3EFFK

The crystal structure of full-length kcsa in its closed conformation
Total Genus 43
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
43
sequence length
139
structure length
139
Chain Sequence
SALHWRAAGAATVLLVIVLLAGSYLAVLAERGAPGAQLITYPRALWWSVETATTVGYGDLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERRGHFVRHSEKAAEEAYTRTTRALHERFDRLERMLDDNRR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of full-length KcsA in its closed conformation.
pubmed doi rcsb
molecule tags Membrane protein
molecule keywords FAB
total genus 43
structure length 139
sequence length 139
chains with identical sequence L, M, N
ec nomenclature
pdb deposition date 2008-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
K PF07885 Ion_trans_2 Ion channel
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.70 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 3effK01
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 3effK02
1J95A 3TETA 4MW3A 3K04A 2K1EA 4MTGA 1LNQA 4PDVA 2XNDH 5CBGA 1V54C 4WFHA 5CBHA 1M56C 4XDLA 4BW5A 4DXWA 3F7VC 2HVKC 3SJQC 1G4YB 2IH3C 3LDCA 1BSHA 2WLIB 1XL4A 4J9ZB 3OGCC 4H33A 2Y69C 4KFMA 4GX0A 4MVUA 1R3LC 4R6ZA 5B1AC 2W6JH 3LDEA 2WSSH 3SPGA 2NLJC 3WG7C 3ZJZA 3RBZA 4MVZA 5E1AC 2BOBC 2HVJC 4HZ3A 3FB8C 3T4DA 3LNMB 5EBMC 4MSWC 4F4LA 3K03A 2ATKC 5IY5C 2A0LA 3GB7C 3SPJA 2X6BA 2AHYA 3JYCA 2YEVA 2EIMC 3BEHA 1IFPA 1JEKA 2JDIH 2X6AA 4DJGA 4MTOA 3SPHA 2R9RB 4P2ZA 4EKWA 1OCOC 4MVSA 2ITCC 4RO2A 4MS2A 4P9OA 2WLKA 1XL6A 2DWEC 2QKSA 4YXWH 3OUSA 4G27B 2Q6AA 2W0FC 5CBFA 2ITDC 2OCCC 2WLIA 3AG4C 3E89A 3UKMA 5J9PC 3AG1C 4MVQA 2QE7H 4GX2A 4MVMA 3EFFK 3STLC 1ORQC 4TLFA 4I9WA 1QLEC 1K4CC 2IH1C 2Q68A 4H37A 5KUMA 4CBCA 1BSNA 4OXSA 2JK5C 3OR6C 3FB7C 1R3JC 4PA7A 4P9PA 3F7YC 3LDDA 2WLNA 2Q69A 4MW8A 3ABLC 4PA9A 4MVRA 4TWKA 4QMAA 2EILC 3TCUA 3SPIA 5BZBA 2DWDC 2BOCC 5EBWC 3UM7A 4J9YB 2ZD9A 4QNHB 3USSA 4WFEA 2H8PC 3E8GA 2DYSC 3R65A 3E83A 2A9HA 4PDRA 3STZC 1OCZC 3ZRSA 4ZBMA 2P7TC 1M57C 2EINC 2HJFC 2A79B 4MVOA 3ABKC 4RUFA 2EIJC 4GX5A 4WFFA 3IFXA 3SYAA 3SYPA 1ZWIC 2AHZA 4R8CA 3T2MA 2QTOA 3FB5C 3HPLC 3E8HA 3OUFA 4QE7A 2WLMA 4JTAB 2E5TA 4PA6A 2E5YA 4X89A 2WLLA 2HFEC 1P7BA 4G28B 3ASNC 2HG5C 1KKDA 2WLJA 3K0DA 4WFGA 1S5HC 4LCUC 2WLLB 1AQTA 2CK3H 3T1CA 3RVYA 5EBLC 4MTFA 3E8BA 4JTDB 4RAIA 1V55C 1BL8A 2X6CA 3LUTB 1R3IC 5EC2C 3VOUA 5KUKA 3PJSK 4QE9A 3E8FA 1R3KC 3RVZA 3F5WC 4XDKA 4X8AA 3RW0A 1K4DC 4RUEA 1OCRC 3K06A 2V7QH 3OR7C 4JTCB 3X2QC 4PA4A 4R50A 3SYCA 3AG2C 3FB6C 2EIKC 3ABMC 4PDMA 5B3SC 4P30A 1FS0E 3SYQA 4LP8A 4PDLA 2ZXWC 1JVMA 4XDJA 5EC1C 4WVZA 3KG2A 2KB1A 4GX1A 2DYRC 3K08A 3ASOC 5B1BC 3SYOA 3T4ZA 3K0GA 2WLHA 3AG3C 1E79H 3IGAC 4R7CA 1OCCC 4HYOA 3E86A 4PA3A 3SPCA 5EK0A 4UUJC 2Q67A 4X88A 4LBEC
chains in the Genus database with same CATH superfamily
1SQXJ 1SFCC 3BA8A 3K5MA 3TJTA 1FZAA 1LP1A 1J1DC 2JO1A 1QVGO 3GHGA 1LNQA 2XNDH 1RSOA 1NI8A 1FC2C 5H2FH 1LTJC 1AILA 3U11A 3CCJV 2Z5IA 1XNQO 1WLEA 1Y6XA 2IH3C 4UCOA 2FYUD 5JCOA 1WB7A 4LF6B 2WLIB 4LFAO 3WUTA 2IJHA 5CJ4A 2FL4A 2GUVA 3R4YA 3WUVA 1G6UA 3V6IA 1FDIA 5AVUB 5FPOA 3SR2C 2ZNIA 2BOBC 1H0TA 2P6JA 1RF0A 5ITZA 1FZFA 3M0DA 1NU1J 2A0LA 5CB4B 2AHYA 5HFLA 2BTQB 4TV9B 5FNVA 4DV1B 2Q5UA 3A7OA 3QTCA 1Y74A 4FZ0A 5KX5B 1W0KG 4WBNB 3H1JH 1RP3B 4TUYA 5CBFA 1PPJE 3RK2B 2E75C 4HB1A 4PD4F 5A2QN 2EIKB 1BSNA 1PPJD 3RYFB 3L72D 1XMOO 1L4AA 4O4IB 3RYHA 4GDOA 3CRAA 1JO5A 2ZXXA 1JQ0A 1ENVA 2PI4A 1SVFA 2IBZI 3JCUH 3P8CD 5GTHH 3H1JJ 3M0AA 2WWWA 1LT9A 1QEXA 2XUMA 3ML0A 1URFA 1NAYA 3AE4C 3H1HG 1VQKV 1LTBC 2QJYC 4HYTB 3B5ND 1M90Q 4IL6H 4IYIA 4UV8A 3CCRV 3D36A 4MVOA 4DUZB 4YTPC 2R70A 5E79H 1GN2A 2FYUE 2QTOA 3E8HA 4IHJB 3BRTB 1ZR2A 4FZ1A 1JOYA 2WSEH 2XASA 2HFEC 2OYOA 2BCCE 1JJ2U 4I50A 4C7UA 4ZHQA 3RL0D 1AFOA 1KQSO 1VQ4P 3G9RA 1MABG 4O2BB 2LGQA 1HJ0A 4LCUC 4WCEV 3TGUD 5LMNO 1AR1B 4MTFA 2D2CB 1JUNA 1MSWD 3A2AA 2WT7A 4MN4C 3RYCB 2IYPA 3E8FA 3BCCD 1EZVG 1RE4C 3MTUE 4I0XA 1BGYH 3ZBHA 2WSEJ 1WPBA 2Q7GA 3M9QA 3UO2A 5FPRA 3W7WA 2J58A 2JJ1G 2ZIOA 5BMVB 2VQEO 3CWBD 2BSKB 1OCRB 4GX1A 4DZOA 1VQKP 5HFMA 2Q4PA 4QPKA 3FX7A 1B06A 2OYIB 5H9CA 4YJ2A 4H13B 3CCVV 1JY3O 5CBGA 4O2AB 4AQYO 1ZW0A 3EWKA 1RHZB 3VN0A 4O4HA 2KQXA 2IZ0A 2NLJC 1HH0A 4NB5A 1DD3A 1N2DC 1R73A 2XAHA 3KZIZ 3D36C 4ZKUA 5IY5C 1IBLO 2C0XA 2F93B 2QKCA 1P7GA 3ASOB 3CC2P 2X6AA 1HNZO 4CS2A 4HJGH 4GT1A 2ZIMA 4AQYB 2W6IG 1GMJA 5CCGD 4YHHB 2HLOA 2ZQMA 1PV0A 2CPBA 4I4TA 3A0HH 4D7SA 1N73B 4ASWA 3LIDA 1SQQG 1N36B 5J9PC 1M57B 3B71A 4X65B 2HFED 1M4UA 3JALB 4FLXA 1QLEC 4LF5O 3B40A 1WP7A 1YJWV 2P10A 2N1TB 1K8AQ 3ZIAG 2JK5C 3DXRA 3L70E 3U1AA 3UO3A 3CCJP 4BIZA 4EB6A 1BE3H 4MT8A 2E76C 4O4LB 1AP5A 4QMAA 5CA0A 5B66E 1DTOA 4U7JA 3OAAG 1R8EA 1LT9C 2JEXA 2JGDA 2P7JA 4UVBA 2GBOA 3HD7B 3USSA 1AVMA 1SS3A 3P3NA 4GIFA 4D6TD 1AJNA 3RFRA 1N8RQ 3E83A 2RN0A 4U3FJ 3B4SA 3JAMN 3SFDC 4OWFA 2RDCA 1XILA 1YTFD 1CW5A 4UB8Z 1NZ6A 5TISZ 1JA8A 1QLED 4KL1A 2ZYAA 3L75G 4YXDC 2F23A 5KLVK 1W2EA 3L72J 3VOPA 3ZMSA 1X4TA 2WLMA 5IT9N 2I1KA 5JCOC 3S4RA 4DUYO 4F6RA 3OFNG 3SJBC 2IDBA 1NJIW 4DR1B 1HP8A 1NTKE 3PH0A 1AI4A 2J59M 1FOSE 3ZEDA 2RKLA 2QSAA 3RVZA 1M1JA 3F5WC 2WPDG 2V7QH 4B3SO 2WITA 1FXKB 1QU7A 2EIKC 2JS5A 1JFFA 4X64B 3ZS8C 1U7MA 5LP6A 2P90A 2R9IA 4ASUG 3Q5SA 4DR5O 1N7SB 3RK3E 1FJGB 1MZFA 2VQFO 1IBKB 2Q67A 4B3SB 1M7LA 1Y76B 1EZVH 1BQ0A 1SQVJ 1Q5OA 2ZR2A 3ZN0A 2ZM6B 3AEFC 1M56C 3G6BA 3FAVA 2QWOB 1OCZB 3CCUP 4IFDK 3CMAV 4FIPC 2E5LB 4XFJA 4B3TO 1BSHA 1J5EO 2IYOA 2RJZA 3RK3B 3OGCC 1EDKA 2SPZA 4MVUA 5B1AC 4JYAB 3H1JG 1WP8A 3CCEV 4UVCA 4WB4A 2HLDG 1VQNP 5E1AC 1Q7YQ 3FB8C 4L76A 4LF6O 3CX5I 3SPJA 1NTME 3A0HE 3G4SP 3D3QA 4X66O 3CWBE 3TNUA 3ZMUA 1DK1A 1SQBK 1FXHA 1BSMA 1WA8B 4AYCA 2GA1A 2Q3IA 5TISE 2UXNA 2YEVB 1NT2B 1MA1A 3H1KH 5AVXB 2FXMA 1V55B 2POHA 4X1KA 5IY5B 1AB3A 4GX2A 2EIMB 1QR9A 2E74B 4WF9V 1EM1A 3GG2A 1Z5WA 2ZDIC 3CRRA 1M8OB 1JNMA 2QJPB 1DLBA 2AXTZ 2XTAA 3LDDA 4JASA 4TWKA 3SWKA 4WFBV 1MV8A 1SQXK 2KSEA 3H1KJ 3TCUA 1PL4A 3SPIA 2LGWA 3K57A 1OW8A 5BZBA 5DJTB 1ZRTE 2H8PC 3ABTA 4PJ0H 2W8ZA 4ZBMA 4C7NB 1W59A 4I0XB 1ZWIC 2LKMA 2QM7A 3NFQA 3H1LH 3MUDC 4KP4A 2F43G 3VBBA 3JAKB 5JVDB 2FXPA 3SWFA 1LGHB 2PRRA 3WFVA 1EQ7A 3JATB 3KZIE 3D6ZA 2DW3A 4JAUA 1XTCC 4JI4B 5APYA 5EBLC 4ASVA 3H6PA 4HKZH 4RAIA 5L3EA 2CDYA 1JCDA 1EN4A 4OX9O 4QE9A 3OD4A 1HVVA 4J10A 3FGAD 1S3JA 1YQ3C 4X66B 3O6QA 2FYUJ 2HHHB 5AVZB 2GUSA 1BE3J 3B5NA 4GKKO 2YKPA 1XUQA 2NPSB 1X9VA 4OGQC 5EZYA 2ADQB 3H32A 4NXMO 2QEXP 2ZDIA 5JWPA 1N34O 2IFNA 4FMTA 5FLXN 4PA3A 1NU1D 1VQOP 3B8EB 2UUCB 5CCHD 4WY4B 1SFCA 1VDFA 3V5BA 1H8EG 5BVZA 2GM4A 4GZRB 1CI6A 3CXHF 4C46A 1KORA 5GONA 1T5EA 1VMGA 1NTKG 1EZVD 1L2PA 1KFNA 5KHGA 4R6ZA 4C7RA 4X62B 2W6JH 3IFMA 3AE3C 3NXSA 2Y9ZA 3ZJZA 3MDSA 2AEMA 3JALA 3RBZA 2HP8A 3JASB 5JJJB 1BDDA 2WAMA 3AE5C 1CPYA 2XAGA 3Q2YA 4F4LA 3BRVB 3ZCCA 4YY3O 4FM1A 1KD1W 1IO4A 1LJ2A 2ZE5A 3N2KA 1G1XB 3EXAA 3I55V 4N78E 4JZGA 2K9PA 1JY2O 3THOA 4N6JA 1RY3A 2QKSA 1PM9A 2X0LA 3E7KA 1YJ9P 3L70D 2Y9YA 1N8RW 4LF9B 1EDJA 3AG1C 1L0NH 4DK1A 1WPXA 1YI2V 4DR4O 1D5NA 3WG7B 2H7HA 5KUMA 3AE8C 3E1IA 2E5LO 1S0VA 5IWAO 4DV2O 2D2CD 1TGOA 3GHGB 2YXLA 1DIPA 5IYZB 1FZCB 5B5EH 4TQFA 2DQ0A 1RF1B 4ZHQB 1QBZA 2QDOA 2YIBD 4HH2A 2J5UA 2YSUB 3MP7B 3TGUJ 1JTHA 2DWDC 3GMAA 4PV1D 3N4XA 3NTNA 1M9NA 1LR1A 2R3CA 3CX5E 1J2JB 1SQPH 1YCIA 2FTKA 3BCCJ 1KQGB 1AR4A 4N3YB 2P1JA 2BTQA 5JH7A 4WFFA 4BRYA 1N34B 2MJZA 4KHXA 5KLVG 1GW4A 1JFFB 1Y47A 5APQA 1X79B 4PA6A 2OYQA 1X22A 2XNXA 1P7BA 3CCQP 1Y74B 1KFMA 4NYKA 1SQPJ 4WWIA 4J7ZA 4GUNA 5AW6B 2YXQB 2HHHO 4FFBB 3CMEP 1Y76A 2WSFJ 4DR7B 3T1CA 3BATA 3BVHA 4FJCC 2XAJA 5KUKA 1N7SA 1YXBA 4FLWA 1RFYA 2FB5A 4RUEA 3CC4V 3K06A 1BQZA 2QM8A 4RESB 3K5NA 1KMIZ 3E22B 2VWJA 5M1BA 3D71A 1X59A 2ZAEB 5B3SC 5CCGC 3SYQA 2ITAA 3B5NC 1IBLB 3R66A 3KG2A 5KKZB 1MSDA 2N04A 1VQ7P 2KK7A 3WU2H 1E79H 3JSLA 4I1LA 5IJ9A 4BIUA 1KB9H 2W6AA 1NTKH 4RKUJ 5H2FZ 1U97A 2E3CA 1B6QA 3H25A 1VQ8V 4OGQB 4X1YA 3SSUA 4FK5C 2Y0PA 2HVKC 4LF5B 3HKCB 5GW7A 4NPDA 2DYSB 3QWOC 5KLVJ 1XL4A 1OZ0A 1ZN5A 2QA4P 1BE3D 1K5SA 1WMKA 1JCCA 5JJEB 4QIWF 4TOIA 1BHBA 3N2GA 1K04A 2GTSA 1Q86W 3H9VA 4X20A 5DN6G 4R4MA 3CCSV 4K8ZA 3CCSP 1QHTA 2JRIA 2PYLA 3TGUG 3JD0A 2BASA 3VMXA 2HODA 2ZR3A 5CMUA 3WB0A 5E79Z 1FXVA 2ITCC 3DGEA 2QA4V 2AGAA 4PV1B 1RE3A 1ZR4A 1GN6A 3H1IE 1J1EC 4OH8B 4N21A 3RYIB 1FE6A 3HUSB 3A3YB 1NAFA 3TYYA 4OXSA 3HKEB 3KQGA 3ZMZA 1T6AA 3DSQA 3G71P 2R3SA 3MHSC 4X1IB 2OTLP 1KILB 2FFDC 4PA9A 2YI8A 3K9AA 1OV9A 1VP7A 2EILC 3JATA 1SC5B 4E2LA 1E79G 2ZD9A 4QNHB 1S1CX 1NR1A 1HWYA 1CZQA 2RMZA 1P84E 2UUBO 4KUMA 2A79B 3CC4P 3ABKC 1YEWA 5DEDA 1PIXA 2WA3A 2KSDA 3T2MA 5APTA 2VS0A 2FXOA 2QJKC 4CPGA 1Q90D 2WSSG 4UB8E 1FXKA 2JEUA 3O6QB 5APXA 2YUAA 4GOFA 1GAXA 4YIOA 5AVSB 2N1TC 3K0DA 1Y9BA 3B2EE 2RH0A 1S5HC 1HW7A 1AJPA 2WQYC 2F1MA 3I5DA 4EEQA 3RVYA 4A7PA 2BCCJ 5LYJB 4PJ0E 1VQ5P 3LUTB 1M1KW 1R3IC 2V4DA 1IBMB 1CI6B 2KB7P 1SA0A 5GTHZ 2N74A 4O9BA 2BE3A 1RQUA 3JCUE 4LFCB 2ARHA 2BTOA 4PDLA 4XDJA 1OCCB 2KNCB 2M7WA 4LR3A 3BPZA 5LHGA 1TUEB 5C8YB 4ZKPA 4DR2B 4QPJA 3T97A 3ZHVA 1LTAC 3RN4A 1YITV 4X88A 4JZ2A 2VQFB 3CXHI 3TSIA 1XNQB 4H44B 4F6RB 5LMUB 1YI2P 4H0LB 1OXZA 3CCMV 4JGSA 1IFIA 2H8PD 2YIUB 2CH7A 2A45H 3IF4A 3E1RA 1QR8A 4JQ0D 2M5AB 2F4VO 3RL0g 4X1KB 1E1QG 3CC7P 2WSFH 4TUYB 2KS1B 3H1KD 3L73D 2EIMC 3BEHA 2BCCH 1CEZA 1S72P 4DW1A 1AVYA 4UCVA 1NHLA 4P2ZA 5JJNB 5BY1A 1GL2D 2Q7CA 2QGNA 3LSQA 1XTGB 1FXKC 3QO7A 1K5QA 1Y4MA 3H01A 3OUSA 5LXTA 5BR8O 1NOHA 3KPEA 5B3SB 4K35A 5KLVD 1PL0A 5BR8B 1OCOB 3ZHUA 3JSNA 1N4CA 2P58A 2VRZA 3GW6A 2Y0EA 1SQGA 1MMMA 1NTKK 4O4HB 2B9BA 3U10A 3L36A 5CA1A 1FKAO 4W4KA 2P4VA 4IIJA 2KI7B 1JMKC 1YJNV 4DYLA 3VP9A 2WPQA 4JF7A 2HPCA 1S4XA 2ZXEB 1BMFG 4IHJA 1TVKB 3ZRXA 4PDRA 2CTPA 4DCKA 4LH7A 3L75E 2JDIG 4RUFA 1URQB 1ZSPA 3B09A 2UXDB 3L70H 4JYBA 3OTFA 1L0LK 5E79E 1DD4A 5LMUO 3B5NB 3IJ4A 4PI2A 5EIBD 1T8ZA 1TA8A 2NN4A 4X89A 2FY8A 2GDSA 2LW1A 3OE7G 2KG7B 5LBQA 3RYCA 2G38A 2Y4UA 1S77D 1H89A 4DV5B 3AG2B 1QNMA 5FL7G 3ETGA 3E8BA 5H5NA 2AZ2A 2YS8A 2PGGA 1V55C 2FKWB 1BCCJ 4D6TE 5GTIZ 3RW0A 3V4WA 1R5LA 5KJ7A 1Q6HA 4JTCB 3DC6A 1JMMA 4P30A 1R6NA 2YO3A 4FFKA 3FX0A 5H2FE 3BABA 3BRCA 2QJPC 3Q4HB 5LGUA 1H38A 4DV3O 3IN6A 1KQFB 2CTWA 3IGAC 1LWUA 1AVOA 4HYOA 2A7WA 2EX3A 3E86A 3SPCA 3L35A 5AVTB 1AI6A 3FYEB 2B88A 2CAZC 3MAQA 1KILE 1Z5VA 2ILMA 3Q3DA 4TV8B 4GKGA 3A8TA 4L74A 3M9HA 2BCCD 3ZN1A 3HTKA 1A02J 5KJ7D 1FPOA 1R6TA 1SQQD 3S9OA 2VQEB 2CPSA 1GTOA 2AZ0A 1YITP 3L70J 1PL5A 2YIDA 3AK3A 4CZZA 3RK2C 1VF5C 5AW2B 2Y69C 1EN5A 2WMMA 2EJRA 2RN9A 4YXWG 1YIJP 4JPRA 3PTZA 1NJIQ 3BA9A 4NPEA 4JI7B 4H44C 2ZT9D 2H3OA 4I4TB 4UCSA 4LFBB 4JI8B 4DJGA 1AV1A 3IR9A 3CCEP 5IYZA 1SQXG 1Q81Q 1FZCC 4YIPA 1IFNA 3OW2O 3HRNA 1KP3A 1YTZI 1X8YA 3SDLA 1WT6A 2XU6A 2OCCC 4PD4H 3GWKC 3P30A 1N32O 2V7QG 3CX5F 3S3WA 1IC2A 3VMAA 3CX5H 3WUUA 1RM1B 1VQMV 3B8MA 1R3JC 1SP4A 3AE1C 5KMGA 2KLUA 1S5LE 2QJKB 5AW9B 1SQVH 1SQPD 3L73J 1IK7A 1OHHG 3CP1A 3LW5J 3UM7A 3CCQV 1TU3F 1PGJA 2W83C 1LWUC 3AK1A 1K7DA 4PJ0Z 4DRXB 1KQSU 2MKVA 2AHZA 3CJHB 1PZQA 2PUSA 2R32A 4QE7A 1ZXGA 3ZDMA 3VQXA 4KHPO 4X9QA 3E22A 1BGYE 3A0BZ 4DV1O 4IL6Z 1LTGC 2ZT9C 3BCCH 3ICXA 3S1KA 2JVDA 4LF7O 1E5WA 1E1RG 1VL2A 2UUAO 1UIIA 1DEBA 3U59A 4D7TA 1M5IA 4XDKA 4NXNO 4YJ3B 1XNRB 1K4DC 2NPSC 2Y0DA 2X7RB 1B04A 3OR7C 3VQVA 1HGZA 4DRXA 1EDIA 1RPRA 4W4LA 1NH2D 1L4AB 4WVZA 5EC1C 4JV5B 4HBNA 2C2AA 3AG7A 3HKCA 1QCEA 2DYRC 3T4ZA 4M3LA 1GL2C 3TGUH 4TT3G 4UVAA 2LQTA 1KB9F 3PN1A 1ZTEA 4MTGA 1SQXE 1N7SD 3S3XA 4I55B 4FLZA 1BE3G 4BR6A 4IT5A 2EJ7A 3LSSA 2BEQD 5LHIA 3T1HO 2JKVA 1LT1A 1BCCD 2XNDG 4MTXA 3AEGC 3VYIA 4UB8H 1RSOB 2ZM6O 1Q82Q 2B1IA 1KN7A 1UPGA 4XBFA 2Y48A 4FFBA 1OW6A 2KP8A 1R3LC 3MUDA 2C0WA 3TF5A 2WVRA 4KXRA 4U7OA 2C9NY 1L0LE 1I08A 3QNEA 1XI1A 1FS0G 3LNMB 4JI3O 1AP6A 1KYOE 2ADPA 2ATKC 4TSFG 2YEVA 2QRXA 3F89A 4TT3H 5ITZB 1UIXA 1BCCH 4MTOA 4JF3A 4FM2A 3L74J 2HR3A 4TV8A 5AW5B 3CD6V 2XOKG 1SQQJ 1R5SA 2WLKA 1XL6A 4QJFB 5IJ9B 1XEQA 3ZRWB 5CN0A 1VPCA 5AVYB 1M57D 4K8XA 1GK4A 1YJNP 1KB9E 3STLC 2OT5A 2ZE8A 3OM3B 2QIWA 5B5EE 4DUYB 3CCVP 3M8AA 5KAFZ 2AEFA 3JARB 4Q20A 4K0KB 1HGVA 1LP1B 3JAWA 1S5LX 2FYUK 5APSA 2OYHA 3P3PA 4X1YB 1IFMA 3AEDC 4D6TG 1F51A 4NXNB 1XNRO 4JPZB 1W2BO 2WTYA 2Z4EA 2KKWA 3KCYA 4L75A 5BU5A 2B87B 1JMBA 2DYSC 1KYOI 3HE5B 3ABMB 3ZRSA 4CH6A 2Q5ZA 1W0JG 3TXSA 2P7TC 3MHVA 2HJFC 5KAFE 2QWNB 5KAIH 1VF5D 2F95B 2NR5A 4R8CA 3T1HB 2QR4A 1VQPP 3SGIA 2E5TA 4UV9A 4CH3A 1VQ4V 2L35A 1YVWA 1IX9A 1ZLLA 3H1LJ 2HG5C 2Q7EA 4FLTA 4WFGA 5AVRB 2KUBA 3CXHE 2YIBA 5CHXA 4PV1C 1NTMK 2V4HA 4JI1O 2N1TA 4JI2O 2R5DA 5IYDO 1R3KC 2A06G 3RWRD 3APQA 3P32A 2QWQB 3CL3D 4LGDE 4CC6A 1URQD 3FB6C 4PDMA 1KU9A 1ZL8B 4O4IA 3RYHB 3DXRB 3QVNA 1GDTA 1VQ7V 1YBKA 1SQVK 2AXCA 3EHBB 2A45G 2P22C 1AI5A 3SYOA 1NH4A 3AG3C 1GL2A 3V2NA 1N33B 3WU2Z 2CUGA 4DV0O 4CC5A 2KS1A 3VQWA 2YIUC 4I7ZC 5EIBC 2M5AA 1GTWA 5CBHA 4JI1B 1SLQA 4DV7O 4XDLA 1KV4A 1HNXO 1FD9A 1K97A 1I7FA 1VQNV 2XZRA 4UB6E 3SJQC 1G4YB 1Q82W 2ZFCA 3BCCE 1M56B 1MZ9A 4PHZA 3WB1A 1PGPA 4B7EA 4L73A 5A9GA 1OWAA 1HNWO 2YIAA 1SA0B 4LNUA 1M1JC 2CTRA 2M6YA 2ZE6A 2YICA 3CYOA 5LYJA 1L4AD 4R4LA 2GUZA 1XHXA 3RL0B 1IZ3A 1XDCA 3GWOA 5KX5A 2PP6A 3SPHA 5LOVB 3L75J 1K3EA 2ZNJA 3OTOO 4DV4B 5CA1B 5LP6B 1BZKA 2Y0IA 2ZYDA 1D5AA 2QVAA 3WU2E 2W0FC 2NRGA 2ZJSE 3II6A 3E89A 2LW7A 5EYPA 1IFDA 3A2FA 4NR1A 1RF1A 2BSKA 3EFFK 3C9IA 1SQFA 1F4MA 1NU1G 3BAAA 3OR6C 2JEEA 3D3IA 4LWSA 1UJWB 3UT5B 1EZJA 3CJHA 3FD9A 1GO3F 2IW5A 2KG7A 5JH7B 1K9MW 2K88A 4J11A 1BCCE 3FAVB 3WMM0 1SS1A 1H2GA 2CGOA 2JGUA 3L74D 3L73G 4W7ZA 3ABKB 1GM7A 3I55P 3QF7A 4JI6O 1DH3A 1YHQV 2VWKA 3HD7A 1L0LH 2EINC 3SYAA 1LTJB 3AG3B 1IBKO 2V1DA 5EYPB 3OUFA 5TJHA 3BY6A 1FU1A 1T2KC 2Z0AA 1H2MA 1OVRA 3HD7D 2IPPA 2DYRB 3L73E 4O2BA 2WLJA 3KXDA 1N7LA 5AW1B 1SQQH 4AHCA 5C93A 4LH6A 1VQPV 2WLLB 1NTMJ 3K5BA 3PRJA 3OEHG 1YTZT 1NTZK 1LTSC 1JY3N 2L6LA 4HNAA 2FYNC 4J42A 4IIJB 4JAVA 3G4SV 4ZOLA 4DOJA 1I94B 1GD2E 3CSXA 3JD4A 5KHJA 2PY5A 4JI0B 5J2TA 4LF9O 1EZVE 5F2VO 2D2CC 2M8RA 3ABMC 2ZXWC 1QLNA 1L0NE 1TVKA 3MGNA 3NR7A 2MW2B 4ZIBA 1BGYJ 1EZVI 1AROP 2AXTE 1ZUQA 1GK9A 2O57A 1VF5B 1EBOA 1COWG 5D5PA 2BCCG 1L1FA 4LFAB 2NZ2A 2ODMA 4IFMA 3L74G 4WFHA 2Q8VA 2GV9A 2K9YA 4WFAV 3N2GB 5EFWB 3CPWO 1GU4A 1XMQO 2WPVB 4N78D 5CBNA 3CWBH 3ABVC 1VQLV 4J9ZB 4B7KA 4XA4A 3M99B 3WG7C 2JP3A 3VMZA 4IL6X 2HODB 4PD4E 1GH6A 4TV9A 5EBMC 5FNVB 1NU1E 1A32A 4BXLA 3MIWA 3GB7C 3TDKA 2QM4A 3CS5A 4Y99B 1NKZB 1RF1C 1N73C 4DT0A 2IBZH 3AG1B 1PGOA 4UB6H 4JYYA 5IJ0B 5EZYB 4UCTA 3UQ8A 3HKBB 1Z2GA 1F4NA 4G27B 4LC1A 3HKEA 2JS3A 1GN4A 3RYFA 4DV6O 5KLIC 3CWBG 1PP9J 2Y4TA 1ORQC 4BIOA 3ZMVA 4H37A 3RL0C 1IJDB 1IXMA 1BE3E 4RJTA 1OFCX 3KKYA 4DV7B 3AEAC 5BU8B 2EZPA 4P9PA 1R1BA 3BVOA 5AVQB 2DQ3A 4U3FH 1KUQA 5CCGA 3TXQA 1SQQE 1VQ6V 1O9GA 3FFQA 3QH9A 5KA5A 2XT9A 2JIZG 3IAOA 4N23A 2DOSA 3L75D 2OYIA 1ZLZA 1THZA 5CA3A 2K9JB 1QQCA 3SYPA 3IFXA 1PP9E 3H1ID 3CHXA 1SQBD 1FJKA 5AG2A 1QX8A 3P8CE 4AILC 1B3QA 4AI8A 1YHQP 4RWUA 2UXBB 5DM6V 3B77A 2YKQA 2PGDA 4I6MC 2HEPA 5AW7B 4D6TH 1V54B 2R72A 2FBWC 3ZHQA 4GCZA 1BHAA 4B3RO 1G2CA 5LP6C 3GLMA 1NTZJ 2WSCH 5EC2C 1GL2B 2FYUG 3N7NA 4LFCO 2YKOA 2LO1A 4W80A 1H8HG 5BMVA 4NTWA 3AE7C 4E4EA 5B66Z 1VF6A 4ZI7A 2V7QJ 1P4RA 4UFZA 2VRSA 3K08A 1NQTA 2NPSA 2EILB 1QVGU 2DW4A 1XBLA 3TETA 5B5EZ 1AI7A 2K1EA 1F23A 2PZSA 5D5QA 1LT9B 2Z5HA 3W7XA 3ZMTA 3KCXA 4IGGA 3K58A 4B3RB 2KZIA 2NPSD 1HJBA 1S9KD 4BWNA 5JQGB 1PPJG 3MD0A 1SETA 4H33A 4B3TB 1H2LA 4GX0A 2YI9A 2HKOA 1Y66A 1GMGA 2LR2A 2OCHA 4YJ3A 1XMOB 2B89A 2AW9A 3L70G 3RK3D 1VQ9P 4NPFX 2W90A 2JDIH 2OIGA 4CH5A 5CCHA 4DR5B 1NTZH 3H1HD 1WA8A 1JM0A 1YIJV 4MVSA 3JAWB 1VQ6P 4MS2A 4NTXA 2B87A 3H1HE 1KTMA 3JSVC 4CS4A 2ITDC 1RM1C 1T3JA 1DGSA 1N33O 4MVMA 3J7AU 3AEEC 3SJCC 3H32B 2IU0A 1K05A 4O4LA 3QO5A 1T3UA 2WT7B 3HKDB 3UCSC 2RCVA 1S76D 2OQQA 1ROPA 4L8JA 3H1LD 2WLNA 4FVMA 3CC7V 2ZVOB 3LSUA 2YMYA 1HUCA 1KQLA 4J9YB 3HE4A 5KHIA 2UU9B 3VP8A 2QWPB 1G1JA 2D3OW 2KXPB 1SF9A 2IJKA 2JJ2G 1LTTC 1Y8AA 3V2PA 3CCLP 2EIJC 1EN6A 4GX5A 1DF4A 4Z2WA 3CXCU 1DF5A 4EI2A 3EFGA 4IFFA 2QWRB 3I56V 3K59A 1GK6A 4B3MO 1MKMA 3W7SA 5AVVB 1KZUB 3X2QB 4F6EA 5J2TB 5L3DA 2PAJA 1SQBH 2QE7G 1FFXA 2DJVA 3IC7A 2YMKA 3RT3C 1KKCA 4I5SA 2WA4A 1LUVA 5CCHC 3JD3A 4NTYA 3O8ZA 1AQTA 3J81N 3OMIB 3AECC 4KHPB 5DECA 2Q0OC 1OCRC 3Q4HA 4X1IA 1WN7A 4PA4A 4JI5B 4R50A 4AUWA 3H1IJ 1SQBJ 4K0KO 3O65A 1V9PA 4DR2O 3CLQA 3W7TA 3VMYA 4DR3O 1BS3A 1HNXB 1L0NK 3ITKA 3SFEC 4GYCB 1K73Q 2E75D 2WLHA 1IDSA 2E74C 3LW5H 2XAFA 3HTKB 2PI5A 3MHHC 2GUZB 1JOCA 1P84I 2B9ZA 1I94O 4GKJO 2WPRA 2GSMB 1FDOA 1FAFA 1KECA 2JGDB 4DR6O 1YZBA 3F7VC 2DMXA 2W6JG 1T2KD 1USDA 3DTUB 5L3FA 3D70A 3JASA 2K37A 2WSSH 1FZGA 1JB0J 1KB9I 3CRMA 4MVZA 3CEIA 2EULA 3T4DA 1W2BU 4MSWC 3HB3B 1ZRTD 1NTZG 1DX7A 1ZL8A 4Z1MG 3G71V 3W67A 2H88C 2B1GA 5K1PA 1IFPA 5LA6B 3MZWB 3FXEA 4JI6B 4U3JA 1AQ5A 5IWAB 4DV2B 4UCRA 1OCOC 1WRGA 2IJIA 2KOGA 3Q5RA 2B5UA 4DR4B 2DN9A 1AA0A 3UKMA 1ZAUA 2YXHA 5H6QA 3J80N 1P84H 3RYIA 1HWTC 4U7NA 2P5OA 2K1AA 3L75H 4I7ZB 1LTIC 3FWLA 4YY3B 1SESA 1D7MA 5GTHE 1VF6C 1JTHB 1OX3A 4J7KA 1SQVE 5L3CA 1A02F 1JJOA 3GHGC 1EFRG 1NTMD 2FYZA 3TK1A 2BOCC 1WB8A 4DV3B 3OTOB 1MG1A 4WY4A 3E8GA 3L73H 3V4QA 2OTJP 2A9HA 5GTIE 1BCCG 3STZC 4BRYB 1KYOF 1M57C 3QG5A 3ETDA 4GKJB 2Y69B 1NU1K 1QL2A 3KHUA 3JAKA 4IYHA 3HPLC 1BGYD 1K9MQ 3ZRWA 2RNBA 3HKDA 4B08A 4J7JA 2N05A 4ICGA 2L5GB 3ASNC 1NKDA 1M56D 2PYJA 4H13C 3KZIH 1N0JA 2FKXA 1L0LJ 4JI5O 1EXJA 4JI3B 1MOFA 3ABLB 1ZX3A 4ZKIA 2OCCB 2O01N 2OGUA 2GHYA 4I50B 4EFBA 1NYHA 3L74E 4EIJA 3X2QC 2UXDO 4Z1MH 4LWSB 3AG2C 2CTQA 3R2PA 3I5CA 3FWNA 3L72G 1JVMA 1PNMA 4EDFA 1FOSF 3L71H 2HPCB 4DR6B 3H1JE 3ASOC 3ZHTA 3EQ2A 2HJDA 2KNCA 3H1KE 3OJAB 4R7CA 3E2EA 4H13D 4HAMA 5KHHA 5EK0A 5GTIH 1I0HA 4WBNA 5CMZA 1NTZE 3HR0A 5CJ0A 3A0RA 1XMQB 1RQVA 2EINB 3APOA 2N1TD 2YO2A 4W7YA 1U96A 3ETEA 1U7JA 4YJ2B 4QGPA 2O1KA 3UIAA 4WBAA 4DV6B 2OTJV 1JR9A 1GW3A 3M06A 5B1NA 1PP9D 3C1LA 2OTKE 2FYNB 1HBWA 5KAIE 2G8YA 5KLVH 5J2UA 1PD3A 4LF7B 3E35A 3N2KB 3OT7A 5KLIB 1Q86Q 4KT0J 1NTMH 5B1AB 2Q1KA 2FFDA 1GM8A 2R5BA 1NGMB 1S72V 3Q5PA 3C3SA 2IJJA 3OW2U 4OVNF 1Q6UA 2LFRA 3HUSC 1VF7A 3HE4B 5K1XA 4PD4I 2QG4A 3AG4C 2XDJA 4MVQA 1FJGO 5C8YA 3CC2V 1JY2N 4I9WA 4TQDA 1IXBA 1NBMG 1UFIA 1US6A 1Q43A 3BHPA 3EVKA 1N73A 1NVPB 3W7UA 1G1IA 3KDPB 1MZEA 3ABLC 2IBZD 4A5UB 2ZT9B 1IZNB 2O3JA 5LA6A 3JCUZ 3CD6P 2JWDA 1KP2A 3T1YO 1SQXH 1KYOD 5CA0B 1FZBA 3H1HH 1NTZD 3QO8A 1SFCB 2YDEA 3L71G 1MFZA 4AQRD 5KTBA 2IBZG 3IAYA 1OCZC 3L72H 1O9HA 1N32B 2QJYB 4JBZA 4G2KA 4JI0O 1M93A 5B1BB 3RK3C 1VQMP 4I9QA 1EDLA 1EC5A 1N0NA 3U0ZA 4RO0A 2E5YA 3ZHSA 1IK9A 1S5JA 4X62O 1OIPA 1VQOV 3ZHRA 1SQPE 2RQ6A 3G6EV 2Q9IA 3CE2A 3VTPC 3U1CA 1K33A 1OVUA 4K3AA 1AJQA 2WZ7A 1TUBB 5AW8B 1Q3EA 5K5GB 1S2EA 1XOUA 5BXZA 4IOIH 4JTDB 3VOUA 2X6CA 1NTKD 1P84D 3K3WA 1PP9H 1HR0O 1NS1A 1CSBA 2P2UA 1JCHA 3ASNB 1JX9A 1PV3A 1FFTB 2LFSA 5CB4A 1FS0E 2M3BA 1KBHA 1VEWA 4NXMB 1L0LG 2ZVNB 3H1IG 2E75B 3T97B 1SRYA 2ZCEA 1SZTA 3CRQA 2UUBB 2UXBO 5DJUB 3RGUA 3V2RA 2UXXA 3AEBC 2E42A 4UB6Z 1LTJA 2K9JA 2GTAA 1OCCC 4X65O 3C8VA 4DR1O 1L4AC 3TGUE 2OARA 4LBEC 1L0LD 1H2KA 2ETNA 1OVVA 1FZCA 3H1HJ 4H0LC 1TUBA 2YXYA 4PDVA 1RPOA 2EBOA 1H8AA 4EOTA 2OYHC 1NU1H 4JI4O 4JYCA 2LXCB 3F5TA 2ZE7A 2PF4E 1YJ9V 2P4KA 2R9AA 4KJMA 3L71E 4DV0B 3F5HA 2F4VB 1ZOYC 3CCMP 4ZOLB 1GU5A 1JY2P 2XKMA 2HVJC 4HZ3A 2H43A 1RF0C 4IL6E 1XHZA 2XHBA 4GODA 2YNYA 2KZJA 2X6BA 3OMAB 4L87A 3JYCA 4WY4C 1JEKA 2N9YB 5IYCO 2L91A 2Y0CA 1GKFA 4P9OA 4ABMA 1YQ4C 1NVOA 2DWEC 1HNWB 5AVWB 4I2LC 1X0TA 2IX7C 2WLIA 1KC8W 1NKNA 3AE9C 3LNNA 3L71J 5B1OA 4Q6GA 1PNKA 1BGYG 4TLFA 1GN3A 3JD2A 4CBCA 2Q68A 2OWOA 4OX9B 1PGQA 3FB7C 4DK0A 4FPPA 3K5OA 2CK3G 3G67A 1QLEB 1N86A 3JCZA 4MVRA 1M1JB 1FFXB 1CP9A 2W0XA 1F7YA 2IU3A 2Z5UA 3L9DA 1Z56A 2E76B 3P8MC 3ABUA 2F66C 4H0LD 3K5LA 1URQC 2PTMA 4H44D 5H6RA 2KLVA 3G80A 2H89C 1W5CE 5B66H 1FBMA 4JI8O 5KLVE 2UXCB 4CH4A 3OAKA 4LF4B 4JI7O 1LUWA 3W68A 2A06H 3AK2A 4RQEA 3CI9A 1SFCD 1G8MA 1HDJA 2WLLA 2LJ2A 5L8RJ 4G28B 3CRCA 1KKDA 1CXZB 1Q7YW 4DUZO 1TAEA 4PI0A 1SQBG 1P84F 5KAIZ 1NVPD 2CK3H 1K92A 2XAQA 1BL8A 1BDCA 1H2NA 3CCLV 4X8AA 1Y67A 3AEIA 2Q73A 4YPCA 1FDMA 1FZEA 1HR0B 3SYCA 3NMDA 5LXTB 3K9SA 4LP8A 3GF7A 2Q0AA 1KD1Q 3GF3A 2QKAA 3AE2C 5B1BC 1SZXA 1PFIA 1Q6IA 2E76D 3AE6C 5KAFH 3GVMA 2LXBA 3BFRA 1MUUA 1QL1A 3CXHD 1J95A 1H2SB 2W6BA 4MW3A 3OEEG 5LHHA 2R44A 1QGKB 3M7MX 4U3JB 4BAYA 4DXWA 1NR7A 2EIJB 2DE0X 1YSCA 4LF8B 2M0BA 3SWYA 5IYBO 1J5EB 2N9BA 1PPJH 1XREA 3OGIB 4LF8O 5KKZC 3LDEA 3VQYA 1HF9A 3SPGA 1URQA 4OPAA 4PD4D 5IJ0A 3CWBJ 2ZINA 1FJPA 2ZXWB 2E74D 2HG5D 4JV5O 3HD7C 3G3ZA 1K73W 3HKBA 4JAAA 1J1EB 2WSCJ 2R9RB 3CPWU 2IBZE 4EKWA 3FYIB 4Z1VA 2BEZF 4RO2A 2OIEA 4DV4O 1DEEG 5C39A 2O1JA 2IFMA 2QJ1A 4CS3A 2I8DA 3G6EP 3M9BA 4DO2A 1PP9G 2LP7A 2IH1C 2FYUH 5KMGB 5LGNA 1QVFO 4PA7A 3ETQA 2A3QA 5JQGA 3B8NA 3F7YC 4MW8A 2Q69A 1N36O 3CMEV 1NWQA 2UUCO 1WNSA 1N7SC 5L3BA 1LWUB 1K8AW 2Q9LA 2JR8A 5EBWC 2OYHB 1IURA 1J1DB 2QSIA 4EYYQ 1VARA 4WFEA 2QEXV 2O01J 2W27A 2UU9O 1S5LZ 3R65A 1VQLP 4LNUB 1NO4A 4FLYA 4GKKB 3CX5D 3H1LG 3D6YA 4LF4O 1HTLC 2QTSA 2OTLV 1M90W 2UXCO 3RGBA 3L71D 3RK2D 2P67A 3ZRVA 2Q3EA 1L0ND 3CB2A 4OGQD 1YYCA 1WAZA 4JTAB 4EB6B 2UUAB 3A0BH 3L37A 1RE3C 1G2CB 2CH7B 1SQQK 4J41A 2O01H 2Q6QA 3H1LE 4U3FG 1Q2NA 1USEA 5LOVA 3C90A 2CGNA 2I1JA 1KYOH 1SQXD 1ZMEC 4PELA 3RBXA 3C3TA 3IC9A 4JI2B 1KB9D 2NNUA 4NVPA 4D6TJ 1MFTA 5LL6Y 3D8CA 2AEJA 4U3FD 5AW4B 3I56P 3TNUB 4ZI7B 3PP5A 5APUA 3UT5A 4LFBO 5APWA 1RH5B 1AR5A 1ZP0C 3ZX6A 4YHHO 3H1KG 5APVA 3FXDA 1S5LH 2HYNA 2YXRB 1SQPG 3K0GA 1HNZB 3LIEA 1EXIA 2KYVA 2EZOA 3JC22 3L72E 1PNLA 3P7KA 2E43A 1OZHA 4I55A 1KILC 2FFDB 1YTFB 2G3AA 1NTMG 3K04A 3WB2A 4DW0A 3FKSG 1IBMO 1VQ5V 4Y99C 5J2UB 1V54C 1YJWP 3PHLA 1WJZA 4BW5A 1S9KE 4OPHA 1OJHA 3V2QA 3BCCG 1L0NG 1SKVA 3LDCA 1SQPK 1GRJA 1R6KA 1GZLA 4KFMA 1P49A 3A0HZ 4C7NA 3K79A 4BW9A 4EFEA 4O2AA 4B86A 3AG4B 1YF2A 5KHKA 1MNGA 5AW3B 2Z3YA 2FMLA 3L74H 4FLVA 4DR7O 3K03A 4BWAA 2OYIC 3H1JD 2WPSA 1AJYA 1U57A 4X20B 1SQVD 1VQ9V 2M3EA 4HNAB 5CBOA 2YC0A 3CXHH 4LLHA 4FLUA 4J80A 4YXWH 5JVDA 2Q6AA 1NH2B 4JYAO 1D2DA 2A06D 2ZKOA 1FAVA 4U3FE 1ZV8A 2QE7H 5AW0B 1SQVG 2IM9A 1M1KQ 1OW7A 1K4CC 2A06E 3JARA 2C9LY 4ZMDA 1K34A 3CMAP 3CCUV 5LMNB 5TISH 3Q1MA 5KJ7C 3HUSA 1PKXA 1OMIA 4NKGB 4O4JB 1Q8IA 3O9OA 3OMNB 3HE5A 2CE4A 2RMKB 1KILA 1SQBE 1QVFU 1NTKJ 3JD1A 4FM0A 1KC8Q 2P06A 5LGTA 3OA7A 4X64O 3A0BE 3KYQA 2KIKA 2MK3A 1IFJA 3A5TA 1IVSA 2JWAA 3L4FA 2PFXA 3FB5C 5IDJA 3SJAC 3T1YB 4RQFA 1FYJA 4DR3B 5GONB 3M0DC 2K3RA 1VIBA 1SERA 2JJLA 4DV5O 4WY4D 4UCUA 2XV5A 5L3GA 2H94A 1KILD 4GOEA 3PLNA 2UWJE 1I5XA 2ZYGA 1VQ8P 4O4JA 3N27A 3M91A 4XE5B 1JY3P 1L8DA 3PJSK 2Q7HA 1I5YA 2A45I 1Q81W 3CCRP 1JPXA 4UXNA 1BT8A 3DC5A 5IE9A 5KA6A 4GLXA 2KSJA 1L0NJ 4Y28J 1H0TB 3BASA 2KB1A 4B3MB 2AXTH 1XQ8A 3H1IH 2IZ1A 1H88A 1RE4A 4ZNCA 4UUJC 1GM9A 1YDXA
chains in the Genus database with same CATH topology
1LNQA 3A0RA 2XNDH 5CBHA 1B6QA 4XDLA 2EINB 1VQ8V 1K97A 4FK5C 3CCJV 1VQNV 2HVKC 3ETEA 1WLEA 3SJQC 1G4YB 2IH3C 5GW7A 1Q82W 2DYSB 2WLIB 1XL4A 2IJHA 2OTJV 1OZ0A 5B1NA 1M56B 1K5SA 4QIWF 1BHBA 2BOBC 1Q86W 1PD3A 2P6JA 5DN6G 3E35A 3CYOA 3CCSV 2A0LA 5B1AB 1GM8A 2AHYA 3GWOA 5HFLA 1S72V 2IJJA 3JD0A 3SPHA 3OW2U 2ZR3A 5CMUA 1FXVA 1K3EA 2LFRA 2ITCC 3DGEA 2QA4V 1W0KG 2W0FC 5CBFA 4N21A 3AG4C 3E89A 4MVQA 3EFFK 3CC2V 2EIKB 4I9WA 1BSNA 1F4MA 4OXSA 1NBMG 3OR6C 3ZMZA 3D3IA 1NVPB 1UJWB 3W7UA 3MHSC 1EZJA 4PA9A 1JQ0A 3ABLC 1GO3F 1ENVA 3K9AA 2IW5A 2EILC 2PI4A 1K9MW 2WWWA 4E2LA 1H2GA 3ML0A 1E79G 1KP2A 2ZD9A 3ABKB 4QNHB 1GM7A 1HWYA 1NR1A 3QO8A 1VQKV 4UV8A 1YHQV 1OCZC 3D36A 3CCRV 4KUMA 2EINC 4MVOA 2A79B 3ABKC 3SYAA 3AG3B 4G2KA 2V1DA 5B1BB 3T2MA 2QTOA 3E8HA 3OUFA 3BY6A 1JOYA 2E5YA 2WSSG 1FXKA 2XASA 2HFEC 2JEUA 2DYRB 1VQOV 1JJ2U 3G6EV 2WLJA 1K33A 3K0DA 1AJQA 1MABG 1S5HC 4LCUC 4WCEV 1AJPA 5C93A 1VQPV 2WLLB 1AR1B 3RVYA 4MTFA 4JTDB 1MSWD 3OEHG 3LUTB 2X6CA 3VOUA 1R3IC 1M1KW 3E8FA 4JAVA 3G4SV 3K3WA 3JD4A 1JCHA 3W7WA 3ASNB 1JX9A 2JJ1G 1FFTB 2LFSA 3ABMC 1FS0E 4PDLA 2ZXWC 4XDJA 1OCCB 1QLNA 2M7WA 1SRYA 1SZTA 1AROP 1TUEB 1OCRB 4GX1A 2UXXA 5LHGA 4QPJA 1GK9A 5HFMA 1EBOA 1OCCC 1COWG 1L1FA 1YITV 4QPKA 4LBEC 4X88A 5H9CA 3CCVV 4PDVA 5CBGA 4WFHA 1RPOA 2EBOA 4WFAV 4BIUA 4JYCA 3CCMV 1YJ9V 4JGSA 1VQLV 4J9ZB 2NLJC 3M99B 3WG7C 1QR8A 1R73A 2HVJC 4HZ3A 2XAHA 1E1QG 5EBMC 5IY5C 3GB7C 2X6BA 3ASOB 3OMAB 3JYCA 4L87A 2EIMC 3BEHA 1CEZA 1JEKA 2X6AA 5IYCO 4GT1A 4P2ZA 3AG1B 2W6IG 1GKFA 3LSQA 4P9OA 2ZQMA 1FXKC 2DWEC 3QO7A 1F4NA 1K5QA 1Y4MA 3H01A 3OUSA 4G27B 4LC1A 2WLIA 1KC8W 5J9PC 5B3SB 1M57B 1PL0A 5B1OA 1PNKA 1OCOB 1ORQC 4TLFA 1QLEC 3JD2A 2Q68A 4H37A 3ZMVA 4CBCA 1IXMA 1YJWV 3ZIAG 2JK5C 3FB7C 4FPPA 4BIZA 4MT8A 2CK3G 2EZPA 4P9PA 1QLEB 4QMAA 3JCZA 4MVRA 1DTOA 1CP9A 3OAAG 2DQ3A 2IU3A 2Z5UA 2JEXA 1YJNV 3ABUA 1VQ6V 4UVBA 3USSA 5KA5A 2JIZG 4N23A 5H6RA 1BMFG 1AJNA 3ZRXA 3E83A 4PDRA 1THZA 2JDIG 5CA3A 1YTFD 4RUFA 3SYPA 3IFXA 4JYBA 3ZMSA 4RQEA 2WLMA 1G8MA 5DM6V 4X89A 2WLLA 3B77A 4G28B 3OFNG 3OE7G 5LBQA 1KKDA 1Q7YW 1NJIW 1V54B 1S77D 4GCZA 1BHAA 1NVPD 3AG2B 2CK3H 1AI4A 1K92A 3ETGA 3E8BA 5FL7G 2XAQA 1V55C 1BL8A 5EC2C 3RVZA 3RW0A 3F5WC 3CCLV 4X8AA 3AEIA 2WPDG 2V7QH 4JTCB 1H8HG 1FXKB 3SYCA 2EIKC 4P30A 1R6NA 4LP8A 2P90A 2R9IA 5LGUA 1P4RA 4ASUG 3K08A 1NQTA 5B1BC 1H38A 3IGAC 2EILB 3E86A 4HYOA 3SPCA 1QVGU 1AI6A 3FYEB 2Q67A 2DW4A 1J95A 3TETA 4MW3A 1AI7A 3OEEG 2K1EA 5LHHA 1F23A 2ZR2A 3ZN0A 1M56C 3ZN1A 4BAYA 3W7XA 3ZMTA 4DXWA 1NR7A 1OCZB 2EIJB 3CMAV 4FIPC 1GTOA 1YSCA 5IYBO 1BSHA 4CZZA 3MD0A 1SETA 3OGCC 2Y69C 4H33A 4GX0A 4MVUA 5B1AC 2EJRA 2HKOA 3LDEA 4YXWG 3SPGA 4UVCA 3CCEV 1Y66A 1GMGA 2HLDG 4JPRA 5E1AC 2ZXWB 3FB8C 3SPJA 1K73W 2JDIH 4DJGA 1YIJV 3ZMUA 2R9RB 3CPWU 1FXHA 4EKWA 3FYIB 4MVSA 4RO2A 4MS2A 2UXNA 2YEVB 1KP3A 1V55B 2ITDC 2OCCC 1RM1C 5IY5B 3P30A 4GX2A 4MVMA 4DO2A 2V7QG 2IU0A 2LP7A 2EIMB 1QR9A 2IH1C 4WF9V 3QO5A 5LGNA 1VQMV 1RM1B 3B8MA 1R3JC 1S76D 4PA7A 1ROPA 2ZDIC 1DLBA 3B8NA 3F7YC 3LDDA 2WLNA 2Q69A 4JASA 4MW8A 4TWKA 4WFBV 3CC7V 3CMEV 3TCUA 1OHHG 3CP1A 5L3BA 3SPIA 1K8AW 5BZBA 5EBWC 3UM7A 4J9YB 3CCQV 4WFEA 2H8PC 3ABTA 2QEXV 3R65A 2D3OW 2IJKA 4ZBMA 1K7DA 2JJ2G 1KQSU 2OTLV 2EIJC 4GX5A 1M90W 1ZWIC 1DF4A 2AHZA 3CXCU 1DF5A 2QM7A 2P67A 3ZRVA 4KP4A 4QE7A 2F43G 3VBBA 3I56V 4JTAB 3W7SA 3X2QB 5L3DA 3WFVA 2QE7G 3IC7A 4I5SA 4PELA 4JAUA 3JD3A 1AQTA 5EBLC 3OMIB 4RAIA 5L3EA 2NNUA 1E1RG 4QE9A 4XDKA 1K4DC 1OCRC 1S3JA 2X7RB 3OR7C 4PA4A 4R50A 1RPRA 1NH2D 4WVZA 5EC1C 2C2AA 3W7TA 1QCEA 2DYRC 3T4ZA 3K0GA 2WLHA 2ZDIA 2EZOA 2XAFA 4FMTA 1PNLA 4PA3A 2PI5A 4TT3G 3MHHC 4UVAA 1YTFB 3K04A 4MTGA 2GSMB 3FKSG 1VQ5V 1H8EG 1V54C 1KECA 4BW5A 3LSSA 5LHIA 3F7VC 2XNDG 4MTXA 2B1IA 2W6JG 4XBFA 2Y48A 3DTUB 3LDCA 1R6KA 5L3FA 4KFMA 4R6ZA 1R3LC 2W6JH 2WSSH 3NXSA 3ZJZA 3RBZA 3K79A 4MVZA 2WAMA 4U7OA 1CPYA 2XAGA 3QNEA 3AG4B 1FS0G 2Z3YA 3LNMB 3T4DA 4MSWC 4F4LA 3K03A 2ATKC 3HB3B 1W2BU 3ZCCA 4Z1MG 4TSFG 3G71V 1KD1W 2YEVA 2B1GA 1IFPA 4MTOA 4JF3A 3I55V 1VQ9V 2HR3A 1OCOC 3CD6V 2XOKG 2IJIA 2WLKA 1XL6A 4QJFB 2QKSA 2X0LA 2B5UA 4YXWH 2Q6AA 3ZRWB 5CN0A 1NH2B 1N8RW 3UKMA 3AG1C 2QE7H 1WPXA 1YI2V 3STLC 2OT5A 3OM3B 5H6QA 3WG7B 1K4CC 5KUMA 1S0VA 4U7NA 1K34A 3CCUV 4Q20A 1SESA 2DQ0A 5L3CA 1PKXA 1QBZA 1F51A 1EFRG 2YSUB 3TK1A 2DWDC 2BOCC 3OMNB 1M9NA 1MG1A 1QVFU 3E8GA 2DYSC 2FTKA 3JD1A 2A9HA 5LGTA 3ABMB 3STZC 3ZRSA 2P7TC 1W0JG 1M57C 2HJFC 3ETDA 2MK3A 2Y69B 4WFFA 4R8CA 3FB5C 3HPLC 5IDJA 3ZRWA 2E5TA 4RQFA 4PA6A 4UV9A 1VQ4V 1P7BA 3ASNC 1NKDA 2HG5C 1SERA 5L3GA 4WFGA 2H94A 1I5XA 3T1CA 4FJCC 1MOFA 3ABLB 2XAJA 5KUKA 3PJSK 4ZKIA 5IYDO 1R3KC 2OCCB 2GHYA 4RUEA 3CC4V 1I5YA 3K06A 2QM8A 1Q81W 3P32A 1JPXA 4UXNA 3X2QC 3AG2C 3FB6C 4PDMA 5B3SC 5KA6A 3SYQA 1JVMA 1PNMA 1VQ7V 3KG2A 2KB1A 3EHBB 1AI5A 3ASOC 3SYOA 1E79H 3AG3C 4R7CA 3E2EA 4HAMA 5EK0A 4UUJC 1GM9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1J95 A;  3TET A;  4MW3 A;  3K04 A;  2K1E A;  4MTG A;  1LNQ A;  4PDV A;  2XND H;  5CBG A;  1V54 C;  4WFH A;  5CBH A;  1M56 C;  4XDL A;  4BW5 A;  4DXW A;  3F7V C;  2HVK C;  3SJQ C;  1G4Y B;  2IH3 C;  3LDC A;  1BSH A;  2WLI B;  1XL4 A;  4J9Z B;  3OGC C;  4H33 A;  2Y69 C;  4KFM A;  4GX0 A;  4MVU A;  1R3L C;  4R6Z A;  5B1A C;  2W6J H;  3LDE A;  2WSS H;  3SPG A;  2NLJ C;  3WG7 C;  3ZJZ A;  3RBZ A;  4MVZ A;  5E1A C;  2BOB C;  2HVJ C;  4HZ3 A;  3FB8 C;  3T4D A;  3LNM B;  5EBM C;  4MSW C;  4F4L A;  3K03 A;  2ATK C;  5IY5 C;  2A0L A;  3GB7 C;  3SPJ A;  2X6B A;  2AHY A;  3JYC A;  2YEV A;  2EIM C;  3BEH A;  1IFP A;  1JEK A;  2JDI H;  2X6A A;  4DJG A;  4MTO A;  3SPH A;  2R9R B;  4P2Z A;  4EKW A;  1OCO C;  4MVS A;  2ITC C;  4RO2 A;  4MS2 A;  4P9O A;  2WLK A;  1XL6 A;  2DWE C;  2QKS A;  4YXW H;  3OUS A;  4G27 B;  2Q6A A;  2W0F C;  5CBF A;  2ITD C;  2OCC C;  2WLI A;  3AG4 C;  3E89 A;  3UKM A;  5J9P C;  3AG1 C;  4MVQ A;  2QE7 H;  4GX2 A;  4MVM A;  3EFF K;  3STL C;  1ORQ C;  4TLF A;  4I9W A;  1QLE C;  1K4C C;  2IH1 C;  2Q68 A;  4H37 A;  5KUM A;  4CBC A;  1BSN A;  4OXS A;  2JK5 C;  3OR6 C;  3FB7 C;  1R3J C;  4PA7 A;  4P9P A;  3F7Y C;  3LDD A;  2WLN A;  2Q69 A;  4MW8 A;  3ABL C;  4PA9 A;  4MVR A;  4TWK A;  4QMA A;  2EIL C;  3TCU A;  3SPI A;  5BZB A;  2DWD C;  2BOC C;  5EBW C;  3UM7 A;  4J9Y B;  2ZD9 A;  4QNH B;  3USS A;  4WFE A;  2H8P C;  3E8G A;  2DYS C;  3R65 A;  3E83 A;  2A9H A;  4PDR A;  3STZ C;  1OCZ C;  3ZRS A;  4ZBM A;  2P7T C;  1M57 C;  2EIN C;  2HJF C;  2A79 B;  4MVO A;  3ABK C;  4RUF A;  2EIJ C;  4GX5 A;  4WFF A;  3IFX A;  3SYA A;  3SYP A;  1ZWI C;  2AHZ A;  4R8C A;  3T2M A;  2QTO A;  3FB5 C;  3HPL C;  3E8H A;  3OUF A;  4QE7 A;  2WLM A;  4JTA B;  2E5T A;  4PA6 A;  2E5Y A;  4X89 A;  2WLL A;  2HFE C;  1P7B A;  4G28 B;  3ASN C;  2HG5 C;  1KKD A;  2WLJ A;  3K0D A;  4WFG A;  1S5H C;  4LCU C;  2WLL B;  1AQT A;  2CK3 H;  3T1C A;  3RVY A;  5EBL C;  4MTF A;  3E8B A;  4JTD B;  4RAI A;  1V55 C;  1BL8 A;  2X6C A;  3LUT B;  1R3I C;  5EC2 C;  3VOU A;  5KUK A;  3PJS K;  4QE9 A;  3E8F A;  1R3K C;  3RVZ A;  3F5W C;  4XDK A;  4X8A A;  3RW0 A;  1K4D C;  4RUE A;  1OCR C;  3K06 A;  2V7Q H;  3OR7 C;  4JTC B;  3X2Q C;  4PA4 A;  4R50 A;  3SYC A;  3AG2 C;  3FB6 C;  2EIK C;  3ABM C;  4PDM A;  5B3S C;  4P30 A;  1FS0 E;  3SYQ A;  4LP8 A;  4PDL A;  2ZXW C;  1JVM A;  4XDJ A;  5EC1 C;  4WVZ A;  3KG2 A;  2KB1 A;  4GX1 A;  2DYR C;  3K08 A;  3ASO C;  5B1B C;  3SYO A;  3T4Z A;  3K0G A;  2WLH A;  3AG3 C;  1E79 H;  3IGA C;  4R7C A;  1OCC C;  4HYO A;  3E86 A;  4PA3 A;  3SPC A;  5EK0 A;  4UUJ C;  2Q67 A;  4X88 A;  4LBE C; 
#chains in the Genus database with same CATH topology
 1SQX J;  1SFC C;  3BA8 A;  3K5M A;  3TJT A;  1FZA A;  1LP1 A;  1J1D C;  2JO1 A;  1QVG O;  3GHG A;  1LNQ A;  2XND H;  1RSO A;  1NI8 A;  1FC2 C;  5H2F H;  1LTJ C;  1AIL A;  3U11 A;  3CCJ V;  2Z5I A;  1XNQ O;  1WLE A;  1Y6X A;  2IH3 C;  4UCO A;  2FYU D;  5JCO A;  1WB7 A;  4LF6 B;  2WLI B;  4LFA O;  3WUT A;  2IJH A;  5CJ4 A;  2FL4 A;  2GUV A;  3R4Y A;  3WUV A;  1G6U A;  3V6I A;  1FDI A;  5AVU B;  5FPO A;  3SR2 C;  2ZNI A;  2BOB C;  1H0T A;  2P6J A;  1RF0 A;  5ITZ A;  1FZF A;  3M0D A;  1NU1 J;  2A0L A;  5CB4 B;  2AHY A;  5HFL A;  2BTQ B;  4TV9 B;  5FNV A;  4DV1 B;  2Q5U A;  3A7O A;  3QTC A;  1Y74 A;  4FZ0 A;  5KX5 B;  1W0K G;  4WBN B;  3H1J H;  1RP3 B;  4TUY A;  5CBF A;  1PPJ E;  3RK2 B;  2E75 C;  4HB1 A;  4PD4 F;  5A2Q N;  2EIK B;  1BSN A;  1PPJ D;  3RYF B;  3L72 D;  1XMO O;  1L4A A;  4O4I B;  3RYH A;  4GDO A;  3CRA A;  1JO5 A;  2ZXX A;  1JQ0 A;  1ENV A;  2PI4 A;  1SVF A;  2IBZ I;  3JCU H;  3P8C D;  5GTH H;  3H1J J;  3M0A A;  2WWW A;  1LT9 A;  1QEX A;  2XUM A;  3ML0 A;  1URF A;  1NAY A;  3AE4 C;  3H1H G;  1VQK V;  1LTB C;  2QJY C;  4HYT B;  3B5N D;  1M90 Q;  4IL6 H;  4IYI A;  4UV8 A;  3CCR V;  3D36 A;  4MVO A;  4DUZ B;  4YTP C;  2R70 A;  5E79 H;  1GN2 A;  2FYU E;  2QTO A;  3E8H A;  4IHJ B;  3BRT B;  1ZR2 A;  4FZ1 A;  1JOY A;  2WSE H;  2XAS A;  2HFE C;  2OYO A;  2BCC E;  1JJ2 U;  4I50 A;  4C7U A;  4ZHQ A;  3RL0 D;  1AFO A;  1KQS O;  1VQ4 P;  3G9R A;  1MAB G;  4O2B B;  2LGQ A;  1HJ0 A;  4LCU C;  4WCE V;  3TGU D;  5LMN O;  1AR1 B;  4MTF A;  2D2C B;  1JUN A;  1MSW D;  3A2A A;  2WT7 A;  4MN4 C;  3RYC B;  2IYP A;  3E8F A;  3BCC D;  1EZV G;  1RE4 C;  3MTU E;  4I0X A;  1BGY H;  3ZBH A;  2WSE J;  1WPB A;  2Q7G A;  3M9Q A;  3UO2 A;  5FPR A;  3W7W A;  2J58 A;  2JJ1 G;  2ZIO A;  5BMV B;  2VQE O;  3CWB D;  2BSK B;  1OCR B;  4GX1 A;  4DZO A;  1VQK P;  5HFM A;  2Q4P A;  4QPK A;  3FX7 A;  1B06 A;  2OYI B;  5H9C A;  4YJ2 A;  4H13 B;  3CCV V;  1JY3 O;  5CBG A;  4O2A B;  4AQY O;  1ZW0 A;  3EWK A;  1RHZ B;  3VN0 A;  4O4H A;  2KQX A;  2IZ0 A;  2NLJ C;  1HH0 A;  4NB5 A;  1DD3 A;  1N2D C;  1R73 A;  2XAH A;  3KZI Z;  3D36 C;  4ZKU A;  5IY5 C;  1IBL O;  2C0X A;  2F93 B;  2QKC A;  1P7G A;  3ASO B;  3CC2 P;  2X6A A;  1HNZ O;  4CS2 A;  4HJG H;  4GT1 A;  2ZIM A;  4AQY B;  2W6I G;  1GMJ A;  5CCG D;  4YHH B;  2HLO A;  2ZQM A;  1PV0 A;  2CPB A;  4I4T A;  3A0H H;  4D7S A;  1N73 B;  4ASW A;  3LID A;  1SQQ G;  1N36 B;  5J9P C;  1M57 B;  3B71 A;  4X65 B;  2HFE D;  1M4U A;  3JAL B;  4FLX A;  1QLE C;  4LF5 O;  3B40 A;  1WP7 A;  1YJW V;  2P10 A;  2N1T B;  1K8A Q;  3ZIA G;  2JK5 C;  3DXR A;  3L70 E;  3U1A A;  3UO3 A;  3CCJ P;  4BIZ A;  4EB6 A;  1BE3 H;  4MT8 A;  2E76 C;  4O4L B;  1AP5 A;  4QMA A;  5CA0 A;  5B66 E;  1DTO A;  4U7J A;  3OAA G;  1R8E A;  1LT9 C;  2JEX A;  2JGD A;  2P7J A;  4UVB A;  2GBO A;  3HD7 B;  3USS A;  1AVM A;  1SS3 A;  3P3N A;  4GIF A;  4D6T D;  1AJN A;  3RFR A;  1N8R Q;  3E83 A;  2RN0 A;  4U3F J;  3B4S A;  3JAM N;  3SFD C;  4OWF A;  2RDC A;  1XIL A;  1YTF D;  1CW5 A;  4UB8 Z;  1NZ6 A;  5TIS Z;  1JA8 A;  1QLE D;  4KL1 A;  2ZYA A;  3L75 G;  4YXD C;  2F23 A;  5KLV K;  1W2E A;  3L72 J;  3VOP A;  3ZMS A;  1X4T A;  2WLM A;  5IT9 N;  2I1K A;  5JCO C;  3S4R A;  4DUY O;  4F6R A;  3OFN G;  3SJB C;  2IDB A;  1NJI W;  4DR1 B;  1HP8 A;  1NTK E;  3PH0 A;  1AI4 A;  2J59 M;  1FOS E;  3ZED A;  2RKL A;  2QSA A;  3RVZ A;  1M1J A;  3F5W C;  2WPD G;  2V7Q H;  4B3S O;  2WIT A;  1FXK B;  1QU7 A;  2EIK C;  2JS5 A;  1JFF A;  4X64 B;  3ZS8 C;  1U7M A;  5LP6 A;  2P90 A;  2R9I A;  4ASU G;  3Q5S A;  4DR5 O;  1N7S B;  3RK3 E;  1FJG B;  1MZF A;  2VQF O;  1IBK B;  2Q67 A;  4B3S B;  1M7L A;  1Y76 B;  1EZV H;  1BQ0 A;  1SQV J;  1Q5O A;  2ZR2 A;  3ZN0 A;  2ZM6 B;  3AEF C;  1M56 C;  3G6B A;  3FAV A;  2QWO B;  1OCZ B;  3CCU P;  4IFD K;  3CMA V;  4FIP C;  2E5L B;  4XFJ A;  4B3T O;  1BSH A;  1J5E O;  2IYO A;  2RJZ A;  3RK3 B;  3OGC C;  1EDK A;  2SPZ A;  4MVU A;  5B1A C;  4JYA B;  3H1J G;  1WP8 A;  3CCE V;  4UVC A;  4WB4 A;  2HLD G;  1VQN P;  5E1A C;  1Q7Y Q;  3FB8 C;  4L76 A;  4LF6 O;  3CX5 I;  3SPJ A;  1NTM E;  3A0H E;  3G4S P;  3D3Q A;  4X66 O;  3CWB E;  3TNU A;  3ZMU A;  1DK1 A;  1SQB K;  1FXH A;  1BSM A;  1WA8 B;  4AYC A;  2GA1 A;  2Q3I A;  5TIS E;  2UXN A;  2YEV B;  1NT2 B;  1MA1 A;  3H1K H;  5AVX B;  2FXM A;  1V55 B;  2POH A;  4X1K A;  5IY5 B;  1AB3 A;  4GX2 A;  2EIM B;  1QR9 A;  2E74 B;  4WF9 V;  1EM1 A;  3GG2 A;  1Z5W A;  2ZDI C;  3CRR A;  1M8O B;  1JNM A;  2QJP B;  1DLB A;  2AXT Z;  2XTA A;  3LDD A;  4JAS A;  4TWK A;  3SWK A;  4WFB V;  1MV8 A;  1SQX K;  2KSE A;  3H1K J;  3TCU A;  1PL4 A;  3SPI A;  2LGW A;  3K57 A;  1OW8 A;  5BZB A;  5DJT B;  1ZRT E;  2H8P C;  3ABT A;  4PJ0 H;  2W8Z A;  4ZBM A;  4C7N B;  1W59 A;  4I0X B;  1ZWI C;  2LKM A;  2QM7 A;  3NFQ A;  3H1L H;  3MUD C;  4KP4 A;  2F43 G;  3VBB A;  3JAK B;  5JVD B;  2FXP A;  3SWF A;  1LGH B;  2PRR A;  3WFV A;  1EQ7 A;  3JAT B;  3KZI E;  3D6Z A;  2DW3 A;  4JAU A;  1XTC C;  4JI4 B;  5APY A;  5EBL C;  4ASV A;  3H6P A;  4HKZ H;  4RAI A;  5L3E A;  2CDY A;  1JCD A;  1EN4 A;  4OX9 O;  4QE9 A;  3OD4 A;  1HVV A;  4J10 A;  3FGA D;  1S3J A;  1YQ3 C;  4X66 B;  3O6Q A;  2FYU J;  2HHH B;  5AVZ B;  2GUS A;  1BE3 J;  3B5N A;  4GKK O;  2YKP A;  1XUQ A;  2NPS B;  1X9V A;  4OGQ C;  5EZY A;  2ADQ B;  3H32 A;  4NXM O;  2QEX P;  2ZDI A;  5JWP A;  1N34 O;  2IFN A;  4FMT A;  5FLX N;  4PA3 A;  1NU1 D;  1VQO P;  3B8E B;  2UUC B;  5CCH D;  4WY4 B;  1SFC A;  1VDF A;  3V5B A;  1H8E G;  5BVZ A;  2GM4 A;  4GZR B;  1CI6 A;  3CXH F;  4C46 A;  1KOR A;  5GON A;  1T5E A;  1VMG A;  1NTK G;  1EZV D;  1L2P A;  1KFN A;  5KHG A;  4R6Z A;  4C7R A;  4X62 B;  2W6J H;  3IFM A;  3AE3 C;  3NXS A;  2Y9Z A;  3ZJZ A;  3MDS A;  2AEM A;  3JAL A;  3RBZ A;  2HP8 A;  3JAS B;  5JJJ B;  1BDD A;  2WAM A;  3AE5 C;  1CPY A;  2XAG A;  3Q2Y A;  4F4L A;  3BRV B;  3ZCC A;  4YY3 O;  4FM1 A;  1KD1 W;  1IO4 A;  1LJ2 A;  2ZE5 A;  3N2K A;  1G1X B;  3EXA A;  3I55 V;  4N78 E;  4JZG A;  2K9P A;  1JY2 O;  3THO A;  4N6J A;  1RY3 A;  2QKS A;  1PM9 A;  2X0L A;  3E7K A;  1YJ9 P;  3L70 D;  2Y9Y A;  1N8R W;  4LF9 B;  1EDJ A;  3AG1 C;  1L0N H;  4DK1 A;  1WPX A;  1YI2 V;  4DR4 O;  1D5N A;  3WG7 B;  2H7H A;  5KUM A;  3AE8 C;  3E1I A;  2E5L O;  1S0V A;  5IWA O;  4DV2 O;  2D2C D;  1TGO A;  3GHG B;  2YXL A;  1DIP A;  5IYZ B;  1FZC B;  5B5E H;  4TQF A;  2DQ0 A;  1RF1 B;  4ZHQ B;  1QBZ A;  2QDO A;  2YIB D;  4HH2 A;  2J5U A;  2YSU B;  3MP7 B;  3TGU J;  1JTH A;  2DWD C;  3GMA A;  4PV1 D;  3N4X A;  3NTN A;  1M9N A;  1LR1 A;  2R3C A;  3CX5 E;  1J2J B;  1SQP H;  1YCI A;  2FTK A;  3BCC J;  1KQG B;  1AR4 A;  4N3Y B;  2P1J A;  2BTQ A;  5JH7 A;  4WFF A;  4BRY A;  1N34 B;  2MJZ A;  4KHX A;  5KLV G;  1GW4 A;  1JFF B;  1Y47 A;  5APQ A;  1X79 B;  4PA6 A;  2OYQ A;  1X22 A;  2XNX A;  1P7B A;  3CCQ P;  1Y74 B;  1KFM A;  4NYK A;  1SQP J;  4WWI A;  4J7Z A;  4GUN A;  5AW6 B;  2YXQ B;  2HHH O;  4FFB B;  3CME P;  1Y76 A;  2WSF J;  4DR7 B;  3T1C A;  3BAT A;  3BVH A;  4FJC C;  2XAJ A;  5KUK A;  1N7S A;  1YXB A;  4FLW A;  1RFY A;  2FB5 A;  4RUE A;  3CC4 V;  3K06 A;  1BQZ A;  2QM8 A;  4RES B;  3K5N A;  1KMI Z;  3E22 B;  2VWJ A;  5M1B A;  3D71 A;  1X59 A;  2ZAE B;  5B3S C;  5CCG C;  3SYQ A;  2ITA A;  3B5N C;  1IBL B;  3R66 A;  3KG2 A;  5KKZ B;  1MSD A;  2N04 A;  1VQ7 P;  2KK7 A;  3WU2 H;  1E79 H;  3JSL A;  4I1L A;  5IJ9 A;  4BIU A;  1KB9 H;  2W6A A;  1NTK H;  4RKU J;  5H2F Z;  1U97 A;  2E3C A;  1B6Q A;  3H25 A;  1VQ8 V;  4OGQ B;  4X1Y A;  3SSU A;  4FK5 C;  2Y0P A;  2HVK C;  4LF5 B;  3HKC B;  5GW7 A;  4NPD A;  2DYS B;  3QWO C;  5KLV J;  1XL4 A;  1OZ0 A;  1ZN5 A;  2QA4 P;  1BE3 D;  1K5S A;  1WMK A;  1JCC A;  5JJE B;  4QIW F;  4TOI A;  1BHB A;  3N2G A;  1K04 A;  2GTS A;  1Q86 W;  3H9V A;  4X20 A;  5DN6 G;  4R4M A;  3CCS V;  4K8Z A;  3CCS P;  1QHT A;  2JRI A;  2PYL A;  3TGU G;  3JD0 A;  2BAS A;  3VMX A;  2HOD A;  2ZR3 A;  5CMU A;  3WB0 A;  5E79 Z;  1FXV A;  2ITC C;  3DGE A;  2QA4 V;  2AGA A;  4PV1 B;  1RE3 A;  1ZR4 A;  1GN6 A;  3H1I E;  1J1E C;  4OH8 B;  4N21 A;  3RYI B;  1FE6 A;  3HUS B;  3A3Y B;  1NAF A;  3TYY A;  4OXS A;  3HKE B;  3KQG A;  3ZMZ A;  1T6A A;  3DSQ A;  3G71 P;  2R3S A;  3MHS C;  4X1I B;  2OTL P;  1KIL B;  2FFD C;  4PA9 A;  2YI8 A;  3K9A A;  1OV9 A;  1VP7 A;  2EIL C;  3JAT A;  1SC5 B;  4E2L A;  1E79 G;  2ZD9 A;  4QNH B;  1S1C X;  1NR1 A;  1HWY A;  1CZQ A;  2RMZ A;  1P84 E;  2UUB O;  4KUM A;  2A79 B;  3CC4 P;  3ABK C;  1YEW A;  5DED A;  1PIX A;  2WA3 A;  2KSD A;  3T2M A;  5APT A;  2VS0 A;  2FXO A;  2QJK C;  4CPG A;  1Q90 D;  2WSS G;  4UB8 E;  1FXK A;  2JEU A;  3O6Q B;  5APX A;  2YUA A;  4GOF A;  1GAX A;  4YIO A;  5AVS B;  2N1T C;  3K0D A;  1Y9B A;  3B2E E;  2RH0 A;  1S5H C;  1HW7 A;  1AJP A;  2WQY C;  2F1M A;  3I5D A;  4EEQ A;  3RVY A;  4A7P A;  2BCC J;  5LYJ B;  4PJ0 E;  1VQ5 P;  3LUT B;  1M1K W;  1R3I C;  2V4D A;  1IBM B;  1CI6 B;  2KB7 P;  1SA0 A;  5GTH Z;  2N74 A;  4O9B A;  2BE3 A;  1RQU A;  3JCU E;  4LFC B;  2ARH A;  2BTO A;  4PDL A;  4XDJ A;  1OCC B;  2KNC B;  2M7W A;  4LR3 A;  3BPZ A;  5LHG A;  1TUE B;  5C8Y B;  4ZKP A;  4DR2 B;  4QPJ A;  3T97 A;  3ZHV A;  1LTA C;  3RN4 A;  1YIT V;  4X88 A;  4JZ2 A;  2VQF B;  3CXH I;  3TSI A;  1XNQ B;  4H44 B;  4F6R B;  5LMU B;  1YI2 P;  4H0L B;  1OXZ A;  3CCM V;  4JGS A;  1IFI A;  2H8P D;  2YIU B;  2CH7 A;  2A45 H;  3IF4 A;  3E1R A;  1QR8 A;  4JQ0 D;  2M5A B;  2F4V O;  3RL0 g;  4X1K B;  1E1Q G;  3CC7 P;  2WSF H;  4TUY B;  2KS1 B;  3H1K D;  3L73 D;  2EIM C;  3BEH A;  2BCC H;  1CEZ A;  1S72 P;  4DW1 A;  1AVY A;  4UCV A;  1NHL A;  4P2Z A;  5JJN B;  5BY1 A;  1GL2 D;  2Q7C A;  2QGN A;  3LSQ A;  1XTG B;  1FXK C;  3QO7 A;  1K5Q A;  1Y4M A;  3H01 A;  3OUS A;  5LXT A;  5BR8 O;  1NOH A;  3KPE A;  5B3S B;  4K35 A;  5KLV D;  1PL0 A;  5BR8 B;  1OCO B;  3ZHU A;  3JSN A;  1N4C A;  2P58 A;  2VRZ A;  3GW6 A;  2Y0E A;  1SQG A;  1MMM A;  1NTK K;  4O4H B;  2B9B A;  3U10 A;  3L36 A;  5CA1 A;  1FKA O;  4W4K A;  2P4V A;  4IIJ A;  2KI7 B;  1JMK C;  1YJN V;  4DYL A;  3VP9 A;  2WPQ A;  4JF7 A;  2HPC A;  1S4X A;  2ZXE B;  1BMF G;  4IHJ A;  1TVK B;  3ZRX A;  4PDR A;  2CTP A;  4DCK A;  4LH7 A;  3L75 E;  2JDI G;  4RUF A;  1URQ B;  1ZSP A;  3B09 A;  2UXD B;  3L70 H;  4JYB A;  3OTF A;  1L0L K;  5E79 E;  1DD4 A;  5LMU O;  3B5N B;  3IJ4 A;  4PI2 A;  5EIB D;  1T8Z A;  1TA8 A;  2NN4 A;  4X89 A;  2FY8 A;  2GDS A;  2LW1 A;  3OE7 G;  2KG7 B;  5LBQ A;  3RYC A;  2G38 A;  2Y4U A;  1S77 D;  1H89 A;  4DV5 B;  3AG2 B;  1QNM A;  5FL7 G;  3ETG A;  3E8B A;  5H5N A;  2AZ2 A;  2YS8 A;  2PGG A;  1V55 C;  2FKW B;  1BCC J;  4D6T E;  5GTI Z;  3RW0 A;  3V4W A;  1R5L A;  5KJ7 A;  1Q6H A;  4JTC B;  3DC6 A;  1JMM A;  4P30 A;  1R6N A;  2YO3 A;  4FFK A;  3FX0 A;  5H2F E;  3BAB A;  3BRC A;  2QJP C;  3Q4H B;  5LGU A;  1H38 A;  4DV3 O;  3IN6 A;  1KQF B;  2CTW A;  3IGA C;  1LWU A;  1AVO A;  4HYO A;  2A7W A;  2EX3 A;  3E86 A;  3SPC A;  3L35 A;  5AVT B;  1AI6 A;  3FYE B;  2B88 A;  2CAZ C;  3MAQ A;  1KIL E;  1Z5V A;  2ILM A;  3Q3D A;  4TV8 B;  4GKG A;  3A8T A;  4L74 A;  3M9H A;  2BCC D;  3ZN1 A;  3HTK A;  1A02 J;  5KJ7 D;  1FPO A;  1R6T A;  1SQQ D;  3S9O A;  2VQE B;  2CPS A;  1GTO A;  2AZ0 A;  1YIT P;  3L70 J;  1PL5 A;  2YID A;  3AK3 A;  4CZZ A;  3RK2 C;  1VF5 C;  5AW2 B;  2Y69 C;  1EN5 A;  2WMM A;  2EJR A;  2RN9 A;  4YXW G;  1YIJ P;  4JPR A;  3PTZ A;  1NJI Q;  3BA9 A;  4NPE A;  4JI7 B;  4H44 C;  2ZT9 D;  2H3O A;  4I4T B;  4UCS A;  4LFB B;  4JI8 B;  4DJG A;  1AV1 A;  3IR9 A;  3CCE P;  5IYZ A;  1SQX G;  1Q81 Q;  1FZC C;  4YIP A;  1IFN A;  3OW2 O;  3HRN A;  1KP3 A;  1YTZ I;  1X8Y A;  3SDL A;  1WT6 A;  2XU6 A;  2OCC C;  4PD4 H;  3GWK C;  3P30 A;  1N32 O;  2V7Q G;  3CX5 F;  3S3W A;  1IC2 A;  3VMA A;  3CX5 H;  3WUU A;  1RM1 B;  1VQM V;  3B8M A;  1R3J C;  1SP4 A;  3AE1 C;  5KMG A;  2KLU A;  1S5L E;  2QJK B;  5AW9 B;  1SQV H;  1SQP D;  3L73 J;  1IK7 A;  1OHH G;  3CP1 A;  3LW5 J;  3UM7 A;  3CCQ V;  1TU3 F;  1PGJ A;  2W83 C;  1LWU C;  3AK1 A;  1K7D A;  4PJ0 Z;  4DRX B;  1KQS U;  2MKV A;  2AHZ A;  3CJH B;  1PZQ A;  2PUS A;  2R32 A;  4QE7 A;  1ZXG A;  3ZDM A;  3VQX A;  4KHP O;  4X9Q A;  3E22 A;  1BGY E;  3A0B Z;  4DV1 O;  4IL6 Z;  1LTG C;  2ZT9 C;  3BCC H;  3ICX A;  3S1K A;  2JVD A;  4LF7 O;  1E5W A;  1E1R G;  1VL2 A;  2UUA O;  1UII A;  1DEB A;  3U59 A;  4D7T A;  1M5I A;  4XDK A;  4NXN O;  4YJ3 B;  1XNR B;  1K4D C;  2NPS C;  2Y0D A;  2X7R B;  1B04 A;  3OR7 C;  3VQV A;  1HGZ A;  4DRX A;  1EDI A;  1RPR A;  4W4L A;  1NH2 D;  1L4A B;  4WVZ A;  5EC1 C;  4JV5 B;  4HBN A;  2C2A A;  3AG7 A;  3HKC A;  1QCE A;  2DYR C;  3T4Z A;  4M3L A;  1GL2 C;  3TGU H;  4TT3 G;  4UVA A;  2LQT A;  1KB9 F;  3PN1 A;  1ZTE A;  4MTG A;  1SQX E;  1N7S D;  3S3X A;  4I55 B;  4FLZ A;  1BE3 G;  4BR6 A;  4IT5 A;  2EJ7 A;  3LSS A;  2BEQ D;  5LHI A;  3T1H O;  2JKV A;  1LT1 A;  1BCC D;  2XND G;  4MTX A;  3AEG C;  3VYI A;  4UB8 H;  1RSO B;  2ZM6 O;  1Q82 Q;  2B1I A;  1KN7 A;  1UPG A;  4XBF A;  2Y48 A;  4FFB A;  1OW6 A;  2KP8 A;  1R3L C;  3MUD A;  2C0W A;  3TF5 A;  2WVR A;  4KXR A;  4U7O A;  2C9N Y;  1L0L E;  1I08 A;  3QNE A;  1XI1 A;  1FS0 G;  3LNM B;  4JI3 O;  1AP6 A;  1KYO E;  2ADP A;  2ATK C;  4TSF G;  2YEV A;  2QRX A;  3F89 A;  4TT3 H;  5ITZ B;  1UIX A;  1BCC H;  4MTO A;  4JF3 A;  4FM2 A;  3L74 J;  2HR3 A;  4TV8 A;  5AW5 B;  3CD6 V;  2XOK G;  1SQQ J;  1R5S A;  2WLK A;  1XL6 A;  4QJF B;  5IJ9 B;  1XEQ A;  3ZRW B;  5CN0 A;  1VPC A;  5AVY B;  1M57 D;  4K8X A;  1GK4 A;  1YJN P;  1KB9 E;  3STL C;  2OT5 A;  2ZE8 A;  3OM3 B;  2QIW A;  5B5E E;  4DUY B;  3CCV P;  3M8A A;  5KAF Z;  2AEF A;  3JAR B;  4Q20 A;  4K0K B;  1HGV A;  1LP1 B;  3JAW A;  1S5L X;  2FYU K;  5APS A;  2OYH A;  3P3P A;  4X1Y B;  1IFM A;  3AED C;  4D6T G;  1F51 A;  4NXN B;  1XNR O;  4JPZ B;  1W2B O;  2WTY A;  2Z4E A;  2KKW A;  3KCY A;  4L75 A;  5BU5 A;  2B87 B;  1JMB A;  2DYS C;  1KYO I;  3HE5 B;  3ABM B;  3ZRS A;  4CH6 A;  2Q5Z A;  1W0J G;  3TXS A;  2P7T C;  3MHV A;  2HJF C;  5KAF E;  2QWN B;  5KAI H;  1VF5 D;  2F95 B;  2NR5 A;  4R8C A;  3T1H B;  2QR4 A;  1VQP P;  3SGI A;  2E5T A;  4UV9 A;  4CH3 A;  1VQ4 V;  2L35 A;  1YVW A;  1IX9 A;  1ZLL A;  3H1L J;  2HG5 C;  2Q7E A;  4FLT A;  4WFG A;  5AVR B;  2KUB A;  3CXH E;  2YIB A;  5CHX A;  4PV1 C;  1NTM K;  2V4H A;  4JI1 O;  2N1T A;  4JI2 O;  2R5D A;  5IYD O;  1R3K C;  2A06 G;  3RWR D;  3APQ A;  3P32 A;  2QWQ B;  3CL3 D;  4LGD E;  4CC6 A;  1URQ D;  3FB6 C;  4PDM A;  1KU9 A;  1ZL8 B;  4O4I A;  3RYH B;  3DXR B;  3QVN A;  1GDT A;  1VQ7 V;  1YBK A;  1SQV K;  2AXC A;  3EHB B;  2A45 G;  2P22 C;  1AI5 A;  3SYO A;  1NH4 A;  3AG3 C;  1GL2 A;  3V2N A;  1N33 B;  3WU2 Z;  2CUG A;  4DV0 O;  4CC5 A;  2KS1 A;  3VQW A;  2YIU C;  4I7Z C;  5EIB C;  2M5A A;  1GTW A;  5CBH A;  4JI1 B;  1SLQ A;  4DV7 O;  4XDL A;  1KV4 A;  1HNX O;  1FD9 A;  1K97 A;  1I7F A;  1VQN V;  2XZR A;  4UB6 E;  3SJQ C;  1G4Y B;  1Q82 W;  2ZFC A;  3BCC E;  1M56 B;  1MZ9 A;  4PHZ A;  3WB1 A;  1PGP A;  4B7E A;  4L73 A;  5A9G A;  1OWA A;  1HNW O;  2YIA A;  1SA0 B;  4LNU A;  1M1J C;  2CTR A;  2M6Y A;  2ZE6 A;  2YIC A;  3CYO A;  5LYJ A;  1L4A D;  4R4L A;  2GUZ A;  1XHX A;  3RL0 B;  1IZ3 A;  1XDC A;  3GWO A;  5KX5 A;  2PP6 A;  3SPH A;  5LOV B;  3L75 J;  1K3E A;  2ZNJ A;  3OTO O;  4DV4 B;  5CA1 B;  5LP6 B;  1BZK A;  2Y0I A;  2ZYD A;  1D5A A;  2QVA A;  3WU2 E;  2W0F C;  2NRG A;  2ZJS E;  3II6 A;  3E89 A;  2LW7 A;  5EYP A;  1IFD A;  3A2F A;  4NR1 A;  1RF1 A;  2BSK A;  3EFF K;  3C9I A;  1SQF A;  1F4M A;  1NU1 G;  3BAA A;  3OR6 C;  2JEE A;  3D3I A;  4LWS A;  1UJW B;  3UT5 B;  1EZJ A;  3CJH A;  3FD9 A;  1GO3 F;  2IW5 A;  2KG7 A;  5JH7 B;  1K9M W;  2K88 A;  4J11 A;  1BCC E;  3FAV B;  3WMM 0;  1SS1 A;  1H2G A;  2CGO A;  2JGU A;  3L74 D;  3L73 G;  4W7Z A;  3ABK B;  1GM7 A;  3I55 P;  3QF7 A;  4JI6 O;  1DH3 A;  1YHQ V;  2VWK A;  3HD7 A;  1L0L H;  2EIN C;  3SYA A;  1LTJ B;  3AG3 B;  1IBK O;  2V1D A;  5EYP B;  3OUF A;  5TJH A;  3BY6 A;  1FU1 A;  1T2K C;  2Z0A A;  1H2M A;  1OVR A;  3HD7 D;  2IPP A;  2DYR B;  3L73 E;  4O2B A;  2WLJ A;  3KXD A;  1N7L A;  5AW1 B;  1SQQ H;  4AHC A;  5C93 A;  4LH6 A;  1VQP V;  2WLL B;  1NTM J;  3K5B A;  3PRJ A;  3OEH G;  1YTZ T;  1NTZ K;  1LTS C;  1JY3 N;  2L6L A;  4HNA A;  2FYN C;  4J42 A;  4IIJ B;  4JAV A;  3G4S V;  4ZOL A;  4DOJ A;  1I94 B;  1GD2 E;  3CSX A;  3JD4 A;  5KHJ A;  2PY5 A;  4JI0 B;  5J2T A;  4LF9 O;  1EZV E;  5F2V O;  2D2C C;  2M8R A;  3ABM C;  2ZXW C;  1QLN A;  1L0N E;  1TVK A;  3MGN A;  3NR7 A;  2MW2 B;  4ZIB A;  1BGY J;  1EZV I;  1ARO P;  2AXT E;  1ZUQ A;  1GK9 A;  2O57 A;  1VF5 B;  1EBO A;  1COW G;  5D5P A;  2BCC G;  1L1F A;  4LFA B;  2NZ2 A;  2ODM A;  4IFM A;  3L74 G;  4WFH A;  2Q8V A;  2GV9 A;  2K9Y A;  4WFA V;  3N2G B;  5EFW B;  3CPW O;  1GU4 A;  1XMQ O;  2WPV B;  4N78 D;  5CBN A;  3CWB H;  3ABV C;  1VQL V;  4J9Z B;  4B7K A;  4XA4 A;  3M99 B;  3WG7 C;  2JP3 A;  3VMZ A;  4IL6 X;  2HOD B;  4PD4 E;  1GH6 A;  4TV9 A;  5EBM C;  5FNV B;  1NU1 E;  1A32 A;  4BXL A;  3MIW A;  3GB7 C;  3TDK A;  2QM4 A;  3CS5 A;  4Y99 B;  1NKZ B;  1RF1 C;  1N73 C;  4DT0 A;  2IBZ H;  3AG1 B;  1PGO A;  4UB6 H;  4JYY A;  5IJ0 B;  5EZY B;  4UCT A;  3UQ8 A;  3HKB B;  1Z2G A;  1F4N A;  4G27 B;  4LC1 A;  3HKE A;  2JS3 A;  1GN4 A;  3RYF A;  4DV6 O;  5KLI C;  3CWB G;  1PP9 J;  2Y4T A;  1ORQ C;  4BIO A;  3ZMV A;  4H37 A;  3RL0 C;  1IJD B;  1IXM A;  1BE3 E;  4RJT A;  1OFC X;  3KKY A;  4DV7 B;  3AEA C;  5BU8 B;  2EZP A;  4P9P A;  1R1B A;  3BVO A;  5AVQ B;  2DQ3 A;  4U3F H;  1KUQ A;  5CCG A;  3TXQ A;  1SQQ E;  1VQ6 V;  1O9G A;  3FFQ A;  3QH9 A;  5KA5 A;  2XT9 A;  2JIZ G;  3IAO A;  4N23 A;  2DOS A;  3L75 D;  2OYI A;  1ZLZ A;  1THZ A;  5CA3 A;  2K9J B;  1QQC A;  3SYP A;  3IFX A;  1PP9 E;  3H1I D;  3CHX A;  1SQB D;  1FJK A;  5AG2 A;  1QX8 A;  3P8C E;  4AIL C;  1B3Q A;  4AI8 A;  1YHQ P;  4RWU A;  2UXB B;  5DM6 V;  3B77 A;  2YKQ A;  2PGD A;  4I6M C;  2HEP A;  5AW7 B;  4D6T H;  1V54 B;  2R72 A;  2FBW C;  3ZHQ A;  4GCZ A;  1BHA A;  4B3R O;  1G2C A;  5LP6 C;  3GLM A;  1NTZ J;  2WSC H;  5EC2 C;  1GL2 B;  2FYU G;  3N7N A;  4LFC O;  2YKO A;  2LO1 A;  4W80 A;  1H8H G;  5BMV A;  4NTW A;  3AE7 C;  4E4E A;  5B66 Z;  1VF6 A;  4ZI7 A;  2V7Q J;  1P4R A;  4UFZ A;  2VRS A;  3K08 A;  1NQT A;  2NPS A;  2EIL B;  1QVG U;  2DW4 A;  1XBL A;  3TET A;  5B5E Z;  1AI7 A;  2K1E A;  1F23 A;  2PZS A;  5D5Q A;  1LT9 B;  2Z5H A;  3W7X A;  3ZMT A;  3KCX A;  4IGG A;  3K58 A;  4B3R B;  2KZI A;  2NPS D;  1HJB A;  1S9K D;  4BWN A;  5JQG B;  1PPJ G;  3MD0 A;  1SET A;  4H33 A;  4B3T B;  1H2L A;  4GX0 A;  2YI9 A;  2HKO A;  1Y66 A;  1GMG A;  2LR2 A;  2OCH A;  4YJ3 A;  1XMO B;  2B89 A;  2AW9 A;  3L70 G;  3RK3 D;  1VQ9 P;  4NPF X;  2W90 A;  2JDI H;  2OIG A;  4CH5 A;  5CCH A;  4DR5 B;  1NTZ H;  3H1H D;  1WA8 A;  1JM0 A;  1YIJ V;  4MVS A;  3JAW B;  1VQ6 P;  4MS2 A;  4NTX A;  2B87 A;  3H1H E;  1KTM A;  3JSV C;  4CS4 A;  2ITD C;  1RM1 C;  1T3J A;  1DGS A;  1N33 O;  4MVM A;  3J7A U;  3AEE C;  3SJC C;  3H32 B;  2IU0 A;  1K05 A;  4O4L A;  3QO5 A;  1T3U A;  2WT7 B;  3HKD B;  3UCS C;  2RCV A;  1S76 D;  2OQQ A;  1ROP A;  4L8J A;  3H1L D;  2WLN A;  4FVM A;  3CC7 V;  2ZVO B;  3LSU A;  2YMY A;  1HUC A;  1KQL A;  4J9Y B;  3HE4 A;  5KHI A;  2UU9 B;  3VP8 A;  2QWP B;  1G1J A;  2D3O W;  2KXP B;  1SF9 A;  2IJK A;  2JJ2 G;  1LTT C;  1Y8A A;  3V2P A;  3CCL P;  2EIJ C;  1EN6 A;  4GX5 A;  1DF4 A;  4Z2W A;  3CXC U;  1DF5 A;  4EI2 A;  3EFG A;  4IFF A;  2QWR B;  3I56 V;  3K59 A;  1GK6 A;  4B3M O;  1MKM A;  3W7S A;  5AVV B;  1KZU B;  3X2Q B;  4F6E A;  5J2T B;  5L3D A;  2PAJ A;  1SQB H;  2QE7 G;  1FFX A;  2DJV A;  3IC7 A;  2YMK A;  3RT3 C;  1KKC A;  4I5S A;  2WA4 A;  1LUV A;  5CCH C;  3JD3 A;  4NTY A;  3O8Z A;  1AQT A;  3J81 N;  3OMI B;  3AEC C;  4KHP B;  5DEC A;  2Q0O C;  1OCR C;  3Q4H A;  4X1I A;  1WN7 A;  4PA4 A;  4JI5 B;  4R50 A;  4AUW A;  3H1I J;  1SQB J;  4K0K O;  3O65 A;  1V9P A;  4DR2 O;  3CLQ A;  3W7T A;  3VMY A;  4DR3 O;  1BS3 A;  1HNX B;  1L0N K;  3ITK A;  3SFE C;  4GYC B;  1K73 Q;  2E75 D;  2WLH A;  1IDS A;  2E74 C;  3LW5 H;  2XAF A;  3HTK B;  2PI5 A;  3MHH C;  2GUZ B;  1JOC A;  1P84 I;  2B9Z A;  1I94 O;  4GKJ O;  2WPR A;  2GSM B;  1FDO A;  1FAF A;  1KEC A;  2JGD B;  4DR6 O;  1YZB A;  3F7V C;  2DMX A;  2W6J G;  1T2K D;  1USD A;  3DTU B;  5L3F A;  3D70 A;  3JAS A;  2K37 A;  2WSS H;  1FZG A;  1JB0 J;  1KB9 I;  3CRM A;  4MVZ A;  3CEI A;  2EUL A;  3T4D A;  1W2B U;  4MSW C;  3HB3 B;  1ZRT D;  1NTZ G;  1DX7 A;  1ZL8 A;  4Z1M G;  3G71 V;  3W67 A;  2H88 C;  2B1G A;  5K1P A;  1IFP A;  5LA6 B;  3MZW B;  3FXE A;  4JI6 B;  4U3J A;  1AQ5 A;  5IWA B;  4DV2 B;  4UCR A;  1OCO C;  1WRG A;  2IJI A;  2KOG A;  3Q5R A;  2B5U A;  4DR4 B;  2DN9 A;  1AA0 A;  3UKM A;  1ZAU A;  2YXH A;  5H6Q A;  3J80 N;  1P84 H;  3RYI A;  1HWT C;  4U7N A;  2P5O A;  2K1A A;  3L75 H;  4I7Z B;  1LTI C;  3FWL A;  4YY3 B;  1SES A;  1D7M A;  5GTH E;  1VF6 C;  1JTH B;  1OX3 A;  4J7K A;  1SQV E;  5L3C A;  1A02 F;  1JJO A;  3GHG C;  1EFR G;  1NTM D;  2FYZ A;  3TK1 A;  2BOC C;  1WB8 A;  4DV3 B;  3OTO B;  1MG1 A;  4WY4 A;  3E8G A;  3L73 H;  3V4Q A;  2OTJ P;  2A9H A;  5GTI E;  1BCC G;  3STZ C;  4BRY B;  1KYO F;  1M57 C;  3QG5 A;  3ETD A;  4GKJ B;  2Y69 B;  1NU1 K;  1QL2 A;  3KHU A;  3JAK A;  4IYH A;  3HPL C;  1BGY D;  1K9M Q;  3ZRW A;  2RNB A;  3HKD A;  4B08 A;  4J7J A;  2N05 A;  4ICG A;  2L5G B;  3ASN C;  1NKD A;  1M56 D;  2PYJ A;  4H13 C;  3KZI H;  1N0J A;  2FKX A;  1L0L J;  4JI5 O;  1EXJ A;  4JI3 B;  1MOF A;  3ABL B;  1ZX3 A;  4ZKI A;  2OCC B;  2O01 N;  2OGU A;  2GHY A;  4I50 B;  4EFB A;  1NYH A;  3L74 E;  4EIJ A;  3X2Q C;  2UXD O;  4Z1M H;  4LWS B;  3AG2 C;  2CTQ A;  3R2P A;  3I5C A;  3FWN A;  3L72 G;  1JVM A;  1PNM A;  4EDF A;  1FOS F;  3L71 H;  2HPC B;  4DR6 B;  3H1J E;  3ASO C;  3ZHT A;  3EQ2 A;  2HJD A;  2KNC A;  3H1K E;  3OJA B;  4R7C A;  3E2E A;  4H13 D;  4HAM A;  5KHH A;  5EK0 A;  5GTI H;  1I0H A;  4WBN A;  5CMZ A;  1NTZ E;  3HR0 A;  5CJ0 A;  3A0R A;  1XMQ B;  1RQV A;  2EIN B;  3APO A;  2N1T D;  2YO2 A;  4W7Y A;  1U96 A;  3ETE A;  1U7J A;  4YJ2 B;  4QGP A;  2O1K A;  3UIA A;  4WBA A;  4DV6 B;  2OTJ V;  1JR9 A;  1GW3 A;  3M06 A;  5B1N A;  1PP9 D;  3C1L A;  2OTK E;  2FYN B;  1HBW A;  5KAI E;  2G8Y A;  5KLV H;  5J2U A;  1PD3 A;  4LF7 B;  3E35 A;  3N2K B;  3OT7 A;  5KLI B;  1Q86 Q;  4KT0 J;  1NTM H;  5B1A B;  2Q1K A;  2FFD A;  1GM8 A;  2R5B A;  1NGM B;  1S72 V;  3Q5P A;  3C3S A;  2IJJ A;  3OW2 U;  4OVN F;  1Q6U A;  2LFR A;  3HUS C;  1VF7 A;  3HE4 B;  5K1X A;  4PD4 I;  2QG4 A;  3AG4 C;  2XDJ A;  4MVQ A;  1FJG O;  5C8Y A;  3CC2 V;  1JY2 N;  4I9W A;  4TQD A;  1IXB A;  1NBM G;  1UFI A;  1US6 A;  1Q43 A;  3BHP A;  3EVK A;  1N73 A;  1NVP B;  3W7U A;  1G1I A;  3KDP B;  1MZE A;  3ABL C;  2IBZ D;  4A5U B;  2ZT9 B;  1IZN B;  2O3J A;  5LA6 A;  3JCU Z;  3CD6 P;  2JWD A;  1KP2 A;  3T1Y O;  1SQX H;  1KYO D;  5CA0 B;  1FZB A;  3H1H H;  1NTZ D;  3QO8 A;  1SFC B;  2YDE A;  3L71 G;  1MFZ A;  4AQR D;  5KTB A;  2IBZ G;  3IAY A;  1OCZ C;  3L72 H;  1O9H A;  1N32 B;  2QJY B;  4JBZ A;  4G2K A;  4JI0 O;  1M93 A;  5B1B B;  3RK3 C;  1VQM P;  4I9Q A;  1EDL A;  1EC5 A;  1N0N A;  3U0Z A;  4RO0 A;  2E5Y A;  3ZHS A;  1IK9 A;  1S5J A;  4X62 O;  1OIP A;  1VQO V;  3ZHR A;  1SQP E;  2RQ6 A;  3G6E V;  2Q9I A;  3CE2 A;  3VTP C;  3U1C A;  1K33 A;  1OVU A;  4K3A A;  1AJQ A;  2WZ7 A;  1TUB B;  5AW8 B;  1Q3E A;  5K5G B;  1S2E A;  1XOU A;  5BXZ A;  4IOI H;  4JTD B;  3VOU A;  2X6C A;  1NTK D;  1P84 D;  3K3W A;  1PP9 H;  1HR0 O;  1NS1 A;  1CSB A;  2P2U A;  1JCH A;  3ASN B;  1JX9 A;  1PV3 A;  1FFT B;  2LFS A;  5CB4 A;  1FS0 E;  2M3B A;  1KBH A;  1VEW A;  4NXM B;  1L0L G;  2ZVN B;  3H1I G;  2E75 B;  3T97 B;  1SRY A;  2ZCE A;  1SZT A;  3CRQ A;  2UUB B;  2UXB O;  5DJU B;  3RGU A;  3V2R A;  2UXX A;  3AEB C;  2E42 A;  4UB6 Z;  1LTJ A;  2K9J A;  2GTA A;  1OCC C;  4X65 O;  3C8V A;  4DR1 O;  1L4A C;  3TGU E;  2OAR A;  4LBE C;  1L0L D;  1H2K A;  2ETN A;  1OVV A;  1FZC A;  3H1H J;  4H0L C;  1TUB A;  2YXY A;  4PDV A;  1RPO A;  2EBO A;  1H8A A;  4EOT A;  2OYH C;  1NU1 H;  4JI4 O;  4JYC A;  2LXC B;  3F5T A;  2ZE7 A;  2PF4 E;  1YJ9 V;  2P4K A;  2R9A A;  4KJM A;  3L71 E;  4DV0 B;  3F5H A;  2F4V B;  1ZOY C;  3CCM P;  4ZOL B;  1GU5 A;  1JY2 P;  2XKM A;  2HVJ C;  4HZ3 A;  2H43 A;  1RF0 C;  4IL6 E;  1XHZ A;  2XHB A;  4GOD A;  2YNY A;  2KZJ A;  2X6B A;  3OMA B;  4L87 A;  3JYC A;  4WY4 C;  1JEK A;  2N9Y B;  5IYC O;  2L91 A;  2Y0C A;  1GKF A;  4P9O A;  4ABM A;  1YQ4 C;  1NVO A;  2DWE C;  1HNW B;  5AVW B;  4I2L C;  1X0T A;  2IX7 C;  2WLI A;  1KC8 W;  1NKN A;  3AE9 C;  3LNN A;  3L71 J;  5B1O A;  4Q6G A;  1PNK A;  1BGY G;  4TLF A;  1GN3 A;  3JD2 A;  4CBC A;  2Q68 A;  2OWO A;  4OX9 B;  1PGQ A;  3FB7 C;  4DK0 A;  4FPP A;  3K5O A;  2CK3 G;  3G67 A;  1QLE B;  1N86 A;  3JCZ A;  4MVR A;  1M1J B;  1FFX B;  1CP9 A;  2W0X A;  1F7Y A;  2IU3 A;  2Z5U A;  3L9D A;  1Z56 A;  2E76 B;  3P8M C;  3ABU A;  2F66 C;  4H0L D;  3K5L A;  1URQ C;  2PTM A;  4H44 D;  5H6R A;  2KLV A;  3G80 A;  2H89 C;  1W5C E;  5B66 H;  1FBM A;  4JI8 O;  5KLV E;  2UXC B;  4CH4 A;  3OAK A;  4LF4 B;  4JI7 O;  1LUW A;  3W68 A;  2A06 H;  3AK2 A;  4RQE A;  3CI9 A;  1SFC D;  1G8M A;  1HDJ A;  2WLL A;  2LJ2 A;  5L8R J;  4G28 B;  3CRC A;  1KKD A;  1CXZ B;  1Q7Y W;  4DUZ O;  1TAE A;  4PI0 A;  1SQB G;  1P84 F;  5KAI Z;  1NVP D;  2CK3 H;  1K92 A;  2XAQ A;  1BL8 A;  1BDC A;  1H2N A;  3CCL V;  4X8A A;  1Y67 A;  3AEI A;  2Q73 A;  4YPC A;  1FDM A;  1FZE A;  1HR0 B;  3SYC A;  3NMD A;  5LXT B;  3K9S A;  4LP8 A;  3GF7 A;  2Q0A A;  1KD1 Q;  3GF3 A;  2QKA A;  3AE2 C;  5B1B C;  1SZX A;  1PFI A;  1Q6I A;  2E76 D;  3AE6 C;  5KAF H;  3GVM A;  2LXB A;  3BFR A;  1MUU A;  1QL1 A;  3CXH D;  1J95 A;  1H2S B;  2W6B A;  4MW3 A;  3OEE G;  5LHH A;  2R44 A;  1QGK B;  3M7M X;  4U3J B;  4BAY A;  4DXW A;  1NR7 A;  2EIJ B;  2DE0 X;  1YSC A;  4LF8 B;  2M0B A;  3SWY A;  5IYB O;  1J5E B;  2N9B A;  1PPJ H;  1XRE A;  3OGI B;  4LF8 O;  5KKZ C;  3LDE A;  3VQY A;  1HF9 A;  3SPG A;  1URQ A;  4OPA A;  4PD4 D;  5IJ0 A;  3CWB J;  2ZIN A;  1FJP A;  2ZXW B;  2E74 D;  2HG5 D;  4JV5 O;  3HD7 C;  3G3Z A;  1K73 W;  3HKB A;  4JAA A;  1J1E B;  2WSC J;  2R9R B;  3CPW U;  2IBZ E;  4EKW A;  3FYI B;  4Z1V A;  2BEZ F;  4RO2 A;  2OIE A;  4DV4 O;  1DEE G;  5C39 A;  2O1J A;  2IFM A;  2QJ1 A;  4CS3 A;  2I8D A;  3G6E P;  3M9B A;  4DO2 A;  1PP9 G;  2LP7 A;  2IH1 C;  2FYU H;  5KMG B;  5LGN A;  1QVF O;  4PA7 A;  3ETQ A;  2A3Q A;  5JQG A;  3B8N A;  3F7Y C;  4MW8 A;  2Q69 A;  1N36 O;  3CME V;  1NWQ A;  2UUC O;  1WNS A;  1N7S C;  5L3B A;  1LWU B;  1K8A W;  2Q9L A;  2JR8 A;  5EBW C;  2OYH B;  1IUR A;  1J1D B;  2QSI A;  4EYY Q;  1VAR A;  4WFE A;  2QEX V;  2O01 J;  2W27 A;  2UU9 O;  1S5L Z;  3R65 A;  1VQL P;  4LNU B;  1NO4 A;  4FLY A;  4GKK B;  3CX5 D;  3H1L G;  3D6Y A;  4LF4 O;  1HTL C;  2QTS A;  2OTL V;  1M90 W;  2UXC O;  3RGB A;  3L71 D;  3RK2 D;  2P67 A;  3ZRV A;  2Q3E A;  1L0N D;  3CB2 A;  4OGQ D;  1YYC A;  1WAZ A;  4JTA B;  4EB6 B;  2UUA B;  3A0B H;  3L37 A;  1RE3 C;  1G2C B;  2CH7 B;  1SQQ K;  4J41 A;  2O01 H;  2Q6Q A;  3H1L E;  4U3F G;  1Q2N A;  1USE A;  5LOV A;  3C90 A;  2CGN A;  2I1J A;  1KYO H;  1SQX D;  1ZME C;  4PEL A;  3RBX A;  3C3T A;  3IC9 A;  4JI2 B;  1KB9 D;  2NNU A;  4NVP A;  4D6T J;  1MFT A;  5LL6 Y;  3D8C A;  2AEJ A;  4U3F D;  5AW4 B;  3I56 P;  3TNU B;  4ZI7 B;  3PP5 A;  5APU A;  3UT5 A;  4LFB O;  5APW A;  1RH5 B;  1AR5 A;  1ZP0 C;  3ZX6 A;  4YHH O;  3H1K G;  5APV A;  3FXD A;  1S5L H;  2HYN A;  2YXR B;  1SQP G;  3K0G A;  1HNZ B;  3LIE A;  1EXI A;  2KYV A;  2EZO A;  3JC2 2;  3L72 E;  1PNL A;  3P7K A;  2E43 A;  1OZH A;  4I55 A;  1KIL C;  2FFD B;  1YTF B;  2G3A A;  1NTM G;  3K04 A;  3WB2 A;  4DW0 A;  3FKS G;  1IBM O;  1VQ5 V;  4Y99 C;  5J2U B;  1V54 C;  1YJW P;  3PHL A;  1WJZ A;  4BW5 A;  1S9K E;  4OPH A;  1OJH A;  3V2Q A;  3BCC G;  1L0N G;  1SKV A;  3LDC A;  1SQP K;  1GRJ A;  1R6K A;  1GZL A;  4KFM A;  1P49 A;  3A0H Z;  4C7N A;  3K79 A;  4BW9 A;  4EFE A;  4O2A A;  4B86 A;  3AG4 B;  1YF2 A;  5KHK A;  1MNG A;  5AW3 B;  2Z3Y A;  2FML A;  3L74 H;  4FLV A;  4DR7 O;  3K03 A;  4BWA A;  2OYI C;  3H1J D;  2WPS A;  1AJY A;  1U57 A;  4X20 B;  1SQV D;  1VQ9 V;  2M3E A;  4HNA B;  5CBO A;  2YC0 A;  3CXH H;  4LLH A;  4FLU A;  4J80 A;  4YXW H;  5JVD A;  2Q6A A;  1NH2 B;  4JYA O;  1D2D A;  2A06 D;  2ZKO A;  1FAV A;  4U3F E;  1ZV8 A;  2QE7 H;  5AW0 B;  1SQV G;  2IM9 A;  1M1K Q;  1OW7 A;  1K4C C;  2A06 E;  3JAR A;  2C9L Y;  4ZMD A;  1K34 A;  3CMA P;  3CCU V;  5LMN B;  5TIS H;  3Q1M A;  5KJ7 C;  3HUS A;  1PKX A;  1OMI A;  4NKG B;  4O4J B;  1Q8I A;  3O9O A;  3OMN B;  3HE5 A;  2CE4 A;  2RMK B;  1KIL A;  1SQB E;  1QVF U;  1NTK J;  3JD1 A;  4FM0 A;  1KC8 Q;  2P06 A;  5LGT A;  3OA7 A;  4X64 O;  3A0B E;  3KYQ A;  2KIK A;  2MK3 A;  1IFJ A;  3A5T A;  1IVS A;  2JWA A;  3L4F A;  2PFX A;  3FB5 C;  5IDJ A;  3SJA C;  3T1Y B;  4RQF A;  1FYJ A;  4DR3 B;  5GON B;  3M0D C;  2K3R A;  1VIB A;  1SER A;  2JJL A;  4DV5 O;  4WY4 D;  4UCU A;  2XV5 A;  5L3G A;  2H94 A;  1KIL D;  4GOE A;  3PLN A;  2UWJ E;  1I5X A;  2ZYG A;  1VQ8 P;  4O4J A;  3N27 A;  3M91 A;  4XE5 B;  1JY3 P;  1L8D A;  3PJS K;  2Q7H A;  1I5Y A;  2A45 I;  1Q81 W;  3CCR P;  1JPX A;  4UXN A;  1BT8 A;  3DC5 A;  5IE9 A;  5KA6 A;  4GLX A;  2KSJ A;  1L0N J;  4Y28 J;  1H0T B;  3BAS A;  2KB1 A;  4B3M B;  2AXT H;  1XQ8 A;  3H1I H;  2IZ1 A;  1H88 A;  1RE4 A;  4ZNC A;  4UUJ C;  1GM9 A;  1YDX A; 
#chains in the Genus database with same CATH homology
 1LNQ A;  3A0R A;  2XND H;  5CBH A;  1B6Q A;  4XDL A;  2EIN B;  1VQ8 V;  1K97 A;  4FK5 C;  3CCJ V;  1VQN V;  2HVK C;  3ETE A;  1WLE A;  3SJQ C;  1G4Y B;  2IH3 C;  5GW7 A;  1Q82 W;  2DYS B;  2WLI B;  1XL4 A;  2IJH A;  2OTJ V;  1OZ0 A;  5B1N A;  1M56 B;  1K5S A;  4QIW F;  1BHB A;  2BOB C;  1Q86 W;  1PD3 A;  2P6J A;  5DN6 G;  3E35 A;  3CYO A;  3CCS V;  2A0L A;  5B1A B;  1GM8 A;  2AHY A;  3GWO A;  5HFL A;  1S72 V;  2IJJ A;  3JD0 A;  3SPH A;  3OW2 U;  2ZR3 A;  5CMU A;  1FXV A;  1K3E A;  2LFR A;  2ITC C;  3DGE A;  2QA4 V;  1W0K G;  2W0F C;  5CBF A;  4N21 A;  3AG4 C;  3E89 A;  4MVQ A;  3EFF K;  3CC2 V;  2EIK B;  4I9W A;  1BSN A;  1F4M A;  4OXS A;  1NBM G;  3OR6 C;  3ZMZ A;  3D3I A;  1NVP B;  1UJW B;  3W7U A;  3MHS C;  1EZJ A;  4PA9 A;  1JQ0 A;  3ABL C;  1GO3 F;  1ENV A;  3K9A A;  2IW5 A;  2EIL C;  2PI4 A;  1K9M W;  2WWW A;  4E2L A;  1H2G A;  3ML0 A;  1E79 G;  1KP2 A;  2ZD9 A;  3ABK B;  4QNH B;  1GM7 A;  1HWY A;  1NR1 A;  3QO8 A;  1VQK V;  4UV8 A;  1YHQ V;  1OCZ C;  3D36 A;  3CCR V;  4KUM A;  2EIN C;  4MVO A;  2A79 B;  3ABK C;  3SYA A;  3AG3 B;  4G2K A;  2V1D A;  5B1B B;  3T2M A;  2QTO A;  3E8H A;  3OUF A;  3BY6 A;  1JOY A;  2E5Y A;  2WSS G;  1FXK A;  2XAS A;  2HFE C;  2JEU A;  2DYR B;  1VQO V;  1JJ2 U;  3G6E V;  2WLJ A;  1K33 A;  3K0D A;  1AJQ A;  1MAB G;  1S5H C;  4LCU C;  4WCE V;  1AJP A;  5C93 A;  1VQP V;  2WLL B;  1AR1 B;  3RVY A;  4MTF A;  4JTD B;  1MSW D;  3OEH G;  3LUT B;  2X6C A;  3VOU A;  1R3I C;  1M1K W;  3E8F A;  4JAV A;  3G4S V;  3K3W A;  3JD4 A;  1JCH A;  3W7W A;  3ASN B;  1JX9 A;  2JJ1 G;  1FFT B;  2LFS A;  3ABM C;  1FS0 E;  4PDL A;  2ZXW C;  4XDJ A;  1OCC B;  1QLN A;  2M7W A;  1SRY A;  1SZT A;  1ARO P;  1TUE B;  1OCR B;  4GX1 A;  2UXX A;  5LHG A;  4QPJ A;  1GK9 A;  5HFM A;  1EBO A;  1OCC C;  1COW G;  1L1F A;  1YIT V;  4QPK A;  4LBE C;  4X88 A;  5H9C A;  3CCV V;  4PDV A;  5CBG A;  4WFH A;  1RPO A;  2EBO A;  4WFA V;  4BIU A;  4JYC A;  3CCM V;  1YJ9 V;  4JGS A;  1VQL V;  4J9Z B;  2NLJ C;  3M99 B;  3WG7 C;  1QR8 A;  1R73 A;  2HVJ C;  4HZ3 A;  2XAH A;  1E1Q G;  5EBM C;  5IY5 C;  3GB7 C;  2X6B A;  3ASO B;  3OMA B;  3JYC A;  4L87 A;  2EIM C;  3BEH A;  1CEZ A;  1JEK A;  2X6A A;  5IYC O;  4GT1 A;  4P2Z A;  3AG1 B;  2W6I G;  1GKF A;  3LSQ A;  4P9O A;  2ZQM A;  1FXK C;  2DWE C;  3QO7 A;  1F4N A;  1K5Q A;  1Y4M A;  3H01 A;  3OUS A;  4G27 B;  4LC1 A;  2WLI A;  1KC8 W;  5J9P C;  5B3S B;  1M57 B;  1PL0 A;  5B1O A;  1PNK A;  1OCO B;  1ORQ C;  4TLF A;  1QLE C;  3JD2 A;  2Q68 A;  4H37 A;  3ZMV A;  4CBC A;  1IXM A;  1YJW V;  3ZIA G;  2JK5 C;  3FB7 C;  4FPP A;  4BIZ A;  4MT8 A;  2CK3 G;  2EZP A;  4P9P A;  1QLE B;  4QMA A;  3JCZ A;  4MVR A;  1DTO A;  1CP9 A;  3OAA G;  2DQ3 A;  2IU3 A;  2Z5U A;  2JEX A;  1YJN V;  3ABU A;  1VQ6 V;  4UVB A;  3USS A;  5KA5 A;  2JIZ G;  4N23 A;  5H6R A;  1BMF G;  1AJN A;  3ZRX A;  3E83 A;  4PDR A;  1THZ A;  2JDI G;  5CA3 A;  1YTF D;  4RUF A;  3SYP A;  3IFX A;  4JYB A;  3ZMS A;  4RQE A;  2WLM A;  1G8M A;  5DM6 V;  4X89 A;  2WLL A;  3B77 A;  4G28 B;  3OFN G;  3OE7 G;  5LBQ A;  1KKD A;  1Q7Y W;  1NJI W;  1V54 B;  1S77 D;  4GCZ A;  1BHA A;  1NVP D;  3AG2 B;  2CK3 H;  1AI4 A;  1K92 A;  3ETG A;  3E8B A;  5FL7 G;  2XAQ A;  1V55 C;  1BL8 A;  5EC2 C;  3RVZ A;  3RW0 A;  3F5W C;  3CCL V;  4X8A A;  3AEI A;  2WPD G;  2V7Q H;  4JTC B;  1H8H G;  1FXK B;  3SYC A;  2EIK C;  4P30 A;  1R6N A;  4LP8 A;  2P90 A;  2R9I A;  5LGU A;  1P4R A;  4ASU G;  3K08 A;  1NQT A;  5B1B C;  1H38 A;  3IGA C;  2EIL B;  3E86 A;  4HYO A;  3SPC A;  1QVG U;  1AI6 A;  3FYE B;  2Q67 A;  2DW4 A;  1J95 A;  3TET A;  4MW3 A;  1AI7 A;  3OEE G;  2K1E A;  5LHH A;  1F23 A;  2ZR2 A;  3ZN0 A;  1M56 C;  3ZN1 A;  4BAY A;  3W7X A;  3ZMT A;  4DXW A;  1NR7 A;  1OCZ B;  2EIJ B;  3CMA V;  4FIP C;  1GTO A;  1YSC A;  5IYB O;  1BSH A;  4CZZ A;  3MD0 A;  1SET A;  3OGC C;  2Y69 C;  4H33 A;  4GX0 A;  4MVU A;  5B1A C;  2EJR A;  2HKO A;  3LDE A;  4YXW G;  3SPG A;  4UVC A;  3CCE V;  1Y66 A;  1GMG A;  2HLD G;  4JPR A;  5E1A C;  2ZXW B;  3FB8 C;  3SPJ A;  1K73 W;  2JDI H;  4DJG A;  1YIJ V;  3ZMU A;  2R9R B;  3CPW U;  1FXH A;  4EKW A;  3FYI B;  4MVS A;  4RO2 A;  4MS2 A;  2UXN A;  2YEV B;  1KP3 A;  1V55 B;  2ITD C;  2OCC C;  1RM1 C;  5IY5 B;  3P30 A;  4GX2 A;  4MVM A;  4DO2 A;  2V7Q G;  2IU0 A;  2LP7 A;  2EIM B;  1QR9 A;  2IH1 C;  4WF9 V;  3QO5 A;  5LGN A;  1VQM V;  1RM1 B;  3B8M A;  1R3J C;  1S76 D;  4PA7 A;  1ROP A;  2ZDI C;  1DLB A;  3B8N A;  3F7Y C;  3LDD A;  2WLN A;  2Q69 A;  4JAS A;  4MW8 A;  4TWK A;  4WFB V;  3CC7 V;  3CME V;  3TCU A;  1OHH G;  3CP1 A;  5L3B A;  3SPI A;  1K8A W;  5BZB A;  5EBW C;  3UM7 A;  4J9Y B;  3CCQ V;  4WFE A;  2H8P C;  3ABT A;  2QEX V;  3R65 A;  2D3O W;  2IJK A;  4ZBM A;  1K7D A;  2JJ2 G;  1KQS U;  2OTL V;  2EIJ C;  4GX5 A;  1M90 W;  1ZWI C;  1DF4 A;  2AHZ A;  3CXC U;  1DF5 A;  2QM7 A;  2P67 A;  3ZRV A;  4KP4 A;  4QE7 A;  2F43 G;  3VBB A;  3I56 V;  4JTA B;  3W7S A;  3X2Q B;  5L3D A;  3WFV A;  2QE7 G;  3IC7 A;  4I5S A;  4PEL A;  4JAU A;  3JD3 A;  1AQT A;  5EBL C;  3OMI B;  4RAI A;  5L3E A;  2NNU A;  1E1R G;  4QE9 A;  4XDK A;  1K4D C;  1OCR C;  1S3J A;  2X7R B;  3OR7 C;  4PA4 A;  4R50 A;  1RPR A;  1NH2 D;  4WVZ A;  5EC1 C;  2C2A A;  3W7T A;  1QCE A;  2DYR C;  3T4Z A;  3K0G A;  2WLH A;  2ZDI A;  2EZO A;  2XAF A;  4FMT A;  1PNL A;  4PA3 A;  2PI5 A;  4TT3 G;  3MHH C;  4UVA A;  1YTF B;  3K04 A;  4MTG A;  2GSM B;  3FKS G;  1VQ5 V;  1H8E G;  1V54 C;  1KEC A;  4BW5 A;  3LSS A;  5LHI A;  3F7V C;  2XND G;  4MTX A;  2B1I A;  2W6J G;  4XBF A;  2Y48 A;  3DTU B;  3LDC A;  1R6K A;  5L3F A;  4KFM A;  4R6Z A;  1R3L C;  2W6J H;  2WSS H;  3NXS A;  3ZJZ A;  3RBZ A;  3K79 A;  4MVZ A;  2WAM A;  4U7O A;  1CPY A;  2XAG A;  3QNE A;  3AG4 B;  1FS0 G;  2Z3Y A;  3LNM B;  3T4D A;  4MSW C;  4F4L A;  3K03 A;  2ATK C;  3HB3 B;  1W2B U;  3ZCC A;  4Z1M G;  4TSF G;  3G71 V;  1KD1 W;  2YEV A;  2B1G A;  1IFP A;  4MTO A;  4JF3 A;  3I55 V;  1VQ9 V;  2HR3 A;  1OCO C;  3CD6 V;  2XOK G;  2IJI A;  2WLK A;  1XL6 A;  4QJF B;  2QKS A;  2X0L A;  2B5U A;  4YXW H;  2Q6A A;  3ZRW B;  5CN0 A;  1NH2 B;  1N8R W;  3UKM A;  3AG1 C;  2QE7 H;  1WPX A;  1YI2 V;  3STL C;  2OT5 A;  3OM3 B;  5H6Q A;  3WG7 B;  1K4C C;  5KUM A;  1S0V A;  4U7N A;  1K34 A;  3CCU V;  4Q20 A;  1SES A;  2DQ0 A;  5L3C A;  1PKX A;  1QBZ A;  1F51 A;  1EFR G;  2YSU B;  3TK1 A;  2DWD C;  2BOC C;  3OMN B;  1M9N A;  1MG1 A;  1QVF U;  3E8G A;  2DYS C;  2FTK A;  3JD1 A;  2A9H A;  5LGT A;  3ABM B;  3STZ C;  3ZRS A;  2P7T C;  1W0J G;  1M57 C;  2HJF C;  3ETD A;  2MK3 A;  2Y69 B;  4WFF A;  4R8C A;  3FB5 C;  3HPL C;  5IDJ A;  3ZRW A;  2E5T A;  4RQF A;  4PA6 A;  4UV9 A;  1VQ4 V;  1P7B A;  3ASN C;  1NKD A;  2HG5 C;  1SER A;  5L3G A;  4WFG A;  2H94 A;  1I5X A;  3T1C A;  4FJC C;  1MOF A;  3ABL B;  2XAJ A;  5KUK A;  3PJS K;  4ZKI A;  5IYD O;  1R3K C;  2OCC B;  2GHY A;  4RUE A;  3CC4 V;  1I5Y A;  3K06 A;  2QM8 A;  1Q81 W;  3P32 A;  1JPX A;  4UXN A;  3X2Q C;  3AG2 C;  3FB6 C;  4PDM A;  5B3S C;  5KA6 A;  3SYQ A;  1JVM A;  1PNM A;  1VQ7 V;  3KG2 A;  2KB1 A;  3EHB B;  1AI5 A;  3ASO C;  3SYO A;  1E79 H;  3AG3 C;  4R7C A;  3E2E A;  4HAM A;  5EK0 A;  4UUJ C;  1GM9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...