3EFFK

The crystal structure of full-length kcsa in its closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
molecule tags Membrane protein
total genus 43
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3effK02
4R7CA 3IGAC 4J9YB 4GX1A 5KUKA 1OCCC 2DYSC 4R8CA 3RVZA 3SPJA 3E8FA 3LDCA 4MVOA 5IY5C 2WLNA 4JTCB 2AHYA 4G27B 3E89A 4QMAA 2QKSA 2WLLB 1ORQC 1BSHA 2Q67A 3GB7C 2ZXWC 3JYCA 4XDKA 1KKDA 4TLFA 3TETA 4WFGA 4P9PA 4PDVA 3SPCA 3K0DA 4GX2A 2A0LA 2HFEC 3ASOC 3EFFK 5B3SC 1XL4A 4H37A 3E83A 4MVRA 4X8AA 4WFEA 2EINC 3FB8C 2X6BA 2ITDC 4P30A 3SPGA 4WFFA 1QLEC 3LDDA 3UKMA 3AG4C 2ZD9A 4DXWA 2JDIH 4YXWH 2XNDH 4PA3A 3OUSA 3STLC 2K1EA 3PJSK 3AG3C 1XL6A 3FB7C 3SYAA 4MW3A 3F5WC 3SPIA 3E8BA 4RO2A 3SYCA 3ABMC 1R3LC 4UUJC 4JTAB 4PA9A 3KG2A 2WLLA 4XDJA 2OCCC 2Q6AA 4P9OA 5KUMA 4ZBMA 3FB5C 4MS2A 4MVZA 2IH1C 4R6ZA 3T2MA 2EILC 4PA6A 2QTOA 3HPLC 4QE7A 4MVUA 3SPHA 4LBEC 2HVJC 2W0FC 1K4CC 3OGCC 4P2ZA 3ZRSA 1OCRC 5B1AC 4MVSA 1OCOC 4TWKA 2E5YA 4OXSA 4LP8A 2WLMA 3OR7C 5CBFA 2BOCC 3ZJZA 5EBMC 3K0GA 2WLIB 3SYOA 2P7TC 2WLKA 3F7VC 4RAIA 3E8HA 2IH3C 3ASNC 3E8GA 4QE9A 3LUTB 3TCUA 4QNHB 4PDRA 2BOBC 4MTFA 4I9WA 1BSNA 1R3IC 2Q69A 4MVQA 2A79B 3LDEA 1IFPA 3F7YC 3BEHA 1JEKA 3RVYA 3ABLC 2WSSH 2NLJC 4PA7A 4F4LA 3RBZA 2Y69C 4MTOA 4MW8A 3WG7C 3T4DA 3OR6C 2YEVA 2HG5C 5BZBA 2E5TA 5E1AC 1G4YB 4MTGA 3SYPA 1J95A 3K08A 4RUEA 3IFXA 5EBWC 1AQTA 3FB6C 4HYOA 2EIKC 1OCZC 3USSA 1V54C 4HZ3A 2JK5C 2ITCC 2HVKC 3SYQA 4MSWC 3AG1C 3VOUA 2X6AA 4LCUC 4PA4A 1FS0E 2H8PC 1BL8A 4PDMA 5B1BC 5EBLC 1E79H 4KFMA 1R3KC 4EKWA 2DWDC 1K4DC 5EK0A 5CBHA 2DWEC 4GX0A 4H33A 2WLJA 4MVMA 4RUFA 1R3JC 3SJQC 3STZC 3T1CA 1S5HC 4JTDB 1ZWIC 2X6CA 5EC2C 2QE7H 2R9RB 1JVMA 4DJGA 3UM7A 4XDLA 1V55C 3ABKC 1P7BA 2Q68A 2EIJC 3T4ZA 3LNMB 4G28B 2ATKC 2AHZA 4J9ZB 4BW5A 3RW0A 2A9HA 3K04A 3R65A 4R50A 2DYRC 5J9PC 2WLHA 5EC1C 2W6JH 2EIMC 3X2QC 1M56C 3K06A 3E86A 4CBCA 2KB1A 1M57C 5CBGA 4PDLA 2V7QH 4WVZA 4GX5A 4X88A 2WLIA 3K03A 2CK3H 1LNQA 2HJFC 3AG2C 4WFHA 4X89A 3OUFA
chains in the Genus database with same CATH superfamily
1AJPA 2R32A 5KUKA 2DYSC 3QO8A 4NVPA 3UIAA 1GM8A 5IE9A 5DECA 4YY3O 1JJOA 4RQFA 1NU1G 3OW2U 1NKDA 3GHGB 1N8RQ 2K37A 2ZQMA 1PP9G 3CPWO 3H1JJ 3G4SP 4DV6O 2YI8A 4JAVA 2K88A 3HKCB 1N33O 4KT0J 1XILA 3W7TA 4YXWG 1TVKA 1GAXA 5KMGA 1M57D 2F95B 4C7UA 1JCDA 4DR3B 1FXKC 3JAWA 1NTKE 1VF6C 3H9VA 1LT1A 1IZ3A 4U7JA 2LFSA 2XAJA 3OTOO 1E1RG 3HE4A 2LO1A 3A2AA 2BEQD 2UXBO 4P9OA 3CB2A 4R6ZA 1QLNA 2WSEH 1YJNV 4DK1A 3CX5D 3FAVB 5LMNB 4LF4O 3NMDA 4FM1A 1KZUB 1P84D 3RYCB 2ZDIA 3J80N 2W6IG 2N04A 1QCEA 1Q90D 5IYZA 2R5DA 3H1LH 3SYOA 3H1KG 3D8CA 3SGIA 2JP3A 4X66O 2IH3C 2GUZB 2A45H 1D5AA 2F66C 1SS1A 3BEHA 3G6EP 1Y76A 2A45I 1NJIQ 3CC4P 1S4XA 2Q7CA 2YMYA 3I55P 4UVAA 2BSKB 4JYYA 4U3FH 4TV8B 2LGWA 3W68A 3SFEC 1XBLA 3K08A 5L3FA 2JIZG 4OX9O 4HYOA 4PD4E 2QA4P 1JO5A 2CGOA 3CMEP 1OHHG 1COWG 1IC2A 1L0LG 1BE3H 3CI9A 3M9BA 5KLVH 4NPEA 1Q8IA 2WVRA 2O1KA 5KLIC 5JWPA 1IFJA 1QL2A 5H2FH 1GL2B 5EFWB 2UXDO 5E79E 2D2CB 4BWNA 4TV9B 1OVRA 1KFMA 1RHZB 4JTDB 1SKVA 1RPRA 1JVMA 1IDSA 1T2KC 2Z4EA 1FS0G 3L73D 5CA1A 1M1KQ 4WWIA 1KQSO 3T4ZA 1GU5A 1VF6A 1S9KD 2O1JA 3B40A 3OAKA 2FYNB 1A02F 1RE3C 5KAFH 5HFLA 3L35A 4WVZA 4PDLA 4DW1A 4IFFA 2ETNA 2KUBA 1SZXA 1NS1A 3IAOA 5KX5B 2HJFC 2R3CA 3ZHTA 2K9JB 2Z0AA 3K5BA 4O2AB 5JH7A 3W7XA 3JD1A 4DV3B 5DJUB 3UO2A 2FFDC 1PL5A 1O9HA 3RYIA 3ZHSA 5AW4B 3E89A 4YPCA 3H1IG 1SQBH 2B9ZA 3SJBC 3OFNG 4DR4O 2QJYC 1EXIA 1HWTC 3KKYA 3TGUH 3TNUA 4DR7B 1FOSE 4KUMA 4XE5B 3LSQA 2IYPA 1YJNP 4DCKA 2JDIG 3L75H 4MT8A 4JYAB 3AG4C 3LNNA 2YXLA 1OX3A 2ZYAA 3ETGA 3K5OA 2IPPA 3VOPA 3CWBG 3AG3C 2WPVB 3I56P 3PN1A 4BIZA 2RKLA 3F5WC 3MZWB 4I4TA 2A06G 2KG7B 3NTNA 1JY2P 2PF4E 2RH0A 4GIFA 1VQNP 3CRQA 1EDKA 4C7RA 1VARA 5TISZ 2HPCB 5B5EH 2R44A 4Z1VA 1YJ9V 5APYA 3CCEV 1G2CB 1OCRC 1K5QA 2P67A 3IAYA 4GKGA 3WB2A 5AW3B 1YZBA 1N34O 3OW2O 5B1OA 2DQ3A 3B2EE 1AR1B 1DEBA 1Q82W 2WLIB 2ZKOA 2ZE7A 1I5YA 2KI7B 2EIKB 2W6AA 2QWQB 3HUSB 3IF4A 3B5ND 1XREA 4J41A 1SQFA 4UB6Z 1NTZG 3L73J 2M5AA 4I0XB 4BR6A 1IO4A 2QEXV 2YEVA 3FAVA 4JI8B 1HTLC 2FFDA 4Q6GA 3Q4HA 3BCCG 2OT5A 1PPJD 2AEMA 3AEEC 1S5LH 3B8MA 1N0JA 4CZZA 4JAUA 4ASVA 3JC22 1SQQG 5KHJA 4E2LA 2F1MA 4YIPA 1MSDA 3L70H 1Q86Q 4ZHQB 4B3TB 1S5HC 2X6CA 1M4UA 3D70A 3MP7B 1ZTEA 2C0XA 3ABKC 3VMZA 1J1EC 3ZDMA 1EBOA 1TA8A 1Y67A 2L35A 2W6JG 2WSCJ 1BSMA 4PD4F 3A0BZ 1GH6A 2O01J 3L74J 3AEDC 3ZN1A 5AVUB 4LF5B 2ZVOB 1S3JA 2WPRA 1WP7A 3U1CA 4WF9V 2ZT9D 1MG1A 1XQ8A 3ETQA 2E74B 4F6EA 3JD4A 3EVKA 3OT7A 3X2QB 1YHQV 1L0NK 3I5CA 2ITAA 3CRMA 4MVOA 1FAVA 4QMAA 2QKSA 4LC1A 4AYCA 2K9YA 2VRSA 3ZS8C 4B86A 2F43G 3TETA 4D7TA 3V6IA 4FLYA 3HD7D 4GX2A 1DH3A 5BMVB 3L71J 2XT9A 2QVAA 2W8ZA 4GODA 1PP9D 4NTWA 4P30A 1H2KA 1YJ9P 4QJFB 3CCEP 5KX5A 5B66Z 2B88A 4I2LC 4FLUA 3JAKA 4PA3A 3RK2D 3KPEA 4WY4B 1EN6A 2CTWA 2RJZA 5APWA 1NTKG 3FXDA 5KHHA 4YHHO 1BHBA 3G3ZA 1SLQA 3S3XA 3L37A 2B5UA 3R4YA 3H1LE 2W0FC 4FMTA 5K1PA 2KNCB 1JTHA 2HFED 1ZP0C 2A3QA 3BASA 2QEXP 5L3GA 4CC5A 5KHKA 4BWAA 4B3RB 2FL4A 4H44B 1GMGA 5AW2B 4PV1C 3H1KD 2WSFJ 1VQLV 4JI5O 2E75C 2BOBC 3D71A 4U3FE 2A79B 1IFPA 1VEWA 4H0LD 2WZ7A 4OGQC 2E5LB 4FM2A 2OTKE 2NLJC 1L0NJ 2A06H 1EQ7A 2HPCA 4CS2A 1BE3E 4H13D 1BQ0A 2UUAO 5KLVE 5BY1A 3BPZA 1YBKA 4J80A 4WFBV 1Q5OA 4B3SB 5H2FE 3ABLB 1FZBA 2QWPB 3USSA 4IHJB 1NKNA 1XHZA 4I6MC 5B1BC 4LF8B 1IFIA 1WN7A 3CCVV 5CBHA 1L1FA 5CCHA 3STZC 2CTPA 5H6QA 3AE4C 3AG1B 3ZMVA 4ZIBA 4DV5B 5LP6B 5KAFE 4DR2B 1YHQP 4I0XA 3RW0A 2AZ0A 3WB1A 1RM1B 2A9HA 2Y9YA 4X1IA 1HDJA 2Q7HA 3CJHB 1H8HG 2JEUA 1NVOA 3L72E 3CCUV 2V7QH 2PUSA 1JM0A 3HKDA 3E22B 1IXMA 3T97B 3HE5A 5AVSB 2M3BA 4R4MA 2AXTZ 4JV5O 1SQBE 4X9QA 1JFFA 1IFNA 1OCCC 4KP4A 3TGUE 2ARHA 4HAMA 2XHBA 4C7NA 2YXYA 1HNXO 2HODA 4TQFA 4RWUA 1GW4A 4ZKUA 4WFGA 2FBWC 3L75E 3SPCA 2IU3A 2X7RB 2J59M 3K5MA 1HGZA 3M9HA 5LOVB 3CC2V 4JI7O 1QLEC 3TK1A 1IURA 1LTAC 4DXWA 2OYHC 1HNWB 5B3SB 2LW1A 4DV1O 2GA1A 3STLC 2G8YA 2JKVA 2HP8A 3H1KJ 1GTOA 3H32B 3T1YB 1IFMA 3WUTA 3OE7G 3K5LA 3CWBD 1QQCA 2JGUA 1KILE 1BMFG 3KG2A 1J5EO 3OTFA 3T2MA 1BCCJ 1VQLP 1BQZA 1J1DB 2QTSA 2CPSA 5LA6A 3N2GA 4JYBA 1GM9A 4LP8A 1KB9F 3ZIAG 3ZJZA 4D6TH 1CSBA 1M5IA 1BHAA 1E79G 4UV9A 2QKAA 4NXNB 1L4AB 4O4JA 1R5SA 1NH2B 4CPGA 4WY4A 1LTGC 3G9RA 4MTFA 3B5NC 3VQXA 3LDEA 2VQEB 3M99B 4IL6H 3OMIB 4FJCC 1LT9C 2WSSH 1AR5A 4NR1A 3CCVP 1LUWA 5H9CA 3RBZA 4GOEA 4TSFG 1S5LE 5LYJB 1NTZD 1W2BU 1XI1A 4JGSA 1XMQB 4MTGA 5EBWC 3G67A 2FKWB 2VQFO 1HR0O 4LH7A 2DMXA 4PJ0Z 3WG7B 4JF7A 3DXRB 1AA0A 2QGNA 1R3KC 3CCUP 3VMYA 4GZRB 4L87A 3AE7C 3I5DA 4YY3B 1NTZK 4QPJA 4X62O 5FLXN 2EIJC 2HR3A 1XMOO 2EZPA 3N27A 3R65A 4DV6B 1L0LE 3AE9C 3G80A 3KHUA 4IHJA 1H2MA 3GVMA 4J42A 1RQUA 1CW5A 2CK3H 3AG2C 2DYRB 3CC2P 2NR5A 1HBWA 3HKEA 1VF5B 1DK1A 2UUBO 3P8CD 4UB8H 1FDMA 3L36A 2ZIOA 3LDCA 2N1TC 5M1BA 5LP6A 1MSWD 1T2KD 2H89C 4IFMA 3UCSC 2PP6A 3H1JH 1KILC 1K5SA 2PGDA 3PH0A 1PIXA 4MVRA 2XV5A 1LT9A 4EFBA 3AEAC 4I50B 1I94O 3CXHF 2P06A 2Q9LA 3RYHB 3RK2C 1VP7A 1P49A 3PJSK 2WT7B 4IIJB 1H89A 2O01N 1EZVH 3BFRA 1EZVI 5AVTB 4DRXB 2W0XA 4MS2A 4BW9A 3RN4A 4ZOLA 2JJ2G 2E76D 4YJ3B 3JATA 4LR3A 5FPOA 4UXNA 1NTZJ 3OGCC 1T3JA 5LOVA 2MJZA 2WLMA 1AI4A 2GTSA 1S5JA 4LWSB 3H1LG 3PTZA 2KLUA 5EBMC 3K0GA 5D5QA 1MV8A 2UUCO 4RAIA 3M8AA 2ZXXA 1JPXA 3TCUA 1M9NA 2A06E 2A45G 2QJKC 1GKFA 4GKKO 1LTJC 3APOA 2VWKA 4I55A 2YSUB 1M8OB 5IWAO 2LGQA 5JQGA 2Q3EA 3M06A 4U3FG 1QX8A 5BZBA 4F6RB 3K3WA 3LSSA 1GD2E 4OVNF 2N1TA 4BRYA 5DM6V 1BE3G 1LTIC 5KLVG 3DSQA 2IJHA 4YIOA 2KSEA 3RL0C 4LCUC 1Q86W 3SSUA 1QR8A 1KILA 2JWAA 1N32O 4KHPB 2N05A 1E79H 3O9OA 2AGAA 3RGUA 4MVMA 5GTHH 3QO7A 3RK3C 2OCHA 3H6PA 4K0KB 1QR9A 2RN9A 2PRRA 1CI6B 4DV4O 1SFCB 2PI4A 3LW5J 3ML0A 5A2QN 1FFXB 1EDLA 1JMMA 1F4MA 3N4XA 1QVFO 1L2PA 4X65O 2XZRA 1ZLLA 2H7HA 3VMXA 1IBKO 1TUBA 3GLMA 5CBGA 5CBOA 1KP3A 3DXRA 2R3SA 4LFAB 1OW8A 1IX9A 3H1HG 3SWKA 2OTJV 4O4IB 4B3MO 3G6EV 3W7WA 4JI4O 1ZLZA 1FE6A 4HNAA 3I55V 3AECC 1M56B 5APSA 2FXOA 1SQBG 2UXCB 3NFQA 1FXKB 1IFDA 1DD4A 3TGUG 1H8AA 1RF1B 1XNQO 1LTTC 2A0LA 4QGPA 1LTJA 3P7KA 5KA5A 4DT0A 3SR2C 3VYIA 3QO5A 3L75G 4WB4A 4DUZO 1ZRTE 3Q5SA 2ZXWB 1LP1A 1YTFD 2YO2A 2Q5UA 2NPSB 1RP3B 1GO3F 4GDOA 1K34A 3ASOB 4L73A 1Y74A 3OUSA 1VIBA 4L75A 1SVFA 1FJGO 5CHXA 1MKMA 1CZQA 2Y9ZA 3RBXA 5E79Z 2OCCC 2EX3A 2GBOA 1YSCA 2FMLA 3CC7V 5AVVB 2H43A 3ZN0A 4NPFX 4D6TE 4JI2O 3KCXA 3MUDC 4EDFA 4JAAA 2NNUA 3AE5C 1MOFA 4KXRA 2QJPC 3CRAA 3RYFB 2C2AA 1PNLA 3P32A 2HHHO 2QWNB 1RY3A 4C46A 4CS3A 2P7TC 1IBLB 3R66A 4IL6E 1SQXG 1Q81W 3ASNC 3LUTB 4LF9O 1EFRG 4ICGA 1KB9H 2N9BA 4IFDK 1FPOA 1BSNA 5JVDB 1KB9I 3L73H 4DUYO 1KKCA 5LHIA 1X59A 3V5BA 2IX7C 3V4QA 1VQKV 5GONB 2E5TA 2HG5D 2VRZA 4DR6O 3E35A 3SYPA 1LWUC 1UJWB 1N73C 3M0AA 4LF6B 1QEXA 4UCUA 3I56V 2JEEA 1AVMA 3NXSA 3L70G 1NTMD 1VQNV 4O2BB 4Z1MH 2DWDC 1K4DC 1GK9A 4PV1D 1OVUA 2XOKG 2QE7H 5H6RA 3ZHVA 1JY3N 2E75D 2OTJP 4UCSA 3TXQA 2IU0A 5D5PA 4OGQD 4O4LA 2WSCH 3H01A 5AG2A 4JI3B 1AP5A 1RSOA 4B08A 3OMAB 1Q2NA 3L74H 2O01H 2YIBD 2WWWA 4CH6A 5J9PC 3BATA 4DOJA 1OVVA 1YJWV 1MABG 4LFCO 2AZ2A 1NTMK 3CE2A 3LIEA 2P90A 1YITP 3FD9A 3ZX6A 1XDCA 1SQVD 4NB5A 2CTQA 1QGKB 1VQ5P 2CDYA 4WFHA 3MUDA 1YDXA 1PZQA 1SP4A 1NVPB 4R7CA 1N7SB 1SQGA 3CCMP 4GX1A 3H1JE 3SWYA 2BCCG 1MZEA 1YYCA 4JTCB 2FKXA 1URQB 2WLLB 3WUVA 2JJ1G 1SFCA 2F4VO 2PFXA 4XDKA 5L8RJ 3L71H 1USEA 3D6ZA 2Y0CA 1W2EA 5IY5B 4H37A 1R6KA 1SQVK 3TSIA 1FBMA 3MHSC 3A0BH 3CC7P 2M7WA 1LR1A 3JD3A 3SPGA 2QKCA 1S2EA 1EZVE 3F5TA 2L5GB 2XNDH 1KU9A 1LUVA 1VF7A 1LWUA 4JI5B 3H1HH 1BS3A 3FB7C 2HLOA 3S4RA 1N73A 2YNYA 3E8BA 3CXHH 4AUWA 3QVNA 5AVRB 1AI5A 4JTAB 1FJPA 5KHGA 3CXHI 4BAYA 2B1GA 4DYLA 3JARB 4DV0B 2E76C 1RF1A 3SPHA 2UUAB 4LBEC 1AJYA 1G1XB 1NGMB 4ASUG 1JB0J 4TUYA 2ZM6O 4TWKA 1JOCA 5APVA 1VQKP 1R73A 2W6BA 3ZRWB 3KZIZ 2N9YB 4OWFA 4UFZA 2WSFH 3H1LD 3V2PA 3BY6A 3MDSA 5KKZC 1QLED 2YI9A 4IYHA 1USDA 4QNHB 1NTMJ 1OCOB 4FK5C 4I9WA 4DV7B 4U7NA 4FM0A 3V2RA 1L0NH 3AE3C 5L3BA 4PA7A 3W7SA 1FZEA 2YIUB 2B1IA 3WUUA 4CH5A 2YKQA 1NAYA 4U3FD 1GL2C 3GHGA 4WBAA 1X4TA 2D2CC 3ZRXA 3JCUH 3HKCA 2PYLA 2QM7A 1BE3D 3SYQA 5GTHE 2YO3A 4E4EA 4NXMO 5KLVD 4A7PA 3Q5RA 4DR5O 1VQ6V 1SQVJ 1AV1A 3WU2H 1SQPD 2FYUG 4JI0O 2C9LY 1N2DC 1YJWP 4GYCB 3GG2A 2VWJA 3B4SA 3T1CA 1SQXH 3SJQC 1R3JC 5LHGA 4GKJO 1ZWIC 2IBZG 5BU5A 3ZMTA 2R9RB 2FYNC 3UM7A 1HNXB 1QVGU 1IZNB 4CH4A 1IVSA 2B87B 5GONA 3G71V 2CH7B 4ASWA 1AR4A 3IC7A 2I1KA 2XKMA 1AVYA 3QWOC 1PGQA 2BEZF 3CCQP 1D7MA 3RYCA 4FLZA 1TAEA 2V7QG 2ZE8A 1JR9A 1ZL8B 1KYOH 1SQPK 1KYOI 4DV1B 4PI2A 4X89A 3OUFA 2EIMB 1NYHA 1VQPV 3L72D 2GUZA 3RVZA 3E8FA 1M57B 4B7EA 4AQYO 4IL6X 3HB3B 3F89A 4FFKA 1UFIA 3CSXA 3CCLV 1SQBD 3GB7C 1JCCA 2BSKA 2ZFCA 5B1NA 4N78E 5BU8B 1A32A 3CXCU 2WSEJ 4TV8A 2IJIA 1JMKC 2GUVA 2J58A 4N21A 2G38A 1D5NA 2BTOA 3FB8C 5LXTB 4LF7B 3MD0A 3L75D 3GF3A 5DJTB 2GDSA 3CRCA 1G1IA 1P7GA 1GL2A 2AXTH 1N7SA 2OYOA 1H2LA 2ZR3A 1URFA 4MW3A 4TV9A 2EINB 1KQGB 1BCCH 4DK0A 5C93A 1SQBK 1R3LC 4L74A 4YTPC 4J7ZA 3E2EA 1URQA 2WLLA 1M90W 2N1TD 3D36A 4DW0A 2BCCH 1ZMEC 1EXJA 2QTOA 4J7KA 4RQEA 2V4HA 4X64O 1DGSA 3CCRV 1KILD 1HF9A 1BGYG 3ABMB 1NH2D 2XTAA 1NU1D 4D6TG 2E5YA 5CCHC 3HUSC 3FFQA 1KB9E 5IJ9B 3JD0A 4W80A 5APXA 3AEBC 3EWKA 1NT2B 1GK4A 3MIWA 3CCSP 2M6YA 2JS3A 1SQPJ 2K9JA 1GN3A 1MFZA 4PDRA 4O2AA 4K8XA 2WSSG 1R3IC 2Q69A 2V4DA 4OPHA 5J2TB 1RF0C 3A3YB 3EQ2A 1VQ6P 1RPOA 1XMOB 2E43A 3ZHRA 1NU1K 5LGNA 2HG5C 1KD1W 1YQ3C 5E1AC 2HJDA 4N23A 4FZ0A 3PLNA 1ZX3A 3JAMN 3GW6A 5BR8O 1QHTA 1TUEB 3G71P 2NRGA 3U10A 4FLWA 3O65A 2H8PC 3ICXA 3CD6P 4EEQA 1OCZB 2ZR2A 1ZUQA 2LXCB 3L72J 1Q6IA 5CCGA 1Q81Q 3L74E 2KQXA 2YDEA 2KG7A 1FKAO 2ZIMA 4G2KA 3BA8A 1VQPP 1B06A 3V2QA 2GSMB 1Q3EA 4N3YB 1G2CA 2E74C 3HRNA 3P3PA 2B9BA 3WMM0 3IJ4A 3UO3A 3X2QC 4EOTA 3CCLP 4LNUB 2P7JA 2XNXA 2CK3G 1Y6XA 3VQWA 3MHVA 2HKOA 5C8YB 2LW7A 2WLIA 3K03A 4KHXA 1L0LD 1PL4A 3RL0D 1SA0B 4W4LA 1DTOA 2IFNA 2QG4A 3L71E 2FYUH 4DV3O 3HTKB 3HUSA 2WLNA 2LR2A 2CPBA 4WFAV 2P1JA 3RK3D 5FNVB 1WA8B 2IBZH 1R6NA 2B87A 3H1JG 3A0BE 5ITZB 2IBZI 3PP5A 1QVGO 4JI1B 3VMAA 3EFFK 1XL4A 4DR7O 5IJ0B 3BVHA 1RF0A 4WY4C 2Q0OC 1S5LZ 2Y0IA 3H1HE 1NU1J 1L0LK 2ITDC 3DC6A 3UKMA 1PP9J 4JYAO 1F7YA 3CXHE 5KAIH 3CCRP 3ETEA 5AVYB 4AI8A 5GTIZ 2IJKA 2XDJA 1EZVG 3IR9A 4GKKB 1X9VA 1HP8A 3V2NA 1FXVA 1JOYA 2WPQA 3L4FA 1P84F 5CJ4A 4ZHQA 2Q5ZA 5IWAB 2AEJA 2IH1C 1GM7A 5AW0B 4QE7A 3C1LA 3B5NB 3H1ID 2PZSA 4P2ZA 3W67A 2R72A 5LXTA 2EILB 2QWRB 1CPYA 1L0NE 3O6QB 5EZYB 1GN6A 4FIPC 5B1AB 5L3DA 3ZEDA 3AEFC 4W7YA 1I5XA 2DN9A 2YKOA 5B5EE 2Q9IA 2LXBA 1AILA 2YXQB 3DC5A 3ABLC 5CA0B 5CB4B 4DV4B 3KYQA 1AQ5A 1VL2A 2A06D 3JCUE 1OV9A 1KUQA 1AQTA 4X65B 5CMZA 1FZCB 5BMVA 2ZE5A 2ADPA 4RO0A 3WU2E 3A8TA 1SQXE 1BGYH 2Y69B 2XASA 4U3JB 4B3MB 1AB3A 3AG1C 1AJQA 5LP6C 4I7ZB 3JSVC 1L0LJ 2ZYGA 5KJ7C 1GTWA 1OJHA 3B71A 2WLJA 1RM1C 5J2TA 5DN6G 4B3TO 4W4KA 2ZT9B 2XU6A 1PV3A 3LW5H 2R9AA 2UU9O 4I9QA 1N4CA 1WPXA 1MMMA 2QDOA 1KYOE 5LGUA 4G28B 3BRCA 5AVXB 3OD4A 1IBMB 1HNZO 2WLHA 1SZTA 4X20B 2KNCA 1K9MW 2ZYDA 4DZOA 3K06A 4CBCA 1ZR2A 2IW5A 4EIJA 3L70E 4LF5O 3HD7B 1MA1A 3BCCD 3ZCCA 3RFRA 1K8AW 2EZOA 3IC9A 1M1JB 1SQQD 3JALB 4Q20A 4NTXA 2XAFA 5J2UB 3RK2B 2OYIB 1ORQC 1MNGA 2B89A 3FX0A 5HFMA 4DR1O 2NN4A 5KA6A 2LJ2A 1SERA 5B3SC 3H1IJ 3UT5B 3NR7A 4WFEA 2AXTE 2FB5A 2HHHB 1N33B 2X6BA 4UCTA 3W7UA 1Z2GA 3DTUB 3VTPC 5C8YA 4LGDE 1BCCE 2CGNA 3AK1A 3A0HZ 3ZHUA 1SQQK 1SA0A 2BCCE 3GMAA 1PNMA 1JY2N 2IZ1A 4BIOA 1XL6A 4DUYB 1U96A 3OTOB 2YMKA 4NPDA 3FKSG 3H25A 2UXBB 1EM1A 3CWBJ 1WA8A 2KS1B 5JCOA 2QSIA 4MVUA 5KJ7A 4LF4B 1NHLA 4H0LB 3SFDC 2P22C 2OWOA 4FPPA 4MVSA 2DW4A 1K92A 1QNMA 3CJHA 2W83C 1DD3A 4H13B 1FAFA 4UCOA 4Y99B 4B3RO 3IN6A 1K3EA 3E22A 1UPGA 3T97A 4X66B 4QE9A 3K58A 3EFGA 3CMAV 4PELA 1VQ7V 1KFNA 3L73G 4UVBA 5AVZB 2I8DA 5AW6B 3SWFA 3F7YC 5KTBA 5K5GB 1E5WA 3AK2A 5AW5B 1NTKD 3WG7C 2KB7P 3MTUE 1CP9A 1WMKA 1M90Q 3D3IA 3OAAG 1U7JA 3WFVA 2OQQA 4OX9B 1GK6A 4RESB 1BDDA 1JMBA 3E7KA 2JK5C 4LH6A 2YIAA 4R4LA 1HW7A 5KMGB 4GUNA 1JJ2U 3BA9A 3JAWB 5EZYA 4Z1MG 3BCCJ 1GW3A 1GN2A 1US6A 1DF4A 2QE7G 2UXDB 4U7OA 3N2KB 4GX0A 3T1HO 1V54B 2H94A 3H32A 1A02J 3FYEB 2JGDB 1NTKK 3HE4B 2FY8A 1SQQJ 2OARA 2ZJSE 2HEPA 5AW8B 1WP8A 3O8ZA 3JASB 1IXBA 2JEXA 2Q68A 1WRGA 1F4NA 4DR2O 3L74G 5K1XA 1GDTA 4JZGA 4BW5A 1HUCA 2WTYA 1MUUA 1RH5B 3K04A 2IDBA 2DYRC 4L8JA 1FZCA 3M7MX 1GL2D 4HBNA 3LIDA 1V55B 1W0JG 1N7SD 1VF5C 1KD1Q 2YICA 5IYZB 2D2CD 4U3JA 2FYUE 4AQRD 1JCHA 1VQOV 1LNQA 5IYBO 5AW7B 4XA4A 3P3NA 1L4AA 1H2GA 2IBZE 4UUJC 2M3EA 5CJ0A 4PD4D 5GW7A 1Y76B 1NBMG 2GHYA 4DR4B 3L71G 1KYOF 3JYCA 1KKDA 2FXPA 5LYJA 3K0DA 1F23A 2DYSB 4ZI7B 1IK9A 5KAIE 1B6QA 1H2NA 2F93B 1PV0A 1W2BO 5LBQA 2XNDG 1EDJA 1HNWO 2PY5A 2P4VA 2ADQB 2K1EA 3AEGC 3P30A 5LGTA 1VPCA 3T1YO 1HWYA 1Q6UA 1EZVD 1I0HA 3OEHG 3SYCA 3RL0g 1H38A 2BE3A 5CA1B 1CXZB 3CMAP 2QIWA 1X79B 3QTCA 3SDLA 3CX5H 1VQ7P 4Y28J 1NTKJ 1N36O 1P84H 2Z5HA 3CX5I 1YITV 1T6AA 4FVMA 4AILC 1P84I 1VQ5V 1N34B 4M3LA 1OFCX 4J7JA 5CBFA 4IOIH 1KQLA 1RQVA 3CCMV 2CE4A 2BTQB 4DR5B 2YXHA 1NTMH 2JWDA 5JH7B 3C3TA 1L0NG 2I1JA 3JD2A 4DV2O 1BGYE 1KQFB 2ILMA 1R5LA 3TNUB 4JYCA 3TDKA 1PL0A 1XEQA 2L91A 5EIBC 1SQVH 3P8MC 5CCHD 4I50A 3KZIH 3VOUA 3RYHA 3OEEG 3D3QA 2M8RA 3MGNA 1Y47A 1SFCC 5EBLC 1XOUA 4PI0A 3THOA 2WT7A 4IIJA 4AQYB 1H8EG 4I4TB 1VQOP 3KQGA 4OH8B 2AW9A 5JJJB 5KLIB 2YIDA 3R2PA 1SF9A 4DRXA 1VQ4P 2E42A 2KZIA 4YJ3A 5TISH 4R50A 3LSUA 5APTA 2DOSA 3G6BA 3OA7A 2ZNJA 1ZOYC 1M56C 1Y66A 5FL7G 4A5UB 1G1JA 1SRYA 3IFMA 3TXSA 4LWSA 3CL3D 2P5OA 3ETDA 1RF1C 1NO4A 1YTZI 2H8PD 3N2KA 2JGDA 1YIJV 4G27B 4CS4A 3JASA 1GRJA 1JQ0A 2M5AB 1X22A 2Q8VA 4UB6H 2ZXWC 4X1YB 2YEVB 4JZ2A 4DO2A 2EULA 3BABA 3J7AU 4X64B 2NPSC 2QSAA 1KC8W 4TT3H 3ASOC 4F6RA 2FFDB 3Q4HB 1WPBA 4IT5A 2DJVA 2E74D 1VMGA 1HGVA 1AFOA 2WQYC 1K73Q 2E76B 3QNEA 1O9GA 3AE2C 2QJYB 2H3OA 4N78D 4UB8E 1K9MQ 3ZHQA 1JY3O 4FLXA 1GZLA 4UV8A 1GMJA 3QH9A 4JF3A 5GTHZ 1KTMA 1BCCG 1K97A 1HJBA 1DEEG 1EC5A 1IK7A 3GHGC 1K8AQ 2EBOA 4YHHB 1XHXA 3AG4B 3CCQV 2Q6AA 5KKZB 5KUMA 3ZMSA 2K9PA 2EJRA 1CI6A 1H88A 3HPLC 2QWOB 3AG3B 2QRXA 4ZI7A 1FFXA 1FC2C 1QBZA 5BR8B 4OXSA 4Z2WA 3K57A 1XTGB 4WY4D 5L3CA 2ZCEA 4LFBO 1SQPH 3VBBA 4O4IA 1OCRB 3AEIA 2KP8A 1MFTA 1ZXGA 3QG5A 1T5EA 1N86A 4FFBB 4J10A 1KB9D 5IDJA 3GWKC 4BIUA 3TJTA 1FXKA 4FLTA 2YS8A 4MW8A 2Y0EA 1PGOA 1JX9A 5LHHA 5CBNA 2KYVA 1MZFA 4RUEA 4H44D 2IM9A 3FB6C 3CHXA 1PPJH 3UQ8A 1YTZT 4HZ3A 1THZA 1E1QG 2BTQA 1NI8A 5JJEB 1OZ0A 1Y4MA 4PA4A 3JAKB 3K59A 2NPSA 2Q7EA 3B8EB 4KHPO 1XNRO 3L72H 1OW7A 4KFMA 5B66H 1H2SB 1HJ0A 1Q7YQ 1FFTB 2DWEC 1WT6A 3KDPB 4JI6O 5CA3A 5EC2C 2DE0X 4DJGA 4FLVA 4K0KO 2LKMA 1QL1A 2VS0A 3FWNA 2W90A 1LJ2A 1YIJP 2JVDA 1KORA 3L74D 1JTHB 5EC1C 5LMUO 1N7SC 3ABKB 4XBFA 3CCSV 4YXDC 2KB1A 3RYFA 3B77A 1J1EB 1U7MA 1U57A 4LFAO 1URQC 3D36C 3J81N 2HYNA 2GTAA 4JV5B 2BASA 3IGAC 5KJ7D 1YTFB 4NYKA 5IY5C 2KSDA 5JVDA 3U1AA 2QM8A 2UXCO 4IGGA 2Y0PA 2WAMA 4GT1A 3SJAC 3A0RA 3L71D 4P9PA 2PI5A 1AI7A 1NU1H 3CYOA 4WCEV 1PP9H 4JI7B 5KLVK 2PYJA 3CD6V 2KIKA 3E1IA 1RE4C 1VQ9V 3FYIB 4YXWH 3VQYA 4ZKPA 4O2BA 3H1HD 3CX5E 1AJNA 1RE3A 1P84E 3DGEA 1EZJA 1EN5A 1L8DA 3CXHD 4XFJA 2AXCA 1J5EB 4PA6A 4X1YA 1MZ9A 2JS5A 3CS5A 1N7LA 2RNBA 3TGUD 1HH0A 4X1IB 1NTME 1OCOC 1K05A 5TJHA 4GCZA 5CCGC 2BOCC 1AROP 2ODMA 2P4KA 3HKDB 1FDIA 3HE5B 1IBLO 5H2FZ 5EYPB 1JA8A 3H1KH 2OIGA 1ROPA 4DR3O 3E8GA 1K04A 2YIUC 3H1LJ 5GTIH 5JJNB 1AP6A 1JFFB 2LP7A 3CCJV 1W5CE 3BRVB 2UU9B 3EHBB 4C7NB 1L0ND 5C39A 2HODB 1D2DA 2QM4A 4PV1B 1SQVE 3CEIA 4MN4C 2E75B 3VQVA 3ZMZA 3KZIE 1HNZB 4K35A 5LMNO 1OMIA 3RT3C 4L76A 2CAZC 4U3FJ 1L4AD 2EIKC 1BT8A 5KAFZ 4OGQB 2VQFB 1HR0B 2C9NY 4KL1A 4QIWF 4LF6O 2UWJE 4MSWC 3M9QA 1L0LH 2GUSA 1BE3J 3L73E 4PDMA 2EJ7A 5KLVJ 2R70A 3ABTA 4FFBA 4H33A 1LGHB 1YVWA 1SQXD 1S9KE 3GWOA 5TISE 1TU3F 3RWRD 1OIPA 1RE4A 4XDLA 2Q7GA 4X62B 4DR1B 5B1BB 2AEFA 2M0BA 3JARA 2ATKC 1KECA 4O4HB 4JI3O 1LTSC 1M7LA 3S3WA 1S1CX 3MHHC 1BZKA 1ZW0A 2IYOA 5IT9N 5LA6B 3N2GB 4UCVA 2EIMC 1WB7A 1ZR4A 3II6A 1V9PA 1KYOD 1M57C 3N7NA 4GX5A 3ZRWA 2XAHA 4X88A 1Z5WA 2K3RA 1SQXK 4O4JB 5BVZA 1OZHA 3ZMUA 4UB6E 1R6TA 4GLXA 4J9YB 2UUBB 3H1HJ 4R8CA 3SPJA 1X0TA 1UIIA 2P6JA 2G3AA 3L70D 1VQ9P 1FDOA 1NAFA 3U59A 3K79A 4LLHA 5B5EZ 3H1IH 3BAAA 1SQBJ 4PDVA 4JASA 1OCCB 1FOSF 3CLQA 3E83A 2YC0A 5APUA 3TGUJ 3K9AA 2WPSA 3JCUZ 5CN0A 1PM9A 1YCIA 2EINC 4QPKA 1I94B 1FJKA 1VF5D 2UXXA 3VP8A 1EDIA 3WU2Z 3MAQA 2ZD9A 4RKUJ 4PJ0H 2JDIH 2PGGA 3L75J 2W27A 3Q1MA 4HJGH 3CWBH 1T3UA 1FD9A 3ABMC 3B09A 1QLEB 1BCCD 1Z56A 1FZAA 3HR0A 4XDJA 3U11A 2OYHB 1DIPA 3JCZA 3OGIB 3FB5C 4YJ2B 2Q1KA 2R5BA 2BCCD 4DV0O 2F23A 1GN4A 4JBZA 2JR8A 4RJTA 2CH7A 4X1KB 2QJ1A 3CCJP 1SQPE 4TOIA 3M0DC 2OIEA 2Y48A 2D3OW 1VQMV 1WLEA 1ZL8A 5BXZA 3CP1A 1KC8Q 4NTYA 2RMKB 2UUCB 1N0NA 2WLKA 1B3QA 3E8HA 3A0HH 2XUMA 3T1HB 1PFIA 3HKEB 3CX5F 2MKVA 2Y4UA 4DV7O 1SQXJ 1H0TB 1PPJE 4F4LA 4GOFA 4MTOA 1K7DA 4BXLA 1NTZH 1G6UA 3OR6C 4JQ0D 1G4YB 1KN7A 4H44C 2JO1A 3IFXA 3ZRVA 1YQ4C 1LT9B 5B66E 1OCZC 1WB8A 2Q0AA 1XTCC 3BCCH 2HVKC 5AVQB 2CUGA 1XUQA 2OGUA 5EYPA 1BL8A 1N32B 3Q3DA 2WA3A 1SQQH 4HH2A 2V1DA 1PGPA 4RUFA 1WNSA 2P10A 1B04A 3L70J 2UXNA 3OJAB 1N8RW 4ZOLB 2DW3A 4EI2A 1S76D 1JY3P 4J9ZB 3JATB 4JPRA 1GU4A 1P4RA 2K1AA 5LL6Y 4EB6B 2KSJA 4JI8O 1FXHA 2W6JH 2Y0DA 1IBKB 4K8ZA 1JUNA 1SC5B 2EIJB 3FXEA 2O3JA 5IJ9A 2RMZA 4EYYQ 5EIBD 2YIBA 2J5UA 4WBNB 2CTRA 5IYCO 1DF5A 2Q3IA 2YUAA 5JCOC 3HKBB 4FZ1A 4JI4B 3U0ZA 3PHLA 3M0DA 1SFCD 1WJZA 2Q4PA 5DEDA 4AHCA 3OMNB 2MW2B 5L3EA 2FYUD 4I55B 2IZ0A 1NU1E 5JQGB 4PHZA 1OW6A 3AG2B 1BSHA 2YKPA 2Q67A 1PP9E 2IBZD 1N36B 1XNQB 4TLFA 2BCCJ 1IJDB 4O4HA 4J11A 1J2JB 2P2UA 1K73W 4I5SA 3AE8C 4N6JA 2N1TB 4BRYB 4DUZB 1M56D 4LF7O 3LDDA 1NH4A 2IFMA 1ZSPA 1FYJA 1FU1A 1KILB 3PRJA 2FYUK 1PNKA 1NJIW 3WB0A 1FJGB 3BRTB 1VQMP 3SYAA 2JRIA 2GM4A 2KOGA 3FX7A 4RO2A 4DV2B 4JPZB 1NTKH 4ZBMA 4ZMDA 3D6YA 1QVFU 2EILC 2A7WA 3Q5PA 2SPZA 4JI2B 2RN0A 2HVJC 1YI2V 2Q73A 4ABMA 5B1AC 2NPSD 3H1KE 4W7ZA 1TUBB 5GTIE 3K9SA 1DX7A 2X0LA 3OR7C 4CC6A 1NTMG 4LNUA 1VQ8V 4EFEA 1Q82Q 4HNAB 4LF9B 1UIXA 1M1KW 1J1DC 2Z5UA 1JEKA 1ZRTD 1FZCC 3HTKA 4O9BA 2OYHA 4YJ2A 5FNVA 2Y69C 1U97A 1NOHA 3T4DA 2QJKB 3FWLA 4X1KA 5ITZA 1PKXA 1LTJB 1CEZA 4DR6B 1ENVA 2ZVNB 4I7ZC 2FXMA 1L4AC 1PD3A 3BHPA 3C9IA 1M93A 3F5HA 4I1LA 5IJ0A 1SQVG 1S0VA 3C8VA 1LP1B 2ITCC 2ZT9C 5KAIZ 1BGYD 1JY2O 3RGBA 3RK3E 4D6TD 2X6AA 2Y4TA 1Y74B 2OTLV 5FPRA 2NZ2A 4PD4H 4EKWA 2KZJA 5EK0A 1FS0E 4PD4I 2ZAEB 2YXRB 3A7OA 2C0WA 3L9DA 2FYUJ 2WMMA 2LFRA 3ABVC 3RL0B 1NR7A 1H0TA 1SS3A 1P7BA 1NR1A 1TGOA 3CPWU 2E5LO 1YXBA 5E79H 3LNMB 3HD7C 4ZKIA 3ABUA 3B5NA 5APQA 2PAJA 3A2FA 2FTKA 3RK3B 4UCRA 4B3SO 1M1JC 1T8ZA 3ZBHA 3QF7A 4MTXA 4LFCB 3OM3B 4OPAA 1FZGA 1TVKB 2OYIC 3ITKA 1JNMA 1S72V 2V7QJ 3AK3A 1NKZB 3O6QA 2XAQA 4LF8O 3H1IE 3S9OA 2E3CA 2AHYA 5CA0A 5CB4A 5IYDO 1F51A 2MK3A 4DV5O 1R1BA 2F4VB 1OWAA 3TF5A 1FZFA 1K33A 4TT3G 2QR4A 4EB6A 5AW1B 4JI1O 2HFEC 1G8MA 4PJ0E 1KMIZ 1VDFA 1NQTA 4X8AA 1NVPD 2ZINA 1I08A 1DLBA 4LFBB 4NKGB 4WFFA 1EN4A 2POHA 1ZN5A 3CWBE 1NZ6A 4WBNA 1YI2P 3FGAD 2FYZA 1URQD 3HKBA 2P58A 3C90A 1WAZA 3M91A 3SJCC 3S1KA 3KCYA 1ZAUA 1YF2A 1VQ4V 5F2VO 1SESA 3SPIA 4IL6Z 1LTBC 4H0LC 1VQ8P 2N74A 4PA9A 3G4SV 5H5NA 4HB1A 4O4LB 4MVZA 4H13C 1QU7A 3EXAA 5AW9B 1Y9BA 1RSOB 5CMUA 4Y99C 1KV4A 2KKWA 1W59A 3H1JD 1K4CC 4TQDA 3ZRSA 2ZE6A 1YEWA 3A0HE 2ZM6B 4X20A 4ZNCA 2OCCB 3C3SA 1Q43A 1SQPG 3KXDA 3JSLA 4HYTB 5AVWB 1ZV8A 1X8YA 1BGYJ 3HD7A 2DQ0A 3AG7A 3F7VC 1XNRB 4D6TJ 2PTMA 2RDCA 2OYQA 2O57A 2QJPB 4JI6B 3TYYA 1NTZE 2L6LA 1I7FA 1M1JA 4IYIA 4MVQA 1KQSU 4CH3A 3AE6C 3JALA 1R8EA 3RVYA 4B7KA 5J2UA 1W0KG 3AE1C 2OTLP 2GV9A 2JJLA 2OYIA 5KHIA 1AVOA 3ASNB 1Y8AA 3VN0A 3BCCE 3VP9A 5LMUB 1J95A 2LQTA 1PPJG 5A9GA 1OXZA 3UT5A 1V54C 2RQ6A 1SQQE 3K5NA 3B8NA 3E1RA 4K3AA 3CRRA 4NXMB 1Q6HA 5CCGD 3L72G 1HVVA 3CC4V 3BVOA 4KJMA 3A5TA 1LWUB 2WITA 4JI0B 1RFYA 4NXNO 2Z5IA 2KXPB 4UB8Z 1N73B 2ZDIC 2RCVA 2ZNIA 4GKJB 2Q6QA 1PGJA 2WA4A 2R9IA 1BDCA 2Z3YA 1AI6A 1S72P 3RYIB 2VQEO 1KP2A 1V55C 2QA4V 4D7SA 2HLDG 1Q7YW 3CMEV 1KBHA 2KS1A 2KK7A 2AHZA 3APQA 4UVCA 3Q2YA 2ZXEB 1Z5VA 1IBMO 1XMQO 4TUYB 2KLVA 2XAGA 1SETA 1NWQA 1S5LX 2H88C 3P8CE 3E86A 1S77D 3GF7A 2WPDG 3V4WA 3JSNA 2IJJA 4HKZH
chains in the Genus database with same CATH topology
1DTOA 1AJPA 3IGAC 5KUKA 2DYSC 3QO8A 1YTFB 3LDCA 5IY5C 2WLNA 1GM8A 2QM8A 4WFAV 1MSWD 2WAMA 4GT1A 1R6NA 4RQFA 3A0RA 4P9PA 2PI5A 1AI7A 3OW2U 1NKDA 1K5SA 3EFFK 1XL4A 2ZQMA 3CYOA 4WCEV 4JAVA 4MVRA 2ITDC 3CD6V 3W7TA 4YXWG 3UKMA 1VQ9V 3FYIB 4YXWH 3ETEA 1FXKC 2IJKA 3PJSK 1AJNA 1FXVA 1JOYA 2LFSA 2XAJA 1E1RG 3DGEA 1EZJA 4P9OA 4MS2A 4R6ZA 2IH1C 4PA6A 1GM7A 1QLNA 2JJ2G 4QE7A 1YJNV 4UXNA 3OGCC 4P2ZA 2ZDIA 1OCOC 2W6IG 2WLMA 1QCEA 1AI4A 4GCZA 2BOCC 1AROP 2EILB 5EBMC 3K0GA 3SYOA 1CPYA 4RAIA 1JPXA 1ROPA 2IH3C 3E8GA 4FIPC 1M9NA 3TCUA 5B1AB 5L3DA 2LP7A 1I5XA 1GKFA 3CCJV 3BEHA 3EHBB 3ABLC 2YSUB 4UVAA 5BZBA 3ZMZA 3K3WA 3LSSA 3K08A 5L3FA 1AQTA 2JIZG 4HYOA 2EIKC 5DM6V 1OHHG 1COWG 2IJHA 4QIWF 2Y69B 2XASA 4MSWC 3AG1C 1AJQA 4LCUC 1Q86W 1QR8A 4PDMA 1E79H 4H33A 3ABTA 2WLJA 4MVMA 1RM1C 3QO7A 3GWOA 4JTDB 5DN6G 1RPRA 1JVMA 4XDLA 1FS0G 1QR9A 1WPXA 5B1BB 2PI4A 5LGUA 3T4ZA 3ML0A 2ATKC 4G28B 1KECA 3MHHC 1F4MA 2WLHA 1SZTA 2EIMC 1K9MW 5HFLA 3K06A 4CBCA 5CBGA 2IW5A 1M57C 4WVZA 4PDLA 4GX5A 1KP3A 3ZRWA 2XAHA 4X88A 2OTJV 3ZCCA 2HJFC 3G6EV 1K8AW 3ZMUA 3W7WA 2EZOA 3I55V 4J9YB 1M56B 3JD1A 3W7XA 4R8CA 3SPJA 2P6JA 4Q20A 2XAFA 3K79A 3E89A 1FXKB 1ORQC 3OFNG 5HFMA 5KA6A 4PDVA 1SERA 4JASA 1OCCB 2A0LA 5B3SC 5KA5A 3E83A 4KUMA 3K9AA 4WFEA 5CN0A 3LSQA 3QO5A 2EINC 2X6BA 4QPKA 3W7UA 2JDIG 2ZXWB 2UXXA 3DTUB 4MT8A 1YTFD 3AG4C 2ZD9A 2JDIH 1GO3F 1K34A 3ASOB 3ETGA 3OUSA 1PNMA 3AG3C 1XL6A 4BIZA 3F5WC 3ABMC 1QLEB 3FKSG 4XDJA 2OCCC 3JCZA 3FB5C 1YSCA 3CC7V 3ZN0A 4MVUA 1YJ9V 3CCEV 2NNUA 1OCRC 1MOFA 1K5QA 2P67A 4FPPA 2DW4A 1K92A 4MVSA 2Y48A 2D3OW 5B1OA 1VQMV 1WLEA 2C2AA 2DQ3A 3CP1A 1PNLA 3P32A 1AR1B 1Q82W 2WLIB 2P7TC 2WLKA 1I5YA 1K3EA 1Q81W 3E8HA 4QE9A 3ASNC 2EIKB 3LUTB 3CMAV 1EFRG 4PELA 1VQ7V 4UVBA 1BSNA 3F7YC 5LHIA 4F4LA 4MTOA 1K7DA 1VQKV 3WG7C 3OR6C 2YEVA 1CP9A 2QEXV 2E5TA 1G4YB 3D3IA 3OAAG 3E35A 3SYPA 3WFVA 3IFXA 3ZRVA 1UJWB 1OCZC 2OT5A 2JK5C 2HVKC 3B8MA 4CZZA 3I56V 4JAUA 1JJ2U 4Z1MG 3NXSA 1BL8A 1VQNV 1DF4A 2QE7G 4E2LA 2DWDC 1K4DC 4U7OA 1GK9A 2V1DA 4GX0A 1V54B 2H94A 2XOKG 4RUFA 2QE7H 5H6RA 1S5HC 3FYEB 2X6CA 2UXNA 2IU0A 3ABKC 1N8RW 2JEXA 2Q68A 1S76D 1F4NA 3H01A 4J9ZB 4JPRA 1P4RA 4BW5A 1EBOA 3OMAB 2W6JG 3K04A 2DYRC 1FXHA 2WWWA 5J9PC 2W6JH 1YJWV 1MABG 1V55B 1W0JG 3ZN1A 2EIJB 2P90A 1S3JA 1JCHA 1VQOV 4WF9V 5IYCO 1DF5A 1LNQA 1MG1A 5IYBO 4WFHA 1H2GA 1NVPB 3JD4A 4UUJC 4R7CA 3X2QB 1YHQV 4GX1A 3OMNB 5GW7A 5L3EA 4MVOA 4JTCB 1NBMG 4QMAA 2QKSA 2GHYA 2WLLB 4LC1A 3AG2B 1BSHA 2JJ1G 2Q67A 4XDKA 3JYCA 1KKDA 4TLFA 2F43G 3TETA 3K0DA 4GX2A 1F23A 2DYSB 4I5SA 1K73W 1B6QA 4H37A 5IY5B 1R6KA 3MHSC 2M7WA 3JD3A 4P30A 3SPGA 5LBQA 3LDDA 4QJFB 2XNDG 2XNDH 1PNKA 4PA3A 2K1EA 3P30A 1NJIW 5LGTA 3FB7C 3SYAA 1HWYA 3E8BA 4RO2A 3OEHG 3SYCA 1BHBA 1AI5A 4JTAB 1H38A 4BAYA 2B1GA 4ZBMA 1QVFU 2EILC 3SPHA 4LBEC 2B5UA 2HVJC 2W0FC 1YITV 4FMTA 1YI2V 4ASUG 5B1AC 1VQ5V 4TWKA 2X0LA 3OR7C 1R73A 5CBFA 3ZRWB 5L3GA 3CCMV 1VQ8V 3BY6A 1GMGA 4QNHB 1VQLV 1OCOB 4FK5C 2BOBC 1M1KW 4I9WA 2Z5UA 4U7NA 2A79B 3JD2A 1IFPA 1JEKA 5L3BA 2NLJC 4PA7A 3W7SA 2Y69C 2B1IA 3T4DA 1PKXA 4JYCA 1CEZA 1ENVA 1PL0A 4WFBV 1PD3A 3ABLB 3USSA 1S0VA 3ZRXA 2ITCC 2QM7A 3SYQA 3VOUA 3OEEG 2X6AA 1VQ6V 2OTLV 5B1BC 5EBLC 3CCVV 4EKWA 5EK0A 1FS0E 5CBHA 1L1FA 3T1CA 3SJQC 3STZC 1R3JC 5LHGA 1H8EG 5H6QA 1ZWIC 3ZMTA 2R9RB 3UM7A 2LFRA 1QVGU 3AG1B 3ZMVA 1NR7A 1P7BA 1NR1A 3CPWU 3LNMB 3G71V 4ZKIA 3IC7A 3ABUA 3RW0A 1RM1B 2A9HA 4R50A 2FTKA 2V7QG 1H8HG 2JEUA 1M56C 1Y66A 5FL7G 4MTXA 1SRYA 3CCUV 2V7QH 3OM3B 1IXMA 1S72V 3ETDA 2XAQA 4X89A 3OUFA 2EIMB 1VQPV 1OCCC 4KP4A 3RVZA 3E8FA 1M57B 1YIJV 3HB3B 2AHYA 4G27B 4HAMA 5IYDO 1F51A 2MK3A 1JQ0A 3CCLV 3GB7C 2ZXWC 2YEVB 1K33A 4TT3G 4WFGA 5B1NA 4DO2A 3SPCA 3CXCU 1KC8W 2HFEC 3ASOC 1G8MA 2IU3A 2IJIA 2X7RB 1NQTA 4X8AA 4N21A 3CC2V 1NVPD 3FB8C 3QNEA 1DLBA 3MD0A 1QLEC 4WFFA 3TK1A 4DXWA 5B3SB 4UV8A 3STLC 1GTOA 4JF3A 1K97A 2ZR3A 2EINB 1SESA 4MW3A 3OE7G 3SPIA 1VQ4V 5C93A 2EBOA 1R3LC 4PA9A 1BMFG 3KG2A 3E2EA 2WLLA 3AG4B 2Q6AA 3G4SV 3D36A 5KUMA 3ZMSA 3CCQV 1M90W 3T2MA 4MVZA 2EJRA 2QTOA 3HPLC 5CMUA 3AG3B 4RQEA 1K4CC 3ZRSA 3CCRV 1QBZA 3ABMB 1NH2D 4JYBA 1GM9A 2OCCB 4LP8A 4OXSA 3ZIAG 2E5YA 3ZJZA 3JD0A 1BHAA 5L3CA 1E79G 4UV9A 3VBBA 2DQ0A 3F7VC 1OCRB 3AEIA 1NH2B 4PDRA 4MTFA 5IDJA 2WSSG 1R3IC 2Q69A 4MVQA 3LDEA 1KQSU 3M99B 3OMIB 4FJCC 3RVYA 2WSSH 1W0KG 4BIUA 1FXKA 1RPOA 5H9CA 3RBZA 4MW8A 3ASNB 4TSFG 5LGNA 2HG5C 1JX9A 5LHHA 1W2BU 1KD1W 4JGSA 5E1AC 4MTGA 4N23A 1J95A 4RUEA 5EBWC 3FB6C 1V54C 1TUEB 4HZ3A 1THZA 1E1QG 3B8NA 3WG7B 1OZ0A 1Y4MA 4PA4A 3CC4V 2H8PC 4KFMA 1R3KC 1FFTB 2DWEC 1OCZB 2ZR2A 2ZDIC 5CA3A 5EC2C 2R9IA 4L87A 2Z3YA 1AI6A 4DJGA 1KP2A 1V55C 4QPJA 2QA4V 2HLDG 1Q7YW 3CMEV 2EIJC 2HR3A 4G2KA 2AHZA 2EZPA 4UVCA 2GSMB 3R65A 5EC1C 3X2QC 2XAGA 1SETA 3ABKB 4XBFA 3CCSV 3E86A 2KB1A 1S77D 2CK3G 3B77A 2HKOA 2WLIA 2WPDG 3K03A 2CK3H 3AG2C 2IJJA 2DYRB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4R7C A;  3IGA C;  4J9Y B;  4GX1 A;  5KUK A;  1OCC C;  2DYS C;  4R8C A;  3RVZ A;  3SPJ A;  3E8F A;  3LDC A;  4MVO A;  5IY5 C;  2WLN A;  4JTC B;  2AHY A;  4G27 B;  3E89 A;  4QMA A;  2QKS A;  2WLL B;  1ORQ C;  1BSH A;  2Q67 A;  3GB7 C;  2ZXW C;  3JYC A;  4XDK A;  1KKD A;  4TLF A;  3TET A;  4WFG A;  4P9P A;  4PDV A;  3SPC A;  3K0D A;  4GX2 A;  2A0L A;  2HFE C;  3ASO C;  3EFF K;  5B3S C;  1XL4 A;  4H37 A;  3E83 A;  4MVR A;  4X8A A;  4WFE A;  2EIN C;  3FB8 C;  2X6B A;  2ITD C;  4P30 A;  3SPG A;  4WFF A;  1QLE C;  3LDD A;  3UKM A;  3AG4 C;  2ZD9 A;  4DXW A;  2JDI H;  4YXW H;  2XND H;  4PA3 A;  3OUS A;  3STL C;  2K1E A;  3PJS K;  3AG3 C;  1XL6 A;  3FB7 C;  3SYA A;  4MW3 A;  3F5W C;  3SPI A;  3E8B A;  4RO2 A;  3SYC A;  3ABM C;  1R3L C;  4UUJ C;  4JTA B;  4PA9 A;  3KG2 A;  2WLL A;  4XDJ A;  2OCC C;  2Q6A A;  4P9O A;  5KUM A;  4ZBM A;  3FB5 C;  4MS2 A;  4MVZ A;  2IH1 C;  4R6Z A;  3T2M A;  2EIL C;  4PA6 A;  2QTO A;  3HPL C;  4QE7 A;  4MVU A;  3SPH A;  4LBE C;  2HVJ C;  2W0F C;  1K4C C;  3OGC C;  4P2Z A;  3ZRS A;  1OCR C;  5B1A C;  4MVS A;  1OCO C;  4TWK A;  2E5Y A;  4OXS A;  4LP8 A;  2WLM A;  3OR7 C;  5CBF A;  2BOC C;  3ZJZ A;  5EBM C;  3K0G A;  2WLI B;  3SYO A;  2P7T C;  2WLK A;  3F7V C;  4RAI A;  3E8H A;  2IH3 C;  3ASN C;  3E8G A;  4QE9 A;  3LUT B;  3TCU A;  4QNH B;  4PDR A;  2BOB C;  4MTF A;  4I9W A;  1BSN A;  1R3I C;  2Q69 A;  4MVQ A;  2A79 B;  3LDE A;  1IFP A;  3F7Y C;  3BEH A;  1JEK A;  3RVY A;  3ABL C;  2WSS H;  2NLJ C;  4PA7 A;  4F4L A;  3RBZ A;  2Y69 C;  4MTO A;  4MW8 A;  3WG7 C;  3T4D A;  3OR6 C;  2YEV A;  2HG5 C;  5BZB A;  2E5T A;  5E1A C;  1G4Y B;  4MTG A;  3SYP A;  1J95 A;  3K08 A;  4RUE A;  3IFX A;  5EBW C;  1AQT A;  3FB6 C;  4HYO A;  2EIK C;  1OCZ C;  3USS A;  1V54 C;  4HZ3 A;  2JK5 C;  2ITC C;  2HVK C;  3SYQ A;  4MSW C;  3AG1 C;  3VOU A;  2X6A A;  4LCU C;  4PA4 A;  1FS0 E;  2H8P C;  1BL8 A;  4PDM A;  5B1B C;  5EBL C;  1E79 H;  4KFM A;  1R3K C;  4EKW A;  2DWD C;  1K4D C;  5EK0 A;  5CBH A;  2DWE C;  4GX0 A;  4H33 A;  2WLJ A;  4MVM A;  4RUF A;  1R3J C;  3SJQ C;  3STZ C;  3T1C A;  1S5H C;  4JTD B;  1ZWI C;  2X6C A;  5EC2 C;  2QE7 H;  2R9R B;  1JVM A;  4DJG A;  3UM7 A;  4XDL A;  1V55 C;  3ABK C;  1P7B A;  2Q68 A;  2EIJ C;  3T4Z A;  3LNM B;  4G28 B;  2ATK C;  2AHZ A;  4J9Z B;  4BW5 A;  3RW0 A;  2A9H A;  3K04 A;  3R65 A;  4R50 A;  2DYR C;  5J9P C;  2WLH A;  5EC1 C;  2W6J H;  2EIM C;  3X2Q C;  1M56 C;  3K06 A;  3E86 A;  4CBC A;  2KB1 A;  1M57 C;  5CBG A;  4PDL A;  2V7Q H;  4WVZ A;  4GX5 A;  4X88 A;  2WLI A;  3K03 A;  2CK3 H;  1LNQ A;  2HJF C;  3AG2 C;  4WFH A;  4X89 A;  3OUF A; 
#chains in the Genus database with same CATH topology
 1AJP A;  2R32 A;  5KUK A;  2DYS C;  3QO8 A;  4NVP A;  3UIA A;  1GM8 A;  5IE9 A;  5DEC A;  4YY3 O;  1JJO A;  4RQF A;  1NU1 G;  3OW2 U;  1NKD A;  3GHG B;  1N8R Q;  2K37 A;  2ZQM A;  1PP9 G;  3CPW O;  3H1J J;  3G4S P;  4DV6 O;  2YI8 A;  4JAV A;  2K88 A;  3HKC B;  1N33 O;  4KT0 J;  1XIL A;  3W7T A;  4YXW G;  1TVK A;  1GAX A;  5KMG A;  1M57 D;  2F95 B;  4C7U A;  1JCD A;  4DR3 B;  1FXK C;  3JAW A;  1NTK E;  1VF6 C;  3H9V A;  1LT1 A;  1IZ3 A;  4U7J A;  2LFS A;  2XAJ A;  3OTO O;  1E1R G;  3HE4 A;  2LO1 A;  3A2A A;  2BEQ D;  2UXB O;  4P9O A;  3CB2 A;  4R6Z A;  1QLN A;  2WSE H;  1YJN V;  4DK1 A;  3CX5 D;  3FAV B;  5LMN B;  4LF4 O;  3NMD A;  4FM1 A;  1KZU B;  1P84 D;  3RYC B;  2ZDI A;  3J80 N;  2W6I G;  2N04 A;  1QCE A;  1Q90 D;  5IYZ A;  2R5D A;  3H1L H;  3SYO A;  3H1K G;  3D8C A;  3SGI A;  2JP3 A;  4X66 O;  2IH3 C;  2GUZ B;  2A45 H;  1D5A A;  2F66 C;  1SS1 A;  3BEH A;  3G6E P;  1Y76 A;  2A45 I;  1NJI Q;  3CC4 P;  1S4X A;  2Q7C A;  2YMY A;  3I55 P;  4UVA A;  2BSK B;  4JYY A;  4U3F H;  4TV8 B;  2LGW A;  3W68 A;  3SFE C;  1XBL A;  3K08 A;  5L3F A;  2JIZ G;  4OX9 O;  4HYO A;  4PD4 E;  2QA4 P;  1JO5 A;  2CGO A;  3CME P;  1OHH G;  1COW G;  1IC2 A;  1L0L G;  1BE3 H;  3CI9 A;  3M9B A;  5KLV H;  4NPE A;  1Q8I A;  2WVR A;  2O1K A;  5KLI C;  5JWP A;  1IFJ A;  1QL2 A;  5H2F H;  1GL2 B;  5EFW B;  2UXD O;  5E79 E;  2D2C B;  4BWN A;  4TV9 B;  1OVR A;  1KFM A;  1RHZ B;  4JTD B;  1SKV A;  1RPR A;  1JVM A;  1IDS A;  1T2K C;  2Z4E A;  1FS0 G;  3L73 D;  5CA1 A;  1M1K Q;  4WWI A;  1KQS O;  3T4Z A;  1GU5 A;  1VF6 A;  1S9K D;  2O1J A;  3B40 A;  3OAK A;  2FYN B;  1A02 F;  1RE3 C;  5KAF H;  5HFL A;  3L35 A;  4WVZ A;  4PDL A;  4DW1 A;  4IFF A;  2ETN A;  2KUB A;  1SZX A;  1NS1 A;  3IAO A;  5KX5 B;  2HJF C;  2R3C A;  3ZHT A;  2K9J B;  2Z0A A;  3K5B A;  4O2A B;  5JH7 A;  3W7X A;  3JD1 A;  4DV3 B;  5DJU B;  3UO2 A;  2FFD C;  1PL5 A;  1O9H A;  3RYI A;  3ZHS A;  5AW4 B;  3E89 A;  4YPC A;  3H1I G;  1SQB H;  2B9Z A;  3SJB C;  3OFN G;  4DR4 O;  2QJY C;  1EXI A;  1HWT C;  3KKY A;  3TGU H;  3TNU A;  4DR7 B;  1FOS E;  4KUM A;  4XE5 B;  3LSQ A;  2IYP A;  1YJN P;  4DCK A;  2JDI G;  3L75 H;  4MT8 A;  4JYA B;  3AG4 C;  3LNN A;  2YXL A;  1OX3 A;  2ZYA A;  3ETG A;  3K5O A;  2IPP A;  3VOP A;  3CWB G;  3AG3 C;  2WPV B;  3I56 P;  3PN1 A;  4BIZ A;  2RKL A;  3F5W C;  3MZW B;  4I4T A;  2A06 G;  2KG7 B;  3NTN A;  1JY2 P;  2PF4 E;  2RH0 A;  4GIF A;  1VQN P;  3CRQ A;  1EDK A;  4C7R A;  1VAR A;  5TIS Z;  2HPC B;  5B5E H;  2R44 A;  4Z1V A;  1YJ9 V;  5APY A;  3CCE V;  1G2C B;  1OCR C;  1K5Q A;  2P67 A;  3IAY A;  4GKG A;  3WB2 A;  5AW3 B;  1YZB A;  1N34 O;  3OW2 O;  5B1O A;  2DQ3 A;  3B2E E;  1AR1 B;  1DEB A;  1Q82 W;  2WLI B;  2ZKO A;  2ZE7 A;  1I5Y A;  2KI7 B;  2EIK B;  2W6A A;  2QWQ B;  3HUS B;  3IF4 A;  3B5N D;  1XRE A;  4J41 A;  1SQF A;  4UB6 Z;  1NTZ G;  3L73 J;  2M5A A;  4I0X B;  4BR6 A;  1IO4 A;  2QEX V;  2YEV A;  3FAV A;  4JI8 B;  1HTL C;  2FFD A;  4Q6G A;  3Q4H A;  3BCC G;  2OT5 A;  1PPJ D;  2AEM A;  3AEE C;  1S5L H;  3B8M A;  1N0J A;  4CZZ A;  4JAU A;  4ASV A;  3JC2 2;  1SQQ G;  5KHJ A;  4E2L A;  2F1M A;  4YIP A;  1MSD A;  3L70 H;  1Q86 Q;  4ZHQ B;  4B3T B;  1S5H C;  2X6C A;  1M4U A;  3D70 A;  3MP7 B;  1ZTE A;  2C0X A;  3ABK C;  3VMZ A;  1J1E C;  3ZDM A;  1EBO A;  1TA8 A;  1Y67 A;  2L35 A;  2W6J G;  2WSC J;  1BSM A;  4PD4 F;  3A0B Z;  1GH6 A;  2O01 J;  3L74 J;  3AED C;  3ZN1 A;  5AVU B;  4LF5 B;  2ZVO B;  1S3J A;  2WPR A;  1WP7 A;  3U1C A;  4WF9 V;  2ZT9 D;  1MG1 A;  1XQ8 A;  3ETQ A;  2E74 B;  4F6E A;  3JD4 A;  3EVK A;  3OT7 A;  3X2Q B;  1YHQ V;  1L0N K;  3I5C A;  2ITA A;  3CRM A;  4MVO A;  1FAV A;  4QMA A;  2QKS A;  4LC1 A;  4AYC A;  2K9Y A;  2VRS A;  3ZS8 C;  4B86 A;  2F43 G;  3TET A;  4D7T A;  3V6I A;  4FLY A;  3HD7 D;  4GX2 A;  1DH3 A;  5BMV B;  3L71 J;  2XT9 A;  2QVA A;  2W8Z A;  4GOD A;  1PP9 D;  4NTW A;  4P30 A;  1H2K A;  1YJ9 P;  4QJF B;  3CCE P;  5KX5 A;  5B66 Z;  2B88 A;  4I2L C;  4FLU A;  3JAK A;  4PA3 A;  3RK2 D;  3KPE A;  4WY4 B;  1EN6 A;  2CTW A;  2RJZ A;  5APW A;  1NTK G;  3FXD A;  5KHH A;  4YHH O;  1BHB A;  3G3Z A;  1SLQ A;  3S3X A;  3L37 A;  2B5U A;  3R4Y A;  3H1L E;  2W0F C;  4FMT A;  5K1P A;  2KNC B;  1JTH A;  2HFE D;  1ZP0 C;  2A3Q A;  3BAS A;  2QEX P;  5L3G A;  4CC5 A;  5KHK A;  4BWA A;  4B3R B;  2FL4 A;  4H44 B;  1GMG A;  5AW2 B;  4PV1 C;  3H1K D;  2WSF J;  1VQL V;  4JI5 O;  2E75 C;  2BOB C;  3D71 A;  4U3F E;  2A79 B;  1IFP A;  1VEW A;  4H0L D;  2WZ7 A;  4OGQ C;  2E5L B;  4FM2 A;  2OTK E;  2NLJ C;  1L0N J;  2A06 H;  1EQ7 A;  2HPC A;  4CS2 A;  1BE3 E;  4H13 D;  1BQ0 A;  2UUA O;  5KLV E;  5BY1 A;  3BPZ A;  1YBK A;  4J80 A;  4WFB V;  1Q5O A;  4B3S B;  5H2F E;  3ABL B;  1FZB A;  2QWP B;  3USS A;  4IHJ B;  1NKN A;  1XHZ A;  4I6M C;  5B1B C;  4LF8 B;  1IFI A;  1WN7 A;  3CCV V;  5CBH A;  1L1F A;  5CCH A;  3STZ C;  2CTP A;  5H6Q A;  3AE4 C;  3AG1 B;  3ZMV A;  4ZIB A;  4DV5 B;  5LP6 B;  5KAF E;  4DR2 B;  1YHQ P;  4I0X A;  3RW0 A;  2AZ0 A;  3WB1 A;  1RM1 B;  2A9H A;  2Y9Y A;  4X1I A;  1HDJ A;  2Q7H A;  3CJH B;  1H8H G;  2JEU A;  1NVO A;  3L72 E;  3CCU V;  2V7Q H;  2PUS A;  1JM0 A;  3HKD A;  3E22 B;  1IXM A;  3T97 B;  3HE5 A;  5AVS B;  2M3B A;  4R4M A;  2AXT Z;  4JV5 O;  1SQB E;  4X9Q A;  1JFF A;  1IFN A;  1OCC C;  4KP4 A;  3TGU E;  2ARH A;  4HAM A;  2XHB A;  4C7N A;  2YXY A;  1HNX O;  2HOD A;  4TQF A;  4RWU A;  1GW4 A;  4ZKU A;  4WFG A;  2FBW C;  3L75 E;  3SPC A;  2IU3 A;  2X7R B;  2J59 M;  3K5M A;  1HGZ A;  3M9H A;  5LOV B;  3CC2 V;  4JI7 O;  1QLE C;  3TK1 A;  1IUR A;  1LTA C;  4DXW A;  2OYH C;  1HNW B;  5B3S B;  2LW1 A;  4DV1 O;  2GA1 A;  3STL C;  2G8Y A;  2JKV A;  2HP8 A;  3H1K J;  1GTO A;  3H32 B;  3T1Y B;  1IFM A;  3WUT A;  3OE7 G;  3K5L A;  3CWB D;  1QQC A;  2JGU A;  1KIL E;  1BMF G;  3KG2 A;  1J5E O;  3OTF A;  3T2M A;  1BCC J;  1VQL P;  1BQZ A;  1J1D B;  2QTS A;  2CPS A;  5LA6 A;  3N2G A;  4JYB A;  1GM9 A;  4LP8 A;  1KB9 F;  3ZIA G;  3ZJZ A;  4D6T H;  1CSB A;  1M5I A;  1BHA A;  1E79 G;  4UV9 A;  2QKA A;  4NXN B;  1L4A B;  4O4J A;  1R5S A;  1NH2 B;  4CPG A;  4WY4 A;  1LTG C;  3G9R A;  4MTF A;  3B5N C;  3VQX A;  3LDE A;  2VQE B;  3M99 B;  4IL6 H;  3OMI B;  4FJC C;  1LT9 C;  2WSS H;  1AR5 A;  4NR1 A;  3CCV P;  1LUW A;  5H9C A;  3RBZ A;  4GOE A;  4TSF G;  1S5L E;  5LYJ B;  1NTZ D;  1W2B U;  1XI1 A;  4JGS A;  1XMQ B;  4MTG A;  5EBW C;  3G67 A;  2FKW B;  2VQF O;  1HR0 O;  4LH7 A;  2DMX A;  4PJ0 Z;  3WG7 B;  4JF7 A;  3DXR B;  1AA0 A;  2QGN A;  1R3K C;  3CCU P;  3VMY A;  4GZR B;  4L87 A;  3AE7 C;  3I5D A;  4YY3 B;  1NTZ K;  4QPJ A;  4X62 O;  5FLX N;  2EIJ C;  2HR3 A;  1XMO O;  2EZP A;  3N27 A;  3R65 A;  4DV6 B;  1L0L E;  3AE9 C;  3G80 A;  3KHU A;  4IHJ A;  1H2M A;  3GVM A;  4J42 A;  1RQU A;  1CW5 A;  2CK3 H;  3AG2 C;  2DYR B;  3CC2 P;  2NR5 A;  1HBW A;  3HKE A;  1VF5 B;  1DK1 A;  2UUB O;  3P8C D;  4UB8 H;  1FDM A;  3L36 A;  2ZIO A;  3LDC A;  2N1T C;  5M1B A;  5LP6 A;  1MSW D;  1T2K D;  2H89 C;  4IFM A;  3UCS C;  2PP6 A;  3H1J H;  1KIL C;  1K5S A;  2PGD A;  3PH0 A;  1PIX A;  4MVR A;  2XV5 A;  1LT9 A;  4EFB A;  3AEA C;  4I50 B;  1I94 O;  3CXH F;  2P06 A;  2Q9L A;  3RYH B;  3RK2 C;  1VP7 A;  1P49 A;  3PJS K;  2WT7 B;  4IIJ B;  1H89 A;  2O01 N;  1EZV H;  3BFR A;  1EZV I;  5AVT B;  4DRX B;  2W0X A;  4MS2 A;  4BW9 A;  3RN4 A;  4ZOL A;  2JJ2 G;  2E76 D;  4YJ3 B;  3JAT A;  4LR3 A;  5FPO A;  4UXN A;  1NTZ J;  3OGC C;  1T3J A;  5LOV A;  2MJZ A;  2WLM A;  1AI4 A;  2GTS A;  1S5J A;  4LWS B;  3H1L G;  3PTZ A;  2KLU A;  5EBM C;  3K0G A;  5D5Q A;  1MV8 A;  2UUC O;  4RAI A;  3M8A A;  2ZXX A;  1JPX A;  3TCU A;  1M9N A;  2A06 E;  2A45 G;  2QJK C;  1GKF A;  4GKK O;  1LTJ C;  3APO A;  2VWK A;  4I55 A;  2YSU B;  1M8O B;  5IWA O;  2LGQ A;  5JQG A;  2Q3E A;  3M06 A;  4U3F G;  1QX8 A;  5BZB A;  4F6R B;  3K3W A;  3LSS A;  1GD2 E;  4OVN F;  2N1T A;  4BRY A;  5DM6 V;  1BE3 G;  1LTI C;  5KLV G;  3DSQ A;  2IJH A;  4YIO A;  2KSE A;  3RL0 C;  4LCU C;  1Q86 W;  3SSU A;  1QR8 A;  1KIL A;  2JWA A;  1N32 O;  4KHP B;  2N05 A;  1E79 H;  3O9O A;  2AGA A;  3RGU A;  4MVM A;  5GTH H;  3QO7 A;  3RK3 C;  2OCH A;  3H6P A;  4K0K B;  1QR9 A;  2RN9 A;  2PRR A;  1CI6 B;  4DV4 O;  1SFC B;  2PI4 A;  3LW5 J;  3ML0 A;  5A2Q N;  1FFX B;  1EDL A;  1JMM A;  1F4M A;  3N4X A;  1QVF O;  1L2P A;  4X65 O;  2XZR A;  1ZLL A;  2H7H A;  3VMX A;  1IBK O;  1TUB A;  3GLM A;  5CBG A;  5CBO A;  1KP3 A;  3DXR A;  2R3S A;  4LFA B;  1OW8 A;  1IX9 A;  3H1H G;  3SWK A;  2OTJ V;  4O4I B;  4B3M O;  3G6E V;  3W7W A;  4JI4 O;  1ZLZ A;  1FE6 A;  4HNA A;  3I55 V;  3AEC C;  1M56 B;  5APS A;  2FXO A;  1SQB G;  2UXC B;  3NFQ A;  1FXK B;  1IFD A;  1DD4 A;  3TGU G;  1H8A A;  1RF1 B;  1XNQ O;  1LTT C;  2A0L A;  4QGP A;  1LTJ A;  3P7K A;  5KA5 A;  4DT0 A;  3SR2 C;  3VYI A;  3QO5 A;  3L75 G;  4WB4 A;  4DUZ O;  1ZRT E;  3Q5S A;  2ZXW B;  1LP1 A;  1YTF D;  2YO2 A;  2Q5U A;  2NPS B;  1RP3 B;  1GO3 F;  4GDO A;  1K34 A;  3ASO B;  4L73 A;  1Y74 A;  3OUS A;  1VIB A;  4L75 A;  1SVF A;  1FJG O;  5CHX A;  1MKM A;  1CZQ A;  2Y9Z A;  3RBX A;  5E79 Z;  2OCC C;  2EX3 A;  2GBO A;  1YSC A;  2FML A;  3CC7 V;  5AVV B;  2H43 A;  3ZN0 A;  4NPF X;  4D6T E;  4JI2 O;  3KCX A;  3MUD C;  4EDF A;  4JAA A;  2NNU A;  3AE5 C;  1MOF A;  4KXR A;  2QJP C;  3CRA A;  3RYF B;  2C2A A;  1PNL A;  3P32 A;  2HHH O;  2QWN B;  1RY3 A;  4C46 A;  4CS3 A;  2P7T C;  1IBL B;  3R66 A;  4IL6 E;  1SQX G;  1Q81 W;  3ASN C;  3LUT B;  4LF9 O;  1EFR G;  4ICG A;  1KB9 H;  2N9B A;  4IFD K;  1FPO A;  1BSN A;  5JVD B;  1KB9 I;  3L73 H;  4DUY O;  1KKC A;  5LHI A;  1X59 A;  3V5B A;  2IX7 C;  3V4Q A;  1VQK V;  5GON B;  2E5T A;  2HG5 D;  2VRZ A;  4DR6 O;  3E35 A;  3SYP A;  1LWU C;  1UJW B;  1N73 C;  3M0A A;  4LF6 B;  1QEX A;  4UCU A;  3I56 V;  2JEE A;  1AVM A;  3NXS A;  3L70 G;  1NTM D;  1VQN V;  4O2B B;  4Z1M H;  2DWD C;  1K4D C;  1GK9 A;  4PV1 D;  1OVU A;  2XOK G;  2QE7 H;  5H6R A;  3ZHV A;  1JY3 N;  2E75 D;  2OTJ P;  4UCS A;  3TXQ A;  2IU0 A;  5D5P A;  4OGQ D;  4O4L A;  2WSC H;  3H01 A;  5AG2 A;  4JI3 B;  1AP5 A;  1RSO A;  4B08 A;  3OMA B;  1Q2N A;  3L74 H;  2O01 H;  2YIB D;  2WWW A;  4CH6 A;  5J9P C;  3BAT A;  4DOJ A;  1OVV A;  1YJW V;  1MAB G;  4LFC O;  2AZ2 A;  1NTM K;  3CE2 A;  3LIE A;  2P90 A;  1YIT P;  3FD9 A;  3ZX6 A;  1XDC A;  1SQV D;  4NB5 A;  2CTQ A;  1QGK B;  1VQ5 P;  2CDY A;  4WFH A;  3MUD A;  1YDX A;  1PZQ A;  1SP4 A;  1NVP B;  4R7C A;  1N7S B;  1SQG A;  3CCM P;  4GX1 A;  3H1J E;  3SWY A;  2BCC G;  1MZE A;  1YYC A;  4JTC B;  2FKX A;  1URQ B;  2WLL B;  3WUV A;  2JJ1 G;  1SFC A;  2F4V O;  2PFX A;  4XDK A;  5L8R J;  3L71 H;  1USE A;  3D6Z A;  2Y0C A;  1W2E A;  5IY5 B;  4H37 A;  1R6K A;  1SQV K;  3TSI A;  1FBM A;  3MHS C;  3A0B H;  3CC7 P;  2M7W A;  1LR1 A;  3JD3 A;  3SPG A;  2QKC A;  1S2E A;  1EZV E;  3F5T A;  2L5G B;  2XND H;  1KU9 A;  1LUV A;  1VF7 A;  1LWU A;  4JI5 B;  3H1H H;  1BS3 A;  3FB7 C;  2HLO A;  3S4R A;  1N73 A;  2YNY A;  3E8B A;  3CXH H;  4AUW A;  3QVN A;  5AVR B;  1AI5 A;  4JTA B;  1FJP A;  5KHG A;  3CXH I;  4BAY A;  2B1G A;  4DYL A;  3JAR B;  4DV0 B;  2E76 C;  1RF1 A;  3SPH A;  2UUA B;  4LBE C;  1AJY A;  1G1X B;  1NGM B;  4ASU G;  1JB0 J;  4TUY A;  2ZM6 O;  4TWK A;  1JOC A;  5APV A;  1VQK P;  1R73 A;  2W6B A;  3ZRW B;  3KZI Z;  2N9Y B;  4OWF A;  4UFZ A;  2WSF H;  3H1L D;  3V2P A;  3BY6 A;  3MDS A;  5KKZ C;  1QLE D;  2YI9 A;  4IYH A;  1USD A;  4QNH B;  1NTM J;  1OCO B;  4FK5 C;  4I9W A;  4DV7 B;  4U7N A;  4FM0 A;  3V2R A;  1L0N H;  3AE3 C;  5L3B A;  4PA7 A;  3W7S A;  1FZE A;  2YIU B;  2B1I A;  3WUU A;  4CH5 A;  2YKQ A;  1NAY A;  4U3F D;  1GL2 C;  3GHG A;  4WBA A;  1X4T A;  2D2C C;  3ZRX A;  3JCU H;  3HKC A;  2PYL A;  2QM7 A;  1BE3 D;  3SYQ A;  5GTH E;  2YO3 A;  4E4E A;  4NXM O;  5KLV D;  4A7P A;  3Q5R A;  4DR5 O;  1VQ6 V;  1SQV J;  1AV1 A;  3WU2 H;  1SQP D;  2FYU G;  4JI0 O;  2C9L Y;  1N2D C;  1YJW P;  4GYC B;  3GG2 A;  2VWJ A;  3B4S A;  3T1C A;  1SQX H;  3SJQ C;  1R3J C;  5LHG A;  4GKJ O;  1ZWI C;  2IBZ G;  5BU5 A;  3ZMT A;  2R9R B;  2FYN C;  3UM7 A;  1HNX B;  1QVG U;  1IZN B;  4CH4 A;  1IVS A;  2B87 B;  5GON A;  3G71 V;  2CH7 B;  4ASW A;  1AR4 A;  3IC7 A;  2I1K A;  2XKM A;  1AVY A;  3QWO C;  1PGQ A;  2BEZ F;  3CCQ P;  1D7M A;  3RYC A;  4FLZ A;  1TAE A;  2V7Q G;  2ZE8 A;  1JR9 A;  1ZL8 B;  1KYO H;  1SQP K;  1KYO I;  4DV1 B;  4PI2 A;  4X89 A;  3OUF A;  2EIM B;  1NYH A;  1VQP V;  3L72 D;  2GUZ A;  3RVZ A;  3E8F A;  1M57 B;  4B7E A;  4AQY O;  4IL6 X;  3HB3 B;  3F89 A;  4FFK A;  1UFI A;  3CSX A;  3CCL V;  1SQB D;  3GB7 C;  1JCC A;  2BSK A;  2ZFC A;  5B1N A;  4N78 E;  5BU8 B;  1A32 A;  3CXC U;  2WSE J;  4TV8 A;  2IJI A;  1JMK C;  2GUV A;  2J58 A;  4N21 A;  2G38 A;  1D5N A;  2BTO A;  3FB8 C;  5LXT B;  4LF7 B;  3MD0 A;  3L75 D;  3GF3 A;  5DJT B;  2GDS A;  3CRC A;  1G1I A;  1P7G A;  1GL2 A;  2AXT H;  1N7S A;  2OYO A;  1H2L A;  2ZR3 A;  1URF A;  4MW3 A;  4TV9 A;  2EIN B;  1KQG B;  1BCC H;  4DK0 A;  5C93 A;  1SQB K;  1R3L C;  4L74 A;  4YTP C;  4J7Z A;  3E2E A;  1URQ A;  2WLL A;  1M90 W;  2N1T D;  3D36 A;  4DW0 A;  2BCC H;  1ZME C;  1EXJ A;  2QTO A;  4J7K A;  4RQE A;  2V4H A;  4X64 O;  1DGS A;  3CCR V;  1KIL D;  1HF9 A;  1BGY G;  3ABM B;  1NH2 D;  2XTA A;  1NU1 D;  4D6T G;  2E5Y A;  5CCH C;  3HUS C;  3FFQ A;  1KB9 E;  5IJ9 B;  3JD0 A;  4W80 A;  5APX A;  3AEB C;  3EWK A;  1NT2 B;  1GK4 A;  3MIW A;  3CCS P;  2M6Y A;  2JS3 A;  1SQP J;  2K9J A;  1GN3 A;  1MFZ A;  4PDR A;  4O2A A;  4K8X A;  2WSS G;  1R3I C;  2Q69 A;  2V4D A;  4OPH A;  5J2T B;  1RF0 C;  3A3Y B;  3EQ2 A;  1VQ6 P;  1RPO A;  1XMO B;  2E43 A;  3ZHR A;  1NU1 K;  5LGN A;  2HG5 C;  1KD1 W;  1YQ3 C;  5E1A C;  2HJD A;  4N23 A;  4FZ0 A;  3PLN A;  1ZX3 A;  3JAM N;  3GW6 A;  5BR8 O;  1QHT A;  1TUE B;  3G71 P;  2NRG A;  3U10 A;  4FLW A;  3O65 A;  2H8P C;  3ICX A;  3CD6 P;  4EEQ A;  1OCZ B;  2ZR2 A;  1ZUQ A;  2LXC B;  3L72 J;  1Q6I A;  5CCG A;  1Q81 Q;  3L74 E;  2KQX A;  2YDE A;  2KG7 A;  1FKA O;  2ZIM A;  4G2K A;  3BA8 A;  1VQP P;  1B06 A;  3V2Q A;  2GSM B;  1Q3E A;  4N3Y B;  1G2C A;  2E74 C;  3HRN A;  3P3P A;  2B9B A;  3WMM 0;  3IJ4 A;  3UO3 A;  3X2Q C;  4EOT A;  3CCL P;  4LNU B;  2P7J A;  2XNX A;  2CK3 G;  1Y6X A;  3VQW A;  3MHV A;  2HKO A;  5C8Y B;  2LW7 A;  2WLI A;  3K03 A;  4KHX A;  1L0L D;  1PL4 A;  3RL0 D;  1SA0 B;  4W4L A;  1DTO A;  2IFN A;  2QG4 A;  3L71 E;  2FYU H;  4DV3 O;  3HTK B;  3HUS A;  2WLN A;  2LR2 A;  2CPB A;  4WFA V;  2P1J A;  3RK3 D;  5FNV B;  1WA8 B;  2IBZ H;  1R6N A;  2B87 A;  3H1J G;  3A0B E;  5ITZ B;  2IBZ I;  3PP5 A;  1QVG O;  4JI1 B;  3VMA A;  3EFF K;  1XL4 A;  4DR7 O;  5IJ0 B;  3BVH A;  1RF0 A;  4WY4 C;  2Q0O C;  1S5L Z;  2Y0I A;  3H1H E;  1NU1 J;  1L0L K;  2ITD C;  3DC6 A;  3UKM A;  1PP9 J;  4JYA O;  1F7Y A;  3CXH E;  5KAI H;  3CCR P;  3ETE A;  5AVY B;  4AI8 A;  5GTI Z;  2IJK A;  2XDJ A;  1EZV G;  3IR9 A;  4GKK B;  1X9V A;  1HP8 A;  3V2N A;  1FXV A;  1JOY A;  2WPQ A;  3L4F A;  1P84 F;  5CJ4 A;  4ZHQ A;  2Q5Z A;  5IWA B;  2AEJ A;  2IH1 C;  1GM7 A;  5AW0 B;  4QE7 A;  3C1L A;  3B5N B;  3H1I D;  2PZS A;  4P2Z A;  3W67 A;  2R72 A;  5LXT A;  2EIL B;  2QWR B;  1CPY A;  1L0N E;  3O6Q B;  5EZY B;  1GN6 A;  4FIP C;  5B1A B;  5L3D A;  3ZED A;  3AEF C;  4W7Y A;  1I5X A;  2DN9 A;  2YKO A;  5B5E E;  2Q9I A;  2LXB A;  1AIL A;  2YXQ B;  3DC5 A;  3ABL C;  5CA0 B;  5CB4 B;  4DV4 B;  3KYQ A;  1AQ5 A;  1VL2 A;  2A06 D;  3JCU E;  1OV9 A;  1KUQ A;  1AQT A;  4X65 B;  5CMZ A;  1FZC B;  5BMV A;  2ZE5 A;  2ADP A;  4RO0 A;  3WU2 E;  3A8T A;  1SQX E;  1BGY H;  2Y69 B;  2XAS A;  4U3J B;  4B3M B;  1AB3 A;  3AG1 C;  1AJQ A;  5LP6 C;  4I7Z B;  3JSV C;  1L0L J;  2ZYG A;  5KJ7 C;  1GTW A;  1OJH A;  3B71 A;  2WLJ A;  1RM1 C;  5J2T A;  5DN6 G;  4B3T O;  4W4K A;  2ZT9 B;  2XU6 A;  1PV3 A;  3LW5 H;  2R9A A;  2UU9 O;  4I9Q A;  1N4C A;  1WPX A;  1MMM A;  2QDO A;  1KYO E;  5LGU A;  4G28 B;  3BRC A;  5AVX B;  3OD4 A;  1IBM B;  1HNZ O;  2WLH A;  1SZT A;  4X20 B;  2KNC A;  1K9M W;  2ZYD A;  4DZO A;  3K06 A;  4CBC A;  1ZR2 A;  2IW5 A;  4EIJ A;  3L70 E;  4LF5 O;  3HD7 B;  1MA1 A;  3BCC D;  3ZCC A;  3RFR A;  1K8A W;  2EZO A;  3IC9 A;  1M1J B;  1SQQ D;  3JAL B;  4Q20 A;  4NTX A;  2XAF A;  5J2U B;  3RK2 B;  2OYI B;  1ORQ C;  1MNG A;  2B89 A;  3FX0 A;  5HFM A;  4DR1 O;  2NN4 A;  5KA6 A;  2LJ2 A;  1SER A;  5B3S C;  3H1I J;  3UT5 B;  3NR7 A;  4WFE A;  2AXT E;  2FB5 A;  2HHH B;  1N33 B;  2X6B A;  4UCT A;  3W7U A;  1Z2G A;  3DTU B;  3VTP C;  5C8Y A;  4LGD E;  1BCC E;  2CGN A;  3AK1 A;  3A0H Z;  3ZHU A;  1SQQ K;  1SA0 A;  2BCC E;  3GMA A;  1PNM A;  1JY2 N;  2IZ1 A;  4BIO A;  1XL6 A;  4DUY B;  1U96 A;  3OTO B;  2YMK A;  4NPD A;  3FKS G;  3H25 A;  2UXB B;  1EM1 A;  3CWB J;  1WA8 A;  2KS1 B;  5JCO A;  2QSI A;  4MVU A;  5KJ7 A;  4LF4 B;  1NHL A;  4H0L B;  3SFD C;  2P22 C;  2OWO A;  4FPP A;  4MVS A;  2DW4 A;  1K92 A;  1QNM A;  3CJH A;  2W83 C;  1DD3 A;  4H13 B;  1FAF A;  4UCO A;  4Y99 B;  4B3R O;  3IN6 A;  1K3E A;  3E22 A;  1UPG A;  3T97 A;  4X66 B;  4QE9 A;  3K58 A;  3EFG A;  3CMA V;  4PEL A;  1VQ7 V;  1KFN A;  3L73 G;  4UVB A;  5AVZ B;  2I8D A;  5AW6 B;  3SWF A;  3F7Y C;  5KTB A;  5K5G B;  1E5W A;  3AK2 A;  5AW5 B;  1NTK D;  3WG7 C;  2KB7 P;  3MTU E;  1CP9 A;  1WMK A;  1M90 Q;  3D3I A;  3OAA G;  1U7J A;  3WFV A;  2OQQ A;  4OX9 B;  1GK6 A;  4RES B;  1BDD A;  1JMB A;  3E7K A;  2JK5 C;  4LH6 A;  2YIA A;  4R4L A;  1HW7 A;  5KMG B;  4GUN A;  1JJ2 U;  3BA9 A;  3JAW B;  5EZY A;  4Z1M G;  3BCC J;  1GW3 A;  1GN2 A;  1US6 A;  1DF4 A;  2QE7 G;  2UXD B;  4U7O A;  3N2K B;  4GX0 A;  3T1H O;  1V54 B;  2H94 A;  3H32 A;  1A02 J;  3FYE B;  2JGD B;  1NTK K;  3HE4 B;  2FY8 A;  1SQQ J;  2OAR A;  2ZJS E;  2HEP A;  5AW8 B;  1WP8 A;  3O8Z A;  3JAS B;  1IXB A;  2JEX A;  2Q68 A;  1WRG A;  1F4N A;  4DR2 O;  3L74 G;  5K1X A;  1GDT A;  4JZG A;  4BW5 A;  1HUC A;  2WTY A;  1MUU A;  1RH5 B;  3K04 A;  2IDB A;  2DYR C;  4L8J A;  1FZC A;  3M7M X;  1GL2 D;  4HBN A;  3LID A;  1V55 B;  1W0J G;  1N7S D;  1VF5 C;  1KD1 Q;  2YIC A;  5IYZ B;  2D2C D;  4U3J A;  2FYU E;  4AQR D;  1JCH A;  1VQO V;  1LNQ A;  5IYB O;  5AW7 B;  4XA4 A;  3P3N A;  1L4A A;  1H2G A;  2IBZ E;  4UUJ C;  2M3E A;  5CJ0 A;  4PD4 D;  5GW7 A;  1Y76 B;  1NBM G;  2GHY A;  4DR4 B;  3L71 G;  1KYO F;  3JYC A;  1KKD A;  2FXP A;  5LYJ A;  3K0D A;  1F23 A;  2DYS B;  4ZI7 B;  1IK9 A;  5KAI E;  1B6Q A;  1H2N A;  2F93 B;  1PV0 A;  1W2B O;  5LBQ A;  2XND G;  1EDJ A;  1HNW O;  2PY5 A;  2P4V A;  2ADQ B;  2K1E A;  3AEG C;  3P30 A;  5LGT A;  1VPC A;  3T1Y O;  1HWY A;  1Q6U A;  1EZV D;  1I0H A;  3OEH G;  3SYC A;  3RL0 g;  1H38 A;  2BE3 A;  5CA1 B;  1CXZ B;  3CMA P;  2QIW A;  1X79 B;  3QTC A;  3SDL A;  3CX5 H;  1VQ7 P;  4Y28 J;  1NTK J;  1N36 O;  1P84 H;  2Z5H A;  3CX5 I;  1YIT V;  1T6A A;  4FVM A;  4AIL C;  1P84 I;  1VQ5 V;  1N34 B;  4M3L A;  1OFC X;  4J7J A;  5CBF A;  4IOI H;  1KQL A;  1RQV A;  3CCM V;  2CE4 A;  2BTQ B;  4DR5 B;  2YXH A;  1NTM H;  2JWD A;  5JH7 B;  3C3T A;  1L0N G;  2I1J A;  3JD2 A;  4DV2 O;  1BGY E;  1KQF B;  2ILM A;  1R5L A;  3TNU B;  4JYC A;  3TDK A;  1PL0 A;  1XEQ A;  2L91 A;  5EIB C;  1SQV H;  3P8M C;  5CCH D;  4I50 A;  3KZI H;  3VOU A;  3RYH A;  3OEE G;  3D3Q A;  2M8R A;  3MGN A;  1Y47 A;  1SFC C;  5EBL C;  1XOU A;  4PI0 A;  3THO A;  2WT7 A;  4IIJ A;  4AQY B;  1H8E G;  4I4T B;  1VQO P;  3KQG A;  4OH8 B;  2AW9 A;  5JJJ B;  5KLI B;  2YID A;  3R2P A;  1SF9 A;  4DRX A;  1VQ4 P;  2E42 A;  2KZI A;  4YJ3 A;  5TIS H;  4R50 A;  3LSU A;  5APT A;  2DOS A;  3G6B A;  3OA7 A;  2ZNJ A;  1ZOY C;  1M56 C;  1Y66 A;  5FL7 G;  4A5U B;  1G1J A;  1SRY A;  3IFM A;  3TXS A;  4LWS A;  3CL3 D;  2P5O A;  3ETD A;  1RF1 C;  1NO4 A;  1YTZ I;  2H8P D;  3N2K A;  2JGD A;  1YIJ V;  4G27 B;  4CS4 A;  3JAS A;  1GRJ A;  1JQ0 A;  2M5A B;  1X22 A;  2Q8V A;  4UB6 H;  2ZXW C;  4X1Y B;  2YEV B;  4JZ2 A;  4DO2 A;  2EUL A;  3BAB A;  3J7A U;  4X64 B;  2NPS C;  2QSA A;  1KC8 W;  4TT3 H;  3ASO C;  4F6R A;  2FFD B;  3Q4H B;  1WPB A;  4IT5 A;  2DJV A;  2E74 D;  1VMG A;  1HGV A;  1AFO A;  2WQY C;  1K73 Q;  2E76 B;  3QNE A;  1O9G A;  3AE2 C;  2QJY B;  2H3O A;  4N78 D;  4UB8 E;  1K9M Q;  3ZHQ A;  1JY3 O;  4FLX A;  1GZL A;  4UV8 A;  1GMJ A;  3QH9 A;  4JF3 A;  5GTH Z;  1KTM A;  1BCC G;  1K97 A;  1HJB A;  1DEE G;  1EC5 A;  1IK7 A;  3GHG C;  1K8A Q;  2EBO A;  4YHH B;  1XHX A;  3AG4 B;  3CCQ V;  2Q6A A;  5KKZ B;  5KUM A;  3ZMS A;  2K9P A;  2EJR A;  1CI6 A;  1H88 A;  3HPL C;  2QWO B;  3AG3 B;  2QRX A;  4ZI7 A;  1FFX A;  1FC2 C;  1QBZ A;  5BR8 B;  4OXS A;  4Z2W A;  3K57 A;  1XTG B;  4WY4 D;  5L3C A;  2ZCE A;  4LFB O;  1SQP H;  3VBB A;  4O4I A;  1OCR B;  3AEI A;  2KP8 A;  1MFT A;  1ZXG A;  3QG5 A;  1T5E A;  1N86 A;  4FFB B;  4J10 A;  1KB9 D;  5IDJ A;  3GWK C;  4BIU A;  3TJT A;  1FXK A;  4FLT A;  2YS8 A;  4MW8 A;  2Y0E A;  1PGO A;  1JX9 A;  5LHH A;  5CBN A;  2KYV A;  1MZF A;  4RUE A;  4H44 D;  2IM9 A;  3FB6 C;  3CHX A;  1PPJ H;  3UQ8 A;  1YTZ T;  4HZ3 A;  1THZ A;  1E1Q G;  2BTQ A;  1NI8 A;  5JJE B;  1OZ0 A;  1Y4M A;  4PA4 A;  3JAK B;  3K59 A;  2NPS A;  2Q7E A;  3B8E B;  4KHP O;  1XNR O;  3L72 H;  1OW7 A;  4KFM A;  5B66 H;  1H2S B;  1HJ0 A;  1Q7Y Q;  1FFT B;  2DWE C;  1WT6 A;  3KDP B;  4JI6 O;  5CA3 A;  5EC2 C;  2DE0 X;  4DJG A;  4FLV A;  4K0K O;  2LKM A;  1QL1 A;  2VS0 A;  3FWN A;  2W90 A;  1LJ2 A;  1YIJ P;  2JVD A;  1KOR A;  3L74 D;  1JTH B;  5EC1 C;  5LMU O;  1N7S C;  3ABK B;  4XBF A;  3CCS V;  4YXD C;  2KB1 A;  3RYF A;  3B77 A;  1J1E B;  1U7M A;  1U57 A;  4LFA O;  1URQ C;  3D36 C;  3J81 N;  2HYN A;  2GTA A;  4JV5 B;  2BAS A;  3IGA C;  5KJ7 D;  1YTF B;  4NYK A;  5IY5 C;  2KSD A;  5JVD A;  3U1A A;  2QM8 A;  2UXC O;  4IGG A;  2Y0P A;  2WAM A;  4GT1 A;  3SJA C;  3A0R A;  3L71 D;  4P9P A;  2PI5 A;  1AI7 A;  1NU1 H;  3CYO A;  4WCE V;  1PP9 H;  4JI7 B;  5KLV K;  2PYJ A;  3CD6 V;  2KIK A;  3E1I A;  1RE4 C;  1VQ9 V;  3FYI B;  4YXW H;  3VQY A;  4ZKP A;  4O2B A;  3H1H D;  3CX5 E;  1AJN A;  1RE3 A;  1P84 E;  3DGE A;  1EZJ A;  1EN5 A;  1L8D A;  3CXH D;  4XFJ A;  2AXC A;  1J5E B;  4PA6 A;  4X1Y A;  1MZ9 A;  2JS5 A;  3CS5 A;  1N7L A;  2RNB A;  3TGU D;  1HH0 A;  4X1I B;  1NTM E;  1OCO C;  1K05 A;  5TJH A;  4GCZ A;  5CCG C;  2BOC C;  1ARO P;  2ODM A;  2P4K A;  3HKD B;  1FDI A;  3HE5 B;  1IBL O;  5H2F Z;  5EYP B;  1JA8 A;  3H1K H;  2OIG A;  1ROP A;  4DR3 O;  3E8G A;  1K04 A;  2YIU C;  3H1L J;  5GTI H;  5JJN B;  1AP6 A;  1JFF B;  2LP7 A;  3CCJ V;  1W5C E;  3BRV B;  2UU9 B;  3EHB B;  4C7N B;  1L0N D;  5C39 A;  2HOD B;  1D2D A;  2QM4 A;  4PV1 B;  1SQV E;  3CEI A;  4MN4 C;  2E75 B;  3VQV A;  3ZMZ A;  3KZI E;  1HNZ B;  4K35 A;  5LMN O;  1OMI A;  3RT3 C;  4L76 A;  2CAZ C;  4U3F J;  1L4A D;  2EIK C;  1BT8 A;  5KAF Z;  4OGQ B;  2VQF B;  1HR0 B;  2C9N Y;  4KL1 A;  4QIW F;  4LF6 O;  2UWJ E;  4MSW C;  3M9Q A;  1L0L H;  2GUS A;  1BE3 J;  3L73 E;  4PDM A;  2EJ7 A;  5KLV J;  2R70 A;  3ABT A;  4FFB A;  4H33 A;  1LGH B;  1YVW A;  1SQX D;  1S9K E;  3GWO A;  5TIS E;  1TU3 F;  3RWR D;  1OIP A;  1RE4 A;  4XDL A;  2Q7G A;  4X62 B;  4DR1 B;  5B1B B;  2AEF A;  2M0B A;  3JAR A;  2ATK C;  1KEC A;  4O4H B;  4JI3 O;  1LTS C;  1M7L A;  3S3W A;  1S1C X;  3MHH C;  1BZK A;  1ZW0 A;  2IYO A;  5IT9 N;  5LA6 B;  3N2G B;  4UCV A;  2EIM C;  1WB7 A;  1ZR4 A;  3II6 A;  1V9P A;  1KYO D;  1M57 C;  3N7N A;  4GX5 A;  3ZRW A;  2XAH A;  4X88 A;  1Z5W A;  2K3R A;  1SQX K;  4O4J B;  5BVZ A;  1OZH A;  3ZMU A;  4UB6 E;  1R6T A;  4GLX A;  4J9Y B;  2UUB B;  3H1H J;  4R8C A;  3SPJ A;  1X0T A;  1UII A;  2P6J A;  2G3A A;  3L70 D;  1VQ9 P;  1FDO A;  1NAF A;  3U59 A;  3K79 A;  4LLH A;  5B5E Z;  3H1I H;  3BAA A;  1SQB J;  4PDV A;  4JAS A;  1OCC B;  1FOS F;  3CLQ A;  3E83 A;  2YC0 A;  5APU A;  3TGU J;  3K9A A;  2WPS A;  3JCU Z;  5CN0 A;  1PM9 A;  1YCI A;  2EIN C;  4QPK A;  1I94 B;  1FJK A;  1VF5 D;  2UXX A;  3VP8 A;  1EDI A;  3WU2 Z;  3MAQ A;  2ZD9 A;  4RKU J;  4PJ0 H;  2JDI H;  2PGG A;  3L75 J;  2W27 A;  3Q1M A;  4HJG H;  3CWB H;  1T3U A;  1FD9 A;  3ABM C;  3B09 A;  1QLE B;  1BCC D;  1Z56 A;  1FZA A;  3HR0 A;  4XDJ A;  3U11 A;  2OYH B;  1DIP A;  3JCZ A;  3OGI B;  3FB5 C;  4YJ2 B;  2Q1K A;  2R5B A;  2BCC D;  4DV0 O;  2F23 A;  1GN4 A;  4JBZ A;  2JR8 A;  4RJT A;  2CH7 A;  4X1K B;  2QJ1 A;  3CCJ P;  1SQP E;  4TOI A;  3M0D C;  2OIE A;  2Y48 A;  2D3O W;  1VQM V;  1WLE A;  1ZL8 A;  5BXZ A;  3CP1 A;  1KC8 Q;  4NTY A;  2RMK B;  2UUC B;  1N0N A;  2WLK A;  1B3Q A;  3E8H A;  3A0H H;  2XUM A;  3T1H B;  1PFI A;  3HKE B;  3CX5 F;  2MKV A;  2Y4U A;  4DV7 O;  1SQX J;  1H0T B;  1PPJ E;  4F4L A;  4GOF A;  4MTO A;  1K7D A;  4BXL A;  1NTZ H;  1G6U A;  3OR6 C;  4JQ0 D;  1G4Y B;  1KN7 A;  4H44 C;  2JO1 A;  3IFX A;  3ZRV A;  1YQ4 C;  1LT9 B;  5B66 E;  1OCZ C;  1WB8 A;  2Q0A A;  1XTC C;  3BCC H;  2HVK C;  5AVQ B;  2CUG A;  1XUQ A;  2OGU A;  5EYP A;  1BL8 A;  1N32 B;  3Q3D A;  2WA3 A;  1SQQ H;  4HH2 A;  2V1D A;  1PGP A;  4RUF A;  1WNS A;  2P10 A;  1B04 A;  3L70 J;  2UXN A;  3OJA B;  1N8R W;  4ZOL B;  2DW3 A;  4EI2 A;  1S76 D;  1JY3 P;  4J9Z B;  3JAT B;  4JPR A;  1GU4 A;  1P4R A;  2K1A A;  5LL6 Y;  4EB6 B;  2KSJ A;  4JI8 O;  1FXH A;  2W6J H;  2Y0D A;  1IBK B;  4K8Z A;  1JUN A;  1SC5 B;  2EIJ B;  3FXE A;  2O3J A;  5IJ9 A;  2RMZ A;  4EYY Q;  5EIB D;  2YIB A;  2J5U A;  4WBN B;  2CTR A;  5IYC O;  1DF5 A;  2Q3I A;  2YUA A;  5JCO C;  3HKB B;  4FZ1 A;  4JI4 B;  3U0Z A;  3PHL A;  3M0D A;  1SFC D;  1WJZ A;  2Q4P A;  5DED A;  4AHC A;  3OMN B;  2MW2 B;  5L3E A;  2FYU D;  4I55 B;  2IZ0 A;  1NU1 E;  5JQG B;  4PHZ A;  1OW6 A;  3AG2 B;  1BSH A;  2YKP A;  2Q67 A;  1PP9 E;  2IBZ D;  1N36 B;  1XNQ B;  4TLF A;  2BCC J;  1IJD B;  4O4H A;  4J11 A;  1J2J B;  2P2U A;  1K73 W;  4I5S A;  3AE8 C;  4N6J A;  2N1T B;  4BRY B;  4DUZ B;  1M56 D;  4LF7 O;  3LDD A;  1NH4 A;  2IFM A;  1ZSP A;  1FYJ A;  1FU1 A;  1KIL B;  3PRJ A;  2FYU K;  1PNK A;  1NJI W;  3WB0 A;  1FJG B;  3BRT B;  1VQM P;  3SYA A;  2JRI A;  2GM4 A;  2KOG A;  3FX7 A;  4RO2 A;  4DV2 B;  4JPZ B;  1NTK H;  4ZBM A;  4ZMD A;  3D6Y A;  1QVF U;  2EIL C;  2A7W A;  3Q5P A;  2SPZ A;  4JI2 B;  2RN0 A;  2HVJ C;  1YI2 V;  2Q73 A;  4ABM A;  5B1A C;  2NPS D;  3H1K E;  4W7Z A;  1TUB B;  5GTI E;  3K9S A;  1DX7 A;  2X0L A;  3OR7 C;  4CC6 A;  1NTM G;  4LNU A;  1VQ8 V;  4EFE A;  1Q82 Q;  4HNA B;  4LF9 B;  1UIX A;  1M1K W;  1J1D C;  2Z5U A;  1JEK A;  1ZRT D;  1FZC C;  3HTK A;  4O9B A;  2OYH A;  4YJ2 A;  5FNV A;  2Y69 C;  1U97 A;  1NOH A;  3T4D A;  2QJK B;  3FWL A;  4X1K A;  5ITZ A;  1PKX A;  1LTJ B;  1CEZ A;  4DR6 B;  1ENV A;  2ZVN B;  4I7Z C;  2FXM A;  1L4A C;  1PD3 A;  3BHP A;  3C9I A;  1M93 A;  3F5H A;  4I1L A;  5IJ0 A;  1SQV G;  1S0V A;  3C8V A;  1LP1 B;  2ITC C;  2ZT9 C;  5KAI Z;  1BGY D;  1JY2 O;  3RGB A;  3RK3 E;  4D6T D;  2X6A A;  2Y4T A;  1Y74 B;  2OTL V;  5FPR A;  2NZ2 A;  4PD4 H;  4EKW A;  2KZJ A;  5EK0 A;  1FS0 E;  4PD4 I;  2ZAE B;  2YXR B;  3A7O A;  2C0W A;  3L9D A;  2FYU J;  2WMM A;  2LFR A;  3ABV C;  3RL0 B;  1NR7 A;  1H0T A;  1SS3 A;  1P7B A;  1NR1 A;  1TGO A;  3CPW U;  2E5L O;  1YXB A;  5E79 H;  3LNM B;  3HD7 C;  4ZKI A;  3ABU A;  3B5N A;  5APQ A;  2PAJ A;  3A2F A;  2FTK A;  3RK3 B;  4UCR A;  4B3S O;  1M1J C;  1T8Z A;  3ZBH A;  3QF7 A;  4MTX A;  4LFC B;  3OM3 B;  4OPA A;  1FZG A;  1TVK B;  2OYI C;  3ITK A;  1JNM A;  1S72 V;  2V7Q J;  3AK3 A;  1NKZ B;  3O6Q A;  2XAQ A;  4LF8 O;  3H1I E;  3S9O A;  2E3C A;  2AHY A;  5CA0 A;  5CB4 A;  5IYD O;  1F51 A;  2MK3 A;  4DV5 O;  1R1B A;  2F4V B;  1OWA A;  3TF5 A;  1FZF A;  1K33 A;  4TT3 G;  2QR4 A;  4EB6 A;  5AW1 B;  4JI1 O;  2HFE C;  1G8M A;  4PJ0 E;  1KMI Z;  1VDF A;  1NQT A;  4X8A A;  1NVP D;  2ZIN A;  1I08 A;  1DLB A;  4LFB B;  4NKG B;  4WFF A;  1EN4 A;  2POH A;  1ZN5 A;  3CWB E;  1NZ6 A;  4WBN A;  1YI2 P;  3FGA D;  2FYZ A;  1URQ D;  3HKB A;  2P58 A;  3C90 A;  1WAZ A;  3M91 A;  3SJC C;  3S1K A;  3KCY A;  1ZAU A;  1YF2 A;  1VQ4 V;  5F2V O;  1SES A;  3SPI A;  4IL6 Z;  1LTB C;  4H0L C;  1VQ8 P;  2N74 A;  4PA9 A;  3G4S V;  5H5N A;  4HB1 A;  4O4L B;  4MVZ A;  4H13 C;  1QU7 A;  3EXA A;  5AW9 B;  1Y9B A;  1RSO B;  5CMU A;  4Y99 C;  1KV4 A;  2KKW A;  1W59 A;  3H1J D;  1K4C C;  4TQD A;  3ZRS A;  2ZE6 A;  1YEW A;  3A0H E;  2ZM6 B;  4X20 A;  4ZNC A;  2OCC B;  3C3S A;  1Q43 A;  1SQP G;  3KXD A;  3JSL A;  4HYT B;  5AVW B;  1ZV8 A;  1X8Y A;  1BGY J;  3HD7 A;  2DQ0 A;  3AG7 A;  3F7V C;  1XNR B;  4D6T J;  2PTM A;  2RDC A;  2OYQ A;  2O57 A;  2QJP B;  4JI6 B;  3TYY A;  1NTZ E;  2L6L A;  1I7F A;  1M1J A;  4IYI A;  4MVQ A;  1KQS U;  4CH3 A;  3AE6 C;  3JAL A;  1R8E A;  3RVY A;  4B7K A;  5J2U A;  1W0K G;  3AE1 C;  2OTL P;  2GV9 A;  2JJL A;  2OYI A;  5KHI A;  1AVO A;  3ASN B;  1Y8A A;  3VN0 A;  3BCC E;  3VP9 A;  5LMU B;  1J95 A;  2LQT A;  1PPJ G;  5A9G A;  1OXZ A;  3UT5 A;  1V54 C;  2RQ6 A;  1SQQ E;  3K5N A;  3B8N A;  3E1R A;  4K3A A;  3CRR A;  4NXM B;  1Q6H A;  5CCG D;  3L72 G;  1HVV A;  3CC4 V;  3BVO A;  4KJM A;  3A5T A;  1LWU B;  2WIT A;  4JI0 B;  1RFY A;  4NXN O;  2Z5I A;  2KXP B;  4UB8 Z;  1N73 B;  2ZDI C;  2RCV A;  2ZNI A;  4GKJ B;  2Q6Q A;  1PGJ A;  2WA4 A;  2R9I A;  1BDC A;  2Z3Y A;  1AI6 A;  1S72 P;  3RYI B;  2VQE O;  1KP2 A;  1V55 C;  2QA4 V;  4D7S A;  2HLD G;  1Q7Y W;  3CME V;  1KBH A;  2KS1 A;  2KK7 A;  2AHZ A;  3APQ A;  4UVC A;  3Q2Y A;  2ZXE B;  1Z5V A;  1IBM O;  1XMQ O;  4TUY B;  2KLV A;  2XAG A;  1SET A;  1NWQ A;  1S5L X;  2H88 C;  3P8C E;  3E86 A;  1S77 D;  3GF7 A;  2WPD G;  3V4W A;  3JSN A;  2IJJ A;  4HKZ H; 
#chains in the Genus database with same CATH homology
 1DTO A;  1AJP A;  3IGA C;  5KUK A;  2DYS C;  3QO8 A;  1YTF B;  3LDC A;  5IY5 C;  2WLN A;  1GM8 A;  2QM8 A;  4WFA V;  1MSW D;  2WAM A;  4GT1 A;  1R6N A;  4RQF A;  3A0R A;  4P9P A;  2PI5 A;  1AI7 A;  3OW2 U;  1NKD A;  1K5S A;  3EFF K;  1XL4 A;  2ZQM A;  3CYO A;  4WCE V;  4JAV A;  4MVR A;  2ITD C;  3CD6 V;  3W7T A;  4YXW G;  3UKM A;  1VQ9 V;  3FYI B;  4YXW H;  3ETE A;  1FXK C;  2IJK A;  3PJS K;  1AJN A;  1FXV A;  1JOY A;  2LFS A;  2XAJ A;  1E1R G;  3DGE A;  1EZJ A;  4P9O A;  4MS2 A;  4R6Z A;  2IH1 C;  4PA6 A;  1GM7 A;  1QLN A;  2JJ2 G;  4QE7 A;  1YJN V;  4UXN A;  3OGC C;  4P2Z A;  2ZDI A;  1OCO C;  2W6I G;  2WLM A;  1QCE A;  1AI4 A;  4GCZ A;  2BOC C;  1ARO P;  2EIL B;  5EBM C;  3K0G A;  3SYO A;  1CPY A;  4RAI A;  1JPX A;  1ROP A;  2IH3 C;  3E8G A;  4FIP C;  1M9N A;  3TCU A;  5B1A B;  5L3D A;  2LP7 A;  1I5X A;  1GKF A;  3CCJ V;  3BEH A;  3EHB B;  3ABL C;  2YSU B;  4UVA A;  5BZB A;  3ZMZ A;  3K3W A;  3LSS A;  3K08 A;  5L3F A;  1AQT A;  2JIZ G;  4HYO A;  2EIK C;  5DM6 V;  1OHH G;  1COW G;  2IJH A;  4QIW F;  2Y69 B;  2XAS A;  4MSW C;  3AG1 C;  1AJQ A;  4LCU C;  1Q86 W;  1QR8 A;  4PDM A;  1E79 H;  4H33 A;  3ABT A;  2WLJ A;  4MVM A;  1RM1 C;  3QO7 A;  3GWO A;  4JTD B;  5DN6 G;  1RPR A;  1JVM A;  4XDL A;  1FS0 G;  1QR9 A;  1WPX A;  5B1B B;  2PI4 A;  5LGU A;  3T4Z A;  3ML0 A;  2ATK C;  4G28 B;  1KEC A;  3MHH C;  1F4M A;  2WLH A;  1SZT A;  2EIM C;  1K9M W;  5HFL A;  3K06 A;  4CBC A;  5CBG A;  2IW5 A;  1M57 C;  4WVZ A;  4PDL A;  4GX5 A;  1KP3 A;  3ZRW A;  2XAH A;  4X88 A;  2OTJ V;  3ZCC A;  2HJF C;  3G6E V;  1K8A W;  3ZMU A;  3W7W A;  2EZO A;  3I55 V;  4J9Y B;  1M56 B;  3JD1 A;  3W7X A;  4R8C A;  3SPJ A;  2P6J A;  4Q20 A;  2XAF A;  3K79 A;  3E89 A;  1FXK B;  1ORQ C;  3OFN G;  5HFM A;  5KA6 A;  4PDV A;  1SER A;  4JAS A;  1OCC B;  2A0L A;  5B3S C;  5KA5 A;  3E83 A;  4KUM A;  3K9A A;  4WFE A;  5CN0 A;  3LSQ A;  3QO5 A;  2EIN C;  2X6B A;  4QPK A;  3W7U A;  2JDI G;  2ZXW B;  2UXX A;  3DTU B;  4MT8 A;  1YTF D;  3AG4 C;  2ZD9 A;  2JDI H;  1GO3 F;  1K34 A;  3ASO B;  3ETG A;  3OUS A;  1PNM A;  3AG3 C;  1XL6 A;  4BIZ A;  3F5W C;  3ABM C;  1QLE B;  3FKS G;  4XDJ A;  2OCC C;  3JCZ A;  3FB5 C;  1YSC A;  3CC7 V;  3ZN0 A;  4MVU A;  1YJ9 V;  3CCE V;  2NNU A;  1OCR C;  1MOF A;  1K5Q A;  2P67 A;  4FPP A;  2DW4 A;  1K92 A;  4MVS A;  2Y48 A;  2D3O W;  5B1O A;  1VQM V;  1WLE A;  2C2A A;  2DQ3 A;  3CP1 A;  1PNL A;  3P32 A;  1AR1 B;  1Q82 W;  2WLI B;  2P7T C;  2WLK A;  1I5Y A;  1K3E A;  1Q81 W;  3E8H A;  4QE9 A;  3ASN C;  2EIK B;  3LUT B;  3CMA V;  1EFR G;  4PEL A;  1VQ7 V;  4UVB A;  1BSN A;  3F7Y C;  5LHI A;  4F4L A;  4MTO A;  1K7D A;  1VQK V;  3WG7 C;  3OR6 C;  2YEV A;  1CP9 A;  2QEX V;  2E5T A;  1G4Y B;  3D3I A;  3OAA G;  3E35 A;  3SYP A;  3WFV A;  3IFX A;  3ZRV A;  1UJW B;  1OCZ C;  2OT5 A;  2JK5 C;  2HVK C;  3B8M A;  4CZZ A;  3I56 V;  4JAU A;  1JJ2 U;  4Z1M G;  3NXS A;  1BL8 A;  1VQN V;  1DF4 A;  2QE7 G;  4E2L A;  2DWD C;  1K4D C;  4U7O A;  1GK9 A;  2V1D A;  4GX0 A;  1V54 B;  2H94 A;  2XOK G;  4RUF A;  2QE7 H;  5H6R A;  1S5H C;  3FYE B;  2X6C A;  2UXN A;  2IU0 A;  3ABK C;  1N8R W;  2JEX A;  2Q68 A;  1S76 D;  1F4N A;  3H01 A;  4J9Z B;  4JPR A;  1P4R A;  4BW5 A;  1EBO A;  3OMA B;  2W6J G;  3K04 A;  2DYR C;  1FXH A;  2WWW A;  5J9P C;  2W6J H;  1YJW V;  1MAB G;  1V55 B;  1W0J G;  3ZN1 A;  2EIJ B;  2P90 A;  1S3J A;  1JCH A;  1VQO V;  4WF9 V;  5IYC O;  1DF5 A;  1LNQ A;  1MG1 A;  5IYB O;  4WFH A;  1H2G A;  1NVP B;  3JD4 A;  4UUJ C;  4R7C A;  3X2Q B;  1YHQ V;  4GX1 A;  3OMN B;  5GW7 A;  5L3E A;  4MVO A;  4JTC B;  1NBM G;  4QMA A;  2QKS A;  2GHY A;  2WLL B;  4LC1 A;  3AG2 B;  1BSH A;  2JJ1 G;  2Q67 A;  4XDK A;  3JYC A;  1KKD A;  4TLF A;  2F43 G;  3TET A;  3K0D A;  4GX2 A;  1F23 A;  2DYS B;  4I5S A;  1K73 W;  1B6Q A;  4H37 A;  5IY5 B;  1R6K A;  3MHS C;  2M7W A;  3JD3 A;  4P30 A;  3SPG A;  5LBQ A;  3LDD A;  4QJF B;  2XND G;  2XND H;  1PNK A;  4PA3 A;  2K1E A;  3P30 A;  1NJI W;  5LGT A;  3FB7 C;  3SYA A;  1HWY A;  3E8B A;  4RO2 A;  3OEH G;  3SYC A;  1BHB A;  1AI5 A;  4JTA B;  1H38 A;  4BAY A;  2B1G A;  4ZBM A;  1QVF U;  2EIL C;  3SPH A;  4LBE C;  2B5U A;  2HVJ C;  2W0F C;  1YIT V;  4FMT A;  1YI2 V;  4ASU G;  5B1A C;  1VQ5 V;  4TWK A;  2X0L A;  3OR7 C;  1R73 A;  5CBF A;  3ZRW B;  5L3G A;  3CCM V;  1VQ8 V;  3BY6 A;  1GMG A;  4QNH B;  1VQL V;  1OCO B;  4FK5 C;  2BOB C;  1M1K W;  4I9W A;  2Z5U A;  4U7N A;  2A79 B;  3JD2 A;  1IFP A;  1JEK A;  5L3B A;  2NLJ C;  4PA7 A;  3W7S A;  2Y69 C;  2B1I A;  3T4D A;  1PKX A;  4JYC A;  1CEZ A;  1ENV A;  1PL0 A;  4WFB V;  1PD3 A;  3ABL B;  3USS A;  1S0V A;  3ZRX A;  2ITC C;  2QM7 A;  3SYQ A;  3VOU A;  3OEE G;  2X6A A;  1VQ6 V;  2OTL V;  5B1B C;  5EBL C;  3CCV V;  4EKW A;  5EK0 A;  1FS0 E;  5CBH A;  1L1F A;  3T1C A;  3SJQ C;  3STZ C;  1R3J C;  5LHG A;  1H8E G;  5H6Q A;  1ZWI C;  3ZMT A;  2R9R B;  3UM7 A;  2LFR A;  1QVG U;  3AG1 B;  3ZMV A;  1NR7 A;  1P7B A;  1NR1 A;  3CPW U;  3LNM B;  3G71 V;  4ZKI A;  3IC7 A;  3ABU A;  3RW0 A;  1RM1 B;  2A9H A;  4R50 A;  2FTK A;  2V7Q G;  1H8H G;  2JEU A;  1M56 C;  1Y66 A;  5FL7 G;  4MTX A;  1SRY A;  3CCU V;  2V7Q H;  3OM3 B;  1IXM A;  1S72 V;  3ETD A;  2XAQ A;  4X89 A;  3OUF A;  2EIM B;  1VQP V;  1OCC C;  4KP4 A;  3RVZ A;  3E8F A;  1M57 B;  1YIJ V;  3HB3 B;  2AHY A;  4G27 B;  4HAM A;  5IYD O;  1F51 A;  2MK3 A;  1JQ0 A;  3CCL V;  3GB7 C;  2ZXW C;  2YEV B;  1K33 A;  4TT3 G;  4WFG A;  5B1N A;  4DO2 A;  3SPC A;  3CXC U;  1KC8 W;  2HFE C;  3ASO C;  1G8M A;  2IU3 A;  2IJI A;  2X7R B;  1NQT A;  4X8A A;  4N21 A;  3CC2 V;  1NVP D;  3FB8 C;  3QNE A;  1DLB A;  3MD0 A;  1QLE C;  4WFF A;  3TK1 A;  4DXW A;  5B3S B;  4UV8 A;  3STL C;  1GTO A;  4JF3 A;  1K97 A;  2ZR3 A;  2EIN B;  1SES A;  4MW3 A;  3OE7 G;  3SPI A;  1VQ4 V;  5C93 A;  2EBO A;  1R3L C;  4PA9 A;  1BMF G;  3KG2 A;  3E2E A;  2WLL A;  3AG4 B;  2Q6A A;  3G4S V;  3D36 A;  5KUM A;  3ZMS A;  3CCQ V;  1M90 W;  3T2M A;  4MVZ A;  2EJR A;  2QTO A;  3HPL C;  5CMU A;  3AG3 B;  4RQE A;  1K4C C;  3ZRS A;  3CCR V;  1QBZ A;  3ABM B;  1NH2 D;  4JYB A;  1GM9 A;  2OCC B;  4LP8 A;  4OXS A;  3ZIA G;  2E5Y A;  3ZJZ A;  3JD0 A;  1BHA A;  5L3C A;  1E79 G;  4UV9 A;  3VBB A;  2DQ0 A;  3F7V C;  1OCR B;  3AEI A;  1NH2 B;  4PDR A;  4MTF A;  5IDJ A;  2WSS G;  1R3I C;  2Q69 A;  4MVQ A;  3LDE A;  1KQS U;  3M99 B;  3OMI B;  4FJC C;  3RVY A;  2WSS H;  1W0K G;  4BIU A;  1FXK A;  1RPO A;  5H9C A;  3RBZ A;  4MW8 A;  3ASN B;  4TSF G;  5LGN A;  2HG5 C;  1JX9 A;  5LHH A;  1W2B U;  1KD1 W;  4JGS A;  5E1A C;  4MTG A;  4N23 A;  1J95 A;  4RUE A;  5EBW C;  3FB6 C;  1V54 C;  1TUE B;  4HZ3 A;  1THZ A;  1E1Q G;  3B8N A;  3WG7 B;  1OZ0 A;  1Y4M A;  4PA4 A;  3CC4 V;  2H8P C;  4KFM A;  1R3K C;  1FFT B;  2DWE C;  1OCZ B;  2ZR2 A;  2ZDI C;  5CA3 A;  5EC2 C;  2R9I A;  4L87 A;  2Z3Y A;  1AI6 A;  4DJG A;  1KP2 A;  1V55 C;  4QPJ A;  2QA4 V;  2HLD G;  1Q7Y W;  3CME V;  2EIJ C;  2HR3 A;  4G2K A;  2AHZ A;  2EZP A;  4UVC A;  2GSM B;  3R65 A;  5EC1 C;  3X2Q C;  2XAG A;  1SET A;  3ABK B;  4XBF A;  3CCS V;  3E86 A;  2KB1 A;  1S77 D;  2CK3 G;  3B77 A;  2HKO A;  2WLI A;  2WPD G;  3K03 A;  2CK3 H;  3AG2 C;  2IJJ A;  2DYR B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...