O6Q A;  2BEQ D;  1FDO A;  5H2F H;  2YIU C;  2BCC J;  4HJG H;  1L0L D;  3GF7 A;  3ITK A;  1VF5 B;  1KYO D;  1BGY G;  4HH2 A;  2KK7 A;  3H1J G;  1KFN A;  1JUN A;  1OW6 A;  3P7K A;  1FDI A;  1SQB K;  4WBA A;  2FKW B;  1S5L X;  3V4W A;  3HE4 A;  2FXO A;  3CD6 P;  3A7O A;  1AVY A;  3CXH E;  3VP9 A;  4B86 A;  4IL6 H;  2KSJ A;  2QE7 H;  4UB6 E;  1NU1 E;  4MN4 C;  4JYC A;  1NU1 J;  1NO4 A;  3MGN A;  1U57 A;  1NHL A;  4GDO A;  5AW3 B;  1PP9 D;  1GL2 D;  1BCC E;  1BCC J;  2O01 N;  1VQM P;  3L70 E;  3L70 J;  1GZL A;  2IBZ G;  3CCV P;  2ZXX A;  2SPZ A;  3WUU A;  1VQP P;  4IOI H;  3MTU E;  1PFI A;  2XND H;  4L76 A;  2YIU B;  1HTL C;  5CCH C;  3FXE A;  1KQL A;  1LWU B;  3HD7 D;  1LTJ A;  1JCC A;  4WY4 D;  2I1K A;  1OMI A;  3H1H E;  1H8A A;  1Q2N A;  5KAI E;  2Q1K A;  1AVO A;  1S2E A;  2IZ0 A;  3L71 E;  3L71 J;  1FJK A;  2JP3 A;  1N7S C;  2W27 A;  1EDI A;  2W8Z A;  2QIW A;  1JY3 N;  3EQ2 A;  3AE8 C;  1GL2 A;  1LT1 A;  3Q2Y A;  1YJ9 P;  1ZR4 A;  1LNQ A;  4EIJ A;  1LTT C;  4PV1 C;  1RQV A;  2OYI A;  1SVF A;  2M3B A;  1SQP G;  1OIP A;  5KTB A;  1URQ D;  5AVQ B;  2J59 M;  2KYV A;  3RL0 C;  1SQX D;  3BRV B;  3A3Y B;  2HPC A;  3TGU D;  3HE5 B;  2AXT E;  1SQV K;  3LW5 H;  4WY4 A;  3G6E P;  3AE6 C;  1WRG A;  2W6A A;  1YTZ I;  5AW4 B;  2B88 A;  2C0X A;  1VQN P;  3L73 D;  1KD1 Q;  3VMY A;  5K5G B;  2K3R A;  1N7S B;  2A45 G;  3L75 D;  3R2P A;  4C7N B;  1UIX A;  1L4A C;  4GKG A;  2K9Y A;  3AEF C;  4Y28 J;  4H44 C;  1FDM A;  3OAK A;  1GU5 A;  4M3L A;  3H1K D;  1RE4 C;  1LT9 C;  4IFF A;  4PV1 B;  1FE6 A;  1LP1 B;  2FYU E;  3I5C A;  3PP5 A;  2FYU J;  2NPS B;  1URQ A;  2CPS A;  1JY2 O;  5AW9 B;  3QWO C;  3M91 A;  3MIW A;  3H1L E;  3RL0 B;  2GM4 A;  2H89 C;  2Y0C A;  3D6Z A;  4U3F D;  1ZW0 A;  1DD3 A;  1YQ4 C;  3SWF A;  1IJD B;  3Q5S A;  2L5G B;  5B66 E;  1DEB A;  2WQY C;  2OAR A;  2MJZ A;  3MUD A;  1FZB A;  1FZA A;  1AFO A;  2NZ2 A;  1PP9 G;  2YMK A;  1NKZ B;  1P84 I;  4LGD E;  2E5Y A;  4IL6 E;  1IK7 A;  1KQG B;  1L2P A;  1VQO P;  1L4A B;  1J1E C;  1SQB E;  1M1J C;  3CC2 P;  1SQB J;  1DIP A;  4H44 B;  1LGH B;  4OH8 B;  2WSC J;  1LT9 B;  4WVZ A;  5APQ A;  3CME P;  1R5L A;  1P84 E;  3RK3 C;  2Z5H A;  4HYT B;  2K37 A;  1PGP A;  1BE3 G;  1U7J A;  3CX5 I;  3RK3 E;  1Q81 Q;  3CCE P;  4I6M C;  3GF3 A;  4W7Z A;  1N86 A;  1G2C A;  3L4F A;  1S5L E;  1YBK A;  2ZYD A;  2M3E A;  2E42 A;  2R3C A;  5E79 E;  3S9O A;  2G8Y A;  5GTH H;  1J2J B;  2Q3E A;  1KTM A;  2MKV A;  1HF9 A;  1NTK E;  1NTK J;  1ZXG A;  1J1E B;  1M1J B;  1OFC X;  2XZR A;  3KZI H;  4OWF A;  1T2K D;  1JCD A;  1IFM A;  1PPJ D;  2PFX A;  3EFG A;  3GHG C;  3TGU G;  2H43 A;  1BSN A;  1RQU A;  1GK6 A;  1JTH B;  4H13 C;  1W2E A;  3H1H D;  5CCH D;  3RK3 B;  1FZC C;  1USD A;  1N7L A;  2P10 A;  3LID A;  3L73 G;  3LW5 J;  5CCG C;  3TSI A;  1Q86 Q;  3L75 G;  2E76 D;  5KJ7 D;  1Y47 A;  1HJ0 A;  2QJK C;  1NVO A;  1NU1 K;  4H0L D;  1GTW A;  2Q6Q A;  1IFJ A;  2A06 D;  3PLN A;  3USS A;  1AQT A;  3CWB D;  2FFD A;  1PL5 A;  2E74 C;  3G71 P;  1MFZ A;  3WU2 H;  2KOG A;  2KI7 B;  4U3F G;  3GHG B;  5CCH A;  3WMM 0;  1MUU A;  1HGV A;  4H13 B;  4RJT A;  5AVT B;  1SP4 A;  1BE3 J;  1L0N E;  1OW8 A;  1L0N J;  1FZC B;  1QEX A;  3HRN A;  1S9K D;  3P8C D;  5KLI C;  5KLV E;  5KLV J;  1KFM A;  5KJ7 A;  3RK2 C;  3A5T A;  1JMB A;  1BSH A;  1NYH A;  1K04 A;  2V4H A;  2XNX A;  2P67 A;  2B87 A;  2HG5 D;  2QJK B;  3CMA P;  5TJH A;  4GOD A;  5TIS E;  1KIL C;  1W5C E;  1H0T B;  1Z56 A;  3L72 D;  2KNC B;  3S4R A;  2LXB A;  2E74 B;  3H1L D;  3N7N A;  1IO4 A;  1KIL E;  1IFI A;  1VQL P;  2AXC A;  4C7R A;  1FOS F;  2K1A A;  3PHL A;  2Y9Z A;  3S1K A;  2JWA A;  3BCC E;  3BCC J;  1ZN5 A;  1K73 Q;  5B5E H;  1FJP A;  2FYZ A;  1EZV E;  3CCL P;  1GK4 A;  2IFM A;  2M0B A;  2R44 A;  3H1I D;  3IR9 A;  3M9B A;  1OVU A;  2W6B A;  5KLI B;  2WMM A;  2OTK E;  3SFE C;  3RK2 B;  2WIT A;  5AW2 B;  2V7Q J;  3RBX A;  3H32 A;  5APW A;  2YNY A;  3U59 A;  3WUV A;  4EI2 A;  1PPJ G;  2WPV B;  1VQ9 P;  3CI9 A;  1KIL B;  2ZAE B;  4UB8 E;  2FYU K;  2ZYG A;  3VTP C;  1NAF A;  1CI6 A;  4IL6 X;  4D6T E;  4D6T J;  1KB9 H;  4OVN F;  1SQQ E;  1SQQ J;  3VOP A;  1YQ3 C;  2QM8 A;  4U3F J;  3FGA D;  3CPW O;  1S4X A;  3A0B H;  3U1A A;  1VL2 A;  1PIX A;  1QLE D;  3PTZ A;  1M56 D;  3RL0 g;  2BCC E;  2NRG A;  1LWU C;  3CX5 D;  1IFD A;  1NTM E;  3OA7 A;  1N2D C;  1NTM J;  2A06 G;  2Y0D A;  3B71 A;  1LTG C;  5C39 A;  3FX0 A;  1Q82 Q;  3G3Z A;  2HOD B;  3CWB G;  2JKV A;  4IFM A;  1NTZ G;  3TF5 A;  3I56 P;  4GOE A;  2RMZ A;  3CCJ P;  1XTG B;  2KSE A;  3B5N C;  4I7Z C;  2KP8 A;  3D71 A;  2XKM A;  3CCM P;  1NH4 A;  1EXI A;  2W6J H;  3WU2 E;  2FYN C;  4RO0 A;  3F89 A;  3VP8 A;  1DX7 A;  3V5B A;  1DEE G;  1JOC A;  5CCG D;  5CJ0 A;  1SQV D;  3AE5 C;  4Y99 C;  1JY2 N;  1EDJ A;  1R8E A;  3MD0 A;  4U7J A;  2R5B A;  2QJP B;  3L72 G;  2PGD A;  1NTK K;  4WB4 A;  3BAS A;  3TYY A;  2ZJS E;  3IAO A;  2A45 H;  4TT3 H;  3PJS K;  2N9Y B;  3B5N B;  4I7Z B;  3M0D A;  1T3J A;  1JB0 J;  4PD4 E;  3TNU B;  2IX7 C;  4BRY A;  2B89 A;  2P1J A;  3H1I G;  2J58 A;  2IYO A;  1M1K Q;  2OYH A;  4RES B;  2BAS A;  1GMJ A;  2NPS C;  3PRJ A;  2FYN B;  1AA0 A;  5CCG A;  3HUS A;  1KYO H;  1GW4 A;  2IYP A;  3RK2 D;  3K5B A;  2M5A B;  2XU6 A;  3D6Y A;  2AEM A;  1KV4 A;  2PP6 A;  3HD7 A;  2P7J A;  4AQR D;  2YXQ B;  2WPS A;  4Y99 B;  5GTI E;  4NPF X;  3M9Q A;  1BGY E;  1BGY J;  3H1J E;  3H1J J;  3UIA A;  2KIK A;  1KC8 Q;  3KQG A;  2G3A A;  3CC4 P;  1RE3 A;  2D2C C;  1NTZ J;  3NTN A;  1QX8 A;  1HVV A;  3N4X A;  2YO2 A;  5APV A;  1SFC B;  2YXR B;  1QGK B;  2XDJ A;  1L0N K;  1KB9 E;  3Q5P A;  3JCU E;  2I1J A;  5KLV K;  2QA4 P;  1L0L G;  1QVG O;  4IFD K;  1Q90 D;  2C9L Y;  3BRT B;  2IBZ E;  1PGJ A;  1VF5 D;  1QL2 A;  3AEA C;  4DCK A;  3M9H A;  5H2F E;  2KS1 A;  2KLV A;  3GMA A;  1YJN P;  3MZW B;  3E1R A;  1N73 A;  2IDB A;  2N1T B;  2YO3 A;  2IFN A;  4EYY Q;  1LTB C;  2WT7 A;  1JY2 P;  2D2C B;  3HTK A;  4I1L A;  3II6 A;  3CCS P;  3GG2 A;  3L74 D;  3W67 A;  4K3A A;  1GDT A;  1ZRT E;  5DJU B;  1SLQ A;  2BCC D;  3LIE A;  2ITA A;  1SQV G;  3SWK A;  5AVX B;  3T97 B;  2WVR A;  2OYO A;  1JY3 P;  3VMZ A;  2E43 A;  1MFT A;  2Q3I A;  2DW3 A;  1SQP E;  1S1C X;  1SQP J;  3A2A A;  1KN7 A;  3A0H H;  1W2B O;  1YHQ P;  3V6I A;  1RF1 B;  1USE A;  1JM0 A;  3CXH D;  1KQF B;  1OVV A;  3AE3 C;  5BU8 B;  1RF0 A;  1ZV8 A;  1NU1 D;  3JSV C;  1IFP A;  1BCC D;  2QEX P;  2B9B A;  1OZH A;  1SQQ K;  2XV5 A;  1GW3 A;  3L70 D;  1FBM A;  4AUW A;  3L36 A;  2FXP A;  3IN6 A;  1DH3 A;  2C0W A;  4DT0 A;  2K9J B;  3O6Q B;  2PAJ A;  1SQX G;  1X22 A;  3AE9 C;  1X8Y A;  1YIJ P;  2LXC B;  1VDF A;  2ZVN B;  1LTJ C;  5AW8 B;  1LWU A;  1L0L J;  4DZO A;  5DJT B;  1NTM K;  2H7H A; 
#chains in the Genus database with same CATH homology
 1EC5 A;  2B87 B;  1NVO A;  4GOE A;  2M5A B;  4HB1 A;  1LP1 A;  2KZJ A;  4CPG A;  2B88 A;  2QVA A;  2LR2 A;  2M0B A;  2KS1 B;  4K3A A;  2R44 A;  1U7J A;  4NPE A;  2SPZ A;  5K5G B;  2K3R A;  4ASV A;  1OVU A;  2WMM A;  5DJU B;  4ASW A;  1S3J A;  2OTK E;  3PH0 A;  4IOI H;  1U7M A;  2HR3 A;  4NPF X;  4K35 A;  3FXE A;  1BDC A;  2UWJ E;  4JBZ A;  2KIK A;  1MFT A;  2KI7 B;  4WWI A;  1Q2N A;  2I8D A;  1LP1 B;  5CBN A;  3RGU A;  2Q1K A;  1DEE G;  4HKZ H;  1EDK A;  2KZI A;  3QWO C;  1X0T A;  5EFW B;  1JM0 A;  2ZAE B;  1EDI A;  1OVV A;  3MHV A;  1H0T A;  1EDJ A;  1BDD A;  1ZW0 A;  1ZXG A;  1SS1 A;  4HJG H;  1JMB A;  3ZDM A;  1LT1 A;  2QRX A;  4GOF A;  2RKL A;  2B87 A;  1EDL A;  4NPD A;  2M5A A;  2JWD A;  4GOD A;  4ZMD A;  1FC2 C;  1H0T B;  3MZW B;  1OVR A;  2B89 A;  2LXB A;  5C39 A;  2LXC B;  2KUB A;  5CBO A;  4MN4 C;  2P58 A;  4BXL A;  5DJT B;  4ZNC A;  1Y47 A;  4EYY Q;  4KJM A;  3FXD A;  3S1K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...