3EFFK

The crystal structure of full-length kcsa in its closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Membrane protein
molecule keywords FAB
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
total genus 43
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3effK02
1ORQC 2EILC 5EK0A 3ASNC 3FB5C 2X6BA 2Q68A 2WLIA 4JTAB 4MVRA 4PA6A 3T4DA 1BSNA 3K03A 2HVJC 3AG1C 4GX0A 2ITDC 2V7QH 3SPCA 2WLNA 4X89A 4PA7A 1K4DC 2KB1A 3E83A 1V55C 2AHZA 4MSWC 4RO2A 5EC2C 1J95A 1XL4A 3E8BA 3RW0A 2WLKA 4G28B 5E1AC 1OCZC 4MVQA 4GX2A 1JEKA 2HJFC 2W6JH 3OGCC 3KG2A 4WFHA 4RAIA 3RVZA 4H37A 4PDMA 3GB7C 2WLLB 2HG5C 4RUFA 4TWKA 2EINC 3ASOC 4QMAA 1R3JC 3USSA 2EIKC 3BEHA 3FB7C 2K1EA 4J9ZB 2WLLA 1OCCC 2X6CA 1JVMA 4MS2A 4LBEC 4H33A 4QE9A 3UM7A 2JDIH 3OUSA 2IH1C 4JTDB 1R3KC 4KFMA 3OUFA 4LCUC 3SPGA 2OCCC 2AHYA 3SPHA 1BSHA 4WVZA 3IGAC 3RBZA 2WSSH 2BOCC 3PJSK 1G4YB 4MTOA 4MW3A 2X6AA 4GX1A 3SYOA 3LDDA 4RUEA 3HPLC 4QE7A 3F7VC 4ZBMA 2DWDC 2XNDH 1LNQA 2DWEC 3ABKC 4R6ZA 1M57C 5CBGA 4MVUA 3TETA 2QTOA 2A9HA 3E89A 3F7YC 3R65A 4TLFA 3AG4C 3F5WC 2A79B 2WLJA 3FB6C 3T1CA 3UKMA 3K04A 5BZBA 2BOBC 3VOUA 4P9OA 4PDLA 4F4LA 2Q6AA 4X8AA 4MVOA 4MTFA 1P7BA 4R50A 3T4ZA 3ZJZA 4EKWA 2QE7H 2P7TC 4JTCB 3SJQC 3AG3C 3ZRSA 2E5YA 5EBLC 4MTGA 5EBWC 4PDVA 3K0DA 3STLC 4MVSA 5B1AC 3FB8C 3TCUA 4OXSA 2R9RB 3SYCA 2E5TA 5KUMA 3E8HA 2EIJC 3SPIA 5KUKA 2HVKC 2ITCC 4UUJC 4XDLA 3AG2C 5B1BC 5J9PC 3JYCA 1K4CC 5EBMC 1ZWIC 3LNMB 2QKSA 4MVMA 3K08A 5CBFA 4WFEA 4BW5A 1FS0E 2Q67A 4MW8A 2JK5C 3E8GA 4GX5A 4P2ZA 4X88A 4PA9A 2Q69A 3EFFK 2ZD9A 3OR6C 3T2MA 2EIMC 4HYOA 2DYRC 4HZ3A 4I9WA 4MVZA 3SYAA 1V54C 1R3LC 3X2QC 4DJGA 1OCOC 1S5HC 2H8PC 3LUTB 4LP8A 2NLJC 2WLMA 1QLEC 1E79H 4R8CA 3RVYA 4PA3A 1BL8A 4XDJA 1R3IC 3ABMC 2ZXWC 3K06A 4R7CA 2DYSC 5CBHA 1XL6A 3LDEA 4QNHB 5EC1C 3SYPA 2ATKC 1M56C 4DXWA 3SPJA 4CBCA 4XDKA 3OR7C 2Y69C 3K0GA 4G27B 3IFXA 1AQTA 2CK3H 4P9PA 2W0FC 4P30A 4WFFA 3WG7C 5IY5C 2A0LA 3ABLC 2YEVA 2WLHA 1KKDA 2IH3C 5B3SC 4YXWH 2WLIB 3SYQA 1OCRC 2HFEC 3E86A 4J9YB 3E8FA 4PA4A 4PDRA 4WFGA 3STZC 3LDCA 1IFPA
chains in the Genus database with same CATH superfamily
1YJWV 2Y9YA 1AR4A 1URQB 4MVRA 1NTMG 3A0BE 5B66Z 3GMAA 4OGQC 3CJHA 5JVDB 2HVJC 3RK3D 1VIBA 1S5LX 3ASOB 4UB8Z 4QGPA 4RO2A 2ZIMA 3OAAG 5EC2C 5KAIH 1Y74A 4JYAB 2WLKA 1NZ6A 1K9MQ 2OTJP 4U3JB 5EIBD 1KYOH 3C1LA 1AI7A 4O4JB 1NTZD 3FGAD 5ITZA 1VQLP 2EIKC 3CCMV 2K1EA 3RYIA 3L75G 1SQVE 2XV5A 1NTMH 3MAQA 4RESB 1H2NA 2ZYDA 3L71H 1GKFA 3Q4HA 1N0JA 3LSSA 2ZE6A 1RF0C 1KKCA 4ABMA 1FDOA 1VQMV 4IOIH 1AI4A 2OCCC 2DE0X 2H89C 2QJ1A 4FFBA 3RK3E 1M5IA 4JASA 1KMIZ 3CRMA 2WPVB 1NTKJ 4ZBMA 5E79H 1BCCD 1DIPA 2OYHA 4BIZA 1HJ0A 1RE3A 1RSOB 1LUWA 3L75H 2E3CA 2WMMA 3FB6C 3UKMA 1K73W 3CMEV 2E74B 1FAVA 2R9AA 4DV0O 2Q6AA 3DSQA 3H1HG 1ZSPA 4ZOLA 4EKWA 1IBLO 1SERA 1JCDA 1M4UA 4YTPC 1M8OB 2OWOA 1K34A 5B5EH 1NU1D 3APQA 3K9AA 2QG4A 2FYZA 1B6QA 4IT5A 4OXSA 2VQFB 3NTNA 3VN0A 3D71A 5AW5B 5KUKA 1FZBA 3AEBC 1FJPA 4D6TG 3ZMVA 5JJEB 1ZOYC 4L87A 1SA0B 1S77D 1GTWA 4RJTA 1VL2A 1VF5C 1S72V 1OVVA 1LWUA 3CRQA 5IWAO 2PYJA 3T1HO 4JI1O 1CEZA 1B3QA 1BCCE 2GHYA 1NTZJ 3CD6P 1MMMA 4DV4O 2ZNIA 3H1HH 1SQPE 1S3JA 1H0TB 4GLXA 4CH6A 2Q69A 5L3EA 3EFFK 2M0BA 3KHUA 1K5QA 5AW3B 1GK4A 2C2AA 3H6PA 3ABUA 1OJHA 3D8CA 1SQBG 3CX5I 1OHHG 4JV5B 1L2PA 2KK7A 4JAUA 1YHQP 1NTMD 1GZLA 4DR7O 3L70G 1PZQA 1IK7A 3LIEA 1N8RW 4H44D 5KKZB 4FJCC 1SKVA 2Y69C 1IBLB 1NO4A 1WP8A 3QH9A 1JUNA 3ZBHA 1KQLA 4TT3G 4UVCA 4LF9O 2IFMA 3HKEA 2OIEA 5IJ0A 2IH3C 1LTJC 2O01N 4O4IB 4PDRA 4PA4A 1G1XB 5FLXN 1NU1J 2QJPB 2IDBA 3L75D 3V4WA 5H6QA 2QTSA 5HFMA 5EK0A 3MGNA 2WLIA 2PYLA 4K0KO 1KYOE 4RO0A 3VMAA 4JI1B 2L6LA 5AVTB 2WA4A 5LHIA 3S1KA 1NTME 2ADQB 1NKZB 3OW2O 4MSWC 3ZS8C 3CCVP 1URQC 2M3EA 3L71E 3E1RA 4TT3H 1H89A 2OCHA 2QM4A 2CUGA 3NR7A 1EN4A 5J2UA 4Y99B 3OGCC 4JI4O 4H37A 4PDMA 2OGUA 3E22A 3JSLA 3ASOC 3OMNB 4DRXA 1KILA 3H1IH 3TJTA 3M9QA 2GTSA 5E79E 3ZHRA 1NAFA 2XKMA 5L8RJ 3H1HD 1YQ3C 3MUDA 4LGDE 3L75E 1NTMJ 3RL0g 4X1IB 3ETGA 2JEXA 1YEWA 1ROPA 1AI5A 4LF4O 4WBNB 1SESA 5AVUB 1HWTC 2R5BA 3B8MA 4ZMDA 3SFDC 4RUEA 1Q5OA 2XAQA 3B8NA 4D6TD 4MVUA 1H2MA 4K0KB 3HD7A 1VQ7V 2P58A 2FFDB 1AQ5A 1KB9D 5CB4B 4P9OA 3L75J 3M9BA 1R73A 1ZLZA 3PN1A 2IZ1A 3VTPC 2LXCB 1SQBD 3H1HE 1W0JG 3ZRWB 2WSFJ 3V2NA 5LYJA 4JI4B 1RPOA 2E74C 2YKOA 2K9JA 2ITCC 2F23A 1NAYA 5IT9N 2XT9A 3L70D 3LNMB 2GM4A 3GW6A 1GK9A 1ZMEC 1D5AA 4WBAA 1Q43A 1R6TA 4HNAA 4JZGA 4YHHO 2Q3EA 1H2SB 2W0XA 4DW1A 5EZYB 2CK3G 1SQGA 4HYOA 1WJZA 3RN4A 1L0LK 1BE3G 2CPSA 4X20A 1JJ2U 2QWQB 5AW2B 1R1BA 2EBOA 3FWLA 1SQBE 5TISH 1R3IC 3C9IA 4D6TJ 4ZHQA 2LW7A 2AXTZ 4ASVA 1RPRA 2LKMA 2CGNA 3L70E 1IFIA 4B86A 1LUVA 4DV2B 2CK3H 3ZMZA 3HB3B 3HR0A 2OIGA 1YTZT 2WQYC 3OE7G 1XUQA 1WP7A 1N0NA 1AR1B 1PGOA 1U97A 2J5UA 1N73A 5KKZC 4NPDA 4PELA 1SFCA 3MHSC 3MIWA 5K1XA 1SQBJ 3A0RA 5JCOA 4W7YA 4DR5O 4FLZA 2GSMB 2WPSA 2O01H 4HJGH 4YHHB 2ITDC 2IU3A 4O2AA 5D5PA 1F4NA 3L70J 4ZI7B 1L4AA 4FZ0A 2KB1A 1V55C 1GTOA 3FXDA 4LFCB 1YJ9V 3WU2H 1J95A 3JAWA 1FKAO 2IJKA 2QM7A 3HE5B 2KNCB 1KQGB 4G28B 3CCLV 2AZ0A 4GOFA 4MVQA 2YNYA 3MP7B 3KG2A 4JQ0D 3U1AA 4TWKA 3P8MC 1UIIA 1Z5VA 3USSA 3HUSB 3RWRD 1OMIA 3MTUE 1IVSA 1PNMA 4Y99C 1Q3EA 2IBZG 3SJBC 4FM1A 2QE7G 1KFMA 4KFMA 3SPGA 2ZR2A 2SPZA 1NQTA 1B06A 2CDYA 3N27A 4I50B 2RKLA 3VQXA 2F4VO 1YJNP 2OYIB 3OEHG 5AW4B 1LNQA 1JR9A 4R6ZA 1BDDA 5C8YB 3P8CD 1AROP 4X62B 3JAMN 3CCUV 5LXTB 2IJHA 2QGNA 3W68A 1T6AA 1GRJA 3F5WC 5AW7B 2AEMA 4BWAA 2QEXV 2XUMA 2IBZH 5B1BB 2QE7H 2E5YA 1AJPA 1BE3D 1YYCA 2RDCA 3STLC 1FU1A 2NPSB 2FFDC 4JPZB 1IXBA 2H88C 2HPCA 5KAFZ 1L0NK 4XDLA 2YXYA 4JI6O 2UU9O 1GN4A 5H2FH 3A0BZ 4XE5B 2QWRB 1K33A 3RK2D 1V54B 4BRYA 3JAKA 5TISE 4ZKIA 3H32A 1YTFD 4ICGA 3RYCB 2WVRA 1MZFA 2F4VB 5BU5A 4UCTA 3H1KG 3PLNA 2KSEA 4LP8A 3CSXA 3G4SP 3A0HZ 4QIWF 1EZVI 1BE3E 1JJOA 5AVWB 5KHGA 3OT7A 4PJ0H 2P10A 4R7CA 5CBHA 4ZNCA 1AJYA 3AE4C 5KLIB 1A32A 3LSUA 3ZRVA 4DXWA 1BGYJ 1NVPB 4P9PA 4GIFA 2R9IA 2Q7GA 2EX3A 2W0FC 3CRCA 1NHLA 1NJIQ 4PI0A 4MT8A 4JI5O 4UV9A 3O6QA 2WSCH 3H1KH 1TUBB 4LH7A 5FPOA 3IAOA 3WU2E 1GN6A 1N36B 4I0XB 4JI6B 3E86A 1BE3J 4LFBO 2UU9B 3CPWO 2J58A 3CRAA 1HNWB 1YCIA 4I7ZB 1Q6IA 2FL4A 2P5OA 2IBZD 2PF4E 2ZQMA 2PGGA 5APVA 3HD7D 2GUVA 5LMUO 2XAGA 4DUZO 1FZCA 2N74A 2JS3A 2WAMA 3B5NA 4K35A 1Q2NA 5DM6V 2EJ7A 1KILE 1YXBA 1OCZC 2YMKA 3LW5H 1GK6A 1OXZA 2DMXA 3HKDA 4HAMA 3AE7C 1GW3A 4QMAA 1RE3C 5LOVA 3C3SA 3FB7C 3CRRA 1QU7A 5LMNB 5JQGB 1VQ5V 3N7NA 3K5OA 1IK9A 1OW7A 2IH1C 4I55B 5APSA 3SDLA 4JI5B 3HUSC 3B8EB 2IBZE 3CS5A 3CXHH 3KKYA 2H8PD 1GM8A 5D5QA 2DWDC 1IBKB 2XNDH 2DWEC 3L72G 3H1LH 3AG3B 4RKUJ 2R5DA 5AW1B 3O65A 3CC4P 2ZM6O 4WCEV 2OYIC 3K04A 2AEFA 4X66O 5H2FE 1N7LA 4AHCA 5IYZB 1ZX3A 1M56D 3T4ZA 3JATA 2KKWA 3BY6A 4DUZB 1HGVA 4IYHA 4LNUB 2FYUD 3WFVA 4W80A 5AW9B 2P7TC 3DC5A 1NTZK 5LBQA 1FFXA 4FFKA 2JEUA 4OH8B 4MVSA 1RF1B 5KAIZ 1I5YA 1Q82Q 4ZKUA 1ZW0A 4JBZA 4JI3O 5B1BC 1T2KD 3B40A 2HFED 3EQ2A 1FBMA 3L72H 3AE3C 1HR0O 2E75B 2Q67A 4X64B 2NPSC 1SFCD 1CI6A 3F5HA 1XHZA 1H8HG 1P84I 3KCXA 2KXPB 3DGEA 1LT9B 4PA9A 4B7KA 4C7NA 1JY2O 2PAJA 1PPJG 3ITKA 4DR4O 3ABMB 2FXPA 1V54C 1L0NG 3Q3DA 1L4AD 3CC2P 3HE4B 3GHGA 2LP7A 3V6IA 3CXCU 3DC6A 3H1KE 1VQKP 3JASB 5E79Z 4J41A 4BW9A 4Y28J 2RCVA 4DUYB 5CA3A 1SZXA 1FE6A 3QO7A 1NU1K 2ATKC 2K88A 3E7KA 2BTOA 2GDSA 1LGHB 1UIXA 4PD4H 2Y4UA 4UFZA 4CH5A 4HKZH 4TUYB 2E76C 4OWFA 1SQXG 1PPJH 4DR1O 1WMKA 3V2RA 1L0NH 4JI0O 5CA1A 4LLHA 3U0ZA 1KKDA 5B5EZ 2W6JG 2FYNB 2FYUJ 5KLIC 2QM8A 2WITA 4GKKO 1KILC 1G1IA 4DO2A 1HR0B 1M57D 3FAVA 3CC7P 5AVYB 1URFA 3A5TA 4UB6H 1HWYA 3KZIZ 3WUTA 2AW9A 2B87A 2XZRA 1XMOO 1JPXA 2Y0EA 5JH7A 1SQXH 1NTMK 5AVVB 1OCRB 2I8DA 2M5AA 5APTA 3KCYA 2Y9ZA 2W6JH 1KC8Q 1YJWP 1FDIA 3L72D 5A9GA 2HG5C 4WY4A 5APUA 3M06A 3CXHE 3DXRA 1J5EB 5CCHC 4OGQB 4EB6A 1SS1A 1U7JA 1BQ0A 1YITP 5CA0B 1SC5B 1QEXA 5KMGB 1JA8A 1LP1B 2L35A 4JF7A 1R3KC 2QRXA 1WPXA 2AHYA 1BSHA 4DR1B 1JOYA 3CP1A 2GUZA 1ZP0C 4B3MO 2LJ2A 4LFAB 3OMAB 2N04A 2PP6A 2FBWC 4I2LC 1NTKG 2GBOA 3OD4A 3W7UA 1ZL8A 2X7RB 2F66C 3D3QA 2N9BA 4UCVA 5BZBA 5AG2A 4PD4D 3L72E 3SFEC 2BSKA 4QPJA 1ZXGA 4F4LA 1XMOB 2JGDB 1USEA 3AG2B 1PPJD 2G3AA 1KQFB 3AG3C 2KG7B 4AI8A 1FYJA 4I9QA 2MKVA 1HH0A 3SSUA 1M1JA 4H0LC 2E5TA 2ZJSE 3E8HA 5J2TB 3O8ZA 1FS0G 3ZMSA 1NTKH 2P06A 2VRSA 4B3RO 3CMEP 4YJ2A 2QWNB 2LFRA 4OVNF 3E8GA 2Q0AA 2JJ2G 4FLYA 1NTZG 1S4XA 1SQXD 4W4LA 2POHA 3TGUD 3CCSV 1KQSU 4PD4E 2DYRC 4X1YA 4D7TA 2E75C 4DJGA 3ZN1A 1N73C 4NTXA 1PPJE 5IYCO 3B5ND 5LP6A 1L0NE 5JCOC 1I94O 3NXSA 1MZEA 4NB5A 3ABMC 2BEQD 3VMXA 4YJ3B 5FNVB 4F6RB 3CMAV 4FMTA 5B3SB 1LTSC 1SQBK 1S2EA 1DH3A 2YEVB 1NTZH 4UB6E 1RE4C 2K1AA 2N9YB 4JYYA 2A0LA 4N78D 3ABLC 5LA6A 2QR4A 2D2CC 1QNMA 3HKBA 3RL0D 1Q81Q 1SQXE 1ZV8A 2KP8A 2ZE8A 1KD1Q 4JYAO 1NU1G 1TU3F 4J7JA 1KP3A 4YPCA 1TAEA 1WA8A 2AGAA 2Y69B 1W2EA 4DZOA 2Z4EA 1QQCA 1K4DC 2ARHA 3H9VA 2JO1A 4O4LB 2NN4A 3W7XA 1NS1A 2CE4A 1LTJB 5APYA 4FPPA 3S3WA 1CXZB 1SQXJ 3VYIA 2IW5A 2UXBB 1NTKD 3TGUJ 3TK1A 1I94B 1TVKA 1GL2A 2M8RA 2WLLB 3A2FA 2MJZA 4JPRA 1F51A 3L74G 4ASWA 4Z1MH 2UUAO 3VP8A 1NU1H 2KIKA 1JTHB 2Z5HA 5KX5B 1JFFA 4IIJB 4LF5O 3R66A 1JM0A 2JJLA 2Z0AA 1X22A 2JRIA 1OX3A 3K59A 3TF5A 4OPHA 3IGAC 3H01A 2Q7HA 2NZ2A 3RK3B 1M90Q 3FYIB 2Z5IA 4EIJA 3IC7A 3CCEV 1AVMA 3G67A 3VMYA 1S9KD 3U10A 1ZRTE 3T1YB 3L74H 3M8AA 2W90A 4FLVA 2HR3A 4NR1A 1X8YA 3E89A 2VQFO 4GOEA 1ZR4A 1NTKE 3SWKA 1NH4A 2JVDA 4DT0A 4JGSA 1HUCA 2R32A 5BY1A 5AW0B 3BATA 2ZINA 4EFBA 3UT5A 3CCRP 2Q73A 5EBLC 4WF9V 1T3JA 3WU2Z 1FXKA 2K9PA 5IJ9B 3DTUB 1VF6C 2Y0DA 1KYOF 3AG2C 2UWJE 2UUAB 1DF4A 2OARA 1FS0E 2XU6A 4LF5B 4JV5O 4J7ZA 3IN6A 2FXMA 1IFMA 1GD2E 2Y4TA 2ZD9A 4R4MA 4U3FJ 3CCJP 2EIMC 4I9WA 1NJIW 1NTZE 4JAVA 3CX5D 2KOGA 1FZFA 1CSBA 1IURA 2NLJC 2WSFH 1L8DA 2YIUB 1PL0A 3P32A 4PA3A 3QVNA 5IY5B 1BL8A 1K97A 1VQPP 3BA9A 1WPBA 2V7QJ 3AE8C 3M0DA 4WY4D 2YXRB 4UVBA 3D6ZA 4XDKA 1K92A 2XAJA 3IFXA 1MG1A 3V4QA 3WG7C 4P30A 3J81N 3U59A 3D36A 2KNCA 3A8TA 2H3OA 5B3SC 4B3SB 4TQDA 3L74D 1FZAA 1S5JA 3LDCA 2IPPA 2YXHA 1EN6A 1XHXA 1J1EB 4O4HB 3BVOA 3T4DA 4FK5C 3G6EV 4W4KA 4JI7B 3K03A 5H2FZ 1AJNA 4D6TH 1NU1E 5GW7A 3ZHVA 3LIDA 2H43A 2ZT9C 3E83A 5LHGA 4I50A 1XL4A 4I4TB 3RW0A 3CWBJ 4CH3A 2G8YA 3OA7A 1KB9H 3AE2C 3RVZA 3OM3B 5JJJB 3JD1A 5L3FA 3TYYA 3CEIA 1Y47A 3RYHB 1MOFA 1YIJP 1SQBH 4NYKA 1RY3A 3UO2A 4PJ0Z 3L74E 1V55B 1AP5A 4TV9A 1QLNA 3OUSA 1YJ9P 1W2BO 3L70H 4JTDB 4ZKPA 1XI1A 4J7KA 4TV8B 1U96A 5FPRA 4FLXA 2Z3YA 2OTLP 2Y0CA 3QO8A 1Q82W 1H8AA 3WUVA 2QWOB 3E35A 3JARB 1VDFA 5BMVA 2GV9A 2QJYC 2DQ3A 4M3LA 1MABG 2BCCJ 1FJGB 3L74J 1LTGC 3RK3C 1FC2C 2CH7A 1JB0J 1KFNA 1QR9A 1Q6UA 2A7WA 2OTKE 3I56P 3NFQA 4MTFA 1P7BA 3TNUB 2RN9A 2JEEA 2X0LA 3ZRSA 3JALB 1KYOI 3H1JJ 4W7ZA 4HH2A 4MTGA 4XBFA 3K0DA 1X9VA 1VQOP 2M7WA 4IHJA 3TCUA 5EIBC 1EFRG 1HW7A 3M91A 2YUAA 4JI8B 3CCUP 1RH5B 1PL4A 3X2QB 4IGGA 3W7TA 2QEXP 3BFRA 3ZEDA 2WPQA 5LGNA 3HKCB 4Q20A 1TUEB 2JIZG 3UCSC 2OTJV 1Q6HA 3IF4A 1CP9A 3BRCA 1N4CA 2IJIA 3VP9A 5GONA 4DV2O 3EWKA 1W0KG 4F6EA 2VS0A 2FYUK 4XDJA 4X9QA 4U7OA 3K9SA 4UXNA 1GL2D 4D7SA 3SYPA 1M93A 5LGTA 4KUMA 3SPJA 1EM1A 4LWSB 1T5EA 4CBCA 4QPKA 2YIUC 1JY3N 3C90A 1N32O 4D6TE 1BGYG 2FKXA 2KSJA 5IY5C 2QA4V 3ICXA 4FIPC 1PGPA 2EULA 2JWAA 3L35A 2YIDA 4JYBA 1KC8W 4LFCO 1KB9E 3K57A 2GUSA 4N6JA 4X1KA 2F95B 2Q68A 2A06G 1N7SA 1Y76A 2LGQA 2B9BA 4JZ2A 2Q7EA 1Y74B 3AEFC 2UXXA 4H13D 3APOA 1T3UA 3S9OA 1BGYH 1WAZA 1GDTA 1J1EC 5ITZB 2ZNJA 1F7YA 1QVGU 2N1TA 4B7EA 1JEKA 4U7NA 2KQXA 3RYIB 1BT8A 1BE3H 3BEHA 4J11A 3Q4HB 3CD6V 3HTKA 2A06H 4H44C 3LSQA 3S3XA 5KHHA 4FFBB 4X62O 1N32B 2WSEJ 2W6IG 3OUFA 1OCZB 2FB5A 1J2JB 1N33B 3FWNA 1LTAC 1LT1A 2YKQA 2BOCC 3IC9A 3PJSK 2KSDA 3OW2U 1G2CA 4J80A 2OYHB 4GX1A 1X4TA 2YICA 2BASA 1YHQV 3AEGC 4AQRD 1OW6A 3CHXA 4B08A 1O9GA 3KXDA 1H88A 3SGIA 3BABA 1PD3A 2PI4A 3OAKA 5EFWB 4TLFA 4ZOLB 1LTBC 2EIJB 1HP8A 4UB6Z 2FTKA 2ZVNB 1GMGA 4KHPO 2RN0A 5EBWC 3JD2A 2Q9LA 1U57A 3BCCG 1BZKA 5KUMA 4NXNO 2UXDO 1N34O 4UUJC 1DLBA 1LWUB 3GF3A 1W59A 3GG2A 1JCCA 4FVMA 1AVYA 5APQA 1VEWA 3L73G 3CCVV 1BGYD 4GYCB 4R4LA 2V4HA 1WLEA 3X2QC 2O57A 4EDFA 4EOTA 4DV6O 3LUTB 1Q81W 4YXWG 1R5LA 2J59M 2WT7A 4X65O 3JD0A 3ETDA 5KLVD 1KD1W 2ILMA 4ASUG 2A06D 5CBOA 5AW8B 1S5LH 1VQ4V 5CHXA 2BTQA 1N36O 3JCUH 4MN4C 2M3BA 4C7RA 5GTHH 1HNWO 3HKEB 2QSAA 4KHPB 5IJ0B 3RK2B 5IE9A 3P8CE 2C0WA 1PV3A 4NXNB 1NH2D 1YTFB 1N34B 2UXDB 1BGYE 4Z2WA 4YXWH 2WLIB 2FYUG 1P84F 1SQXK 4DV1B 3WMM0 2EILC 2NR5A 1SZTA 1ZR2A 5CA0A 4PV1D 3RYFA 2W6BA 2E76B 2P4VA 1IC2A 3N2GA 3SPCA 4X89A 4PA7A 4DV7O 2A06E 1DTOA 2R72A 1GO3F 5J2UB 5LMNO 1KECA 3TDKA 4DV6B 3E22B 4OPAA 5C39A 2G38A 4DRXB 1M90W 1KILB 1A02F 3BHPA 4X65B 2FYUH 1X59A 2PTMA 1HGZA 3IR9A 3WUUA 1EQ7A 4TOIA 2W8ZA 1K9MW 1I5XA 1RF0A 3PTZA 4UB8E 2PRRA 3FX7A 3P7KA 3PH0A 1IBKO 1MUUA 2JGDA 2EJRA 5KLVJ 2ZVOB 2Q8VA 1VQ9P 1GN3A 1MA1A 3A3YB 1NKNA 3EVKA 1K8AQ 3BCCD 2P7JA 1GM9A 3AG4B 4JF3A 2HODA 3HRNA 2W83C 5K5GB 3HD7B 1PP9G 4DW0A 3B71A 2QIWA 4YIPA 4YXDC 1QLED 3V2QA 2R70A 3L73D 2YIBA 1FOSF 4ZIBA 3PP5A 1YBKA 5EYPA 2OYHC 1D5NA 2I1KA 4DV7B 1I0HA 2WWWA 4UCRA 4A5UB 1NTKK 5LYJB 4X64O 2K9JB 4AQYB 3FXEA 3ZRXA 5CMZA 3SYCA 1RQUA 2EIJC 2FKWB 2IZ0A 1PP9H 5KHKA 3BCCE 3JYCA 1DF5A 4DV3B 3G80A 4HNAB 2E42A 5CCGD 4IFMA 3T97A 2OQQA 3ML0A 3QTCA 5JJNB 1W5CE 4MW8A 1NBMG 3CCQP 5JWPA 4GX5A 4P2ZA 1S5LE 4X88A 1QVFO 4UVAA 3JCUE 4X20B 1LWUC 1USDA 1N7SD 4H0LB 1EDJA 4DUYO 3AEEC 3D36C 3OR6C 3UQ8A 3L73E 5GTHE 1YI2P 3BRTB 2QKCA 3BA8A 1R3LC 2Z5UA 3CXHF 1M56B 4RQEA 2YSUB 2KS1A 3N2KA 2WLMA 4ZHQB 3BCCJ 5APXA 4AILC 3RGBA 4O2BA 2P2UA 3K5MA 2IBZI 2N1TD 2ZE5A 1JMKC 3ZHSA 2WSSG 1JMMA 2F93B 3CCSP 2DYRB 1BHAA 1XTCC 4EI2A 1LTJA 1YJNV 3L73J 3ABTA 4KP4A 1M1KQ 1N73B 1SFCB 2ZIOA 2RJZA 4IYIA 3D70A 1ZAUA 1DK1A 1L1FA 3KDPB 2UUCB 2JGUA 4WFGA 4UCSA 1FDMA 3RK2C 4O2AB 2X6BA 3CMAP 5AVZB 1L4AB 1VQ6V 1BSNA 1K05A 2FYUE 1GM7A 2E5LB 3JAWB 1URQA 2WA3A 2PUSA 2WLNA 2WPDG 1J5EO 1AV1A 1E1RG 3ABLB 2D2CB 1US6A 5JVDA 2LFSA 5AW6B 2AEJA 4NXMO 2B1GA 3FYEB 1VQNP 3FFQA 1KN7A 3IFMA 2A45G 1PP9D 2HJFC 4RAIA 2EZPA 2L5GB 1YVWA 3TGUG 4B3TO 2DW3A 1PKXA 3P3PA 4FLWA 4UV8A 4U3JA 1P7GA 4LFAO 2QDOA 1FAFA 3CPWU 4O4JA 1JVMA 4MS2A 2V4DA 5AVSB 1NWQA 1SQFA 1R8EA 3AE5C 3MUDC 4NKGB 1XILA 1G4YB 3G4SV 1IDSA 2A45H 1XNQB 4DR2O 1KORA 2JP3A 3TGUH 1KZUB 4DYLA 3W67A 1PP9E 3AG4C 1I7FA 1RSOA 3HD7C 3W7WA 1MZ9A 4WB4A 3SR2C 4NXMB 1VPCA 1IJDB 2ZYGA 2HPCB 1HNZO 3L9DA 5KA6A 1S0VA 1XOUA 1LTIC 2HVKC 2VWJA 1DD4A 4BRYB 4B3TB 3JAKB 4KHXA 1ZUQA 1HDJA 3H32B 1PP9J 1JY3P 1LJ2A 5CJ0A 4HYTB 3CCMP 1OVUA 1GMJA 1SA0A 1QL2A 1AILA 5H5NA 2ETNA 3CXHI 1MFTA 5TJHA 3KYQA 1JQ0A 1VQMP 4U3FG 2PI5A 2LGWA 1H0TA 4DR2B 2H8PC 4NTWA 4WFAV 5L3CA 3L37A 4CS4A 2B89A 1N7SC 2DYSC 4KT0J 1J1DB 2P4KA 2ZDIA 1M56C 2P22C 2V7QG 2IYOA 1NR7A 3O6QB 2EIMB 1K04A 1D7MA 1HNZB 2XAFA 4U3FH 3ETQA 5L3GA 2XHBA 4OX9O 1Q7YQ 4CS2A 4K8ZA 1T2KC 3UO3A 2HFEC 5F2VO 3CC4V 2YDEA 3FB5C 4O4IA 1SFCC 1G6UA 1WT6A 2UXBO 1FZGA 4KXRA 1FZCB 1SS3A 1VQ8V 3B5NB 4L76A 2V7QH 3WG7B 1S72P 3TXQA 4HBNA 2YIBD 3HKDB 1L4AC 1SQQD 5LOVB 3AE6C 3CWBG 3GB7C 1SRYA 4RUFA 2B1IA 2CGOA 2EINC 3WB1A 1PGQA 3K79A 1BDCA 4PD4I 5L3BA 4J9ZB 3AE1C 1EBOA 3TGUE 2CAZC 1VF5D 3Q5SA 1DX7A 2ZT9B 4I1LA 3T1YO 1S76D 3KPEA 2BE3A 2QSIA 4MW3A 4OX9B 1JOCA 4X1IA 5KA5A 3CWBH 3SYOA 2YO3A 1VQKV 1SQPG 4YY3O 1NI8A 2Q4PA 4WBNA 4LF6B 3ZX6A 1M57C 3I55V 3CL3D 5H9CA 2A9HA 3CX5H 3JATB 2DOSA 3R65A 2CPBA 5BVZA 2BCCG 1UJWB 3VOUA 4N78E 2AZ2A 3G6BA 2Q9IA 1FFXB 4EEQA 3ZJZA 1IX9A 2ZE7A 4LC1A 3W7SA 2FFDA 3AK2A 1V9PA 4JTCB 5TISZ 4U3FD 5CB4A 2XDJA 5BR8B 3H1JG 1EC5A 1XNRB 1XMQB 4Z1VA 2QJYB 1KUQA 4TSFG 5J9PC 1CI6B 3ZRWA 5DEDA 1SQQJ 1HBWA 4MVMA 4IFDK 3K08A 4WFEA 2HHHB 2C9LY 3Q5PA 3IAYA 4C7NB 2A3QA 2BCCH 4DV5B 2RNBA 1H2GA 2YMYA 1XTGB 2KI7B 3GF7A 3QO5A 1SQVD 2MK3A 4N3YB 2IFNA 3GHGB 2YC0A 1URQD 3H1JH 5EZYA 1MFZA 1F4MA 1RM1B 3V2PA 4BWNA 2PY5A 4J42A 3L36A 4YY3B 3R2PA 3CE2A 3G71V 4C46A 4U3FE 1PIXA 3ZHUA 2KUBA 1YITV 4G2KA 3L71G 3F5TA 1EZJA 2ZXWC 1HVVA 1JCHA 3BPZA 4B3SO 3LDEA 4O9BA 1VQ7P 2YIAA 1THZA 1QBZA 1M9NA 3MD0A 2ZAEB 3G9RA 4G27B 4CPGA 5DN6G 5CA1B 1AQTA 4JI7O 3ASNB 3CWBD 1S9KE 3A0HE 4LF7O 1J1DC 3E1IA 3OJAB 2IU0A 3AG1B 3FAVB 1Y66A 2YS8A 1Z2GA 1KV4A 5LGUA 3M0AA 5DJTB 3E8FA 5IDJA 1MSWD 2YXQB 1GW4A 2B9ZA 4JTAB 2B87B 3QWOC 2O1JA 2ITAA 4BIOA 5JH7B 3AG7A 4GX0A 1BSMA 2ZKOA 2M5AB 2QA4P 2CTQA 1K8AW 4N21A 5KLVK 4ZI7A 2P1JA 4WY4B 1YQ4C 3DXRB 1SQPD 1FZCC 3O9OA 5KHIA 1SQVJ 4EB6B 3B5NC 3SWFA 3ZIAG 4C7UA 2N05A 2E74D 3HE5A 3RFRA 3CWBE 1R3JC 1FZEA 2BCCD 2DQ0A 2Y48A 2O3JA 3PRJA 2PGDA 1IZ3A 1S5LZ 4H33A 2QJKC 3HUSA 3CX5E 4XA4A 2GUZB 3ABKB 3JCUZ 5GTHZ 1LTTC 3H1JD 4CZZA 1FJGO 3I5CA 3H25A 4LF7B 2K9YA 3ZN0A 3RL0C 3KZIH 2LQTA 1ZL8B 1YSCA 2OYIA 2BSKB 3PHLA 4H44B 2MW2B 2XOKG 2WLJA 4FLUA 4JI8O 5C8YA 2PZSA 1X79B 2BOBC 1BQZA 3GVMA 2KB7P 5AVQB 5LXTA 2ZYAA 1M1JB 1KYOD 1IFJA 2BCCE 2WSEH 2M6YA 2P67A 2Q3IA 2UXCO 5B1AC 1KB9F 5AVRB 2K3RA 4YJ2B 3CCLP 3H1JE 2V1DA 1BMFG 3L71D 1BCCJ 2NPSA 1AFOA 4DV0B 3BASA 3VQWA 2HJDA 1SQPJ 2L91A 1SP4A 1QVGO 2JK5C 1COWG 4X1YB 1G1JA 1IXMA 2B5UA 1PM9A 3OTFA 5KAIE 3U1CA 1VARA 1WNSA 1Y4MA 1DGSA 1AVOA 1M1KW 5LP6B 3RYCA 3H1IG 1OCOC 1K7DA 1S5HC 5LL6Y 3JSNA 5IWAB 3S4RA 3T1HB 1G8MA 1PNLA 3CB2A 4R8CA 5DJUB 4DV4B 3KQGA 3B09A 3GHGC 1N2DC 3K06A 1RM1C 2Q5ZA 5LA6B 4BAYA 4LR3A 3HKBB 3AK1A 4WFFA 2UXCB 4YIOA 5B1OA 4LF8O 5GTIH 1Y8AA 1Q8IA 4DR7B 2WLHA 3CYOA 2R3SA 4DCKA 1WA8B 1TUBA 1ORQC 1VQ4P 3ASNC 2Q7CA 4I0XA 3P3NA 1VQLV 4DOJA 3L71J 3AG1C 4LF9B 2ZFCA 3CCRV 1RHZB 5APWA 1PGJA 3JC22 2Y0IA 5B5EE 3ZHQA 1TVKB 1GL2B 1OCCB 1OVRA 1CPYA 3NMDA 5E1AC 5CCHA 1NT2B 3QG5A 3MHHC 4IL6H 2EILB 4WFHA 4RQFA 3Q1MA 1XEQA 1JFFB 1E1QG 1FD9A 1N33O 2Q1KA 3EXAA 2PFXA 3AECC 3KZIE 5CCGA 1OV9A 4MTXA 1KU9A 4WY4C 5DECA 1EZVG 5KJ7A 3CJHB 4L8JA 3JD4A 2XTAA 1WRGA 3CCJV 3OGIB 1MNGA 2P90A 5JQGA 4EFEA 5KLVG 2WTYA 3JCZA 4LF8B 4CS3A 3K58A 2ZCEA 2HKOA 1FXVA 4I55A 5FL7G 4I5SA 4QE7A 3F7VC 4H13B 1NOHA 3ABKC 1VQPV 3TETA 1GAXA 1X0TA 2WPRA 1B04A 1PL5A 2QWPB 1RFYA 1WB8A 3J80N 4LF4B 3CLQA 1EZVH 2VRZA 3UT5B 3H1HJ 2Q5UA 3F89A 3I5DA 5LHHA 1KB9I 1FJKA 1FXKB 5KLVH 1NGMB 2GTAA 3H1ID 5IYZA 2JR8A 1W2BU 1QX8A 4U7JA 1XDCA 1AA0A 4LNUA 2Y0PA 1XQ8A 1E79G 1M1JC 1RF1A 2O1KA 5EBMC 1K4CC 4NPFX 5B66H 2FY8A 4GZRB 4GUNA 5IYDO 4NPEA 2ZDIC 3C3TA 4QJFB 2EZOA 4UB8H 1VQ5P 4XFJA 1AI6A 3SJAC 1HNXO 4NVPA 1LT9A 2XAHA 1ENVA 3L4FA 4A7PA 1Q86Q 1OIPA 4FZ1A 2HLDG 3B2EE 1Q7YW 5GTIE 5CBNA 1YIJV 1E79H 5HFLA 1P49A 3H1IE 2ODMA 1YDXA 1XBLA 2K37A 4PI2A 1H2LA 3HE4A 4HB1A 3ZHTA 1N86A 1XL6A 2QJPC 5LP6C 1OFCX 4LH6A 3JASA 1RE4A 2RMZA 3A2AA 4IFFA 2XNXA 2ADPA 4DV1O 1H8EG 3WB2A 2FMLA 4Q6GA 2YKPA 2ZXEB 1GU5A 2OTLV 1DEEG 1YF2A 4TUYA 1IFNA 2UUBO 2CTWA 1BHBA 4J9YB 3H1IJ 3STZC 1QGKB 2HP8A 3ZDMA 3BCCH 4IL6E 3D3IA 3M99B 1EZVD 3R4YA 3GLMA 3I56V 1Y6XA 3A7OA 1HNXB 4DK1A 1F23A 2AHZA 1VQOV 2RQ6A 2KLVA 1U7MA 1CW5A 3GWKC 1XREA 1AB3A 3L73H 4DR5B 1JY2N 2JKVA 5L3DA 2FXOA 1PNKA 1VQ6P 4TV9B 3EFGA 1RP3B 3M7MX 2CTRA 1OZHA 5CN0A 1GL2C 4PHZA 1OCCC 1NH2B 3AE9C 2NPSD 1GU4A 3Q5RA 4QE9A 3UM7A 1TGOA 4JAAA 4LCUC 1EZVE 2RMKB 4PV1B 3BAAA 5KMGA 1P84H 3RBZA 1LP1A 2UUBB 4MTOA 5KLVE 2X6AA 3SJCC 5BMVB 4DR6O 4FM2A 5CBGA 4AQYO 2CH7B 4GODA 1S1CX 2C9NY 2VWKA 2YI8A 2P6JA 1JY3O 3VBBA 5B66E 1SQQK 1K3EA 4X8AA 4DV3O 4H13C 4IHJB 1H2KA 1NR1A 2E76D 3SJQC 1EXIA 1VF6A 1JO5A 3K3WA 2KG7A 4KL1A 1OZ0A 1FXKC 1KILD 1ZWIC 2YO2A 2QKSA 5J2TA 1LR1A 1NVPD 1M7LA 4BW5A 1K73Q 1L0LG 4AUWA 3G3ZA 1JNMA 4N23A 1QLEB 1SF9A 3J7AU 3FX0A 5GONB 1AR5A 4HZ3A 1QCEA 1KP2A 1SETA 4DR6B 2OT5A 2JJ1G 4DR3O 1K5SA 2HG5D 1HTLC 2O01J 5CCHD 2VQEO 1AJQA 3RT3C 1L0LH 2LW1A 2UUCO 2C0XA 1FFTB 1E5WA 3M9HA 4YJ3A 5B1NA 1P84D 5FNVA 4F6RA 1IBMO 2R44A 3M0DC 2XNDG 4EYYQ 1IO4A 5KJ7D 2YEVA 1D2DA 3H1LG 2E5LO 3V5BA 5K1PA 3FD9A 4X1KB 3SYQA 1N7SB 1Y76B 2DYSB 1EDIA 1IFPA 1IZNB 4TQFA 5KHJA 1SQVK 1EDLA 2OYOA 2KYVA 3QF7A 4AYCA 1N8RQ 2DW4A 2JDIG 2HEPA 2N1TB 4LFBB 1Y67A 2YXLA 3LNNA 3E8BA 3VQYA 1H38A 5C93A 4O4LA 4DR3B 1HF9A 4H0LD 4GX2A 1P84E 3HTKB 2NNUA 1Z56A 4J10A 4E4EA 2VQEB 2HYNA 5LMUB 1VQ8P 1OWAA 2DJVA 1XNQO 2WLLA 2X6CA 3H1KD 4FM0A 3OMIB 4LBEC 4UCUA 3OEEG 1SLQA 1SVFA 2JDIH 1G2CB 1IBMB 2IX7C 1QHTA 1JTHA 5KX5A 4BXLA 4IIJA 3EHBB 4E2LA 4WVZA 4FLTA 2WSSH 1O9HA 2HLOA 2H94A 2E75D 2EINB 2RH0A 3HPLC 3RBXA 3IJ4A 5A2QN 1NKDA 2LXBA 4PJ0E 1BS3A 4I6MC 5IYBO 2AXTH 2QTOA 1FXHA 1L0LD 4PV1C 1I08A 2R3CA 3F7YC 4GCZA 2A79B 4WFBV 3JD3A 4DK0A 2BEZF 4PDLA 1SQPK 2H7HA 4UCOA 1KQSO 1EXJA 3E2EA 4WWIA 1ZN5A 1A02J 4PD4F 5BU8B 2D2CD 2R9RB 2YI9A 1M57B 1T8ZA 3AEAC 2ZM6B 1YTZI 3I55P 4K3AA 3ZMUA 4X66B 3C8VA 1PFIA 3TXSA 5IJ9A 1SQQG 1GN2A 5CBFA 1FOSE 1UFIA 1AP6A 3CXHD 3B77A 4JYCA 1L0LE 1ZLLA 4JI3B 2WSCJ 3H1KJ 3H1LD 2WT7B 1MSDA 3P30A 1EDKA 2IM9A 3OTOO 1QLEC 2F43G 5M1BA 2BTQB 3CCEP 3B4SA 3N4XA 1SQQH 3VOPA 4DR4B 5BXZA 5EC1C 1VQ9V 4I7ZC 3AK3A 1L0LJ 3K0GA 4CC6A 5AVXB 1R6NA 2UXNA 4GT1A 4OGQD 1QVFU 3AEDC 3LW5J 3G71P 2QVAA 4L74A 3CI9A 4CC5A 1UPGA 3ABVC 3BRVB 2D3OW 2ZXWB 3RYFB 1MKMA 3H1LE 2CTPA 5CCGC 2E43A 3N2GB 4PA6A 1Q90D 2LR2A 5KJ7C 1QL1A 4KJMA 4O4HA 4JI0B 2ZXXA 5CMUA 3GWOA 3MHVA 4GKKB 2EIKB 1WB7A 3VQVA 5KAFH 1KBHA 2JWDA 4RWUA 4IL6X 1Z5WA 3OTOB 2W6AA 3U11A 4I4TA 1SQVG 3H1LJ 4BIUA 3A0BH 2OCCB 2N1TC 5H6RA 3CCQV 3K5LA 3VMZA 2W27A 1L0ND 2IYPA 4GKJO 3RYHA 4LF6O 2AXTE 1YI2V 2HODB 3II6A 2B88A 3SPHA 4K8XA 1DEBA 4L73A 4GKGA 3A0HH 5GTIZ 3LDDA 1PV0A 3L72J 1RF1C 1SQVH 4TV8A 1VF7A 5EYPB 5BR8O 4NTYA 2ZR3A 2JS5A 2QJKB 1XNRO 1XMQO 2DN9A 3T1CA 3JARA 3TSIA 3G6EP 1MV8A 3SWYA 4MVOA 4R50A 1EN5A 4B3MB 1IFDA 3RL0B 2HHHO 1LT9C 1VF5B 4PDVA 4DV5O 3TNUA 1Q86W 3FB8C 1Y9BA 3OFNG 4GDOA 3D6YA 4BR6A 3SPIA 3JALA 1RQVA 3T97B 2KZJA 3CC2V 1GH6A 1WN7A 4JI2O 1KTMA 4IL6Z 1BCCG 2KLUA 2F1MA 1R5SA 2GA1A 4L75A 4GKJB 2LO1A 3ZMTA 2IJJA 1NVOA 1OW8A 1SQQE 2Q0OC 2A45I 3THOA 5B1AB 1VQNV 2ZT9D 3T2MA 1L0NJ 4MVZA 2KS1B 1ZTEA 3N2KB 3HKCA 3SYAA 4Z1MG 4B3RB 1JMBA 3RGUA 5KTBA 2OYQA 1QR8A 1P4RA 4O2BB 1JX9A 2AXCA 1NYHA 1R6KA 3AEIA 3QNEA 1FPOA 3ZCCA 3JSVC 2QKAA 3RVYA 2FYNC 3K5BA 1CZQA 1VP7A 3BVHA 3MZWB 1BCCH 3UIAA 3Q2YA 3FKSG 3CX5F 1SQPH 4QNHB 3K5NA 3CC7V 1ZRTD 5CJ4A 2WZ7A 3OR7C 1JY2P 2Q6QA 3ETEA 1YZBA 1OCOB 4LWSA 1HJBA 3WB0A 1VMGA 2NRGA 2XASA 3MDSA 1TA8A 4CH4A 4JI2B 1OCRC 5KAFE 1DD3A 2KZIA 2I1JA
chains in the Genus database with same CATH topology
1ORQC 1YJWV 2EILC 3ASNC 1SZTA 4MVRA 1VQLV 1HWYA 2HVJC 3AG1C 3SPCA 4X89A 4PA7A 3CCRV 1DTOA 1JPXA 3ASOB 1GO3F 4RO2A 3OAAG 5EC2C 1KECA 2WLKA 1OCCB 1OCRB 1CPYA 5E1AC 1M90W 2W6JH 3MHHC 2EILB 4WFHA 2HG5C 1AI7A 4RQFA 1E1QG 2EIKC 3CCMV 2K1EA 1K9MW 1I5XA 4MTXA 3JD4A 2EJRA 1GKFA 3LSSA 3CCJV 2P90A 1R3KC 1VQMV 1AI4A 1WPXA 2AHYA 2OCCC 3JCZA 1BSHA 1JOYA 1GM9A 3CP1A 3AG4B 4JF3A 2HKOA 1FXVA 4JASA 5FL7G 3OMAB 4I5SA 4QE7A 3F7VC 4ZBMA 3ABKC 1VQPV 4BIZA 3TETA 3W7UA 2X7RB 3FB6C 3UKMA 5BZBA 1K73W 3CMEV 4QPJA 4F4LA 2Q6AA 2WWWA 3AG2B 5LHHA 4EKWA 1FXKB 1SERA 3AG3C 3ZRXA 1K34A 1W2BU 3K9AA 1B6QA 4OXSA 3SYCA 2E5TA 3E8HA 2EIJC 5KUKA 1E79G 1FS0G 3ZMSA 3ZMVA 3JYCA 1DF5A 1K4CC 5EBMC 4L87A 1S77D 5IYDO 3ML0A 2ZDIC 1S72V 2LFRA 4QJFB 4MW8A 2EZOA 1NBMG 3E8GA 1CEZA 4GX5A 2GHYA 4P2ZA 4X88A 2JJ2G 1AI6A 1S3JA 4UVAA 2Q69A 5L3EA 3EFFK 3OR6C 3CCSV 1KQSU 2DYRC 2XAHA 1ENVA 1K5QA 1R3LC 4DJGA 2C2AA 3ABUA 2Z5UA 3ZN1A 1M56B 2HLDG 1Q7YW 4RQEA 2YSUB 1OHHG 5IYCO 2WLMA 1YIJV 5HFLA 1E79H 4JAUA 3NXSA 3ABMC 1XL6A 3CMAV 2WSSG 4FMTA 5B3SB 1N8RW 4FJCC 2Y69C 2DYRB 1H8EG 2YEVB 1BHAA 1YJNV 3ABTA 2A0LA 4KP4A 3ABLC 4TT3G 2OTLV 4UVCA 2IH3C 1L1FA 1BHBA 4J9YB 4PDRA 4PA4A 3STZC 4WFGA 5H6QA 5HFMA 5EK0A 3D3IA 3M99B 2X6BA 2WLIA 1KP3A 1VQ6V 1BSNA 3I56V 2Y69B 1GM7A 5LHIA 2WLNA 2WPDG 1K4DC 1E1RG 3ABLB 1F23A 2AHZA 4MSWC 1VQOV 2LFSA 3W7XA 2B1GA 3FYEB 4FPPA 2IW5A 2HJFC 3OGCC 4RAIA 3TK1A 4H37A 2EZPA 4PDMA 5L3DA 2WLLB 3ASOC 1PNKA 1F51A 3OMNB 1PKXA 4JPRA 4UV8A 5CN0A 1NH2B 1OCCC 3CPWU 1JVMA 4MS2A 4QE9A 3UM7A 3ETGA 4LCUC 2JEXA 3IGAC 1ROPA 1AI5A 3H01A 3RBZA 1SESA 1G4YB 4MTOA 3B8MA 3G4SV 2X6AA 3FYIB 4RUEA 2XAQA 3B8NA 3IC7A 3CCEV 5CBGA 4MVUA 1VQ7V 2HR3A 3E89A 2P6JA 3AG4C 3VBBA 4JGSA 4P9OA 1K3EA 4X8AA 3W7WA 1R73A 1NR1A 3SJQC 5EBLC 4WF9V 3K3WA 1W0JG 3ZRWB 5KA6A 1FXKA 1S0VA 1RPOA 2HVKC 3DTUB 1OZ0A 2ITCC 3AG2C 1FXKC 1DF4A 1ZWIC 3LNMB 2QKSA 1NVPD 4BW5A 1GK9A 1FS0E 4N23A 1QLEB 2CK3G 2ZD9A 1JQ0A 2EIMC 4HYOA 4HZ3A 1QCEA 4I9WA 1NJIW 4JAVA 2PI5A 1KP2A 1SETA 2OT5A 2JJ1G 2H8PC 1JJ2U 2NLJC 4WFAV 5L3CA 1K5SA 1PL0A 3P32A 4PA3A 2EBOA 5IY5B 1BL8A 1K97A 1R3IC 1AJQA 2DYSC 2ZDIA 1M56C 1RPRA 1FFTB 2V7QG 4UVBA 4XDKA 1NR7A 1K92A 2EIMB 2XAJA 3IFXA 5B1NA 1MG1A 2CK3H 3ZMZA 2XNDG 4P30A 3HB3B 3WG7C 2XAFA 3D36A 3OE7G 2YEVA 5L3GA 1AR1B 5B3SC 3SYQA 2HFEC 4PELA 3MHSC 2DYSB 3LDCA 1IFPA 3A0RA 3CC4V 3FB5C 3T4DA 4FK5C 2GSMB 3G6EV 3K03A 1AJNA 1VQ8V 2DW4A 2ITDC 2IU3A 2JDIG 3WG7B 5GW7A 1F4NA 2V7QH 2KB1A 3E83A 1V55C 5LHGA 1GTOA 1YJ9V 1J95A 1XL4A 3E8BA 3RW0A 1H38A 5C93A 2IJKA 2QM7A 4G28B 3CCLV 4MVQA 4GX2A 3KG2A 3RVZA 2NNUA 3OM3B 3GB7C 1SRYA 3JD1A 2B1IA 4RUFA 2EINC 4TWKA 5L3FA 3K79A 3USSA 1MOFA 5L3BA 4J9ZB 1EBOA 2WLLA 2X6CA 3OMIB 4LBEC 1V55B 1PNMA 3OEEG 2JDIH 1QLNA 3OUSA 2QE7G 4JTDB 4KFMA 3SPGA 3EHBB 4E2LA 1S76D 2ZR2A 4WVZA 2WSSH 1NQTA 4MW3A 2H94A 5KA5A 3SYOA 2EINB 2Z3YA 3OEHG 1VQKV 3HPLC 3QO8A 1Q82W 1LNQA 4R6ZA 3E35A 1M57C 1NKDA 3I55V 1AROP 5H9CA 5IYBO 3CCUV 2DQ3A 2QTOA 1FXHA 2A9HA 2IJHA 1MABG 3F7YC 4GCZA 3R65A 3F5WC 2A79B 4WFBV 3JD3A 1UJWB 3VOUA 1QR9A 4PDLA 2QEXV 4MTFA 1P7BA 3ZJZA 5B1BB 4LC1A 3W7SA 3E2EA 2QE7H 2X0LA 4JTCB 3ZRSA 2E5YA 1AJPA 4MTGA 4XBFA 3K0DA 3STLC 2M7WA 3TCUA 2R9RB 1M57B 1EFRG 3ZMUA 4TSFG 4XDLA 5J9PC 3ZRWA 4MVMA 3X2QB 3K08A 1K33A 4WFEA 1V54B 5CBFA 3W7TA 4ZKIA 3B77A 1H2GA 1YTFD 4JYCA 5LGNA 4Q20A 1TUEB 3QO5A 2MK3A 2JIZG 2OTJV 1CP9A 3P30A 1F4MA 1RM1B 4LP8A 2IJIA 3G71V 4QIWF 1QLEC 2F43G 1W0KG 1YITV 4G2KA 4XDJA 1EZJA 2ZXWC 4R7CA 4U7OA 5CBHA 4UXNA 1JCHA 3LDEA 1VQ9V 5EC1C 3SYPA 1THZA 1QBZA 4KUMA 1M9NA 3MD0A 3SPJA 3ZRVA 4CBCA 4DXWA 5LGTA 4QPKA 3K0GA 4G27B 5DN6G 1NVPB 1R6NA 2UXNA 4P9PA 2R9IA 2W0FC 3ASNB 4GT1A 1AQTA 5IY5C 2QA4V 4MT8A 1QVFU 4UV9A 4FIPC 2IU0A 3AG1B 1Y66A 5LGUA 4JYBA 1KC8W 3E86A 2D3OW 2ZXWB 3E8FA 5IDJA 1MSWD 2Q68A 4JTAB 4PA6A 2ZQMA 4GX0A 2UXXA 5CMUA 3GWOA 2XAGA 2EIKB 2WAMA 1K8AW 4N21A 5DM6V 1OCZC 1QVGU 1JEKA 4U7NA 3ZIAG 4HAMA 4BIUA 4QMAA 2OCCB 1R3JC 5H6RA 3BEHA 3FB7C 2DQ0A 2Y48A 3CCQV 3CD6V 1VQ5V 3LSQA 4H33A 3ABKB 1YI2V 2IH1C 2W6IG 3OUFA 1OCZB 3SPHA 4CZZA 2BOCC 3PJSK 3ZN0A 3OW2U 4GX1A 3LDDA 1YHQV 1GM8A 2DWDC 2XNDH 2DWEC 1YSCA 3AG3B 2ZR3A 1PD3A 2PI4A 4TLFA 2XOKG 4WCEV 2WLJA 3T1CA 3K04A 2BOBC 2EIJB 4MVOA 4R50A 3T4ZA 2FTKA 3BY6A 3WFVA 1GMGA 2P7TC 5LBQA 5EBWC 3JD2A 2P67A 2JEUA 4PDVA 4MVSA 5B1AC 3FB8C 1Q86W 1I5YA 3OFNG 5KUMA 3SPIA 2V1DA 1BMFG 4UUJC 1DLBA 5B1BC 3CC2V 2Q67A 3ZMTA 2IJJA 1H8HG 2JK5C 1COWG 3DGEA 4PA9A 3CCVV 1IXMA 2B5UA 5B1AB 1VQNV 1WLEA 3T2MA 1Y4MA 3ABMB 4MVZA 3X2QC 1M1KW 3SYAA 1V54C 4Z1MG 1OCOC 1K7DA 1S5HC 1QR8A 1P4RA 3LUTB 1Q81W 1JX9A 4YXWG 2LP7A 1R6KA 3AEIA 3QNEA 3CXCU 3ZCCA 1G8MA 1PNLA 3JD0A 3ETDA 4R8CA 3RVYA 1KD1W 4ASUG 3FKSG 3K06A 1VQ4V 5CA3A 4QNHB 3QO7A 1RM1C 2ATKC 3CC7V 3OR7C 4BAYA 3ETEA 1OCOB 4WFFA 5B1OA 2XASA 2WLHA 3CYOA 1KKDA 1NH2D 2W6JG 1YTFB 4YXWH 2WLIB 1OCRC 2QM8A 4DO2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ORQ C;  2EIL C;  5EK0 A;  3ASN C;  3FB5 C;  2X6B A;  2Q68 A;  2WLI A;  4JTA B;  4MVR A;  4PA6 A;  3T4D A;  1BSN A;  3K03 A;  2HVJ C;  3AG1 C;  4GX0 A;  2ITD C;  2V7Q H;  3SPC A;  2WLN A;  4X89 A;  4PA7 A;  1K4D C;  2KB1 A;  3E83 A;  1V55 C;  2AHZ A;  4MSW C;  4RO2 A;  5EC2 C;  1J95 A;  1XL4 A;  3E8B A;  3RW0 A;  2WLK A;  4G28 B;  5E1A C;  1OCZ C;  4MVQ A;  4GX2 A;  1JEK A;  2HJF C;  2W6J H;  3OGC C;  3KG2 A;  4WFH A;  4RAI A;  3RVZ A;  4H37 A;  4PDM A;  3GB7 C;  2WLL B;  2HG5 C;  4RUF A;  4TWK A;  2EIN C;  3ASO C;  4QMA A;  1R3J C;  3USS A;  2EIK C;  3BEH A;  3FB7 C;  2K1E A;  4J9Z B;  2WLL A;  1OCC C;  2X6C A;  1JVM A;  4MS2 A;  4LBE C;  4H33 A;  4QE9 A;  3UM7 A;  2JDI H;  3OUS A;  2IH1 C;  4JTD B;  1R3K C;  4KFM A;  3OUF A;  4LCU C;  3SPG A;  2OCC C;  2AHY A;  3SPH A;  1BSH A;  4WVZ A;  3IGA C;  3RBZ A;  2WSS H;  2BOC C;  3PJS K;  1G4Y B;  4MTO A;  4MW3 A;  2X6A A;  4GX1 A;  3SYO A;  3LDD A;  4RUE A;  3HPL C;  4QE7 A;  3F7V C;  4ZBM A;  2DWD C;  2XND H;  1LNQ A;  2DWE C;  3ABK C;  4R6Z A;  1M57 C;  5CBG A;  4MVU A;  3TET A;  2QTO A;  2A9H A;  3E89 A;  3F7Y C;  3R65 A;  4TLF A;  3AG4 C;  3F5W C;  2A79 B;  2WLJ A;  3FB6 C;  3T1C A;  3UKM A;  3K04 A;  5BZB A;  2BOB C;  3VOU A;  4P9O A;  4PDL A;  4F4L A;  2Q6A A;  4X8A A;  4MVO A;  4MTF A;  1P7B A;  4R50 A;  3T4Z A;  3ZJZ A;  4EKW A;  2QE7 H;  2P7T C;  4JTC B;  3SJQ C;  3AG3 C;  3ZRS A;  2E5Y A;  5EBL C;  4MTG A;  5EBW C;  4PDV A;  3K0D A;  3STL C;  4MVS A;  5B1A C;  3FB8 C;  3TCU A;  4OXS A;  2R9R B;  3SYC A;  2E5T A;  5KUM A;  3E8H A;  2EIJ C;  3SPI A;  5KUK A;  2HVK C;  2ITC C;  4UUJ C;  4XDL A;  3AG2 C;  5B1B C;  5J9P C;  3JYC A;  1K4C C;  5EBM C;  1ZWI C;  3LNM B;  2QKS A;  4MVM A;  3K08 A;  5CBF A;  4WFE A;  4BW5 A;  1FS0 E;  2Q67 A;  4MW8 A;  2JK5 C;  3E8G A;  4GX5 A;  4P2Z A;  4X88 A;  4PA9 A;  2Q69 A;  3EFF K;  2ZD9 A;  3OR6 C;  3T2M A;  2EIM C;  4HYO A;  2DYR C;  4HZ3 A;  4I9W A;  4MVZ A;  3SYA A;  1V54 C;  1R3L C;  3X2Q C;  4DJG A;  1OCO C;  1S5H C;  2H8P C;  3LUT B;  4LP8 A;  2NLJ C;  2WLM A;  1QLE C;  1E79 H;  4R8C A;  3RVY A;  4PA3 A;  1BL8 A;  4XDJ A;  1R3I C;  3ABM C;  2ZXW C;  3K06 A;  4R7C A;  2DYS C;  5CBH A;  1XL6 A;  3LDE A;  4QNH B;  5EC1 C;  3SYP A;  2ATK C;  1M56 C;  4DXW A;  3SPJ A;  4CBC A;  4XDK A;  3OR7 C;  2Y69 C;  3K0G A;  4G27 B;  3IFX A;  1AQT A;  2CK3 H;  4P9P A;  2W0F C;  4P30 A;  4WFF A;  3WG7 C;  5IY5 C;  2A0L A;  3ABL C;  2YEV A;  2WLH A;  1KKD A;  2IH3 C;  5B3S C;  4YXW H;  2WLI B;  3SYQ A;  1OCR C;  2HFE C;  3E86 A;  4J9Y B;  3E8F A;  4PA4 A;  4PDR A;  4WFG A;  3STZ C;  3LDC A;  1IFP A; 
#chains in the Genus database with same CATH topology
 1YJW V;  2Y9Y A;  1AR4 A;  1URQ B;  4MVR A;  1NTM G;  3A0B E;  5B66 Z;  3GMA A;  4OGQ C;  3CJH A;  5JVD B;  2HVJ C;  3RK3 D;  1VIB A;  1S5L X;  3ASO B;  4UB8 Z;  4QGP A;  4RO2 A;  2ZIM A;  3OAA G;  5EC2 C;  5KAI H;  1Y74 A;  4JYA B;  2WLK A;  1NZ6 A;  1K9M Q;  2OTJ P;  4U3J B;  5EIB D;  1KYO H;  3C1L A;  1AI7 A;  4O4J B;  1NTZ D;  3FGA D;  5ITZ A;  1VQL P;  2EIK C;  3CCM V;  2K1E A;  3RYI A;  3L75 G;  1SQV E;  2XV5 A;  1NTM H;  3MAQ A;  4RES B;  1H2N A;  2ZYD A;  3L71 H;  1GKF A;  3Q4H A;  1N0J A;  3LSS A;  2ZE6 A;  1RF0 C;  1KKC A;  4ABM A;  1FDO A;  1VQM V;  4IOI H;  1AI4 A;  2OCC C;  2DE0 X;  2H89 C;  2QJ1 A;  4FFB A;  3RK3 E;  1M5I A;  4JAS A;  1KMI Z;  3CRM A;  2WPV B;  1NTK J;  4ZBM A;  5E79 H;  1BCC D;  1DIP A;  2OYH A;  4BIZ A;  1HJ0 A;  1RE3 A;  1RSO B;  1LUW A;  3L75 H;  2E3C A;  2WMM A;  3FB6 C;  3UKM A;  1K73 W;  3CME V;  2E74 B;  1FAV A;  2R9A A;  4DV0 O;  2Q6A A;  3DSQ A;  3H1H G;  1ZSP A;  4ZOL A;  4EKW A;  1IBL O;  1SER A;  1JCD A;  1M4U A;  4YTP C;  1M8O B;  2OWO A;  1K34 A;  5B5E H;  1NU1 D;  3APQ A;  3K9A A;  2QG4 A;  2FYZ A;  1B6Q A;  4IT5 A;  4OXS A;  2VQF B;  3NTN A;  3VN0 A;  3D71 A;  5AW5 B;  5KUK A;  1FZB A;  3AEB C;  1FJP A;  4D6T G;  3ZMV A;  5JJE B;  1ZOY C;  4L87 A;  1SA0 B;  1S77 D;  1GTW A;  4RJT A;  1VL2 A;  1VF5 C;  1S72 V;  1OVV A;  1LWU A;  3CRQ A;  5IWA O;  2PYJ A;  3T1H O;  4JI1 O;  1CEZ A;  1B3Q A;  1BCC E;  2GHY A;  1NTZ J;  3CD6 P;  1MMM A;  4DV4 O;  2ZNI A;  3H1H H;  1SQP E;  1S3J A;  1H0T B;  4GLX A;  4CH6 A;  2Q69 A;  5L3E A;  3EFF K;  2M0B A;  3KHU A;  1K5Q A;  5AW3 B;  1GK4 A;  2C2A A;  3H6P A;  3ABU A;  1OJH A;  3D8C A;  1SQB G;  3CX5 I;  1OHH G;  4JV5 B;  1L2P A;  2KK7 A;  4JAU A;  1YHQ P;  1NTM D;  1GZL A;  4DR7 O;  3L70 G;  1PZQ A;  1IK7 A;  3LIE A;  1N8R W;  4H44 D;  5KKZ B;  4FJC C;  1SKV A;  2Y69 C;  1IBL B;  1NO4 A;  1WP8 A;  3QH9 A;  1JUN A;  3ZBH A;  1KQL A;  4TT3 G;  4UVC A;  4LF9 O;  2IFM A;  3HKE A;  2OIE A;  5IJ0 A;  2IH3 C;  1LTJ C;  2O01 N;  4O4I B;  4PDR A;  4PA4 A;  1G1X B;  5FLX N;  1NU1 J;  2QJP B;  2IDB A;  3L75 D;  3V4W A;  5H6Q A;  2QTS A;  5HFM A;  5EK0 A;  3MGN A;  2WLI A;  2PYL A;  4K0K O;  1KYO E;  4RO0 A;  3VMA A;  4JI1 B;  2L6L A;  5AVT B;  2WA4 A;  5LHI A;  3S1K A;  1NTM E;  2ADQ B;  1NKZ B;  3OW2 O;  4MSW C;  3ZS8 C;  3CCV P;  1URQ C;  2M3E A;  3L71 E;  3E1R A;  4TT3 H;  1H89 A;  2OCH A;  2QM4 A;  2CUG A;  3NR7 A;  1EN4 A;  5J2U A;  4Y99 B;  3OGC C;  4JI4 O;  4H37 A;  4PDM A;  2OGU A;  3E22 A;  3JSL A;  3ASO C;  3OMN B;  4DRX A;  1KIL A;  3H1I H;  3TJT A;  3M9Q A;  2GTS A;  5E79 E;  3ZHR A;  1NAF A;  2XKM A;  5L8R J;  3H1H D;  1YQ3 C;  3MUD A;  4LGD E;  3L75 E;  1NTM J;  3RL0 g;  4X1I B;  3ETG A;  2JEX A;  1YEW A;  1ROP A;  1AI5 A;  4LF4 O;  4WBN B;  1SES A;  5AVU B;  1HWT C;  2R5B A;  3B8M A;  4ZMD A;  3SFD C;  4RUE A;  1Q5O A;  2XAQ A;  3B8N A;  4D6T D;  4MVU A;  1H2M A;  4K0K B;  3HD7 A;  1VQ7 V;  2P58 A;  2FFD B;  1AQ5 A;  1KB9 D;  5CB4 B;  4P9O A;  3L75 J;  3M9B A;  1R73 A;  1ZLZ A;  3PN1 A;  2IZ1 A;  3VTP C;  2LXC B;  1SQB D;  3H1H E;  1W0J G;  3ZRW B;  2WSF J;  3V2N A;  5LYJ A;  4JI4 B;  1RPO A;  2E74 C;  2YKO A;  2K9J A;  2ITC C;  2F23 A;  1NAY A;  5IT9 N;  2XT9 A;  3L70 D;  3LNM B;  2GM4 A;  3GW6 A;  1GK9 A;  1ZME C;  1D5A A;  4WBA A;  1Q43 A;  1R6T A;  4HNA A;  4JZG A;  4YHH O;  2Q3E A;  1H2S B;  2W0X A;  4DW1 A;  5EZY B;  2CK3 G;  1SQG A;  4HYO A;  1WJZ A;  3RN4 A;  1L0L K;  1BE3 G;  2CPS A;  4X20 A;  1JJ2 U;  2QWQ B;  5AW2 B;  1R1B A;  2EBO A;  3FWL A;  1SQB E;  5TIS H;  1R3I C;  3C9I A;  4D6T J;  4ZHQ A;  2LW7 A;  2AXT Z;  4ASV A;  1RPR A;  2LKM A;  2CGN A;  3L70 E;  1IFI A;  4B86 A;  1LUV A;  4DV2 B;  2CK3 H;  3ZMZ A;  3HB3 B;  3HR0 A;  2OIG A;  1YTZ T;  2WQY C;  3OE7 G;  1XUQ A;  1WP7 A;  1N0N A;  1AR1 B;  1PGO A;  1U97 A;  2J5U A;  1N73 A;  5KKZ C;  4NPD A;  4PEL A;  1SFC A;  3MHS C;  3MIW A;  5K1X A;  1SQB J;  3A0R A;  5JCO A;  4W7Y A;  4DR5 O;  4FLZ A;  2GSM B;  2WPS A;  2O01 H;  4HJG H;  4YHH B;  2ITD C;  2IU3 A;  4O2A A;  5D5P A;  1F4N A;  3L70 J;  4ZI7 B;  1L4A A;  4FZ0 A;  2KB1 A;  1V55 C;  1GTO A;  3FXD A;  4LFC B;  1YJ9 V;  3WU2 H;  1J95 A;  3JAW A;  1FKA O;  2IJK A;  2QM7 A;  3HE5 B;  2KNC B;  1KQG B;  4G28 B;  3CCL V;  2AZ0 A;  4GOF A;  4MVQ A;  2YNY A;  3MP7 B;  3KG2 A;  4JQ0 D;  3U1A A;  4TWK A;  3P8M C;  1UII A;  1Z5V A;  3USS A;  3HUS B;  3RWR D;  1OMI A;  3MTU E;  1IVS A;  1PNM A;  4Y99 C;  1Q3E A;  2IBZ G;  3SJB C;  4FM1 A;  2QE7 G;  1KFM A;  4KFM A;  3SPG A;  2ZR2 A;  2SPZ A;  1NQT A;  1B06 A;  2CDY A;  3N27 A;  4I50 B;  2RKL A;  3VQX A;  2F4V O;  1YJN P;  2OYI B;  3OEH G;  5AW4 B;  1LNQ A;  1JR9 A;  4R6Z A;  1BDD A;  5C8Y B;  3P8C D;  1ARO P;  4X62 B;  3JAM N;  3CCU V;  5LXT B;  2IJH A;  2QGN A;  3W68 A;  1T6A A;  1GRJ A;  3F5W C;  5AW7 B;  2AEM A;  4BWA A;  2QEX V;  2XUM A;  2IBZ H;  5B1B B;  2QE7 H;  2E5Y A;  1AJP A;  1BE3 D;  1YYC A;  2RDC A;  3STL C;  1FU1 A;  2NPS B;  2FFD C;  4JPZ B;  1IXB A;  2H88 C;  2HPC A;  5KAF Z;  1L0N K;  4XDL A;  2YXY A;  4JI6 O;  2UU9 O;  1GN4 A;  5H2F H;  3A0B Z;  4XE5 B;  2QWR B;  1K33 A;  3RK2 D;  1V54 B;  4BRY A;  3JAK A;  5TIS E;  4ZKI A;  3H32 A;  1YTF D;  4ICG A;  3RYC B;  2WVR A;  1MZF A;  2F4V B;  5BU5 A;  4UCT A;  3H1K G;  3PLN A;  2KSE A;  4LP8 A;  3CSX A;  3G4S P;  3A0H Z;  4QIW F;  1EZV I;  1BE3 E;  1JJO A;  5AVW B;  5KHG A;  3OT7 A;  4PJ0 H;  2P10 A;  4R7C A;  5CBH A;  4ZNC A;  1AJY A;  3AE4 C;  5KLI B;  1A32 A;  3LSU A;  3ZRV A;  4DXW A;  1BGY J;  1NVP B;  4P9P A;  4GIF A;  2R9I A;  2Q7G A;  2EX3 A;  2W0F C;  3CRC A;  1NHL A;  1NJI Q;  4PI0 A;  4MT8 A;  4JI5 O;  4UV9 A;  3O6Q A;  2WSC H;  3H1K H;  1TUB B;  4LH7 A;  5FPO A;  3IAO A;  3WU2 E;  1GN6 A;  1N36 B;  4I0X B;  4JI6 B;  3E86 A;  1BE3 J;  4LFB O;  2UU9 B;  3CPW O;  2J58 A;  3CRA A;  1HNW B;  1YCI A;  4I7Z B;  1Q6I A;  2FL4 A;  2P5O A;  2IBZ D;  2PF4 E;  2ZQM A;  2PGG A;  5APV A;  3HD7 D;  2GUV A;  5LMU O;  2XAG A;  4DUZ O;  1FZC A;  2N74 A;  2JS3 A;  2WAM A;  3B5N A;  4K35 A;  1Q2N A;  5DM6 V;  2EJ7 A;  1KIL E;  1YXB A;  1OCZ C;  2YMK A;  3LW5 H;  1GK6 A;  1OXZ A;  2DMX A;  3HKD A;  4HAM A;  3AE7 C;  1GW3 A;  4QMA A;  1RE3 C;  5LOV A;  3C3S A;  3FB7 C;  3CRR A;  1QU7 A;  5LMN B;  5JQG B;  1VQ5 V;  3N7N A;  3K5O A;  1IK9 A;  1OW7 A;  2IH1 C;  4I55 B;  5APS A;  3SDL A;  4JI5 B;  3HUS C;  3B8E B;  2IBZ E;  3CS5 A;  3CXH H;  3KKY A;  2H8P D;  1GM8 A;  5D5Q A;  2DWD C;  1IBK B;  2XND H;  2DWE C;  3L72 G;  3H1L H;  3AG3 B;  4RKU J;  2R5D A;  5AW1 B;  3O65 A;  3CC4 P;  2ZM6 O;  4WCE V;  2OYI C;  3K04 A;  2AEF A;  4X66 O;  5H2F E;  1N7L A;  4AHC A;  5IYZ B;  1ZX3 A;  1M56 D;  3T4Z A;  3JAT A;  2KKW A;  3BY6 A;  4DUZ B;  1HGV A;  4IYH A;  4LNU B;  2FYU D;  3WFV A;  4W80 A;  5AW9 B;  2P7T C;  3DC5 A;  1NTZ K;  5LBQ A;  1FFX A;  4FFK A;  2JEU A;  4OH8 B;  4MVS A;  1RF1 B;  5KAI Z;  1I5Y A;  1Q82 Q;  4ZKU A;  1ZW0 A;  4JBZ A;  4JI3 O;  5B1B C;  1T2K D;  3B40 A;  2HFE D;  3EQ2 A;  1FBM A;  3L72 H;  3AE3 C;  1HR0 O;  2E75 B;  2Q67 A;  4X64 B;  2NPS C;  1SFC D;  1CI6 A;  3F5H A;  1XHZ A;  1H8H G;  1P84 I;  3KCX A;  2KXP B;  3DGE A;  1LT9 B;  4PA9 A;  4B7K A;  4C7N A;  1JY2 O;  2PAJ A;  1PPJ G;  3ITK A;  4DR4 O;  3ABM B;  2FXP A;  1V54 C;  1L0N G;  3Q3D A;  1L4A D;  3CC2 P;  3HE4 B;  3GHG A;  2LP7 A;  3V6I A;  3CXC U;  3DC6 A;  3H1K E;  1VQK P;  3JAS B;  5E79 Z;  4J41 A;  4BW9 A;  4Y28 J;  2RCV A;  4DUY B;  5CA3 A;  1SZX A;  1FE6 A;  3QO7 A;  1NU1 K;  2ATK C;  2K88 A;  3E7K A;  2BTO A;  2GDS A;  1LGH B;  1UIX A;  4PD4 H;  2Y4U A;  4UFZ A;  4CH5 A;  4HKZ H;  4TUY B;  2E76 C;  4OWF A;  1SQX G;  1PPJ H;  4DR1 O;  1WMK A;  3V2R A;  1L0N H;  4JI0 O;  5CA1 A;  4LLH A;  3U0Z A;  1KKD A;  5B5E Z;  2W6J G;  2FYN B;  2FYU J;  5KLI C;  2QM8 A;  2WIT A;  4GKK O;  1KIL C;  1G1I A;  4DO2 A;  1HR0 B;  1M57 D;  3FAV A;  3CC7 P;  5AVY B;  1URF A;  3A5T A;  4UB6 H;  1HWY A;  3KZI Z;  3WUT A;  2AW9 A;  2B87 A;  2XZR A;  1XMO O;  1JPX A;  2Y0E A;  5JH7 A;  1SQX H;  1NTM K;  5AVV B;  1OCR B;  2I8D A;  2M5A A;  5APT A;  3KCY A;  2Y9Z A;  2W6J H;  1KC8 Q;  1YJW P;  1FDI A;  3L72 D;  5A9G A;  2HG5 C;  4WY4 A;  5APU A;  3M06 A;  3CXH E;  3DXR A;  1J5E B;  5CCH C;  4OGQ B;  4EB6 A;  1SS1 A;  1U7J A;  1BQ0 A;  1YIT P;  5CA0 B;  1SC5 B;  1QEX A;  5KMG B;  1JA8 A;  1LP1 B;  2L35 A;  4JF7 A;  1R3K C;  2QRX A;  1WPX A;  2AHY A;  1BSH A;  4DR1 B;  1JOY A;  3CP1 A;  2GUZ A;  1ZP0 C;  4B3M O;  2LJ2 A;  4LFA B;  3OMA B;  2N04 A;  2PP6 A;  2FBW C;  4I2L C;  1NTK G;  2GBO A;  3OD4 A;  3W7U A;  1ZL8 A;  2X7R B;  2F66 C;  3D3Q A;  2N9B A;  4UCV A;  5BZB A;  5AG2 A;  4PD4 D;  3L72 E;  3SFE C;  2BSK A;  4QPJ A;  1ZXG A;  4F4L A;  1XMO B;  2JGD B;  1USE A;  3AG2 B;  1PPJ D;  2G3A A;  1KQF B;  3AG3 C;  2KG7 B;  4AI8 A;  1FYJ A;  4I9Q A;  2MKV A;  1HH0 A;  3SSU A;  1M1J A;  4H0L C;  2E5T A;  2ZJS E;  3E8H A;  5J2T B;  3O8Z A;  1FS0 G;  3ZMS A;  1NTK H;  2P06 A;  2VRS A;  4B3R O;  3CME P;  4YJ2 A;  2QWN B;  2LFR A;  4OVN F;  3E8G A;  2Q0A A;  2JJ2 G;  4FLY A;  1NTZ G;  1S4X A;  1SQX D;  4W4L A;  2POH A;  3TGU D;  3CCS V;  1KQS U;  4PD4 E;  2DYR C;  4X1Y A;  4D7T A;  2E75 C;  4DJG A;  3ZN1 A;  1N73 C;  4NTX A;  1PPJ E;  5IYC O;  3B5N D;  5LP6 A;  1L0N E;  5JCO C;  1I94 O;  3NXS A;  1MZE A;  4NB5 A;  3ABM C;  2BEQ D;  3VMX A;  4YJ3 B;  5FNV B;  4F6R B;  3CMA V;  4FMT A;  5B3S B;  1LTS C;  1SQB K;  1S2E A;  1DH3 A;  2YEV B;  1NTZ H;  4UB6 E;  1RE4 C;  2K1A A;  2N9Y B;  4JYY A;  2A0L A;  4N78 D;  3ABL C;  5LA6 A;  2QR4 A;  2D2C C;  1QNM A;  3HKB A;  3RL0 D;  1Q81 Q;  1SQX E;  1ZV8 A;  2KP8 A;  2ZE8 A;  1KD1 Q;  4JYA O;  1NU1 G;  1TU3 F;  4J7J A;  1KP3 A;  4YPC A;  1TAE A;  1WA8 A;  2AGA A;  2Y69 B;  1W2E A;  4DZO A;  2Z4E A;  1QQC A;  1K4D C;  2ARH A;  3H9V A;  2JO1 A;  4O4L B;  2NN4 A;  3W7X A;  1NS1 A;  2CE4 A;  1LTJ B;  5APY A;  4FPP A;  3S3W A;  1CXZ B;  1SQX J;  3VYI A;  2IW5 A;  2UXB B;  1NTK D;  3TGU J;  3TK1 A;  1I94 B;  1TVK A;  1GL2 A;  2M8R A;  2WLL B;  3A2F A;  2MJZ A;  4JPR A;  1F51 A;  3L74 G;  4ASW A;  4Z1M H;  2UUA O;  3VP8 A;  1NU1 H;  2KIK A;  1JTH B;  2Z5H A;  5KX5 B;  1JFF A;  4IIJ B;  4LF5 O;  3R66 A;  1JM0 A;  2JJL A;  2Z0A A;  1X22 A;  2JRI A;  1OX3 A;  3K59 A;  3TF5 A;  4OPH A;  3IGA C;  3H01 A;  2Q7H A;  2NZ2 A;  3RK3 B;  1M90 Q;  3FYI B;  2Z5I A;  4EIJ A;  3IC7 A;  3CCE V;  1AVM A;  3G67 A;  3VMY A;  1S9K D;  3U10 A;  1ZRT E;  3T1Y B;  3L74 H;  3M8A A;  2W90 A;  4FLV A;  2HR3 A;  4NR1 A;  1X8Y A;  3E89 A;  2VQF O;  4GOE A;  1ZR4 A;  1NTK E;  3SWK A;  1NH4 A;  2JVD A;  4DT0 A;  4JGS A;  1HUC A;  2R32 A;  5BY1 A;  5AW0 B;  3BAT A;  2ZIN A;  4EFB A;  3UT5 A;  3CCR P;  2Q73 A;  5EBL C;  4WF9 V;  1T3J A;  3WU2 Z;  1FXK A;  2K9P A;  5IJ9 B;  3DTU B;  1VF6 C;  2Y0D A;  1KYO F;  3AG2 C;  2UWJ E;  2UUA B;  1DF4 A;  2OAR A;  1FS0 E;  2XU6 A;  4LF5 B;  4JV5 O;  4J7Z A;  3IN6 A;  2FXM A;  1IFM A;  1GD2 E;  2Y4T A;  2ZD9 A;  4R4M A;  4U3F J;  3CCJ P;  2EIM C;  4I9W A;  1NJI W;  1NTZ E;  4JAV A;  3CX5 D;  2KOG A;  1FZF A;  1CSB A;  1IUR A;  2NLJ C;  2WSF H;  1L8D A;  2YIU B;  1PL0 A;  3P32 A;  4PA3 A;  3QVN A;  5IY5 B;  1BL8 A;  1K97 A;  1VQP P;  3BA9 A;  1WPB A;  2V7Q J;  3AE8 C;  3M0D A;  4WY4 D;  2YXR B;  4UVB A;  3D6Z A;  4XDK A;  1K92 A;  2XAJ A;  3IFX A;  1MG1 A;  3V4Q A;  3WG7 C;  4P30 A;  3J81 N;  3U59 A;  3D36 A;  2KNC A;  3A8T A;  2H3O A;  5B3S C;  4B3S B;  4TQD A;  3L74 D;  1FZA A;  1S5J A;  3LDC A;  2IPP A;  2YXH A;  1EN6 A;  1XHX A;  1J1E B;  4O4H B;  3BVO A;  3T4D A;  4FK5 C;  3G6E V;  4W4K A;  4JI7 B;  3K03 A;  5H2F Z;  1AJN A;  4D6T H;  1NU1 E;  5GW7 A;  3ZHV A;  3LID A;  2H43 A;  2ZT9 C;  3E83 A;  5LHG A;  4I50 A;  1XL4 A;  4I4T B;  3RW0 A;  3CWB J;  4CH3 A;  2G8Y A;  3OA7 A;  1KB9 H;  3AE2 C;  3RVZ A;  3OM3 B;  5JJJ B;  3JD1 A;  5L3F A;  3TYY A;  3CEI A;  1Y47 A;  3RYH B;  1MOF A;  1YIJ P;  1SQB H;  4NYK A;  1RY3 A;  3UO2 A;  4PJ0 Z;  3L74 E;  1V55 B;  1AP5 A;  4TV9 A;  1QLN A;  3OUS A;  1YJ9 P;  1W2B O;  3L70 H;  4JTD B;  4ZKP A;  1XI1 A;  4J7K A;  4TV8 B;  1U96 A;  5FPR A;  4FLX A;  2Z3Y A;  2OTL P;  2Y0C A;  3QO8 A;  1Q82 W;  1H8A A;  3WUV A;  2QWO B;  3E35 A;  3JAR B;  1VDF A;  5BMV A;  2GV9 A;  2QJY C;  2DQ3 A;  4M3L A;  1MAB G;  2BCC J;  1FJG B;  3L74 J;  1LTG C;  3RK3 C;  1FC2 C;  2CH7 A;  1JB0 J;  1KFN A;  1QR9 A;  1Q6U A;  2A7W A;  2OTK E;  3I56 P;  3NFQ A;  4MTF A;  1P7B A;  3TNU B;  2RN9 A;  2JEE A;  2X0L A;  3ZRS A;  3JAL B;  1KYO I;  3H1J J;  4W7Z A;  4HH2 A;  4MTG A;  4XBF A;  3K0D A;  1X9V A;  1VQO P;  2M7W A;  4IHJ A;  3TCU A;  5EIB C;  1EFR G;  1HW7 A;  3M91 A;  2YUA A;  4JI8 B;  3CCU P;  1RH5 B;  1PL4 A;  3X2Q B;  4IGG A;  3W7T A;  2QEX P;  3BFR A;  3ZED A;  2WPQ A;  5LGN A;  3HKC B;  4Q20 A;  1TUE B;  2JIZ G;  3UCS C;  2OTJ V;  1Q6H A;  3IF4 A;  1CP9 A;  3BRC A;  1N4C A;  2IJI A;  3VP9 A;  5GON A;  4DV2 O;  3EWK A;  1W0K G;  4F6E A;  2VS0 A;  2FYU K;  4XDJ A;  4X9Q A;  4U7O A;  3K9S A;  4UXN A;  1GL2 D;  4D7S A;  3SYP A;  1M93 A;  5LGT A;  4KUM A;  3SPJ A;  1EM1 A;  4LWS B;  1T5E A;  4CBC A;  4QPK A;  2YIU C;  1JY3 N;  3C90 A;  1N32 O;  4D6T E;  1BGY G;  2FKX A;  2KSJ A;  5IY5 C;  2QA4 V;  3ICX A;  4FIP C;  1PGP A;  2EUL A;  2JWA A;  3L35 A;  2YID A;  4JYB A;  1KC8 W;  4LFC O;  1KB9 E;  3K57 A;  2GUS A;  4N6J A;  4X1K A;  2F95 B;  2Q68 A;  2A06 G;  1N7S A;  1Y76 A;  2LGQ A;  2B9B A;  4JZ2 A;  2Q7E A;  1Y74 B;  3AEF C;  2UXX A;  4H13 D;  3APO A;  1T3U A;  3S9O A;  1BGY H;  1WAZ A;  1GDT A;  1J1E C;  5ITZ B;  2ZNJ A;  1F7Y A;  1QVG U;  2N1T A;  4B7E A;  1JEK A;  4U7N A;  2KQX A;  3RYI B;  1BT8 A;  1BE3 H;  3BEH A;  4J11 A;  3Q4H B;  3CD6 V;  3HTK A;  2A06 H;  4H44 C;  3LSQ A;  3S3X A;  5KHH A;  4FFB B;  4X62 O;  1N32 B;  2WSE J;  2W6I G;  3OUF A;  1OCZ B;  2FB5 A;  1J2J B;  1N33 B;  3FWN A;  1LTA C;  1LT1 A;  2YKQ A;  2BOC C;  3IC9 A;  3PJS K;  2KSD A;  3OW2 U;  1G2C A;  4J80 A;  2OYH B;  4GX1 A;  1X4T A;  2YIC A;  2BAS A;  1YHQ V;  3AEG C;  4AQR D;  1OW6 A;  3CHX A;  4B08 A;  1O9G A;  3KXD A;  1H88 A;  3SGI A;  3BAB A;  1PD3 A;  2PI4 A;  3OAK A;  5EFW B;  4TLF A;  4ZOL B;  1LTB C;  2EIJ B;  1HP8 A;  4UB6 Z;  2FTK A;  2ZVN B;  1GMG A;  4KHP O;  2RN0 A;  5EBW C;  3JD2 A;  2Q9L A;  1U57 A;  3BCC G;  1BZK A;  5KUM A;  4NXN O;  2UXD O;  1N34 O;  4UUJ C;  1DLB A;  1LWU B;  3GF3 A;  1W59 A;  3GG2 A;  1JCC A;  4FVM A;  1AVY A;  5APQ A;  1VEW A;  3L73 G;  3CCV V;  1BGY D;  4GYC B;  4R4L A;  2V4H A;  1WLE A;  3X2Q C;  2O57 A;  4EDF A;  4EOT A;  4DV6 O;  3LUT B;  1Q81 W;  4YXW G;  1R5L A;  2J59 M;  2WT7 A;  4X65 O;  3JD0 A;  3ETD A;  5KLV D;  1KD1 W;  2ILM A;  4ASU G;  2A06 D;  5CBO A;  5AW8 B;  1S5L H;  1VQ4 V;  5CHX A;  2BTQ A;  1N36 O;  3JCU H;  4MN4 C;  2M3B A;  4C7R A;  5GTH H;  1HNW O;  3HKE B;  2QSA A;  4KHP B;  5IJ0 B;  3RK2 B;  5IE9 A;  3P8C E;  2C0W A;  1PV3 A;  4NXN B;  1NH2 D;  1YTF B;  1N34 B;  2UXD B;  1BGY E;  4Z2W A;  4YXW H;  2WLI B;  2FYU G;  1P84 F;  1SQX K;  4DV1 B;  3WMM 0;  2EIL C;  2NR5 A;  1SZT A;  1ZR2 A;  5CA0 A;  4PV1 D;  3RYF A;  2W6B A;  2E76 B;  2P4V A;  1IC2 A;  3N2G A;  3SPC A;  4X89 A;  4PA7 A;  4DV7 O;  2A06 E;  1DTO A;  2R72 A;  1GO3 F;  5J2U B;  5LMN O;  1KEC A;  3TDK A;  4DV6 B;  3E22 B;  4OPA A;  5C39 A;  2G38 A;  4DRX B;  1M90 W;  1KIL B;  1A02 F;  3BHP A;  4X65 B;  2FYU H;  1X59 A;  2PTM A;  1HGZ A;  3IR9 A;  3WUU A;  1EQ7 A;  4TOI A;  2W8Z A;  1K9M W;  1I5X A;  1RF0 A;  3PTZ A;  4UB8 E;  2PRR A;  3FX7 A;  3P7K A;  3PH0 A;  1IBK O;  1MUU A;  2JGD A;  2EJR A;  5KLV J;  2ZVO B;  2Q8V A;  1VQ9 P;  1GN3 A;  1MA1 A;  3A3Y B;  1NKN A;  3EVK A;  1K8A Q;  3BCC D;  2P7J A;  1GM9 A;  3AG4 B;  4JF3 A;  2HOD A;  3HRN A;  2W83 C;  5K5G B;  3HD7 B;  1PP9 G;  4DW0 A;  3B71 A;  2QIW A;  4YIP A;  4YXD C;  1QLE D;  3V2Q A;  2R70 A;  3L73 D;  2YIB A;  1FOS F;  4ZIB A;  3PP5 A;  1YBK A;  5EYP A;  2OYH C;  1D5N A;  2I1K A;  4DV7 B;  1I0H A;  2WWW A;  4UCR A;  4A5U B;  1NTK K;  5LYJ B;  4X64 O;  2K9J B;  4AQY B;  3FXE A;  3ZRX A;  5CMZ A;  3SYC A;  1RQU A;  2EIJ C;  2FKW B;  2IZ0 A;  1PP9 H;  5KHK A;  3BCC E;  3JYC A;  1DF5 A;  4DV3 B;  3G80 A;  4HNA B;  2E42 A;  5CCG D;  4IFM A;  3T97 A;  2OQQ A;  3ML0 A;  3QTC A;  5JJN B;  1W5C E;  4MW8 A;  1NBM G;  3CCQ P;  5JWP A;  4GX5 A;  4P2Z A;  1S5L E;  4X88 A;  1QVF O;  4UVA A;  3JCU E;  4X20 B;  1LWU C;  1USD A;  1N7S D;  4H0L B;  1EDJ A;  4DUY O;  3AEE C;  3D36 C;  3OR6 C;  3UQ8 A;  3L73 E;  5GTH E;  1YI2 P;  3BRT B;  2QKC A;  3BA8 A;  1R3L C;  2Z5U A;  3CXH F;  1M56 B;  4RQE A;  2YSU B;  2KS1 A;  3N2K A;  2WLM A;  4ZHQ B;  3BCC J;  5APX A;  4AIL C;  3RGB A;  4O2B A;  2P2U A;  3K5M A;  2IBZ I;  2N1T D;  2ZE5 A;  1JMK C;  3ZHS A;  2WSS G;  1JMM A;  2F93 B;  3CCS P;  2DYR B;  1BHA A;  1XTC C;  4EI2 A;  1LTJ A;  1YJN V;  3L73 J;  3ABT A;  4KP4 A;  1M1K Q;  1N73 B;  1SFC B;  2ZIO A;  2RJZ A;  4IYI A;  3D70 A;  1ZAU A;  1DK1 A;  1L1F A;  3KDP B;  2UUC B;  2JGU A;  4WFG A;  4UCS A;  1FDM A;  3RK2 C;  4O2A B;  2X6B A;  3CMA P;  5AVZ B;  1L4A B;  1VQ6 V;  1BSN A;  1K05 A;  2FYU E;  1GM7 A;  2E5L B;  3JAW B;  1URQ A;  2WA3 A;  2PUS A;  2WLN A;  2WPD G;  1J5E O;  1AV1 A;  1E1R G;  3ABL B;  2D2C B;  1US6 A;  5JVD A;  2LFS A;  5AW6 B;  2AEJ A;  4NXM O;  2B1G A;  3FYE B;  1VQN P;  3FFQ A;  1KN7 A;  3IFM A;  2A45 G;  1PP9 D;  2HJF C;  4RAI A;  2EZP A;  2L5G B;  1YVW A;  3TGU G;  4B3T O;  2DW3 A;  1PKX A;  3P3P A;  4FLW A;  4UV8 A;  4U3J A;  1P7G A;  4LFA O;  2QDO A;  1FAF A;  3CPW U;  4O4J A;  1JVM A;  4MS2 A;  2V4D A;  5AVS B;  1NWQ A;  1SQF A;  1R8E A;  3AE5 C;  3MUD C;  4NKG B;  1XIL A;  1G4Y B;  3G4S V;  1IDS A;  2A45 H;  1XNQ B;  4DR2 O;  1KOR A;  2JP3 A;  3TGU H;  1KZU B;  4DYL A;  3W67 A;  1PP9 E;  3AG4 C;  1I7F A;  1RSO A;  3HD7 C;  3W7W A;  1MZ9 A;  4WB4 A;  3SR2 C;  4NXM B;  1VPC A;  1IJD B;  2ZYG A;  2HPC B;  1HNZ O;  3L9D A;  5KA6 A;  1S0V A;  1XOU A;  1LTI C;  2HVK C;  2VWJ A;  1DD4 A;  4BRY B;  4B3T B;  3JAK B;  4KHX A;  1ZUQ A;  1HDJ A;  3H32 B;  1PP9 J;  1JY3 P;  1LJ2 A;  5CJ0 A;  4HYT B;  3CCM P;  1OVU A;  1GMJ A;  1SA0 A;  1QL2 A;  1AIL A;  5H5N A;  2ETN A;  3CXH I;  1MFT A;  5TJH A;  3KYQ A;  1JQ0 A;  1VQM P;  4U3F G;  2PI5 A;  2LGW A;  1H0T A;  4DR2 B;  2H8P C;  4NTW A;  4WFA V;  5L3C A;  3L37 A;  4CS4 A;  2B89 A;  1N7S C;  2DYS C;  4KT0 J;  1J1D B;  2P4K A;  2ZDI A;  1M56 C;  2P22 C;  2V7Q G;  2IYO A;  1NR7 A;  3O6Q B;  2EIM B;  1K04 A;  1D7M A;  1HNZ B;  2XAF A;  4U3F H;  3ETQ A;  5L3G A;  2XHB A;  4OX9 O;  1Q7Y Q;  4CS2 A;  4K8Z A;  1T2K C;  3UO3 A;  2HFE C;  5F2V O;  3CC4 V;  2YDE A;  3FB5 C;  4O4I A;  1SFC C;  1G6U A;  1WT6 A;  2UXB O;  1FZG A;  4KXR A;  1FZC B;  1SS3 A;  1VQ8 V;  3B5N B;  4L76 A;  2V7Q H;  3WG7 B;  1S72 P;  3TXQ A;  4HBN A;  2YIB D;  3HKD B;  1L4A C;  1SQQ D;  5LOV B;  3AE6 C;  3CWB G;  3GB7 C;  1SRY A;  4RUF A;  2B1I A;  2CGO A;  2EIN C;  3WB1 A;  1PGQ A;  3K79 A;  1BDC A;  4PD4 I;  5L3B A;  4J9Z B;  3AE1 C;  1EBO A;  3TGU E;  2CAZ C;  1VF5 D;  3Q5S A;  1DX7 A;  2ZT9 B;  4I1L A;  3T1Y O;  1S76 D;  3KPE A;  2BE3 A;  2QSI A;  4MW3 A;  4OX9 B;  1JOC A;  4X1I A;  5KA5 A;  3CWB H;  3SYO A;  2YO3 A;  1VQK V;  1SQP G;  4YY3 O;  1NI8 A;  2Q4P A;  4WBN A;  4LF6 B;  3ZX6 A;  1M57 C;  3I55 V;  3CL3 D;  5H9C A;  2A9H A;  3CX5 H;  3JAT B;  2DOS A;  3R65 A;  2CPB A;  5BVZ A;  2BCC G;  1UJW B;  3VOU A;  4N78 E;  2AZ2 A;  3G6B A;  2Q9I A;  1FFX B;  4EEQ A;  3ZJZ A;  1IX9 A;  2ZE7 A;  4LC1 A;  3W7S A;  2FFD A;  3AK2 A;  1V9P A;  4JTC B;  5TIS Z;  4U3F D;  5CB4 A;  2XDJ A;  5BR8 B;  3H1J G;  1EC5 A;  1XNR B;  1XMQ B;  4Z1V A;  2QJY B;  1KUQ A;  4TSF G;  5J9P C;  1CI6 B;  3ZRW A;  5DED A;  1SQQ J;  1HBW A;  4MVM A;  4IFD K;  3K08 A;  4WFE A;  2HHH B;  2C9L Y;  3Q5P A;  3IAY A;  4C7N B;  2A3Q A;  2BCC H;  4DV5 B;  2RNB A;  1H2G A;  2YMY A;  1XTG B;  2KI7 B;  3GF7 A;  3QO5 A;  1SQV D;  2MK3 A;  4N3Y B;  2IFN A;  3GHG B;  2YC0 A;  1URQ D;  3H1J H;  5EZY A;  1MFZ A;  1F4M A;  1RM1 B;  3V2P A;  4BWN A;  2PY5 A;  4J42 A;  3L36 A;  4YY3 B;  3R2P A;  3CE2 A;  3G71 V;  4C46 A;  4U3F E;  1PIX A;  3ZHU A;  2KUB A;  1YIT V;  4G2K A;  3L71 G;  3F5T A;  1EZJ A;  2ZXW C;  1HVV A;  1JCH A;  3BPZ A;  4B3S O;  3LDE A;  4O9B A;  1VQ7 P;  2YIA A;  1THZ A;  1QBZ A;  1M9N A;  3MD0 A;  2ZAE B;  3G9R A;  4G27 B;  4CPG A;  5DN6 G;  5CA1 B;  1AQT A;  4JI7 O;  3ASN B;  3CWB D;  1S9K E;  3A0H E;  4LF7 O;  1J1D C;  3E1I A;  3OJA B;  2IU0 A;  3AG1 B;  3FAV B;  1Y66 A;  2YS8 A;  1Z2G A;  1KV4 A;  5LGU A;  3M0A A;  5DJT B;  3E8F A;  5IDJ A;  1MSW D;  2YXQ B;  1GW4 A;  2B9Z A;  4JTA B;  2B87 B;  3QWO C;  2O1J A;  2ITA A;  4BIO A;  5JH7 B;  3AG7 A;  4GX0 A;  1BSM A;  2ZKO A;  2M5A B;  2QA4 P;  2CTQ A;  1K8A W;  4N21 A;  5KLV K;  4ZI7 A;  2P1J A;  4WY4 B;  1YQ4 C;  3DXR B;  1SQP D;  1FZC C;  3O9O A;  5KHI A;  1SQV J;  4EB6 B;  3B5N C;  3SWF A;  3ZIA G;  4C7U A;  2N05 A;  2E74 D;  3HE5 A;  3RFR A;  3CWB E;  1R3J C;  1FZE A;  2BCC D;  2DQ0 A;  2Y48 A;  2O3J A;  3PRJ A;  2PGD A;  1IZ3 A;  1S5L Z;  4H33 A;  2QJK C;  3HUS A;  3CX5 E;  4XA4 A;  2GUZ B;  3ABK B;  3JCU Z;  5GTH Z;  1LTT C;  3H1J D;  4CZZ A;  1FJG O;  3I5C A;  3H25 A;  4LF7 B;  2K9Y A;  3ZN0 A;  3RL0 C;  3KZI H;  2LQT A;  1ZL8 B;  1YSC A;  2OYI A;  2BSK B;  3PHL A;  4H44 B;  2MW2 B;  2XOK G;  2WLJ A;  4FLU A;  4JI8 O;  5C8Y A;  2PZS A;  1X79 B;  2BOB C;  1BQZ A;  3GVM A;  2KB7 P;  5AVQ B;  5LXT A;  2ZYA A;  1M1J B;  1KYO D;  1IFJ A;  2BCC E;  2WSE H;  2M6Y A;  2P67 A;  2Q3I A;  2UXC O;  5B1A C;  1KB9 F;  5AVR B;  2K3R A;  4YJ2 B;  3CCL P;  3H1J E;  2V1D A;  1BMF G;  3L71 D;  1BCC J;  2NPS A;  1AFO A;  4DV0 B;  3BAS A;  3VQW A;  2HJD A;  1SQP J;  2L91 A;  1SP4 A;  1QVG O;  2JK5 C;  1COW G;  4X1Y B;  1G1J A;  1IXM A;  2B5U A;  1PM9 A;  3OTF A;  5KAI E;  3U1C A;  1VAR A;  1WNS A;  1Y4M A;  1DGS A;  1AVO A;  1M1K W;  5LP6 B;  3RYC A;  3H1I G;  1OCO C;  1K7D A;  1S5H C;  5LL6 Y;  3JSN A;  5IWA B;  3S4R A;  3T1H B;  1G8M A;  1PNL A;  3CB2 A;  4R8C A;  5DJU B;  4DV4 B;  3KQG A;  3B09 A;  3GHG C;  1N2D C;  3K06 A;  1RM1 C;  2Q5Z A;  5LA6 B;  4BAY A;  4LR3 A;  3HKB B;  3AK1 A;  4WFF A;  2UXC B;  4YIO A;  5B1O A;  4LF8 O;  5GTI H;  1Y8A A;  1Q8I A;  4DR7 B;  2WLH A;  3CYO A;  2R3S A;  4DCK A;  1WA8 B;  1TUB A;  1ORQ C;  1VQ4 P;  3ASN C;  2Q7C A;  4I0X A;  3P3N A;  1VQL V;  4DOJ A;  3L71 J;  3AG1 C;  4LF9 B;  2ZFC A;  3CCR V;  1RHZ B;  5APW A;  1PGJ A;  3JC2 2;  2Y0I A;  5B5E E;  3ZHQ A;  1TVK B;  1GL2 B;  1OCC B;  1OVR A;  1CPY A;  3NMD A;  5E1A C;  5CCH A;  1NT2 B;  3QG5 A;  3MHH C;  4IL6 H;  2EIL B;  4WFH A;  4RQF A;  3Q1M A;  1XEQ A;  1JFF B;  1E1Q G;  1FD9 A;  1N33 O;  2Q1K A;  3EXA A;  2PFX A;  3AEC C;  3KZI E;  5CCG A;  1OV9 A;  4MTX A;  1KU9 A;  4WY4 C;  5DEC A;  1EZV G;  5KJ7 A;  3CJH B;  4L8J A;  3JD4 A;  2XTA A;  1WRG A;  3CCJ V;  3OGI B;  1MNG A;  2P90 A;  5JQG A;  4EFE A;  5KLV G;  2WTY A;  3JCZ A;  4LF8 B;  4CS3 A;  3K58 A;  2ZCE A;  2HKO A;  1FXV A;  4I55 A;  5FL7 G;  4I5S A;  4QE7 A;  3F7V C;  4H13 B;  1NOH A;  3ABK C;  1VQP V;  3TET A;  1GAX A;  1X0T A;  2WPR A;  1B04 A;  1PL5 A;  2QWP B;  1RFY A;  1WB8 A;  3J80 N;  4LF4 B;  3CLQ A;  1EZV H;  2VRZ A;  3UT5 B;  3H1H J;  2Q5U A;  3F89 A;  3I5D A;  5LHH A;  1KB9 I;  1FJK A;  1FXK B;  5KLV H;  1NGM B;  2GTA A;  3H1I D;  5IYZ A;  2JR8 A;  1W2B U;  1QX8 A;  4U7J A;  1XDC A;  1AA0 A;  4LNU A;  2Y0P A;  1XQ8 A;  1E79 G;  1M1J C;  1RF1 A;  2O1K A;  5EBM C;  1K4C C;  4NPF X;  5B66 H;  2FY8 A;  4GZR B;  4GUN A;  5IYD O;  4NPE A;  2ZDI C;  3C3T A;  4QJF B;  2EZO A;  4UB8 H;  1VQ5 P;  4XFJ A;  1AI6 A;  3SJA C;  1HNX O;  4NVP A;  1LT9 A;  2XAH A;  1ENV A;  3L4F A;  4A7P A;  1Q86 Q;  1OIP A;  4FZ1 A;  2HLD G;  3B2E E;  1Q7Y W;  5GTI E;  5CBN A;  1YIJ V;  1E79 H;  5HFL A;  1P49 A;  3H1I E;  2ODM A;  1YDX A;  1XBL A;  2K37 A;  4PI2 A;  1H2L A;  3HE4 A;  4HB1 A;  3ZHT A;  1N86 A;  1XL6 A;  2QJP C;  5LP6 C;  1OFC X;  4LH6 A;  3JAS A;  1RE4 A;  2RMZ A;  3A2A A;  4IFF A;  2XNX A;  2ADP A;  4DV1 O;  1H8E G;  3WB2 A;  2FML A;  4Q6G A;  2YKP A;  2ZXE B;  1GU5 A;  2OTL V;  1DEE G;  1YF2 A;  4TUY A;  1IFN A;  2UUB O;  2CTW A;  1BHB A;  4J9Y B;  3H1I J;  3STZ C;  1QGK B;  2HP8 A;  3ZDM A;  3BCC H;  4IL6 E;  3D3I A;  3M99 B;  1EZV D;  3R4Y A;  3GLM A;  3I56 V;  1Y6X A;  3A7O A;  1HNX B;  4DK1 A;  1F23 A;  2AHZ A;  1VQO V;  2RQ6 A;  2KLV A;  1U7M A;  1CW5 A;  3GWK C;  1XRE A;  1AB3 A;  3L73 H;  4DR5 B;  1JY2 N;  2JKV A;  5L3D A;  2FXO A;  1PNK A;  1VQ6 P;  4TV9 B;  3EFG A;  1RP3 B;  3M7M X;  2CTR A;  1OZH A;  5CN0 A;  1GL2 C;  4PHZ A;  1OCC C;  1NH2 B;  3AE9 C;  2NPS D;  1GU4 A;  3Q5R A;  4QE9 A;  3UM7 A;  1TGO A;  4JAA A;  4LCU C;  1EZV E;  2RMK B;  4PV1 B;  3BAA A;  5KMG A;  1P84 H;  3RBZ A;  1LP1 A;  2UUB B;  4MTO A;  5KLV E;  2X6A A;  3SJC C;  5BMV B;  4DR6 O;  4FM2 A;  5CBG A;  4AQY O;  2CH7 B;  4GOD A;  1S1C X;  2C9N Y;  2VWK A;  2YI8 A;  2P6J A;  1JY3 O;  3VBB A;  5B66 E;  1SQQ K;  1K3E A;  4X8A A;  4DV3 O;  4H13 C;  4IHJ B;  1H2K A;  1NR1 A;  2E76 D;  3SJQ C;  1EXI A;  1VF6 A;  1JO5 A;  3K3W A;  2KG7 A;  4KL1 A;  1OZ0 A;  1FXK C;  1KIL D;  1ZWI C;  2YO2 A;  2QKS A;  5J2T A;  1LR1 A;  1NVP D;  1M7L A;  4BW5 A;  1K73 Q;  1L0L G;  4AUW A;  3G3Z A;  1JNM A;  4N23 A;  1QLE B;  1SF9 A;  3J7A U;  3FX0 A;  5GON B;  1AR5 A;  4HZ3 A;  1QCE A;  1KP2 A;  1SET A;  4DR6 B;  2OT5 A;  2JJ1 G;  4DR3 O;  1K5S A;  2HG5 D;  1HTL C;  2O01 J;  5CCH D;  2VQE O;  1AJQ A;  3RT3 C;  1L0L H;  2LW1 A;  2UUC O;  2C0X A;  1FFT B;  1E5W A;  3M9H A;  4YJ3 A;  5B1N A;  1P84 D;  5FNV A;  4F6R A;  1IBM O;  2R44 A;  3M0D C;  2XND G;  4EYY Q;  1IO4 A;  5KJ7 D;  2YEV A;  1D2D A;  3H1L G;  2E5L O;  3V5B A;  5K1P A;  3FD9 A;  4X1K B;  3SYQ A;  1N7S B;  1Y76 B;  2DYS B;  1EDI A;  1IFP A;  1IZN B;  4TQF A;  5KHJ A;  1SQV K;  1EDL A;  2OYO A;  2KYV A;  3QF7 A;  4AYC A;  1N8R Q;  2DW4 A;  2JDI G;  2HEP A;  2N1T B;  4LFB B;  1Y67 A;  2YXL A;  3LNN A;  3E8B A;  3VQY A;  1H38 A;  5C93 A;  4O4L A;  4DR3 B;  1HF9 A;  4H0L D;  4GX2 A;  1P84 E;  3HTK B;  2NNU A;  1Z56 A;  4J10 A;  4E4E A;  2VQE B;  2HYN A;  5LMU B;  1VQ8 P;  1OWA A;  2DJV A;  1XNQ O;  2WLL A;  2X6C A;  3H1K D;  4FM0 A;  3OMI B;  4LBE C;  4UCU A;  3OEE G;  1SLQ A;  1SVF A;  2JDI H;  1G2C B;  1IBM B;  2IX7 C;  1QHT A;  1JTH A;  5KX5 A;  4BXL A;  4IIJ A;  3EHB B;  4E2L A;  4WVZ A;  4FLT A;  2WSS H;  1O9H A;  2HLO A;  2H94 A;  2E75 D;  2EIN B;  2RH0 A;  3HPL C;  3RBX A;  3IJ4 A;  5A2Q N;  1NKD A;  2LXB A;  4PJ0 E;  1BS3 A;  4I6M C;  5IYB O;  2AXT H;  2QTO A;  1FXH A;  1L0L D;  4PV1 C;  1I08 A;  2R3C A;  3F7Y C;  4GCZ A;  2A79 B;  4WFB V;  3JD3 A;  4DK0 A;  2BEZ F;  4PDL A;  1SQP K;  2H7H A;  4UCO A;  1KQS O;  1EXJ A;  3E2E A;  4WWI A;  1ZN5 A;  1A02 J;  4PD4 F;  5BU8 B;  2D2C D;  2R9R B;  2YI9 A;  1M57 B;  1T8Z A;  3AEA C;  2ZM6 B;  1YTZ I;  3I55 P;  4K3A A;  3ZMU A;  4X66 B;  3C8V A;  1PFI A;  3TXS A;  5IJ9 A;  1SQQ G;  1GN2 A;  5CBF A;  1FOS E;  1UFI A;  1AP6 A;  3CXH D;  3B77 A;  4JYC A;  1L0L E;  1ZLL A;  4JI3 B;  2WSC J;  3H1K J;  3H1L D;  2WT7 B;  1MSD A;  3P30 A;  1EDK A;  2IM9 A;  3OTO O;  1QLE C;  2F43 G;  5M1B A;  2BTQ B;  3CCE P;  3B4S A;  3N4X A;  1SQQ H;  3VOP A;  4DR4 B;  5BXZ A;  5EC1 C;  1VQ9 V;  4I7Z C;  3AK3 A;  1L0L J;  3K0G A;  4CC6 A;  5AVX B;  1R6N A;  2UXN A;  4GT1 A;  4OGQ D;  1QVF U;  3AED C;  3LW5 J;  3G71 P;  2QVA A;  4L74 A;  3CI9 A;  4CC5 A;  1UPG A;  3ABV C;  3BRV B;  2D3O W;  2ZXW B;  3RYF B;  1MKM A;  3H1L E;  2CTP A;  5CCG C;  2E43 A;  3N2G B;  4PA6 A;  1Q90 D;  2LR2 A;  5KJ7 C;  1QL1 A;  4KJM A;  4O4H A;  4JI0 B;  2ZXX A;  5CMU A;  3GWO A;  3MHV A;  4GKK B;  2EIK B;  1WB7 A;  3VQV A;  5KAF H;  1KBH A;  2JWD A;  4RWU A;  4IL6 X;  1Z5W A;  3OTO B;  2W6A A;  3U11 A;  4I4T A;  1SQV G;  3H1L J;  4BIU A;  3A0B H;  2OCC B;  2N1T C;  5H6R A;  3CCQ V;  3K5L A;  3VMZ A;  2W27 A;  1L0N D;  2IYP A;  4GKJ O;  3RYH A;  4LF6 O;  2AXT E;  1YI2 V;  2HOD B;  3II6 A;  2B88 A;  3SPH A;  4K8X A;  1DEB A;  4L73 A;  4GKG A;  3A0H H;  5GTI Z;  3LDD A;  1PV0 A;  3L72 J;  1RF1 C;  1SQV H;  4TV8 A;  1VF7 A;  5EYP B;  5BR8 O;  4NTY A;  2ZR3 A;  2JS5 A;  2QJK B;  1XNR O;  1XMQ O;  2DN9 A;  3T1C A;  3JAR A;  3TSI A;  3G6E P;  1MV8 A;  3SWY A;  4MVO A;  4R50 A;  1EN5 A;  4B3M B;  1IFD A;  3RL0 B;  2HHH O;  1LT9 C;  1VF5 B;  4PDV A;  4DV5 O;  3TNU A;  1Q86 W;  3FB8 C;  1Y9B A;  3OFN G;  4GDO A;  3D6Y A;  4BR6 A;  3SPI A;  3JAL A;  1RQV A;  3T97 B;  2KZJ A;  3CC2 V;  1GH6 A;  1WN7 A;  4JI2 O;  1KTM A;  4IL6 Z;  1BCC G;  2KLU A;  2F1M A;  1R5S A;  2GA1 A;  4L75 A;  4GKJ B;  2LO1 A;  3ZMT A;  2IJJ A;  1NVO A;  1OW8 A;  1SQQ E;  2Q0O C;  2A45 I;  3THO A;  5B1A B;  1VQN V;  2ZT9 D;  3T2M A;  1L0N J;  4MVZ A;  2KS1 B;  1ZTE A;  3N2K B;  3HKC A;  3SYA A;  4Z1M G;  4B3R B;  1JMB A;  3RGU A;  5KTB A;  2OYQ A;  1QR8 A;  1P4R A;  4O2B B;  1JX9 A;  2AXC A;  1NYH A;  1R6K A;  3AEI A;  3QNE A;  1FPO A;  3ZCC A;  3JSV C;  2QKA A;  3RVY A;  2FYN C;  3K5B A;  1CZQ A;  1VP7 A;  3BVH A;  3MZW B;  1BCC H;  3UIA A;  3Q2Y A;  3FKS G;  3CX5 F;  1SQP H;  4QNH B;  3K5N A;  3CC7 V;  1ZRT D;  5CJ4 A;  2WZ7 A;  3OR7 C;  1JY2 P;  2Q6Q A;  3ETE A;  1YZB A;  1OCO B;  4LWS A;  1HJB A;  3WB0 A;  1VMG A;  2NRG A;  2XAS A;  3MDS A;  1TA8 A;  4CH4 A;  4JI2 B;  1OCR C;  5KAF E;  1DD3 A;  2KZI A;  2I1J A; 
#chains in the Genus database with same CATH homology
 1ORQ C;  1YJW V;  2EIL C;  3ASN C;  1SZT A;  4MVR A;  1VQL V;  1HWY A;  2HVJ C;  3AG1 C;  3SPC A;  4X89 A;  4PA7 A;  3CCR V;  1DTO A;  1JPX A;  3ASO B;  1GO3 F;  4RO2 A;  3OAA G;  5EC2 C;  1KEC A;  2WLK A;  1OCC B;  1OCR B;  1CPY A;  5E1A C;  1M90 W;  2W6J H;  3MHH C;  2EIL B;  4WFH A;  2HG5 C;  1AI7 A;  4RQF A;  1E1Q G;  2EIK C;  3CCM V;  2K1E A;  1K9M W;  1I5X A;  4MTX A;  3JD4 A;  2EJR A;  1GKF A;  3LSS A;  3CCJ V;  2P90 A;  1R3K C;  1VQM V;  1AI4 A;  1WPX A;  2AHY A;  2OCC C;  3JCZ A;  1BSH A;  1JOY A;  1GM9 A;  3CP1 A;  3AG4 B;  4JF3 A;  2HKO A;  1FXV A;  4JAS A;  5FL7 G;  3OMA B;  4I5S A;  4QE7 A;  3F7V C;  4ZBM A;  3ABK C;  1VQP V;  4BIZ A;  3TET A;  3W7U A;  2X7R B;  3FB6 C;  3UKM A;  5BZB A;  1K73 W;  3CME V;  4QPJ A;  4F4L A;  2Q6A A;  2WWW A;  3AG2 B;  5LHH A;  4EKW A;  1FXK B;  1SER A;  3AG3 C;  3ZRX A;  1K34 A;  1W2B U;  3K9A A;  1B6Q A;  4OXS A;  3SYC A;  2E5T A;  3E8H A;  2EIJ C;  5KUK A;  1E79 G;  1FS0 G;  3ZMS A;  3ZMV A;  3JYC A;  1DF5 A;  1K4C C;  5EBM C;  4L87 A;  1S77 D;  5IYD O;  3ML0 A;  2ZDI C;  1S72 V;  2LFR A;  4QJF B;  4MW8 A;  2EZO A;  1NBM G;  3E8G A;  1CEZ A;  4GX5 A;  2GHY A;  4P2Z A;  4X88 A;  2JJ2 G;  1AI6 A;  1S3J A;  4UVA A;  2Q69 A;  5L3E A;  3EFF K;  3OR6 C;  3CCS V;  1KQS U;  2DYR C;  2XAH A;  1ENV A;  1K5Q A;  1R3L C;  4DJG A;  2C2A A;  3ABU A;  2Z5U A;  3ZN1 A;  1M56 B;  2HLD G;  1Q7Y W;  4RQE A;  2YSU B;  1OHH G;  5IYC O;  2WLM A;  1YIJ V;  5HFL A;  1E79 H;  4JAU A;  3NXS A;  3ABM C;  1XL6 A;  3CMA V;  2WSS G;  4FMT A;  5B3S B;  1N8R W;  4FJC C;  2Y69 C;  2DYR B;  1H8E G;  2YEV B;  1BHA A;  1YJN V;  3ABT A;  2A0L A;  4KP4 A;  3ABL C;  4TT3 G;  2OTL V;  4UVC A;  2IH3 C;  1L1F A;  1BHB A;  4J9Y B;  4PDR A;  4PA4 A;  3STZ C;  4WFG A;  5H6Q A;  5HFM A;  5EK0 A;  3D3I A;  3M99 B;  2X6B A;  2WLI A;  1KP3 A;  1VQ6 V;  1BSN A;  3I56 V;  2Y69 B;  1GM7 A;  5LHI A;  2WLN A;  2WPD G;  1K4D C;  1E1R G;  3ABL B;  1F23 A;  2AHZ A;  4MSW C;  1VQO V;  2LFS A;  3W7X A;  2B1G A;  3FYE B;  4FPP A;  2IW5 A;  2HJF C;  3OGC C;  4RAI A;  3TK1 A;  4H37 A;  2EZP A;  4PDM A;  5L3D A;  2WLL B;  3ASO C;  1PNK A;  1F51 A;  3OMN B;  1PKX A;  4JPR A;  4UV8 A;  5CN0 A;  1NH2 B;  1OCC C;  3CPW U;  1JVM A;  4MS2 A;  4QE9 A;  3UM7 A;  3ETG A;  4LCU C;  2JEX A;  3IGA C;  1ROP A;  1AI5 A;  3H01 A;  3RBZ A;  1SES A;  1G4Y B;  4MTO A;  3B8M A;  3G4S V;  2X6A A;  3FYI B;  4RUE A;  2XAQ A;  3B8N A;  3IC7 A;  3CCE V;  5CBG A;  4MVU A;  1VQ7 V;  2HR3 A;  3E89 A;  2P6J A;  3AG4 C;  3VBB A;  4JGS A;  4P9O A;  1K3E A;  4X8A A;  3W7W A;  1R73 A;  1NR1 A;  3SJQ C;  5EBL C;  4WF9 V;  3K3W A;  1W0J G;  3ZRW B;  5KA6 A;  1FXK A;  1S0V A;  1RPO A;  2HVK C;  3DTU B;  1OZ0 A;  2ITC C;  3AG2 C;  1FXK C;  1DF4 A;  1ZWI C;  3LNM B;  2QKS A;  1NVP D;  4BW5 A;  1GK9 A;  1FS0 E;  4N23 A;  1QLE B;  2CK3 G;  2ZD9 A;  1JQ0 A;  2EIM C;  4HYO A;  4HZ3 A;  1QCE A;  4I9W A;  1NJI W;  4JAV A;  2PI5 A;  1KP2 A;  1SET A;  2OT5 A;  2JJ1 G;  2H8P C;  1JJ2 U;  2NLJ C;  4WFA V;  5L3C A;  1K5S A;  1PL0 A;  3P32 A;  4PA3 A;  2EBO A;  5IY5 B;  1BL8 A;  1K97 A;  1R3I C;  1AJQ A;  2DYS C;  2ZDI A;  1M56 C;  1RPR A;  1FFT B;  2V7Q G;  4UVB A;  4XDK A;  1NR7 A;  1K92 A;  2EIM B;  2XAJ A;  3IFX A;  5B1N A;  1MG1 A;  2CK3 H;  3ZMZ A;  2XND G;  4P30 A;  3HB3 B;  3WG7 C;  2XAF A;  3D36 A;  3OE7 G;  2YEV A;  5L3G A;  1AR1 B;  5B3S C;  3SYQ A;  2HFE C;  4PEL A;  3MHS C;  2DYS B;  3LDC A;  1IFP A;  3A0R A;  3CC4 V;  3FB5 C;  3T4D A;  4FK5 C;  2GSM B;  3G6E V;  3K03 A;  1AJN A;  1VQ8 V;  2DW4 A;  2ITD C;  2IU3 A;  2JDI G;  3WG7 B;  5GW7 A;  1F4N A;  2V7Q H;  2KB1 A;  3E83 A;  1V55 C;  5LHG A;  1GTO A;  1YJ9 V;  1J95 A;  1XL4 A;  3E8B A;  3RW0 A;  1H38 A;  5C93 A;  2IJK A;  2QM7 A;  4G28 B;  3CCL V;  4MVQ A;  4GX2 A;  3KG2 A;  3RVZ A;  2NNU A;  3OM3 B;  3GB7 C;  1SRY A;  3JD1 A;  2B1I A;  4RUF A;  2EIN C;  4TWK A;  5L3F A;  3K79 A;  3USS A;  1MOF A;  5L3B A;  4J9Z B;  1EBO A;  2WLL A;  2X6C A;  3OMI B;  4LBE C;  1V55 B;  1PNM A;  3OEE G;  2JDI H;  1QLN A;  3OUS A;  2QE7 G;  4JTD B;  4KFM A;  3SPG A;  3EHB B;  4E2L A;  1S76 D;  2ZR2 A;  4WVZ A;  2WSS H;  1NQT A;  4MW3 A;  2H94 A;  5KA5 A;  3SYO A;  2EIN B;  2Z3Y A;  3OEH G;  1VQK V;  3HPL C;  3QO8 A;  1Q82 W;  1LNQ A;  4R6Z A;  3E35 A;  1M57 C;  1NKD A;  3I55 V;  1ARO P;  5H9C A;  5IYB O;  3CCU V;  2DQ3 A;  2QTO A;  1FXH A;  2A9H A;  2IJH A;  1MAB G;  3F7Y C;  4GCZ A;  3R65 A;  3F5W C;  2A79 B;  4WFB V;  3JD3 A;  1UJW B;  3VOU A;  1QR9 A;  4PDL A;  2QEX V;  4MTF A;  1P7B A;  3ZJZ A;  5B1B B;  4LC1 A;  3W7S A;  3E2E A;  2QE7 H;  2X0L A;  4JTC B;  3ZRS A;  2E5Y A;  1AJP A;  4MTG A;  4XBF A;  3K0D A;  3STL C;  2M7W A;  3TCU A;  2R9R B;  1M57 B;  1EFR G;  3ZMU A;  4TSF G;  4XDL A;  5J9P C;  3ZRW A;  4MVM A;  3X2Q B;  3K08 A;  1K33 A;  4WFE A;  1V54 B;  5CBF A;  3W7T A;  4ZKI A;  3B77 A;  1H2G A;  1YTF D;  4JYC A;  5LGN A;  4Q20 A;  1TUE B;  3QO5 A;  2MK3 A;  2JIZ G;  2OTJ V;  1CP9 A;  3P30 A;  1F4M A;  1RM1 B;  4LP8 A;  2IJI A;  3G71 V;  4QIW F;  1QLE C;  2F43 G;  1W0K G;  1YIT V;  4G2K A;  4XDJ A;  1EZJ A;  2ZXW C;  4R7C A;  4U7O A;  5CBH A;  4UXN A;  1JCH A;  3LDE A;  1VQ9 V;  5EC1 C;  3SYP A;  1THZ A;  1QBZ A;  4KUM A;  1M9N A;  3MD0 A;  3SPJ A;  3ZRV A;  4CBC A;  4DXW A;  5LGT A;  4QPK A;  3K0G A;  4G27 B;  5DN6 G;  1NVP B;  1R6N A;  2UXN A;  4P9P A;  2R9I A;  2W0F C;  3ASN B;  4GT1 A;  1AQT A;  5IY5 C;  2QA4 V;  4MT8 A;  1QVF U;  4UV9 A;  4FIP C;  2IU0 A;  3AG1 B;  1Y66 A;  5LGU A;  4JYB A;  1KC8 W;  3E86 A;  2D3O W;  2ZXW B;  3E8F A;  5IDJ A;  1MSW D;  2Q68 A;  4JTA B;  4PA6 A;  2ZQM A;  4GX0 A;  2UXX A;  5CMU A;  3GWO A;  2XAG A;  2EIK B;  2WAM A;  1K8A W;  4N21 A;  5DM6 V;  1OCZ C;  1QVG U;  1JEK A;  4U7N A;  3ZIA G;  4HAM A;  4BIU A;  4QMA A;  2OCC B;  1R3J C;  5H6R A;  3BEH A;  3FB7 C;  2DQ0 A;  2Y48 A;  3CCQ V;  3CD6 V;  1VQ5 V;  3LSQ A;  4H33 A;  3ABK B;  1YI2 V;  2IH1 C;  2W6I G;  3OUF A;  1OCZ B;  3SPH A;  4CZZ A;  2BOC C;  3PJS K;  3ZN0 A;  3OW2 U;  4GX1 A;  3LDD A;  1YHQ V;  1GM8 A;  2DWD C;  2XND H;  2DWE C;  1YSC A;  3AG3 B;  2ZR3 A;  1PD3 A;  2PI4 A;  4TLF A;  2XOK G;  4WCE V;  2WLJ A;  3T1C A;  3K04 A;  2BOB C;  2EIJ B;  4MVO A;  4R50 A;  3T4Z A;  2FTK A;  3BY6 A;  3WFV A;  1GMG A;  2P7T C;  5LBQ A;  5EBW C;  3JD2 A;  2P67 A;  2JEU A;  4PDV A;  4MVS A;  5B1A C;  3FB8 C;  1Q86 W;  1I5Y A;  3OFN G;  5KUM A;  3SPI A;  2V1D A;  1BMF G;  4UUJ C;  1DLB A;  5B1B C;  3CC2 V;  2Q67 A;  3ZMT A;  2IJJ A;  1H8H G;  2JK5 C;  1COW G;  3DGE A;  4PA9 A;  3CCV V;  1IXM A;  2B5U A;  5B1A B;  1VQN V;  1WLE A;  3T2M A;  1Y4M A;  3ABM B;  4MVZ A;  3X2Q C;  1M1K W;  3SYA A;  1V54 C;  4Z1M G;  1OCO C;  1K7D A;  1S5H C;  1QR8 A;  1P4R A;  3LUT B;  1Q81 W;  1JX9 A;  4YXW G;  2LP7 A;  1R6K A;  3AEI A;  3QNE A;  3CXC U;  3ZCC A;  1G8M A;  1PNL A;  3JD0 A;  3ETD A;  4R8C A;  3RVY A;  1KD1 W;  4ASU G;  3FKS G;  3K06 A;  1VQ4 V;  5CA3 A;  4QNH B;  3QO7 A;  1RM1 C;  2ATK C;  3CC7 V;  3OR7 C;  4BAY A;  3ETE A;  1OCO B;  4WFF A;  5B1O A;  2XAS A;  2WLH A;  3CYO A;  1KKD A;  1NH2 D;  2W6J G;  1YTF B;  4YXW H;  2WLI B;  1OCR C;  2QM8 A;  4DO2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...