3EFFK

The crystal structure of full-length kcsa in its closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords FAB
total genus 43
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3effK02
3FB5C 2XNDH 2A9HA 4DXWA 1OCRC 5KUKA 1XL4A 2EINC 2EIJC 3SYPA 2YEVA 4PA9A 2WLIA 4P30A 4DJGA 4GX5A 2QKSA 3SPHA 4P9OA 1S5HC 1P7BA 2QTOA 4PDMA 4P9PA 2WLLA 1K4DC 2HG5C 1K4CC 4TWKA 1BSHA 2P7TC 3EFFK 4MVZA 4EKWA 2WLKA 3K03A 2ITDC 2HVKC 1J95A 2IH1C 3E8HA 4RO2A 4X8AA 4MVOA 5EC2C 3IFXA 1E79H 3LDEA 3HPLC 2ITCC 3STZC 2W6JH 2AHZA 4R8CA 1FS0E 3K06A 2WLMA 3T2MA 2X6AA 2EIKC 2A79B 4PDRA 2HJFC 1OCOC 3SPJA 3TCUA 4QE7A 3E8FA 2OCCC 4J9ZB 5B1AC 4PDVA 1AQTA 3AG2C 3ZRSA 1G4YB 1OCCC 3K04A 3AG1C 4LCUC 5CBGA 3KG2A 3UKMA 3SYOA 4LBEC 4P2ZA 5EK0A 3K0DA 1QLEC 3F5WC 4PA7A 5B1BC 3AG4C 1KKDA 4HYOA 3OR7C 4QE9A 4MVRA 3E89A 3FB7C 2Y69C 5B3SC 4WFFA 1ZWIC 2BOCC 4RUFA 4XDKA 3T4ZA 4R50A 2H8PC 3X2QC 4WFEA 3E83A 4MW8A 4PDLA 3LNMB 4XDLA 2WLHA 3PJSK 4WFGA 2WLJA 4R7CA 2QE7H 1OCZC 4R6ZA 2ZD9A 4RUEA 4GX1A 4HZ3A 3T4DA 3SPCA 3UM7A 3ABKC 4LP8A 4UUJC 3VOUA 4J9YB 1M57C 2R9RB 3TETA 4G27B 2DYSC 2Q69A 4MSWC 1V54C 4PA3A 2A0LA 3E86A 4MTOA 5IY5C 2E5TA 2WLIB 4ZBMA 3E8GA 4MVMA 2HVJC 2X6BA 4PA4A 4PA6A 1R3IC 3OR6C 4QNHB 3GB7C 3ASNC 2Q67A 2DWEC 2DYRC 2W0FC 4KFMA 4H37A 2IH3C 3RW0A 3RVZA 2WSSH 4MW3A 3K08A 4F4LA 4MVSA 3JYCA 4JTDB 4MS2A 5EBLC 1R3JC 2AHYA 2X6CA 4GX0A 5EBMC 3T1CA 2BOBC 4H33A 3ZJZA 1JVMA 3LUTB 5EC1C 4BW5A 4QMAA 1R3KC 3FB6C 3F7YC 4I9WA 2Q6AA 4JTAB 3LDDA 3SPGA 3STLC 1XL6A 4CBCA 4MTFA 4OXSA 2JK5C 2Q68A 1V55C 4JTCB 2K1EA 3OUFA 4X88A 3RVYA 4MVQA 3SYCA 4TLFA 2EILC 3E8BA 2CK3H 3SYAA 3ABLC 3LDCA 3ASOC 3USSA 3K0GA 3R65A 3SJQC 3OGCC 2EIMC 3OUSA 2DWDC 3FB8C 3BEHA 3RBZA 1R3LC 1M56C 3WG7C 2ZXWC 2WLNA 3ABMC 3SPIA 4XDJA 3SYQA 5CBHA 2HFEC 4G28B 5E1AC 5J9PC 2E5YA 4WVZA 2WLLB 3AG3C 1ORQC 5EBWC 1IFPA 2KB1A 5BZBA 5CBFA 4X89A 5KUMA 1BL8A 4RAIA 2ATKC 1LNQA 4WFHA 4MTGA 1BSNA 3F7VC 3IGAC 4GX2A 2V7QH 4YXWH 4MVUA 2NLJC 2JDIH 1JEKA
chains in the Genus database with same CATH superfamily
1VQ7V 5E79Z 3L74E 1JA8A 1Y9BA 2R44A 3JD0A 1HWTC 2PI4A 4J80A 3ZN0A 4CS2A 2UXCO 2N9YB 2BCCJ 2QJKC 4YJ3B 3KHUA 1T5EA 1WJZA 4C7UA 2E74D 2OYIB 1M9NA 2ZINA 3HKDA 1FJKA 3H32A 2YSUB 2ZFCA 4N3YB 3H1KH 4Z1MH 4AILC 2IH1C 3E8HA 4DV0O 1IK9A 2A7WA 3HB3B 3KZIZ 2ZXEB 3OTFA 3O65A 1L0NK 3KXDA 3B8EB 4U3FJ 2ITCC 2QWQB 5LXTA 3OMNB 4JF7A 5J2TB 2HJFC 5KKZB 1FZCA 4DW0A 1VQNV 3AEFC 3KKYA 5BR8O 3V4WA 1RPRA 4B7KA 4WBAA 3A0HH 2E74B 2QA4P 2ZAEB 3RL0g 3Q3DA 4HYOA 2M8RA 5AW1B 1SQXH 4MVRA 4DR6O 4H0LD 1L0NH 2Q0AA 1LT9B 4CH6A 5IJ0B 3G67A 3X2QC 3TGUJ 3Q5PA 3K5LA 5KLVE 3E83A 1WB7A 4DR7B 3R2PA 3D36A 4FIPC 3T1HO 4GDOA 4RUEA 3TGUH 4XA4A 1EDKA 4DV4B 1DF5A 1JTHA 1AROP 1M93A 2XTAA 1YI2V 4C7RA 1YTZI 2FYNB 3SJBC 1NTZH 1ZMEC 5BU8B 1NZ6A 3M0DA 2M7WA 3EHBB 3E8GA 1L4AB 4F6EA 4FFBA 1OV9A 1SZXA 3WUTA 4H37A 3MZWB 1J1DB 2E76C 3CCQV 3HTKB 3TDKA 3WUVA 1NU1G 1EXIA 2G3AA 3L35A 1IO4A 2ZVOB 2H94A 4H33A 2VQFB 1IFMA 2VQEB 5JVDB 3STLC 1YJ9V 4FK5C 1NTZK 3ZS8C 2A3QA 4DR6B 1SFCA 3HR0A 4OXSA 1HGVA 3CS5A 1CPYA 1KC8Q 3ZRWA 3CHXA 1D5AA 3SJQC 2DWDC 3BEHA 1EZVD 3A0BE 2W6JG 5KHJA 1AI4A 3JASA 3P30A 3L37A 1K8AQ 1YQ4C 3CWBJ 1TVKA 5BZBA 1V55B 1IBKO 2N9BA 4AYCA 1LTTC 2LW1A 3JD2A 4LR3A 4BIUA 4B86A 5DN6G 1J1EB 2F43G 4E4EA 2AXTZ 1NU1K 1NT2B 2ZXWB 4X1YB 1OCRC 4GKKO 3QG5A 1PP9H 4J7JA 1M57D 5AVXB 2BCCG 1AILA 2KSJA 3H1IE 1COWG 4X64O 2W83C 2WLIA 1GK4A 2OWOA 1OHHG 3JASB 1NTZD 5APUA 3JATB 2FFDA 4WCEV 4ZOLB 3EFFK 2G38A 2OIEA 4X1IB 1JMMA 1HGZA 3TNUB 4FZ0A 2FYUJ 2GDSA 3VN0A 5EC2C 3D3IA 3K58A 3JALB 1FS0E 3M06A 3ABVC 1SC5B 4O2BB 5GTIH 4DRXA 3B5NB 3H1LG 4W7YA 1UFIA 4X1YA 4OPAA 2FFDC 3CCEP 1PM9A 1VQOP 4UCRA 5B1AC 3ZHRA 1TA8A 4NR1A 1KILB 2NPSB 3H1JG 2I1JA 3UO3A 2YIUC 2YXQB 4EI2A 4QPJA 1N7LA 3AG1C 4OX9O 3MP7B 1KB9E 3K0DA 1LUWA 4UB8Z 2ZIMA 1BS3A 1R73A 2RMKB 2PY5A 1AJYA 2RDCA 1PNLA 2XUMA 3TYYA 1DD3A 4R6ZA 2UUCO 3A5TA 4NTWA 4RQFA 1SZTA 3A0BZ 1FXVA 4UCSA 5EYPA 1BGYG 4HJGH 4GT1A 2P4VA 2RN9A 2YKQA 4U7JA 1Y47A 4WBNA 3A0HZ 2Q69A 1T2KD 3WFVA 1KQGB 1H88A 4ABMA 3TXQA 2R9AA 2E5LO 4DV5O 4JI5O 3CCLV 1SFCC 4B3TO 4EFEA 1M90Q 1GN3A 4TT3H 3RVZA 1IK7A 2GUZA 2YIAA 3N4XA 2JP3A 1JO5A 1OCZB 3LIDA 5JJEB 2Q0OC 1GM8A 3W67A 1L0NJ 3CCRV 1GL2B 1NKZB 1S72P 5DEDA 4DUYB 1W59A 2HODB 5KLVG 1MSWD 3D3QA 1VF5C 1Q43A 4JI6O 3NMDA 3AE9C 5JQGA 3USSA 4O4LA 2UUCB 4NTYA 3I56P 1H2MA 1QL2A 2OYIA 4WBNB 3VP8A 1O9HA 2J59M 3Q2YA 5KAFZ 4DK1A 4WFAV 1N33O 1DGSA 3CXCU 5B5EZ 4JZ2A 4LFCB 4JPZB 1E1QG 2K3RA 1XQ8A 3MHVA 1G8MA 5AVSB 2CUGA 2XAHA 2YXHA 2Q9LA 2V4DA 5AW9B 4L73A 4MT8A 1SQVE 2QIWA 3BCCE 4NXNO 4MVUA 3ETQA 5LMUO 1U7MA 5H9CA 2M0BA 2BCCH 1YJWV 1H0TB 3Q4HA 2Y0CA 1L0LD 2MK3A 3RT3C 1S1CX 3APOA 4DV3B 4GX5A 2BASA 4WY4C 4DW1A 4OGQB 5AVUB 2G8YA 4PDMA 4FM1A 4PD4D 2QTSA 4FJCC 1BDCA 2WLLA 5JH7A 1OW8A 1BSHA 3SGIA 4I50A 4JI4B 4A7PA 4TV9A 2EILB 3JALA 4X8AA 2Y0IA 4W80A 2Y0EA 1KYOE 1E79H 1M90W 1NHLA 3STZC 3HPLC 1QLNA 1PP9J 3CCQP 1JCDA 1K7DA 3H1HH 1IBLO 4CH3A 3ZEDA 2HR3A 2Z5IA 3ZMUA 1AB3A 2GBOA 1IFIA 1H38A 1N7SD 1SQBJ 5KHIA 2UXCB 2QJKB 1T2KC 2ZT9D 3CCUP 2CH7B 3SFDC 2WPSA 1TVKB 2GV9A 4IIJB 5H6RA 5A9GA 3GMAA 4XBFA 2LFSA 4B3MO 1YVWA 2ZDIA 3MHSC 3G4SV 1RF0C 4DV2B 4LF4O 3EQ2A 1X59A 2Z5UA 2UXBO 2WPQA 2WSSG 4LFAB 2Q7HA 3AEEC 3AG7A 4GX1A 1LWUA 1SS1A 4DUYO 2JGDA 1L0LE 2AZ0A 4D6TE 1AR4A 3U10A 1KN7A 1QHTA 1YI2P 3RK3C 4UFZA 1G1JA 1N8RQ 2BCCD 2LP7A 2VWKA 3HE4A 5CCGA 3TGUG 1S5LE 5LGNA 4KXRA 1N33B 3CC7P 4RO0A 1Q90D 5BXZA 1BCCH 4JI3B 2P4KA 5B1NA 4EB6A 2AHYA 3CWBG 1VQMP 3RN4A 1VQ5V 4QMAA 4JI0O 4PJ0H 1VL2A 3QF7A 3OD4A 1HNWO 1JOYA 1USEA 2R3SA 3ZMTA 1RPOA 5GTHH 2CDYA 1TUBB 1GAXA 4JBZA 4HNAB 1F23A 3LSSA 4TLFA 3D6YA 2IW5A 1LP1B 3IJ4A 1GTWA 1EZVH 1AI6A 4JPRA 2CGNA 1N2DC 3ZMVA 4G28B 5AW6B 3BHPA 4L8JA 1MV8A 4BWAA 2OTJP 1CW5A 4LWSA 2ZJSE 1I0HA 3L74H 2GHYA 3L74D 3G3ZA 5IYZA 2P5OA 3QO8A 1FFTB 2C2AA 2DYRB 3F7VC 1IZNB 1SKVA 1OWAA 2Z5HA 4BRYB 2V7QH 1URFA 2XAFA 3H01A 2N74A 2LQTA 2Y48A 1KD1W 2A9HA 3RFRA 3HKCA 1N86A 3JCUE 4DR7O 5LGTA 3QH9A 4FZ1A 2XNDG 1SQVH 4LC1A 3TK1A 4FFKA 1PIXA 1P7BA 5J2UA 3H32B 4UV8A 5EZYA 3CCJP 2BCCE 3H1IG 1K97A 1BQZA 3HE4B 3G6BA 2LKMA 1Q2NA 4HAMA 3JD3A 4JYBA 1PL5A 1URQB 3L73H 1F7YA 4K3AA 1BMFG 3T1YO 2ADPA 3LDEA 4JI7O 4KHPO 3L75H 2L6LA 5KMGB 2GM4A 2WSCH 2XT9A 5AW3B 2WT7A 1FD9A 1FZBA 2VS0A 2EIJB 4BR6A 3ZRSA 1CI6A 1FJPA 3L71D 1Q82Q 4DV6B 3AE2C 1NTKD 4HNAA 2I8DA 1NTMK 1S5LH 3DC5A 3F5WC 1I08A 4GOFA 1B6QA 2CTWA 1Q6UA 3JAMN 4IIJA 1U7JA 2AEFA 2FYUG 3C8VA 3H1JD 2KSEA 1NKNA 2OQQA 1S9KE 3G6EV 3CD6P 4KT0J 1BE3G 1SQVJ 5TISZ 2H3OA 3RK3E 2E74C 3CC2P 3T4DA 2B89A 3HKEB 3CX5F 1ZV8A 2F93B 4FMTA 1FJGB 5C8YA 2HHHO 2R9RB 1N32O 1P84F 4L75A 1EDIA 3FX7A 4QGPA 1VQLV 5CB4B 1VF7A 3BCCG 3OR6C 1ZOYC 2RJZA 4UVAA 5IYBO 4WF9V 1M5IA 5D5QA 3GG2A 2Q7GA 3OMAB 4JAVA 1RP3B 4DYLA 1L0LJ 1SLQA 5AVWB 3U0ZA 2QM8A 3CCVP 2C0WA 4H13C 1DLBA 4MVSA 4HYTB 1KQSU 1FZGA 1AR1B 5EBLC 1R3JC 2RMZA 2D2CB 2WTYA 3LUTB 5CMUA 3L70E 2YIDA 1S5LZ 2BSKA 5KAIZ 4OH8B 3MHHC 1S76D 1XMQO 3AE1C 3V2RA 2K9YA 1ROPA 1QL1A 1S72V 2IJHA 3P3NA 5KMGA 4WY4A 2QGNA 1BCCJ 1XREA 3K0GA 2Z3YA 3JAKB 1GN2A 1W2BO 5AVVB 1H2NA 1FU1A 1M57B 4ZI7B 2RKLA 3WMM0 2OT5A 4HH2A 5B66E 2V7QG 5J2UB 1S9KD 1IDSA 1PNMA 2Z0AA 4O9BA 2ZNJA 1Q7YQ 5JCOC 1TUBA 1NO4A 3LIEA 2Y9ZA 1KQSO 4DUZO 3CXHE 2A45G 3SYPA 1GK6A 3N2GB 4P30A 2IBZH 3NXSA 1EFRG 3BFRA 2Y0DA 1YYCA 3II6A 4JI2B 3FD9A 3L36A 3JAKA 1SQPE 2YNYA 3CC4P 4EEQA 3OE7G 1NYHA 1OZHA 3GLMA 3B40A 4UCOA 3ABUA 2MKVA 3H1LD 2VRZA 1BDDA 3TCUA 3IN6A 3RBXA 4PDVA 4XFJA 2WMMA 4OWFA 4FLVA 4KHXA 5EK0A 1LGHB 3AG4C 2PP6A 3OR7C 1ZUQA 4I0XA 5B3SC 1ZL8A 2IJJA 1ZWIC 1ZTEA 4GKJO 1UIXA 2PFXA 5APXA 1JY3O 3A7OA 3M0DC 4BRYA 2JEXA 3PJSK 2C9NY 2GUZB 2D2CC 3G4SP 3IC7A 5KA6A 1LTIC 1LUVA 1FZFA 2YKOA 4UXNA 2XNXA 4UUJC 1YCIA 1JPXA 5B5EE 2N1TD 3H1HD 1SS3A 4F6RA 2CH7A 3OFNG 1S3JA 3MUDA 4MSWC 3EWKA 4NTXA 2MW2B 4U3FG 2ZE6A 1FS0G 4CC6A 3IAOA 3M0AA 1XOUA 3ASNC 5L3DA 3JATA 2W0FC 3VYIA 4O4JA 2WSSH 1S5JA 1K9MW 2ARHA 1DEEG 1KP3A 5BR8B 3EXAA 2NNUA 5JCOA 1ZRTE 1NTZJ 2OYHA 4I9WA 4IHJA 2IZ0A 1DX7A 1FAVA 1FZCC 1Q6HA 3OJAB 2B87B 1YTZT 1KECA 4UB6Z 2Q68A 4N6JA 1V55C 3AK2A 5CA1A 3K57A 1WP8A 1SQXK 3ASOC 1KILA 2NPSA 4U7NA 1I94O 3T1HB 4F6RB 2I1KA 1OMIA 4TV9B 1M56C 2WITA 1Q81Q 2P7JA 5B1BB 1BE3H 3K9SA 2E5YA 4K35A 4H13D 2WLLB 3AEIA 4YY3B 1WB8A 2QM4A 2QDOA 3BABA 1N8RW 3BPZA 3T97B 3HUSC 5AVQB 1YBKA 3SJCC 2RCVA 2B87A 2EIKB 4N21A 4B7EA 2W6IG 5KUKA 5IY5B 1EN5A 4LH7A 1D7MA 4D6TD 1F51A 1YJNV 1M1JA 1FKAO 3SPHA 4I4TA 4LWSB 1QVFU 1KYOD 1K5SA 2V7QJ 1PV0A 1K4CC 5FL7G 2O01H 3GW6A 4FLTA 1NU1E 4EKWA 2UUAO 2ITDC 2Q6QA 3L72H 3OEEG 2CTRA 4TV8B 3CPWU 2QEXV 2DQ3A 2P1JA 1HTLC 4ZKIA 2YXRB 3P7KA 5H5NA 3CCEV 1JTHB 5KTBA 2XAGA 4TT3G 3H1KE 5IJ9A 3SPJA 5LBQA 2AGAA 3E8FA 1NTZE 2FYUD 1SF9A 3FFQA 1AQTA 1Y76A 4D6TG 2N1TC 2R72A 3L71H 1ZP0C 3ZRXA 3SYOA 1KFNA 5B1BC 4B3SB 2Q8VA 3KCYA 1GW4A 3CXHI 5TISE 3Q5SA 3M7MX 4KUMA 4RUFA 5AW4B 2PUSA 1KB9F 5LOVA 2N1TA 4YXWH 4X64B 2AXTE 2JGUA 2R70A 5LYJB 4LF8O 3UM7A 5J2TA 2EZPA 4H44B 1FZCB 1NR1A 3CB2A 3J7AU 1JB0J 1MZ9A 4DR3O 1AP5A 4C7NA 3E86A 4PV1D 2YC0A 1RQUA 3A0BH 4MVMA 5IYCO 4UV9A 3CWBH 1BGYD 1T3JA 2A06E 5TJHA 4O4IB 2DYRC 3ASNB 3DXRA 1YF2A 3H1JH 4KFMA 4RJTA 4UB6E 1BSMA 1VQKV 4XE5B 4NKGB 2PF4E 3PHLA 1OZ0A 4GX0A 5DECA 1OVRA 4TUYB 1JX9A 1MZEA 5IE9A 4JTAB 4PD4I 2KLUA 3PRJA 2PZSA 4Q20A 2D3OW 1FJGO 1SRYA 4CBCA 4PHZA 4YTPC 2W27A 1QBZA 1QVFO 3T97A 2CTQA 2XHBA 4LF9O 1IBMO 4MVQA 1NH2D 1JY2N 4A5UB 2QWRB 3AEDC 3JSVC 2RNBA 3OUSA 5FLXN 2QWNB 4IFDK 1R3LC 2BEQD 4LF5B 3L75G 1PP9G 3ABMC 1SQQJ 1VF5D 4X1IA 3TNUA 2E42A 5LP6A 1SQVK 3B71A 2FFDB 5LXTB 5H2FH 1Q7YW 1H2SB 1AP6A 3BRVB 3CX5H 3VOPA 4WFHA 3L74J 3M9QA 4J10A 1VQ7P 3P3PA 2L35A 2HLDG 2F4VB 1JUNA 1YJWP 4B3TB 2EBOA 4ZKUA 5LP6C 2N05A 1SQPG 3TGUD 3G9RA 2OIGA 4ASWA 3RWRD 2OTLV 1N73A 1N34O 2M5AA 2JS5A 1VQPP 3APQA 3L73E 4C7NB 2F23A 4O4JB 4AI8A 1FOSF 3TXSA 1NTMG 5DJTB 2ADQB 4JI5B 1EZVE 1NTMH 4LF9B 2HVKC 4MVOA 2EINB 1RY3A 4LNUB 5CJ0A 2OTKE 2W6JH 3CSXA 2CTPA 4JI8B 3T2MA 2X6AA 1K9MQ 3K5BA 5CJ4A 2FL4A 1SFCB 3L72E 1IC2A 2NRGA 3G71V 1BGYE 1NJIQ 2WA3A 3BY6A 1RF1A 4I55B 3FKSG 1X4TA 3ZCCA 1KKDA 5AW5B 5DJUB 5CCGC 3E2EA 2WSFJ 4LF5O 3ZIAG 4N78D 1SQFA 5E79E 2E76B 1MNGA 2B5UA 1IFNA 2V4HA 2P6JA 3M99B 2M3EA 3PH0A 4TV8A 3HTKA 1VP7A 1ZLZA 4HZ3A 2K9PA 2GTSA 2LW7A 3B8MA 5B66Z 1J1DC 1QX8A 5FPOA 2P06A 2KI7B 1DF4A 2QM7A 1GK9A 3W7UA 1V54C 1YTFB 2E5TA 2UU9O 3FGAD 3ZHUA 1IXBA 4JZGA 3SWYA 2EIMB 3CXHF 1JM0A 4I7ZB 1SQQH 3ICXA 5APSA 3MTUE 1L1FA 1GM7A 3CX5E 1YJNP 4DV1O 2PGGA 1JY3P 3CE2A 4MS2A 1NQTA 5JJJB 3CC7V 1MFZA 4IT5A 2ZE5A 1P84E 1JVMA 4Z1VA 1SERA 3DTUB 1N7SB 3WG7B 3LDDA 2ZKOA 5IJ9B 5GTHZ 5HFMA 2HLOA 1T6AA 3TF5A 3CWBD 3J81N 1SQQK 3SYAA 1L4AA 4X20A 4JI3O 1JQ0A 3V5BA 3NFQA 3ABKB 2WSCJ 3ETDA 3C1LA 5KLVD 1SQPK 4CZZA 3QVNA 5EBWC 1HR0B 4DZOA 1KMIZ 1Q6IA 2KB1A 4IHJB 3CXHH 4B3MB 2ZE7A 1VQ4P 2Q9IA 3HKDB 3OMIB 3H1KD 2VRSA 3IGAC 1Y6XA 4PJ0Z 2JEEA 3AE5C 3PN1A 3S9OA 1QLEB 3BATA 1KORA 2KIKA 3A3YB 1JEKA 3FB5C 1USDA 2JKVA 3I5CA 3RYCB 4DR4B 1Q8IA 2ZE8A 2HHHB 2UXXA 1L0LK 3ABTA 2GUVA 3FWLA 3BA9A 2B9BA 2QG4A 1SQPH 5F2VO 2AEMA 5FNVB 4DJGA 2N04A 1X79B 5AW0B 4TQFA 2QTOA 2JJLA 2WSEJ 4JAAA 1QR9A 3AG3B 5LMNO 5L3CA 1XTCC 4EYYQ 4ZKPA 2ILMA 3ZHVA 4GKGA 1IX9A 4YHHB 2UUBB 3VMZA 3H1LH 4X9QA 3RYCA 5IYDO 3L70D 1N7SA 1AQ5A 1H2GA 3KDPB 4IL6H 2CK3G 3HUSA 2HFED 2IBZD 3G80A 1XHXA 1FFXB 3K04A 1VPCA 2IZ1A 1GU4A 2JR8A 5KLVH 3ABLB 4O4HB 2DE0X 4PA7A 1RE4C 2DQ0A 4QE9A 3VQXA 3E89A 2Y69C 2HPCA 3U11A 4XDKA 1UJWB 2GTAA 3CJHB 4FFBB 2PTMA 3MDSA 1YITV 1OJHA 4PDLA 3G6EP 1WP7A 4R7CA 3ZX6A 2QE7H 3GVMA 4J42A 4D6TJ 3LSQA 4JASA 3JSNA 4AUWA 5C8YB 1M57C 3C3SA 2FKWB 2FXOA 2L5GB 3LNNA 1HNXB 5LMNB 3E22B 3RK3D 1R6KA 4JYYA 1SETA 4PA3A 1L4AC 5APTA 2K9JB 3CMAV 4PA4A 5IJ0A 1G1IA 1SVFA 2Q67A 1A32A 5EZYB 1VQLP 2QRXA 1FBMA 1LTAC 1LTGC 1VF5B 3RW0A 5AW7B 1H89A 1HDJA 1L0NE 1FPOA 4MW3A 1SQQG 4N23A 4TSFG 3ZJZA 4CH5A 3FXDA 2BOBC 1JJ2U 3GF7A 5EC1C 4X1KB 4LF8B 2KNCA 4I9QA 4DR2O 1YHQV 3RYHA 1IJDB 3PLNA 4LGDE 2H8PD 4DR4O 1BE3E 5B5EH 1DTOA 2EILC 1SQPJ 3Q1MA 1HWYA 2R5DA 2A45I 4YPCA 3MUDC 2VQEO 2RQ6A 1R5SA 5J9PC 5CBHA 1BE3D 3K79A 4XDJA 3MIWA 1M8OB 5KX5B 1HNXO 5CA0A 3D8CA 4PV1B 2B9ZA 3D36C 1EDJA 2ATKC 3M9HA 3H1LE 3WB1A 1GMJA 1BSNA 4D7TA 2Q1KA 1TUEB 2WWWA 2HODA 4DV0B 2IFNA 2QJYB 3RL0D 3K5OA 4GIFA 5APQA 1NVPD 2FYNC 3WU2Z 2H89C 3AE6C 2BEZF 2KG7A 1K04A 1JMKC 5K5GB 2WSFH 1GL2D 4NPEA 4Z1MG 1KILC 2NPSC 2WLKA 3AEGC 1K34A 1K73W 4RO2A 2E76D 3CXHD 1HBWA 5IDJA 1FDMA 1BCCD 2AHZA 3CJHA 4J41A 2OARA 4IGGA 1NVPB 3B5NC 4U7OA 3L70J 1PD3A 5CBOA 2KXPB 2FYUK 1PNKA 1XBLA 1H0TA 1OCCC 2KQXA 4B3RO 1GH6A 4LCUC 1SQPD 2CAZC 1CI6B 1EC5A 4B08A 2CGOA 1N73C 4O4IA 1BE3J 5LP6B 1XMOO 3T4ZA 1P4RA 3K9AA 2YI8A 1LTJA 3IC9A 1QGKB 3HE5A 1NU1H 4MW8A 2XKMA 3VMYA 2KUBA 4L76A 4PELA 3NTNA 1ENVA 3GHGA 1L2PA 3IFMA 4YIPA 2ODMA 2LXCB 3N7NA 2LJ2A 1Z56A 2A06H 3CWBE 3IAYA 4JI2O 3HD7D 5GTIE 4ASVA 3UT5B 2E3CA 1ZAUA 1P7GA 1W2BU 4JYAB 1BQ0A 2P90A 3D70A 2OGUA 2WPRA 3ZRWB 2VQFO 2KSDA 1N36B 2QJ1A 4TQDA 5CN0A 1OIPA 1X9VA 2H88C 4W4LA 2H43A 2P10A 1U96A 4NB5A 3CEIA 3CL3D 3L71E 4ZOLA 2F4VO 1EXJA 1SESA 2XAQA 1KB9H 4BWNA 1JR9A 2AZ2A 1FZEA 5JWPA 3W7SA 1GO3F 3K08A 4JYCA 1U57A 2POHA 1NWQA 3QO5A 4NXMO 2ZCEA 2AXTH 4R4MA 2Z4EA 1VF6C 1KILD 4BIOA 2NPSD 4I5SA 5GW7A 2W90A 5LA6A 1SQGA 3JARA 5KLVJ 1P49A 1S4XA 2FYUE 4X20B 2QKAA 1M1JC 4FLUA 3OGCC 2B1GA 4H44C 3K59A 3OTOO 4O2AB 3I55V 3SYQA 2DW4A 1OW6A 1HUCA 1FXKA 3H1JE 2HG5D 1XNQO 1GL2A 1I5XA 4X89A 1YTFD 2UXNA 3L73D 5LOVB 2N1TB 2H7HA 3SWKA 2XDJA 3CX5D 1SQBH 2WPDG 4EB6B 3JC22 1N7SC 3RYIA 2P2UA 3Q5RA 3CLQA 4U3FE 4HKZH 2EZOA 3RYIB 3ABMB 4GZRB 3RGBA 3GWKC 3OA7A 4LF6O 4YJ2B 1PV3A 2YEVA 1PPJH 5CA3A 4K8ZA 5KAIE 4U3JA 2Q7CA 1S5HC 4YXWG 1PZQA 1RSOA 4WB4A 5BY1A 4P9PA 3FYIB 2IPPA 2E5LB 2QVAA 1S2EA 1YIJP 1NTKE 2EJ7A 3CMAP 1KYOI 3UO2A 1NOHA 2UU9B 2OYOA 1XILA 3CCLP 4DR1O 2E75D 1I94B 4OVNF 1UIIA 4N78E 5EYPB 1PP9D 1WN7A 4PDRA 3H1JJ 2OCCC 2KS1A 1TAEA 2YMKA 2K1AA 2RH0A 3L73J 3O6QB 3RK3B 2EJRA 1JY2O 1D5NA 1KU9A 1AJPA 4X65B 3WB0A 1ZX3A 2HEPA 2FKXA 3OTOB 3BCCJ 3A0HE 1JNMA 2WLHA 1NTME 2WLJA 1I5YA 1OCZC 2UXDO 2KYVA 4YHHO 3M9BA 4NXMB 1SQXE 4DO2A 1WT6A 1V9PA 3DGEA 1US6A 1NAYA 2W0XA 4C46A 3ZBHA 5CCGD 5CCHD 1SQQE 2JIZG 1Y74B 1R5LA 1J5EO 2X7RB 4I4TB 3X2QB 2PGDA 3AG1B 2R5BA 3TGUE 1YIJV 1M1JB 1N34B 4RKUJ 3SSUA 3CRAA 3C3TA 2E43A 2P67A 3ETGA 2ZVNB 5CMZA 3AECC 1EN6A 3BRCA 3GHGB 1B06A 4R4LA 5E79H 1VARA 3T1CA 1H8HG 4U3FD 1R3KC 5LA6B 3SPGA 1WMKA 5L3BA 1SQXJ 2V1DA 2AXCA 5B1AB 4UVBA 1N32B 1OCOB 4IL6Z 3RVYA 2WSEH 3B5ND 1NAFA 4O4LB 4CS4A 3CD6V 4LF7O 2AW9A 1QVGU 2KK7A 4HBNA 3FB8C 3RBZA 4TOIA 3CRQA 1VQNP 2W6BA 1LTJB 3CC2V 2HFEC 1D2DA 1NJIW 3PTZA 3CCMP 2IU3A 4DV1B 5IWAB 3CCUV 3ZDMA 3SR2C 2LGWA 3HD7A 3UT5A 4UCTA 2A06G 4GX2A 3A0RA 1WNSA 1R6TA 1P84H 2NLJC 2Q4PA 1HP8A 3H9VA 1JCCA 2XNDH 2LFRA 4DCKA 1GZLA 4UB8E 1MFTA 3UQ8A 2LXBA 5AW2B 2QKSA 1FZAA 1NVOA 5M1BA 3P8MC 2KZJA 1G1XB 4IFMA 1K4DC 2HG5C 2M3BA 4X62B 1N0NA 1ZSPA 3CCRP 1F4MA 5H6QA 3K03A 3S3WA 2MJZA 3E1IA 5EIBD 1OFCX 4IL6E 3IFXA 3AE4C 2LO1A 1SQBD 3P32A 1JJOA 5KX5A 1GL2C 1EZVI 2FBWC 2JEUA 5AW8B 2JO1A 5LHIA 2IYOA 1OCOC 3FAVB 3VP9A 1DEBA 4YJ3A 2LR2A 3JSLA 5BU5A 1VQMV 4FPPA 5C93A 1PL0A 5IWAO 1VIBA 3TJTA 1K5QA 1KZUB 1NKDA 3JARB 2YEVB 1JCHA 1QLEC 5D5PA 4DV7O 4DR2B 1FXKB 2C9LY 3WU2E 1WA8A 2YKPA 2OYIC 3AK1A 5C39A 4ZI7A 4WFFA 4DR3B 3RL0B 4X1KA 2KNCB 2WAMA 2R3CA 4XDLA 4LF6B 3ML0A 1BHBA 1NU1D 5GTIZ 4EFBA 5BMVB 2KP8A 1QQCA 3ABKC 4LP8A 3VOUA 1Q81W 4J9YB 2BTQA 2O57A 1K92A 1LJ2A 2DYSC 2K9JA 3CYOA 4DV3O 2P22C 2J5UA 1IZ3A 4EOTA 3ASOB 4PA6A 4QNHB 1A02F 1RM1C 5KKZC 1GDTA 1G2CB 3I5DA 3QWOC 4MTXA 1KB9I 4X62O 1KUQA 1N4CA 4J7KA 3O8ZA 5EBMC 3U1CA 4X65O 2WT7B 3FB6C 3F7YC 3CP1A 3T1YB 4I7ZC 1IBLB 2E75C 3RYHB 3BVHA 1A02J 2ZM6B 2IM9A 4LFCO 4O2BA 2OYHC 4JTCB 2KOGA 2K1EA 2J58A 2QSAA 1FFXA 3LDCA 2ZNIA 3HUSB 1NU1J 4CH4A 4AQYO 1NS1A 1Q3EA 5B1OA 1EM1A 3WG7C 3KQGA 1KB9D 1AJQA 4WVZA 1R1BA 5FNVA 1AVMA 1VQ4V 1UPGA 3R66A 3JCUZ 3E7KA 2IJKA 1VQ9P 1KQFB 2PYJA 2GSMB 4MTGA 5KHGA 2K37A 4ZMDA 4ZHQB 4FLXA 1Q86Q 1RH5B 2IBZI 3L70H 4JGSA 1ZW0A 1NTKG 1DD4A 4LH6A 3ZRVA 2F95B 2EINC 2EIJC 1VDFA 1X0TA 4FLYA 4L74A 1XNRB 2FXMA 5CB4A 3H25A 4JI8O 1RM1B 2Y4UA 2JJ2G 3H1IJ 4YIOA 1IURA 1E5WA 5L8RJ 2QEXP 3HKEA 2L91A 2YDEA 1IFJA 5CA0B 1ZN5A 4LF7B 1HNWB 3H1ID 3JCZA 2UWJE 4OGQC 5LGUA 4K0KB 3L4FA 2FMLA 3RYFA 5LHHA 1HR0O 4LFAO 4FM2A 3HKCB 2ZQMA 3F5HA 3OAKA 4JQ0D 4LFBB 3H1HE 3ZMSA 4JI7B 3F89A 2ZT9C 2IBZE 4J11A 1OCRB 2UUAB 2QR4A 4WFEA 3LNMB 4DK0A 1PGJA 4PJ0E 4Y99C 1MA1A 2O1KA 3WU2H 1B04A 2ZD9A 1O9GA 2JGDB 3KYQA 1PL4A 3CPWO 2A06D 1SQVD 5KAFE 1J2JB 1SQBG 1N0JA 3TETA 2CPSA 1EQ7A 4LLHA 4WFBV 1HH0A 1H8EG 4QPKA 3B2EE 2NZ2A 3H6PA 3L71G 3RK2B 1R3IC 1DH3A 3SJAC 2XU6A 1EZJA 4K0KO 2PAJA 1EN4A 5BMVA 1Z5WA 2QWOB 2QJYC 4GUNA 1RF1B 3HD7C 4DT0A 1FXHA 1K8AW 2JVDA 1QCEA 2R9IA 4OGQD 1RHZB 2ZYGA 5CCHA 2F1MA 2ZR3A 3A2AA 2Y69B 2UUBO 1GW3A 2KKWA 3CC4V 3GHGC 1KV4A 1BCCG 1XNRO 1KP2A 3RYFB 1U97A 5APYA 3M8AA 2ZYDA 2WLNA 1GM9A 1AI5A 1XMQB 1NTKK 3WUUA 1AFOA 3THOA 1FYJA 3FYEB 4RAIA 4CPGA 1NTMJ 1Y66A 5BVZA 5KAIH 1GKFA 1Y4MA 1XDCA 1P84D 2OTLP 2B1IA 3QTCA 5KHHA 2DMXA 3TSIA 1HW7A 4OPHA 3HKBB 4ZNCA 3A8TA 3WB2A 2Y0PA 4I1LA 5KJ7C 1AI7A 5KLIB 1NTKH 3AK3A 1IBKB 3CCVV 1N36O 3IR9A 3W68A 2IX7C 2Q3EA 1HJ0A 3CRRA 4TWKA 3JCUH 1RE3A 3KPEA 2IFMA 4MVZA 1J95A 2GUSA 3V6IA 1NH2B 4WWIA 4I50B 1RFYA 3H1HG 5JJNB 2R32A 3AEBC 3K06A 5KAFH 3G71P 4QE7A 1ZXGA 2C0XA 3L9DA 4NPDA 4PD4E 4BXLA 5TISH 2ZIOA 1Q5OA 1KKCA 1G4YB 1QNMA 2AEJA 3K5MA 3L75E 3FWNA 1DIPA 2XAJA 1CP9A 3VQVA 1PPJE 2DN9A 1NTMD 3DXRB 3VMXA 2QA4V 2SPZA 4IYIA 1HVVA 1M56B 3FB7C 1RF1C 4K8XA 3CI9A 3CRMA 4R50A 2H8PC 2OCCB 1QEXA 2ZXXA 4YY3O 4Y99B 5LHGA 1VQPV 5AG2A 2ZR2A 3L75D 3PP5A 2QKCA 2BTQB 1L0NG 2NN4A 4G27B 1B3QA 2OYQA 5IY5C 5DM6V 1BZKA 2JWAA 4ZBMA 1M56D 2KB7P 1H8AA 1XUQA 2YS8A 5HFLA 4E2LA 3C9IA 3V2QA 2RN0A 3AE7C 1JY2P 1NBMG 4Q6GA 5LYJA 4GODA 2FTKA 1GN4A 5A2QN 4JYAO 5IYZB 1IFDA 3W7WA 2HJDA 2X6CA 3ZHSA 2XOKG 2QSIA 1CZQA 3P8CD 1QU7A 2D2CD 3A2FA 4DR1B 4DRXB 1KFMA 3B5NA 1XL6A 4RWUA 2KZIA 3E35A 3FAVA 5FPRA 4DV5B 3GF3A 1R8EA 5EIBC 3U1AA 4PV1C 1URQD 5KA5A 1FDOA 3RGUA 4X88A 3L71J 4FLWA 5AVZB 5H2FE 1NTKJ 1LP1A 1KD1Q 3IF4A 2XZRA 3B77A 2IU0A 4GOEA 2HKOA 4O2AA 3L75J 4JAUA 3CMEP 3AG3C 1I7FA 1YDXA 1CEZA 2IYPA 5KUMA 3HD7B 3BASA 3H1KG 3L72J 4H44D 3ETEA 5L3GA 1MABG 4UB8H 4NPFX 4DV7B 1M4UA 3OM3B 4KP4A 5B66H 1RE3C 1VQ6V 4QIWF 2QE7G 4DXWA 1S5LX 3D71A 1LTBC 4M3LA 2M5AB 4YJ2A 4I55A 3HRNA 1JFFB 4DV6O 5KJ7D 2DOSA 1OXZA 2ZDIC 1RF0A 4AQYB 1YXBA 4P9OA 3C90A 4UVCA 1KYOH 1Q82W 1LT1A 4X66B 5JH7B 4DR5B 4KJMA 1GMGA 3MAQA 2W8ZA 3CCSP 3OAAG 1LWUC 2Y4TA 3AE3C 4OX9B 1M7LA 1OX3A 3KZIE 2Y9YA 1N73B 3JAWB 5LL6Y 1VQOV 3F5TA 5GONB 4WY4D 4DV4O 1LR1A 3H1LJ 2OYHB 3LSUA 3AG2C 5AVRB 3CMEV 1W0KG 2XV5A 5CBGA 2PYLA 3AG4B 4LBEC 3CX5I 4HB1A 1Y74A 1K33A 2YMYA 1MSDA 4D7SA 1SQBK 1H2LA 1AVOA 4TUYA 2BOCC 2Q5ZA 2WA4A 3O9OA 3S3XA 2YI9A 1MOFA 3S1KA 3M91A 1MG1A 2KLVA 5CCHC 2YXYA 3OT7A 3ZHQA 4I2LC 5CA1B 3L70G 2O1JA 5AVYB 4DR5O 4QJFB 2O3JA 3U59A 2JWDA 4H0LB 1TU3F 3VQWA 2HYNA 2A0LA 3CCSV 1W5CE 2WLIB 1JFFA 2HVJC 2X6BA 3Q4HB 3GB7C 1AVYA 2YIBD 1RSOB 2DWEC 1Q86W 5LMUB 1CSBA 2DJVA 1WLEA 4JI6B 2IH3C 1GTOA 1ZLLA 3QNEA 2BTOA 4F4LA 1SQBE 2YO2A 1GRJA 1XEQA 1GD2E 3JYCA 5APVA 4Z2WA 1YHQP 2CE4A 2BE3A 1SFCD 2O01N 2Q6AA 4BAYA 1JMBA 2KS1B 3V2NA 5IT9N 2YICA 3RL0C 2FB5A 3H1IH 4JF3A 1AJNA 2JK5C 2Q3IA 5GONA 1WAZA 3OUFA 3SYCA 1MZFA 2LGQA 4D6TH 4U3JB 4ZIBA 3R4YA 2JJ1G 5JQGB 1SQVG 2WVRA 3R65A 4B3SO 1L0ND 1PGPA 1PPJG 1OVUA 3RK2C 5ITZB 1LTSC 3FX0A 1KTMA 1PGQA 4JI0B 2ZXWC 3CRCA 3SPIA 1ZL8B 3I56V 4AHCA 1VEWA 2DYSB 2JDIG 1ORQC 2IJIA 1IFPA 3L72G 4H13B 5CBFA 1NTZG 1BL8A 1JOCA 3KZIH 4JV5B 1EDLA 2JS3A 2X0LA 4KL1A 3DC6A 1Y76B 4LFBO 3S4RA 2UXDB 2EX3A 3SWFA 3ZMZA 1ZRTD 1NGMB 5L3EA 1BHAA 2NR5A 2KG7B 1EZVG 1XL4A 1KQLA 5GTHE 2ETNA 1PPJD 4PA9A 4ICGA 3O6QA 1LT9A 3AEAC 1SQXG 3ZN1A 2O01J 2OCHA 2WQYC 2P7TC 5APWA 4GKJB 1Y8AA 1TGOA 2QJPC 5ITZA 1S77D 5KLIC 4JI1O 1HNZB 1L4AD 2EULA 1FXKC 3N27A 3EFGA 2A79B 2EIKC 2VWJA 2A45H 1IBMB 1YEWA 4DV2O 4LF4B 2GA1A 1GU5A 4FM0A 3OEHG 5CHXA 1P84I 1GN6A 3BA8A 3KG2A 3UKMA 1XHZA 4P2ZA 3V2PA 4CS3A 1IVSA 5KJ7A 1K3EA 1RQVA 3JD4A 1J5EB 3SFEC 4ASUG 2HP8A 1AA0A 3RK2D 4WFGA 1QLED 2QWPB 1PFIA 1VMGA 2DW3A 1VQ8P 4Y28J 3KCXA 1X22A 1OVVA 2YIBA 2PRRA 5JVDA 2WPVB 4YXDC 4IFFA 4B3RB 2FYZA 4GCZA 1KILE 3E22A 1T8ZA 1VQ6P 1CXZB 1SP4A 2PI5A 3H1HJ 3ITKA 2YIUB 1F4NA 5EFWB 1VQ5P 4GYCB 3W7XA 5L3FA 2P58A 1L0LG 2FY8A 3GWOA 3J80N 4UCUA 1BT8A 1AR5A 1E79G 2Q73A 3BCCH 3HKBA 1IXMA 4BW5A 4JV5O 1LTJC 1YSCA 1Z2GA 4NYKA 4NXNB 4UB6H 1YZBA 4MTFA 5B3SB 1FC2C 1E1RG 3JAWA 4ZHQA 1S0VA 3OW2U 3FXEA 1AV1A 2IBZG 3MGNA 3BAAA 1FAFA 1J1EC 1ZR4A 3I55P 2EIMC 3W7TA 4KHPB 1RE4A 5K1XA 4I0XB 4UCVA 1VQ9V 1VQ8V 1X8YA 3BCCD 1MKMA 2B88A 1HJBA 4EIJA 2WZ7A 2FXPA 2OTJV 1M1KQ 2YUAA 4FLZA 1HNZO 3HE5B 2JDIH 1FOSE 1KYOF 3N2GA 4CC5A 1V54B 1K05A 3MD0A 3E1RA 4BW9A 3B8NA 1PKXA 1W2EA 2YO3A 3OW2O 1SA0A 1BGYJ 1G2CA 2W6AA 3N2KA 2ZYAA 3D6ZA 1NR7A 1K73Q 2ZM6O 1M1KW 1YJ9P 2CPBA 4AQRD 3K5NA 1ZR2A 3CCJV 1XNQB 4IOIH 2QJPB 4NVPA 1NI8A 1EBOA 3LW5J 1NH4A 1WPXA 3OGIB 4R8CA 2WLMA 1KC8W 1JY3N 4J9ZB 3DSQA 1L8DA 4RQEA 1T3UA 5CBNA 1Z5VA 1R6NA 3EVKA 4G2KA 4PI2A 2HPCB 4IYHA 1SQQD 4DOJA 1WA8B 3K3WA 4J7ZA 4L87A 3B4SA 3N2KB 1BCCE 4O4HA 1LT9C 1DK1A 1KBHA 1BGYH 1SA0B 1G6UA 4GLXA 2IDBA 2Q5UA 2F66C 3L72D 1MUUA 3NR7A 4IL6X 3SPCA 4DUZB 1HF9A 1THZA 1WPBA 1OW7A 2ITAA 2ZT9B 2Q7EA 2XASA 4MN4C 3BVOA 5K1PA 2BSKB 3L74G 4I6MC 1MMMA 1XMOB 1QVGO 4PD4H 3P8CE 4MTOA 5AVTB 3BRTB 3VMAA 4JI1B 1OCCB 2JRIA 4BIZA 2K88A 2E75B 3QO7A 1L0LH 4WY4B 1FDIA 3VQYA 1SQXD 4RESB 3VTPC 4GKKB 4PI0A 3LW5H 1VF6A 3VBBA 1XTGB 1Y67A 1H2KA 4JTDB 1VQKP 1WRGA 2FYUH 3L73G 1YQ3C 3SDLA 4X66O 5H2FZ 4H0LC 1LWUB 1FE6A 2CK3H 3E8BA 2UXBB 1URQC 3UCSC 3ABLC 2M6YA 3ZHTA 4W7ZA 1YITP 3CCMV 5KHKA 4PD4F 5E1AC 3B09A 3AE8C 4U3FH 5KLVK 1XI1A 4JI4O 4LNUA 3UIAA 3AG2B 4FVMA 1URQA 1LNQA 1W0JG 1PP9E 3H1KJ 1QR8A 1PGOA 3V4QA 4EDFA 4W4KA 2YXLA 3JD1A
chains in the Genus database with same CATH topology
1VQ7V 3JD0A 2PI4A 1AI7A 3SYPA 3ZN0A 1NVPD 4P30A 3CCVV 3NXSA 1EFRG 4Z1MG 4TWKA 1M9NA 2YSUB 4MVZA 2WLKA 1K34A 1K73W 2IH1C 1J95A 3E8HA 4RO2A 3HB3B 1NH2B 3OE7G 3ABUA 5IDJA 2ITCC 2AHZA 3OMNB 3K06A 1NVPB 2HJFC 4U7OA 3TCUA 4QE7A 1VQNV 1PD3A 4PDVA 1PNKA 1G4YB 1RPRA 1OCCC 4LCUC 2XAJA 1CP9A 5EK0A 3AG4C 4HYOA 2QA4V 3OR7C 1M56B 4MVRA 3FB7C 5B3SC 2IJJA 1ZWIC 3T4ZA 1P4RA 3K9AA 4R50A 2H8PC 3X2QC 2OCCB 3E83A 4MW8A 2JEXA 3PJSK 3D36A 4PELA 4FIPC 3IC7A 5KA6A 5LHGA 1ENVA 4RUEA 1VQPV 2ZR2A 4UXNA 4UUJC 1JPXA 1DF5A 1W2BU 1AROP 1YI2V 2P90A 4G27B 3OFNG 1S3JA 4MSWC 3ZRWB 5IY5C 5DM6V 5CN0A 4ZBMA 2M7WA 3EHBB 1FS0G 3E8GA 3ASNC 5HFLA 1SESA 5L3DA 2XAQA 4E2LA 2W0FC 4H37A 3CCQV 1NBMG 2WSSH 2FTKA 3W7SA 1GO3F 3K08A 1K9MW 4JYCA 1KP3A 3W7WA 2X6CA 2H94A 2NNUA 2XOKG 4H33A 3QO5A 4I9WA 3STLC 1YJ9V 4FK5C 4I5SA 1XL6A 5GW7A 3E35A 1KECA 4OXSA 2Q68A 1V55C 5KA5A 4X88A 1CPYA 3ZRWA 3ASOC 3SJQC 4U7NA 3OGCC 2B1GA 2DWDC 3BEHA 1M56C 3B77A 2IU0A 2W6JG 2HKOA 1AI4A 5B1BB 3I55V 3P30A 3SYQA 2E5YA 4JAUA 2DW4A 2WLLB 3AG3C 3AEIA 1FXKA 5BZBA 1CEZA 1V55B 1I5XA 4X89A 5KUMA 2UXNA 1YTFD 1N8RW 3JD2A 4BIUA 3ETEA 2WPDG 5L3GA 5DN6G 1MABG 2F43G 3OM3B 2EIKB 4KP4A 4N21A 2EZOA 2ZXWB 3ABMB 4QIWF 1VQ6V 2QE7G 2W6IG 4DXWA 1OCRC 5KUKA 5IY5B 1COWG 2YEVA 5CA3A 1F51A 1YJNV 2WLIA 2ZDIC 3SPHA 1OHHG 4P9OA 1S5HC 4YXWG 1QVFU 4UVCA 1Q82W 1K5SA 4P9PA 3FYIB 1GMGA 1K4CC 5FL7G 4WCEV 3EFFK 3OAAG 4EKWA 2ITDC 5EC2C 3OEEG 3CPWU 2QEXV 2DQ3A 3D3IA 4ZKIA 1FS0E 3CCEV 1VQOV 2XAGA 4PDRA 4TT3G 3SPJA 5LBQA 3E8FA 2OCCC 5B1AC 1AQTA 3AG2C 3CMEV 4QPJA 1W0KG 3AG1C 2EJRA 5CBGA 3ZRXA 1AJPA 3AG4B 4LBEC 3SYOA 3K0DA 1K33A 5B1BC 1R73A 4KUMA 1PNLA 2BOCC 4RUFA 1MOFA 1MG1A 2WLHA 2WLJA 1I5YA 1OCZC 4R6ZA 4RQFA 4DO2A 1SZTA 3DGEA 3JD1A 3UM7A 1FXVA 2EZPA 1NR1A 4GT1A 4QJFB 2JIZG 2Q69A 2X7RB 3WFVA 2A0LA 3E86A 3X2QB 3CCSV 3AG1B 2WLIB 1YIJV 4MVMA 2HVJC 2X6BA 4UV9A 5IYCO 3GB7C 2P67A 3ETGA 2DWEC 2DYRC 1Q86W 3CCLV 3ASNB 4KFMA 1WLEA 2IH3C 1GTOA 3RVZA 3QNEA 1VQKV 4F4LA 3JYCA 1OZ0A 3T1CA 4GX0A 1OCZB 1H8HG 1JX9A 1R3KC 4JTAB 1GM8A 3SPGA 2Q6AA 4BAYA 3CCRV 5L3BA 4Q20A 2D3OW 2V1DA 1SRYA 4CBCA 5B1AB 4UVBA 1MSWD 1QBZA 4JF3A 1AJNA 1OCOB 2JK5C 3RVYA 3OUFA 3SYCA 4MVQA 1NH2D 3CD6V 2JJ1G 3USSA 3R65A 1QVGU 3OUSA 3FB8C 3RBZA 1R3LC 2ZXWC 3ABMC 3SPIA 3CC2V 2HFEC 3I56V 1NJIW 2DYSB 4WFAV 2JDIG 1ORQC 2IJIA 3CXCU 1IFPA 2IU3A 1Q7YW 5CBFA 1BL8A 1E1QG 3CCUV 1G8MA 4WFHA 2X0LA 2XAHA 2HLDG 4GX2A 3A0RA 4MT8A 4MVUA 3ZMZA 2NLJC 2EBOA 5L3EA 5H9CA 2XNDH 2LFRA 1BHAA 1YJWV 2OTLV 1XL4A 2MK3A 4PA9A 4GX5A 2QKSA 4PDMA 3ZN1A 4FJCC 2WLLA 1K4DC 2HG5C 1BSHA 2P7TC 1F4MA 5H6QA 3K03A 1S77D 2HVKC 2EILB 4X8AA 4MVOA 2EINB 3IFXA 1E79H 1M90W 3P32A 3HPLC 3STZC 1QLNA 2W6JH 1FXKC 2JEUA 3T2MA 2X6AA 2A79B 2EIKC 1K7DA 5LHIA 1OCOC 2HR3A 3ZMUA 1VQMV 3OEHG 4FPPA 5C93A 1PL0A 3G71V 1H38A 1K5QA 1NKDA 3BY6A 3KG2A 2YEVB 3FKSG 3UKMA 4P2ZA 1JCHA 1QLEC 3ZCCA 1FXKB 1KKDA 3E2EA 5H6RA 1K3EA 3ZIAG 3JD4A 4WFFA 4XBFA 2LFSA 2B5UA 2ZDIA 3MHSC 4ASUG 2WAMA 3G4SV 2P6JA 2Z5UA 4XDLA 2WSSG 3M99B 3ML0A 4WFGA 1BHBA 4GX1A 4HZ3A 3ABKC 4LP8A 3B8MA 3VOUA 1Q81W 4J9YB 1K92A 1DF4A 2DYSC 2QM7A 3CYOA 1GK9A 3W7UA 1V54C 1YTFB 2E5TA 4GCZA 3ASOB 4PA6A 4QNHB 2EIMB 2LP7A 1RM1C 2PI5A 5LGNA 1F4NA 1GM7A 4MTXA 1L1FA 3W7XA 5L3FA 5B1NA 3GWOA 4MS2A 1NQTA 2AHYA 5EBMC 3CC7V 1E79G 1VQ5V 1IXMA 1JVMA 4BW5A 1SERA 3DTUB 4QMAA 3FB6C 3F7YC 1YSCA 3CP1A 3WG7B 3LDDA 1JOYA 3ZMTA 5B3SB 4MTFA 1RPOA 5HFMA 1E1RG 4JTCB 2K1EA 1S0VA 1F23A 3LSSA 3OW2U 4TLFA 2IW5A 3SYAA 3LDCA 1JQ0A 2EIMC 3W7TA 3ABKB 5B1OA 3WG7C 1AI6A 3ETDA 4JPRA 3ZMVA 4G28B 1AJQA 4WVZA 4CZZA 1VQ9V 1VQ8V 5EBWC 1VQ4V 2KB1A 2IJKA 2GHYA 2OTJV 2GSMB 4MTGA 3OMIB 3QO8A 1FFTB 2C2AA 2DYRB 3F7VC 3IGAC 2V7QH 1QLEB 3H01A 2XAFA 4JGSA 2JDIH 1JEKA 2Y48A 3FB5C 1KD1W 2A9HA 1V54B 3ZRVA 2UXXA 2EINC 3ABTA 2EIJC 3MD0A 5LGTA 3B8NA 1PKXA 2XNDG 4LC1A 3TK1A 4DJGA 1RM1B 1P7BA 2QTOA 2JJ2G 4UV8A 1QR9A 1NR7A 1K97A 1M1KW 3AG3B 5L3CA 4HAMA 3CCJV 3JD3A 4JYBA 1BMFG 3LDEA 1EBOA 3JCZA 1WPXA 4R8CA 2WLMA 1KC8W 5LGUA 5IYDO 1H2GA 4J9ZB 5LHHA 2CK3G 2EIJB 3ZRSA 4RQEA 3K04A 1R6NA 4G2KA 2ZQMA 3ABLB 3F5WC 4PA7A 1B6QA 3ZMSA 2DQ0A 3K3WA 4L87A 3E89A 4QE9A 2Y69C 3G6EV 1OCRB 4XDKA 1UJWB 4WFEA 1YITV 4PDLA 3LNMB 4R7CA 2QE7H 2ZD9A 3T4DA 3SPCA 3LSQA 4JASA 1THZA 4FMTA 2XASA 1M57C 2R9RB 3TETA 1R6KA 1SETA 4PA3A 4MTOA 4WFBV 1OCCB 1VQLV 1H8EG 4QPKA 3CMAV 4PA4A 4BIZA 1R3IC 3OR6C 3QO7A 4UVAA 2Q67A 1EZJA 5IYBO 4WF9V 3OMAB 4JAVA 3RW0A 2QM8A 4MW3A 1FXHA 1DLBA 4MVSA 4N23A 4JTDB 3VBBA 1AR1B 1KQSU 5EBLC 1R3JC 4TSFG 3ZJZA 1K8AW 1QCEA 2BOBC 2R9IA 1JJ2U 3LUTB 5EC1C 5CMUA 3MHHC 1S76D 2ZR3A 1YHQV 2Y69B 1ROPA 3CC4V 1S72V 2IJHA 1DTOA 2EILC 3E8BA 2CK3H 3ABLC 1KP2A 3K0GA 1HWYA 2Z3YA 3CCMV 2WLNA 5CBHA 5J9PC 3K79A 4XDJA 1GM9A 1M57B 1AI5A 5E1AC 2OT5A 2V7QG 3FYEB 4RAIA 3AG2B 1PNMA 2ATKC 1LNQA 1W0JG 1QR8A 1Y66A 1BSNA 1GKFA 1TUEB 2WWWA 1Y4MA 4YXWH 2B1IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3FB5 C;  2XND H;  2A9H A;  4DXW A;  1OCR C;  5KUK A;  1XL4 A;  2EIN C;  2EIJ C;  3SYP A;  2YEV A;  4PA9 A;  2WLI A;  4P30 A;  4DJG A;  4GX5 A;  2QKS A;  3SPH A;  4P9O A;  1S5H C;  1P7B A;  2QTO A;  4PDM A;  4P9P A;  2WLL A;  1K4D C;  2HG5 C;  1K4C C;  4TWK A;  1BSH A;  2P7T C;  3EFF K;  4MVZ A;  4EKW A;  2WLK A;  3K03 A;  2ITD C;  2HVK C;  1J95 A;  2IH1 C;  3E8H A;  4RO2 A;  4X8A A;  4MVO A;  5EC2 C;  3IFX A;  1E79 H;  3LDE A;  3HPL C;  2ITC C;  3STZ C;  2W6J H;  2AHZ A;  4R8C A;  1FS0 E;  3K06 A;  2WLM A;  3T2M A;  2X6A A;  2EIK C;  2A79 B;  4PDR A;  2HJF C;  1OCO C;  3SPJ A;  3TCU A;  4QE7 A;  3E8F A;  2OCC C;  4J9Z B;  5B1A C;  4PDV A;  1AQT A;  3AG2 C;  3ZRS A;  1G4Y B;  1OCC C;  3K04 A;  3AG1 C;  4LCU C;  5CBG A;  3KG2 A;  3UKM A;  3SYO A;  4LBE C;  4P2Z A;  5EK0 A;  3K0D A;  1QLE C;  3F5W C;  4PA7 A;  5B1B C;  3AG4 C;  1KKD A;  4HYO A;  3OR7 C;  4QE9 A;  4MVR A;  3E89 A;  3FB7 C;  2Y69 C;  5B3S C;  4WFF A;  1ZWI C;  2BOC C;  4RUF A;  4XDK A;  3T4Z A;  4R50 A;  2H8P C;  3X2Q C;  4WFE A;  3E83 A;  4MW8 A;  4PDL A;  3LNM B;  4XDL A;  2WLH A;  3PJS K;  4WFG A;  2WLJ A;  4R7C A;  2QE7 H;  1OCZ C;  4R6Z A;  2ZD9 A;  4RUE A;  4GX1 A;  4HZ3 A;  3T4D A;  3SPC A;  3UM7 A;  3ABK C;  4LP8 A;  4UUJ C;  3VOU A;  4J9Y B;  1M57 C;  2R9R B;  3TET A;  4G27 B;  2DYS C;  2Q69 A;  4MSW C;  1V54 C;  4PA3 A;  2A0L A;  3E86 A;  4MTO A;  5IY5 C;  2E5T A;  2WLI B;  4ZBM A;  3E8G A;  4MVM A;  2HVJ C;  2X6B A;  4PA4 A;  4PA6 A;  1R3I C;  3OR6 C;  4QNH B;  3GB7 C;  3ASN C;  2Q67 A;  2DWE C;  2DYR C;  2W0F C;  4KFM A;  4H37 A;  2IH3 C;  3RW0 A;  3RVZ A;  2WSS H;  4MW3 A;  3K08 A;  4F4L A;  4MVS A;  3JYC A;  4JTD B;  4MS2 A;  5EBL C;  1R3J C;  2AHY A;  2X6C A;  4GX0 A;  5EBM C;  3T1C A;  2BOB C;  4H33 A;  3ZJZ A;  1JVM A;  3LUT B;  5EC1 C;  4BW5 A;  4QMA A;  1R3K C;  3FB6 C;  3F7Y C;  4I9W A;  2Q6A A;  4JTA B;  3LDD A;  3SPG A;  3STL C;  1XL6 A;  4CBC A;  4MTF A;  4OXS A;  2JK5 C;  2Q68 A;  1V55 C;  4JTC B;  2K1E A;  3OUF A;  4X88 A;  3RVY A;  4MVQ A;  3SYC A;  4TLF A;  2EIL C;  3E8B A;  2CK3 H;  3SYA A;  3ABL C;  3LDC A;  3ASO C;  3USS A;  3K0G A;  3R65 A;  3SJQ C;  3OGC C;  2EIM C;  3OUS A;  2DWD C;  3FB8 C;  3BEH A;  3RBZ A;  1R3L C;  1M56 C;  3WG7 C;  2ZXW C;  2WLN A;  3ABM C;  3SPI A;  4XDJ A;  3SYQ A;  5CBH A;  2HFE C;  4G28 B;  5E1A C;  5J9P C;  2E5Y A;  4WVZ A;  2WLL B;  3AG3 C;  1ORQ C;  5EBW C;  1IFP A;  2KB1 A;  5BZB A;  5CBF A;  4X89 A;  5KUM A;  1BL8 A;  4RAI A;  2ATK C;  1LNQ A;  4WFH A;  4MTG A;  1BSN A;  3F7V C;  3IGA C;  4GX2 A;  2V7Q H;  4YXW H;  4MVU A;  2NLJ C;  2JDI H;  1JEK A; 
#chains in the Genus database with same CATH topology
 1VQ7 V;  5E79 Z;  3L74 E;  1JA8 A;  1Y9B A;  2R44 A;  3JD0 A;  1HWT C;  2PI4 A;  4J80 A;  3ZN0 A;  4CS2 A;  2UXC O;  2N9Y B;  2BCC J;  2QJK C;  4YJ3 B;  3KHU A;  1T5E A;  1WJZ A;  4C7U A;  2E74 D;  2OYI B;  1M9N A;  2ZIN A;  3HKD A;  1FJK A;  3H32 A;  2YSU B;  2ZFC A;  4N3Y B;  3H1K H;  4Z1M H;  4AIL C;  2IH1 C;  3E8H A;  4DV0 O;  1IK9 A;  2A7W A;  3HB3 B;  3KZI Z;  2ZXE B;  3OTF A;  3O65 A;  1L0N K;  3KXD A;  3B8E B;  4U3F J;  2ITC C;  2QWQ B;  5LXT A;  3OMN B;  4JF7 A;  5J2T B;  2HJF C;  5KKZ B;  1FZC A;  4DW0 A;  1VQN V;  3AEF C;  3KKY A;  5BR8 O;  3V4W A;  1RPR A;  4B7K A;  4WBA A;  3A0H H;  2E74 B;  2QA4 P;  2ZAE B;  3RL0 g;  3Q3D A;  4HYO A;  2M8R A;  5AW1 B;  1SQX H;  4MVR A;  4DR6 O;  4H0L D;  1L0N H;  2Q0A A;  1LT9 B;  4CH6 A;  5IJ0 B;  3G67 A;  3X2Q C;  3TGU J;  3Q5P A;  3K5L A;  5KLV E;  3E83 A;  1WB7 A;  4DR7 B;  3R2P A;  3D36 A;  4FIP C;  3T1H O;  4GDO A;  4RUE A;  3TGU H;  4XA4 A;  1EDK A;  4DV4 B;  1DF5 A;  1JTH A;  1ARO P;  1M93 A;  2XTA A;  1YI2 V;  4C7R A;  1YTZ I;  2FYN B;  3SJB C;  1NTZ H;  1ZME C;  5BU8 B;  1NZ6 A;  3M0D A;  2M7W A;  3EHB B;  3E8G A;  1L4A B;  4F6E A;  4FFB A;  1OV9 A;  1SZX A;  3WUT A;  4H37 A;  3MZW B;  1J1D B;  2E76 C;  3CCQ V;  3HTK B;  3TDK A;  3WUV A;  1NU1 G;  1EXI A;  2G3A A;  3L35 A;  1IO4 A;  2ZVO B;  2H94 A;  4H33 A;  2VQF B;  1IFM A;  2VQE B;  5JVD B;  3STL C;  1YJ9 V;  4FK5 C;  1NTZ K;  3ZS8 C;  2A3Q A;  4DR6 B;  1SFC A;  3HR0 A;  4OXS A;  1HGV A;  3CS5 A;  1CPY A;  1KC8 Q;  3ZRW A;  3CHX A;  1D5A A;  3SJQ C;  2DWD C;  3BEH A;  1EZV D;  3A0B E;  2W6J G;  5KHJ A;  1AI4 A;  3JAS A;  3P30 A;  3L37 A;  1K8A Q;  1YQ4 C;  3CWB J;  1TVK A;  5BZB A;  1V55 B;  1IBK O;  2N9B A;  4AYC A;  1LTT C;  2LW1 A;  3JD2 A;  4LR3 A;  4BIU A;  4B86 A;  5DN6 G;  1J1E B;  2F43 G;  4E4E A;  2AXT Z;  1NU1 K;  1NT2 B;  2ZXW B;  4X1Y B;  1OCR C;  4GKK O;  3QG5 A;  1PP9 H;  4J7J A;  1M57 D;  5AVX B;  2BCC G;  1AIL A;  2KSJ A;  3H1I E;  1COW G;  4X64 O;  2W83 C;  2WLI A;  1GK4 A;  2OWO A;  1OHH G;  3JAS B;  1NTZ D;  5APU A;  3JAT B;  2FFD A;  4WCE V;  4ZOL B;  3EFF K;  2G38 A;  2OIE A;  4X1I B;  1JMM A;  1HGZ A;  3TNU B;  4FZ0 A;  2FYU J;  2GDS A;  3VN0 A;  5EC2 C;  3D3I A;  3K58 A;  3JAL B;  1FS0 E;  3M06 A;  3ABV C;  1SC5 B;  4O2B B;  5GTI H;  4DRX A;  3B5N B;  3H1L G;  4W7Y A;  1UFI A;  4X1Y A;  4OPA A;  2FFD C;  3CCE P;  1PM9 A;  1VQO P;  4UCR A;  5B1A C;  3ZHR A;  1TA8 A;  4NR1 A;  1KIL B;  2NPS B;  3H1J G;  2I1J A;  3UO3 A;  2YIU C;  2YXQ B;  4EI2 A;  4QPJ A;  1N7L A;  3AG1 C;  4OX9 O;  3MP7 B;  1KB9 E;  3K0D A;  1LUW A;  4UB8 Z;  2ZIM A;  1BS3 A;  1R73 A;  2RMK B;  2PY5 A;  1AJY A;  2RDC A;  1PNL A;  2XUM A;  3TYY A;  1DD3 A;  4R6Z A;  2UUC O;  3A5T A;  4NTW A;  4RQF A;  1SZT A;  3A0B Z;  1FXV A;  4UCS A;  5EYP A;  1BGY G;  4HJG H;  4GT1 A;  2P4V A;  2RN9 A;  2YKQ A;  4U7J A;  1Y47 A;  4WBN A;  3A0H Z;  2Q69 A;  1T2K D;  3WFV A;  1KQG B;  1H88 A;  4ABM A;  3TXQ A;  2R9A A;  2E5L O;  4DV5 O;  4JI5 O;  3CCL V;  1SFC C;  4B3T O;  4EFE A;  1M90 Q;  1GN3 A;  4TT3 H;  3RVZ A;  1IK7 A;  2GUZ A;  2YIA A;  3N4X A;  2JP3 A;  1JO5 A;  1OCZ B;  3LID A;  5JJE B;  2Q0O C;  1GM8 A;  3W67 A;  1L0N J;  3CCR V;  1GL2 B;  1NKZ B;  1S72 P;  5DED A;  4DUY B;  1W59 A;  2HOD B;  5KLV G;  1MSW D;  3D3Q A;  1VF5 C;  1Q43 A;  4JI6 O;  3NMD A;  3AE9 C;  5JQG A;  3USS A;  4O4L A;  2UUC B;  4NTY A;  3I56 P;  1H2M A;  1QL2 A;  2OYI A;  4WBN B;  3VP8 A;  1O9H A;  2J59 M;  3Q2Y A;  5KAF Z;  4DK1 A;  4WFA V;  1N33 O;  1DGS A;  3CXC U;  5B5E Z;  4JZ2 A;  4LFC B;  4JPZ B;  1E1Q G;  2K3R A;  1XQ8 A;  3MHV A;  1G8M A;  5AVS B;  2CUG A;  2XAH A;  2YXH A;  2Q9L A;  2V4D A;  5AW9 B;  4L73 A;  4MT8 A;  1SQV E;  2QIW A;  3BCC E;  4NXN O;  4MVU A;  3ETQ A;  5LMU O;  1U7M A;  5H9C A;  2M0B A;  2BCC H;  1YJW V;  1H0T B;  3Q4H A;  2Y0C A;  1L0L D;  2MK3 A;  3RT3 C;  1S1C X;  3APO A;  4DV3 B;  4GX5 A;  2BAS A;  4WY4 C;  4DW1 A;  4OGQ B;  5AVU B;  2G8Y A;  4PDM A;  4FM1 A;  4PD4 D;  2QTS A;  4FJC C;  1BDC A;  2WLL A;  5JH7 A;  1OW8 A;  1BSH A;  3SGI A;  4I50 A;  4JI4 B;  4A7P A;  4TV9 A;  2EIL B;  3JAL A;  4X8A A;  2Y0I A;  4W80 A;  2Y0E A;  1KYO E;  1E79 H;  1M90 W;  1NHL A;  3STZ C;  3HPL C;  1QLN A;  1PP9 J;  3CCQ P;  1JCD A;  1K7D A;  3H1H H;  1IBL O;  4CH3 A;  3ZED A;  2HR3 A;  2Z5I A;  3ZMU A;  1AB3 A;  2GBO A;  1IFI A;  1H38 A;  1N7S D;  1SQB J;  5KHI A;  2UXC B;  2QJK B;  1T2K C;  2ZT9 D;  3CCU P;  2CH7 B;  3SFD C;  2WPS A;  1TVK B;  2GV9 A;  4IIJ B;  5H6R A;  5A9G A;  3GMA A;  4XBF A;  2LFS A;  4B3M O;  1YVW A;  2ZDI A;  3MHS C;  3G4S V;  1RF0 C;  4DV2 B;  4LF4 O;  3EQ2 A;  1X59 A;  2Z5U A;  2UXB O;  2WPQ A;  2WSS G;  4LFA B;  2Q7H A;  3AEE C;  3AG7 A;  4GX1 A;  1LWU A;  1SS1 A;  4DUY O;  2JGD A;  1L0L E;  2AZ0 A;  4D6T E;  1AR4 A;  3U10 A;  1KN7 A;  1QHT A;  1YI2 P;  3RK3 C;  4UFZ A;  1G1J A;  1N8R Q;  2BCC D;  2LP7 A;  2VWK A;  3HE4 A;  5CCG A;  3TGU G;  1S5L E;  5LGN A;  4KXR A;  1N33 B;  3CC7 P;  4RO0 A;  1Q90 D;  5BXZ A;  1BCC H;  4JI3 B;  2P4K A;  5B1N A;  4EB6 A;  2AHY A;  3CWB G;  1VQM P;  3RN4 A;  1VQ5 V;  4QMA A;  4JI0 O;  4PJ0 H;  1VL2 A;  3QF7 A;  3OD4 A;  1HNW O;  1JOY A;  1USE A;  2R3S A;  3ZMT A;  1RPO A;  5GTH H;  2CDY A;  1TUB B;  1GAX A;  4JBZ A;  4HNA B;  1F23 A;  3LSS A;  4TLF A;  3D6Y A;  2IW5 A;  1LP1 B;  3IJ4 A;  1GTW A;  1EZV H;  1AI6 A;  4JPR A;  2CGN A;  1N2D C;  3ZMV A;  4G28 B;  5AW6 B;  3BHP A;  4L8J A;  1MV8 A;  4BWA A;  2OTJ P;  1CW5 A;  4LWS A;  2ZJS E;  1I0H A;  3L74 H;  2GHY A;  3L74 D;  3G3Z A;  5IYZ A;  2P5O A;  3QO8 A;  1FFT B;  2C2A A;  2DYR B;  3F7V C;  1IZN B;  1SKV A;  1OWA A;  2Z5H A;  4BRY B;  2V7Q H;  1URF A;  2XAF A;  3H01 A;  2N74 A;  2LQT A;  2Y48 A;  1KD1 W;  2A9H A;  3RFR A;  3HKC A;  1N86 A;  3JCU E;  4DR7 O;  5LGT A;  3QH9 A;  4FZ1 A;  2XND G;  1SQV H;  4LC1 A;  3TK1 A;  4FFK A;  1PIX A;  1P7B A;  5J2U A;  3H32 B;  4UV8 A;  5EZY A;  3CCJ P;  2BCC E;  3H1I G;  1K97 A;  1BQZ A;  3HE4 B;  3G6B A;  2LKM A;  1Q2N A;  4HAM A;  3JD3 A;  4JYB A;  1PL5 A;  1URQ B;  3L73 H;  1F7Y A;  4K3A A;  1BMF G;  3T1Y O;  2ADP A;  3LDE A;  4JI7 O;  4KHP O;  3L75 H;  2L6L A;  5KMG B;  2GM4 A;  2WSC H;  2XT9 A;  5AW3 B;  2WT7 A;  1FD9 A;  1FZB A;  2VS0 A;  2EIJ B;  4BR6 A;  3ZRS A;  1CI6 A;  1FJP A;  3L71 D;  1Q82 Q;  4DV6 B;  3AE2 C;  1NTK D;  4HNA A;  2I8D A;  1NTM K;  1S5L H;  3DC5 A;  3F5W C;  1I08 A;  4GOF A;  1B6Q A;  2CTW A;  1Q6U A;  3JAM N;  4IIJ A;  1U7J A;  2AEF A;  2FYU G;  3C8V A;  3H1J D;  2KSE A;  1NKN A;  2OQQ A;  1S9K E;  3G6E V;  3CD6 P;  4KT0 J;  1BE3 G;  1SQV J;  5TIS Z;  2H3O A;  3RK3 E;  2E74 C;  3CC2 P;  3T4D A;  2B89 A;  3HKE B;  3CX5 F;  1ZV8 A;  2F93 B;  4FMT A;  1FJG B;  5C8Y A;  2HHH O;  2R9R B;  1N32 O;  1P84 F;  4L75 A;  1EDI A;  3FX7 A;  4QGP A;  1VQL V;  5CB4 B;  1VF7 A;  3BCC G;  3OR6 C;  1ZOY C;  2RJZ A;  4UVA A;  5IYB O;  4WF9 V;  1M5I A;  5D5Q A;  3GG2 A;  2Q7G A;  3OMA B;  4JAV A;  1RP3 B;  4DYL A;  1L0L J;  1SLQ A;  5AVW B;  3U0Z A;  2QM8 A;  3CCV P;  2C0W A;  4H13 C;  1DLB A;  4MVS A;  4HYT B;  1KQS U;  1FZG A;  1AR1 B;  5EBL C;  1R3J C;  2RMZ A;  2D2C B;  2WTY A;  3LUT B;  5CMU A;  3L70 E;  2YID A;  1S5L Z;  2BSK A;  5KAI Z;  4OH8 B;  3MHH C;  1S76 D;  1XMQ O;  3AE1 C;  3V2R A;  2K9Y A;  1ROP A;  1QL1 A;  1S72 V;  2IJH A;  3P3N A;  5KMG A;  4WY4 A;  2QGN A;  1BCC J;  1XRE A;  3K0G A;  2Z3Y A;  3JAK B;  1GN2 A;  1W2B O;  5AVV B;  1H2N A;  1FU1 A;  1M57 B;  4ZI7 B;  2RKL A;  3WMM 0;  2OT5 A;  4HH2 A;  5B66 E;  2V7Q G;  5J2U B;  1S9K D;  1IDS A;  1PNM A;  2Z0A A;  4O9B A;  2ZNJ A;  1Q7Y Q;  5JCO C;  1TUB A;  1NO4 A;  3LIE A;  2Y9Z A;  1KQS O;  4DUZ O;  3CXH E;  2A45 G;  3SYP A;  1GK6 A;  3N2G B;  4P30 A;  2IBZ H;  3NXS A;  1EFR G;  3BFR A;  2Y0D A;  1YYC A;  3II6 A;  4JI2 B;  3FD9 A;  3L36 A;  3JAK A;  1SQP E;  2YNY A;  3CC4 P;  4EEQ A;  3OE7 G;  1NYH A;  1OZH A;  3GLM A;  3B40 A;  4UCO A;  3ABU A;  2MKV A;  3H1L D;  2VRZ A;  1BDD A;  3TCU A;  3IN6 A;  3RBX A;  4PDV A;  4XFJ A;  2WMM A;  4OWF A;  4FLV A;  4KHX A;  5EK0 A;  1LGH B;  3AG4 C;  2PP6 A;  3OR7 C;  1ZUQ A;  4I0X A;  5B3S C;  1ZL8 A;  2IJJ A;  1ZWI C;  1ZTE A;  4GKJ O;  1UIX A;  2PFX A;  5APX A;  1JY3 O;  3A7O A;  3M0D C;  4BRY A;  2JEX A;  3PJS K;  2C9N Y;  2GUZ B;  2D2C C;  3G4S P;  3IC7 A;  5KA6 A;  1LTI C;  1LUV A;  1FZF A;  2YKO A;  4UXN A;  2XNX A;  4UUJ C;  1YCI A;  1JPX A;  5B5E E;  2N1T D;  3H1H D;  1SS3 A;  4F6R A;  2CH7 A;  3OFN G;  1S3J A;  3MUD A;  4MSW C;  3EWK A;  4NTX A;  2MW2 B;  4U3F G;  2ZE6 A;  1FS0 G;  4CC6 A;  3IAO A;  3M0A A;  1XOU A;  3ASN C;  5L3D A;  3JAT A;  2W0F C;  3VYI A;  4O4J A;  2WSS H;  1S5J A;  1K9M W;  2ARH A;  1DEE G;  1KP3 A;  5BR8 B;  3EXA A;  2NNU A;  5JCO A;  1ZRT E;  1NTZ J;  2OYH A;  4I9W A;  4IHJ A;  2IZ0 A;  1DX7 A;  1FAV A;  1FZC C;  1Q6H A;  3OJA B;  2B87 B;  1YTZ T;  1KEC A;  4UB6 Z;  2Q68 A;  4N6J A;  1V55 C;  3AK2 A;  5CA1 A;  3K57 A;  1WP8 A;  1SQX K;  3ASO C;  1KIL A;  2NPS A;  4U7N A;  1I94 O;  3T1H B;  4F6R B;  2I1K A;  1OMI A;  4TV9 B;  1M56 C;  2WIT A;  1Q81 Q;  2P7J A;  5B1B B;  1BE3 H;  3K9S A;  2E5Y A;  4K35 A;  4H13 D;  2WLL B;  3AEI A;  4YY3 B;  1WB8 A;  2QM4 A;  2QDO A;  3BAB A;  1N8R W;  3BPZ A;  3T97 B;  3HUS C;  5AVQ B;  1YBK A;  3SJC C;  2RCV A;  2B87 A;  2EIK B;  4N21 A;  4B7E A;  2W6I G;  5KUK A;  5IY5 B;  1EN5 A;  4LH7 A;  1D7M A;  4D6T D;  1F51 A;  1YJN V;  1M1J A;  1FKA O;  3SPH A;  4I4T A;  4LWS B;  1QVF U;  1KYO D;  1K5S A;  2V7Q J;  1PV0 A;  1K4C C;  5FL7 G;  2O01 H;  3GW6 A;  4FLT A;  1NU1 E;  4EKW A;  2UUA O;  2ITD C;  2Q6Q A;  3L72 H;  3OEE G;  2CTR A;  4TV8 B;  3CPW U;  2QEX V;  2DQ3 A;  2P1J A;  1HTL C;  4ZKI A;  2YXR B;  3P7K A;  5H5N A;  3CCE V;  1JTH B;  5KTB A;  2XAG A;  4TT3 G;  3H1K E;  5IJ9 A;  3SPJ A;  5LBQ A;  2AGA A;  3E8F A;  1NTZ E;  2FYU D;  1SF9 A;  3FFQ A;  1AQT A;  1Y76 A;  4D6T G;  2N1T C;  2R72 A;  3L71 H;  1ZP0 C;  3ZRX A;  3SYO A;  1KFN A;  5B1B C;  4B3S B;  2Q8V A;  3KCY A;  1GW4 A;  3CXH I;  5TIS E;  3Q5S A;  3M7M X;  4KUM A;  4RUF A;  5AW4 B;  2PUS A;  1KB9 F;  5LOV A;  2N1T A;  4YXW H;  4X64 B;  2AXT E;  2JGU A;  2R70 A;  5LYJ B;  4LF8 O;  3UM7 A;  5J2T A;  2EZP A;  4H44 B;  1FZC B;  1NR1 A;  3CB2 A;  3J7A U;  1JB0 J;  1MZ9 A;  4DR3 O;  1AP5 A;  4C7N A;  3E86 A;  4PV1 D;  2YC0 A;  1RQU A;  3A0B H;  4MVM A;  5IYC O;  4UV9 A;  3CWB H;  1BGY D;  1T3J A;  2A06 E;  5TJH A;  4O4I B;  2DYR C;  3ASN B;  3DXR A;  1YF2 A;  3H1J H;  4KFM A;  4RJT A;  4UB6 E;  1BSM A;  1VQK V;  4XE5 B;  4NKG B;  2PF4 E;  3PHL A;  1OZ0 A;  4GX0 A;  5DEC A;  1OVR A;  4TUY B;  1JX9 A;  1MZE A;  5IE9 A;  4JTA B;  4PD4 I;  2KLU A;  3PRJ A;  2PZS A;  4Q20 A;  2D3O W;  1FJG O;  1SRY A;  4CBC A;  4PHZ A;  4YTP C;  2W27 A;  1QBZ A;  1QVF O;  3T97 A;  2CTQ A;  2XHB A;  4LF9 O;  1IBM O;  4MVQ A;  1NH2 D;  1JY2 N;  4A5U B;  2QWR B;  3AED C;  3JSV C;  2RNB A;  3OUS A;  5FLX N;  2QWN B;  4IFD K;  1R3L C;  2BEQ D;  4LF5 B;  3L75 G;  1PP9 G;  3ABM C;  1SQQ J;  1VF5 D;  4X1I A;  3TNU A;  2E42 A;  5LP6 A;  1SQV K;  3B71 A;  2FFD B;  5LXT B;  5H2F H;  1Q7Y W;  1H2S B;  1AP6 A;  3BRV B;  3CX5 H;  3VOP A;  4WFH A;  3L74 J;  3M9Q A;  4J10 A;  1VQ7 P;  3P3P A;  2L35 A;  2HLD G;  2F4V B;  1JUN A;  1YJW P;  4B3T B;  2EBO A;  4ZKU A;  5LP6 C;  2N05 A;  1SQP G;  3TGU D;  3G9R A;  2OIG A;  4ASW A;  3RWR D;  2OTL V;  1N73 A;  1N34 O;  2M5A A;  2JS5 A;  1VQP P;  3APQ A;  3L73 E;  4C7N B;  2F23 A;  4O4J B;  4AI8 A;  1FOS F;  3TXS A;  1NTM G;  5DJT B;  2ADQ B;  4JI5 B;  1EZV E;  1NTM H;  4LF9 B;  2HVK C;  4MVO A;  2EIN B;  1RY3 A;  4LNU B;  5CJ0 A;  2OTK E;  2W6J H;  3CSX A;  2CTP A;  4JI8 B;  3T2M A;  2X6A A;  1K9M Q;  3K5B A;  5CJ4 A;  2FL4 A;  1SFC B;  3L72 E;  1IC2 A;  2NRG A;  3G71 V;  1BGY E;  1NJI Q;  2WA3 A;  3BY6 A;  1RF1 A;  4I55 B;  3FKS G;  1X4T A;  3ZCC A;  1KKD A;  5AW5 B;  5DJU B;  5CCG C;  3E2E A;  2WSF J;  4LF5 O;  3ZIA G;  4N78 D;  1SQF A;  5E79 E;  2E76 B;  1MNG A;  2B5U A;  1IFN A;  2V4H A;  2P6J A;  3M99 B;  2M3E A;  3PH0 A;  4TV8 A;  3HTK A;  1VP7 A;  1ZLZ A;  4HZ3 A;  2K9P A;  2GTS A;  2LW7 A;  3B8M A;  5B66 Z;  1J1D C;  1QX8 A;  5FPO A;  2P06 A;  2KI7 B;  1DF4 A;  2QM7 A;  1GK9 A;  3W7U A;  1V54 C;  1YTF B;  2E5T A;  2UU9 O;  3FGA D;  3ZHU A;  1IXB A;  4JZG A;  3SWY A;  2EIM B;  3CXH F;  1JM0 A;  4I7Z B;  1SQQ H;  3ICX A;  5APS A;  3MTU E;  1L1F A;  1GM7 A;  3CX5 E;  1YJN P;  4DV1 O;  2PGG A;  1JY3 P;  3CE2 A;  4MS2 A;  1NQT A;  5JJJ B;  3CC7 V;  1MFZ A;  4IT5 A;  2ZE5 A;  1P84 E;  1JVM A;  4Z1V A;  1SER A;  3DTU B;  1N7S B;  3WG7 B;  3LDD A;  2ZKO A;  5IJ9 B;  5GTH Z;  5HFM A;  2HLO A;  1T6A A;  3TF5 A;  3CWB D;  3J81 N;  1SQQ K;  3SYA A;  1L4A A;  4X20 A;  4JI3 O;  1JQ0 A;  3V5B A;  3NFQ A;  3ABK B;  2WSC J;  3ETD A;  3C1L A;  5KLV D;  1SQP K;  4CZZ A;  3QVN A;  5EBW C;  1HR0 B;  4DZO A;  1KMI Z;  1Q6I A;  2KB1 A;  4IHJ B;  3CXH H;  4B3M B;  2ZE7 A;  1VQ4 P;  2Q9I A;  3HKD B;  3OMI B;  3H1K D;  2VRS A;  3IGA C;  1Y6X A;  4PJ0 Z;  2JEE A;  3AE5 C;  3PN1 A;  3S9O A;  1QLE B;  3BAT A;  1KOR A;  2KIK A;  3A3Y B;  1JEK A;  3FB5 C;  1USD A;  2JKV A;  3I5C A;  3RYC B;  4DR4 B;  1Q8I A;  2ZE8 A;  2HHH B;  2UXX A;  1L0L K;  3ABT A;  2GUV A;  3FWL A;  3BA9 A;  2B9B A;  2QG4 A;  1SQP H;  5F2V O;  2AEM A;  5FNV B;  4DJG A;  2N04 A;  1X79 B;  5AW0 B;  4TQF A;  2QTO A;  2JJL A;  2WSE J;  4JAA A;  1QR9 A;  3AG3 B;  5LMN O;  5L3C A;  1XTC C;  4EYY Q;  4ZKP A;  2ILM A;  3ZHV A;  4GKG A;  1IX9 A;  4YHH B;  2UUB B;  3VMZ A;  3H1L H;  4X9Q A;  3RYC A;  5IYD O;  3L70 D;  1N7S A;  1AQ5 A;  1H2G A;  3KDP B;  4IL6 H;  2CK3 G;  3HUS A;  2HFE D;  2IBZ D;  3G80 A;  1XHX A;  1FFX B;  3K04 A;  1VPC A;  2IZ1 A;  1GU4 A;  2JR8 A;  5KLV H;  3ABL B;  4O4H B;  2DE0 X;  4PA7 A;  1RE4 C;  2DQ0 A;  4QE9 A;  3VQX A;  3E89 A;  2Y69 C;  2HPC A;  3U11 A;  4XDK A;  1UJW B;  2GTA A;  3CJH B;  4FFB B;  2PTM A;  3MDS A;  1YIT V;  1OJH A;  4PDL A;  3G6E P;  1WP7 A;  4R7C A;  3ZX6 A;  2QE7 H;  3GVM A;  4J42 A;  4D6T J;  3LSQ A;  4JAS A;  3JSN A;  4AUW A;  5C8Y B;  1M57 C;  3C3S A;  2FKW B;  2FXO A;  2L5G B;  3LNN A;  1HNX B;  5LMN B;  3E22 B;  3RK3 D;  1R6K A;  4JYY A;  1SET A;  4PA3 A;  1L4A C;  5APT A;  2K9J B;  3CMA V;  4PA4 A;  5IJ0 A;  1G1I A;  1SVF A;  2Q67 A;  1A32 A;  5EZY B;  1VQL P;  2QRX A;  1FBM A;  1LTA C;  1LTG C;  1VF5 B;  3RW0 A;  5AW7 B;  1H89 A;  1HDJ A;  1L0N E;  1FPO A;  4MW3 A;  1SQQ G;  4N23 A;  4TSF G;  3ZJZ A;  4CH5 A;  3FXD A;  2BOB C;  1JJ2 U;  3GF7 A;  5EC1 C;  4X1K B;  4LF8 B;  2KNC A;  4I9Q A;  4DR2 O;  1YHQ V;  3RYH A;  1IJD B;  3PLN A;  4LGD E;  2H8P D;  4DR4 O;  1BE3 E;  5B5E H;  1DTO A;  2EIL C;  1SQP J;  3Q1M A;  1HWY A;  2R5D A;  2A45 I;  4YPC A;  3MUD C;  2VQE O;  2RQ6 A;  1R5S A;  5J9P C;  5CBH A;  1BE3 D;  3K79 A;  4XDJ A;  3MIW A;  1M8O B;  5KX5 B;  1HNX O;  5CA0 A;  3D8C A;  4PV1 B;  2B9Z A;  3D36 C;  1EDJ A;  2ATK C;  3M9H A;  3H1L E;  3WB1 A;  1GMJ A;  1BSN A;  4D7T A;  2Q1K A;  1TUE B;  2WWW A;  2HOD A;  4DV0 B;  2IFN A;  2QJY B;  3RL0 D;  3K5O A;  4GIF A;  5APQ A;  1NVP D;  2FYN C;  3WU2 Z;  2H89 C;  3AE6 C;  2BEZ F;  2KG7 A;  1K04 A;  1JMK C;  5K5G B;  2WSF H;  1GL2 D;  4NPE A;  4Z1M G;  1KIL C;  2NPS C;  2WLK A;  3AEG C;  1K34 A;  1K73 W;  4RO2 A;  2E76 D;  3CXH D;  1HBW A;  5IDJ A;  1FDM A;  1BCC D;  2AHZ A;  3CJH A;  4J41 A;  2OAR A;  4IGG A;  1NVP B;  3B5N C;  4U7O A;  3L70 J;  1PD3 A;  5CBO A;  2KXP B;  2FYU K;  1PNK A;  1XBL A;  1H0T A;  1OCC C;  2KQX A;  4B3R O;  1GH6 A;  4LCU C;  1SQP D;  2CAZ C;  1CI6 B;  1EC5 A;  4B08 A;  2CGO A;  1N73 C;  4O4I A;  1BE3 J;  5LP6 B;  1XMO O;  3T4Z A;  1P4R A;  3K9A A;  2YI8 A;  1LTJ A;  3IC9 A;  1QGK B;  3HE5 A;  1NU1 H;  4MW8 A;  2XKM A;  3VMY A;  2KUB A;  4L76 A;  4PEL A;  3NTN A;  1ENV A;  3GHG A;  1L2P A;  3IFM A;  4YIP A;  2ODM A;  2LXC B;  3N7N A;  2LJ2 A;  1Z56 A;  2A06 H;  3CWB E;  3IAY A;  4JI2 O;  3HD7 D;  5GTI E;  4ASV A;  3UT5 B;  2E3C A;  1ZAU A;  1P7G A;  1W2B U;  4JYA B;  1BQ0 A;  2P90 A;  3D70 A;  2OGU A;  2WPR A;  3ZRW B;  2VQF O;  2KSD A;  1N36 B;  2QJ1 A;  4TQD A;  5CN0 A;  1OIP A;  1X9V A;  2H88 C;  4W4L A;  2H43 A;  2P10 A;  1U96 A;  4NB5 A;  3CEI A;  3CL3 D;  3L71 E;  4ZOL A;  2F4V O;  1EXJ A;  1SES A;  2XAQ A;  1KB9 H;  4BWN A;  1JR9 A;  2AZ2 A;  1FZE A;  5JWP A;  3W7S A;  1GO3 F;  3K08 A;  4JYC A;  1U57 A;  2POH A;  1NWQ A;  3QO5 A;  4NXM O;  2ZCE A;  2AXT H;  4R4M A;  2Z4E A;  1VF6 C;  1KIL D;  4BIO A;  2NPS D;  4I5S A;  5GW7 A;  2W90 A;  5LA6 A;  1SQG A;  3JAR A;  5KLV J;  1P49 A;  1S4X A;  2FYU E;  4X20 B;  2QKA A;  1M1J C;  4FLU A;  3OGC C;  2B1G A;  4H44 C;  3K59 A;  3OTO O;  4O2A B;  3I55 V;  3SYQ A;  2DW4 A;  1OW6 A;  1HUC A;  1FXK A;  3H1J E;  2HG5 D;  1XNQ O;  1GL2 A;  1I5X A;  4X89 A;  1YTF D;  2UXN A;  3L73 D;  5LOV B;  2N1T B;  2H7H A;  3SWK A;  2XDJ A;  3CX5 D;  1SQB H;  2WPD G;  4EB6 B;  3JC2 2;  1N7S C;  3RYI A;  2P2U A;  3Q5R A;  3CLQ A;  4U3F E;  4HKZ H;  2EZO A;  3RYI B;  3ABM B;  4GZR B;  3RGB A;  3GWK C;  3OA7 A;  4LF6 O;  4YJ2 B;  1PV3 A;  2YEV A;  1PPJ H;  5CA3 A;  4K8Z A;  5KAI E;  4U3J A;  2Q7C A;  1S5H C;  4YXW G;  1PZQ A;  1RSO A;  4WB4 A;  5BY1 A;  4P9P A;  3FYI B;  2IPP A;  2E5L B;  2QVA A;  1S2E A;  1YIJ P;  1NTK E;  2EJ7 A;  3CMA P;  1KYO I;  3UO2 A;  1NOH A;  2UU9 B;  2OYO A;  1XIL A;  3CCL P;  4DR1 O;  2E75 D;  1I94 B;  4OVN F;  1UII A;  4N78 E;  5EYP B;  1PP9 D;  1WN7 A;  4PDR A;  3H1J J;  2OCC C;  2KS1 A;  1TAE A;  2YMK A;  2K1A A;  2RH0 A;  3L73 J;  3O6Q B;  3RK3 B;  2EJR A;  1JY2 O;  1D5N A;  1KU9 A;  1AJP A;  4X65 B;  3WB0 A;  1ZX3 A;  2HEP A;  2FKX A;  3OTO B;  3BCC J;  3A0H E;  1JNM A;  2WLH A;  1NTM E;  2WLJ A;  1I5Y A;  1OCZ C;  2UXD O;  2KYV A;  4YHH O;  3M9B A;  4NXM B;  1SQX E;  4DO2 A;  1WT6 A;  1V9P A;  3DGE A;  1US6 A;  1NAY A;  2W0X A;  4C46 A;  3ZBH A;  5CCG D;  5CCH D;  1SQQ E;  2JIZ G;  1Y74 B;  1R5L A;  1J5E O;  2X7R B;  4I4T B;  3X2Q B;  2PGD A;  3AG1 B;  2R5B A;  3TGU E;  1YIJ V;  1M1J B;  1N34 B;  4RKU J;  3SSU A;  3CRA A;  3C3T A;  2E43 A;  2P67 A;  3ETG A;  2ZVN B;  5CMZ A;  3AEC C;  1EN6 A;  3BRC A;  3GHG B;  1B06 A;  4R4L A;  5E79 H;  1VAR A;  3T1C A;  1H8H G;  4U3F D;  1R3K C;  5LA6 B;  3SPG A;  1WMK A;  5L3B A;  1SQX J;  2V1D A;  2AXC A;  5B1A B;  4UVB A;  1N32 B;  1OCO B;  4IL6 Z;  3RVY A;  2WSE H;  3B5N D;  1NAF A;  4O4L B;  4CS4 A;  3CD6 V;  4LF7 O;  2AW9 A;  1QVG U;  2KK7 A;  4HBN A;  3FB8 C;  3RBZ A;  4TOI A;  3CRQ A;  1VQN P;  2W6B A;  1LTJ B;  3CC2 V;  2HFE C;  1D2D A;  1NJI W;  3PTZ A;  3CCM P;  2IU3 A;  4DV1 B;  5IWA B;  3CCU V;  3ZDM A;  3SR2 C;  2LGW A;  3HD7 A;  3UT5 A;  4UCT A;  2A06 G;  4GX2 A;  3A0R A;  1WNS A;  1R6T A;  1P84 H;  2NLJ C;  2Q4P A;  1HP8 A;  3H9V A;  1JCC A;  2XND H;  2LFR A;  4DCK A;  1GZL A;  4UB8 E;  1MFT A;  3UQ8 A;  2LXB A;  5AW2 B;  2QKS A;  1FZA A;  1NVO A;  5M1B A;  3P8M C;  2KZJ A;  1G1X B;  4IFM A;  1K4D C;  2HG5 C;  2M3B A;  4X62 B;  1N0N A;  1ZSP A;  3CCR P;  1F4M A;  5H6Q A;  3K03 A;  3S3W A;  2MJZ A;  3E1I A;  5EIB D;  1OFC X;  4IL6 E;  3IFX A;  3AE4 C;  2LO1 A;  1SQB D;  3P32 A;  1JJO A;  5KX5 A;  1GL2 C;  1EZV I;  2FBW C;  2JEU A;  5AW8 B;  2JO1 A;  5LHI A;  2IYO A;  1OCO C;  3FAV B;  3VP9 A;  1DEB A;  4YJ3 A;  2LR2 A;  3JSL A;  5BU5 A;  1VQM V;  4FPP A;  5C93 A;  1PL0 A;  5IWA O;  1VIB A;  3TJT A;  1K5Q A;  1KZU B;  1NKD A;  3JAR B;  2YEV B;  1JCH A;  1QLE C;  5D5P A;  4DV7 O;  4DR2 B;  1FXK B;  2C9L Y;  3WU2 E;  1WA8 A;  2YKP A;  2OYI C;  3AK1 A;  5C39 A;  4ZI7 A;  4WFF A;  4DR3 B;  3RL0 B;  4X1K A;  2KNC B;  2WAM A;  2R3C A;  4XDL A;  4LF6 B;  3ML0 A;  1BHB A;  1NU1 D;  5GTI Z;  4EFB A;  5BMV B;  2KP8 A;  1QQC A;  3ABK C;  4LP8 A;  3VOU A;  1Q81 W;  4J9Y B;  2BTQ A;  2O57 A;  1K92 A;  1LJ2 A;  2DYS C;  2K9J A;  3CYO A;  4DV3 O;  2P22 C;  2J5U A;  1IZ3 A;  4EOT A;  3ASO B;  4PA6 A;  4QNH B;  1A02 F;  1RM1 C;  5KKZ C;  1GDT A;  1G2C B;  3I5D A;  3QWO C;  4MTX A;  1KB9 I;  4X62 O;  1KUQ A;  1N4C A;  4J7K A;  3O8Z A;  5EBM C;  3U1C A;  4X65 O;  2WT7 B;  3FB6 C;  3F7Y C;  3CP1 A;  3T1Y B;  4I7Z C;  1IBL B;  2E75 C;  3RYH B;  3BVH A;  1A02 J;  2ZM6 B;  2IM9 A;  4LFC O;  4O2B A;  2OYH C;  4JTC B;  2KOG A;  2K1E A;  2J58 A;  2QSA A;  1FFX A;  3LDC A;  2ZNI A;  3HUS B;  1NU1 J;  4CH4 A;  4AQY O;  1NS1 A;  1Q3E A;  5B1O A;  1EM1 A;  3WG7 C;  3KQG A;  1KB9 D;  1AJQ A;  4WVZ A;  1R1B A;  5FNV A;  1AVM A;  1VQ4 V;  1UPG A;  3R66 A;  3JCU Z;  3E7K A;  2IJK A;  1VQ9 P;  1KQF B;  2PYJ A;  2GSM B;  4MTG A;  5KHG A;  2K37 A;  4ZMD A;  4ZHQ B;  4FLX A;  1Q86 Q;  1RH5 B;  2IBZ I;  3L70 H;  4JGS A;  1ZW0 A;  1NTK G;  1DD4 A;  4LH6 A;  3ZRV A;  2F95 B;  2EIN C;  2EIJ C;  1VDF A;  1X0T A;  4FLY A;  4L74 A;  1XNR B;  2FXM A;  5CB4 A;  3H25 A;  4JI8 O;  1RM1 B;  2Y4U A;  2JJ2 G;  3H1I J;  4YIO A;  1IUR A;  1E5W A;  5L8R J;  2QEX P;  3HKE A;  2L91 A;  2YDE A;  1IFJ A;  5CA0 B;  1ZN5 A;  4LF7 B;  1HNW B;  3H1I D;  3JCZ A;  2UWJ E;  4OGQ C;  5LGU A;  4K0K B;  3L4F A;  2FML A;  3RYF A;  5LHH A;  1HR0 O;  4LFA O;  4FM2 A;  3HKC B;  2ZQM A;  3F5H A;  3OAK A;  4JQ0 D;  4LFB B;  3H1H E;  3ZMS A;  4JI7 B;  3F89 A;  2ZT9 C;  2IBZ E;  4J11 A;  1OCR B;  2UUA B;  2QR4 A;  4WFE A;  3LNM B;  4DK0 A;  1PGJ A;  4PJ0 E;  4Y99 C;  1MA1 A;  2O1K A;  3WU2 H;  1B04 A;  2ZD9 A;  1O9G A;  2JGD B;  3KYQ A;  1PL4 A;  3CPW O;  2A06 D;  1SQV D;  5KAF E;  1J2J B;  1SQB G;  1N0J A;  3TET A;  2CPS A;  1EQ7 A;  4LLH A;  4WFB V;  1HH0 A;  1H8E G;  4QPK A;  3B2E E;  2NZ2 A;  3H6P A;  3L71 G;  3RK2 B;  1R3I C;  1DH3 A;  3SJA C;  2XU6 A;  1EZJ A;  4K0K O;  2PAJ A;  1EN4 A;  5BMV A;  1Z5W A;  2QWO B;  2QJY C;  4GUN A;  1RF1 B;  3HD7 C;  4DT0 A;  1FXH A;  1K8A W;  2JVD A;  1QCE A;  2R9I A;  4OGQ D;  1RHZ B;  2ZYG A;  5CCH A;  2F1M A;  2ZR3 A;  3A2A A;  2Y69 B;  2UUB O;  1GW3 A;  2KKW A;  3CC4 V;  3GHG C;  1KV4 A;  1BCC G;  1XNR O;  1KP2 A;  3RYF B;  1U97 A;  5APY A;  3M8A A;  2ZYD A;  2WLN A;  1GM9 A;  1AI5 A;  1XMQ B;  1NTK K;  3WUU A;  1AFO A;  3THO A;  1FYJ A;  3FYE B;  4RAI A;  4CPG A;  1NTM J;  1Y66 A;  5BVZ A;  5KAI H;  1GKF A;  1Y4M A;  1XDC A;  1P84 D;  2OTL P;  2B1I A;  3QTC A;  5KHH A;  2DMX A;  3TSI A;  1HW7 A;  4OPH A;  3HKB B;  4ZNC A;  3A8T A;  3WB2 A;  2Y0P A;  4I1L A;  5KJ7 C;  1AI7 A;  5KLI B;  1NTK H;  3AK3 A;  1IBK B;  3CCV V;  1N36 O;  3IR9 A;  3W68 A;  2IX7 C;  2Q3E A;  1HJ0 A;  3CRR A;  4TWK A;  3JCU H;  1RE3 A;  3KPE A;  2IFM A;  4MVZ A;  1J95 A;  2GUS A;  3V6I A;  1NH2 B;  4WWI A;  4I50 B;  1RFY A;  3H1H G;  5JJN B;  2R32 A;  3AEB C;  3K06 A;  5KAF H;  3G71 P;  4QE7 A;  1ZXG A;  2C0X A;  3L9D A;  4NPD A;  4PD4 E;  4BXL A;  5TIS H;  2ZIO A;  1Q5O A;  1KKC A;  1G4Y B;  1QNM A;  2AEJ A;  3K5M A;  3L75 E;  3FWN A;  1DIP A;  2XAJ A;  1CP9 A;  3VQV A;  1PPJ E;  2DN9 A;  1NTM D;  3DXR B;  3VMX A;  2QA4 V;  2SPZ A;  4IYI A;  1HVV A;  1M56 B;  3FB7 C;  1RF1 C;  4K8X A;  3CI9 A;  3CRM A;  4R50 A;  2H8P C;  2OCC B;  1QEX A;  2ZXX A;  4YY3 O;  4Y99 B;  5LHG A;  1VQP V;  5AG2 A;  2ZR2 A;  3L75 D;  3PP5 A;  2QKC A;  2BTQ B;  1L0N G;  2NN4 A;  4G27 B;  1B3Q A;  2OYQ A;  5IY5 C;  5DM6 V;  1BZK A;  2JWA A;  4ZBM A;  1M56 D;  2KB7 P;  1H8A A;  1XUQ A;  2YS8 A;  5HFL A;  4E2L A;  3C9I A;  3V2Q A;  2RN0 A;  3AE7 C;  1JY2 P;  1NBM G;  4Q6G A;  5LYJ A;  4GOD A;  2FTK A;  1GN4 A;  5A2Q N;  4JYA O;  5IYZ B;  1IFD A;  3W7W A;  2HJD A;  2X6C A;  3ZHS A;  2XOK G;  2QSI A;  1CZQ A;  3P8C D;  1QU7 A;  2D2C D;  3A2F A;  4DR1 B;  4DRX B;  1KFM A;  3B5N A;  1XL6 A;  4RWU A;  2KZI A;  3E35 A;  3FAV A;  5FPR A;  4DV5 B;  3GF3 A;  1R8E A;  5EIB C;  3U1A A;  4PV1 C;  1URQ D;  5KA5 A;  1FDO A;  3RGU A;  4X88 A;  3L71 J;  4FLW A;  5AVZ B;  5H2F E;  1NTK J;  1LP1 A;  1KD1 Q;  3IF4 A;  2XZR A;  3B77 A;  2IU0 A;  4GOE A;  2HKO A;  4O2A A;  3L75 J;  4JAU A;  3CME P;  3AG3 C;  1I7F A;  1YDX A;  1CEZ A;  2IYP A;  5KUM A;  3HD7 B;  3BAS A;  3H1K G;  3L72 J;  4H44 D;  3ETE A;  5L3G A;  1MAB G;  4UB8 H;  4NPF X;  4DV7 B;  1M4U A;  3OM3 B;  4KP4 A;  5B66 H;  1RE3 C;  1VQ6 V;  4QIW F;  2QE7 G;  4DXW A;  1S5L X;  3D71 A;  1LTB C;  4M3L A;  2M5A B;  4YJ2 A;  4I55 A;  3HRN A;  1JFF B;  4DV6 O;  5KJ7 D;  2DOS A;  1OXZ A;  2ZDI C;  1RF0 A;  4AQY B;  1YXB A;  4P9O A;  3C90 A;  4UVC A;  1KYO H;  1Q82 W;  1LT1 A;  4X66 B;  5JH7 B;  4DR5 B;  4KJM A;  1GMG A;  3MAQ A;  2W8Z A;  3CCS P;  3OAA G;  1LWU C;  2Y4T A;  3AE3 C;  4OX9 B;  1M7L A;  1OX3 A;  3KZI E;  2Y9Y A;  1N73 B;  3JAW B;  5LL6 Y;  1VQO V;  3F5T A;  5GON B;  4WY4 D;  4DV4 O;  1LR1 A;  3H1L J;  2OYH B;  3LSU A;  3AG2 C;  5AVR B;  3CME V;  1W0K G;  2XV5 A;  5CBG A;  2PYL A;  3AG4 B;  4LBE C;  3CX5 I;  4HB1 A;  1Y74 A;  1K33 A;  2YMY A;  1MSD A;  4D7S A;  1SQB K;  1H2L A;  1AVO A;  4TUY A;  2BOC C;  2Q5Z A;  2WA4 A;  3O9O A;  3S3X A;  2YI9 A;  1MOF A;  3S1K A;  3M91 A;  1MG1 A;  2KLV A;  5CCH C;  2YXY A;  3OT7 A;  3ZHQ A;  4I2L C;  5CA1 B;  3L70 G;  2O1J A;  5AVY B;  4DR5 O;  4QJF B;  2O3J A;  3U59 A;  2JWD A;  4H0L B;  1TU3 F;  3VQW A;  2HYN A;  2A0L A;  3CCS V;  1W5C E;  2WLI B;  1JFF A;  2HVJ C;  2X6B A;  3Q4H B;  3GB7 C;  1AVY A;  2YIB D;  1RSO B;  2DWE C;  1Q86 W;  5LMU B;  1CSB A;  2DJV A;  1WLE A;  4JI6 B;  2IH3 C;  1GTO A;  1ZLL A;  3QNE A;  2BTO A;  4F4L A;  1SQB E;  2YO2 A;  1GRJ A;  1XEQ A;  1GD2 E;  3JYC A;  5APV A;  4Z2W A;  1YHQ P;  2CE4 A;  2BE3 A;  1SFC D;  2O01 N;  2Q6A A;  4BAY A;  1JMB A;  2KS1 B;  3V2N A;  5IT9 N;  2YIC A;  3RL0 C;  2FB5 A;  3H1I H;  4JF3 A;  1AJN A;  2JK5 C;  2Q3I A;  5GON A;  1WAZ A;  3OUF A;  3SYC A;  1MZF A;  2LGQ A;  4D6T H;  4U3J B;  4ZIB A;  3R4Y A;  2JJ1 G;  5JQG B;  1SQV G;  2WVR A;  3R65 A;  4B3S O;  1L0N D;  1PGP A;  1PPJ G;  1OVU A;  3RK2 C;  5ITZ B;  1LTS C;  3FX0 A;  1KTM A;  1PGQ A;  4JI0 B;  2ZXW C;  3CRC A;  3SPI A;  1ZL8 B;  3I56 V;  4AHC A;  1VEW A;  2DYS B;  2JDI G;  1ORQ C;  2IJI A;  1IFP A;  3L72 G;  4H13 B;  5CBF A;  1NTZ G;  1BL8 A;  1JOC A;  3KZI H;  4JV5 B;  1EDL A;  2JS3 A;  2X0L A;  4KL1 A;  3DC6 A;  1Y76 B;  4LFB O;  3S4R A;  2UXD B;  2EX3 A;  3SWF A;  3ZMZ A;  1ZRT D;  1NGM B;  5L3E A;  1BHA A;  2NR5 A;  2KG7 B;  1EZV G;  1XL4 A;  1KQL A;  5GTH E;  2ETN A;  1PPJ D;  4PA9 A;  4ICG A;  3O6Q A;  1LT9 A;  3AEA C;  1SQX G;  3ZN1 A;  2O01 J;  2OCH A;  2WQY C;  2P7T C;  5APW A;  4GKJ B;  1Y8A A;  1TGO A;  2QJP C;  5ITZ A;  1S77 D;  5KLI C;  4JI1 O;  1HNZ B;  1L4A D;  2EUL A;  1FXK C;  3N27 A;  3EFG A;  2A79 B;  2EIK C;  2VWJ A;  2A45 H;  1IBM B;  1YEW A;  4DV2 O;  4LF4 B;  2GA1 A;  1GU5 A;  4FM0 A;  3OEH G;  5CHX A;  1P84 I;  1GN6 A;  3BA8 A;  3KG2 A;  3UKM A;  1XHZ A;  4P2Z A;  3V2P A;  4CS3 A;  1IVS A;  5KJ7 A;  1K3E A;  1RQV A;  3JD4 A;  1J5E B;  3SFE C;  4ASU G;  2HP8 A;  1AA0 A;  3RK2 D;  4WFG A;  1QLE D;  2QWP B;  1PFI A;  1VMG A;  2DW3 A;  1VQ8 P;  4Y28 J;  3KCX A;  1X22 A;  1OVV A;  2YIB A;  2PRR A;  5JVD A;  2WPV B;  4YXD C;  4IFF A;  4B3R B;  2FYZ A;  4GCZ A;  1KIL E;  3E22 A;  1T8Z A;  1VQ6 P;  1CXZ B;  1SP4 A;  2PI5 A;  3H1H J;  3ITK A;  2YIU B;  1F4N A;  5EFW B;  1VQ5 P;  4GYC B;  3W7X A;  5L3F A;  2P58 A;  1L0L G;  2FY8 A;  3GWO A;  3J80 N;  4UCU A;  1BT8 A;  1AR5 A;  1E79 G;  2Q73 A;  3BCC H;  3HKB A;  1IXM A;  4BW5 A;  4JV5 O;  1LTJ C;  1YSC A;  1Z2G A;  4NYK A;  4NXN B;  4UB6 H;  1YZB A;  4MTF A;  5B3S B;  1FC2 C;  1E1R G;  3JAW A;  4ZHQ A;  1S0V A;  3OW2 U;  3FXE A;  1AV1 A;  2IBZ G;  3MGN A;  3BAA A;  1FAF A;  1J1E C;  1ZR4 A;  3I55 P;  2EIM C;  3W7T A;  4KHP B;  1RE4 A;  5K1X A;  4I0X B;  4UCV A;  1VQ9 V;  1VQ8 V;  1X8Y A;  3BCC D;  1MKM A;  2B88 A;  1HJB A;  4EIJ A;  2WZ7 A;  2FXP A;  2OTJ V;  1M1K Q;  2YUA A;  4FLZ A;  1HNZ O;  3HE5 B;  2JDI H;  1FOS E;  1KYO F;  3N2G A;  4CC5 A;  1V54 B;  1K05 A;  3MD0 A;  3E1R A;  4BW9 A;  3B8N A;  1PKX A;  1W2E A;  2YO3 A;  3OW2 O;  1SA0 A;  1BGY J;  1G2C A;  2W6A A;  3N2K A;  2ZYA A;  3D6Z A;  1NR7 A;  1K73 Q;  2ZM6 O;  1M1K W;  1YJ9 P;  2CPB A;  4AQR D;  3K5N A;  1ZR2 A;  3CCJ V;  1XNQ B;  4IOI H;  2QJP B;  4NVP A;  1NI8 A;  1EBO A;  3LW5 J;  1NH4 A;  1WPX A;  3OGI B;  4R8C A;  2WLM A;  1KC8 W;  1JY3 N;  4J9Z B;  3DSQ A;  1L8D A;  4RQE A;  1T3U A;  5CBN A;  1Z5V A;  1R6N A;  3EVK A;  4G2K A;  4PI2 A;  2HPC B;  4IYH A;  1SQQ D;  4DOJ A;  1WA8 B;  3K3W A;  4J7Z A;  4L87 A;  3B4S A;  3N2K B;  1BCC E;  4O4H A;  1LT9 C;  1DK1 A;  1KBH A;  1BGY H;  1SA0 B;  1G6U A;  4GLX A;  2IDB A;  2Q5U A;  2F66 C;  3L72 D;  1MUU A;  3NR7 A;  4IL6 X;  3SPC A;  4DUZ B;  1HF9 A;  1THZ A;  1WPB A;  1OW7 A;  2ITA A;  2ZT9 B;  2Q7E A;  2XAS A;  4MN4 C;  3BVO A;  5K1P A;  2BSK B;  3L74 G;  4I6M C;  1MMM A;  1XMO B;  1QVG O;  4PD4 H;  3P8C E;  4MTO A;  5AVT B;  3BRT B;  3VMA A;  4JI1 B;  1OCC B;  2JRI A;  4BIZ A;  2K88 A;  2E75 B;  3QO7 A;  1L0L H;  4WY4 B;  1FDI A;  3VQY A;  1SQX D;  4RES B;  3VTP C;  4GKK B;  4PI0 A;  3LW5 H;  1VF6 A;  3VBB A;  1XTG B;  1Y67 A;  1H2K A;  4JTD B;  1VQK P;  1WRG A;  2FYU H;  3L73 G;  1YQ3 C;  3SDL A;  4X66 O;  5H2F Z;  4H0L C;  1LWU B;  1FE6 A;  2CK3 H;  3E8B A;  2UXB B;  1URQ C;  3UCS C;  3ABL C;  2M6Y A;  3ZHT A;  4W7Z A;  1YIT P;  3CCM V;  5KHK A;  4PD4 F;  5E1A C;  3B09 A;  3AE8 C;  4U3F H;  5KLV K;  1XI1 A;  4JI4 O;  4LNU A;  3UIA A;  3AG2 B;  4FVM A;  1URQ A;  1LNQ A;  1W0J G;  1PP9 E;  3H1K J;  1QR8 A;  1PGO A;  3V4Q A;  4EDF A;  4W4K A;  2YXL A;  3JD1 A; 
#chains in the Genus database with same CATH homology
 1VQ7 V;  3JD0 A;  2PI4 A;  1AI7 A;  3SYP A;  3ZN0 A;  1NVP D;  4P30 A;  3CCV V;  3NXS A;  1EFR G;  4Z1M G;  4TWK A;  1M9N A;  2YSU B;  4MVZ A;  2WLK A;  1K34 A;  1K73 W;  2IH1 C;  1J95 A;  3E8H A;  4RO2 A;  3HB3 B;  1NH2 B;  3OE7 G;  3ABU A;  5IDJ A;  2ITC C;  2AHZ A;  3OMN B;  3K06 A;  1NVP B;  2HJF C;  4U7O A;  3TCU A;  4QE7 A;  1VQN V;  1PD3 A;  4PDV A;  1PNK A;  1G4Y B;  1RPR A;  1OCC C;  4LCU C;  2XAJ A;  1CP9 A;  5EK0 A;  3AG4 C;  4HYO A;  2QA4 V;  3OR7 C;  1M56 B;  4MVR A;  3FB7 C;  5B3S C;  2IJJ A;  1ZWI C;  3T4Z A;  1P4R A;  3K9A A;  4R50 A;  2H8P C;  3X2Q C;  2OCC B;  3E83 A;  4MW8 A;  2JEX A;  3PJS K;  3D36 A;  4PEL A;  4FIP C;  3IC7 A;  5KA6 A;  5LHG A;  1ENV A;  4RUE A;  1VQP V;  2ZR2 A;  4UXN A;  4UUJ C;  1JPX A;  1DF5 A;  1W2B U;  1ARO P;  1YI2 V;  2P90 A;  4G27 B;  3OFN G;  1S3J A;  4MSW C;  3ZRW B;  5IY5 C;  5DM6 V;  5CN0 A;  4ZBM A;  2M7W A;  3EHB B;  1FS0 G;  3E8G A;  3ASN C;  5HFL A;  1SES A;  5L3D A;  2XAQ A;  4E2L A;  2W0F C;  4H37 A;  3CCQ V;  1NBM G;  2WSS H;  2FTK A;  3W7S A;  1GO3 F;  3K08 A;  1K9M W;  4JYC A;  1KP3 A;  3W7W A;  2X6C A;  2H94 A;  2NNU A;  2XOK G;  4H33 A;  3QO5 A;  4I9W A;  3STL C;  1YJ9 V;  4FK5 C;  4I5S A;  1XL6 A;  5GW7 A;  3E35 A;  1KEC A;  4OXS A;  2Q68 A;  1V55 C;  5KA5 A;  4X88 A;  1CPY A;  3ZRW A;  3ASO C;  3SJQ C;  4U7N A;  3OGC C;  2B1G A;  2DWD C;  3BEH A;  1M56 C;  3B77 A;  2IU0 A;  2W6J G;  2HKO A;  1AI4 A;  5B1B B;  3I55 V;  3P30 A;  3SYQ A;  2E5Y A;  4JAU A;  2DW4 A;  2WLL B;  3AG3 C;  3AEI A;  1FXK A;  5BZB A;  1CEZ A;  1V55 B;  1I5X A;  4X89 A;  5KUM A;  2UXN A;  1YTF D;  1N8R W;  3JD2 A;  4BIU A;  3ETE A;  2WPD G;  5L3G A;  5DN6 G;  1MAB G;  2F43 G;  3OM3 B;  2EIK B;  4KP4 A;  4N21 A;  2EZO A;  2ZXW B;  3ABM B;  4QIW F;  1VQ6 V;  2QE7 G;  2W6I G;  4DXW A;  1OCR C;  5KUK A;  5IY5 B;  1COW G;  2YEV A;  5CA3 A;  1F51 A;  1YJN V;  2WLI A;  2ZDI C;  3SPH A;  1OHH G;  4P9O A;  1S5H C;  4YXW G;  1QVF U;  4UVC A;  1Q82 W;  1K5S A;  4P9P A;  3FYI B;  1GMG A;  1K4C C;  5FL7 G;  4WCE V;  3EFF K;  3OAA G;  4EKW A;  2ITD C;  5EC2 C;  3OEE G;  3CPW U;  2QEX V;  2DQ3 A;  3D3I A;  4ZKI A;  1FS0 E;  3CCE V;  1VQO V;  2XAG A;  4PDR A;  4TT3 G;  3SPJ A;  5LBQ A;  3E8F A;  2OCC C;  5B1A C;  1AQT A;  3AG2 C;  3CME V;  4QPJ A;  1W0K G;  3AG1 C;  2EJR A;  5CBG A;  3ZRX A;  1AJP A;  3AG4 B;  4LBE C;  3SYO A;  3K0D A;  1K33 A;  5B1B C;  1R73 A;  4KUM A;  1PNL A;  2BOC C;  4RUF A;  1MOF A;  1MG1 A;  2WLH A;  2WLJ A;  1I5Y A;  1OCZ C;  4R6Z A;  4RQF A;  4DO2 A;  1SZT A;  3DGE A;  3JD1 A;  3UM7 A;  1FXV A;  2EZP A;  1NR1 A;  4GT1 A;  4QJF B;  2JIZ G;  2Q69 A;  2X7R B;  3WFV A;  2A0L A;  3E86 A;  3X2Q B;  3CCS V;  3AG1 B;  2WLI B;  1YIJ V;  4MVM A;  2HVJ C;  2X6B A;  4UV9 A;  5IYC O;  3GB7 C;  2P67 A;  3ETG A;  2DWE C;  2DYR C;  1Q86 W;  3CCL V;  3ASN B;  4KFM A;  1WLE A;  2IH3 C;  1GTO A;  3RVZ A;  3QNE A;  1VQK V;  4F4L A;  3JYC A;  1OZ0 A;  3T1C A;  4GX0 A;  1OCZ B;  1H8H G;  1JX9 A;  1R3K C;  4JTA B;  1GM8 A;  3SPG A;  2Q6A A;  4BAY A;  3CCR V;  5L3B A;  4Q20 A;  2D3O W;  2V1D A;  1SRY A;  4CBC A;  5B1A B;  4UVB A;  1MSW D;  1QBZ A;  4JF3 A;  1AJN A;  1OCO B;  2JK5 C;  3RVY A;  3OUF A;  3SYC A;  4MVQ A;  1NH2 D;  3CD6 V;  2JJ1 G;  3USS A;  3R65 A;  1QVG U;  3OUS A;  3FB8 C;  3RBZ A;  1R3L C;  2ZXW C;  3ABM C;  3SPI A;  3CC2 V;  2HFE C;  3I56 V;  1NJI W;  2DYS B;  4WFA V;  2JDI G;  1ORQ C;  2IJI A;  3CXC U;  1IFP A;  2IU3 A;  1Q7Y W;  5CBF A;  1BL8 A;  1E1Q G;  3CCU V;  1G8M A;  4WFH A;  2X0L A;  2XAH A;  2HLD G;  4GX2 A;  3A0R A;  4MT8 A;  4MVU A;  3ZMZ A;  2NLJ C;  2EBO A;  5L3E A;  5H9C A;  2XND H;  2LFR A;  1BHA A;  1YJW V;  2OTL V;  1XL4 A;  2MK3 A;  4PA9 A;  4GX5 A;  2QKS A;  4PDM A;  3ZN1 A;  4FJC C;  2WLL A;  1K4D C;  2HG5 C;  1BSH A;  2P7T C;  1F4M A;  5H6Q A;  3K03 A;  1S77 D;  2HVK C;  2EIL B;  4X8A A;  4MVO A;  2EIN B;  3IFX A;  1E79 H;  1M90 W;  3P32 A;  3HPL C;  3STZ C;  1QLN A;  2W6J H;  1FXK C;  2JEU A;  3T2M A;  2X6A A;  2A79 B;  2EIK C;  1K7D A;  5LHI A;  1OCO C;  2HR3 A;  3ZMU A;  1VQM V;  3OEH G;  4FPP A;  5C93 A;  1PL0 A;  3G71 V;  1H38 A;  1K5Q A;  1NKD A;  3BY6 A;  3KG2 A;  2YEV B;  3FKS G;  3UKM A;  4P2Z A;  1JCH A;  1QLE C;  3ZCC A;  1FXK B;  1KKD A;  3E2E A;  5H6R A;  1K3E A;  3ZIA G;  3JD4 A;  4WFF A;  4XBF A;  2LFS A;  2B5U A;  2ZDI A;  3MHS C;  4ASU G;  2WAM A;  3G4S V;  2P6J A;  2Z5U A;  4XDL A;  2WSS G;  3M99 B;  3ML0 A;  4WFG A;  1BHB A;  4GX1 A;  4HZ3 A;  3ABK C;  4LP8 A;  3B8M A;  3VOU A;  1Q81 W;  4J9Y B;  1K92 A;  1DF4 A;  2DYS C;  2QM7 A;  3CYO A;  1GK9 A;  3W7U A;  1V54 C;  1YTF B;  2E5T A;  4GCZ A;  3ASO B;  4PA6 A;  4QNH B;  2EIM B;  2LP7 A;  1RM1 C;  2PI5 A;  5LGN A;  1F4N A;  1GM7 A;  4MTX A;  1L1F A;  3W7X A;  5L3F A;  5B1N A;  3GWO A;  4MS2 A;  1NQT A;  2AHY A;  5EBM C;  3CC7 V;  1E79 G;  1VQ5 V;  1IXM A;  1JVM A;  4BW5 A;  1SER A;  3DTU B;  4QMA A;  3FB6 C;  3F7Y C;  1YSC A;  3CP1 A;  3WG7 B;  3LDD A;  1JOY A;  3ZMT A;  5B3S B;  4MTF A;  1RPO A;  5HFM A;  1E1R G;  4JTC B;  2K1E A;  1S0V A;  1F23 A;  3LSS A;  3OW2 U;  4TLF A;  2IW5 A;  3SYA A;  3LDC A;  1JQ0 A;  2EIM C;  3W7T A;  3ABK B;  5B1O A;  3WG7 C;  1AI6 A;  3ETD A;  4JPR A;  3ZMV A;  4G28 B;  1AJQ A;  4WVZ A;  4CZZ A;  1VQ9 V;  1VQ8 V;  5EBW C;  1VQ4 V;  2KB1 A;  2IJK A;  2GHY A;  2OTJ V;  2GSM B;  4MTG A;  3OMI B;  3QO8 A;  1FFT B;  2C2A A;  2DYR B;  3F7V C;  3IGA C;  2V7Q H;  1QLE B;  3H01 A;  2XAF A;  4JGS A;  2JDI H;  1JEK A;  2Y48 A;  3FB5 C;  1KD1 W;  2A9H A;  1V54 B;  3ZRV A;  2UXX A;  2EIN C;  3ABT A;  2EIJ C;  3MD0 A;  5LGT A;  3B8N A;  1PKX A;  2XND G;  4LC1 A;  3TK1 A;  4DJG A;  1RM1 B;  1P7B A;  2QTO A;  2JJ2 G;  4UV8 A;  1QR9 A;  1NR7 A;  1K97 A;  1M1K W;  3AG3 B;  5L3C A;  4HAM A;  3CCJ V;  3JD3 A;  4JYB A;  1BMF G;  3LDE A;  1EBO A;  3JCZ A;  1WPX A;  4R8C A;  2WLM A;  1KC8 W;  5LGU A;  5IYD O;  1H2G A;  4J9Z B;  5LHH A;  2CK3 G;  2EIJ B;  3ZRS A;  4RQE A;  3K04 A;  1R6N A;  4G2K A;  2ZQM A;  3ABL B;  3F5W C;  4PA7 A;  1B6Q A;  3ZMS A;  2DQ0 A;  3K3W A;  4L87 A;  3E89 A;  4QE9 A;  2Y69 C;  3G6E V;  1OCR B;  4XDK A;  1UJW B;  4WFE A;  1YIT V;  4PDL A;  3LNM B;  4R7C A;  2QE7 H;  2ZD9 A;  3T4D A;  3SPC A;  3LSQ A;  4JAS A;  1THZ A;  4FMT A;  2XAS A;  1M57 C;  2R9R B;  3TET A;  1R6K A;  1SET A;  4PA3 A;  4MTO A;  4WFB V;  1OCC B;  1VQL V;  1H8E G;  4QPK A;  3CMA V;  4PA4 A;  4BIZ A;  1R3I C;  3OR6 C;  3QO7 A;  4UVA A;  2Q67 A;  1EZJ A;  5IYB O;  4WF9 V;  3OMA B;  4JAV A;  3RW0 A;  2QM8 A;  4MW3 A;  1FXH A;  1DLB A;  4MVS A;  4N23 A;  4JTD B;  3VBB A;  1AR1 B;  1KQS U;  5EBL C;  1R3J C;  4TSF G;  3ZJZ A;  1K8A W;  1QCE A;  2BOB C;  2R9I A;  1JJ2 U;  3LUT B;  5EC1 C;  5CMU A;  3MHH C;  1S76 D;  2ZR3 A;  1YHQ V;  2Y69 B;  1ROP A;  3CC4 V;  1S72 V;  2IJH A;  1DTO A;  2EIL C;  3E8B A;  2CK3 H;  3ABL C;  1KP2 A;  3K0G A;  1HWY A;  2Z3Y A;  3CCM V;  2WLN A;  5CBH A;  5J9P C;  3K79 A;  4XDJ A;  1GM9 A;  1M57 B;  1AI5 A;  5E1A C;  2OT5 A;  2V7Q G;  3FYE B;  4RAI A;  3AG2 B;  1PNM A;  2ATK C;  1LNQ A;  1W0J G;  1QR8 A;  1Y66 A;  1BSN A;  1GKF A;  1TUE B;  2WWW A;  1Y4M A;  4YXW H;  2B1I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...