3EFFK

The crystal structure of full-length kcsa in its closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
b'SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
molecule tags Membrane protein
total genus 43
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3effK02
4MVZA 2K1EA 2EINC 2QTOA 4R50A 2WSSH 4HYOA 3SYAA 1LNQA 4RO2A 1G4YB 3UM7A 1P7BA 2WLHA 2W6JH 1R3JC 2EIMC 2DWDC 3LDEA 1OCOC 3SJQC 1R3KC 3FB6C 3K04A 3AG4C 4PDVA 4X89A 4R7CA 3F5WC 2IH3C 4XDLA 3USSA 4OXSA 4PA4A 4GX2A 4UUJC 2BOCC 4MTFA 4P2ZA 5CBHA 5J9PC 1AQTA 2WLLB 3ABKC 3E86A 3LUTB 3SPCA 2X6BA 3TETA 2DYRC 3GB7C 4PDRA 3FB7C 3K06A 4XDKA 2ITDC 3E89A 3SYPA 3ABMC 1BSNA 1E79H 3RVYA 5BZBA 1BSHA 2KB1A 2DYSC 2NLJC 4QNHB 3UKMA 2E5YA 2JK5C 3T1CA 3WG7C 4CBCA 1XL4A 1JEKA 1OCZC 4WFEA 4YXWH 3KG2A 3AG2C 2Q6AA 2WLKA 4MVMA 1K4DC 4X8AA 2WLJA 3IFXA 4J9YB 4MVOA 3LDCA 3JYCA 4WFFA 3K0DA 1XL6A 4KFMA 2HVJC 3SPHA 2XNDH 3E8HA 3F7VC 4H37A 3STZC 3T4ZA 3IGAC 4MSWC 4R6ZA 5B1AC 2Y69C 4R8CA 2ZXWC 4GX0A 4X88A 4H33A 5CBGA 5IY5C 4GX1A 4PA6A 1ORQC 2R9RB 4JTAB 4MTGA 4LCUC 4PDMA 4RAIA 4JTCB 2DWEC 2X6AA 5EBMC 4G27B 5E1AC 5B3SC 2P7TC 2CK3H 1QLEC 3EFFK 4MVQA 3AG3C 4XDJA 1BL8A 1M56C 2H8PC 2AHYA 3T4DA 3HPLC 2HFEC 5KUMA 2OCCC 5B1BC 2ITCC 3OGCC 3ZJZA 2JDIH 4WVZA 3SPJA 3F7YC 3SYOA 4ZBMA 4TLFA 2EIKC 3RW0A 4HZ3A 3K08A 4MVSA 2EIJC 3FB8C 3OUSA 3LNMB 3RBZA 1KKDA 3BEHA 1R3IC 4MS2A 4PDLA 2QE7H 3K0GA 2X6CA 3E83A 4PA7A 4G28B 1M57C 4DJGA 4RUFA 2A9HA 3AG1C 2WLMA 4WFHA 3ZRSA 1OCRC 4MW3A 2HG5C 2WLIA 3FB5C 2ZD9A 3OR6C 3ABLC 4MVUA 3STLC 2A0LA 2WLNA 3ASOC 4F4LA 4TWKA 1J95A 2QKSA 4MW8A 4QE9A 4QMAA 4P9OA 1K4CC 2Q69A 4QE7A 1OCCC 2EILC 1V54C 4MVRA 1S5HC 1ZWIC 3R65A 5EC2C 4MTOA 3E8FA 3SPIA 4DXWA 4EKWA 3K03A 2E5TA 4BW5A 1R3LC 2BOBC 2Q67A 2W0FC 2IH1C 4J9ZB 3E8GA 5EC1C 4GX5A 5EK0A 3OUFA 3E8BA 2HJFC 2V7QH 1JVMA 2ATKC 2HVKC 2WLIB 5EBWC 3SPGA 3TCUA 3PJSK 1IFPA 3ASNC 3SYQA 4P30A 4RUEA 2A79B 4PA9A 2YEVA 5CBFA 2Q68A 5KUKA 4LP8A 4I9WA 2AHZA 3T2MA 4LBEC 4JTDB 4WFGA 3LDDA 4P9PA 1V55C 3OR7C 3VOUA 3X2QC 1FS0E 4PA3A 2WLLA 3SYCA 3RVZA 5EBLC
chains in the Genus database with same CATH superfamily
4R50A 4ASVA 2WSSG 1NU1J 1ZOYC 4DR5O 1F4MA 3QG5A 1H0TB 1ZLZA 3FB6C 2IBZH 1NTMH 5KHIA 5KLVH 3RL0B 4P2ZA 3QO5A 5J2UA 3JSNA 1AI7A 4RQFA 3TETA 2DYRC 2XUMA 3HE5B 2M5AB 1VQ5P 2PYLA 1BSNA 1URFA 1I5XA 3OMNB 1SFCC 2DYSC 2NLJC 3K59A 3EXAA 4CBCA 2FMLA 1QL1A 2E76C 3H1IE 1LJ2A 3JCZA 4EEQA 2Q6AA 1L0NG 5APUA 3CLQA 1COWG 1K34A 1X9VA 2NPSD 1LTBC 3HE4B 3WU2H 2N05A 3CS5A 3ETQA 1YJ9V 5AW7B 2MW2B 4OGQC 5GTIE 1BE3H 2XNDH 4LF5O 3CXHI 1IBLB 1WLEA 4R8CA 5IY5C 2A06E 2F23A 4IFDK 2R9RB 2B87A 3H32A 1Y67A 3P8CE 1NR1A 3M7MX 1NTZG 2BEZF 2YI9A 3KCYA 1BHBA 2ZAEB 2PGDA 5AVSB 1VQ9P 2ILMA 4F6EA 4Y99B 3ZRWA 3JAKB 4MVQA 1NHLA 1Q7YW 3T4DA 3HPLC 3L74H 1IFMA 3ZJZA 4R4LA 1F23A 2KKWA 1D2DA 2QWNB 4GOEA 2B88A 2KNCA 2QGNA 3RK3C 2QIWA 3W7SA 2IJIA 1LT1A 3F5HA 1M57C 1S1CX 5LP6B 3L71J 4IOIH 1NVPD 2E43A 3AE3C 1NQTA 1L0LE 2WSCH 1GMGA 1LUVA 5CA3A 1JB0J 3ZRXA 1KB9I 2B5UA 3LSQA 3CRMA 3II6A 1S77D 2KSJA 1B04A 1OW8A 3U1AA 3H1JG 3QF7A 2W0XA 4EKWA 1SC5B 1JMBA 5H9CA 2IJHA 2IH1C 4FLZA 3E8BA 2I1JA 1PPJH 2VRSA 3L70E 1BZKA 1JY3P 1P84E 2XHBA 1BCCD 4IIJB 4RUEA 4YJ2B 4L8JA 3HKDB 2VWKA 3D8CA 1K04A 1NTKK 4DCKA 3A2AA 1JA8A 1IBLO 4GIFA 1SQBG 3V2QA 2WLLA 4WVZA 4N23A 4UB8E 2Z4EA 2QTOA 3ASNB 2ZKOA 3CX5D 1J1DC 3THOA 2B89A 1Y74A 2KLVA 1Q82W 1R3JC 3AE9C 3QO8A 1RY3A 5AW0B 1GTWA 4IFFA 2PYJA 1X0TA 2J5UA 3CC2V 4LWSB 2JJ2G 5LA6B 2F43G 3DXRB 4WFBV 3FKSG 2OYQA 4PV1D 3K06A 3E89A 1NJIW 1M1JC 2YSUB 2HFED 1WB8A 1GL2A 1GU5A 4C7NA 3C9IA 3VN0A 3LSUA 1VF5C 2QWPB 1PP9H 1URQD 2K9JB 2G3AA 1AROP 1JEKA 4X1YB 4C7UA 4YXWH 4R4MA 3Q3DA 2WMMA 3RK2C 1RF1A 1YCIA 1KU9A 1MFTA 3IFXA 4B3TB 1XNQB 1DD4A 1N2DC 3HTKA 1O9HA 1URQA 3CI9A 2A3QA 2WSFJ 1N36B 4GKJO 1NI8A 2ZXWC 5L3BA 4H0LD 2FFDB 1HNXB 1KYOH 2WWWA 1AVOA 2UXBO 1T6AA 3ZS8C 4JGSA 2OCHA 1HNZO 4ZKIA 3GWOA 2IBZD 3FYEB 1GKFA 1LTJC 3V2PA 1V9PA 2Y9YA 5DJTB 5KLVD 3RW0A 2CTQA 3JSVC 4BRYA 3A0BZ 1PKXA 1VQ8V 1BCCJ 1EZVE 4MS2A 2Q0AA 2DE0X 5KHJA 2LO1A 2NPSC 3FWNA 4EFEA 4PA7A 4I4TA 3CPWO 1S9KD 3VMZA 3TGUH 5EZYA 1FXKA 5GONB 4BIZA 5KHKA 5DEDA 2NNUA 4ZKPA 2CTRA 1L0LD 1SQXG 4UB6Z 3JD4A 2O1KA 4IL6X 2E5TA 5AW6B 4HNAA 1L0LK 1BE3D 2KOGA 1JVMA 2Y0CA 4TV9B 4UVCA 1S72P 4KT0J 1HDJA 1MFZA 3JASB 3JATB 3ZHUA 2EILB 2L5GB 4I1LA 1L8DA 3B77A 3LDDA 1VQ5V 5B5EZ 4DR6O 5KA5A 1RF0C 3RVZA 1AVMA 2ZE5A 1VF6A 1S5LZ 3L74D 4FM2A 3C3TA 5CB4B 1P84F 2JIZG 3O6QB 1W59A 2DWDC 3S3XA 3W67A 4F6RA 1J5EB 3OM3B 2C9NY 2BOCC 4GCZA 5FL7G 4JF3A 4B7EA 1FBMA 4LR3A 2ITDC 4U3JA 3K9SA 4ZOLB 3RN4A 1XMOB 4H13B 2XAHA 2E5YA 1WRGA 3RYFA 3HKBA 1AI5A 2Y0IA 5KLIB 4WF9V 4DR2O 2HHHO 1U57A 1SQGA 2D2CC 5IYDO 1DF4A 3FXEA 3EVKA 2E75C 5L3FA 2LGWA 1PPJD 3B8MA 1VEWA 2Y0PA 4LH6A 1GO3F 1IXBA 1YTFB 2JR8A 4FFBB 1BS3A 1QLED 3FFQA 4AYCA 3CRAA 2PFXA 2XV5A 3L9DA 1VMGA 1XMQB 1L0NE 4XFJA 4CH4A 3E7KA 5D5QA 4LNUA 2CK3H 3L35A 1XNRO 4JYYA 4LF7B 4B3MO 1P49A 2KIKA 3A0BH 5H2FE 1L0LJ 3H1HH 5KA6A 1KILE 2OYHC 1XILA 3L72G 2JDIH 2HFEC 5AW2B 2ITCC 3OGCC 4FK5C 4WBNA 1BE3J 2FYNB 3CMAP 4JYAB 2Y4UA 1NTZE 1R6KA 2C9LY 4CH6A 3LNMB 5JJEB 1KB9H 2CGOA 1R3IC 2BASA 3QWOC 3E83A 4BR6A 4UB6H 2UUAB 4YJ3B 1Y4MA 4B3RB 1B06A 4K8XA 3L75G 2M8RA 1DEEG 4GT1A 1PP9D 2C2AA 1EN5A 3QH9A 2JWDA 1KKCA 3L74J 2QM7A 4MVRA 3PRJA 5JJNB 1RE3A 3MGNA 1J1EB 1YIJP 1GMJA 4DYLA 5KX5B 5B5EH 4AILC 3JC22 1VDFA 1DD3A 4WY4B 2JEUA 4NPEA 1S5LH 2P06A 1KYOD 2PF4E 2XTAA 5JWPA 1GTOA 1GM7A 3H1JE 3CWBG 1V55C 4DV1O 3M9QA 3HD7B 3IN6A 4RJTA 1YQ3C 3K5MA 3SYCA 2QRXA 4DR4B 1R6TA 3RYIA 1SQPG 3IAYA 2YMKA 3HUSC 2IZ1A 3ZBHA 1IBKO 2GA1A 1Z5VA 2J58A 1WA8B 2W6JH 4HKZH 2RMZA 2OTJP 3KPEA 1NU1H 5K5GB 2W27A 1YITV 1ZL8A 3CCMP 2QJKC 2P2UA 1SQBE 1MG1A 2Y48A 3SPCA 2X6BA 4X20B 3TGUD 1WNSA 2YKQA 3D71A 4JYAO 4UCRA 1VQOP 4JI7O 2CPSA 2IFNA 5APQA 1QBZA 4YIPA 5A2QN 1TAEA 5ITZB 3J7AU 4JQ0D 2IFMA 4FLYA 1M9NA 2P5OA 2Z5IA 2WLJA 2OTKE 1JR9A 1JJOA 3JYCA 4E2LA 1DTOA 4DV6O 5FNVA 1ZXGA 1LP1A 1YQ4C 4O4HB 3MP7B 4D7TA 3SWKA 1NZ6A 5CBGA 2KYVA 1KMIZ 2IW5A 3WG7B 4W7YA 5LOVA 3FGAD 2OYOA 3AG2B 2KUBA 3J80N 1RQVA 1K33A 2M7WA 3K5NA 1PP9J 1D5AA 3VQWA 2L6LA 3CJHA 5H6RA 1VARA 3M0AA 1MA1A 1LT9A 1JOCA 4DV4B 1M56C 4EDFA 4LGDE 3OTOB 1L0NK 2OCCC 1N7SA 3I5DA 1THZA 3OTFA 4JV5O 1IFIA 2Q7CA 4WBAA 4DR7B 5LXTA 2VQEB 2YIUB 4LC1A 1IFJA 5APTA 5AW8B 5B66Z 2CE4A 1M90Q 4BIOA 3G6EV 2Y9ZA 2ZR3A 3ML0A 1HWTC 3HKCA 5IJ9A 2GUVA 5JVDA 4CPGA 1TA8A 4IFMA 1NTZK 2AEMA 4MW3A 2DJVA 1SLQA 4D7SA 3CXHD 5EFWB 4GYCB 5AVQB 2ZFCA 5DN6G 1K4CC 5TISZ 1LTGC 3JAMN 3BCCG 2ZT9B 2M0BA 1GRJA 2UWJE 4X62O 3I5CA 2I8DA 1H38A 1P84I 1SA0B 1NTMG 3M99B 1I94O 2BE3A 2H3OA 5KLVG 3UO3A 4IT5A 1IFPA 2F4VB 1Y76A 3I56P 2P90A 4RKUJ 2A79B 3E35A 4AQYB 4LFBO 5LGTA 2JKVA 2UXCB 1SQXE 2LXBA 4KL1A 5FPOA 5KAFZ 1N33B 1FJKA 2AHZA 1JX9A 3W7WA 4I7ZC 5GW7A 2FYUG 1OJHA 2M3BA 2X0LA 1CXZB 3H1HD 2YS8A 5CCHD 3S4RA 2ZYAA 2FKWB 2OT5A 1F7YA 1G4YB 1K3EA 3HKEA 3UM7A 2NZ2A 1JM0A 3SJQC 4QPKA 4L73A 3K04A 2I1KA 3W7UA 1KB9D 5KMGB 3CCSP 4X1IB 1AQTA 1SFCD 3OTOO 2IZ0A 2RNBA 5M1BA 1BT8A 5LYJB 2BTQB 1IXMA 1TUBB 1KQGB 2E76D 3T1HO 2KLUA 2QJPC 3CP1A 2DW3A 4D6TG 1Q3EA 4ZI7A 2WA3A 4PD4F 3UT5A 3B5NB 4X64B 3WUVA 1SQBK 1SFCA 3AG4B 1AP6A 3BY6A 4UCSA 4OGQD 5IY5B 3ABKB 4I50B 2H88C 5GTIZ 2YIBD 5AVZB 4Z1MH 1N73C 2ZIOA 1PZQA 4X66B 1QHTA 1AA0A 3CMAV 2V1DA 3STZC 4NXNO 3E22B 3DC5A 1YDXA 2JGDB 3AEDC 3JD0A 4DR1B 1FDOA 2WSFH 1H89A 4JI3B 1N32O 1OFCX 2NN4A 1OVVA 3ETGA 2ZXXA 1FFXA 2P7TC 4N3YB 1L1FA 1CSBA 1TU3F 5E79E 2POHA 2Z5HA 3L73H 5IJ0A 1FKAO 3TYYA 5B66H 4AQYO 3RK3B 2Y0EA 1UJWB 4B86A 3M91A 3H1KH 3JAWA 4IGGA 2AEJA 1NO4A 2CUGA 3GHGB 1EZVI 1M57D 3N2KB 4TSFG 1XI1A 3CXCU 3V6IA 4EOTA 4TUYB 5AVVB 3Q5RA 1PNMA 1YIJV 3DGEA 1MOFA 3B8NA 5TISH 2X6CA 2OARA 3H01A 1NTKH 3AE7C 4EB6A 3L72E 3ZHTA 3D6YA 5K1PA 2PTMA 3R66A 5IWAO 5H5NA 3ZMSA 1V54C 1GD2E 4X1KB 3R65A 2PP6A 3SPIA 1JY2P 3C8VA 1AVYA 1XTGB 5KAFH 1LWUC 2QKAA 1OW6A 4JI6B 1VQ7P 3L75E 2OTJV 1U7JA 4NYKA 4N21A 1M90W 2N1TB 5AVUB 4PA9A 3CCMV 1KILC 1R73A 2P7JA 3EHBB 2XAGA 1D5NA 4GKKO 3KQGA 1PL5A 5EYPB 4MT8A 3OA7A 4UB8Z 2LFRA 3OR7C 3NXSA 1VQOV 1VQ6V 2BSKA 4H44D 4UXNA 1SZXA 4DW1A 2K1EA 1SQXK 2Q4PA 3OFNG 3MHHC 3SJBC 2JEEA 2YEVB 2AGAA 1OCOC 3B2EE 2IJKA 4I0XB 1T3UA 4R7CA 4OWFA 3H1IH 5CBHA 3CWBE 3RYHA 3KDPB 3T97A 3E86A 2FXPA 2SPZA 1VF5D 4BAYA 2AXCA 1S0VA 1H2KA 1SQPE 3CCUP 1VQKV 5GTIH 1PNKA 1NJIQ 1M1JA 3RK2D 1CI6A 2MKVA 2A06H 3JARA 1FJGB 5J2UB 4ZMDA 1L4AD 1SQVE 4FPPA 1TGOA 3GWKC 5CCHC 3IJ4A 3ABMB 1AP5A 4FMTA 3M0DC 2JJLA 3TGUG 4PDMA 4WFAV 4JI6O 1LTJB 1AQ5A 1VQLP 3RYCA 1K5QA 1M7LA 3CCVP 1WN7A 1HW7A 1Q6HA 2QWOB 1Z2GA 2Y69B 2E74B 2YIDA 4L75A 1EN4A 1L0LH 5B1BC 3VMXA 2B87B 3NMDA 1N7LA 3H32B 1EFRG 2ZNIA 1LTJA 2EIKC 4HZ3A 2YIAA 2K88A 1Q43A 2UUCO 1ZRTE 1CPYA 3ZRWB 2QE7H 2PI5A 4OH8B 3T1YO 3AG3B 2NPSA 3I56V 4DJGA 3BABA 2ZYDA 3L70H 5KJ7D 1P84H 1SQXJ 4MVUA 5AVTB 5L3EA 3ASOC 3K57A 4MW8A 4QE9A 3LSSA 1HGZA 2KNCB 1FAVA 2Q69A 2RCVA 2MJZA 2HPCA 1FJPA 2R9IA 3E1RA 4JI0B 2PGGA 1NAFA 4BW5A 2BOBC 4XA4A 2ETNA 3B4SA 2UUBO 3A7OA 3M8AA 4UB8H 3FX0A 2ZVNB 3CC4P 2IDBA 3BFRA 1FJGO 3F5TA 3CCSV 2ZXEB 3VBBA 2JP3A 1OCCB 3BCCE 1NVPB 3L37A 4DK0A 3LW5H 1Z56A 2XASA 1M8OB 4WFGA 1FC2C 1HVVA 5L3DA 1VPCA 2IU3A 1QNMA 3L73D 2OYIC 4HAMA 1NTME 1H2MA 4PI2A 3R2PA 1LTTC 3ZMVA 2OIEA 1RF0A 2F95B 2EINC 1YJWP 3H1KD 2Q5UA 1AI4A 5BR8O 4GKJB 1E1RG 2IYPA 3U11A 1GN3A 2EIMC 2XZRA 2FY8A 3AK1A 4PDVA 3ZDMA 4OXSA 3ZN0A 5BVZA 2FYUE 2WLLB 1OV9A 2YXHA 2UXBB 1H8HG 3AE4C 1NTKD 3M06A 4I9QA 4J7KA 3KCXA 1I08A 1HNZB 4XDKA 1BDCA 2Q3IA 2QM8A 5F2VO 2D2CD 1Y74B 2QJ1A 1CEZA 2KG7A 4U3FG 2E75D 1XOUA 1RPRA 1GN2A 1UFIA 2CK3G 2KB1A 4QNHB 5CA1A 1G2CA 2JK5C 3H1HG 4I55A 1WAZA 1EDLA 2V4DA 3SR2C 4DV5O 3I55P 1SQPK 1M5IA 2JDIG 2WLKA 4DV3O 1A02F 4J11A 1SQQG 1JO5A 2YXRB 3K0DA 2AZ0A 2WITA 3VOPA 1SQVD 2KB7P 1GL2B 2B9ZA 4H44C 1GU4A 4C7NB 4GZRB 3ZRVA 1G1JA 4D6TE 4R6ZA 5B1AC 4JI0O 3CCRP 4PV1B 1SQVK 1RF1B 5H2FZ 2LP7A 1EZVH 2XAJA 2K37A 3V4QA 3HTKB 1URQB 1M4UA 4DR3O 1O9GA 4JZGA 2GBOA 3APQA 5B1NA 3HB3B 3TNUA 1RFYA 4NR1A 3OW2O 2OYHA 2QJYC 2A45G 3H1ID 1X59A 2RN0A 1FZCC 3FB8C 4WB4A 1RM1B 5B3SB 3U0ZA 3BVOA 1JCCA 4H0LB 3CX5F 4PDLA 4OX9O 1L4AC 3B40A 4JASA 3UQ8A 4DR6B 1PGJA 1N86A 3AG1C 3KZIZ 1FZFA 3TK1A 1YTZI 2LKMA 2WLIA 4RESB 2A06D 3L73J 2BCCG 1H8EG 4F4LA 2UU9O 2CPBA 3QNEA 4BRYB 2Z3YA 3P8CD 5EIBD 1OVRA 3H1LG 3AK2A 3KXDA 4XBFA 3BRCA 5LMUO 3H1KJ 4LF4O 3OE7G 4FVMA 1FZGA 1B3QA 4I4TB 2O1JA 3UIAA 5KKZC 5EK0A 1EDIA 1NU1G 5EZYB 3CCQP 4FIPC 4ZIBA 1FXKB 2V7QH 4NTWA 4RQEA 1JMKC 1BHAA 1NTKJ 1AB3A 5APSA 1NKZB 3EWKA 1KBHA 1NR7A 4UV8A 1YTZT 2KSEA 4JAAA 2HHHB 4DR2B 2W8ZA 3CSXA 4I9WA 4TT3H 4HNAB 3RL0C 3GF7A 3OAAG 2O01J 3K79A 1JTHA 2H7HA 3FXDA 2WSSH 4HYOA 1J2JB 3HUSA 1GM8A 5KJ7C 1P7BA 1I0HA 2CDYA 4DK1A 3ZHRA 1BGYE 3JD3A 4N6JA 1KV4A 1SQVJ 1W0KG 4GX2A 4IYHA 5J9PC 3LUTB 1XNRB 2N04A 4B3MB 5IYZA 3L70D 2GTAA 4W4KA 2AXTE 2FL4A 1P84D 1E79H 2R32A 3PLNA 2OIGA 1SETA 4K0KO 2ZE6A 3MZWB 4F6RB 2FYUK 1NBMG 5CCGD 4EFBA 1VQLV 3Q5SA 2XAQA 2E3CA 3GLMA 1L0NH 3CCVV 1UPGA 3K3WA 3RWRD 2D3OW 1GK6A 2WT7A 4X8AA 2QTSA 3LDCA 3H1IJ 4Y99C 4O4IA 5H2FH 2QM4A 1K92A 4U3JB 4BXLA 5KAIZ 2CH7A 3OGIB 2HLOA 5APXA 3IGAC 4PELA 3RYFB 3HKBB 3G4SP 4GX0A 1KORA 2CTWA 3ABVC 1GAXA 1OCZB 4JI5O 3SJCC 3H9VA 3VQYA 3L36A 1NTZH 5FPRA 1JCHA 1M56D 3SJAC 5APWA 1GM9A 1K97A 1YEWA 1K9MW 3L71G 3EFFK 1VQ9V 4GOFA 5D5PA 4HBNA 1U7MA 3CXHH 2H8PC 5GTHE 5LP6C 1JOYA 1VQNP 2GUZA 4LF6O 2JVDA 3H25A 3JALA 3KZIH 4X9QA 4LNUB 1QLEB 3WUTA 3CC7P 4DV1B 2O57A 1Q2NA 1DIPA 2PZSA 2KZIA 4FFKA 4FLXA 2ZJSE 2Q7GA 1G1XB 1OHHG 4WBNB 3MAQA 2KP8A 5CN0A 4H13D 1IJDB 1IBKB 1PFIA 4JAUA 4QMAA 5JQGA 2IYOA 4QJFB 4MN4C 1ZWIC 3H1JH 3ZHQA 4LLHA 3K03A 5LHGA 1XHZA 1YJWV 2ZDIC 3RL0g 3VTPC 2FKXA 4KUMA 2HODA 5AW9B 3JSLA 3ASNC 3C1LA 4JI7B 1NS1A 1R8EA 5CBFA 3L70J 1NH4A 5KUKA 2P22C 1WMKA 3LIDA 2RJZA 1W2BU 1EZVD 2HYNA 3D3QA 1YI2P 4JTDB 1SQBH 2J59M 2CAZC 1P4RA 3M9HA 1Q6IA 1SERA 4DV6B 1MSDA 3VYIA 1LNQA 2XNXA 4Z1MG 3I55V 2YXQB 1EDKA 3IF4A 1EDJA 2QWQB 5EIBC 4PA4A 3B09A 3X2QB 1BGYD 3ABUA 3QVNA 1JY3O 3LW5J 3RYIB 4DRXA 1CW5A 2W6BA 3CCRV 3RVYA 5BZBA 2EX3A 4JV5B 4YHHO 1RSOA 3FX7A 5KAIH 1PV0A 1NKDA 1ZL8B 4NB5A 4LFCO 4DV7O 2FFDC 1E1QG 2W6IG 4B7KA 1AR4A 3F89A 2IX7C 2F1MA 1FXHA 1YJNP 1KD1Q 4IHJA 1FYJA 4PD4E 1VQ4P 1N73A 5LHHA 4L87A 3SPHA 2JO1A 3VMAA 1ZR2A 4U3FE 2Q0OC 4WY4D 1HJ0A 1HGVA 3A0BE 5AW5B 1BDDA 1W0JG 1BCCG 1S2EA 4CC5A 1TVKA 2IJJA 3FYIB 3R4YA 1H88A 4X62B 2DWEC 4QIWF 2GM4A 2H94A 2AW9A 3KKYA 1SQQE 4NXMO 1HTLC 3B71A 5FNVB 5LL6Y 1LP1B 1DEBA 3G71P 1I94B 3D6ZA 1NH2B 1BL8A 1PL4A 3LIEA 1MSWD 5LOVB 3DSQA 1YSCA 5HFMA 3MHSC 3SPJA 1Y8AA 5CCGC 4LFBB 4I2LC 3N2GA 1Q86Q 4JI1O 1WP7A 4FM1A 3ETEA 3CCQV 4FLUA 5JJJB 3CJHB 3LNNA 3RBZA 1RP3B 1LT9B 1AJYA 2KZJA 4G28B 2UXNA 3B8EB 4NTXA 1N7SB 1P7GA 1ZTEA 1N34O 1QLNA 5LXTB 2Y0DA 3U10A 1JY3N 1HNWO 1RE4C 1L0ND 2Q73A 2EIJB 1SQXH 2EILC 1MZFA 5AVWB 3G6BA 3SWYA 3ZIAG 4MTOA 3E8FA 2ZE7A 3HKCB 5IJ9B 4DO2A 2N9BA 1R3LC 3T1CA 5JVDB 1KILD 3ZEDA 4LFAO 5IYCO 3W7XA 1LWUA 1HP8A 1T8ZA 2ATKC 3E2EA 1OCRB 3T1HB 2WA4A 4FLTA 2F66C 1USDA 2RQ6A 1BGYJ 2JS3A 3ABLB 1XHXA 2BCCE 5KTBA 1SQFA 1OZ0A 3V5BA 1S72V 1NTZD 3H1LE 1KILA 3BRVB 2A7WA 3RK3E 1FD9A 3WB2A 2Q9IA 1YF2A 4W80A 2WZ7A 2EJ7A 1Y76B 2QA4P 4NXNB 2ADQB 2V7QJ 2WLHA 4H13C 2JRIA 4DUZO 3CMEP 1QQCA 3P8MC 2IBZG 4XDLA 3A0RA 1N32B 5KLIC 2LFSA 4O2BA 4MTFA 5HFLA 3ZMUA 1NT2B 3SSUA 1QL2A 3GB7C 2Q9LA 1Z5WA 3HKEB 4PHZA 1GN6A 2ZM6O 1SKVA 4RO0A 1MZ9A 1W2EA 1F51A 4WFEA 3H1JD 3MIWA 3A0HE 1EC5A 1YJ9P 1HH0A 1L0LG 2DW4A 4UVAA 2DYRB 1VQNV 2FXMA 5LGUA 3Q4HA 5CCHA 2HG5D 4ZI7B 3UT5B 2XNDG 1BE3G 1SFCB 2DYSB 4MSWC 5IWAB 3MDSA 2E5LO 2KS1A 2PRRA 3M0DA 1ORQC 3CC7V 2E76B 2FYNC 4MTGA 1SQBD 4LF9O 1PGOA 1T5EA 1I5YA 4DV2O 1L0NJ 2P4KA 2P58A 4OGQB 5BMVA 4GDOA 2ODMA 5L8RJ 3CCLP 3L74G 1H2NA 2LW1A 1SQQK 1KD1W 4GKKB 4TLFA 2B1IA 2VQFO 1L2PA 3BATA 5CA0A 3AEEC 1FFXB 2R9AA 1NWQA 1QVFU 4AI8A 5CMUA 3L71E 5IJ0B 1FOSE 1NTZJ 3K0GA 2YIBA 2AEFA 3OD4A 5JH7A 1J1EC 3RGBA 3H6PA 4I6MC 3L75H 2WTYA 1KFMA 3S9OA 1ZX3A 3JAWB 1ZP0C 2W90A 1Y6XA 3B5ND 3JCUE 4WY4C 1W2BO 1PD3A 1DK1A 1FDMA 4NKGB 1NAYA 2YICA 1MUUA 1QX8A 4J41A 2EBOA 1M57B 3HD7C 5B1OA 1F4NA 2DMXA 4EB6B 1GK4A 1Q86W 1OZHA 1PPJG 2PUSA 2Q5ZA 5LGNA 1YYCA 4G2KA 1WPBA 4P30A 2GHYA 3D36C 3CRRA 4YIOA 3BASA 5L3CA 5IDJA 4AQRD 3CWBH 4LBEC 2O3JA 4P9PA 2WSEH 3VOUA 2OYIA 4JI2O 1JQ0A 1H2SB 3H1JJ 5EBLC 3CYOA 1NGMB 1SQPH 4MVZA 4AUWA 3SYAA 2O01H 4IYIA 2K1AA 1LTSC 2HLDG 3RGUA 4IL6E 2JWAA 2R5BA 4Z1VA 4CC6A 1R3KC 2XAFA 1YJNV 1MV8A 2XOKG 3USSA 1VQ4V 5LMNO 3CL3D 2ZNJA 1SQVH 2Q6QA 2BSKB 1YXBA 3IC9A 4TV8A 2QR4A 1G1IA 4ZHQA 4JI4O 1SQBJ 5AW3B 3MTUE 3J81N 2WPRA 3TJTA 1GH6A 1J1DB 3WMM0 1BSHA 4YY3B 1KZUB 1SQXD 3RBXA 3N27A 3WG7C 1PP9G 3RYHB 1EN6A 1M93A 3G71V 3T97B 4CH5A 4YXWG 3AG2C 2UUCB 5BY1A 1JFFA 5AW4B 4A7PA 2LXCB 3T1YB 2YKPA 4DZOA 1M1JB 4NVPA 5C8YA 4KFMA 1CI6B 1SF9A 1QR9A 1R6NA 2JS5A 3T4ZA 1VF5B 4X88A 3JARB 2N1TD 4OVNF 4N78E 1GW3A 1HWYA 2YIUC 1FZEA 3RK2B 2N9YB 2M6YA 2X6AA 2UXXA 2QJYB 5J2TA 4TOIA 2UUBB 1FZCB 3ZMTA 4O4LA 4KHXA 1S3JA 2GTSA 2K9PA 1DH3A 2ZXWB 2WPSA 2ZVOB 2P67A 5AG2A 3SYOA 1BCCE 3P3PA 4J10A 3BA9A 3V2RA 1VQ8P 3K08A 1AJPA 3OUSA 1FZCA 1PV3A 2ZT9C 3RYCB 3TXQA 3AEAC 2JJ1G 2RDCA 1L4AA 1FDIA 2P10A 3CCJP 2KXPB 4XE5B 2QEXP 2A9HA 4TT3G 3AEIA 3KYQA 4ABMA 2HG5C 4O2AB 5BR8B 4CS4A 4CS3A 2P1JA 4PJ0E 1J95A 3CX5E 1QR8A 3BCCH 1RPOA 3IR9A 4JZ2A 4BWNA 1ENVA 2WVRA 2NPSB 2Q67A 3UO2A 3W7TA 2QA4V 2YXYA 5LBQA 1FOSF 1MABG 4O2AA 4YY3O 4DW0A 2G38A 1IBMO 2HVKC 3CMEV 1FZBA 2YMYA 3RL0D 5CJ4A 3BHPA 1X8YA 3MHVA 2HPCB 1H0TA 1E79G 4DV5B 4GODA 3AE5C 4DV3B 1K5SA 2FYUH 5CMZA 5DECA 5IT9N 4C46A 1MMMA 3L72D 3VQVA 3PTZA 3HE5A 3PH0A 1GW4A 2M5AA 4RO2A 2E74D 1S5LX 2YI8A 3AK3A 5KJ7A 3LDEA 2GUSA 2OGUA 3B5NC 2XDJA 3AG4C 3P7KA 3F5WC 3GVMA 1IFDA 3CEIA 1FE6A 3ETDA 3ZN1A 4HJGH 4JBZA 2AXTZ 3ABKC 3SGIA 2B1GA 2EZPA 2LQTA 4B3SO 3L75D 1OVUA 1Y47A 4PDRA 3HE4A 4DR3B 1DX7A 1VL2A 1ZMEC 2C0WA 4D6TH 3VQXA 4LF8O 2ZYGA 4HB1A 2IBZE 3TDKA 1XL4A 1H2GA 5CBNA 1HR0O 4PD4I 5KLVE 5A9GA 4MVMA 2G8YA 3EFGA 1PNLA 4OX9B 3IAOA 3CCLV 1SS1A 1XL6A 2KG7B 1ROPA 5AVYB 1S9KE 3F7VC 3JAKA 5CA1B 1G2CB 3Q1MA 2EZOA 2UU9B 4I55B 2Q3EA 3WB0A 4GX1A 4PA6A 4JTAB 3GG2A 3MUDC 2D2CB 3CWBD 3GHGC 1QVFO 5LMUB 2HKOA 2H8PD 4LF4B 2E75B 4N78D 3WU2E 5GTHZ 1T2KD 1HUCA 4NPFX 1SQPD 1HBWA 1EXIA 3AE6C 1R1BA 4C7RA 1AI6A 1BE3E 1G8MA 5LP6A 3JD2A 2WPVB 3D3IA 3Q5PA 5C39A 4DT0A 2IU0A 2KQXA 2UXDB 3D70A 2EJRA 1IO4A 1VF7A 1AV1A 4YTPC 2MK3A 1PL0A 1KKDA 3BEHA 3K9AA 4EI2A 3S3WA 2Q7HA 2A45I 3TNUB 4ASUG 2OYHB 2WLMA 4JI8B 1SESA 4K35A 3GF3A 2QSAA 3VMYA 3FB5C 1RHZB 3L74E 3OR6C 2A0LA 1K7DA 2QKSA 4J7JA 2N1TC 2KK7A 4IIJA 3L72J 4YJ2A 3HKDA 1IK9A 1S5HC 2NRGA 3BRTB 5AW1B 3ZCCA 4KJMA 3FAVB 2W0FC 3E8GA 5EC1C 1FS0G 2ZDIA 2WQYC 1LTIC 3K5LA 2HJFC 2WLIB 1GL2D 2JEXA 3TCUA 5BXZA 4NTYA 2VS0A 3SYQA 4K0KB 5FLXN 1VQ7V 3UCSC 3L75J 4NPDA 2Q68A 1BGYH 2ZR2A 1USEA 5JCOC 3FAVA 3ZHVA 1IC2A 1NYHA 2YNYA 1ZRTD 1PIXA 1YVWA 4ICGA 1NKNA 1QU7A 4PI0A 4LWSA 1PPJE 5LA6A 2KSDA 1QGKB 1BQ0A 3DXRA 3W68A 1YHQP 2AXTH 2H89C 1EXJA 4ZKUA 4BIUA 4U7NA 1OMIA 1YITP 2W6JG 1JY2O 4UCTA 4JI5B 1ZW0A 1SVFA 2K9JA 4LH7A 1V55B 2L35A 4X1YA 4M3LA 1GN4A 3BVHA 1JJ2U 1JTHB 4QPJA 3CWBJ 3FWLA 2WSEJ 1A02J 3HUSB 3ABMC 2UXDO 1AILA 3CE2A 4LF6B 1N8RQ 3OMIB 1U97A 3BCCD 3CCUV 1SQPJ 3UKMA 2R3CA 2P6JA 1N4CA 2FFDA 4W4LA 1KP2A 2FTKA 2QJKB 4WCEV 4JI8O 3DC6A 1WT6A 5IYZB 3AEBC 2E42A 1NTMD 2QDOA 2FBWC 4WFFA 1S76D 3VP8A 2DQ3A 1NTMK 5GTHH 4Q20A 5KLVK 3CRCA 2Y69C 5IE9A 2E74C 3L4FA 3A5TA 2QWRB 1PP9E 5DJUB 1EQ7A 2WT7B 2YDEA 2YUAA 4L76A 4LCUC 2FYUD 1QVGU 3CCJV 2QEXV 4O4IB 1ZV8A 2W83C 1H2LA 3OMAB 2CH7B 3O8ZA 3AG3C 1YZBA 4BW9A 2AHYA 2BTOA 2YO3A 5K1XA 3AE1C 1JCDA 3CHXA 2R72A 4JPRA 5GONA 1Q8IA 5CCGA 4FZ1A 3G6EP 4U7OA 1KYOE 4TQDA 1IVSA 1KQSU 3NR7A 4B3TO 2N74A 1XNQO 2ZCEA 1JY2N 4YXDC 1G6UA 1M56B 2GUZB 2O01N 4D6TD 3A8TA 1EBOA 2OCCB 1MZEA 2ZD9A 3JALB 1N36O 4TV9A 1WP8A 1HNXO 4P9OA 1RE4A 1OCCC 1FAFA 3JASA 3JATA 3CCEP 4DXWA 1XUQA 1IDSA 2YKOA 1T2KC 2LR2A 1VQPP 1JUNA 4FLWA 1B6QA 2R44A 3TGUE 1WJZA 1Q5OA 4CZZA 3AE8C 5JQGB 5CB4A 4YHHB 1HJBA 3CC4V 1S4XA 2RH0A 3OEEG 1KP3A 4LFCB 3O6QA 4DV7B 2L91A 3U59A 1U96A 1N0NA 4FLVA 3BCCJ 2HODB 2KI7B 3TXSA 1NTMJ 5KHGA 4ZOLA 4UCUA 1BQZA 2ZQMA 5KLVJ 3WUUA 4K8ZA 4I7ZB 4FJCC 1YTFD 3SDLA 4TQFA 1KN7A 5DM6V 4NXMB 3CB2A 4A5UB 1X4TA 1UIXA 4O9BA 4PD4H 3K58A 1ZUQA 3U1CA 2FYUJ 3C3SA 1MNGA 3SYPA 1GL2C 5IYBO 4U3FH 1VP7A 1CZQA 2C0XA 3KHUA 2Q7EA 1DF5A 4ASWA 3A0HZ 5BU5A 2YO2A 4FFBA 4PV1C 4JI1B 3RFRA 1RF1C 3ABTA 4UCVA 1ZN5A 2ADPA 4DRXB 1SQQH 1H8AA 4MVOA 2WAMA 2M3EA 1KQFB 1PGPA 1URQC 2QJPB 2XU6A 1NVOA 3E8HA 1RSOB 3OEHG 4UV9A 3Q2YA 1N34B 1XBLA 2GDSA 4H33A 3BAAA 2R70A 1HNWB 2OTLP 3CXHE 4D6TJ 1J5EO 1UIIA 4RAIA 3AE2C 3VP9A 4JTCB 2R3SA 5EBMC 4IHJB 4CH3A 4G27B 3CRQA 5B3SC 1RM1C 1EM1A 1N8RW 1SP4A 3KZIE 1N73B 1QCEA 3WB1A 4H0LC 4LFAB 4JAVA 4OPHA 3L73G 1KUQA 3OJAB 1FXVA 2R5DA 1XEQA 4L74A 4YJ3A 4UVBA 1AJNA 5KUMA 1VIBA 1XMOO 3H1KG 2A45H 1TVKB 3MD0A 3AEGC 4MVSA 1K73Q 2GSMB 2ARHA 3ICXA 3N4XA 1LR1A 2WSCJ 3H1HE 2WPQA 3ZHSA 1NTKG 3JCUZ 4UFZA 3SWFA 1FXKC 5E79Z 2ZIMA 4WFHA 3ZRSA 1OW7A 3CX5I 1OWAA 2W6AA 2BCCH 3JD1A 3N2GB 5KX5A 2FB5A 4TWKA 1FPOA 4DUZB 4Z2WA 3HD7D 1Q81Q 3H1LH 3O9OA 4O4JB 4WY4A 2QG4A 1AFOA 1FZAA 1HF9A 1KYOF 1XMQO 3A3YB 1JNMA 2DN9A 4GKGA 1YHQV 5H6QA 1KB9E 2ZINA 2XT9A 4LF7O 4GX5A 4UB6E 3HD7A 3WFVA 3SPGA 3GMAA 2Z0AA 3PJSK 4O4JA 1SQVG 2ZM6B 1ZR4A 2P4VA 3HR0A 3D36A 1IZNB 1KC8Q 4YPCA 1V54B 4FZ0A 4KP4A 3AEFC 1WA8A 1VQ6P 1OIPA 3CD6P 1IK7A 1AR1B 1IURA 4UCOA 1A32A 1VQMP 1LWUB 1FS0E 4PA3A 2Q8VA 1WB7A 1VF6C 2UUAO 4IL6Z 1NH2D 1BMFG 4B3RO 4X20A 5KHHA 3TF5A 5B5EE 1ZSPA 2OQQA 1KILB 3RT3C 2E5LB 2X7RB 2LW7A 3OT7A 4J7ZA 1S5LE 4JPZB 4X89A 2GV9A 1N0JA 2IH3C 2HEPA 5ITZA 3H1IG 4LF9B 3A0HH 2H43A 1Y9BA 3V4WA 5KAIE 1VQKP 3G9RA 4DV2B 2B9BA 1US6A 3FB7C 4B08A 4JF7A 4BWAA 5TJHA 1LUWA 4KXRA 1DGSA 3P32A 1N7SD 2IBZI 4U7JA 4O4HA 1NOHA 2Y4TA 1Q90D 1OCOB 2LGQA 2A06G 2VQFB 1NU1E 1QVGO 4O2BB 1W5CE 1OCZC 5CJ0A 2ZE8A 1K05A 5BU8B 2JGUA 1S5JA 4J9YB 1M1KQ 2HP8A 4DR4O 3ZX6A 2HVJC 3M9BA 2NR5A 1IX9A 1RH5B 2Q1KA 1DLBA 2QVAA 2IM9A 4HH2A 1KQSO 2F93B 3QO7A 3G4SV 3AG7A 2YC0A 3IC7A 3L71H 5E1AC 3Q4HB 1QLEC 3S1KA 3A2FA 4DV0B 4GUNA 4FM0A 1K8AQ 4XDJA 1XTCC 3AECC 2RMKB 1LGHB 1GK9A 2ZT9D 2KS1B 3G80A 3F7YC 3CCEV 4ZBMA 3JCUH 5CHXA 5E79H 3FD9A 3CXHF 3SFEC 1ZAUA 4MTXA 1VQPV 3GW6A 1ZLLA 4PD4D 3TGUJ 2RKLA 1PM9A 2QE7G 5BMVB 4JI2B 2RN9A 1KFNA 2K9YA 4PJ0Z 4U3FD 4KHPB 1SA0A 3L70G 1TUEB 5B1BB 3QTCA 3P3NA 2CGNA 1KQLA 5CA0B 1OXZA 1T3JA 2EIKB 5LMNB 1SQQD 1KTMA 5EC2C 4J80A 1RE3C 3L72H 3G3ZA 5JH7B 4J9ZB 1GZLA 3OUFA 4JI4B 1WPXA 1JMMA 3BPZA 5EBWC 4DV4O 2Z5UA 1K73W 1YBKA 3EQ2A 4GLXA 3ASOB 4EIJA 4IL6H 1QEXA 4DR7O 4CS2A 2VQEO 1I7FA 4LP8A 3APOA 3T2MA 3NFQA 5AVRB 2BEQD 1KB9F 2HR3A 4QGPA 3X2QC 3K5BA 1XQ8A 5KMGA 3N7NA 1XDCA 4X1IA 4W7ZA 1YI2V 1Q81W 4Q6GA 1OX3A 2V4HA 3OAKA 5LYJA 2BTQA 1TUBA 2CTPA 1RQUA 1IZ3A 2FXOA 2EULA 1D7MA 1XREA 2YXLA 3B5NA 4DV0O 5AVXB 4RWUA 4UUJC 3PN1A 2OYIB 2QSIA 4Y28J 2VWJA 1FU1A 4I50A 4ZNCA 3SFDC 2FYZA 1KC8W 2EINB 4JYBA 4AHCA 2OTLV 2PY5A 4K3AA 2BCCD 3ITKA 2F4VO 2EIMB 3H1LD 4X65B 1Y66A 3DTUB 3E22A 2DOSA 2UXCO 1Q7YQ 2JGDA 3BA8A 5CBOA 1N33O 3KG2A 3RK3D 4KHPO 1K4DC 4TV8B 1AR5A 1NU1D 1AJQA 1EZJA 3HRNA 4ZHQB 4E4EA 2VRZA 5C93A 2AZ2A 1NU1K 3CC2P 2PI4A 1JPXA 4H37A 4HYTB 4DUYB 3K5OA 2IPPA 4J42A 1BCCH 3WU2Z 4U3FJ 1MKMA 3MUDA 1JFFB 2ITAA 1SRYA 3GHGA 3N2KA 4DR5B 3H1HJ 1SZTA 3G67A 4JYCA 4TUYA 3IFMA 1EZVG 3OW2U 5C8YB 1SS3A 2LJ2A 1LT9C 4H44B 1IBMB 4EYYQ 1SQQJ 5APVA 5B1AB 1IFNA 1N7SC 1E5WA 1KYOI 4I5SA 4X64O 4PJ0H 2XKMA 1BSMA 1M1KW 1FFTB 3CX5H 1GDTA 3O65A 1LTAC 2EIJC 3V2NA 1R5LA 1CP9A 5J2TB 3E1IA 4X1KA 1BGYG 4O4LB 3L73E 3NTNA 3P30A 3PHLA 5B66E 4RUFA 2WPDG 1K9MQ 4X66O 2OWOA 1OCRC 1X22A 3ABLC 3STLC 1PGQA 2WLNA 2K3RA 3CD6V 3H1KE 5LHIA 1X79B 1VQMV 4DR1O 1R5SA 2N1TA 4QE7A 1K8AW 1Q6UA 4JI3O 4LF5B 2PAJA 2DQ0A 1L4AB 5EYPA 1Q82Q 5TISE 4B3SB 4X65O 4DOJA 1NTKE 3AG1B 2V7QG 3CPWU 3TSIA 4LF8B 3ZMZA 4OPAA 2YEVA 1KECA 1HR0B 2QKCA 2BCCJ 5APYA 5JCOA 4I0XA 3L71D 3PP5A 5KKZB 3H1LJ 5L3GA 4WWIA 4DUYO 5KAFE 3C90A 2HJDA
chains in the Genus database with same CATH topology
4R50A 2OT5A 2WSSG 1LNQA 4BIUA 1G4YB 1K3EA 4U7NA 3UM7A 1F4MA 4Z1MG 3I55V 3SJQC 2W6JG 4QPKA 3FB6C 3K04A 3W7UA 4PA4A 1V55B 4P2ZA 3X2QB 1AQTA 3QO5A 3ABUA 1JJ2U 1AI7A 4QPJA 4RQFA 3TETA 2DYRC 3CCRV 1IXMA 3ABMC 1BSNA 1I5XA 3RVYA 3CP1A 3OMIB 5BZBA 3OMNB 2DYSC 2NLJC 3CCUV 3UKMA 3AG4B 2P6JA 3BY6A 1NKDA 4CBCA 1E1QG 2W6IG 5IY5B 1KP2A 2FTKA 3JCZA 2Q6AA 3ABKB 4WCEV 1FXHA 1COWG 1K34A 4WFFA 1S76D 1YJ9V 5LHHA 2DQ3A 4L87A 3SPHA 2XNDH 3CMAV 2V1DA 3STZC 4Q20A 1WLEA 2Y69C 4R8CA 5IY5C 3JD0A 1W0JG 2R9RB 2IJJA 3FYIB 4LCUC 1NR1A 1QVGU 3CCJV 3ETGA 2DWEC 4QIWF 1BHBA 2H94A 2QEXV 2P7TC 1L1FA 3OMAB 3ZRWA 4MVQA 3AG3C 1Q7YW 1NH2B 1BL8A 1MSWD 2AHYA 1UJWB 3T4DA 3HPLC 1YSCA 3ZJZA 5HFMA 3MHSC 3SPJA 4JPRA 1F23A 4TSFG 4U7OA 3CXCU 3ETEA 3CCQV 1KQSU 1PNMA 1YIJV 3DGEA 1MOFA 3RBZA 3B8NA 3W7SA 2IJIA 2X6CA 3H01A 4G28B 2UXNA 1M57C 1M56B 1EBOA 1NVPD 2OCCB 1NQTA 2ZD9A 1GMGA 1QLNA 5CA3A 3ZRXA 2B5UA 3LSQA 2EIJB 4P9OA 1OCCC 2EILC 1V54C 3ZMSA 1S77D 3R65A 3ZIAG 4MTOA 3E8FA 3SPIA 4DXWA 4EKWA 4DO2A 1R3LC 5H9CA 3T1CA 2IJHA 2IH1C 3E8BA 1B6QA 3W7XA 5IYCO 2ATKC 3E2EA 1OCRB 2OTJV 3ABLB 4N21A 4CZZA 1OZ0A 1M90W 4RUEA 4PA9A 3CCMV 3CC4V 1R73A 1S72V 3EHBB 1KP3A 2XAGA 3OEEG 4MT8A 2LFRA 3OR7C 3NXSA 1VQOV 1VQ6V 2WLLA 4WVZA 4UXNA 4N23A 2K1EA 2QTOA 3ASNB 3OFNG 3MHHC 2YEVB 2WLHA 1Q82W 1R3JC 2ZQMA 1OCOC 3QO8A 2IJKA 4R7CA 4XDLA 3A0RA 2LFSA 5CBHA 4MTFA 4FJCC 5HFLA 1YTFD 3CC2V 3ZMUA 3E86A 2JJ2G 5DM6V 2F43G 4WFBV 3FKSG 4BAYA 3GB7C 1S0VA 3K06A 3E89A 1NJIW 1VQKV 2YSUB 1PNKA 3SYPA 5IYBO 1DF5A 1AROP 1JEKA 1F51A 4WFEA 4YXWH 3ABTA 3IFXA 2DW4A 2WAMA 2DYRB 4MVOA 4UVAA 1VQNV 5LGUA 4FPPA 3ABMB 3E8HA 2XNDG 3OEHG 4FMTA 2DYSB 4MSWC 4UV9A 2ZXWC 4H33A 5L3BA 1ORQC 3CC7V 4MTGA 4PDMA 4WFAV 4RAIA 4JTCB 5EBMC 2WWWA 4G27B 1RM1C 5B3SC 1N8RW 1QCEA 1K5QA 1I5YA 4JAVA 4JGSA 1FXVA 4ZKIA 4UVBA 1AJNA 2Y69B 5KUMA 3GWOA 5B1BC 3FYEB 1GKFA 1KD1W 1EFRG 4TLFA 2B1IA 3MD0A 2EIKC 3RW0A 4HZ3A 4MVSA 2GSMB 1PKXA 1QVFU 5CMUA 1VQ8V 1CPYA 3ZRWB 2QE7H 4MS2A 2PI5A 3K0GA 3AG3B 4PA7A 3I56V 4DJGA 1FXKC 4WFHA 3ZRSA 1FXKA 3JD1A 4MVUA 4BIZA 5L3EA 3ASOC 4TWKA 4MW8A 4QE9A 3LSSA 2NNUA 1PD3A 2Q69A 3JD4A 2R9IA 1YHQV 2E5TA 5H6QA 4BW5A 2BOBC 2EBOA 1M57B 4GX5A 5B1OA 1F4NA 1Q86W 1JVMA 3WFVA 3SPGA 5LGNA 4UVCA 3PJSK 4G2KA 4P30A 2GHYA 3CCSV 3D36A 3VBBA 1OCCB 2EILB 1V54B 1NVPB 4KP4A 5L3CA 5IDJA 2XASA 4LBEC 4WFGA 3B77A 3LDDA 4P9PA 5L3DA 1AR1B 2IU3A 3VOUA 1VQ5V 1FS0E 4HAMA 4PA3A 1JQ0A 5KA5A 3RVZA 5EBLC 3CYOA 3ZMVA 1NH2D 1BMFG 4MVZA 2EINC 3SYAA 1AI4A 2HLDG 1E1RG 2JIZG 2X7RB 2EIMC 2DWDC 1R3KC 2XAFA 1YJNV 4X89A 4PDVA 2XOKG 3OM3B 2IH3C 3USSA 4OXSA 1VQ4V 3ZN0A 2BOCC 4GCZA 5FL7G 4JF3A 2WLLB 1H8HG 3FB7C 4XDKA 2ITDC 2QM8A 3P32A 1CEZA 2CK3G 1RPRA 1BSHA 2KB1A 1OCOB 4QNHB 2XAHA 2E5YA 2JK5C 3WG7C 1AI5A 4WF9V 1OCZC 3G71V 4YXWG 3AG2C 2JDIG 2WLKA 1DF4A 5IYDO 5L3FA 4J9YB 3B8MA 3K0DA 4KFMA 2HVJC 1GO3F 1YTFB 3ZRVA 1QR9A 1R6NA 3T4ZA 4R6ZA 5B1AC 4X88A 1DLBA 1HWYA 3QO7A 3G4SV 3IC7A 2X6AA 2UXXA 5E1AC 2LP7A 2XAJA 2CK3H 1QLEC 4XDJA 3ZMTA 5KA6A 1S3JA 5B1NA 1GK9A 2ZXWB 2HFEC 3HB3B 2JDIH 2ITCC 3OGCC 2P67A 3F7YC 4FK5C 4ZBMA 3SYOA 3CCEV 3K08A 1AJPA 4MTXA 1VQPV 1R6KA 3FB8C 3OUSA 1RM1B 5B3SB 3LNMB 1R3IC 2QE7G 4PDLA 2JJ1G 4JASA 3E83A 1Y4MA 2A9HA 3AG1C 4TT3G 3AEIA 3TK1A 1TUEB 5B1BB 2HG5C 2WLIA 4GT1A 1H8EG 2C2AA 4F4LA 1J95A 3QNEA 2EIKB 2Z3YA 1QR8A 1RPOA 2QM7A 4XBFA 4MVRA 1ENVA 5EC2C 3OE7G 2Q67A 3W7TA 2QA4V 4J9ZB 5EK0A 5LBQA 1MABG 3OUFA 1WPXA 4FIPC 1FXKB 2V7QH 2HVKC 5EBWC 4RQEA 3CMEV 2Z5UA 1K73W 3ASOB 1BHAA 1NR7A 2JEUA 4UV8A 4LP8A 1E79G 1GTOA 1GM7A 4I9WA 3T2MA 1K5SA 1V55C 3X2QC 2HR3A 3OAAG 3K79A 3SYCA 1YI2V 1Q81W 2WSSH 4HYOA 4RO2A 1GM8A 1P7BA 2W6JH 3LDEA 3JD3A 3AG4C 3F5WC 1YITV 1W0KG 3ETDA 4GX2A 4UUJC 3ZN1A 5J9PC 3ABKC 2B1GA 1MG1A 2Y48A 3LUTB 2EZPA 3SPCA 2X6BA 4PDRA 1KC8W 2EINB 4JYBA 2OTLV 1E79H 1SETA 2EIMB 1NBMG 1Y66A 1QBZA 3DTUB 1VQLV 1XL4A 1H2GA 2XAQA 3KG2A 1M9NA 3CCVV 3K3WA 4MVMA 1K4DC 2D3OW 4X8AA 1AJQA 1EZJA 2WLJA 1PNLA 3LDCA 3JYCA 3CCLV 4E2LA 1DTOA 1K92A 1XL6A 5C93A 1ROPA 1JPXA 2PI4A 3F7VC 4H37A 3IGAC 4PELA 2EZOA 4GX0A 5CBGA 2IW5A 3WG7B 4GX1A 4PA6A 4JTAB 1OCZB 3AG2B 1JCHA 2HKOA 1SRYA 1K33A 2M7WA 1SZTA 1GM9A 1K97A 4JYCA 1K9MW 3OW2U 3EFFK 5H6RA 1VQ9V 1AI6A 1M56C 2H8PC 1JOYA 5B1AB 1G8MA 2OCCC 1THZA 4I5SA 3JD2A 3D3IA 1M1KW 1FFTB 2IU0A 4LC1A 2EIJC 2EJRA 1CP9A 1QLEB 2MK3A 3G6EV 1PL0A 1KKDA 3BEHA 2ZR3A 3K9AA 3ML0A 3P30A 4RUFA 2WPDG 4ASUG 2WLMA 1SESA 1OCRC 1OHHG 4MW3A 3FB5C 3OR6C 3ABLC 5CN0A 3STLC 2A0LA 2WLNA 3CD6V 1K7DA 2QKSA 5LHIA 4JAUA 1VQMV 4QMAA 5DN6G 1K4CC 4QE7A 1K8AW 4QJFB 2DQ0A 1S5HC 1ZWIC 3ZCCA 3K03A 5LHGA 1YJWV 2ZDIC 2W0FC 3E8GA 5EC1C 1FS0G 2ZDIA 1H38A 2HJFC 3AG1B 3M99B 2V7QG 2WLIB 4KUMA 3CPWU 2JEXA 3TCUA 1IFPA 3ASNC 3SYQA 3ZMZA 1VQ7V 2P90A 2A79B 3E35A 2YEVA 5CBFA 2Q68A 5LGTA 2ZR2A 1KECA 5KUKA 1W2BU 2AHZA 1JX9A 4JTDB 3W7WA 5GW7A 2X0LA 5L3GA 1P4RA 1SERA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MVZ A;  2K1E A;  2EIN C;  2QTO A;  4R50 A;  2WSS H;  4HYO A;  3SYA A;  1LNQ A;  4RO2 A;  1G4Y B;  3UM7 A;  1P7B A;  2WLH A;  2W6J H;  1R3J C;  2EIM C;  2DWD C;  3LDE A;  1OCO C;  3SJQ C;  1R3K C;  3FB6 C;  3K04 A;  3AG4 C;  4PDV A;  4X89 A;  4R7C A;  3F5W C;  2IH3 C;  4XDL A;  3USS A;  4OXS A;  4PA4 A;  4GX2 A;  4UUJ C;  2BOC C;  4MTF A;  4P2Z A;  5CBH A;  5J9P C;  1AQT A;  2WLL B;  3ABK C;  3E86 A;  3LUT B;  3SPC A;  2X6B A;  3TET A;  2DYR C;  3GB7 C;  4PDR A;  3FB7 C;  3K06 A;  4XDK A;  2ITD C;  3E89 A;  3SYP A;  3ABM C;  1BSN A;  1E79 H;  3RVY A;  5BZB A;  1BSH A;  2KB1 A;  2DYS C;  2NLJ C;  4QNH B;  3UKM A;  2E5Y A;  2JK5 C;  3T1C A;  3WG7 C;  4CBC A;  1XL4 A;  1JEK A;  1OCZ C;  4WFE A;  4YXW H;  3KG2 A;  3AG2 C;  2Q6A A;  2WLK A;  4MVM A;  1K4D C;  4X8A A;  2WLJ A;  3IFX A;  4J9Y B;  4MVO A;  3LDC A;  3JYC A;  4WFF A;  3K0D A;  1XL6 A;  4KFM A;  2HVJ C;  3SPH A;  2XND H;  3E8H A;  3F7V C;  4H37 A;  3STZ C;  3T4Z A;  3IGA C;  4MSW C;  4R6Z A;  5B1A C;  2Y69 C;  4R8C A;  2ZXW C;  4GX0 A;  4X88 A;  4H33 A;  5CBG A;  5IY5 C;  4GX1 A;  4PA6 A;  1ORQ C;  2R9R B;  4JTA B;  4MTG A;  4LCU C;  4PDM A;  4RAI A;  4JTC B;  2DWE C;  2X6A A;  5EBM C;  4G27 B;  5E1A C;  5B3S C;  2P7T C;  2CK3 H;  1QLE C;  3EFF K;  4MVQ A;  3AG3 C;  4XDJ A;  1BL8 A;  1M56 C;  2H8P C;  2AHY A;  3T4D A;  3HPL C;  2HFE C;  5KUM A;  2OCC C;  5B1B C;  2ITC C;  3OGC C;  3ZJZ A;  2JDI H;  4WVZ A;  3SPJ A;  3F7Y C;  3SYO A;  4ZBM A;  4TLF A;  2EIK C;  3RW0 A;  4HZ3 A;  3K08 A;  4MVS A;  2EIJ C;  3FB8 C;  3OUS A;  3LNM B;  3RBZ A;  1KKD A;  3BEH A;  1R3I C;  4MS2 A;  4PDL A;  2QE7 H;  3K0G A;  2X6C A;  3E83 A;  4PA7 A;  4G28 B;  1M57 C;  4DJG A;  4RUF A;  2A9H A;  3AG1 C;  2WLM A;  4WFH A;  3ZRS A;  1OCR C;  4MW3 A;  2HG5 C;  2WLI A;  3FB5 C;  2ZD9 A;  3OR6 C;  3ABL C;  4MVU A;  3STL C;  2A0L A;  2WLN A;  3ASO C;  4F4L A;  4TWK A;  1J95 A;  2QKS A;  4MW8 A;  4QE9 A;  4QMA A;  4P9O A;  1K4C C;  2Q69 A;  4QE7 A;  1OCC C;  2EIL C;  1V54 C;  4MVR A;  1S5H C;  1ZWI C;  3R65 A;  5EC2 C;  4MTO A;  3E8F A;  3SPI A;  4DXW A;  4EKW A;  3K03 A;  2E5T A;  4BW5 A;  1R3L C;  2BOB C;  2Q67 A;  2W0F C;  2IH1 C;  4J9Z B;  3E8G A;  5EC1 C;  4GX5 A;  5EK0 A;  3OUF A;  3E8B A;  2HJF C;  2V7Q H;  1JVM A;  2ATK C;  2HVK C;  2WLI B;  5EBW C;  3SPG A;  3TCU A;  3PJS K;  1IFP A;  3ASN C;  3SYQ A;  4P30 A;  4RUE A;  2A79 B;  4PA9 A;  2YEV A;  5CBF A;  2Q68 A;  5KUK A;  4LP8 A;  4I9W A;  2AHZ A;  3T2M A;  4LBE C;  4JTD B;  4WFG A;  3LDD A;  4P9P A;  1V55 C;  3OR7 C;  3VOU A;  3X2Q C;  1FS0 E;  4PA3 A;  2WLL A;  3SYC A;  3RVZ A;  5EBL C; 
#chains in the Genus database with same CATH topology
 4R50 A;  4ASV A;  2WSS G;  1NU1 J;  1ZOY C;  4DR5 O;  1F4M A;  3QG5 A;  1H0T B;  1ZLZ A;  3FB6 C;  2IBZ H;  1NTM H;  5KHI A;  5KLV H;  3RL0 B;  4P2Z A;  3QO5 A;  5J2U A;  3JSN A;  1AI7 A;  4RQF A;  3TET A;  2DYR C;  2XUM A;  3HE5 B;  2M5A B;  1VQ5 P;  2PYL A;  1BSN A;  1URF A;  1I5X A;  3OMN B;  1SFC C;  2DYS C;  2NLJ C;  3K59 A;  3EXA A;  4CBC A;  2FML A;  1QL1 A;  2E76 C;  3H1I E;  1LJ2 A;  3JCZ A;  4EEQ A;  2Q6A A;  1L0N G;  5APU A;  3CLQ A;  1COW G;  1K34 A;  1X9V A;  2NPS D;  1LTB C;  3HE4 B;  3WU2 H;  2N05 A;  3CS5 A;  3ETQ A;  1YJ9 V;  5AW7 B;  2MW2 B;  4OGQ C;  5GTI E;  1BE3 H;  2XND H;  4LF5 O;  3CXH I;  1IBL B;  1WLE A;  4R8C A;  5IY5 C;  2A06 E;  2F23 A;  4IFD K;  2R9R B;  2B87 A;  3H32 A;  1Y67 A;  3P8C E;  1NR1 A;  3M7M X;  1NTZ G;  2BEZ F;  2YI9 A;  3KCY A;  1BHB A;  2ZAE B;  2PGD A;  5AVS B;  1VQ9 P;  2ILM A;  4F6E A;  4Y99 B;  3ZRW A;  3JAK B;  4MVQ A;  1NHL A;  1Q7Y W;  3T4D A;  3HPL C;  3L74 H;  1IFM A;  3ZJZ A;  4R4L A;  1F23 A;  2KKW A;  1D2D A;  2QWN B;  4GOE A;  2B88 A;  2KNC A;  2QGN A;  3RK3 C;  2QIW A;  3W7S A;  2IJI A;  1LT1 A;  3F5H A;  1M57 C;  1S1C X;  5LP6 B;  3L71 J;  4IOI H;  1NVP D;  2E43 A;  3AE3 C;  1NQT A;  1L0L E;  2WSC H;  1GMG A;  1LUV A;  5CA3 A;  1JB0 J;  3ZRX A;  1KB9 I;  2B5U A;  3LSQ A;  3CRM A;  3II6 A;  1S77 D;  2KSJ A;  1B04 A;  1OW8 A;  3U1A A;  3H1J G;  3QF7 A;  2W0X A;  4EKW A;  1SC5 B;  1JMB A;  5H9C A;  2IJH A;  2IH1 C;  4FLZ A;  3E8B A;  2I1J A;  1PPJ H;  2VRS A;  3L70 E;  1BZK A;  1JY3 P;  1P84 E;  2XHB A;  1BCC D;  4IIJ B;  4RUE A;  4YJ2 B;  4L8J A;  3HKD B;  2VWK A;  3D8C A;  1K04 A;  1NTK K;  4DCK A;  3A2A A;  1JA8 A;  1IBL O;  4GIF A;  1SQB G;  3V2Q A;  2WLL A;  4WVZ A;  4N23 A;  4UB8 E;  2Z4E A;  2QTO A;  3ASN B;  2ZKO A;  3CX5 D;  1J1D C;  3THO A;  2B89 A;  1Y74 A;  2KLV A;  1Q82 W;  1R3J C;  3AE9 C;  3QO8 A;  1RY3 A;  5AW0 B;  1GTW A;  4IFF A;  2PYJ A;  1X0T A;  2J5U A;  3CC2 V;  4LWS B;  2JJ2 G;  5LA6 B;  2F43 G;  3DXR B;  4WFB V;  3FKS G;  2OYQ A;  4PV1 D;  3K06 A;  3E89 A;  1NJI W;  1M1J C;  2YSU B;  2HFE D;  1WB8 A;  1GL2 A;  1GU5 A;  4C7N A;  3C9I A;  3VN0 A;  3LSU A;  1VF5 C;  2QWP B;  1PP9 H;  1URQ D;  2K9J B;  2G3A A;  1ARO P;  1JEK A;  4X1Y B;  4C7U A;  4YXW H;  4R4M A;  3Q3D A;  2WMM A;  3RK2 C;  1RF1 A;  1YCI A;  1KU9 A;  1MFT A;  3IFX A;  4B3T B;  1XNQ B;  1DD4 A;  1N2D C;  3HTK A;  1O9H A;  1URQ A;  3CI9 A;  2A3Q A;  2WSF J;  1N36 B;  4GKJ O;  1NI8 A;  2ZXW C;  5L3B A;  4H0L D;  2FFD B;  1HNX B;  1KYO H;  2WWW A;  1AVO A;  2UXB O;  1T6A A;  3ZS8 C;  4JGS A;  2OCH A;  1HNZ O;  4ZKI A;  3GWO A;  2IBZ D;  3FYE B;  1GKF A;  1LTJ C;  3V2P A;  1V9P A;  2Y9Y A;  5DJT B;  5KLV D;  3RW0 A;  2CTQ A;  3JSV C;  4BRY A;  3A0B Z;  1PKX A;  1VQ8 V;  1BCC J;  1EZV E;  4MS2 A;  2Q0A A;  2DE0 X;  5KHJ A;  2LO1 A;  2NPS C;  3FWN A;  4EFE A;  4PA7 A;  4I4T A;  3CPW O;  1S9K D;  3VMZ A;  3TGU H;  5EZY A;  1FXK A;  5GON B;  4BIZ A;  5KHK A;  5DED A;  2NNU A;  4ZKP A;  2CTR A;  1L0L D;  1SQX G;  4UB6 Z;  3JD4 A;  2O1K A;  4IL6 X;  2E5T A;  5AW6 B;  4HNA A;  1L0L K;  1BE3 D;  2KOG A;  1JVM A;  2Y0C A;  4TV9 B;  4UVC A;  1S72 P;  4KT0 J;  1HDJ A;  1MFZ A;  3JAS B;  3JAT B;  3ZHU A;  2EIL B;  2L5G B;  4I1L A;  1L8D A;  3B77 A;  3LDD A;  1VQ5 V;  5B5E Z;  4DR6 O;  5KA5 A;  1RF0 C;  3RVZ A;  1AVM A;  2ZE5 A;  1VF6 A;  1S5L Z;  3L74 D;  4FM2 A;  3C3T A;  5CB4 B;  1P84 F;  2JIZ G;  3O6Q B;  1W59 A;  2DWD C;  3S3X A;  3W67 A;  4F6R A;  1J5E B;  3OM3 B;  2C9N Y;  2BOC C;  4GCZ A;  5FL7 G;  4JF3 A;  4B7E A;  1FBM A;  4LR3 A;  2ITD C;  4U3J A;  3K9S A;  4ZOL B;  3RN4 A;  1XMO B;  4H13 B;  2XAH A;  2E5Y A;  1WRG A;  3RYF A;  3HKB A;  1AI5 A;  2Y0I A;  5KLI B;  4WF9 V;  4DR2 O;  2HHH O;  1U57 A;  1SQG A;  2D2C C;  5IYD O;  1DF4 A;  3FXE A;  3EVK A;  2E75 C;  5L3F A;  2LGW A;  1PPJ D;  3B8M A;  1VEW A;  2Y0P A;  4LH6 A;  1GO3 F;  1IXB A;  1YTF B;  2JR8 A;  4FFB B;  1BS3 A;  1QLE D;  3FFQ A;  4AYC A;  3CRA A;  2PFX A;  2XV5 A;  3L9D A;  1VMG A;  1XMQ B;  1L0N E;  4XFJ A;  4CH4 A;  3E7K A;  5D5Q A;  4LNU A;  2CK3 H;  3L35 A;  1XNR O;  4JYY A;  4LF7 B;  4B3M O;  1P49 A;  2KIK A;  3A0B H;  5H2F E;  1L0L J;  3H1H H;  5KA6 A;  1KIL E;  2OYH C;  1XIL A;  3L72 G;  2JDI H;  2HFE C;  5AW2 B;  2ITC C;  3OGC C;  4FK5 C;  4WBN A;  1BE3 J;  2FYN B;  3CMA P;  4JYA B;  2Y4U A;  1NTZ E;  1R6K A;  2C9L Y;  4CH6 A;  3LNM B;  5JJE B;  1KB9 H;  2CGO A;  1R3I C;  2BAS A;  3QWO C;  3E83 A;  4BR6 A;  4UB6 H;  2UUA B;  4YJ3 B;  1Y4M A;  4B3R B;  1B06 A;  4K8X A;  3L75 G;  2M8R A;  1DEE G;  4GT1 A;  1PP9 D;  2C2A A;  1EN5 A;  3QH9 A;  2JWD A;  1KKC A;  3L74 J;  2QM7 A;  4MVR A;  3PRJ A;  5JJN B;  1RE3 A;  3MGN A;  1J1E B;  1YIJ P;  1GMJ A;  4DYL A;  5KX5 B;  5B5E H;  4AIL C;  3JC2 2;  1VDF A;  1DD3 A;  4WY4 B;  2JEU A;  4NPE A;  1S5L H;  2P06 A;  1KYO D;  2PF4 E;  2XTA A;  5JWP A;  1GTO A;  1GM7 A;  3H1J E;  3CWB G;  1V55 C;  4DV1 O;  3M9Q A;  3HD7 B;  3IN6 A;  4RJT A;  1YQ3 C;  3K5M A;  3SYC A;  2QRX A;  4DR4 B;  1R6T A;  3RYI A;  1SQP G;  3IAY A;  2YMK A;  3HUS C;  2IZ1 A;  3ZBH A;  1IBK O;  2GA1 A;  1Z5V A;  2J58 A;  1WA8 B;  2W6J H;  4HKZ H;  2RMZ A;  2OTJ P;  3KPE A;  1NU1 H;  5K5G B;  2W27 A;  1YIT V;  1ZL8 A;  3CCM P;  2QJK C;  2P2U A;  1SQB E;  1MG1 A;  2Y48 A;  3SPC A;  2X6B A;  4X20 B;  3TGU D;  1WNS A;  2YKQ A;  3D71 A;  4JYA O;  4UCR A;  1VQO P;  4JI7 O;  2CPS A;  2IFN A;  5APQ A;  1QBZ A;  4YIP A;  5A2Q N;  1TAE A;  5ITZ B;  3J7A U;  4JQ0 D;  2IFM A;  4FLY A;  1M9N A;  2P5O A;  2Z5I A;  2WLJ A;  2OTK E;  1JR9 A;  1JJO A;  3JYC A;  4E2L A;  1DTO A;  4DV6 O;  5FNV A;  1ZXG A;  1LP1 A;  1YQ4 C;  4O4H B;  3MP7 B;  4D7T A;  3SWK A;  1NZ6 A;  5CBG A;  2KYV A;  1KMI Z;  2IW5 A;  3WG7 B;  4W7Y A;  5LOV A;  3FGA D;  2OYO A;  3AG2 B;  2KUB A;  3J80 N;  1RQV A;  1K33 A;  2M7W A;  3K5N A;  1PP9 J;  1D5A A;  3VQW A;  2L6L A;  3CJH A;  5H6R A;  1VAR A;  3M0A A;  1MA1 A;  1LT9 A;  1JOC A;  4DV4 B;  1M56 C;  4EDF A;  4LGD E;  3OTO B;  1L0N K;  2OCC C;  1N7S A;  3I5D A;  1THZ A;  3OTF A;  4JV5 O;  1IFI A;  2Q7C A;  4WBA A;  4DR7 B;  5LXT A;  2VQE B;  2YIU B;  4LC1 A;  1IFJ A;  5APT A;  5AW8 B;  5B66 Z;  2CE4 A;  1M90 Q;  4BIO A;  3G6E V;  2Y9Z A;  2ZR3 A;  3ML0 A;  1HWT C;  3HKC A;  5IJ9 A;  2GUV A;  5JVD A;  4CPG A;  1TA8 A;  4IFM A;  1NTZ K;  2AEM A;  4MW3 A;  2DJV A;  1SLQ A;  4D7S A;  3CXH D;  5EFW B;  4GYC B;  5AVQ B;  2ZFC A;  5DN6 G;  1K4C C;  5TIS Z;  1LTG C;  3JAM N;  3BCC G;  2ZT9 B;  2M0B A;  1GRJ A;  2UWJ E;  4X62 O;  3I5C A;  2I8D A;  1H38 A;  1P84 I;  1SA0 B;  1NTM G;  3M99 B;  1I94 O;  2BE3 A;  2H3O A;  5KLV G;  3UO3 A;  4IT5 A;  1IFP A;  2F4V B;  1Y76 A;  3I56 P;  2P90 A;  4RKU J;  2A79 B;  3E35 A;  4AQY B;  4LFB O;  5LGT A;  2JKV A;  2UXC B;  1SQX E;  2LXB A;  4KL1 A;  5FPO A;  5KAF Z;  1N33 B;  1FJK A;  2AHZ A;  1JX9 A;  3W7W A;  4I7Z C;  5GW7 A;  2FYU G;  1OJH A;  2M3B A;  2X0L A;  1CXZ B;  3H1H D;  2YS8 A;  5CCH D;  3S4R A;  2ZYA A;  2FKW B;  2OT5 A;  1F7Y A;  1G4Y B;  1K3E A;  3HKE A;  3UM7 A;  2NZ2 A;  1JM0 A;  3SJQ C;  4QPK A;  4L73 A;  3K04 A;  2I1K A;  3W7U A;  1KB9 D;  5KMG B;  3CCS P;  4X1I B;  1AQT A;  1SFC D;  3OTO O;  2IZ0 A;  2RNB A;  5M1B A;  1BT8 A;  5LYJ B;  2BTQ B;  1IXM A;  1TUB B;  1KQG B;  2E76 D;  3T1H O;  2KLU A;  2QJP C;  3CP1 A;  2DW3 A;  4D6T G;  1Q3E A;  4ZI7 A;  2WA3 A;  4PD4 F;  3UT5 A;  3B5N B;  4X64 B;  3WUV A;  1SQB K;  1SFC A;  3AG4 B;  1AP6 A;  3BY6 A;  4UCS A;  4OGQ D;  5IY5 B;  3ABK B;  4I50 B;  2H88 C;  5GTI Z;  2YIB D;  5AVZ B;  4Z1M H;  1N73 C;  2ZIO A;  1PZQ A;  4X66 B;  1QHT A;  1AA0 A;  3CMA V;  2V1D A;  3STZ C;  4NXN O;  3E22 B;  3DC5 A;  1YDX A;  2JGD B;  3AED C;  3JD0 A;  4DR1 B;  1FDO A;  2WSF H;  1H89 A;  4JI3 B;  1N32 O;  1OFC X;  2NN4 A;  1OVV A;  3ETG A;  2ZXX A;  1FFX A;  2P7T C;  4N3Y B;  1L1F A;  1CSB A;  1TU3 F;  5E79 E;  2POH A;  2Z5H A;  3L73 H;  5IJ0 A;  1FKA O;  3TYY A;  5B66 H;  4AQY O;  3RK3 B;  2Y0E A;  1UJW B;  4B86 A;  3M91 A;  3H1K H;  3JAW A;  4IGG A;  2AEJ A;  1NO4 A;  2CUG A;  3GHG B;  1EZV I;  1M57 D;  3N2K B;  4TSF G;  1XI1 A;  3CXC U;  3V6I A;  4EOT A;  4TUY B;  5AVV B;  3Q5R A;  1PNM A;  1YIJ V;  3DGE A;  1MOF A;  3B8N A;  5TIS H;  2X6C A;  2OAR A;  3H01 A;  1NTK H;  3AE7 C;  4EB6 A;  3L72 E;  3ZHT A;  3D6Y A;  5K1P A;  2PTM A;  3R66 A;  5IWA O;  5H5N A;  3ZMS A;  1V54 C;  1GD2 E;  4X1K B;  3R65 A;  2PP6 A;  3SPI A;  1JY2 P;  3C8V A;  1AVY A;  1XTG B;  5KAF H;  1LWU C;  2QKA A;  1OW6 A;  4JI6 B;  1VQ7 P;  3L75 E;  2OTJ V;  1U7J A;  4NYK A;  4N21 A;  1M90 W;  2N1T B;  5AVU B;  4PA9 A;  3CCM V;  1KIL C;  1R73 A;  2P7J A;  3EHB B;  2XAG A;  1D5N A;  4GKK O;  3KQG A;  1PL5 A;  5EYP B;  4MT8 A;  3OA7 A;  4UB8 Z;  2LFR A;  3OR7 C;  3NXS A;  1VQO V;  1VQ6 V;  2BSK A;  4H44 D;  4UXN A;  1SZX A;  4DW1 A;  2K1E A;  1SQX K;  2Q4P A;  3OFN G;  3MHH C;  3SJB C;  2JEE A;  2YEV B;  2AGA A;  1OCO C;  3B2E E;  2IJK A;  4I0X B;  1T3U A;  4R7C A;  4OWF A;  3H1I H;  5CBH A;  3CWB E;  3RYH A;  3KDP B;  3T97 A;  3E86 A;  2FXP A;  2SPZ A;  1VF5 D;  4BAY A;  2AXC A;  1S0V A;  1H2K A;  1SQP E;  3CCU P;  1VQK V;  5GTI H;  1PNK A;  1NJI Q;  1M1J A;  3RK2 D;  1CI6 A;  2MKV A;  2A06 H;  3JAR A;  1FJG B;  5J2U B;  4ZMD A;  1L4A D;  1SQV E;  4FPP A;  1TGO A;  3GWK C;  5CCH C;  3IJ4 A;  3ABM B;  1AP5 A;  4FMT A;  3M0D C;  2JJL A;  3TGU G;  4PDM A;  4WFA V;  4JI6 O;  1LTJ B;  1AQ5 A;  1VQL P;  3RYC A;  1K5Q A;  1M7L A;  3CCV P;  1WN7 A;  1HW7 A;  1Q6H A;  2QWO B;  1Z2G A;  2Y69 B;  2E74 B;  2YID A;  4L75 A;  1EN4 A;  1L0L H;  5B1B C;  3VMX A;  2B87 B;  3NMD A;  1N7L A;  3H32 B;  1EFR G;  2ZNI A;  1LTJ A;  2EIK C;  4HZ3 A;  2YIA A;  2K88 A;  1Q43 A;  2UUC O;  1ZRT E;  1CPY A;  3ZRW B;  2QE7 H;  2PI5 A;  4OH8 B;  3T1Y O;  3AG3 B;  2NPS A;  3I56 V;  4DJG A;  3BAB A;  2ZYD A;  3L70 H;  5KJ7 D;  1P84 H;  1SQX J;  4MVU A;  5AVT B;  5L3E A;  3ASO C;  3K57 A;  4MW8 A;  4QE9 A;  3LSS A;  1HGZ A;  2KNC B;  1FAV A;  2Q69 A;  2RCV A;  2MJZ A;  2HPC A;  1FJP A;  2R9I A;  3E1R A;  4JI0 B;  2PGG A;  1NAF A;  4BW5 A;  2BOB C;  4XA4 A;  2ETN A;  3B4S A;  2UUB O;  3A7O A;  3M8A A;  4UB8 H;  3FX0 A;  2ZVN B;  3CC4 P;  2IDB A;  3BFR A;  1FJG O;  3F5T A;  3CCS V;  2ZXE B;  3VBB A;  2JP3 A;  1OCC B;  3BCC E;  1NVP B;  3L37 A;  4DK0 A;  3LW5 H;  1Z56 A;  2XAS A;  1M8O B;  4WFG A;  1FC2 C;  1HVV A;  5L3D A;  1VPC A;  2IU3 A;  1QNM A;  3L73 D;  2OYI C;  4HAM A;  1NTM E;  1H2M A;  4PI2 A;  3R2P A;  1LTT C;  3ZMV A;  2OIE A;  1RF0 A;  2F95 B;  2EIN C;  1YJW P;  3H1K D;  2Q5U A;  1AI4 A;  5BR8 O;  4GKJ B;  1E1R G;  2IYP A;  3U11 A;  1GN3 A;  2EIM C;  2XZR A;  2FY8 A;  3AK1 A;  4PDV A;  3ZDM A;  4OXS A;  3ZN0 A;  5BVZ A;  2FYU E;  2WLL B;  1OV9 A;  2YXH A;  2UXB B;  1H8H G;  3AE4 C;  1NTK D;  3M06 A;  4I9Q A;  4J7K A;  3KCX A;  1I08 A;  1HNZ B;  4XDK A;  1BDC A;  2Q3I A;  2QM8 A;  5F2V O;  2D2C D;  1Y74 B;  2QJ1 A;  1CEZ A;  2KG7 A;  4U3F G;  2E75 D;  1XOU A;  1RPR A;  1GN2 A;  1UFI A;  2CK3 G;  2KB1 A;  4QNH B;  5CA1 A;  1G2C A;  2JK5 C;  3H1H G;  4I55 A;  1WAZ A;  1EDL A;  2V4D A;  3SR2 C;  4DV5 O;  3I55 P;  1SQP K;  1M5I A;  2JDI G;  2WLK A;  4DV3 O;  1A02 F;  4J11 A;  1SQQ G;  1JO5 A;  2YXR B;  3K0D A;  2AZ0 A;  2WIT A;  3VOP A;  1SQV D;  2KB7 P;  1GL2 B;  2B9Z A;  4H44 C;  1GU4 A;  4C7N B;  4GZR B;  3ZRV A;  1G1J A;  4D6T E;  4R6Z A;  5B1A C;  4JI0 O;  3CCR P;  4PV1 B;  1SQV K;  1RF1 B;  5H2F Z;  2LP7 A;  1EZV H;  2XAJ A;  2K37 A;  3V4Q A;  3HTK B;  1URQ B;  1M4U A;  4DR3 O;  1O9G A;  4JZG A;  2GBO A;  3APQ A;  5B1N A;  3HB3 B;  3TNU A;  1RFY A;  4NR1 A;  3OW2 O;  2OYH A;  2QJY C;  2A45 G;  3H1I D;  1X59 A;  2RN0 A;  1FZC C;  3FB8 C;  4WB4 A;  1RM1 B;  5B3S B;  3U0Z A;  3BVO A;  1JCC A;  4H0L B;  3CX5 F;  4PDL A;  4OX9 O;  1L4A C;  3B40 A;  4JAS A;  3UQ8 A;  4DR6 B;  1PGJ A;  1N86 A;  3AG1 C;  3KZI Z;  1FZF A;  3TK1 A;  1YTZ I;  2LKM A;  2WLI A;  4RES B;  2A06 D;  3L73 J;  2BCC G;  1H8E G;  4F4L A;  2UU9 O;  2CPB A;  3QNE A;  4BRY B;  2Z3Y A;  3P8C D;  5EIB D;  1OVR A;  3H1L G;  3AK2 A;  3KXD A;  4XBF A;  3BRC A;  5LMU O;  3H1K J;  4LF4 O;  3OE7 G;  4FVM A;  1FZG A;  1B3Q A;  4I4T B;  2O1J A;  3UIA A;  5KKZ C;  5EK0 A;  1EDI A;  1NU1 G;  5EZY B;  3CCQ P;  4FIP C;  4ZIB A;  1FXK B;  2V7Q H;  4NTW A;  4RQE A;  1JMK C;  1BHA A;  1NTK J;  1AB3 A;  5APS A;  1NKZ B;  3EWK A;  1KBH A;  1NR7 A;  4UV8 A;  1YTZ T;  2KSE A;  4JAA A;  2HHH B;  4DR2 B;  2W8Z A;  3CSX A;  4I9W A;  4TT3 H;  4HNA B;  3RL0 C;  3GF7 A;  3OAA G;  2O01 J;  3K79 A;  1JTH A;  2H7H A;  3FXD A;  2WSS H;  4HYO A;  1J2J B;  3HUS A;  1GM8 A;  5KJ7 C;  1P7B A;  1I0H A;  2CDY A;  4DK1 A;  3ZHR A;  1BGY E;  3JD3 A;  4N6J A;  1KV4 A;  1SQV J;  1W0K G;  4GX2 A;  4IYH A;  5J9P C;  3LUT B;  1XNR B;  2N04 A;  4B3M B;  5IYZ A;  3L70 D;  2GTA A;  4W4K A;  2AXT E;  2FL4 A;  1P84 D;  1E79 H;  2R32 A;  3PLN A;  2OIG A;  1SET A;  4K0K O;  2ZE6 A;  3MZW B;  4F6R B;  2FYU K;  1NBM G;  5CCG D;  4EFB A;  1VQL V;  3Q5S A;  2XAQ A;  2E3C A;  3GLM A;  1L0N H;  3CCV V;  1UPG A;  3K3W A;  3RWR D;  2D3O W;  1GK6 A;  2WT7 A;  4X8A A;  2QTS A;  3LDC A;  3H1I J;  4Y99 C;  4O4I A;  5H2F H;  2QM4 A;  1K92 A;  4U3J B;  4BXL A;  5KAI Z;  2CH7 A;  3OGI B;  2HLO A;  5APX A;  3IGA C;  4PEL A;  3RYF B;  3HKB B;  3G4S P;  4GX0 A;  1KOR A;  2CTW A;  3ABV C;  1GAX A;  1OCZ B;  4JI5 O;  3SJC C;  3H9V A;  3VQY A;  3L36 A;  1NTZ H;  5FPR A;  1JCH A;  1M56 D;  3SJA C;  5APW A;  1GM9 A;  1K97 A;  1YEW A;  1K9M W;  3L71 G;  3EFF K;  1VQ9 V;  4GOF A;  5D5P A;  4HBN A;  1U7M A;  3CXH H;  2H8P C;  5GTH E;  5LP6 C;  1JOY A;  1VQN P;  2GUZ A;  4LF6 O;  2JVD A;  3H25 A;  3JAL A;  3KZI H;  4X9Q A;  4LNU B;  1QLE B;  3WUT A;  3CC7 P;  4DV1 B;  2O57 A;  1Q2N A;  1DIP A;  2PZS A;  2KZI A;  4FFK A;  4FLX A;  2ZJS E;  2Q7G A;  1G1X B;  1OHH G;  4WBN B;  3MAQ A;  2KP8 A;  5CN0 A;  4H13 D;  1IJD B;  1IBK B;  1PFI A;  4JAU A;  4QMA A;  5JQG A;  2IYO A;  4QJF B;  4MN4 C;  1ZWI C;  3H1J H;  3ZHQ A;  4LLH A;  3K03 A;  5LHG A;  1XHZ A;  1YJW V;  2ZDI C;  3RL0 g;  3VTP C;  2FKX A;  4KUM A;  2HOD A;  5AW9 B;  3JSL A;  3ASN C;  3C1L A;  4JI7 B;  1NS1 A;  1R8E A;  5CBF A;  3L70 J;  1NH4 A;  5KUK A;  2P22 C;  1WMK A;  3LID A;  2RJZ A;  1W2B U;  1EZV D;  2HYN A;  3D3Q A;  1YI2 P;  4JTD B;  1SQB H;  2J59 M;  2CAZ C;  1P4R A;  3M9H A;  1Q6I A;  1SER A;  4DV6 B;  1MSD A;  3VYI A;  1LNQ A;  2XNX A;  4Z1M G;  3I55 V;  2YXQ B;  1EDK A;  3IF4 A;  1EDJ A;  2QWQ B;  5EIB C;  4PA4 A;  3B09 A;  3X2Q B;  1BGY D;  3ABU A;  3QVN A;  1JY3 O;  3LW5 J;  3RYI B;  4DRX A;  1CW5 A;  2W6B A;  3CCR V;  3RVY A;  5BZB A;  2EX3 A;  4JV5 B;  4YHH O;  1RSO A;  3FX7 A;  5KAI H;  1PV0 A;  1NKD A;  1ZL8 B;  4NB5 A;  4LFC O;  4DV7 O;  2FFD C;  1E1Q G;  2W6I G;  4B7K A;  1AR4 A;  3F89 A;  2IX7 C;  2F1M A;  1FXH A;  1YJN P;  1KD1 Q;  4IHJ A;  1FYJ A;  4PD4 E;  1VQ4 P;  1N73 A;  5LHH A;  4L87 A;  3SPH A;  2JO1 A;  3VMA A;  1ZR2 A;  4U3F E;  2Q0O C;  4WY4 D;  1HJ0 A;  1HGV A;  3A0B E;  5AW5 B;  1BDD A;  1W0J G;  1BCC G;  1S2E A;  4CC5 A;  1TVK A;  2IJJ A;  3FYI B;  3R4Y A;  1H88 A;  4X62 B;  2DWE C;  4QIW F;  2GM4 A;  2H94 A;  2AW9 A;  3KKY A;  1SQQ E;  4NXM O;  1HTL C;  3B71 A;  5FNV B;  5LL6 Y;  1LP1 B;  1DEB A;  3G71 P;  1I94 B;  3D6Z A;  1NH2 B;  1BL8 A;  1PL4 A;  3LIE A;  1MSW D;  5LOV B;  3DSQ A;  1YSC A;  5HFM A;  3MHS C;  3SPJ A;  1Y8A A;  5CCG C;  4LFB B;  4I2L C;  3N2G A;  1Q86 Q;  4JI1 O;  1WP7 A;  4FM1 A;  3ETE A;  3CCQ V;  4FLU A;  5JJJ B;  3CJH B;  3LNN A;  3RBZ A;  1RP3 B;  1LT9 B;  1AJY A;  2KZJ A;  4G28 B;  2UXN A;  3B8E B;  4NTX A;  1N7S B;  1P7G A;  1ZTE A;  1N34 O;  1QLN A;  5LXT B;  2Y0D A;  3U10 A;  1JY3 N;  1HNW O;  1RE4 C;  1L0N D;  2Q73 A;  2EIJ B;  1SQX H;  2EIL C;  1MZF A;  5AVW B;  3G6B A;  3SWY A;  3ZIA G;  4MTO A;  3E8F A;  2ZE7 A;  3HKC B;  5IJ9 B;  4DO2 A;  2N9B A;  1R3L C;  3T1C A;  5JVD B;  1KIL D;  3ZED A;  4LFA O;  5IYC O;  3W7X A;  1LWU A;  1HP8 A;  1T8Z A;  2ATK C;  3E2E A;  1OCR B;  3T1H B;  2WA4 A;  4FLT A;  2F66 C;  1USD A;  2RQ6 A;  1BGY J;  2JS3 A;  3ABL B;  1XHX A;  2BCC E;  5KTB A;  1SQF A;  1OZ0 A;  3V5B A;  1S72 V;  1NTZ D;  3H1L E;  1KIL A;  3BRV B;  2A7W A;  3RK3 E;  1FD9 A;  3WB2 A;  2Q9I A;  1YF2 A;  4W80 A;  2WZ7 A;  2EJ7 A;  1Y76 B;  2QA4 P;  4NXN B;  2ADQ B;  2V7Q J;  2WLH A;  4H13 C;  2JRI A;  4DUZ O;  3CME P;  1QQC A;  3P8M C;  2IBZ G;  4XDL A;  3A0R A;  1N32 B;  5KLI C;  2LFS A;  4O2B A;  4MTF A;  5HFL A;  3ZMU A;  1NT2 B;  3SSU A;  1QL2 A;  3GB7 C;  2Q9L A;  1Z5W A;  3HKE B;  4PHZ A;  1GN6 A;  2ZM6 O;  1SKV A;  4RO0 A;  1MZ9 A;  1W2E A;  1F51 A;  4WFE A;  3H1J D;  3MIW A;  3A0H E;  1EC5 A;  1YJ9 P;  1HH0 A;  1L0L G;  2DW4 A;  4UVA A;  2DYR B;  1VQN V;  2FXM A;  5LGU A;  3Q4H A;  5CCH A;  2HG5 D;  4ZI7 B;  3UT5 B;  2XND G;  1BE3 G;  1SFC B;  2DYS B;  4MSW C;  5IWA B;  3MDS A;  2E5L O;  2KS1 A;  2PRR A;  3M0D A;  1ORQ C;  3CC7 V;  2E76 B;  2FYN C;  4MTG A;  1SQB D;  4LF9 O;  1PGO A;  1T5E A;  1I5Y A;  4DV2 O;  1L0N J;  2P4K A;  2P58 A;  4OGQ B;  5BMV A;  4GDO A;  2ODM A;  5L8R J;  3CCL P;  3L74 G;  1H2N A;  2LW1 A;  1SQQ K;  1KD1 W;  4GKK B;  4TLF A;  2B1I A;  2VQF O;  1L2P A;  3BAT A;  5CA0 A;  3AEE C;  1FFX B;  2R9A A;  1NWQ A;  1QVF U;  4AI8 A;  5CMU A;  3L71 E;  5IJ0 B;  1FOS E;  1NTZ J;  3K0G A;  2YIB A;  2AEF A;  3OD4 A;  5JH7 A;  1J1E C;  3RGB A;  3H6P A;  4I6M C;  3L75 H;  2WTY A;  1KFM A;  3S9O A;  1ZX3 A;  3JAW B;  1ZP0 C;  2W90 A;  1Y6X A;  3B5N D;  3JCU E;  4WY4 C;  1W2B O;  1PD3 A;  1DK1 A;  1FDM A;  4NKG B;  1NAY A;  2YIC A;  1MUU A;  1QX8 A;  4J41 A;  2EBO A;  1M57 B;  3HD7 C;  5B1O A;  1F4N A;  2DMX A;  4EB6 B;  1GK4 A;  1Q86 W;  1OZH A;  1PPJ G;  2PUS A;  2Q5Z A;  5LGN A;  1YYC A;  4G2K A;  1WPB A;  4P30 A;  2GHY A;  3D36 C;  3CRR A;  4YIO A;  3BAS A;  5L3C A;  5IDJ A;  4AQR D;  3CWB H;  4LBE C;  2O3J A;  4P9P A;  2WSE H;  3VOU A;  2OYI A;  4JI2 O;  1JQ0 A;  1H2S B;  3H1J J;  5EBL C;  3CYO A;  1NGM B;  1SQP H;  4MVZ A;  4AUW A;  3SYA A;  2O01 H;  4IYI A;  2K1A A;  1LTS C;  2HLD G;  3RGU A;  4IL6 E;  2JWA A;  2R5B A;  4Z1V A;  4CC6 A;  1R3K C;  2XAF A;  1YJN V;  1MV8 A;  2XOK G;  3USS A;  1VQ4 V;  5LMN O;  3CL3 D;  2ZNJ A;  1SQV H;  2Q6Q A;  2BSK B;  1YXB A;  3IC9 A;  4TV8 A;  2QR4 A;  1G1I A;  4ZHQ A;  4JI4 O;  1SQB J;  5AW3 B;  3MTU E;  3J81 N;  2WPR A;  3TJT A;  1GH6 A;  1J1D B;  3WMM 0;  1BSH A;  4YY3 B;  1KZU B;  1SQX D;  3RBX A;  3N27 A;  3WG7 C;  1PP9 G;  3RYH B;  1EN6 A;  1M93 A;  3G71 V;  3T97 B;  4CH5 A;  4YXW G;  3AG2 C;  2UUC B;  5BY1 A;  1JFF A;  5AW4 B;  4A7P A;  2LXC B;  3T1Y B;  2YKP A;  4DZO A;  1M1J B;  4NVP A;  5C8Y A;  4KFM A;  1CI6 B;  1SF9 A;  1QR9 A;  1R6N A;  2JS5 A;  3T4Z A;  1VF5 B;  4X88 A;  3JAR B;  2N1T D;  4OVN F;  4N78 E;  1GW3 A;  1HWY A;  2YIU C;  1FZE A;  3RK2 B;  2N9Y B;  2M6Y A;  2X6A A;  2UXX A;  2QJY B;  5J2T A;  4TOI A;  2UUB B;  1FZC B;  3ZMT A;  4O4L A;  4KHX A;  1S3J A;  2GTS A;  2K9P A;  1DH3 A;  2ZXW B;  2WPS A;  2ZVO B;  2P67 A;  5AG2 A;  3SYO A;  1BCC E;  3P3P A;  4J10 A;  3BA9 A;  3V2R A;  1VQ8 P;  3K08 A;  1AJP A;  3OUS A;  1FZC A;  1PV3 A;  2ZT9 C;  3RYC B;  3TXQ A;  3AEA C;  2JJ1 G;  2RDC A;  1L4A A;  1FDI A;  2P10 A;  3CCJ P;  2KXP B;  4XE5 B;  2QEX P;  2A9H A;  4TT3 G;  3AEI A;  3KYQ A;  4ABM A;  2HG5 C;  4O2A B;  5BR8 B;  4CS4 A;  4CS3 A;  2P1J A;  4PJ0 E;  1J95 A;  3CX5 E;  1QR8 A;  3BCC H;  1RPO A;  3IR9 A;  4JZ2 A;  4BWN A;  1ENV A;  2WVR A;  2NPS B;  2Q67 A;  3UO2 A;  3W7T A;  2QA4 V;  2YXY A;  5LBQ A;  1FOS F;  1MAB G;  4O2A A;  4YY3 O;  4DW0 A;  2G38 A;  1IBM O;  2HVK C;  3CME V;  1FZB A;  2YMY A;  3RL0 D;  5CJ4 A;  3BHP A;  1X8Y A;  3MHV A;  2HPC B;  1H0T A;  1E79 G;  4DV5 B;  4GOD A;  3AE5 C;  4DV3 B;  1K5S A;  2FYU H;  5CMZ A;  5DEC A;  5IT9 N;  4C46 A;  1MMM A;  3L72 D;  3VQV A;  3PTZ A;  3HE5 A;  3PH0 A;  1GW4 A;  2M5A A;  4RO2 A;  2E74 D;  1S5L X;  2YI8 A;  3AK3 A;  5KJ7 A;  3LDE A;  2GUS A;  2OGU A;  3B5N C;  2XDJ A;  3AG4 C;  3P7K A;  3F5W C;  3GVM A;  1IFD A;  3CEI A;  1FE6 A;  3ETD A;  3ZN1 A;  4HJG H;  4JBZ A;  2AXT Z;  3ABK C;  3SGI A;  2B1G A;  2EZP A;  2LQT A;  4B3S O;  3L75 D;  1OVU A;  1Y47 A;  4PDR A;  3HE4 A;  4DR3 B;  1DX7 A;  1VL2 A;  1ZME C;  2C0W A;  4D6T H;  3VQX A;  4LF8 O;  2ZYG A;  4HB1 A;  2IBZ E;  3TDK A;  1XL4 A;  1H2G A;  5CBN A;  1HR0 O;  4PD4 I;  5KLV E;  5A9G A;  4MVM A;  2G8Y A;  3EFG A;  1PNL A;  4OX9 B;  3IAO A;  3CCL V;  1SS1 A;  1XL6 A;  2KG7 B;  1ROP A;  5AVY B;  1S9K E;  3F7V C;  3JAK A;  5CA1 B;  1G2C B;  3Q1M A;  2EZO A;  2UU9 B;  4I55 B;  2Q3E A;  3WB0 A;  4GX1 A;  4PA6 A;  4JTA B;  3GG2 A;  3MUD C;  2D2C B;  3CWB D;  3GHG C;  1QVF O;  5LMU B;  2HKO A;  2H8P D;  4LF4 B;  2E75 B;  4N78 D;  3WU2 E;  5GTH Z;  1T2K D;  1HUC A;  4NPF X;  1SQP D;  1HBW A;  1EXI A;  3AE6 C;  1R1B A;  4C7R A;  1AI6 A;  1BE3 E;  1G8M A;  5LP6 A;  3JD2 A;  2WPV B;  3D3I A;  3Q5P A;  5C39 A;  4DT0 A;  2IU0 A;  2KQX A;  2UXD B;  3D70 A;  2EJR A;  1IO4 A;  1VF7 A;  1AV1 A;  4YTP C;  2MK3 A;  1PL0 A;  1KKD A;  3BEH A;  3K9A A;  4EI2 A;  3S3W A;  2Q7H A;  2A45 I;  3TNU B;  4ASU G;  2OYH B;  2WLM A;  4JI8 B;  1SES A;  4K35 A;  3GF3 A;  2QSA A;  3VMY A;  3FB5 C;  1RHZ B;  3L74 E;  3OR6 C;  2A0L A;  1K7D A;  2QKS A;  4J7J A;  2N1T C;  2KK7 A;  4IIJ A;  3L72 J;  4YJ2 A;  3HKD A;  1IK9 A;  1S5H C;  2NRG A;  3BRT B;  5AW1 B;  3ZCC A;  4KJM A;  3FAV B;  2W0F C;  3E8G A;  5EC1 C;  1FS0 G;  2ZDI A;  2WQY C;  1LTI C;  3K5L A;  2HJF C;  2WLI B;  1GL2 D;  2JEX A;  3TCU A;  5BXZ A;  4NTY A;  2VS0 A;  3SYQ A;  4K0K B;  5FLX N;  1VQ7 V;  3UCS C;  3L75 J;  4NPD A;  2Q68 A;  1BGY H;  2ZR2 A;  1USE A;  5JCO C;  3FAV A;  3ZHV A;  1IC2 A;  1NYH A;  2YNY A;  1ZRT D;  1PIX A;  1YVW A;  4ICG A;  1NKN A;  1QU7 A;  4PI0 A;  4LWS A;  1PPJ E;  5LA6 A;  2KSD A;  1QGK B;  1BQ0 A;  3DXR A;  3W68 A;  1YHQ P;  2AXT H;  2H89 C;  1EXJ A;  4ZKU A;  4BIU A;  4U7N A;  1OMI A;  1YIT P;  2W6J G;  1JY2 O;  4UCT A;  4JI5 B;  1ZW0 A;  1SVF A;  2K9J A;  4LH7 A;  1V55 B;  2L35 A;  4X1Y A;  4M3L A;  1GN4 A;  3BVH A;  1JJ2 U;  1JTH B;  4QPJ A;  3CWB J;  3FWL A;  2WSE J;  1A02 J;  3HUS B;  3ABM C;  2UXD O;  1AIL A;  3CE2 A;  4LF6 B;  1N8R Q;  3OMI B;  1U97 A;  3BCC D;  3CCU V;  1SQP J;  3UKM A;  2R3C A;  2P6J A;  1N4C A;  2FFD A;  4W4L A;  1KP2 A;  2FTK A;  2QJK B;  4WCE V;  4JI8 O;  3DC6 A;  1WT6 A;  5IYZ B;  3AEB C;  2E42 A;  1NTM D;  2QDO A;  2FBW C;  4WFF A;  1S76 D;  3VP8 A;  2DQ3 A;  1NTM K;  5GTH H;  4Q20 A;  5KLV K;  3CRC A;  2Y69 C;  5IE9 A;  2E74 C;  3L4F A;  3A5T A;  2QWR B;  1PP9 E;  5DJU B;  1EQ7 A;  2WT7 B;  2YDE A;  2YUA A;  4L76 A;  4LCU C;  2FYU D;  1QVG U;  3CCJ V;  2QEX V;  4O4I B;  1ZV8 A;  2W83 C;  1H2L A;  3OMA B;  2CH7 B;  3O8Z A;  3AG3 C;  1YZB A;  4BW9 A;  2AHY A;  2BTO A;  2YO3 A;  5K1X A;  3AE1 C;  1JCD A;  3CHX A;  2R72 A;  4JPR A;  5GON A;  1Q8I A;  5CCG A;  4FZ1 A;  3G6E P;  4U7O A;  1KYO E;  4TQD A;  1IVS A;  1KQS U;  3NR7 A;  4B3T O;  2N74 A;  1XNQ O;  2ZCE A;  1JY2 N;  4YXD C;  1G6U A;  1M56 B;  2GUZ B;  2O01 N;  4D6T D;  3A8T A;  1EBO A;  2OCC B;  1MZE A;  2ZD9 A;  3JAL B;  1N36 O;  4TV9 A;  1WP8 A;  1HNX O;  4P9O A;  1RE4 A;  1OCC C;  1FAF A;  3JAS A;  3JAT A;  3CCE P;  4DXW A;  1XUQ A;  1IDS A;  2YKO A;  1T2K C;  2LR2 A;  1VQP P;  1JUN A;  4FLW A;  1B6Q A;  2R44 A;  3TGU E;  1WJZ A;  1Q5O A;  4CZZ A;  3AE8 C;  5JQG B;  5CB4 A;  4YHH B;  1HJB A;  3CC4 V;  1S4X A;  2RH0 A;  3OEE G;  1KP3 A;  4LFC B;  3O6Q A;  4DV7 B;  2L91 A;  3U59 A;  1U96 A;  1N0N A;  4FLV A;  3BCC J;  2HOD B;  2KI7 B;  3TXS A;  1NTM J;  5KHG A;  4ZOL A;  4UCU A;  1BQZ A;  2ZQM A;  5KLV J;  3WUU A;  4K8Z A;  4I7Z B;  4FJC C;  1YTF D;  3SDL A;  4TQF A;  1KN7 A;  5DM6 V;  4NXM B;  3CB2 A;  4A5U B;  1X4T A;  1UIX A;  4O9B A;  4PD4 H;  3K58 A;  1ZUQ A;  3U1C A;  2FYU J;  3C3S A;  1MNG A;  3SYP A;  1GL2 C;  5IYB O;  4U3F H;  1VP7 A;  1CZQ A;  2C0X A;  3KHU A;  2Q7E A;  1DF5 A;  4ASW A;  3A0H Z;  5BU5 A;  2YO2 A;  4FFB A;  4PV1 C;  4JI1 B;  3RFR A;  1RF1 C;  3ABT A;  4UCV A;  1ZN5 A;  2ADP A;  4DRX B;  1SQQ H;  1H8A A;  4MVO A;  2WAM A;  2M3E A;  1KQF B;  1PGP A;  1URQ C;  2QJP B;  2XU6 A;  1NVO A;  3E8H A;  1RSO B;  3OEH G;  4UV9 A;  3Q2Y A;  1N34 B;  1XBL A;  2GDS A;  4H33 A;  3BAA A;  2R70 A;  1HNW B;  2OTL P;  3CXH E;  4D6T J;  1J5E O;  1UII A;  4RAI A;  3AE2 C;  3VP9 A;  4JTC B;  2R3S A;  5EBM C;  4IHJ B;  4CH3 A;  4G27 B;  3CRQ A;  5B3S C;  1RM1 C;  1EM1 A;  1N8R W;  1SP4 A;  3KZI E;  1N73 B;  1QCE A;  3WB1 A;  4H0L C;  4LFA B;  4JAV A;  4OPH A;  3L73 G;  1KUQ A;  3OJA B;  1FXV A;  2R5D A;  1XEQ A;  4L74 A;  4YJ3 A;  4UVB A;  1AJN A;  5KUM A;  1VIB A;  1XMO O;  3H1K G;  2A45 H;  1TVK B;  3MD0 A;  3AEG C;  4MVS A;  1K73 Q;  2GSM B;  2ARH A;  3ICX A;  3N4X A;  1LR1 A;  2WSC J;  3H1H E;  2WPQ A;  3ZHS A;  1NTK G;  3JCU Z;  4UFZ A;  3SWF A;  1FXK C;  5E79 Z;  2ZIM A;  4WFH A;  3ZRS A;  1OW7 A;  3CX5 I;  1OWA A;  2W6A A;  2BCC H;  3JD1 A;  3N2G B;  5KX5 A;  2FB5 A;  4TWK A;  1FPO A;  4DUZ B;  4Z2W A;  3HD7 D;  1Q81 Q;  3H1L H;  3O9O A;  4O4J B;  4WY4 A;  2QG4 A;  1AFO A;  1FZA A;  1HF9 A;  1KYO F;  1XMQ O;  3A3Y B;  1JNM A;  2DN9 A;  4GKG A;  1YHQ V;  5H6Q A;  1KB9 E;  2ZIN A;  2XT9 A;  4LF7 O;  4GX5 A;  4UB6 E;  3HD7 A;  3WFV A;  3SPG A;  3GMA A;  2Z0A A;  3PJS K;  4O4J A;  1SQV G;  2ZM6 B;  1ZR4 A;  2P4V A;  3HR0 A;  3D36 A;  1IZN B;  1KC8 Q;  4YPC A;  1V54 B;  4FZ0 A;  4KP4 A;  3AEF C;  1WA8 A;  1VQ6 P;  1OIP A;  3CD6 P;  1IK7 A;  1AR1 B;  1IUR A;  4UCO A;  1A32 A;  1VQM P;  1LWU B;  1FS0 E;  4PA3 A;  2Q8V A;  1WB7 A;  1VF6 C;  2UUA O;  4IL6 Z;  1NH2 D;  1BMF G;  4B3R O;  4X20 A;  5KHH A;  3TF5 A;  5B5E E;  1ZSP A;  2OQQ A;  1KIL B;  3RT3 C;  2E5L B;  2X7R B;  2LW7 A;  3OT7 A;  4J7Z A;  1S5L E;  4JPZ B;  4X89 A;  2GV9 A;  1N0J A;  2IH3 C;  2HEP A;  5ITZ A;  3H1I G;  4LF9 B;  3A0H H;  2H43 A;  1Y9B A;  3V4W A;  5KAI E;  1VQK P;  3G9R A;  4DV2 B;  2B9B A;  1US6 A;  3FB7 C;  4B08 A;  4JF7 A;  4BWA A;  5TJH A;  1LUW A;  4KXR A;  1DGS A;  3P32 A;  1N7S D;  2IBZ I;  4U7J A;  4O4H A;  1NOH A;  2Y4T A;  1Q90 D;  1OCO B;  2LGQ A;  2A06 G;  2VQF B;  1NU1 E;  1QVG O;  4O2B B;  1W5C E;  1OCZ C;  5CJ0 A;  2ZE8 A;  1K05 A;  5BU8 B;  2JGU A;  1S5J A;  4J9Y B;  1M1K Q;  2HP8 A;  4DR4 O;  3ZX6 A;  2HVJ C;  3M9B A;  2NR5 A;  1IX9 A;  1RH5 B;  2Q1K A;  1DLB A;  2QVA A;  2IM9 A;  4HH2 A;  1KQS O;  2F93 B;  3QO7 A;  3G4S V;  3AG7 A;  2YC0 A;  3IC7 A;  3L71 H;  5E1A C;  3Q4H B;  1QLE C;  3S1K A;  3A2F A;  4DV0 B;  4GUN A;  4FM0 A;  1K8A Q;  4XDJ A;  1XTC C;  3AEC C;  2RMK B;  1LGH B;  1GK9 A;  2ZT9 D;  2KS1 B;  3G80 A;  3F7Y C;  3CCE V;  4ZBM A;  3JCU H;  5CHX A;  5E79 H;  3FD9 A;  3CXH F;  3SFE C;  1ZAU A;  4MTX A;  1VQP V;  3GW6 A;  1ZLL A;  4PD4 D;  3TGU J;  2RKL A;  1PM9 A;  2QE7 G;  5BMV B;  4JI2 B;  2RN9 A;  1KFN A;  2K9Y A;  4PJ0 Z;  4U3F D;  4KHP B;  1SA0 A;  3L70 G;  1TUE B;  5B1B B;  3QTC A;  3P3N A;  2CGN A;  1KQL A;  5CA0 B;  1OXZ A;  1T3J A;  2EIK B;  5LMN B;  1SQQ D;  1KTM A;  5EC2 C;  4J80 A;  1RE3 C;  3L72 H;  3G3Z A;  5JH7 B;  4J9Z B;  1GZL A;  3OUF A;  4JI4 B;  1WPX A;  1JMM A;  3BPZ A;  5EBW C;  4DV4 O;  2Z5U A;  1K73 W;  1YBK A;  3EQ2 A;  4GLX A;  3ASO B;  4EIJ A;  4IL6 H;  1QEX A;  4DR7 O;  4CS2 A;  2VQE O;  1I7F A;  4LP8 A;  3APO A;  3T2M A;  3NFQ A;  5AVR B;  2BEQ D;  1KB9 F;  2HR3 A;  4QGP A;  3X2Q C;  3K5B A;  1XQ8 A;  5KMG A;  3N7N A;  1XDC A;  4X1I A;  4W7Z A;  1YI2 V;  1Q81 W;  4Q6G A;  1OX3 A;  2V4H A;  3OAK A;  5LYJ A;  2BTQ A;  1TUB A;  2CTP A;  1RQU A;  1IZ3 A;  2FXO A;  2EUL A;  1D7M A;  1XRE A;  2YXL A;  3B5N A;  4DV0 O;  5AVX B;  4RWU A;  4UUJ C;  3PN1 A;  2OYI B;  2QSI A;  4Y28 J;  2VWJ A;  1FU1 A;  4I50 A;  4ZNC A;  3SFD C;  2FYZ A;  1KC8 W;  2EIN B;  4JYB A;  4AHC A;  2OTL V;  2PY5 A;  4K3A A;  2BCC D;  3ITK A;  2F4V O;  2EIM B;  3H1L D;  4X65 B;  1Y66 A;  3DTU B;  3E22 A;  2DOS A;  2UXC O;  1Q7Y Q;  2JGD A;  3BA8 A;  5CBO A;  1N33 O;  3KG2 A;  3RK3 D;  4KHP O;  1K4D C;  4TV8 B;  1AR5 A;  1NU1 D;  1AJQ A;  1EZJ A;  3HRN A;  4ZHQ B;  4E4E A;  2VRZ A;  5C93 A;  2AZ2 A;  1NU1 K;  3CC2 P;  2PI4 A;  1JPX A;  4H37 A;  4HYT B;  4DUY B;  3K5O A;  2IPP A;  4J42 A;  1BCC H;  3WU2 Z;  4U3F J;  1MKM A;  3MUD A;  1JFF B;  2ITA A;  1SRY A;  3GHG A;  3N2K A;  4DR5 B;  3H1H J;  1SZT A;  3G67 A;  4JYC A;  4TUY A;  3IFM A;  1EZV G;  3OW2 U;  5C8Y B;  1SS3 A;  2LJ2 A;  1LT9 C;  4H44 B;  1IBM B;  4EYY Q;  1SQQ J;  5APV A;  5B1A B;  1IFN A;  1N7S C;  1E5W A;  1KYO I;  4I5S A;  4X64 O;  4PJ0 H;  2XKM A;  1BSM A;  1M1K W;  1FFT B;  3CX5 H;  1GDT A;  3O65 A;  1LTA C;  2EIJ C;  3V2N A;  1R5L A;  1CP9 A;  5J2T B;  3E1I A;  4X1K A;  1BGY G;  4O4L B;  3L73 E;  3NTN A;  3P30 A;  3PHL A;  5B66 E;  4RUF A;  2WPD G;  1K9M Q;  4X66 O;  2OWO A;  1OCR C;  1X22 A;  3ABL C;  3STL C;  1PGQ A;  2WLN A;  2K3R A;  3CD6 V;  3H1K E;  5LHI A;  1X79 B;  1VQM V;  4DR1 O;  1R5S A;  2N1T A;  4QE7 A;  1K8A W;  1Q6U A;  4JI3 O;  4LF5 B;  2PAJ A;  2DQ0 A;  1L4A B;  5EYP A;  1Q82 Q;  5TIS E;  4B3S B;  4X65 O;  4DOJ A;  1NTK E;  3AG1 B;  2V7Q G;  3CPW U;  3TSI A;  4LF8 B;  3ZMZ A;  4OPA A;  2YEV A;  1KEC A;  1HR0 B;  2QKC A;  2BCC J;  5APY A;  5JCO A;  4I0X A;  3L71 D;  3PP5 A;  5KKZ B;  3H1L J;  5L3G A;  4WWI A;  4DUY O;  5KAF E;  3C90 A;  2HJD A; 
#chains in the Genus database with same CATH homology
 4R50 A;  2OT5 A;  2WSS G;  1LNQ A;  4BIU A;  1G4Y B;  1K3E A;  4U7N A;  3UM7 A;  1F4M A;  4Z1M G;  3I55 V;  3SJQ C;  2W6J G;  4QPK A;  3FB6 C;  3K04 A;  3W7U A;  4PA4 A;  1V55 B;  4P2Z A;  3X2Q B;  1AQT A;  3QO5 A;  3ABU A;  1JJ2 U;  1AI7 A;  4QPJ A;  4RQF A;  3TET A;  2DYR C;  3CCR V;  1IXM A;  3ABM C;  1BSN A;  1I5X A;  3RVY A;  3CP1 A;  3OMI B;  5BZB A;  3OMN B;  2DYS C;  2NLJ C;  3CCU V;  3UKM A;  3AG4 B;  2P6J A;  3BY6 A;  1NKD A;  4CBC A;  1E1Q G;  2W6I G;  5IY5 B;  1KP2 A;  2FTK A;  3JCZ A;  2Q6A A;  3ABK B;  4WCE V;  1FXH A;  1COW G;  1K34 A;  4WFF A;  1S76 D;  1YJ9 V;  5LHH A;  2DQ3 A;  4L87 A;  3SPH A;  2XND H;  3CMA V;  2V1D A;  3STZ C;  4Q20 A;  1WLE A;  2Y69 C;  4R8C A;  5IY5 C;  3JD0 A;  1W0J G;  2R9R B;  2IJJ A;  3FYI B;  4LCU C;  1NR1 A;  1QVG U;  3CCJ V;  3ETG A;  2DWE C;  4QIW F;  1BHB A;  2H94 A;  2QEX V;  2P7T C;  1L1F A;  3OMA B;  3ZRW A;  4MVQ A;  3AG3 C;  1Q7Y W;  1NH2 B;  1BL8 A;  1MSW D;  2AHY A;  1UJW B;  3T4D A;  3HPL C;  1YSC A;  3ZJZ A;  5HFM A;  3MHS C;  3SPJ A;  4JPR A;  1F23 A;  4TSF G;  4U7O A;  3CXC U;  3ETE A;  3CCQ V;  1KQS U;  1PNM A;  1YIJ V;  3DGE A;  1MOF A;  3RBZ A;  3B8N A;  3W7S A;  2IJI A;  2X6C A;  3H01 A;  4G28 B;  2UXN A;  1M57 C;  1M56 B;  1EBO A;  1NVP D;  2OCC B;  1NQT A;  2ZD9 A;  1GMG A;  1QLN A;  5CA3 A;  3ZRX A;  2B5U A;  3LSQ A;  2EIJ B;  4P9O A;  1OCC C;  2EIL C;  1V54 C;  3ZMS A;  1S77 D;  3R65 A;  3ZIA G;  4MTO A;  3E8F A;  3SPI A;  4DXW A;  4EKW A;  4DO2 A;  1R3L C;  5H9C A;  3T1C A;  2IJH A;  2IH1 C;  3E8B A;  1B6Q A;  3W7X A;  5IYC O;  2ATK C;  3E2E A;  1OCR B;  2OTJ V;  3ABL B;  4N21 A;  4CZZ A;  1OZ0 A;  1M90 W;  4RUE A;  4PA9 A;  3CCM V;  3CC4 V;  1R73 A;  1S72 V;  3EHB B;  1KP3 A;  2XAG A;  3OEE G;  4MT8 A;  2LFR A;  3OR7 C;  3NXS A;  1VQO V;  1VQ6 V;  2WLL A;  4WVZ A;  4UXN A;  4N23 A;  2K1E A;  2QTO A;  3ASN B;  3OFN G;  3MHH C;  2YEV B;  2WLH A;  1Q82 W;  1R3J C;  2ZQM A;  1OCO C;  3QO8 A;  2IJK A;  4R7C A;  4XDL A;  3A0R A;  2LFS A;  5CBH A;  4MTF A;  4FJC C;  5HFL A;  1YTF D;  3CC2 V;  3ZMU A;  3E86 A;  2JJ2 G;  5DM6 V;  2F43 G;  4WFB V;  3FKS G;  4BAY A;  3GB7 C;  1S0V A;  3K06 A;  3E89 A;  1NJI W;  1VQK V;  2YSU B;  1PNK A;  3SYP A;  5IYB O;  1DF5 A;  1ARO P;  1JEK A;  1F51 A;  4WFE A;  4YXW H;  3ABT A;  3IFX A;  2DW4 A;  2WAM A;  2DYR B;  4MVO A;  4UVA A;  1VQN V;  5LGU A;  4FPP A;  3ABM B;  3E8H A;  2XND G;  3OEH G;  4FMT A;  2DYS B;  4MSW C;  4UV9 A;  2ZXW C;  4H33 A;  5L3B A;  1ORQ C;  3CC7 V;  4MTG A;  4PDM A;  4WFA V;  4RAI A;  4JTC B;  5EBM C;  2WWW A;  4G27 B;  1RM1 C;  5B3S C;  1N8R W;  1QCE A;  1K5Q A;  1I5Y A;  4JAV A;  4JGS A;  1FXV A;  4ZKI A;  4UVB A;  1AJN A;  2Y69 B;  5KUM A;  3GWO A;  5B1B C;  3FYE B;  1GKF A;  1KD1 W;  1EFR G;  4TLF A;  2B1I A;  3MD0 A;  2EIK C;  3RW0 A;  4HZ3 A;  4MVS A;  2GSM B;  1PKX A;  1QVF U;  5CMU A;  1VQ8 V;  1CPY A;  3ZRW B;  2QE7 H;  4MS2 A;  2PI5 A;  3K0G A;  3AG3 B;  4PA7 A;  3I56 V;  4DJG A;  1FXK C;  4WFH A;  3ZRS A;  1FXK A;  3JD1 A;  4MVU A;  4BIZ A;  5L3E A;  3ASO C;  4TWK A;  4MW8 A;  4QE9 A;  3LSS A;  2NNU A;  1PD3 A;  2Q69 A;  3JD4 A;  2R9I A;  1YHQ V;  2E5T A;  5H6Q A;  4BW5 A;  2BOB C;  2EBO A;  1M57 B;  4GX5 A;  5B1O A;  1F4N A;  1Q86 W;  1JVM A;  3WFV A;  3SPG A;  5LGN A;  4UVC A;  3PJS K;  4G2K A;  4P30 A;  2GHY A;  3CCS V;  3D36 A;  3VBB A;  1OCC B;  2EIL B;  1V54 B;  1NVP B;  4KP4 A;  5L3C A;  5IDJ A;  2XAS A;  4LBE C;  4WFG A;  3B77 A;  3LDD A;  4P9P A;  5L3D A;  1AR1 B;  2IU3 A;  3VOU A;  1VQ5 V;  1FS0 E;  4HAM A;  4PA3 A;  1JQ0 A;  5KA5 A;  3RVZ A;  5EBL C;  3CYO A;  3ZMV A;  1NH2 D;  1BMF G;  4MVZ A;  2EIN C;  3SYA A;  1AI4 A;  2HLD G;  1E1R G;  2JIZ G;  2X7R B;  2EIM C;  2DWD C;  1R3K C;  2XAF A;  1YJN V;  4X89 A;  4PDV A;  2XOK G;  3OM3 B;  2IH3 C;  3USS A;  4OXS A;  1VQ4 V;  3ZN0 A;  2BOC C;  4GCZ A;  5FL7 G;  4JF3 A;  2WLL B;  1H8H G;  3FB7 C;  4XDK A;  2ITD C;  2QM8 A;  3P32 A;  1CEZ A;  2CK3 G;  1RPR A;  1BSH A;  2KB1 A;  1OCO B;  4QNH B;  2XAH A;  2E5Y A;  2JK5 C;  3WG7 C;  1AI5 A;  4WF9 V;  1OCZ C;  3G71 V;  4YXW G;  3AG2 C;  2JDI G;  2WLK A;  1DF4 A;  5IYD O;  5L3F A;  4J9Y B;  3B8M A;  3K0D A;  4KFM A;  2HVJ C;  1GO3 F;  1YTF B;  3ZRV A;  1QR9 A;  1R6N A;  3T4Z A;  4R6Z A;  5B1A C;  4X88 A;  1DLB A;  1HWY A;  3QO7 A;  3G4S V;  3IC7 A;  2X6A A;  2UXX A;  5E1A C;  2LP7 A;  2XAJ A;  2CK3 H;  1QLE C;  4XDJ A;  3ZMT A;  5KA6 A;  1S3J A;  5B1N A;  1GK9 A;  2ZXW B;  2HFE C;  3HB3 B;  2JDI H;  2ITC C;  3OGC C;  2P67 A;  3F7Y C;  4FK5 C;  4ZBM A;  3SYO A;  3CCE V;  3K08 A;  1AJP A;  4MTX A;  1VQP V;  1R6K A;  3FB8 C;  3OUS A;  1RM1 B;  5B3S B;  3LNM B;  1R3I C;  2QE7 G;  4PDL A;  2JJ1 G;  4JAS A;  3E83 A;  1Y4M A;  2A9H A;  3AG1 C;  4TT3 G;  3AEI A;  3TK1 A;  1TUE B;  5B1B B;  2HG5 C;  2WLI A;  4GT1 A;  1H8E G;  2C2A A;  4F4L A;  1J95 A;  3QNE A;  2EIK B;  2Z3Y A;  1QR8 A;  1RPO A;  2QM7 A;  4XBF A;  4MVR A;  1ENV A;  5EC2 C;  3OE7 G;  2Q67 A;  3W7T A;  2QA4 V;  4J9Z B;  5EK0 A;  5LBQ A;  1MAB G;  3OUF A;  1WPX A;  4FIP C;  1FXK B;  2V7Q H;  2HVK C;  5EBW C;  4RQE A;  3CME V;  2Z5U A;  1K73 W;  3ASO B;  1BHA A;  1NR7 A;  2JEU A;  4UV8 A;  4LP8 A;  1E79 G;  1GTO A;  1GM7 A;  4I9W A;  3T2M A;  1K5S A;  1V55 C;  3X2Q C;  2HR3 A;  3OAA G;  3K79 A;  3SYC A;  1YI2 V;  1Q81 W;  2WSS H;  4HYO A;  4RO2 A;  1GM8 A;  1P7B A;  2W6J H;  3LDE A;  3JD3 A;  3AG4 C;  3F5W C;  1YIT V;  1W0K G;  3ETD A;  4GX2 A;  4UUJ C;  3ZN1 A;  5J9P C;  3ABK C;  2B1G A;  1MG1 A;  2Y48 A;  3LUT B;  2EZP A;  3SPC A;  2X6B A;  4PDR A;  1KC8 W;  2EIN B;  4JYB A;  2OTL V;  1E79 H;  1SET A;  2EIM B;  1NBM G;  1Y66 A;  1QBZ A;  3DTU B;  1VQL V;  1XL4 A;  1H2G A;  2XAQ A;  3KG2 A;  1M9N A;  3CCV V;  3K3W A;  4MVM A;  1K4D C;  2D3O W;  4X8A A;  1AJQ A;  1EZJ A;  2WLJ A;  1PNL A;  3LDC A;  3JYC A;  3CCL V;  4E2L A;  1DTO A;  1K92 A;  1XL6 A;  5C93 A;  1ROP A;  1JPX A;  2PI4 A;  3F7V C;  4H37 A;  3IGA C;  4PEL A;  2EZO A;  4GX0 A;  5CBG A;  2IW5 A;  3WG7 B;  4GX1 A;  4PA6 A;  4JTA B;  1OCZ B;  3AG2 B;  1JCH A;  2HKO A;  1SRY A;  1K33 A;  2M7W A;  1SZT A;  1GM9 A;  1K97 A;  4JYC A;  1K9M W;  3OW2 U;  3EFF K;  5H6R A;  1VQ9 V;  1AI6 A;  1M56 C;  2H8P C;  1JOY A;  5B1A B;  1G8M A;  2OCC C;  1THZ A;  4I5S A;  3JD2 A;  3D3I A;  1M1K W;  1FFT B;  2IU0 A;  4LC1 A;  2EIJ C;  2EJR A;  1CP9 A;  1QLE B;  2MK3 A;  3G6E V;  1PL0 A;  1KKD A;  3BEH A;  2ZR3 A;  3K9A A;  3ML0 A;  3P30 A;  4RUF A;  2WPD G;  4ASU G;  2WLM A;  1SES A;  1OCR C;  1OHH G;  4MW3 A;  3FB5 C;  3OR6 C;  3ABL C;  5CN0 A;  3STL C;  2A0L A;  2WLN A;  3CD6 V;  1K7D A;  2QKS A;  5LHI A;  4JAU A;  1VQM V;  4QMA A;  5DN6 G;  1K4C C;  4QE7 A;  1K8A W;  4QJF B;  2DQ0 A;  1S5H C;  1ZWI C;  3ZCC A;  3K03 A;  5LHG A;  1YJW V;  2ZDI C;  2W0F C;  3E8G A;  5EC1 C;  1FS0 G;  2ZDI A;  1H38 A;  2HJF C;  3AG1 B;  3M99 B;  2V7Q G;  2WLI B;  4KUM A;  3CPW U;  2JEX A;  3TCU A;  1IFP A;  3ASN C;  3SYQ A;  3ZMZ A;  1VQ7 V;  2P90 A;  2A79 B;  3E35 A;  2YEV A;  5CBF A;  2Q68 A;  5LGT A;  2ZR2 A;  1KEC A;  5KUK A;  1W2B U;  2AHZ A;  1JX9 A;  4JTD B;  3W7W A;  5GW7 A;  2X0L A;  5L3G A;  1P4R A;  1SER A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...