3EFFK

The crystal structure of full-length kcsa in its closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
molecule tags Membrane protein
total genus 43
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3effK02
2ATKC 2WLLB 1J95A 3RVYA 4PA6A 4P2ZA 1KKDA 4MTOA 2EIJC 2DYRC 3T4DA 1G4YB 2W0FC 2P7TC 3BEHA 2Q67A 4MVOA 5B1BC 4MVZA 4QNHB 3RVZA 3F7VC 4BW5A 1ORQC 2ZXWC 4KFMA 4PDMA 4WFEA 4YXWH 3KG2A 2EIKC 2Q6AA 4P30A 4MS2A 4LCUC 2HG5C 5IY5C 2WLIB 5KUMA 4OXSA 2W6JH 2HJFC 1E79H 1R3IC 1R3LC 1OCRC 2WLLA 3LDEA 5EK0A 3T1CA 3STZC 5EC1C 4CBCA 2Y69C 5CBFA 4RAIA 2CK3H 4WVZA 3ASOC 3EFFK 3ABMC 4PA9A 4UUJC 2ITDC 2DWDC 4DJGA 2X6CA 3ABKC 1BL8A 3IGAC 3ASNC 2H8PC 3FB8C 3LNMB 4H33A 4JTDB 2WLMA 4X8AA 3LDDA 1P7BA 4JTAB 4GX5A 4MW3A 1BSNA 3SPGA 3SYAA 2QTOA 4XDJA 2AHYA 3K0GA 3RBZA 3UKMA 3VOUA 5BZBA 3SPHA 3T4ZA 2WLIA 2AHZA 4PDRA 4LP8A 1XL4A 2IH1C 2K1EA 3FB5C 3OUFA 1BSHA 4TWKA 3X2QC 2JDIH 4H37A 4MVMA 3K06A 3OR6C 3E83A 4MW8A 4P9PA 3F5WC 5CBHA 1V55C 2R9RB 2Q69A 3OR7C 4HYOA 1IFPA 1ZWIC 2E5TA 3FB6C 4QE9A 1OCZC 5EC2C 1K4DC 4GX2A 4JTCB 5B1AC 2WLHA 4G27B 1JEKA 2WLJA 3AG2C 3E8FA 1AQTA 4TLFA 2ITCC 3R65A 2HVJC 1R3KC 3JYCA 5B3SC 3AG3C 3WG7C 2OCCC 1LNQA 2BOCC 2X6BA 4MVUA 5EBMC 4P9OA 2WLNA 3E8BA 2EINC 1M57C 4PA4A 5CBGA 4MTFA 1XL6A 2ZD9A 1OCOC 1S5HC 2EILC 3SYOA 4RUFA 1QLEC 3LDCA 3F7YC 4R7CA 3RW0A 3K03A 3T2MA 2QE7H 4MVSA 2IH3C 2JK5C 3ZJZA 2YEVA 3SPCA 4LBEC 3AG1C 4J9ZB 4J9YB 1JVMA 3FB7C 4PA7A 5J9PC 4QMAA 3SYQA 3SJQC 2X6AA 5EBWC 4EKWA 2HVKC 3LUTB 4WFFA 1M56C 3SPJA 1R3JC 4MTGA 5EBLC 2WSSH 4R6ZA 1K4CC 2KB1A 4QE7A 5KUKA 3PJSK 4DXWA 5E1AC 3OGCC 3E89A 4G28B 4R8CA 4RO2A 4R50A 3UM7A 4PA3A 2DWEC 2A0LA 4GX0A 2BOBC 4I9WA 3OUSA 3E8HA 4MVRA 3ZRSA 1V54C 4PDVA 3SYPA 3K08A 4PDLA 3K0DA 3TCUA 3K04A 2A9HA 2DYSC 3TETA 4ZBMA 3IFXA 4RUEA 3STLC 4MVQA 3GB7C 3E86A 2QKSA 2WLKA 3AG4C 3E8GA 3HPLC 4HZ3A 2EIMC 4WFHA 2E5YA 2V7QH 3SPIA 4X89A 3ABLC 4MSWC 2NLJC 1OCCC 2Q68A 4XDKA 4X88A 4XDLA 3SYCA 2XNDH 4WFGA 2A79B 4GX1A 1FS0E 3USSA 2HFEC 4F4LA
chains in the Genus database with same CATH superfamily
1Q5OA 3RVYA 5B1AB 1M1JC 3CLQA 1R6KA 1HR0O 2P7JA 2UXDO 2XUMA 1AI4A 1OZ0A 4DR4B 1PZQA 1KYOF 4N21A 1RPOA 2FYUH 2OCHA 3JD2A 2W6JG 2A45H 2QJPC 1FBMA 2QR4A 5DM6V 2KS1B 3ZBHA 2K9JA 1YJNP 1PKXA 3HUSA 5AVQB 1RF1C 3Q5RA 1S72V 4BW9A 5F2VO 1KQLA 3RFRA 5D5PA 3QO7A 1I94O 4NPFX 3ABMC 4JPRA 1L0LE 1AI7A 3KKYA 2UU9O 3D3QA 1JY3N 1SZTA 2JO1A 3QG5A 3LDDA 2F1MA 3SYAA 5JJEB 2QG4A 1KYOE 1Y4MA 5EIBC 1KILA 3B8MA 2GV9A 1JOYA 2N74A 1GL2A 1VQLP 2JWDA 1BE3H 1K9MQ 3RYCA 5K1XA 2Q9LA 4XBFA 1FZCB 2LO1A 3K06A 4PD4I 1GU5A 1YITV 1RH5B 1R73A 4K8XA 3ZMVA 4JTCB 1JEKA 1IURA 5CCGA 1AROP 3V5BA 1LTJC 4TLFA 3ASOB 3ZHRA 1EZVE 4O4JA 5A2QN 3A7OA 4B3MB 3L4FA 3ZX6A 1JY2N 3CCQV 1XMQO 2QE7G 4UCTA 1DEEG 3RBXA 4X1YA 1D5NA 1IFIA 1AP5A 1TUBB 5L8RJ 1R5SA 3ZHSA 4FK5C 1EBOA 4UV9A 4WF9V 1LT9C 3AK3A 4BAYA 1NH2D 2DW3A 2FFDC 3OMAB 4H0LC 1JY3P 3FAVB 3ABTA 2L6LA 1N73A 5HFMA 2E76D 1LTTC 2BCCH 1KC8Q 4W4KA 4DV6B 4R50A 2ZYGA 3M91A 5B3SB 4CH4A 4NB5A 2ZJSE 3PP5A 2YIAA 2FKWB 4LNUA 1ZLZA 4DV5B 3UT5B 4TUYA 5L3FA 1X59A 3ABVC 1SS1A 3L70J 4ZBMA 3STLC 2LW1A 4CS4A 1WA8B 1JTHB 2OYIC 3A0BH 5D5QA 1VQ4V 1EDIA 3P3NA 2Y0IA 2NPSA 2YI8A 1SQVG 3SYCA 4IL6H 2GA1A 2WLLB 1AP6A 3BCCH 1DD3A 1H38A 3HKDB 3JASA 1R6TA 4JYBA 3CWBH 2F23A 4IGGA 2Q5ZA 3KDPB 2CTWA 1N7SB 5APVA 4I55A 1SQPJ 4GKJB 1SQVD 1VQ6P 4JYYA 2W0XA 1RY3A 4DV2O 2OARA 1RSOA 1HUCA 2Y4UA 3AE5C 3KG2A 1EZVI 3L73J 4OXSA 4GYCB 4AQYO 2G3AA 3ICXA 3Q4HB 3MGNA 5H2FH 5KLVE 1K33A 1QEXA 1Q81Q 3RWRD 5AVXB 4NR1A 3FD9A 1OCCB 2E74C 1FZFA 3ASNC 1OMIA 2AXCA 2N1TB 3GVMA 3AEAC 1IFDA 1AR5A 1YTZI 1PGJA 1M1KQ 5EZYA 1SQXK 2FXPA 3IAYA 4JI6O 2OQQA 3F5HA 2WMMA 1XTGB 2FXOA 3FB5C 1NR7A 3L71H 4B3SB 1S2EA 1NTKH 3RK2B 4RESB 3AEGC 2WA4A 5BR8B 2IJIA 4HYOA 2PFXA 1SQGA 5LGTA 1SFCB 3P8CD 4LR3A 2PY5A 3CL3D 1SRYA 1M1JA 1MKMA 2Y69B 3OTOB 1K92A 3KCXA 3CP1A 4DW0A 1OW7A 4O9BA 1R3KC 4PJ0H 2ZINA 4PI2A 5GONA 1RF0A 4ZMDA 1EDKA 4PD4H 1G1JA 5CJ4A 2VQFB 4PA4A 5LYJB 3C9IA 2IDBA 2JVDA 3SFDC 5GTHH 3R4YA 5CA1B 4TT3G 5CBNA 3LDCA 5BVZA 3CCVV 1CXZB 1N36B 3SPCA 4LBEC 2Q73A 5CHXA 1KUQA 3AG1C 3HE5A 1Q2NA 5LP6C 3T1YB 4WWIA 2YXQB 3H1LD 4EIJA 4FPPA 3GF7A 1ZLLA 3RYFB 2LP7A 2P06A 2ZAEB 1GK4A 2P2UA 2DJVA 2AXTE 2XT9A 4JI2O 3FYEB 3UM7A 1EXIA 2DQ3A 3NR7A 2QSAA 3HKEA 1TA8A 3MDSA 3K08A 3JSVC 1GW3A 5KTBA 1F23A 2IBZD 1S3JA 3QO8A 5JVDA 2E5YA 4JI8O 3CX5H 5GTIE 4HH2A 3AK1A 4XE5B 4YY3B 1LTJA 1MNGA 2NLJC 3BVOA 4AUWA 1MFZA 3HUSB 2XHBA 1U97A 3OJAB 1Q7YW 4B7EA 1AQ5A 2P4KA 3ZIAG 3H1JG 1NTZJ 3H1KJ 2DW4A 1KKDA 4IFFA 2IX7C 4FFKA 2E76C 5APTA 3CCJP 5BMVB 2R5DA 3F7VC 2BTQA 1VQNP 1KYOH 3IAOA 4N78D 3H1JD 3CC4V 4C46A 3RK2D 1AB3A 3CMEV 1KILB 2Q6AA 4EB6A 2WPDG 4U7NA 3HR0A 1SFCD 4JYAO 2FFDA 1U57A 1VQ5P 1R3LC 1GL2B 2E75C 5J2UA 2F93B 4F6EA 3RYCB 1X22A 4RAIA 3T1HO 1K7DA 4LC1A 2ITDC 2ZE5A 1S4XA 2OIEA 3JAKA 3HD7C 4UB6H 1VF5C 2R70A 2Q7GA 4CS2A 1T8ZA 2PP6A 3O8ZA 5LHIA 1BSNA 3SPGA 4I5SA 1EZVH 1PPJG 4O4JB 4Z1MG 2SPZA 1Y74A 3J81N 2CDYA 1IFMA 1GK6A 2W6AA 4WY4C 1Q43A 1X9VA 3K5BA 4X1YB 2PI4A 3OW2U 2DN9A 1AVOA 1P84F 4Z1VA 1BCCH 1PPJD 5CBHA 5B66E 1FZGA 5LOVB 2YXRB 1ZWIC 1SQQG 1VQKV 2ZXEB 1YYCA 2JR8A 1K4DC 1MFTA 2A06E 4G27B 1SQXJ 2POHA 5APQA 5JWPA 3A0BZ 1NU1G 3PH0A 1VQMP 2JJ1G 1SQQD 3E35A 1U96A 4IL6Z 4X64B 1N73B 1KB9F 3B40A 3KZIH 4RWUA 1XL6A 3DXRA 1E5WA 4RUFA 1CPYA 4LFAO 1Q6HA 4I1LA 1NU1D 2M3BA 1P84E 3ZS8C 2QA4V 4BWAA 1RFYA 4LFCO 4H44B 4LNUB 3BA9A 1GKFA 4TUYB 2UXCB 3V4WA 4D6TE 2M8RA 5KMGA 1OXZA 1RP3B 2RNBA 3ZN1A 1NTMG 2KXPB 5KAFE 3VQYA 4NXNO 5JQGA 2NPSB 3OGCC 2YC0A 3S3WA 3K5OA 1PP9H 2XZRA 4B3TO 1KB9E 5H2FZ 1XMOB 4JI7O 1NI8A 5FPRA 4LF5O 1YJNV 2XTAA 4RQEA 3SYPA 3JASB 1KILD 1NTMD 1F51A 1SQVK 2ZVOB 2ZIMA 4I55B 4DUYB 4TQDA 1GL2D 1W2EA 5B1NA 4DV4O 1RSOB 3UQ8A 5AW8B 3AE3C 4X89A 2BE3A 4GKKO 1OHHG 4BIZA 2A79B 1PIXA 2P58A 3HKBA 4KJMA 2Q9IA 2CH7A 4BWNA 2B1GA 2UWJE 1VQLV 3G6BA 2FYUG 1SQBE 3U1AA 2A45G 3SR2C 5DJUB 4W7YA 1QVGO 1KP3A 3BVHA 1WP7A 3AEBC 3L74H 2NNUA 4PDMA 2L35A 1SZXA 3CCQP 2IBZI 3L35A 4PJ0Z 4I6MC 2HR3A 5LP6A 5EZYB 4H13C 5IY5C 2Z4EA 3WU2Z 3IFMA 1NVPB 2KIKA 4AI8A 1GZLA 3A0HE 1H2GA 3AG4B 1BHAA 5GTHZ 3VQVA 1MV8A 3A2FA 4DJGA 1FDOA 2X6CA 3ABKC 3TSIA 3CC7P 2Q3EA 4R4MA 5KLIB 1FJPA 3NXSA 1P84I 1MSDA 1NJIW 1XEQA 2EJ7A 1DD4A 1OFCX 1M1JB 1KKCA 4LH6A 1BE3G 4DR5O 2CTRA 1AVYA 1KV4A 2AHZA 4FFBB 1SA0A 2AEFA 2XAFA 4H44D 4BRYA 1GMJA 5H9CA 4NPEA 1Y66A 5GONB 3EXAA 3WMM0 5CCHD 1M90W 1QU7A 2QJPB 2KLVA 3VN0A 3B4SA 5KJ7D 1HVVA 2VRSA 1V55C 1BE3D 3WFVA 1KB9I 5CBOA 4GZRB 3M0DC 2W90A 3ZN0A 1TU3F 3L73D 3CRRA 3HE5B 4UFZA 1KTMA 2CPSA 3C1LA 1GN2A 1RQUA 1MZEA 4Z2WA 5EBMC 1H8EG 2KS1A 1ZXGA 3CJHA 2AXTH 1F4MA 3GWOA 5FL7G 1O9GA 2QWNB 5B1OA 4O2AA 1I5XA 1DIPA 1AR1B 4JI0O 3HKEB 1ZSPA 2ILMA 5AW4B 1P7GA 2MW2B 3N27A 5GTIH 1S5LE 5JVDB 3V2PA 4Q20A 2YNYA 1VQ6V 1PV0A 2YXHA 1LTJB 1MG1A 1XDCA 1XILA 3CCLP 2BOBC 3L70E 4WY4A 4GOFA 3ZRSA 3ABUA 3MZWB 1VEWA 1X0TA 3S9OA 1K97A 2R5BA 3AE7C 3B5NC 2A3QA 3G4SP 1HNXB 1FXHA 5KA5A 1NVPD 4MVQA 2ZM6O 3E8GA 2BTQB 2EIMC 2AZ0A 3BHPA 3V2NA 4ASWA 1Q82Q 4XDKA 2OIGA 1GM9A 4FLTA 1USEA 4EB6B 1NHLA 1ZOYC 2FFDB 1FS0E 3CWBG 3OW2O 4H0LB 3LIEA 1YHQP 4O2BA 5J2UB 1SQVJ 3RYIA 4YJ2A 1SQPE 4KL1A 4MTOA 2WSCH 4B7KA 3CC2P 4OH8B 3JAKB 3OE7G 4MVZA 3E1IA 2CTQA 4K0KB 3CWBD 1AFOA 2FKXA 1N33O 4G2KA 3FXEA 4UB8E 4X1IA 4YIPA 1L0NG 2Y0DA 1Y74B 1BDCA 1SC5B 4ZKPA 3LDEA 5EK0A 1GRJA 1IBLO 1K8AQ 3EWKA 3CCVP 1AILA 5B66H 1RE4C 5C39A 1YI2V 1S76D 2YI9A 1EFRG 1L0ND 3W7TA 4JI3O 4LF8O 4HBNA 4BIOA 4GUNA 5EIBD 1PV3A 3L71G 4K35A 2P90A 2WLIA 4X62B 1NTZD 3H1KD 1SQQK 3CYOA 4LP8A 1NTKG 2IH1C 1JFFA 1EN6A 2YXLA 2ZKOA 1SLQA 3DXRB 1NU1K 1EDJA 2X7RB 3OR7C 3L71D 1FXKA 2ARHA 3O9OA 3BASA 4D6TH 4KHPO 1OZHA 1NT2B 2ITCC 2UUBO 2QKAA 5KMGB 3W7UA 3JYCA 5ITZA 4N3YB 3CRAA 3WG7C 1AR4A 5KAFH 4DRXA 4JI8B 2WT7A 2QM4A 2H94A 2PAJA 4LGDE 1DH3A 5JQGB 4NTWA 2EILC 1URFA 4DR7O 1HP8A 3CEIA 1LTIC 2WPRA 5KKZB 4MVSA 1KECA 2EULA 2OTLP 1BGYE 1NTMK 4DR6O 2R32A 4J9YB 4GLXA 5E79E 4H0LD 3CC4P 3VP9A 3TK1A 4UCVA 1JCHA 2JGDA 3CCJV 5EBLC 4PV1D 1VQNV 4FMTA 2LFSA 2B87A 1S9KE 2WTYA 4J7JA 2Q0AA 3E8HA 3HKBB 2ZNJA 1JR9A 4YTPC 1K73Q 2CH7B 3W7XA 1SQBH 1ZW0A 3AECC 1GDTA 1VQ5V 1FKAO 2A9HA 3JCUE 4J7ZA 2JRIA 3M0DA 5JH7A 3M9BA 3OA7A 3K3WA 1HNZB 1CZQA 3UO2A 4DR3B 5LMUB 3CX5D 2QTSA 1FZAA 5LP6B 4WFGA 3A0HH 2MKVA 2O01H 3H1IG 2ZIOA 3V2RA 1VQKP 2KG7A 3AG7A 3AE8C 3H1JJ 2V1DA 4NXMO 2KZJA 1Y67A 3CCUP 3RVZA 3JALA 1BQ0A 2LR2A 1WMKA 3H1ID 4IL6X 3CXHD 4LCUC 2HG5C 4W80A 1FJGB 1SA0B 2JJLA 1R3IC 4OX9O 1ENVA 4BRYB 2AXTZ 3JSNA 2IZ1A 5AVYB 4EOTA 3ZMZA 1VQMV 4X65O 1AJQA 2E74D 2DWDC 3CPWU 3LNMB 2YDEA 2LGQA 5AW7B 1F4NA 1N34B 5IYDO 3CD6V 3B5NA 2M6YA 5GTIZ 2E76B 1XNQB 1QLED 3D3IA 3K5NA 2WPSA 3AE6C 1BCCG 1SS3A 1N32B 3OUFA 1Q8IA 3ZEDA 4TWKA 3CJHB 2EBOA 4P9PA 1SQXE 2Z5UA 4NXNB 4J11A 1UJWB 4O2AB 3OAAG 1VP7A 2M7WA 2UUAB 4JAVA 2R9AA 2RCVA 1BCCD 2D3OW 2PF4E 3DC5A 1SQQJ 3SSUA 3C3SA 1H2KA 4X66B 3M9HA 5BMVA 3D71A 3LSUA 3OFNG 4GOEA 1S77D 1VF5B 2X6BA 2KSEA 3G3ZA 3MP7B 1NU1J 5KAIE 1GK9A 4UCUA 1GU4A 1FDMA 3WB0A 3TGUE 4LF4B 1GM7A 2K9YA 4R7CA 2P22C 3ZJZA 3GWKC 4WY4B 2QWRB 3LNNA 1KQFB 4TOIA 3KHUA 2HHHO 3VQWA 2B88A 2ITAA 3AE9C 3SJQC 4PELA 4IHJA 3ZCCA 2BTOA 2B89A 2ZYDA 3SPJA 1USDA 4XA4A 1PP9G 4JYCA 1YSCA 3OMNB 5LGUA 5LHHA 3K9AA 4LLHA 3PJSK 4U3FG 2VQEB 1YBKA 2C9LY 2FYNC 4M3LA 5FNVA 1NTMJ 2YKPA 1DLBA 4GX0A 4IOIH 4I9WA 2J59M 1SQPH 3SJBC 4O2BB 4L8JA 3B2EE 4YJ2B 3RYIB 5B66Z 1PP9D 3K04A 3RK3C 1K9MW 1LT1A 2WPQA 4U3FD 5LOVA 4Y28J 1FD9A 2ZT9C 3E86A 2QKSA 1IBMB 1Y76A 3VBBA 4UB8H 3CC7V 3FX7A 3BABA 4X1IB 3K79A 5AVVB 1VL2A 2GSMB 1M9NA 3CRMA 3IN6A 5IYZA 1HJBA 2QRXA 4DR1B 2DYRC 2YMYA 4PV1C 3L74G 1Q86Q 1L0NK 2YO3A 1N86A 2FYUJ 3L9DA 1VQOP 5CB4A 1K5QA 5CCHA 5IWAB 1NO4A 3G9RA 2CPBA 1Z2GA 1NTZK 5IE9A 5KJ7A 2UXBO 2WLIB 5KUMA 5KAFZ 3L74D 4UVAA 2QGNA 1E79H 2E75D 1JFFB 1E1QG 2R9IA 1FZEA 3VYIA 4JASA 3AK2A 1WAZA 1QVFU 3HD7D 2QM8A 1YIJP 1UIXA 1VF5D 1FXKB 1JY2P 4LF7B 2PYLA 4UV8A 1KC8W 1JM0A 4O4LA 1OW8A 3P32A 4J41A 2WZ7A 4X1KA 3VOUA 1HWTC 1MZFA 1VF6C 1YZBA 4MTXA 2UXXA 4PDRA 5ITZB 3BATA 4WY4D 1KQGB 3RGUA 2YKQA 1BE3J 3SJAC 4LF9O 1BHBA 3A3YB 4DRXB 2WT7B 3D36C 3E83A 3MHVA 5IYCO 4BR6A 1BGYH 2VRZA 3SWFA 2WSEH 3CCLV 5E79H 1QR8A 3H1HH 4LFBB 2Y9YA 5IT9N 3ABKB 4ZHQA 4AHCA 4E4EA 2BOCC 3G4SV 2JGDB 3A0HZ 2RDCA 2B87B 1QLEC 2H89C 2P1JA 1J5EB 1LUVA 4I7ZC 1XNRB 1JOCA 3M06A 4DV0B 2JIZG 1IBKO 1GMGA 1YHQV 1IFJA 3F89A 3JCUH 3L75G 2HPCA 1FOSF 3GMAA 1V55B 1Q81W 4ABMA 4EKWA 2HVKC 1GW4A 5JH7B 3CC2V 5APYA 4MTGA 2UUCO 2AZ2A 2IU3A 4FFBA 3M0AA 1MA1A 1YVWA 2Y0PA 2QVAA 3L75D 1M8OB 3WU2H 2FY8A 1M1KW 4NVPA 1YI2P 3CPWO 4D7SA 3KCYA 1VIBA 2KG7B 4DT0A 1QLNA 1G2CA 1RF1A 4FM0A 5JCOC 3JALB 4CS3A 1T5EA 1WT6A 1FOSE 3C90A 1WLEA 1MOFA 1WJZA 2DMXA 1SQVE 3ZRWA 2QJYB 3NMDA 1PL4A 4JI4O 3CHXA 4F4LA 1XQ8A 3CI9A 3QO5A 2K9PA 1FPOA 2XV5A 3CWBJ 3T4DA 1LTGC 1G4YB 1L4AC 3BEHA 2P7TC 3VQXA 2WA3A 1FAVA 4J7KA 4DR2O 4BW5A 1JMBA 5CMZA 2ZXWC 1S5LZ 1KBHA 2EIKC 3B5NB 3S3XA 4B3RB 4H13D 3PTZA 4EFEA 2UUBB 1Y9BA 4GDOA 1N8RQ 2LJ2A 5EC1C 1L0NJ 2EIMB 3WB1A 2JS5A 4C7RA 4EI2A 2WVRA 4EYYQ 3K5LA 1YJWP 1NYHA 1LP1A 1YCIA 1W2BU 3OEEG 3L72G 1L0LH 2LQTA 3K0GA 2PYJA 4I9QA 4WBAA 2OTLV 3ZHTA 3P8CE 4AYCA 4JI1O 2E5LB 1KQSU 1K34A 3N2KA 3L36A 1XL4A 5KAIH 2YS8A 3L71J 4KHXA 3L72D 1LT9A 3X2QC 3TGUH 1NTKJ 3F5TA 4MW8A 4D6TG 1T2KC 1RQVA 3RL0g 1JMKC 5B1AC 4DUZB 3DSQA 3KQGA 4BIUA 4CZZA 2EJRA 1FXVA 2QKCA 2JP3A 1L8DA 1ZRTD 5L3CA 5LMNB 1Q6IA 2FL4A 4UB8Z 4IHJB 1VQ9P 1N0NA 1TVKB 3E8BA 3H1LE 5CJ0A 3APQA 4DZOA 1CW5A 1EZJA 5FNVB 4DV1B 2OYIA 4GT1A 2G38A 2ZNIA 4GIFA 1FZBA 2KQXA 3SYQA 2K3RA 1Y76B 2AEMA 1R3JC 2MJZA 1B06A 4FZ0A 2WSSH 3SFEC 3CCUV 4JI5O 4DXWA 2IBZE 1AJNA 4DV3B 1SQBG 4ASUG 4ZI7B 3WG7B 1HGVA 2P67A 4YHHB 4NPDA 1ZV8A 2BEZF 2IFMA 2F4VO 5IYZB 4PDLA 3B5ND 3D36A 3CCMP 4X65B 1E1RG 2EILB 3CD6P 2Q0OC 3TXQA 2V7QH 2RKLA 5CB4B 2K1AA 4FM2A 1LR1A 1HR0B 2KNCA 2XNDH 5JJJB 2UXDB 4L75A 2ZQMA 4N78E 3H1JE 1IX9A 5AW5B 4DK0A 2ZXXA 2JS3A 3C3TA 3E1RA 2W0FC 3GG2A 1FFXA 3TJTA 3H1IJ 4FIPC 1RE3C 5B1BC 1SVFA 2Q8VA 1X4TA 4N23A 4O4LB 5E79Z 2KB7P 4X1KB 3NTNA 1I94B 1Y8AA 4MS2A 4DR4O 2FB5A 2M5AA 2UU9B 4CPGA 2ZE7A 1OX3A 5TISE 4IYIA 1B04A 2CK3H 1QHTA 3EFFK 4PA9A 3SJCC 1JY3O 1GO3F 1IJDB 2RQ6A 4H33A 5KLVH 4KXRA 5L3BA 3JCUZ 5HFLA 1PPJE 3IC7A 1P4RA 1FYJA 5JCOA 4ZHQB 5AG2A 3B09A 4MVMA 1BCCJ 2CGNA 1G8MA 1XHXA 1SF9A 2FYUD 3PLNA 2Q69A 2Q7EA 1OVUA 1IFPA 1SQQE 5LA6A 4HJGH 1M56D 2J5UA 1XMQB 3JCZA 4W4LA 4RKUJ 3D6ZA 3V2QA 2HVJC 1JY2O 1NU1E 2HPCB 3QTCA 5BU8B 3HKCA 1EDLA 4JV5O 3Q3DA 4B3MO 3EFGA 1FU1A 4IT5A 1A32A 2HP8A 4WB4A 3E7KA 3G67A 3KXDA 1XTCC 4J9ZB 3RGBA 3ZHQA 1EXJA 1VF7A 3AE4C 1G2CB 4I0XA 2L5GB 1RF1B 2GUVA 1FS0G 1KILE 1TAEA 1NTME 3C8VA 3A5TA 2KB1A 3DTUB 5KUKA 2WSFJ 3ABMB 1EC5A 3ZRWB 1VQOV 1YQ4C 1PP9J 2P6JA 1NH4A 5IJ0A 4U3FJ 1PNKA 4MVRA 4A5UB 1VMGA 1COWG 5CA0A 4DV6O 1D2DA 3TYYA 4JQ0D 4I50A 2QWPB 4DV5O 1KN7A 1YIJV 2LFRA 2Q68A 3WUTA 4X88A 3UCSC 3HD7A 5KAIZ 3S4RA 1LWUC 2BCCG 2LKMA 1KORA 2PRRA 2ZDIC 2YKOA 4DV2B 2EIJC 4EFBA 3ETEA 1PGQA 1BT8A 4GCZA 2FXMA 4MVOA 2EZOA 2FYNB 4NYKA 1LP1B 4AQYB 3L74J 2BCCD 1ORQC 1E79G 1WPBA 5KHIA 2OYQA 2RH0A 5C93A 3FX0A 4GKJO 2HG5D 1JCCA 2KSJA 4HKZH 2V4HA 3N2KB 3ZHVA 4UCOA 4CBCA 2H88C 1LT9B 3BCCG 1KP2A 1R6NA 2H8PC 2WLMA 2PI5A 4Q6GA 4JI6B 3PRJA 1X79B 3E22A 1I5YA 2AHYA 3RBZA 5BZBA 1BE3E 1G1IA 1IFNA 1KFMA 2DYRB 4PV1B 3BCCD 1H2SB 1QQCA 3L73E 3CCSP 3ZHUA 4LWSA 3H1LH 1JX9A 3D70A 4UVCA 1BGYG 4TT3H 3FXDA 5AVWB 3HUSC 3VMXA 3M99B 1Q82W 3J80N 2OYIB 1OCZC 3H1HG 4GX2A 3FGAD 3O65A 1W0KG 1IVSA 3R65A 4ZOLA 5BR8O 2IZ0A 2A06H 3CRCA 1Z5WA 4O4IA 3JC22 4WCEV 1O9HA 2IBZH 4FLZA 3MAQA 1ZP0C 1LJ2A 2K88A 3H1HD 3H32A 5M1BA 4J10A 5BU5A 1OCOC 1LTAC 2W6IG 4JF7A 2KK7A 2VQFO 3VOPA 1I08A 2H3OA 2X0LA 1AV1A 4X9QA 2A45I 1NGMB 2XAGA 1P84H 1N36O 1K8AW 2E42A 1N4CA 4JI2B 1L2PA 4JBZA 4JGSA 1G6UA 1NTKD 1M56C 2PGDA 1TGOA 3L75J 1URQC 4EEQA 2DE0X 5CCGC 3T1YO 3AEFC 1J1EC 1KD1Q 1JB0J 1ZAUA 2E74B 2KNCB 3FFQA 4RO2A 1MMMA 3B71A 3G71P 3ASNB 1JJOA 3H1JH 5H5NA 2I8DA 4ZKUA 5APUA 1N7LA 3B8NA 4PDVA 1JQ0A 3RL0C 1UIIA 3JSLA 3RK3D 1KB9H 4U3JA 3FWLA 4RUEA 1FFXB 3MD0A 4PD4D 2ZT9D 1QLEB 2AGAA 3LW5H 2HYNA 1SETA 4HZ3A 4DCKA 4I7ZB 5IYBO 3SPIA 1YJWV 2RN0A 1GD2E 2M5AB 4TV9A 3CWBE 1K3EA 3EHBB 4OGQC 5TISH 2HFEC 2KKWA 4NKGB 1J95A 3CCEP 3BAAA 4P2ZA 3VP8A 1KFNA 2WSCJ 1N73C 5DECA 4QGPA 1NS1A 4JZ2A 2P4VA 4JYAB 1VDFA 2HLOA 4CC5A 4YXWH 4Z1MH 2ETNA 4TQFA 3T1HB 1L0NE 1MZ9A 4RQFA 3RYHB 2QJKC 2KI7B 1BQZA 1WB8A 5CBFA 3AG1B 2FYUK 3HE4B 1XI1A 4WVZA 4KP4A 1VQ9V 2WWWA 1NTZE 1L0LG 2NPSC 3H1KE 1SERA 3IGAC 3JAMN 3K57A 4X8AA 3FB8C 2KSDA 3LIDA 3CMAV 3UO3A 5LA6B 1ZR4A 1KU9A 2C2AA 2QTOA 5J2TA 2HLDG 3L72J 2C0XA 1K73W 3OT7A 2IU0A 1L0LD 2HEPA 3TGUG 2GDSA 3I56V 3HKCB 2EZPA 3P30A 3IR9A 4GODA 1QX8A 2OYHC 1H0TA 4OPAA 3QH9A 2N05A 1KYOD 2EIKB 3CRQA 2R9RB 2XAJA 5LL6Y 2OT5A 4TSFG 1XUQA 1LWUA 1Q3EA 3TGUD 5EC2C 4D6TJ 1RHZB 3BY6A 1J2JB 2ZDIA 5LXTA 1YJ9P 2FBWC 2OTKE 2ADQB 1EZVG 1H8AA 4I0XB 3G6EV 4LFAB 3CCMV 2OCCC 2IJKA 1N2DC 4LFCB 2YIUC 2EINC 1M57C 5FPOA 4MTFA 1S5HC 4NTXA 3BRTB 3CX5F 5IJ0B 1EZVD 3BA8A 4X64O 2LXCB 3D6YA 1UPGA 3X2QB 1MUUA 1WNSA 5CA0B 2G8YA 4QMAA 3OTFA 1IDSA 2X6AA 5KLIC 4I50B 1MSWD 1IZNB 3QNEA 3P8MC 2GHYA 2E75B 4YJ3A 1WB7A 4B3TB 2UXCO 4JI7B 4LF5B 5EYPB 2GM4A 1W0JG 5C8YA 2JGUA 2XOKG 1S5LH 3HD7B 2CTPA 3AEEC 4KT0J 2Y9ZA 3JATA 3CXHF 4PA3A 2DWEC 1SQBJ 2IFNA 1RF0C 1H88A 4LF6O 3CX5E 4AQRD 2V7QG 4DV4B 3K0DA 2RMZA 1HNWO 5H6QA 1AI5A 2B5UA 2DYSC 3L70H 1XMOO 4GKKB 3OEHG 1P49A 4B08A 3HPLC 2XNDG 5B5EE 5DN6G 1VQ8P 3G80A 2JKVA 4DUYO 1RE4A 2HODB 2GUSA 3ZMUA 1ZMEC 2O01J 3W68A 3ETDA 3PHLA 2Y0CA 3H1IE 2F43G 1TVKA 2KUBA 3V6IA 2Y48A 3CXHE 2JJ2G 2GTSA 2NZ2A 1L4AD 1WP8A 1EM1A 1NKDA 1PM9A 1GN6A 3AE2C 1B3QA 3NFQA 2MK3A 4WFBV 4WFEA 4HNAA 1LTBC 3E22B 3DGEA 3R66A 4P30A 2W83C 1YTFB 1LUWA 2CK3G 3L73H 1Y47A 2IM9A 2N9YB 1AJPA 3ZMSA 4DV7O 1LTSC 4UB6E 2RN9A 2D2CD 3T1CA 4LWSB 3JD4A 3BPZA 1URQA 5KLVG 2W27A 4U7JA 1ZTEA 2CUGA 4JV5B 2ZYAA 4DR5B 4ZI7A 4JTDB 1A02J 2QEXP 2VWKA 4JTAB 4GX5A 2ZCEA 4MW3A 1DK1A 2OWOA 3O6QB 4IIJA 5KLVD 3BRCA 4ZOLB 5AW0B 3T4ZA 5AW3B 4QJFB 4GKGA 1ZR2A 5B1BB 1BCCE 4O4IB 2OGUA 1DX7A 3JD0A 2JDIH 3H32B 2ZFCA 5KHGA 2GTAA 2DOSA 1T2KD 2B9ZA 3Q5SA 1JNMA 2E5TA 3RW0A 1L1FA 2WLHA 3CX5I 4L74A 3I55P 1Q90D 1NTKK 3KZIE 4B86A 1CI6A 3N4XA 3AG3C 4EDFA 3WUVA 1YF2A 4MVUA 1Q86W 2C0WA 3T97B 3Q5PA 1YTZT 4JI0B 2XKMA 2ZD9A 5TISZ 4CH6A 3F7YC 4IFMA 4DOJA 1FFTB 3CXHI 4NTYA 1KYOI 1JVMA 1WPXA 2N04A 4H13B 4U3JB 5IY5B 1H2LA 4JPZB 3L37A 3LUTB 1GH6A 1SQFA 1PP9E 1VARA 1FDIA 3RN4A 4QE7A 4U3FE 3FKSG 5E1AC 3TNUA 4TV9B 1BSMA 3OUSA 1V54C 2ZM6B 2OYHA 4RJTA 1HWYA 1YTFD 4WBNA 4FLYA 3OM3B 1NVOA 5KHHA 3CXCU 2YIBA 1BS3A 2XDJA 1HNXO 1L0NH 3ABLC 2GUZA 4MSWC 5AW2B 3AEDC 4ASVA 5CN0A 3U10A 4FLWA 1AI6A 1NTZH 3MHSC 3H1KH 1S5JA 2ZR2A 2BCCJ 3CCSV 1N33B 2ZVNB 3L74E 4L87A 3U59A 3ETGA 5KKZC 2ZE6A 3DC6A 1K04A 5AVZB 1JCDA 1OV9A 5BY1A 4K3AA 5J2TB 1H89A 1L0LK 1IBLB 4K0KO 4ZIBA 1I0HA 3GHGC 1IC2A 1OCRC 3A8TA 1H0TB 4JI3B 1RM1C 4LF8B 2QSIA 3VMAA 2JEUA 4UUJC 1QVGU 2JWAA 3MTUE 4F6RA 4FLXA 1IK9A 3OGIB 1QGKB 3BCCJ 2QM7A 1HGZA 1LWUB 1Y6XA 3PN1A 2Q1KA 5K1PA 5LXTB 3ZDMA 1VQ7P 2EIJB 3H1LG 1PL5A 1IO4A 2NRGA 5AW6B 2FYZA 5KX5A 3HTKA 3P3PA 3IF4A 2PZSA 3V4QA 2FTKA 5IDJA 4X62O 1XOUA 4KHPB 3II6A 1IXBA 3F5WC 1BGYJ 2H7HA 5GW7A 4TV8A 2D2CC 2WSEJ 4QE9A 1XBLA 3G71V 1Z5VA 2PUSA 2A06G 2XASA 3AG2C 1SQXH 2R72A 2ZR3A 5LBQA 1Q7YQ 1N7SD 2VWJA 2IBZG 3H1HJ 3HB3B 5AVRB 3EQ2A 1LGHB 4DR7B 4YJ3B 3APOA 1J1DC 5K5GB 3I5CA 3VTPC 2A06D 5C8YB 4DR6B 1OVRA 2KLUA 3JATB 2QWQB 2IH3C 4Y99C 2YEVA 4UXNA 3ML0A 5DEDA 2BASA 2Q5UA 4FLVA 3K5MA 2UXNA 1K05A 3QWOC 1N8RW 3FB7C 2K9JB 3CCEV 3L75E 2O01N 3MUDC 2LXBA 1HBWA 2N1TD 1US6A 3R2PA 5B5EH 3CCRP 2CGOA 1OCZB 2Q4PA 1DGSA 1P84D 2WITA 1K4CC 2QJ1A 1YDXA 3S1KA 3E89A 3GLMA 4D6TD 3LSQA 1VPCA 1H2MA 3H1IH 1OW6A 3A2AA 2Z0AA 3CXHH 1ZL8A 1W59A 1R1BA 1FJKA 4CC6A 3CMAP 3IFXA 1OCOB 1DF4A 1XHZA 5H6RA 3GB7C 3AEIA 3E2EA 2OTJP 1KB9D 2XAHA 1S0VA 3I56P 4HNAB 2IJHA 3D8CA 1IK7A 3USSA 1JJ2U 5KHJA 1HNZO 4NXMB 1X8YA 4DW1A 4DR3O 1M56B 4PA6A 5LMUO 1URQB 4AILC 4ZKIA 1VQPV 1NKZB 1VF6A 1J1EB 3WUUA 4YXWG 1BMFG 1OWAA 4HB1A 1HF9A 1M5IA 1QVFO 2YMKA 2XNXA 4OX9B 4KFMA 5KLVK 3G6EP 1FZCC 5AVSB 3RL0B 4IIJB 2YO2A 5LGNA 3THOA 3N2GA 4DYLA 1SQBD 4X20A 2W6JH 1YJ9V 3N7NA 1GTOA 5APWA 1ZUQA 2AW9A 3ASOC 3U0ZA 1MABG 2O3JA 2P10A 1FJGO 1HJ0A 4J42A 2H8PD 1EN5A 2C9NY 3L72E 4OGQB 2YSUB 1L0LJ 3ZMTA 3JAWA 4OWFA 3UKMA 4O4HA 2Z3YA 3EVKA 3VMZA 2IW5A 1WRGA 3W67A 1CI6B 3TDKA 1XREA 2E3CA 1CEZA 1N34O 3M8AA 5AVUB 5AW9B 1ZRTE 2R44A 3TGUJ 4H37A 4PHZA 2V4DA 2P5OA 3OR6C 1PGOA 1XNQO 2O1JA 3LSSA 3WB2A 2Q6QA 3JD1A 2QJKB 1N32O 4CH3A 3IJ4A 3AE1C 1QNMA 1HTLC 1S72P 2WSFH 4LF6B 3U1CA 5B3SC 2UUAO 1HNWB 3UIAA 5IJ9A 3H9VA 4U3FH 2WLNA 3SGIA 1DF5A 1OIPA 1RPRA 1YEWA 4X66O 3RYHA 4BXLA 4JAUA 3TNUB 2QE7H 1VQ8V 5LHGA 3K03A 2HHHB 3GHGA 2YIDA 1W5CE 2E43A 1YQ3C 4C7NA 2Y4TA 3HE4A 2OYHB 2WAMA 1EN4A 5L3DA 3H6PA 4LF4O 4WBNB 5AVTB 5J9PC 4UVBA 3JARA 1PD3A 1FXKC 4J80A 2Q3IA 1URQD 2NN4A 3K59A 5CCGD 2R3CA 2YXYA 1YITP 2L91A 3M9QA 2GUZB 1N7SC 1L4AA 5L3EA 1U7JA 1NJIQ 4G28B 1T3UA 2AEJA 4PI0A 5JJNB 5TJHA 2KYVA 3L70G 3CB2A 2OCCB 3RL0D 4DV7B 2ADPA 2VQEO 1B6QA 2QWOB 3TCUA 3U11A 2EINB 1M57B 1NKNA 2M3EA 4JAAA 2M0BA 3TETA 2YIUB 1NOHA 4I2LC 5EFWB 1NR1A 4JF3A 2V7QJ 1M90Q 2CAZC 2WLKA 3L70D 3VMYA 2QEXV 3FWNA 1NBMG 5KHKA 1OCCC 2WPVB 2GBOA 1IBMO 4OGQD 1A02F 3H01A 2HFED 2N1TC 4HYTB 4UCSA 1SQVH 1JMMA 1SQPG 1GAXA 4F6RB 1SP4A 1IXMA 2UXBB 4QNHB 4R4LA 5APXA 3L73G 2I1KA 1CP9A 4DR1O 1W2BO 3QF7A 3ZRVA 4DK1A 3RK2C 1SQPD 1H8HG 2O1KA 3K58A 3TF5A 2DYSB 3MUDA 1GN3A 2BSKA 2HJFC 1SFCC 4I4TA 4FVMA 1CSBA 5KX5B 5IWAO 3HTKB 3I55V 1KQSO 3STZC 1ZX3A 5EYPA 2Y69C 2NPSD 5CA3A 5KLVJ 1VQ4P 4TV8B 1P7BA 4LF9B 2FYUE 2R3SA 2HJDA 2YICA 3SPHA 4N6JA 2JDIG 4LF7O 5DJTB 5B5EZ 1D5AA 2PGGA 4IYHA 2K1EA 4LH7A 1JA8A 1YXBA 1BZKA 2N9BA 2HODA 3JD3A 3B77A 3RK3B 2QJYC 2YIBD 2ZT9B 2ZE8A 4FJCC 2Z5HA 3RT3C 2YEVB 2YUAA 4IFDK 3L75H 1TUEB 2NR5A 1AJYA 4RO0A 1DTOA 1KZUB 1R8EA 1NWQA 2Q7CA 4QPKA 4P9OA 5CMUA 3KPEA 1M57D 1FZCA 3Q1MA 4K8ZA 3I5DA 4LFBO 4UB6Z 1IBKB 2IYOA 2F95B 1N0JA 1NAFA 3T2MA 4D7TA 2J58A 1PNLA 1AVMA 1ZL8B 4YIOA 1KMIZ 2UUCB 4PA7A 1UFIA 3A0RA 1J5EO 1G1XB 1QBZA 1XNRO 2JEXA 4WFFA 4DV0O 4B3SO 3OD4A 3O6QA 3Q2YA 4WFAV 1BGYD 1V9PA 1GTWA 2W6BA 2RMKB 1TUBA 4UCRA 1M4UA 1RE3A 3AG3B 3OTOO 1QCEA 1PFIA 2IPPA 3B8EB 4L76A 1KILC 4YXDC 1Q6UA 1PL0A 3FYIB 2O57A 4XFJA 1OJHA 1GL2C 3MIWA 5A9GA 1JUNA 1S9KD 3FAVA 2RJZA 4JI4B 2HKOA 3KZIZ 3SWKA 1SQBK 1S5LX 4XDLA 1FE6A 1IZ3A 4OPHA 1NTZG 3N2GB 3H1KG 4GX1A 4X20B 2BCCE 1VQ7V 1FAFA 2I1JA 5AW1B 3T97A 2ATKC 4DR2B 3BRVB 1BDDA 3UT5A 2A7WA 3H25A 2WQYC 2Y0EA 1FC2C 2Q67A 2QDOA 3L72H 1WA8A 1JTHA 1Z56A 2XU6A 2IYPA 1ROPA 1PNMA 1D7MA 4QIWF 3CS5A 5BXZA 2KOGA 3JAWB 2KP8A 3A0BE 4HAMA 1V54B 1U7MA 3OAKA 4O4HB 3SDLA 1SKVA 2B1IA 4IL6E 3TXSA 4L73A 1HDJA 2WLLA 2PTMA 4ICGA 2EX3A 3HKDA 3GF3A 3BCCE 2FMLA 4B3RO 5L3GA 3ABLB 1N7SA 1BL8A 2LW7A 4CH5A 3W7WA 5KA6A 1M7LA 4JI1B 1KD1W 4YY3O 2H43A 4XDJA 3P7KA 2K37A 3SWYA 1H2NA 3Q4HA 4H44C 5IJ9B 1PPJH 3H1LJ 1AA0A 5FLXN 4OVNF 5CCHC 1BSHA 1JO5A 1M93A 4U7OA 5H2FE 2E5LO 3CCRV 5KJ7C 4KUMA 1SQXG 1QL2A 3K9SA 4ZNCA 1DEBA 3M7MX 4MT8A 3GHGB 1ZN5A 3FB6C 2XAQA 2N1TA 3H1HE 1OCRB 4C7NB 3CMEP 2Z5IA 4A7PA 1NQTA 2WLJA 3E8FA 1RM1B 1AQTA 2LGWA 3ETQA 1SQQH 1GN4A 1R5LA 2CE4A 2VS0A 3JARB 3CE2A 3ITKA 1QR9A 4DUZO 1SQXD 1LNQA 4PD4F 1HH0A 2ODMA 2KZIA 1NU1H 5LMNO 5CBGA 3L71E 1I7FA 2Q7HA 1T3JA 4QPJA 1JPXA 2OTJV 1L4AB 1NAYA 3SYOA 3OMIB 1NTKE 1VQPP 4MN4C 1SFCA 2JK5C 3ZRXA 1SESA 4FM1A 2IJJA 1OVVA 2ZXWB 4DO2A 1T6AA 1THZA 1S1CX 4DV1O 1QL1A 4JI5B 3J7AU 5EBWC 4PJ0E 2D2CB 2OYOA 3RK3E 3W7SA 3WU2E 4R6ZA 5LYJA 4JZGA 3AG2B 1WN7A 4E2LA 2F4VB 4PD4E 5CA1A 4R8CA 5GTHE 1NTMH 2A0LA 3CSXA 4W7ZA 1K5SA 3BFRA 4FZ1A 2B9BA 1J1DB 1HW7A 4DV3O 1NZ6A 5APSA 3IC9A 4YPCA 3GW6A 1EQ7A 4YHHO 3LW5J 3RYFA 2JEEA 3AG4C 4Y99B 2DQ0A 4WFHA 3MHHC 1F7YA 1SQPK 3HRNA 1GM8A 4C7UA 2QA4P 2WSSG 3KYQA 2BEQD 4FLUA 2QIWA 3QVNA 2W8ZA 1NH2B 2BSKB 4I4TB 2F66C 1PGPA
chains in the Genus database with same CATH topology
3RVYA 5B1AB 1R6KA 1AI6A 3MHSC 4MTOA 2ZR2A 3CCSV 4L87A 2W0FC 3OE7G 3ETGA 4FIPC 1AI4A 1OZ0A 4MVZA 5B1BC 4N21A 1RPOA 3JD2A 2W6JG 4N23A 4G2KA 5DM6V 1PKXA 4MS2A 1S72V 1OCRC 3LDEA 5EK0A 1RM1C 3QO7A 2CK3H 2JEUA 3EFFK 4PA9A 3ABMC 4JPRA 4UUJC 1QVGU 1AI7A 1GO3F 1YI2V 1S76D 1EFRG 1SZTA 4H33A 3W7TA 2QM7A 3LDDA 3SYAA 5L3BA 5HFLA 1Y4MA 2EIJB 3B8MA 3IC7A 2P90A 2WLIA 1JOYA 1P4RA 3CYOA 4LP8A 2IH1C 2FTKA 4XBFA 5IDJA 4MVMA 3K06A 1G8MA 3F5WC 1YITV 2Q69A 2X7RB 3OR7C 1FXKA 5GW7A 1IFPA 1R73A 4QE9A 3ZMVA 4JTCB 3G71V 1JEKA 1AROP 2XASA 3AG2C 3JCZA 4TLFA 2ITCC 2ZR3A 3ASOB 5LBQA 2HVJC 3HB3B 3W7UA 3JYCA 3WG7C 3CCQV 2QE7G 2H94A 2EILC 4FK5C 1EBOA 2IH3C 4MVSA 4UV9A 4WF9V 1KECA 2YEVA 4UXNA 3ML0A 2UXNA 4J9ZB 4BAYA 1N8RW 4J9YB 3FB7C 3CCEV 1NH2D 3OMAB 3TK1A 1FS0G 1JCHA 3CCJV 1OCZB 3ABTA 5EBLC 1K4CC 2KB1A 3DTUB 5KUKA 3ABMB 5HFMA 3ZRWB 4FMTA 1VQOV 2LFSA 3E89A 1VQNV 2P6JA 3LSQA 4R50A 5B3SB 1PNKA 3E8HA 4MVRA 3W7XA 1COWG 5L3FA 1VQ5V 2A9HA 4ZBMA 3IFXA 1OCOB 3STLC 1DF4A 5H6RA 3GB7C 3AEIA 1YIJV 3K3WA 3E2EA 1VQ4V 2XAHA 1S0VA 2LFRA 2IJHA 2Q68A 4X88A 3SYCA 4WFGA 3USSA 1JJ2U 2WLLB 1M56B 2ZDIC 4PA6A 1H38A 2EIJC 3ETEA 4JYBA 4ZKIA 1VQPV 4GCZA 4YXWG 2V1DA 4MVOA 1BMFG 2EZOA 3RVZA 1ORQC 4KFMA 1E79G 3KG2A 5LGNA 5C93A 4LCUC 2HG5C 4OXSA 2W6JH 1R3IC 1YJ9V 1ENVA 1GTOA 4CBCA 1K33A 3ZMZA 1VQMV 1AJQA 3ASOC 1MABG 1KP2A 1OCCB 2DWDC 3CPWU 1R6NA 3ASNC 2H8PC 3LNMB 2WLMA 2PI5A 2YSUB 3ZMTA 1F4NA 5IYDO 1I5YA 2AHYA 3RBZA 3UKMA 2Z3YA 5BZBA 3CD6V 2DYRB 2IW5A 3D3IA 1CEZA 3FB5C 3OUFA 1JX9A 1NR7A 4TWKA 4UVCA 2EBOA 4H37A 3OR6C 4P9PA 3LSSA 3M99B 2IJIA 2Z5UA 4HYOA 3JD1A 1UJWB 1Q82W 5LGTA 3OAAG 2M7WA 4JAVA 1OCZC 4GX2A 1SRYA 2D3OW 2Y69B 1K92A 1W0KG 3CP1A 3R65A 1R3KC 5B3SC 3OFNG 1S77D 2X6BA 4WCEV 2WLNA 1GK9A 1DF5A 4PA4A 1RPRA 1OCOC 4JAUA 1GM7A 4TT3G 3LDCA 2W6IG 4R7CA 5LHGA 3K03A 1VQ8V 2QE7H 3CCVV 3ZJZA 3SPCA 4LBEC 2WAMA 3AG1C 2X0LA 5L3DA 2XAGA 5J9PC 4UVBA 1K8AW 3SJQC 4FPPA 1PD3A 1FXKC 4PELA 3ZCCA 4JGSA 1M56C 3SPJA 2LP7A 4JYCA 1YSCA 3OMNB 5LGUA 5LHHA 3K9AA 3PJSK 5L3EA 3FYEB 4G28B 4RO2A 3ASNB 3UM7A 1DLBA 4GX0A 4I9WA 2DQ3A 2OCCB 3B8NA 4PDVA 1JQ0A 3K08A 1B6QA 3TCUA 2EINB 1M57B 3K04A 1K9MW 3TETA 1F23A 4RUEA 1S3JA 1NR1A 3MD0A 4JF3A 1QLEB 3QO8A 3E86A 2QKSA 2WLKA 3VBBA 2E5YA 1SETA 4HZ3A 3CC7V 5IYBO 3SPIA 1YJWV 2QEXV 1NBMG 2NLJC 1OCCC 3K79A 1K3EA 3EHBB 3H01A 2HFEC 1Q7YW 2GSMB 1M9NA 1J95A 3ZIAG 4P2ZA 2DW4A 1KKDA 2DYRC 1IXMA 4QNHB 3F7VC 1CP9A 1K5QA 4YXWH 3CC4V 3ZRVA 3CMEV 1H8HG 2Q6AA 4RQFA 2WPDG 2DYSB 2WLIB 4U7NA 5KUMA 4UVAA 2HJFC 1E79H 1R3LC 3I55V 3STZC 2Y69C 5CBFA 3AG1B 1E1QG 4RAIA 4WVZA 2R9IA 1K7DA 4KP4A 4LC1A 1VQ9V 2WWWA 2ITDC 4JASA 1QVFU 2QM8A 5CA3A 3IGAC 1SERA 4X8AA 3FB8C 1FXKB 3CMAV 5LHIA 4UV8A 1P7BA 1KC8W 1BSNA 3SPGA 4I5SA 3P32A 2C2AA 2QTOA 3VOUA 2HLDG 4MTXA 3SPHA 1K73W 4Z1MG 2UXXA 2IU0A 2JDIG 4PDRA 3I56V 2EZPA 2K1EA 3P30A 1BHBA 2PI4A 3OW2U 3JD3A 3B77A 3E83A 2EIKB 5CBHA 2R9RB 5IYCO 2XAJA 1ZWIC 4FJCC 2OT5A 4TSFG 1VQKV 5EC2C 1K4DC 2YEVB 3BY6A 4G27B 3CCLV 2ZDIA 1TUEB 1DTOA 1QR8A 3ABKB 4QPKA 3G6EV 3CCMV 2OCCC 2BOCC 2JJ1G 2IJKA 3G4SV 4P9OA 5CMUA 3E35A 2EINC 1M57C 4MTFA 1XL6A 1S5HC 4RUFA 1CPYA 1QLEC 3T2MA 1PNLA 2QA4V 1GKFA 2JIZG 3X2QB 4PA7A 1GMGA 3A0RA 1YHQV 4QMAA 1QBZA 1V55B 2X6AA 1Q81W 1MSWD 2JEXA 3QNEA 4EKWA 2GHYA 2HVKC 4WFFA 3CC2V 4MTGA 3ZN1A 1W0JG 4WFAV 2IU3A 2XOKG 3OGCC 4PA3A 2DWEC 3AG3B 1M1KW 1YJNV 1QCEA 4RQEA 3SYPA 2V7QG 3K0DA 1F51A 1PL0A 3FYIB 5H6QA 1AI5A 2B5UA 2DYSC 1QLNA 3OEHG 3HPLC 2XNDG 5B1NA 1WLEA 2HKOA 1MOFA 5DN6G 4X89A 3ZRWA 4XDLA 1OHHG 4BIZA 3ZMUA 2A79B 4GX1A 3ETDA 1VQ7V 4F4LA 2ATKC 2F43G 3QO5A 2Y48A 2JJ2G 2B1GA 1VQLV 3T4DA 1G4YB 3BEHA 2P7TC 2Q67A 1NKDA 1KP3A 1ROPA 1PNMA 4BW5A 2MK3A 4QIWF 4WFBV 2ZXWC 2NNUA 4PDMA 4HAMA 4WFEA 1V54B 3DGEA 2EIKC 4P30A 2HR3A 1YTFB 2B1IA 2CK3G 5IY5C 1NVPB 1AJPA 3ZMSA 2WLLA 1H2GA 3AG4B 3T1CA 5EC1C 3JD4A 2EIMB 1BHAA 5L3GA 3ABLB 4DJGA 2X6CA 3ABKC 1BL8A 3W7WA 4JTDB 5KA6A 3NXSA 1W2BU 1KD1W 3OEEG 4JTAB 4GX5A 4MW3A 1NJIW 4XDJA 3K0GA 2OTLV 3T4ZA 2AHZA 4QJFB 1KQSU 1K34A 2XAFA 5B1BB 1XL4A 5H9CA 1Y66A 3JD0A 1BSHA 3X2QC 1M90W 2JDIH 4U7OA 3CCRV 4MW8A 4KUMA 1V55C 3WFVA 4MT8A 2E5TA 3FB6C 2XAQA 1L1FA 3RW0A 1OCRB 5B1AC 3ZN0A 2WLHA 1NQTA 2WLJA 4BIUA 4CZZA 3E8FA 2EJRA 1FXVA 1RM1B 1AQTA 5L3CA 3AG3C 1QR9A 1LNQA 4MVUA 1Q86W 5EBMC 1H8EG 3E8BA 1F4MA 3GWOA 5FL7G 5CBGA 2ZD9A 1JPXA 4QPJA 2OTJV 1EZJA 3SYOA 3OMIB 3F7YC 5B1OA 1I5XA 4GT1A 2JK5C 1AR1B 3ZRXA 1SESA 2IJJA 2ZXWB 1FFTB 4DO2A 1THZA 1JVMA 1WPXA 3SYQA 5IY5B 5EBWC 3LUTB 4Q20A 1R3JC 3W7SA 2WSSH 4R6ZA 4QE7A 3CCUV 1VQ6V 3AG2B 4DXWA 1AJNA 4E2LA 1MG1A 3FKSG 5E1AC 4R8CA 4ASUG 2A0LA 2BOBC 1K5SA 3OUSA 3WG7B 3ZRSA 2P67A 3ABUA 1V54C 4PDLA 1K97A 3D36A 1HWYA 1YTFD 1FXHA 3OM3B 5KA5A 1NVPD 1E1RG 4MVQA 2EILB 3CXCU 3AG4C 3E8GA 2V7QH 2DQ0A 2EIMC 4WFHA 3MHHC 3ABLC 4MSWC 1GM8A 4XDKA 2WSSG 1GM9A 2XNDH 1NH2B 1FS0E 2ZQMA 5CN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ATK C;  2WLL B;  1J95 A;  3RVY A;  4PA6 A;  4P2Z A;  1KKD A;  4MTO A;  2EIJ C;  2DYR C;  3T4D A;  1G4Y B;  2W0F C;  2P7T C;  3BEH A;  2Q67 A;  4MVO A;  5B1B C;  4MVZ A;  4QNH B;  3RVZ A;  3F7V C;  4BW5 A;  1ORQ C;  2ZXW C;  4KFM A;  4PDM A;  4WFE A;  4YXW H;  3KG2 A;  2EIK C;  2Q6A A;  4P30 A;  4MS2 A;  4LCU C;  2HG5 C;  5IY5 C;  2WLI B;  5KUM A;  4OXS A;  2W6J H;  2HJF C;  1E79 H;  1R3I C;  1R3L C;  1OCR C;  2WLL A;  3LDE A;  5EK0 A;  3T1C A;  3STZ C;  5EC1 C;  4CBC A;  2Y69 C;  5CBF A;  4RAI A;  2CK3 H;  4WVZ A;  3ASO C;  3EFF K;  3ABM C;  4PA9 A;  4UUJ C;  2ITD C;  2DWD C;  4DJG A;  2X6C A;  3ABK C;  1BL8 A;  3IGA C;  3ASN C;  2H8P C;  3FB8 C;  3LNM B;  4H33 A;  4JTD B;  2WLM A;  4X8A A;  3LDD A;  1P7B A;  4JTA B;  4GX5 A;  4MW3 A;  1BSN A;  3SPG A;  3SYA A;  2QTO A;  4XDJ A;  2AHY A;  3K0G A;  3RBZ A;  3UKM A;  3VOU A;  5BZB A;  3SPH A;  3T4Z A;  2WLI A;  2AHZ A;  4PDR A;  4LP8 A;  1XL4 A;  2IH1 C;  2K1E A;  3FB5 C;  3OUF A;  1BSH A;  4TWK A;  3X2Q C;  2JDI H;  4H37 A;  4MVM A;  3K06 A;  3OR6 C;  3E83 A;  4MW8 A;  4P9P A;  3F5W C;  5CBH A;  1V55 C;  2R9R B;  2Q69 A;  3OR7 C;  4HYO A;  1IFP A;  1ZWI C;  2E5T A;  3FB6 C;  4QE9 A;  1OCZ C;  5EC2 C;  1K4D C;  4GX2 A;  4JTC B;  5B1A C;  2WLH A;  4G27 B;  1JEK A;  2WLJ A;  3AG2 C;  3E8F A;  1AQT A;  4TLF A;  2ITC C;  3R65 A;  2HVJ C;  1R3K C;  3JYC A;  5B3S C;  3AG3 C;  3WG7 C;  2OCC C;  1LNQ A;  2BOC C;  2X6B A;  4MVU A;  5EBM C;  4P9O A;  2WLN A;  3E8B A;  2EIN C;  1M57 C;  4PA4 A;  5CBG A;  4MTF A;  1XL6 A;  2ZD9 A;  1OCO C;  1S5H C;  2EIL C;  3SYO A;  4RUF A;  1QLE C;  3LDC A;  3F7Y C;  4R7C A;  3RW0 A;  3K03 A;  3T2M A;  2QE7 H;  4MVS A;  2IH3 C;  2JK5 C;  3ZJZ A;  2YEV A;  3SPC A;  4LBE C;  3AG1 C;  4J9Z B;  4J9Y B;  1JVM A;  3FB7 C;  4PA7 A;  5J9P C;  4QMA A;  3SYQ A;  3SJQ C;  2X6A A;  5EBW C;  4EKW A;  2HVK C;  3LUT B;  4WFF A;  1M56 C;  3SPJ A;  1R3J C;  4MTG A;  5EBL C;  2WSS H;  4R6Z A;  1K4C C;  2KB1 A;  4QE7 A;  5KUK A;  3PJS K;  4DXW A;  5E1A C;  3OGC C;  3E89 A;  4G28 B;  4R8C A;  4RO2 A;  4R50 A;  3UM7 A;  4PA3 A;  2DWE C;  2A0L A;  4GX0 A;  2BOB C;  4I9W A;  3OUS A;  3E8H A;  4MVR A;  3ZRS A;  1V54 C;  4PDV A;  3SYP A;  3K08 A;  4PDL A;  3K0D A;  3TCU A;  3K04 A;  2A9H A;  2DYS C;  3TET A;  4ZBM A;  3IFX A;  4RUE A;  3STL C;  4MVQ A;  3GB7 C;  3E86 A;  2QKS A;  2WLK A;  3AG4 C;  3E8G A;  3HPL C;  4HZ3 A;  2EIM C;  4WFH A;  2E5Y A;  2V7Q H;  3SPI A;  4X89 A;  3ABL C;  4MSW C;  2NLJ C;  1OCC C;  2Q68 A;  4XDK A;  4X88 A;  4XDL A;  3SYC A;  2XND H;  4WFG A;  2A79 B;  4GX1 A;  1FS0 E;  3USS A;  2HFE C;  4F4L A; 
#chains in the Genus database with same CATH topology
 1Q5O A;  3RVY A;  5B1A B;  1M1J C;  3CLQ A;  1R6K A;  1HR0 O;  2P7J A;  2UXD O;  2XUM A;  1AI4 A;  1OZ0 A;  4DR4 B;  1PZQ A;  1KYO F;  4N21 A;  1RPO A;  2FYU H;  2OCH A;  3JD2 A;  2W6J G;  2A45 H;  2QJP C;  1FBM A;  2QR4 A;  5DM6 V;  2KS1 B;  3ZBH A;  2K9J A;  1YJN P;  1PKX A;  3HUS A;  5AVQ B;  1RF1 C;  3Q5R A;  1S72 V;  4BW9 A;  5F2V O;  1KQL A;  3RFR A;  5D5P A;  3QO7 A;  1I94 O;  4NPF X;  3ABM C;  4JPR A;  1L0L E;  1AI7 A;  3KKY A;  2UU9 O;  3D3Q A;  1JY3 N;  1SZT A;  2JO1 A;  3QG5 A;  3LDD A;  2F1M A;  3SYA A;  5JJE B;  2QG4 A;  1KYO E;  1Y4M A;  5EIB C;  1KIL A;  3B8M A;  2GV9 A;  1JOY A;  2N74 A;  1GL2 A;  1VQL P;  2JWD A;  1BE3 H;  1K9M Q;  3RYC A;  5K1X A;  2Q9L A;  4XBF A;  1FZC B;  2LO1 A;  3K06 A;  4PD4 I;  1GU5 A;  1YIT V;  1RH5 B;  1R73 A;  4K8X A;  3ZMV A;  4JTC B;  1JEK A;  1IUR A;  5CCG A;  1ARO P;  3V5B A;  1LTJ C;  4TLF A;  3ASO B;  3ZHR A;  1EZV E;  4O4J A;  5A2Q N;  3A7O A;  4B3M B;  3L4F A;  3ZX6 A;  1JY2 N;  3CCQ V;  1XMQ O;  2QE7 G;  4UCT A;  1DEE G;  3RBX A;  4X1Y A;  1D5N A;  1IFI A;  1AP5 A;  1TUB B;  5L8R J;  1R5S A;  3ZHS A;  4FK5 C;  1EBO A;  4UV9 A;  4WF9 V;  1LT9 C;  3AK3 A;  4BAY A;  1NH2 D;  2DW3 A;  2FFD C;  3OMA B;  4H0L C;  1JY3 P;  3FAV B;  3ABT A;  2L6L A;  1N73 A;  5HFM A;  2E76 D;  1LTT C;  2BCC H;  1KC8 Q;  4W4K A;  4DV6 B;  4R50 A;  2ZYG A;  3M91 A;  5B3S B;  4CH4 A;  4NB5 A;  2ZJS E;  3PP5 A;  2YIA A;  2FKW B;  4LNU A;  1ZLZ A;  4DV5 B;  3UT5 B;  4TUY A;  5L3F A;  1X59 A;  3ABV C;  1SS1 A;  3L70 J;  4ZBM A;  3STL C;  2LW1 A;  4CS4 A;  1WA8 B;  1JTH B;  2OYI C;  3A0B H;  5D5Q A;  1VQ4 V;  1EDI A;  3P3N A;  2Y0I A;  2NPS A;  2YI8 A;  1SQV G;  3SYC A;  4IL6 H;  2GA1 A;  2WLL B;  1AP6 A;  3BCC H;  1DD3 A;  1H38 A;  3HKD B;  3JAS A;  1R6T A;  4JYB A;  3CWB H;  2F23 A;  4IGG A;  2Q5Z A;  3KDP B;  2CTW A;  1N7S B;  5APV A;  4I55 A;  1SQP J;  4GKJ B;  1SQV D;  1VQ6 P;  4JYY A;  2W0X A;  1RY3 A;  4DV2 O;  2OAR A;  1RSO A;  1HUC A;  2Y4U A;  3AE5 C;  3KG2 A;  1EZV I;  3L73 J;  4OXS A;  4GYC B;  4AQY O;  2G3A A;  3ICX A;  3Q4H B;  3MGN A;  5H2F H;  5KLV E;  1K33 A;  1QEX A;  1Q81 Q;  3RWR D;  5AVX B;  4NR1 A;  3FD9 A;  1OCC B;  2E74 C;  1FZF A;  3ASN C;  1OMI A;  2AXC A;  2N1T B;  3GVM A;  3AEA C;  1IFD A;  1AR5 A;  1YTZ I;  1PGJ A;  1M1K Q;  5EZY A;  1SQX K;  2FXP A;  3IAY A;  4JI6 O;  2OQQ A;  3F5H A;  2WMM A;  1XTG B;  2FXO A;  3FB5 C;  1NR7 A;  3L71 H;  4B3S B;  1S2E A;  1NTK H;  3RK2 B;  4RES B;  3AEG C;  2WA4 A;  5BR8 B;  2IJI A;  4HYO A;  2PFX A;  1SQG A;  5LGT A;  1SFC B;  3P8C D;  4LR3 A;  2PY5 A;  3CL3 D;  1SRY A;  1M1J A;  1MKM A;  2Y69 B;  3OTO B;  1K92 A;  3KCX A;  3CP1 A;  4DW0 A;  1OW7 A;  4O9B A;  1R3K C;  4PJ0 H;  2ZIN A;  4PI2 A;  5GON A;  1RF0 A;  4ZMD A;  1EDK A;  4PD4 H;  1G1J A;  5CJ4 A;  2VQF B;  4PA4 A;  5LYJ B;  3C9I A;  2IDB A;  2JVD A;  3SFD C;  5GTH H;  3R4Y A;  5CA1 B;  4TT3 G;  5CBN A;  3LDC A;  5BVZ A;  3CCV V;  1CXZ B;  1N36 B;  3SPC A;  4LBE C;  2Q73 A;  5CHX A;  1KUQ A;  3AG1 C;  3HE5 A;  1Q2N A;  5LP6 C;  3T1Y B;  4WWI A;  2YXQ B;  3H1L D;  4EIJ A;  4FPP A;  3GF7 A;  1ZLL A;  3RYF B;  2LP7 A;  2P06 A;  2ZAE B;  1GK4 A;  2P2U A;  2DJV A;  2AXT E;  2XT9 A;  4JI2 O;  3FYE B;  3UM7 A;  1EXI A;  2DQ3 A;  3NR7 A;  2QSA A;  3HKE A;  1TA8 A;  3MDS A;  3K08 A;  3JSV C;  1GW3 A;  5KTB A;  1F23 A;  2IBZ D;  1S3J A;  3QO8 A;  5JVD A;  2E5Y A;  4JI8 O;  3CX5 H;  5GTI E;  4HH2 A;  3AK1 A;  4XE5 B;  4YY3 B;  1LTJ A;  1MNG A;  2NLJ C;  3BVO A;  4AUW A;  1MFZ A;  3HUS B;  2XHB A;  1U97 A;  3OJA B;  1Q7Y W;  4B7E A;  1AQ5 A;  2P4K A;  3ZIA G;  3H1J G;  1NTZ J;  3H1K J;  2DW4 A;  1KKD A;  4IFF A;  2IX7 C;  4FFK A;  2E76 C;  5APT A;  3CCJ P;  5BMV B;  2R5D A;  3F7V C;  2BTQ A;  1VQN P;  1KYO H;  3IAO A;  4N78 D;  3H1J D;  3CC4 V;  4C46 A;  3RK2 D;  1AB3 A;  3CME V;  1KIL B;  2Q6A A;  4EB6 A;  2WPD G;  4U7N A;  3HR0 A;  1SFC D;  4JYA O;  2FFD A;  1U57 A;  1VQ5 P;  1R3L C;  1GL2 B;  2E75 C;  5J2U A;  2F93 B;  4F6E A;  3RYC B;  1X22 A;  4RAI A;  3T1H O;  1K7D A;  4LC1 A;  2ITD C;  2ZE5 A;  1S4X A;  2OIE A;  3JAK A;  3HD7 C;  4UB6 H;  1VF5 C;  2R70 A;  2Q7G A;  4CS2 A;  1T8Z A;  2PP6 A;  3O8Z A;  5LHI A;  1BSN A;  3SPG A;  4I5S A;  1EZV H;  1PPJ G;  4O4J B;  4Z1M G;  2SPZ A;  1Y74 A;  3J81 N;  2CDY A;  1IFM A;  1GK6 A;  2W6A A;  4WY4 C;  1Q43 A;  1X9V A;  3K5B A;  4X1Y B;  2PI4 A;  3OW2 U;  2DN9 A;  1AVO A;  1P84 F;  4Z1V A;  1BCC H;  1PPJ D;  5CBH A;  5B66 E;  1FZG A;  5LOV B;  2YXR B;  1ZWI C;  1SQQ G;  1VQK V;  2ZXE B;  1YYC A;  2JR8 A;  1K4D C;  1MFT A;  2A06 E;  4G27 B;  1SQX J;  2POH A;  5APQ A;  5JWP A;  3A0B Z;  1NU1 G;  3PH0 A;  1VQM P;  2JJ1 G;  1SQQ D;  3E35 A;  1U96 A;  4IL6 Z;  4X64 B;  1N73 B;  1KB9 F;  3B40 A;  3KZI H;  4RWU A;  1XL6 A;  3DXR A;  1E5W A;  4RUF A;  1CPY A;  4LFA O;  1Q6H A;  4I1L A;  1NU1 D;  2M3B A;  1P84 E;  3ZS8 C;  2QA4 V;  4BWA A;  1RFY A;  4LFC O;  4H44 B;  4LNU B;  3BA9 A;  1GKF A;  4TUY B;  2UXC B;  3V4W A;  4D6T E;  2M8R A;  5KMG A;  1OXZ A;  1RP3 B;  2RNB A;  3ZN1 A;  1NTM G;  2KXP B;  5KAF E;  3VQY A;  4NXN O;  5JQG A;  2NPS B;  3OGC C;  2YC0 A;  3S3W A;  3K5O A;  1PP9 H;  2XZR A;  4B3T O;  1KB9 E;  5H2F Z;  1XMO B;  4JI7 O;  1NI8 A;  5FPR A;  4LF5 O;  1YJN V;  2XTA A;  4RQE A;  3SYP A;  3JAS B;  1KIL D;  1NTM D;  1F51 A;  1SQV K;  2ZVO B;  2ZIM A;  4I55 B;  4DUY B;  4TQD A;  1GL2 D;  1W2E A;  5B1N A;  4DV4 O;  1RSO B;  3UQ8 A;  5AW8 B;  3AE3 C;  4X89 A;  2BE3 A;  4GKK O;  1OHH G;  4BIZ A;  2A79 B;  1PIX A;  2P58 A;  3HKB A;  4KJM A;  2Q9I A;  2CH7 A;  4BWN A;  2B1G A;  2UWJ E;  1VQL V;  3G6B A;  2FYU G;  1SQB E;  3U1A A;  2A45 G;  3SR2 C;  5DJU B;  4W7Y A;  1QVG O;  1KP3 A;  3BVH A;  1WP7 A;  3AEB C;  3L74 H;  2NNU A;  4PDM A;  2L35 A;  1SZX A;  3CCQ P;  2IBZ I;  3L35 A;  4PJ0 Z;  4I6M C;  2HR3 A;  5LP6 A;  5EZY B;  4H13 C;  5IY5 C;  2Z4E A;  3WU2 Z;  3IFM A;  1NVP B;  2KIK A;  4AI8 A;  1GZL A;  3A0H E;  1H2G A;  3AG4 B;  1BHA A;  5GTH Z;  3VQV A;  1MV8 A;  3A2F A;  4DJG A;  1FDO A;  2X6C A;  3ABK C;  3TSI A;  3CC7 P;  2Q3E A;  4R4M A;  5KLI B;  1FJP A;  3NXS A;  1P84 I;  1MSD A;  1NJI W;  1XEQ A;  2EJ7 A;  1DD4 A;  1OFC X;  1M1J B;  1KKC A;  4LH6 A;  1BE3 G;  4DR5 O;  2CTR A;  1AVY A;  1KV4 A;  2AHZ A;  4FFB B;  1SA0 A;  2AEF A;  2XAF A;  4H44 D;  4BRY A;  1GMJ A;  5H9C A;  4NPE A;  1Y66 A;  5GON B;  3EXA A;  3WMM 0;  5CCH D;  1M90 W;  1QU7 A;  2QJP B;  2KLV A;  3VN0 A;  3B4S A;  5KJ7 D;  1HVV A;  2VRS A;  1V55 C;  1BE3 D;  3WFV A;  1KB9 I;  5CBO A;  4GZR B;  3M0D C;  2W90 A;  3ZN0 A;  1TU3 F;  3L73 D;  3CRR A;  3HE5 B;  4UFZ A;  1KTM A;  2CPS A;  3C1L A;  1GN2 A;  1RQU A;  1MZE A;  4Z2W A;  5EBM C;  1H8E G;  2KS1 A;  1ZXG A;  3CJH A;  2AXT H;  1F4M A;  3GWO A;  5FL7 G;  1O9G A;  2QWN B;  5B1O A;  4O2A A;  1I5X A;  1DIP A;  1AR1 B;  4JI0 O;  3HKE B;  1ZSP A;  2ILM A;  5AW4 B;  1P7G A;  2MW2 B;  3N27 A;  5GTI H;  1S5L E;  5JVD B;  3V2P A;  4Q20 A;  2YNY A;  1VQ6 V;  1PV0 A;  2YXH A;  1LTJ B;  1MG1 A;  1XDC A;  1XIL A;  3CCL P;  2BOB C;  3L70 E;  4WY4 A;  4GOF A;  3ZRS A;  3ABU A;  3MZW B;  1VEW A;  1X0T A;  3S9O A;  1K97 A;  2R5B A;  3AE7 C;  3B5N C;  2A3Q A;  3G4S P;  1HNX B;  1FXH A;  5KA5 A;  1NVP D;  4MVQ A;  2ZM6 O;  3E8G A;  2BTQ B;  2EIM C;  2AZ0 A;  3BHP A;  3V2N A;  4ASW A;  1Q82 Q;  4XDK A;  2OIG A;  1GM9 A;  4FLT A;  1USE A;  4EB6 B;  1NHL A;  1ZOY C;  2FFD B;  1FS0 E;  3CWB G;  3OW2 O;  4H0L B;  3LIE A;  1YHQ P;  4O2B A;  5J2U B;  1SQV J;  3RYI A;  4YJ2 A;  1SQP E;  4KL1 A;  4MTO A;  2WSC H;  4B7K A;  3CC2 P;  4OH8 B;  3JAK B;  3OE7 G;  4MVZ A;  3E1I A;  2CTQ A;  4K0K B;  3CWB D;  1AFO A;  2FKX A;  1N33 O;  4G2K A;  3FXE A;  4UB8 E;  4X1I A;  4YIP A;  1L0N G;  2Y0D A;  1Y74 B;  1BDC A;  1SC5 B;  4ZKP A;  3LDE A;  5EK0 A;  1GRJ A;  1IBL O;  1K8A Q;  3EWK A;  3CCV P;  1AIL A;  5B66 H;  1RE4 C;  5C39 A;  1YI2 V;  1S76 D;  2YI9 A;  1EFR G;  1L0N D;  3W7T A;  4JI3 O;  4LF8 O;  4HBN A;  4BIO A;  4GUN A;  5EIB D;  1PV3 A;  3L71 G;  4K35 A;  2P90 A;  2WLI A;  4X62 B;  1NTZ D;  3H1K D;  1SQQ K;  3CYO A;  4LP8 A;  1NTK G;  2IH1 C;  1JFF A;  1EN6 A;  2YXL A;  2ZKO A;  1SLQ A;  3DXR B;  1NU1 K;  1EDJ A;  2X7R B;  3OR7 C;  3L71 D;  1FXK A;  2ARH A;  3O9O A;  3BAS A;  4D6T H;  4KHP O;  1OZH A;  1NT2 B;  2ITC C;  2UUB O;  2QKA A;  5KMG B;  3W7U A;  3JYC A;  5ITZ A;  4N3Y B;  3CRA A;  3WG7 C;  1AR4 A;  5KAF H;  4DRX A;  4JI8 B;  2WT7 A;  2QM4 A;  2H94 A;  2PAJ A;  4LGD E;  1DH3 A;  5JQG B;  4NTW A;  2EIL C;  1URF A;  4DR7 O;  1HP8 A;  3CEI A;  1LTI C;  2WPR A;  5KKZ B;  4MVS A;  1KEC A;  2EUL A;  2OTL P;  1BGY E;  1NTM K;  4DR6 O;  2R32 A;  4J9Y B;  4GLX A;  5E79 E;  4H0L D;  3CC4 P;  3VP9 A;  3TK1 A;  4UCV A;  1JCH A;  2JGD A;  3CCJ V;  5EBL C;  4PV1 D;  1VQN V;  4FMT A;  2LFS A;  2B87 A;  1S9K E;  2WTY A;  4J7J A;  2Q0A A;  3E8H A;  3HKB B;  2ZNJ A;  1JR9 A;  4YTP C;  1K73 Q;  2CH7 B;  3W7X A;  1SQB H;  1ZW0 A;  3AEC C;  1GDT A;  1VQ5 V;  1FKA O;  2A9H A;  3JCU E;  4J7Z A;  2JRI A;  3M0D A;  5JH7 A;  3M9B A;  3OA7 A;  3K3W A;  1HNZ B;  1CZQ A;  3UO2 A;  4DR3 B;  5LMU B;  3CX5 D;  2QTS A;  1FZA A;  5LP6 B;  4WFG A;  3A0H H;  2MKV A;  2O01 H;  3H1I G;  2ZIO A;  3V2R A;  1VQK P;  2KG7 A;  3AG7 A;  3AE8 C;  3H1J J;  2V1D A;  4NXM O;  2KZJ A;  1Y67 A;  3CCU P;  3RVZ A;  3JAL A;  1BQ0 A;  2LR2 A;  1WMK A;  3H1I D;  4IL6 X;  3CXH D;  4LCU C;  2HG5 C;  4W80 A;  1FJG B;  1SA0 B;  2JJL A;  1R3I C;  4OX9 O;  1ENV A;  4BRY B;  2AXT Z;  3JSN A;  2IZ1 A;  5AVY B;  4EOT A;  3ZMZ A;  1VQM V;  4X65 O;  1AJQ A;  2E74 D;  2DWD C;  3CPW U;  3LNM B;  2YDE A;  2LGQ A;  5AW7 B;  1F4N A;  1N34 B;  5IYD O;  3CD6 V;  3B5N A;  2M6Y A;  5GTI Z;  2E76 B;  1XNQ B;  1QLE D;  3D3I A;  3K5N A;  2WPS A;  3AE6 C;  1BCC G;  1SS3 A;  1N32 B;  3OUF A;  1Q8I A;  3ZED A;  4TWK A;  3CJH B;  2EBO A;  4P9P A;  1SQX E;  2Z5U A;  4NXN B;  4J11 A;  1UJW B;  4O2A B;  3OAA G;  1VP7 A;  2M7W A;  2UUA B;  4JAV A;  2R9A A;  2RCV A;  1BCC D;  2D3O W;  2PF4 E;  3DC5 A;  1SQQ J;  3SSU A;  3C3S A;  1H2K A;  4X66 B;  3M9H A;  5BMV A;  3D71 A;  3LSU A;  3OFN G;  4GOE A;  1S77 D;  1VF5 B;  2X6B A;  2KSE A;  3G3Z A;  3MP7 B;  1NU1 J;  5KAI E;  1GK9 A;  4UCU A;  1GU4 A;  1FDM A;  3WB0 A;  3TGU E;  4LF4 B;  1GM7 A;  2K9Y A;  4R7C A;  2P22 C;  3ZJZ A;  3GWK C;  4WY4 B;  2QWR B;  3LNN A;  1KQF B;  4TOI A;  3KHU A;  2HHH O;  3VQW A;  2B88 A;  2ITA A;  3AE9 C;  3SJQ C;  4PEL A;  4IHJ A;  3ZCC A;  2BTO A;  2B89 A;  2ZYD A;  3SPJ A;  1USD A;  4XA4 A;  1PP9 G;  4JYC A;  1YSC A;  3OMN B;  5LGU A;  5LHH A;  3K9A A;  4LLH A;  3PJS K;  4U3F G;  2VQE B;  1YBK A;  2C9L Y;  2FYN C;  4M3L A;  5FNV A;  1NTM J;  2YKP A;  1DLB A;  4GX0 A;  4IOI H;  4I9W A;  2J59 M;  1SQP H;  3SJB C;  4O2B B;  4L8J A;  3B2E E;  4YJ2 B;  3RYI B;  5B66 Z;  1PP9 D;  3K04 A;  3RK3 C;  1K9M W;  1LT1 A;  2WPQ A;  4U3F D;  5LOV A;  4Y28 J;  1FD9 A;  2ZT9 C;  3E86 A;  2QKS A;  1IBM B;  1Y76 A;  3VBB A;  4UB8 H;  3CC7 V;  3FX7 A;  3BAB A;  4X1I B;  3K79 A;  5AVV B;  1VL2 A;  2GSM B;  1M9N A;  3CRM A;  3IN6 A;  5IYZ A;  1HJB A;  2QRX A;  4DR1 B;  2DYR C;  2YMY A;  4PV1 C;  3L74 G;  1Q86 Q;  1L0N K;  2YO3 A;  1N86 A;  2FYU J;  3L9D A;  1VQO P;  5CB4 A;  1K5Q A;  5CCH A;  5IWA B;  1NO4 A;  3G9R A;  2CPB A;  1Z2G A;  1NTZ K;  5IE9 A;  5KJ7 A;  2UXB O;  2WLI B;  5KUM A;  5KAF Z;  3L74 D;  4UVA A;  2QGN A;  1E79 H;  2E75 D;  1JFF B;  1E1Q G;  2R9I A;  1FZE A;  3VYI A;  4JAS A;  3AK2 A;  1WAZ A;  1QVF U;  3HD7 D;  2QM8 A;  1YIJ P;  1UIX A;  1VF5 D;  1FXK B;  1JY2 P;  4LF7 B;  2PYL A;  4UV8 A;  1KC8 W;  1JM0 A;  4O4L A;  1OW8 A;  3P32 A;  4J41 A;  2WZ7 A;  4X1K A;  3VOU A;  1HWT C;  1MZF A;  1VF6 C;  1YZB A;  4MTX A;  2UXX A;  4PDR A;  5ITZ B;  3BAT A;  4WY4 D;  1KQG B;  3RGU A;  2YKQ A;  1BE3 J;  3SJA C;  4LF9 O;  1BHB A;  3A3Y B;  4DRX B;  2WT7 B;  3D36 C;  3E83 A;  3MHV A;  5IYC O;  4BR6 A;  1BGY H;  2VRZ A;  3SWF A;  2WSE H;  3CCL V;  5E79 H;  1QR8 A;  3H1H H;  4LFB B;  2Y9Y A;  5IT9 N;  3ABK B;  4ZHQ A;  4AHC A;  4E4E A;  2BOC C;  3G4S V;  2JGD B;  3A0H Z;  2RDC A;  2B87 B;  1QLE C;  2H89 C;  2P1J A;  1J5E B;  1LUV A;  4I7Z C;  1XNR B;  1JOC A;  3M06 A;  4DV0 B;  2JIZ G;  1IBK O;  1GMG A;  1YHQ V;  1IFJ A;  3F89 A;  3JCU H;  3L75 G;  2HPC A;  1FOS F;  3GMA A;  1V55 B;  1Q81 W;  4ABM A;  4EKW A;  2HVK C;  1GW4 A;  5JH7 B;  3CC2 V;  5APY A;  4MTG A;  2UUC O;  2AZ2 A;  2IU3 A;  4FFB A;  3M0A A;  1MA1 A;  1YVW A;  2Y0P A;  2QVA A;  3L75 D;  1M8O B;  3WU2 H;  2FY8 A;  1M1K W;  4NVP A;  1YI2 P;  3CPW O;  4D7S A;  3KCY A;  1VIB A;  2KG7 B;  4DT0 A;  1QLN A;  1G2C A;  1RF1 A;  4FM0 A;  5JCO C;  3JAL B;  4CS3 A;  1T5E A;  1WT6 A;  1FOS E;  3C90 A;  1WLE A;  1MOF A;  1WJZ A;  2DMX A;  1SQV E;  3ZRW A;  2QJY B;  3NMD A;  1PL4 A;  4JI4 O;  3CHX A;  4F4L A;  1XQ8 A;  3CI9 A;  3QO5 A;  2K9P A;  1FPO A;  2XV5 A;  3CWB J;  3T4D A;  1LTG C;  1G4Y B;  1L4A C;  3BEH A;  2P7T C;  3VQX A;  2WA3 A;  1FAV A;  4J7K A;  4DR2 O;  4BW5 A;  1JMB A;  5CMZ A;  2ZXW C;  1S5L Z;  1KBH A;  2EIK C;  3B5N B;  3S3X A;  4B3R B;  4H13 D;  3PTZ A;  4EFE A;  2UUB B;  1Y9B A;  4GDO A;  1N8R Q;  2LJ2 A;  5EC1 C;  1L0N J;  2EIM B;  3WB1 A;  2JS5 A;  4C7R A;  4EI2 A;  2WVR A;  4EYY Q;  3K5L A;  1YJW P;  1NYH A;  1LP1 A;  1YCI A;  1W2B U;  3OEE G;  3L72 G;  1L0L H;  2LQT A;  3K0G A;  2PYJ A;  4I9Q A;  4WBA A;  2OTL V;  3ZHT A;  3P8C E;  4AYC A;  4JI1 O;  2E5L B;  1KQS U;  1K34 A;  3N2K A;  3L36 A;  1XL4 A;  5KAI H;  2YS8 A;  3L71 J;  4KHX A;  3L72 D;  1LT9 A;  3X2Q C;  3TGU H;  1NTK J;  3F5T A;  4MW8 A;  4D6T G;  1T2K C;  1RQV A;  3RL0 g;  1JMK C;  5B1A C;  4DUZ B;  3DSQ A;  3KQG A;  4BIU A;  4CZZ A;  2EJR A;  1FXV A;  2QKC A;  2JP3 A;  1L8D A;  1ZRT D;  5L3C A;  5LMN B;  1Q6I A;  2FL4 A;  4UB8 Z;  4IHJ B;  1VQ9 P;  1N0N A;  1TVK B;  3E8B A;  3H1L E;  5CJ0 A;  3APQ A;  4DZO A;  1CW5 A;  1EZJ A;  5FNV B;  4DV1 B;  2OYI A;  4GT1 A;  2G38 A;  2ZNI A;  4GIF A;  1FZB A;  2KQX A;  3SYQ A;  2K3R A;  1Y76 B;  2AEM A;  1R3J C;  2MJZ A;  1B06 A;  4FZ0 A;  2WSS H;  3SFE C;  3CCU V;  4JI5 O;  4DXW A;  2IBZ E;  1AJN A;  4DV3 B;  1SQB G;  4ASU G;  4ZI7 B;  3WG7 B;  1HGV A;  2P67 A;  4YHH B;  4NPD A;  1ZV8 A;  2BEZ F;  2IFM A;  2F4V O;  5IYZ B;  4PDL A;  3B5N D;  3D36 A;  3CCM P;  4X65 B;  1E1R G;  2EIL B;  3CD6 P;  2Q0O C;  3TXQ A;  2V7Q H;  2RKL A;  5CB4 B;  2K1A A;  4FM2 A;  1LR1 A;  1HR0 B;  2KNC A;  2XND H;  5JJJ B;  2UXD B;  4L75 A;  2ZQM A;  4N78 E;  3H1J E;  1IX9 A;  5AW5 B;  4DK0 A;  2ZXX A;  2JS3 A;  3C3T A;  3E1R A;  2W0F C;  3GG2 A;  1FFX A;  3TJT A;  3H1I J;  4FIP C;  1RE3 C;  5B1B C;  1SVF A;  2Q8V A;  1X4T A;  4N23 A;  4O4L B;  5E79 Z;  2KB7 P;  4X1K B;  3NTN A;  1I94 B;  1Y8A A;  4MS2 A;  4DR4 O;  2FB5 A;  2M5A A;  2UU9 B;  4CPG A;  2ZE7 A;  1OX3 A;  5TIS E;  4IYI A;  1B04 A;  2CK3 H;  1QHT A;  3EFF K;  4PA9 A;  3SJC C;  1JY3 O;  1GO3 F;  1IJD B;  2RQ6 A;  4H33 A;  5KLV H;  4KXR A;  5L3B A;  3JCU Z;  5HFL A;  1PPJ E;  3IC7 A;  1P4R A;  1FYJ A;  5JCO A;  4ZHQ B;  5AG2 A;  3B09 A;  4MVM A;  1BCC J;  2CGN A;  1G8M A;  1XHX A;  1SF9 A;  2FYU D;  3PLN A;  2Q69 A;  2Q7E A;  1OVU A;  1IFP A;  1SQQ E;  5LA6 A;  4HJG H;  1M56 D;  2J5U A;  1XMQ B;  3JCZ A;  4W4L A;  4RKU J;  3D6Z A;  3V2Q A;  2HVJ C;  1JY2 O;  1NU1 E;  2HPC B;  3QTC A;  5BU8 B;  3HKC A;  1EDL A;  4JV5 O;  3Q3D A;  4B3M O;  3EFG A;  1FU1 A;  4IT5 A;  1A32 A;  2HP8 A;  4WB4 A;  3E7K A;  3G67 A;  3KXD A;  1XTC C;  4J9Z B;  3RGB A;  3ZHQ A;  1EXJ A;  1VF7 A;  3AE4 C;  1G2C B;  4I0X A;  2L5G B;  1RF1 B;  2GUV A;  1FS0 G;  1KIL E;  1TAE A;  1NTM E;  3C8V A;  3A5T A;  2KB1 A;  3DTU B;  5KUK A;  2WSF J;  3ABM B;  1EC5 A;  3ZRW B;  1VQO V;  1YQ4 C;  1PP9 J;  2P6J A;  1NH4 A;  5IJ0 A;  4U3F J;  1PNK A;  4MVR A;  4A5U B;  1VMG A;  1COW G;  5CA0 A;  4DV6 O;  1D2D A;  3TYY A;  4JQ0 D;  4I50 A;  2QWP B;  4DV5 O;  1KN7 A;  1YIJ V;  2LFR A;  2Q68 A;  3WUT A;  4X88 A;  3UCS C;  3HD7 A;  5KAI Z;  3S4R A;  1LWU C;  2BCC G;  2LKM A;  1KOR A;  2PRR A;  2ZDI C;  2YKO A;  4DV2 B;  2EIJ C;  4EFB A;  3ETE A;  1PGQ A;  1BT8 A;  4GCZ A;  2FXM A;  4MVO A;  2EZO A;  2FYN B;  4NYK A;  1LP1 B;  4AQY B;  3L74 J;  2BCC D;  1ORQ C;  1E79 G;  1WPB A;  5KHI A;  2OYQ A;  2RH0 A;  5C93 A;  3FX0 A;  4GKJ O;  2HG5 D;  1JCC A;  2KSJ A;  4HKZ H;  2V4H A;  3N2K B;  3ZHV A;  4UCO A;  4CBC A;  2H88 C;  1LT9 B;  3BCC G;  1KP2 A;  1R6N A;  2H8P C;  2WLM A;  2PI5 A;  4Q6G A;  4JI6 B;  3PRJ A;  1X79 B;  3E22 A;  1I5Y A;  2AHY A;  3RBZ A;  5BZB A;  1BE3 E;  1G1I A;  1IFN A;  1KFM A;  2DYR B;  4PV1 B;  3BCC D;  1H2S B;  1QQC A;  3L73 E;  3CCS P;  3ZHU A;  4LWS A;  3H1L H;  1JX9 A;  3D70 A;  4UVC A;  1BGY G;  4TT3 H;  3FXD A;  5AVW B;  3HUS C;  3VMX A;  3M99 B;  1Q82 W;  3J80 N;  2OYI B;  1OCZ C;  3H1H G;  4GX2 A;  3FGA D;  3O65 A;  1W0K G;  1IVS A;  3R65 A;  4ZOL A;  5BR8 O;  2IZ0 A;  2A06 H;  3CRC A;  1Z5W A;  4O4I A;  3JC2 2;  4WCE V;  1O9H A;  2IBZ H;  4FLZ A;  3MAQ A;  1ZP0 C;  1LJ2 A;  2K88 A;  3H1H D;  3H32 A;  5M1B A;  4J10 A;  5BU5 A;  1OCO C;  1LTA C;  2W6I G;  4JF7 A;  2KK7 A;  2VQF O;  3VOP A;  1I08 A;  2H3O A;  2X0L A;  1AV1 A;  4X9Q A;  2A45 I;  1NGM B;  2XAG A;  1P84 H;  1N36 O;  1K8A W;  2E42 A;  1N4C A;  4JI2 B;  1L2P A;  4JBZ A;  4JGS A;  1G6U A;  1NTK D;  1M56 C;  2PGD A;  1TGO A;  3L75 J;  1URQ C;  4EEQ A;  2DE0 X;  5CCG C;  3T1Y O;  3AEF C;  1J1E C;  1KD1 Q;  1JB0 J;  1ZAU A;  2E74 B;  2KNC B;  3FFQ A;  4RO2 A;  1MMM A;  3B71 A;  3G71 P;  3ASN B;  1JJO A;  3H1J H;  5H5N A;  2I8D A;  4ZKU A;  5APU A;  1N7L A;  3B8N A;  4PDV A;  1JQ0 A;  3RL0 C;  1UII A;  3JSL A;  3RK3 D;  1KB9 H;  4U3J A;  3FWL A;  4RUE A;  1FFX B;  3MD0 A;  4PD4 D;  2ZT9 D;  1QLE B;  2AGA A;  3LW5 H;  2HYN A;  1SET A;  4HZ3 A;  4DCK A;  4I7Z B;  5IYB O;  3SPI A;  1YJW V;  2RN0 A;  1GD2 E;  2M5A B;  4TV9 A;  3CWB E;  1K3E A;  3EHB B;  4OGQ C;  5TIS H;  2HFE C;  2KKW A;  4NKG B;  1J95 A;  3CCE P;  3BAA A;  4P2Z A;  3VP8 A;  1KFN A;  2WSC J;  1N73 C;  5DEC A;  4QGP A;  1NS1 A;  4JZ2 A;  2P4V A;  4JYA B;  1VDF A;  2HLO A;  4CC5 A;  4YXW H;  4Z1M H;  2ETN A;  4TQF A;  3T1H B;  1L0N E;  1MZ9 A;  4RQF A;  3RYH B;  2QJK C;  2KI7 B;  1BQZ A;  1WB8 A;  5CBF A;  3AG1 B;  2FYU K;  3HE4 B;  1XI1 A;  4WVZ A;  4KP4 A;  1VQ9 V;  2WWW A;  1NTZ E;  1L0L G;  2NPS C;  3H1K E;  1SER A;  3IGA C;  3JAM N;  3K57 A;  4X8A A;  3FB8 C;  2KSD A;  3LID A;  3CMA V;  3UO3 A;  5LA6 B;  1ZR4 A;  1KU9 A;  2C2A A;  2QTO A;  5J2T A;  2HLD G;  3L72 J;  2C0X A;  1K73 W;  3OT7 A;  2IU0 A;  1L0L D;  2HEP A;  3TGU G;  2GDS A;  3I56 V;  3HKC B;  2EZP A;  3P30 A;  3IR9 A;  4GOD A;  1QX8 A;  2OYH C;  1H0T A;  4OPA A;  3QH9 A;  2N05 A;  1KYO D;  2EIK B;  3CRQ A;  2R9R B;  2XAJ A;  5LL6 Y;  2OT5 A;  4TSF G;  1XUQ A;  1LWU A;  1Q3E A;  3TGU D;  5EC2 C;  4D6T J;  1RHZ B;  3BY6 A;  1J2J B;  2ZDI A;  5LXT A;  1YJ9 P;  2FBW C;  2OTK E;  2ADQ B;  1EZV G;  1H8A A;  4I0X B;  3G6E V;  4LFA B;  3CCM V;  2OCC C;  2IJK A;  1N2D C;  4LFC B;  2YIU C;  2EIN C;  1M57 C;  5FPO A;  4MTF A;  1S5H C;  4NTX A;  3BRT B;  3CX5 F;  5IJ0 B;  1EZV D;  3BA8 A;  4X64 O;  2LXC B;  3D6Y A;  1UPG A;  3X2Q B;  1MUU A;  1WNS A;  5CA0 B;  2G8Y A;  4QMA A;  3OTF A;  1IDS A;  2X6A A;  5KLI C;  4I50 B;  1MSW D;  1IZN B;  3QNE A;  3P8M C;  2GHY A;  2E75 B;  4YJ3 A;  1WB7 A;  4B3T B;  2UXC O;  4JI7 B;  4LF5 B;  5EYP B;  2GM4 A;  1W0J G;  5C8Y A;  2JGU A;  2XOK G;  1S5L H;  3HD7 B;  2CTP A;  3AEE C;  4KT0 J;  2Y9Z A;  3JAT A;  3CXH F;  4PA3 A;  2DWE C;  1SQB J;  2IFN A;  1RF0 C;  1H88 A;  4LF6 O;  3CX5 E;  4AQR D;  2V7Q G;  4DV4 B;  3K0D A;  2RMZ A;  1HNW O;  5H6Q A;  1AI5 A;  2B5U A;  2DYS C;  3L70 H;  1XMO O;  4GKK B;  3OEH G;  1P49 A;  4B08 A;  3HPL C;  2XND G;  5B5E E;  5DN6 G;  1VQ8 P;  3G80 A;  2JKV A;  4DUY O;  1RE4 A;  2HOD B;  2GUS A;  3ZMU A;  1ZME C;  2O01 J;  3W68 A;  3ETD A;  3PHL A;  2Y0C A;  3H1I E;  2F43 G;  1TVK A;  2KUB A;  3V6I A;  2Y48 A;  3CXH E;  2JJ2 G;  2GTS A;  2NZ2 A;  1L4A D;  1WP8 A;  1EM1 A;  1NKD A;  1PM9 A;  1GN6 A;  3AE2 C;  1B3Q A;  3NFQ A;  2MK3 A;  4WFB V;  4WFE A;  4HNA A;  1LTB C;  3E22 B;  3DGE A;  3R66 A;  4P30 A;  2W83 C;  1YTF B;  1LUW A;  2CK3 G;  3L73 H;  1Y47 A;  2IM9 A;  2N9Y B;  1AJP A;  3ZMS A;  4DV7 O;  1LTS C;  4UB6 E;  2RN9 A;  2D2C D;  3T1C A;  4LWS B;  3JD4 A;  3BPZ A;  1URQ A;  5KLV G;  2W27 A;  4U7J A;  1ZTE A;  2CUG A;  4JV5 B;  2ZYA A;  4DR5 B;  4ZI7 A;  4JTD B;  1A02 J;  2QEX P;  2VWK A;  4JTA B;  4GX5 A;  2ZCE A;  4MW3 A;  1DK1 A;  2OWO A;  3O6Q B;  4IIJ A;  5KLV D;  3BRC A;  4ZOL B;  5AW0 B;  3T4Z A;  5AW3 B;  4QJF B;  4GKG A;  1ZR2 A;  5B1B B;  1BCC E;  4O4I B;  2OGU A;  1DX7 A;  3JD0 A;  2JDI H;  3H32 B;  2ZFC A;  5KHG A;  2GTA A;  2DOS A;  1T2K D;  2B9Z A;  3Q5S A;  1JNM A;  2E5T A;  3RW0 A;  1L1F A;  2WLH A;  3CX5 I;  4L74 A;  3I55 P;  1Q90 D;  1NTK K;  3KZI E;  4B86 A;  1CI6 A;  3N4X A;  3AG3 C;  4EDF A;  3WUV A;  1YF2 A;  4MVU A;  1Q86 W;  2C0W A;  3T97 B;  3Q5P A;  1YTZ T;  4JI0 B;  2XKM A;  2ZD9 A;  5TIS Z;  4CH6 A;  3F7Y C;  4IFM A;  4DOJ A;  1FFT B;  3CXH I;  4NTY A;  1KYO I;  1JVM A;  1WPX A;  2N04 A;  4H13 B;  4U3J B;  5IY5 B;  1H2L A;  4JPZ B;  3L37 A;  3LUT B;  1GH6 A;  1SQF A;  1PP9 E;  1VAR A;  1FDI A;  3RN4 A;  4QE7 A;  4U3F E;  3FKS G;  5E1A C;  3TNU A;  4TV9 B;  1BSM A;  3OUS A;  1V54 C;  2ZM6 B;  2OYH A;  4RJT A;  1HWY A;  1YTF D;  4WBN A;  4FLY A;  3OM3 B;  1NVO A;  5KHH A;  3CXC U;  2YIB A;  1BS3 A;  2XDJ A;  1HNX O;  1L0N H;  3ABL C;  2GUZ A;  4MSW C;  5AW2 B;  3AED C;  4ASV A;  5CN0 A;  3U10 A;  4FLW A;  1AI6 A;  1NTZ H;  3MHS C;  3H1K H;  1S5J A;  2ZR2 A;  2BCC J;  3CCS V;  1N33 B;  2ZVN B;  3L74 E;  4L87 A;  3U59 A;  3ETG A;  5KKZ C;  2ZE6 A;  3DC6 A;  1K04 A;  5AVZ B;  1JCD A;  1OV9 A;  5BY1 A;  4K3A A;  5J2T B;  1H89 A;  1L0L K;  1IBL B;  4K0K O;  4ZIB A;  1I0H A;  3GHG C;  1IC2 A;  1OCR C;  3A8T A;  1H0T B;  4JI3 B;  1RM1 C;  4LF8 B;  2QSI A;  3VMA A;  2JEU A;  4UUJ C;  1QVG U;  2JWA A;  3MTU E;  4F6R A;  4FLX A;  1IK9 A;  3OGI B;  1QGK B;  3BCC J;  2QM7 A;  1HGZ A;  1LWU B;  1Y6X A;  3PN1 A;  2Q1K A;  5K1P A;  5LXT B;  3ZDM A;  1VQ7 P;  2EIJ B;  3H1L G;  1PL5 A;  1IO4 A;  2NRG A;  5AW6 B;  2FYZ A;  5KX5 A;  3HTK A;  3P3P A;  3IF4 A;  2PZS A;  3V4Q A;  2FTK A;  5IDJ A;  4X62 O;  1XOU A;  4KHP B;  3II6 A;  1IXB A;  3F5W C;  1BGY J;  2H7H A;  5GW7 A;  4TV8 A;  2D2C C;  2WSE J;  4QE9 A;  1XBL A;  3G71 V;  1Z5V A;  2PUS A;  2A06 G;  2XAS A;  3AG2 C;  1SQX H;  2R72 A;  2ZR3 A;  5LBQ A;  1Q7Y Q;  1N7S D;  2VWJ A;  2IBZ G;  3H1H J;  3HB3 B;  5AVR B;  3EQ2 A;  1LGH B;  4DR7 B;  4YJ3 B;  3APO A;  1J1D C;  5K5G B;  3I5C A;  3VTP C;  2A06 D;  5C8Y B;  4DR6 B;  1OVR A;  2KLU A;  3JAT B;  2QWQ B;  2IH3 C;  4Y99 C;  2YEV A;  4UXN A;  3ML0 A;  5DED A;  2BAS A;  2Q5U A;  4FLV A;  3K5M A;  2UXN A;  1K05 A;  3QWO C;  1N8R W;  3FB7 C;  2K9J B;  3CCE V;  3L75 E;  2O01 N;  3MUD C;  2LXB A;  1HBW A;  2N1T D;  1US6 A;  3R2P A;  5B5E H;  3CCR P;  2CGO A;  1OCZ B;  2Q4P A;  1DGS A;  1P84 D;  2WIT A;  1K4C C;  2QJ1 A;  1YDX A;  3S1K A;  3E89 A;  3GLM A;  4D6T D;  3LSQ A;  1VPC A;  1H2M A;  3H1I H;  1OW6 A;  3A2A A;  2Z0A A;  3CXH H;  1ZL8 A;  1W59 A;  1R1B A;  1FJK A;  4CC6 A;  3CMA P;  3IFX A;  1OCO B;  1DF4 A;  1XHZ A;  5H6R A;  3GB7 C;  3AEI A;  3E2E A;  2OTJ P;  1KB9 D;  2XAH A;  1S0V A;  3I56 P;  4HNA B;  2IJH A;  3D8C A;  1IK7 A;  3USS A;  1JJ2 U;  5KHJ A;  1HNZ O;  4NXM B;  1X8Y A;  4DW1 A;  4DR3 O;  1M56 B;  4PA6 A;  5LMU O;  1URQ B;  4AIL C;  4ZKI A;  1VQP V;  1NKZ B;  1VF6 A;  1J1E B;  3WUU A;  4YXW G;  1BMF G;  1OWA A;  4HB1 A;  1HF9 A;  1M5I A;  1QVF O;  2YMK A;  2XNX A;  4OX9 B;  4KFM A;  5KLV K;  3G6E P;  1FZC C;  5AVS B;  3RL0 B;  4IIJ B;  2YO2 A;  5LGN A;  3THO A;  3N2G A;  4DYL A;  1SQB D;  4X20 A;  2W6J H;  1YJ9 V;  3N7N A;  1GTO A;  5APW A;  1ZUQ A;  2AW9 A;  3ASO C;  3U0Z A;  1MAB G;  2O3J A;  2P10 A;  1FJG O;  1HJ0 A;  4J42 A;  2H8P D;  1EN5 A;  2C9N Y;  3L72 E;  4OGQ B;  2YSU B;  1L0L J;  3ZMT A;  3JAW A;  4OWF A;  3UKM A;  4O4H A;  2Z3Y A;  3EVK A;  3VMZ A;  2IW5 A;  1WRG A;  3W67 A;  1CI6 B;  3TDK A;  1XRE A;  2E3C A;  1CEZ A;  1N34 O;  3M8A A;  5AVU B;  5AW9 B;  1ZRT E;  2R44 A;  3TGU J;  4H37 A;  4PHZ A;  2V4D A;  2P5O A;  3OR6 C;  1PGO A;  1XNQ O;  2O1J A;  3LSS A;  3WB2 A;  2Q6Q A;  3JD1 A;  2QJK B;  1N32 O;  4CH3 A;  3IJ4 A;  3AE1 C;  1QNM A;  1HTL C;  1S72 P;  2WSF H;  4LF6 B;  3U1C A;  5B3S C;  2UUA O;  1HNW B;  3UIA A;  5IJ9 A;  3H9V A;  4U3F H;  2WLN A;  3SGI A;  1DF5 A;  1OIP A;  1RPR A;  1YEW A;  4X66 O;  3RYH A;  4BXL A;  4JAU A;  3TNU B;  2QE7 H;  1VQ8 V;  5LHG A;  3K03 A;  2HHH B;  3GHG A;  2YID A;  1W5C E;  2E43 A;  1YQ3 C;  4C7N A;  2Y4T A;  3HE4 A;  2OYH B;  2WAM A;  1EN4 A;  5L3D A;  3H6P A;  4LF4 O;  4WBN B;  5AVT B;  5J9P C;  4UVB A;  3JAR A;  1PD3 A;  1FXK C;  4J80 A;  2Q3I A;  1URQ D;  2NN4 A;  3K59 A;  5CCG D;  2R3C A;  2YXY A;  1YIT P;  2L91 A;  3M9Q A;  2GUZ B;  1N7S C;  1L4A A;  5L3E A;  1U7J A;  1NJI Q;  4G28 B;  1T3U A;  2AEJ A;  4PI0 A;  5JJN B;  5TJH A;  2KYV A;  3L70 G;  3CB2 A;  2OCC B;  3RL0 D;  4DV7 B;  2ADP A;  2VQE O;  1B6Q A;  2QWO B;  3TCU A;  3U11 A;  2EIN B;  1M57 B;  1NKN A;  2M3E A;  4JAA A;  2M0B A;  3TET A;  2YIU B;  1NOH A;  4I2L C;  5EFW B;  1NR1 A;  4JF3 A;  2V7Q J;  1M90 Q;  2CAZ C;  2WLK A;  3L70 D;  3VMY A;  2QEX V;  3FWN A;  1NBM G;  5KHK A;  1OCC C;  2WPV B;  2GBO A;  1IBM O;  4OGQ D;  1A02 F;  3H01 A;  2HFE D;  2N1T C;  4HYT B;  4UCS A;  1SQV H;  1JMM A;  1SQP G;  1GAX A;  4F6R B;  1SP4 A;  1IXM A;  2UXB B;  4QNH B;  4R4L A;  5APX A;  3L73 G;  2I1K A;  1CP9 A;  4DR1 O;  1W2B O;  3QF7 A;  3ZRV A;  4DK1 A;  3RK2 C;  1SQP D;  1H8H G;  2O1K A;  3K58 A;  3TF5 A;  2DYS B;  3MUD A;  1GN3 A;  2BSK A;  2HJF C;  1SFC C;  4I4T A;  4FVM A;  1CSB A;  5KX5 B;  5IWA O;  3HTK B;  3I55 V;  1KQS O;  3STZ C;  1ZX3 A;  5EYP A;  2Y69 C;  2NPS D;  5CA3 A;  5KLV J;  1VQ4 P;  4TV8 B;  1P7B A;  4LF9 B;  2FYU E;  2R3S A;  2HJD A;  2YIC A;  3SPH A;  4N6J A;  2JDI G;  4LF7 O;  5DJT B;  5B5E Z;  1D5A A;  2PGG A;  4IYH A;  2K1E A;  4LH7 A;  1JA8 A;  1YXB A;  1BZK A;  2N9B A;  2HOD A;  3JD3 A;  3B77 A;  3RK3 B;  2QJY C;  2YIB D;  2ZT9 B;  2ZE8 A;  4FJC C;  2Z5H A;  3RT3 C;  2YEV B;  2YUA A;  4IFD K;  3L75 H;  1TUE B;  2NR5 A;  1AJY A;  4RO0 A;  1DTO A;  1KZU B;  1R8E A;  1NWQ A;  2Q7C A;  4QPK A;  4P9O A;  5CMU A;  3KPE A;  1M57 D;  1FZC A;  3Q1M A;  4K8Z A;  3I5D A;  4LFB O;  4UB6 Z;  1IBK B;  2IYO A;  2F95 B;  1N0J A;  1NAF A;  3T2M A;  4D7T A;  2J58 A;  1PNL A;  1AVM A;  1ZL8 B;  4YIO A;  1KMI Z;  2UUC B;  4PA7 A;  1UFI A;  3A0R A;  1J5E O;  1G1X B;  1QBZ A;  1XNR O;  2JEX A;  4WFF A;  4DV0 O;  4B3S O;  3OD4 A;  3O6Q A;  3Q2Y A;  4WFA V;  1BGY D;  1V9P A;  1GTW A;  2W6B A;  2RMK B;  1TUB A;  4UCR A;  1M4U A;  1RE3 A;  3AG3 B;  3OTO O;  1QCE A;  1PFI A;  2IPP A;  3B8E B;  4L76 A;  1KIL C;  4YXD C;  1Q6U A;  1PL0 A;  3FYI B;  2O57 A;  4XFJ A;  1OJH A;  1GL2 C;  3MIW A;  5A9G A;  1JUN A;  1S9K D;  3FAV A;  2RJZ A;  4JI4 B;  2HKO A;  3KZI Z;  3SWK A;  1SQB K;  1S5L X;  4XDL A;  1FE6 A;  1IZ3 A;  4OPH A;  1NTZ G;  3N2G B;  3H1K G;  4GX1 A;  4X20 B;  2BCC E;  1VQ7 V;  1FAF A;  2I1J A;  5AW1 B;  3T97 A;  2ATK C;  4DR2 B;  3BRV B;  1BDD A;  3UT5 A;  2A7W A;  3H25 A;  2WQY C;  2Y0E A;  1FC2 C;  2Q67 A;  2QDO A;  3L72 H;  1WA8 A;  1JTH A;  1Z56 A;  2XU6 A;  2IYP A;  1ROP A;  1PNM A;  1D7M A;  4QIW F;  3CS5 A;  5BXZ A;  2KOG A;  3JAW B;  2KP8 A;  3A0B E;  4HAM A;  1V54 B;  1U7M A;  3OAK A;  4O4H B;  3SDL A;  1SKV A;  2B1I A;  4IL6 E;  3TXS A;  4L73 A;  1HDJ A;  2WLL A;  2PTM A;  4ICG A;  2EX3 A;  3HKD A;  3GF3 A;  3BCC E;  2FML A;  4B3R O;  5L3G A;  3ABL B;  1N7S A;  1BL8 A;  2LW7 A;  4CH5 A;  3W7W A;  5KA6 A;  1M7L A;  4JI1 B;  1KD1 W;  4YY3 O;  2H43 A;  4XDJ A;  3P7K A;  2K37 A;  3SWY A;  1H2N A;  3Q4H A;  4H44 C;  5IJ9 B;  1PPJ H;  3H1L J;  1AA0 A;  5FLX N;  4OVN F;  5CCH C;  1BSH A;  1JO5 A;  1M93 A;  4U7O A;  5H2F E;  2E5L O;  3CCR V;  5KJ7 C;  4KUM A;  1SQX G;  1QL2 A;  3K9S A;  4ZNC A;  1DEB A;  3M7M X;  4MT8 A;  3GHG B;  1ZN5 A;  3FB6 C;  2XAQ A;  2N1T A;  3H1H E;  1OCR B;  4C7N B;  3CME P;  2Z5I A;  4A7P A;  1NQT A;  2WLJ A;  3E8F A;  1RM1 B;  1AQT A;  2LGW A;  3ETQ A;  1SQQ H;  1GN4 A;  1R5L A;  2CE4 A;  2VS0 A;  3JAR B;  3CE2 A;  3ITK A;  1QR9 A;  4DUZ O;  1SQX D;  1LNQ A;  4PD4 F;  1HH0 A;  2ODM A;  2KZI A;  1NU1 H;  5LMN O;  5CBG A;  3L71 E;  1I7F A;  2Q7H A;  1T3J A;  4QPJ A;  1JPX A;  2OTJ V;  1L4A B;  1NAY A;  3SYO A;  3OMI B;  1NTK E;  1VQP P;  4MN4 C;  1SFC A;  2JK5 C;  3ZRX A;  1SES A;  4FM1 A;  2IJJ A;  1OVV A;  2ZXW B;  4DO2 A;  1T6A A;  1THZ A;  1S1C X;  4DV1 O;  1QL1 A;  4JI5 B;  3J7A U;  5EBW C;  4PJ0 E;  2D2C B;  2OYO A;  3RK3 E;  3W7S A;  3WU2 E;  4R6Z A;  5LYJ A;  4JZG A;  3AG2 B;  1WN7 A;  4E2L A;  2F4V B;  4PD4 E;  5CA1 A;  4R8C A;  5GTH E;  1NTM H;  2A0L A;  3CSX A;  4W7Z A;  1K5S A;  3BFR A;  4FZ1 A;  2B9B A;  1J1D B;  1HW7 A;  4DV3 O;  1NZ6 A;  5APS A;  3IC9 A;  4YPC A;  3GW6 A;  1EQ7 A;  4YHH O;  3LW5 J;  3RYF A;  2JEE A;  3AG4 C;  4Y99 B;  2DQ0 A;  4WFH A;  3MHH C;  1F7Y A;  1SQP K;  3HRN A;  1GM8 A;  4C7U A;  2QA4 P;  2WSS G;  3KYQ A;  2BEQ D;  4FLU A;  2QIW A;  3QVN A;  2W8Z A;  1NH2 B;  2BSK B;  4I4T B;  2F66 C;  1PGP A; 
#chains in the Genus database with same CATH homology
 3RVY A;  5B1A B;  1R6K A;  1AI6 A;  3MHS C;  4MTO A;  2ZR2 A;  3CCS V;  4L87 A;  2W0F C;  3OE7 G;  3ETG A;  4FIP C;  1AI4 A;  1OZ0 A;  4MVZ A;  5B1B C;  4N21 A;  1RPO A;  3JD2 A;  2W6J G;  4N23 A;  4G2K A;  5DM6 V;  1PKX A;  4MS2 A;  1S72 V;  1OCR C;  3LDE A;  5EK0 A;  1RM1 C;  3QO7 A;  2CK3 H;  2JEU A;  3EFF K;  4PA9 A;  3ABM C;  4JPR A;  4UUJ C;  1QVG U;  1AI7 A;  1GO3 F;  1YI2 V;  1S76 D;  1EFR G;  1SZT A;  4H33 A;  3W7T A;  2QM7 A;  3LDD A;  3SYA A;  5L3B A;  5HFL A;  1Y4M A;  2EIJ B;  3B8M A;  3IC7 A;  2P90 A;  2WLI A;  1JOY A;  1P4R A;  3CYO A;  4LP8 A;  2IH1 C;  2FTK A;  4XBF A;  5IDJ A;  4MVM A;  3K06 A;  1G8M A;  3F5W C;  1YIT V;  2Q69 A;  2X7R B;  3OR7 C;  1FXK A;  5GW7 A;  1IFP A;  1R73 A;  4QE9 A;  3ZMV A;  4JTC B;  3G71 V;  1JEK A;  1ARO P;  2XAS A;  3AG2 C;  3JCZ A;  4TLF A;  2ITC C;  2ZR3 A;  3ASO B;  5LBQ A;  2HVJ C;  3HB3 B;  3W7U A;  3JYC A;  3WG7 C;  3CCQ V;  2QE7 G;  2H94 A;  2EIL C;  4FK5 C;  1EBO A;  2IH3 C;  4MVS A;  4UV9 A;  4WF9 V;  1KEC A;  2YEV A;  4UXN A;  3ML0 A;  2UXN A;  4J9Z B;  4BAY A;  1N8R W;  4J9Y B;  3FB7 C;  3CCE V;  1NH2 D;  3OMA B;  3TK1 A;  1FS0 G;  1JCH A;  3CCJ V;  1OCZ B;  3ABT A;  5EBL C;  1K4C C;  2KB1 A;  3DTU B;  5KUK A;  3ABM B;  5HFM A;  3ZRW B;  4FMT A;  1VQO V;  2LFS A;  3E89 A;  1VQN V;  2P6J A;  3LSQ A;  4R50 A;  5B3S B;  1PNK A;  3E8H A;  4MVR A;  3W7X A;  1COW G;  5L3F A;  1VQ5 V;  2A9H A;  4ZBM A;  3IFX A;  1OCO B;  3STL C;  1DF4 A;  5H6R A;  3GB7 C;  3AEI A;  1YIJ V;  3K3W A;  3E2E A;  1VQ4 V;  2XAH A;  1S0V A;  2LFR A;  2IJH A;  2Q68 A;  4X88 A;  3SYC A;  4WFG A;  3USS A;  1JJ2 U;  2WLL B;  1M56 B;  2ZDI C;  4PA6 A;  1H38 A;  2EIJ C;  3ETE A;  4JYB A;  4ZKI A;  1VQP V;  4GCZ A;  4YXW G;  2V1D A;  4MVO A;  1BMF G;  2EZO A;  3RVZ A;  1ORQ C;  4KFM A;  1E79 G;  3KG2 A;  5LGN A;  5C93 A;  4LCU C;  2HG5 C;  4OXS A;  2W6J H;  1R3I C;  1YJ9 V;  1ENV A;  1GTO A;  4CBC A;  1K33 A;  3ZMZ A;  1VQM V;  1AJQ A;  3ASO C;  1MAB G;  1KP2 A;  1OCC B;  2DWD C;  3CPW U;  1R6N A;  3ASN C;  2H8P C;  3LNM B;  2WLM A;  2PI5 A;  2YSU B;  3ZMT A;  1F4N A;  5IYD O;  1I5Y A;  2AHY A;  3RBZ A;  3UKM A;  2Z3Y A;  5BZB A;  3CD6 V;  2DYR B;  2IW5 A;  3D3I A;  1CEZ A;  3FB5 C;  3OUF A;  1JX9 A;  1NR7 A;  4TWK A;  4UVC A;  2EBO A;  4H37 A;  3OR6 C;  4P9P A;  3LSS A;  3M99 B;  2IJI A;  2Z5U A;  4HYO A;  3JD1 A;  1UJW B;  1Q82 W;  5LGT A;  3OAA G;  2M7W A;  4JAV A;  1OCZ C;  4GX2 A;  1SRY A;  2D3O W;  2Y69 B;  1K92 A;  1W0K G;  3CP1 A;  3R65 A;  1R3K C;  5B3S C;  3OFN G;  1S77 D;  2X6B A;  4WCE V;  2WLN A;  1GK9 A;  1DF5 A;  4PA4 A;  1RPR A;  1OCO C;  4JAU A;  1GM7 A;  4TT3 G;  3LDC A;  2W6I G;  4R7C A;  5LHG A;  3K03 A;  1VQ8 V;  2QE7 H;  3CCV V;  3ZJZ A;  3SPC A;  4LBE C;  2WAM A;  3AG1 C;  2X0L A;  5L3D A;  2XAG A;  5J9P C;  4UVB A;  1K8A W;  3SJQ C;  4FPP A;  1PD3 A;  1FXK C;  4PEL A;  3ZCC A;  4JGS A;  1M56 C;  3SPJ A;  2LP7 A;  4JYC A;  1YSC A;  3OMN B;  5LGU A;  5LHH A;  3K9A A;  3PJS K;  5L3E A;  3FYE B;  4G28 B;  4RO2 A;  3ASN B;  3UM7 A;  1DLB A;  4GX0 A;  4I9W A;  2DQ3 A;  2OCC B;  3B8N A;  4PDV A;  1JQ0 A;  3K08 A;  1B6Q A;  3TCU A;  2EIN B;  1M57 B;  3K04 A;  1K9M W;  3TET A;  1F23 A;  4RUE A;  1S3J A;  1NR1 A;  3MD0 A;  4JF3 A;  1QLE B;  3QO8 A;  3E86 A;  2QKS A;  2WLK A;  3VBB A;  2E5Y A;  1SET A;  4HZ3 A;  3CC7 V;  5IYB O;  3SPI A;  1YJW V;  2QEX V;  1NBM G;  2NLJ C;  1OCC C;  3K79 A;  1K3E A;  3EHB B;  3H01 A;  2HFE C;  1Q7Y W;  2GSM B;  1M9N A;  1J95 A;  3ZIA G;  4P2Z A;  2DW4 A;  1KKD A;  2DYR C;  1IXM A;  4QNH B;  3F7V C;  1CP9 A;  1K5Q A;  4YXW H;  3CC4 V;  3ZRV A;  3CME V;  1H8H G;  2Q6A A;  4RQF A;  2WPD G;  2DYS B;  2WLI B;  4U7N A;  5KUM A;  4UVA A;  2HJF C;  1E79 H;  1R3L C;  3I55 V;  3STZ C;  2Y69 C;  5CBF A;  3AG1 B;  1E1Q G;  4RAI A;  4WVZ A;  2R9I A;  1K7D A;  4KP4 A;  4LC1 A;  1VQ9 V;  2WWW A;  2ITD C;  4JAS A;  1QVF U;  2QM8 A;  5CA3 A;  3IGA C;  1SER A;  4X8A A;  3FB8 C;  1FXK B;  3CMA V;  5LHI A;  4UV8 A;  1P7B A;  1KC8 W;  1BSN A;  3SPG A;  4I5S A;  3P32 A;  2C2A A;  2QTO A;  3VOU A;  2HLD G;  4MTX A;  3SPH A;  1K73 W;  4Z1M G;  2UXX A;  2IU0 A;  2JDI G;  4PDR A;  3I56 V;  2EZP A;  2K1E A;  3P30 A;  1BHB A;  2PI4 A;  3OW2 U;  3JD3 A;  3B77 A;  3E83 A;  2EIK B;  5CBH A;  2R9R B;  5IYC O;  2XAJ A;  1ZWI C;  4FJC C;  2OT5 A;  4TSF G;  1VQK V;  5EC2 C;  1K4D C;  2YEV B;  3BY6 A;  4G27 B;  3CCL V;  2ZDI A;  1TUE B;  1DTO A;  1QR8 A;  3ABK B;  4QPK A;  3G6E V;  3CCM V;  2OCC C;  2BOC C;  2JJ1 G;  2IJK A;  3G4S V;  4P9O A;  5CMU A;  3E35 A;  2EIN C;  1M57 C;  4MTF A;  1XL6 A;  1S5H C;  4RUF A;  1CPY A;  1QLE C;  3T2M A;  1PNL A;  2QA4 V;  1GKF A;  2JIZ G;  3X2Q B;  4PA7 A;  1GMG A;  3A0R A;  1YHQ V;  4QMA A;  1QBZ A;  1V55 B;  2X6A A;  1Q81 W;  1MSW D;  2JEX A;  3QNE A;  4EKW A;  2GHY A;  2HVK C;  4WFF A;  3CC2 V;  4MTG A;  3ZN1 A;  1W0J G;  4WFA V;  2IU3 A;  2XOK G;  3OGC C;  4PA3 A;  2DWE C;  3AG3 B;  1M1K W;  1YJN V;  1QCE A;  4RQE A;  3SYP A;  2V7Q G;  3K0D A;  1F51 A;  1PL0 A;  3FYI B;  5H6Q A;  1AI5 A;  2B5U A;  2DYS C;  1QLN A;  3OEH G;  3HPL C;  2XND G;  5B1N A;  1WLE A;  2HKO A;  1MOF A;  5DN6 G;  4X89 A;  3ZRW A;  4XDL A;  1OHH G;  4BIZ A;  3ZMU A;  2A79 B;  4GX1 A;  3ETD A;  1VQ7 V;  4F4L A;  2ATK C;  2F43 G;  3QO5 A;  2Y48 A;  2JJ2 G;  2B1G A;  1VQL V;  3T4D A;  1G4Y B;  3BEH A;  2P7T C;  2Q67 A;  1NKD A;  1KP3 A;  1ROP A;  1PNM A;  4BW5 A;  2MK3 A;  4QIW F;  4WFB V;  2ZXW C;  2NNU A;  4PDM A;  4HAM A;  4WFE A;  1V54 B;  3DGE A;  2EIK C;  4P30 A;  2HR3 A;  1YTF B;  2B1I A;  2CK3 G;  5IY5 C;  1NVP B;  1AJP A;  3ZMS A;  2WLL A;  1H2G A;  3AG4 B;  3T1C A;  5EC1 C;  3JD4 A;  2EIM B;  1BHA A;  5L3G A;  3ABL B;  4DJG A;  2X6C A;  3ABK C;  1BL8 A;  3W7W A;  4JTD B;  5KA6 A;  3NXS A;  1W2B U;  1KD1 W;  3OEE G;  4JTA B;  4GX5 A;  4MW3 A;  1NJI W;  4XDJ A;  3K0G A;  2OTL V;  3T4Z A;  2AHZ A;  4QJF B;  1KQS U;  1K34 A;  2XAF A;  5B1B B;  1XL4 A;  5H9C A;  1Y66 A;  3JD0 A;  1BSH A;  3X2Q C;  1M90 W;  2JDI H;  4U7O A;  3CCR V;  4MW8 A;  4KUM A;  1V55 C;  3WFV A;  4MT8 A;  2E5T A;  3FB6 C;  2XAQ A;  1L1F A;  3RW0 A;  1OCR B;  5B1A C;  3ZN0 A;  2WLH A;  1NQT A;  2WLJ A;  4BIU A;  4CZZ A;  3E8F A;  2EJR A;  1FXV A;  1RM1 B;  1AQT A;  5L3C A;  3AG3 C;  1QR9 A;  1LNQ A;  4MVU A;  1Q86 W;  5EBM C;  1H8E G;  3E8B A;  1F4M A;  3GWO A;  5FL7 G;  5CBG A;  2ZD9 A;  1JPX A;  4QPJ A;  2OTJ V;  1EZJ A;  3SYO A;  3OMI B;  3F7Y C;  5B1O A;  1I5X A;  4GT1 A;  2JK5 C;  1AR1 B;  3ZRX A;  1SES A;  2IJJ A;  2ZXW B;  1FFT B;  4DO2 A;  1THZ A;  1JVM A;  1WPX A;  3SYQ A;  5IY5 B;  5EBW C;  3LUT B;  4Q20 A;  1R3J C;  3W7S A;  2WSS H;  4R6Z A;  4QE7 A;  3CCU V;  1VQ6 V;  3AG2 B;  4DXW A;  1AJN A;  4E2L A;  1MG1 A;  3FKS G;  5E1A C;  4R8C A;  4ASU G;  2A0L A;  2BOB C;  1K5S A;  3OUS A;  3WG7 B;  3ZRS A;  2P67 A;  3ABU A;  1V54 C;  4PDL A;  1K97 A;  3D36 A;  1HWY A;  1YTF D;  1FXH A;  3OM3 B;  5KA5 A;  1NVP D;  1E1R G;  4MVQ A;  2EIL B;  3CXC U;  3AG4 C;  3E8G A;  2V7Q H;  2DQ0 A;  2EIM C;  4WFH A;  3MHH C;  3ABL C;  4MSW C;  1GM8 A;  4XDK A;  2WSS G;  1GM9 A;  2XND H;  1NH2 B;  1FS0 E;  2ZQM A;  5CN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...