4W7ZA

Tetrameric bap29 vded without disulfide bonds
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
64
structure length
64
Chain Sequence
SMDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transport protein
molecule keywords B-cell receptor-associated protein 29
publication title A disulfide polymerized protein crystal.
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4w7zA00
3RL0B 1SFCD 1SFCC 1KILA 1N7SD 1SFCB 1N7SC 3HD7A 4WY4A 5CCHD 5CCHC 1HVVA 3P8CE 1GL2A 1GL2D 4LGDE 1URQA 1GL2C 4W7ZA 1T3JA 4W80A 1GL2B 1KILD 3M0DC 1KILC 1L4AA 1KILB 3VOPA 3HD7B 4WY4B 3RL0D 3RL0C 2PP6A 4N78E 1URQB 2HFED 1L4AB 2M8RA 3KYQA 2NPSA 3HD7D 3HD7C 3PP5A 4WY4D 4WY4C 3RK2B 2N1TA 2HG5D 4OH8B 3B5NA 4JF7A 1URQD 3HTKB 1URQC 2NPSB 5KJ7A 2XDJA 1L4AD 1L4AC 1N7SA 2N1TB 5CCHA 1JTHA 3B5NB 3RK2D 3RK2C 5CCGA 1N7SB 2YMYA 2NPSD 4W7YA 2NPSC 3RK3D 3TSIA 3RK3C 1NHLA 1XTGB 1JTHB 3RK3B 1SFCA 2N1TD 2N1TC 2KOGA 5CCGD 5CCGC 3B5ND 3B5NC 5KJ7D 5KJ7C 2H8PD 2WZ7A
chains in the Genus database with same CATH superfamily
1S9KE 1S5LX 2RH0A 1JMBA 2C0WA 1H89A 4M3LA 3VN0A 4N78D 2FFDB 1NTKE 2W6JH 1JOCA 1KFMA 4H13C 2PAJA 1EZVD 1PP9E 3AEDC 1N73C 2OYIB 4I1LA 1LJ2A 5CBNA 3Q5PA 4GDOA 2L5GB 1FZEA 1ZLLA 2C9NY 1NTZE 5AVSB 1FU1A 3H32B 4PJ0H 1P84I 2E75B 3IN6A 1JY2P 3AE8C 1SQXE 2G8YA 3H1HD 5AW6B 2Q1KA 3FGAD 3L74J 2E5YA 2Y0DA 5TISE 1DD4A 1EDJA 3AE6C 2VRSA 3G6EP 4XFJA 5KAIE 4ZKPA 2E75D 1FZAA 2A06E 3M06A 5TISH 3CCUP 1IJDB 1R5SA 3W67A 1KILE 2QRXA 1JTHA 3RK2C 1IO4A 1JEKA 2WSEJ 2QIWA 3UIAA 1N73A 2NPSC 4ZKUA 5C39A 1LTAC 3PTZA 5APVA 1Q81Q 2QJKC 1VQPP 3HE5A 1ZOYC 4WWIA 3I55P 3L4FA 4CPGA 1NTKK 1QGKB 4H0LD 3E7KA 1SLQA 2LXBA 2SPZA 1RY3A 3Q3DA 1A02J 1M8OB 4W80A 4H13B 3EWKA 4K35A 1GTWA 2B87A 1NTZK 2A45I 1E79H 1BGYD 3C1LA 1KD1Q 3H1JE 2PP6A 1AVOA 4GKGA 5KLVG 1FZCC 1YJWP 3KZIE 1TU3F 2AEFA 2NPSA 3CWBE 3BCCD 4OWFA 2FY8A 5AW2B 4L74A 3U1AA 3M9BA 1RQVA 4I7ZB 4IOIH 3L71G 1X8YA 2ZAEB 3JC22 3I5CA 4Z1MH 2ZJSE 3AECC 1JY3N 3AE7C 1KQGB 2E76B 3S4RA 1BDCA 2BEQD 1D7MA 1KQFB 2O01N 4B86A 2OYHC 1FZFA 1IK9A 2IBZG 1R5LA 4JQ0D 3QH9A 1FOSF 5CCGC 1FZCA 2M3EA 2WT7A 1OFCX 2QJYB 2R5BA 2E76D 3H1LG 2WZ7A 5KLVJ 2MJZA 2QM8A 3L35A 4AYCA 1LNQA 2KK7A 1HVVA 1KTMA 3GG2A 3WU2E 3VMAA 3A7OA 2WPQA 1BE3J 1IFDA 1L0NK 2M3BA 3FX0A 3ITKA 1NU1G 3L71J 1NTKG 3MGNA 2Q6QA 3WU2H 1URQB 3MD0A 4C7NB 1PP9G 5AW9B 1KB9D 1JMMA 4JYCA 2OYHA 3HD7C 2KP8A 2WSCH 5KLIB 1SQXG 4JF7A 1URQD 2JJLA 2XDJA 2WPRA 2H88C 3H1LJ 2JR8A 1XTCC 1QEXA 2AXTE 2KS1B 3L75D 4YXDC 4W7YA 3L74E 1S3JA 3KPEA 1QL2A 3CMEP 2OGUA 3IAOA 2N1TC 3G4SP 5AW3B 1NU1J 3TGUD 3CXHE 1EDKA 2YXQB 1LTGC 3HD7A 4GIFA 1BDDA 1JUNA 3VYIA 2GA1A 2KZJA 2YKQA 4ZMDA 1JM0A 2Y9ZA 1SQXJ 2HYNA 3M9QA 3RL0C 2WWWA 1JCCA 1GK6A 4PV1C 2M8RA 2WSEH 1MV8A 3AE5C 1AQTA 4H44C 2Q5UA 1SP4A 1KYOD 1YBKA 3H1JG 3FXEA 5KAFE 2N1TA 3LW5H 1LTSC 1S9KD 1L0LE 2JDIH 3HTKB 1PGPA 1OX3A 1HUCA 3L70J 2BEZF 1NTKD 1SQQG 1NVOA 1USEA 5CBOA 4EIJA 1R8EA 3HE4A 1S72P 1GZLA 4A7PA 1FBMA 1PP9D 2XU6A 4DZOA 1IFJA 1ZR2A 2IZ1A 4OGQC 1MFTA 1NTZD 2KLVA 1M90Q 1YI2P 2OYOA 1ZMEC 1WT6A 3KXDA 3D6YA 2JWAA 1AQ5A 1NGMB 5KJ7C 5AVTB 1JY3P 1GL2A 4YXWH 3H1KE 1SFCD 1Q90D 1M1JC 3V4WA 1NKZB 3H1JJ 2A06D 2RMZA 3A2AA 1KILD 1NKNA 3T97B 3ZDMA 1RHZB 1BSNA 1LTBC 1SQQJ 3PJSK 1YYCA 2O1JA 1HWTC 5AW7B 2HFED 4PV1B 2R5DA 4PD4I 2ZXXA 3TNUA 2MKVA 2WSSH 1L0LK 2OYIC 3C8VA 1Y47A 4JPZB 1HJ0A 5KJ7A 1MUUA 1BE3E 3FWLA 2E75C 2YO2A 2HPCB 3TDKA 2Y0CA 2HODA 1NAYA 4D6TE 1M1JA 1LTJB 3L71E 3BASA 2M5AA 1EZVI 1ZW0A 4OGQB 1N7SB 3H1JD 1L0ND 4MN4C 2W27A 1SVFA 1WMKA 3OAKA 4U3FJ 1NWQA 3CMAP 2Q7CA 2FFDA 3CWBD 3QWOC 3CC7P 2PFXA 3TYYA 4WB4A 2QEXP 1N7SD 1RF0A 2OYIA 4H0LC 1CW5A 2H43A 4BRYB 3H1LE 3MTUE 3Q2YA 3CX5E 4ZNCA 1G1IA 3CCMP 2ZYAA 5GTHE 3H32A 1GW3A 2UWJE 3M0DC 1G2CB 4UB6H 4HYTB 4YTPC 1SQVG 4GT1A 1VPCA 2Q3EA 3CX5H 1K73Q 5KLVK 1YHQP 1NU1E 5GTHH 1KYOH 2KZIA 5APYA 4IL6H 1KZUB 1IFPA 3USSA 3GF3A 3R4YA 3VTPC 2WITA 3A0HE 2JWDA 1L0LG 1AJYA 1N86A 3A0BE 2LR2A 2KNCB 1Z56A 4I7ZC 3V2PA 2ZVOB 3A0HH 5K5GB 1KC8Q 1SQVJ 3A0BH 3AE2C 1SQPE 1PGOA 4WBAA 2E76C 2Q3IA 3L70E 5KAIH 3GF7A 1W2BO 4H0LB 2A45G 4KHXA 3HRNA 2HLOA 3CCVP 3AEGC 1AA0A 3GHGB 3H1KG 4Y28J 5APSA 3VOPA 1QX8A 4WY4B 2QJYC 1VQOP 1NU1K 1U7JA 1X79B 3CCEP 2Y9YA 1VDFA 1ZP0C 1UIXA 3SWYA 3L74D 3NFQA 1L0LJ 1LTTC 2B9BA 5APWA 1VQ5P 1FZBA 3CXHD 4WY4D 1T3UA 3V5BA 2YNYA 3CCJP 3KHUA 4C7RA 1S4XA 1EC5A 4LLHA 1SQXK 1URQC 3N4XA 5AW4B 1PPJE 1DIPA 1GU5A 3JCUE 4UB8E 2YXRB 3B5NB 1SQQE 4EYYQ 1BE3G 5KLIC 2IPPA 1NOHA 3KZIH 4D6TG 3JCUH 3H1KJ 2FYZA 1DEEG 1OVVA 3AE9C 1HF9A 4KJMA 3IR9A 1T8ZA 1KB9I 1U7MA 4HH2A 3B5ND 1ZN5A 1KN7A 2K37A 1L0LD 2KSJA 2O01J 1FZGA 3SSUA 3B71A 2I1JA 2Y0EA 1URQA 2NRGA 4C7NA 1YTZI 1OVUA 2BCCG 3AE1C 4U3FE 5B66E 3RK3E 4N78E 2QSIA 1VL2A 3PHLA 2FKWB 1ZRTE 3CD6P 2YMKA 5AVQB 1J2JB 4DJGA 2W83C 2IYPA 4R4MA 3W68A 3VP9A 1IK7A 4D6TJ 2XZRA 5B66H 3H1KD 2QG4A 3H1IE 2K9JB 3KQGA 1LP1B 2FYUG 1VQKP 2KS1A 1VQMP 2RN0A 1LT9C 2FXOA 1SQQK 1H0TB 2E42A 5AVXB 1RE3C 1NTMG 3M0AA 1X9VA 3F89A 5CCGA 2Z5HA 2I1KA 2E74B 2P67A 5APTA 1N7LA 1W2EA 1QLED 1SQBE 3MIWA 1OVRA 2BCCJ 5KLVD 3L73J 3RBXA 3N7NA 2DW3A 4R4LA 1SFCC 3GW6A 4GOEA 2YKOA 1USDA 2P10A 2XNDH 1M7LA 2E74D 1BE3D 1J1DC 1SQPG 2JO1A 1T2KD 1KFNA 2QM7A 4EI2A 1MKMA 4D6TD 1KILC 2KUBA 1HGZA 3L71D 2IX7C 3L70G 2AXTH 1MFZA 2FYUJ 1WRGA 1P84E 1SQVE 1RE3A 3L72G 5B5EE 2FXPA 3FXDA 3HTKA 3CXHH 3G71P 1NTMJ 4I2LC 1YQ3C 3MHVA 5E79E 2IBZD 5AVZB 1P84H 4GOFA 2HG5D 2OARA 1HBWA 2E43A 1RF1B 3MZWB 1EXIA 3H1LD 4NPFX 3CX5D 1LT9B 1Q82Q 5TJHA 2H89C 2Q9IA 3CI9A 3RGUA 1DD3A 3JSVC 1HGVA 2ITAA 3P7KA 2GUVA 1PPJG 1SQPJ 1SQBK 4N3YB 1NU1D 1DH3A 1LWUB 2B88A 1LTJC 5KAFH 1VQ4P 2KSEA 5GTIE 3IF4A 1VF5D 2POHA 3Q5SA 3L72J 3D6ZA 3T97A 1BCCE 1SFCB 1N7SC 2QVAA 1NYHA 5AVVB 3O8ZA 1GDTA 5APUA 1OZHA 1J1DB 2WSFJ 5GTIH 1E5WA 1SQXD 1YJ9P 2P2UA 1KILB 2N9YB 2HR3A 3TF5A 4NPDA 3L36A 1SQVK 1KORA 3R2PA 1DEBA 2A45H 4AQRD 1ZV8A 2G3AA 3LIDA 2HPCA 2GM4A 3PP5A 1SQPD 2K1AA 4U3FG 5L8RJ 1LTJA 1Y9BA 2QE7H 1PIXA 4L75A 1GMJA 3L70D 2R3CA 5BVZA 1N7SA 1FDOA 1EQ7A 3SWKA 1GK4A 2O01H 3H1IG 3B8EB 4DCKA 1JB0J 1JY2O 2OTLP 2R32A 3H1HG 5AW1B 2CK3H 2YMYA 4DOJA 2O3JA 1MZ9A 1NHLA 5H2FE 1JNMA 1IZNB 4BRYA 1ZXGA 3V2NA 2LKMA 3RL0g 1FS0E 1A02F 2H8PD 1G2CA 4XA4A 5H2FH 2P7JA 5CCHD 1OIPA 1J1EC 1SQBG 1Q86Q 2JP3A 5CJ0A 1PPJD 3NMDA 1GL2D 4JYBA 2L91A 1OXZA 1GW4A 1SQQD 4L76A 1CSBA 1LT1A 2ZXEB 4IFMA 4N6JA 3C9IA 1RH5B 2BCCE 5AW0B 3L73E 1L4AB 4QMAA 1U57A 3H1IJ 1W5CE 3GHGC 3U1CA 3CCLP 3H1HJ 4WY4C 4KT0J 1EDLA 2BASA 2CPSA 3SFEC 2KNCA 3HUSB 1L4AD 2KXPB 1CI6B 4L73A 1S5LE 4IL6X 1BGYG 3G9RA 2FYUE 3M91A 1M56D 3A5TA 3WUVA 3CC4P 2V7QJ 3O6QB 2WTYA 1SQBJ 1K8AQ 3BCCG 4U3FD 3RK3D 1S5LH 5AVYB 1DX7A 1NTME 2D2CD 4U7JA 2KLUA 4PJ0E 2C9LY 1ZRTD 2NZ2A 3MUDC 3V2QA 2KOGA 1QL1A 3AEEC 2FYNB 1H8AA 3B5NC 2P1JA 3AE4C 3CXHI 2KB7P 4HKZH 3GHGA 1PFIA 3M0DA 1Q7YQ 4RJTA 3H1ID 4WY4A 4HB1A 2ZT9B 5KKZB 1J1EB 3E1RA 5BU5A 5APQA 3CCSP 4LGDE 2KIKA 1BCCG 2XNXA 4EOTA 1FJKA 1KV4A 1OW6A 2YO3A 3ABVC 3AEBC 2ZT9D 1BGYJ 4K3AA 5AW8B 3D71A 5BU8B 1LGHB 3CC2P 5CMZA 3WMM0 1EXJA 1FE6A 1PGJA 2W90A 2WMMA 3L72E 1SQBD 5AVRB 1ZR4A 3MUDA 3BCCJ 1FOSE 5AVUB 3BRVB 3B5NA 3H25A 1QVGO 1Q2NA 2WVRA 2FYUK 1PZQA 1FDMA 4HJGH 3LW5J 3L37A 3OJAB 2OQQA 1OWAA 1VQ9P 1KQSO 2OTKE 1RE4C 2WSFH 1NTMK 3NTNA 2FBWC 2C0XA 1P84D 3VMXA 1NAFA 4C46A 1XTGB 1JTHB 1SQVD 2FXMA 1BCCJ 4ASWA 2WQYC 3F5HA 1IFMA 1CZQA 1N73B 1K9MQ 4XE5B 3SFDC 1L0NE 2KYVA 2ZVNB 4BWNA 2Z4EA 3H6PA 2JKVA 2E74C 3P8CE 3S9OA 3EFGA 1AV1A 1VQLP 2YIUC 1T2KC 3SWFA 4UB8H 3M9HA 1L2PA 1SQPK 3HE5B 4H13D 4W7ZA 5CJ4A 3GMAA 1FDIA 3L75G 3CL3D 2Z5IA 2YKPA 5M1BA 3VMYA 1KMIZ 4ASVA 1NO4A 3WUTA 3FWNA 2AXCA 2ZYDA 3TGUG 1RE4A 4PD4E 2B87B 2K9JA 1LP1A 1RQUA 5AW5B 3CPWO 5KTBA 3RK2B 3VP8A 2B89A 3EFFK 1H0TA 1NH4A 3L73G 1K05A 4PD4H 1BCCD 2NPSB 1EDIA 3BVHA 4GODA 3AE3C 1N2DC 5CHXA 2QJKB 2PRRA 1EZVE 2CPBA 3RK2D 2I8DA 2R3SA 4TLFA 2K9YA 3LIEA 3Q5RA 1VQNP 3KDPB 3NXSA 1H88A 3CCRP 2NPSD 3B4SA 1RF1C 3L75J 3H1HE 3II6A 1LTIC 3Q1MA 3D70A 1VF5C 2AEMA 5AVWB 3TGUJ 2IBZI 1AVYA 5EFWB 1YITP 4EDFA 1FZCB 2WT7B 1PGQA 2YIUB 1LWUC 3CX5I 2IYOA 3P8MC 1NTZG 2RKLA 1KYOI 2IFMA 2QA4P 3CCQP 2H7HA 4WVZA 2V7QH 1JY3O 4RKUJ 1RF1A 3V4QA 1YIJP 1FC2C 4LC1A 1LT9A 1S2EA 2N9BA 1M1KQ 2A06G 4OH8B 3BRTB 5DJUB 2OYHB 3TK1A 1X0TA 3A3YB 1QVFO 1NTKJ 4OVNF 3PLNA 1GD2E 2O1KA 3EQ2A 1BGYE 1LWUA 1S1CX 1PP9J 4JBZA 2E5TA 2XV5A 3TSIA 5B5EH 2BCCD 1SFCA 3L73D 1NTZJ 2K3RA 3WUUA 3BCCE 5CCGD 2IFNA 5E79H 1OW7A 1AFOA 1VF5B 1UIIA 1KILA 1VQ8P 4DT0A 5CCHC 1JY2N 3PRJA 1GL2C 3U59A 1T3JA 4IFFA 2FYUD 1L0NG 3HD7B 3CWBG 2IZ0A 2R44A 4AUWA 1NTMD 1GU4A 3KYQA 1KQLA 1YTZT 3BATA 3HD7D 1OW8A 3AEFC 3VMZA 1VQ7P 5DJTB 2XKMA 3MP7B 2M0BA 1M57D 1HTLC 1L4AC 3E1IA 2P58A 2WPSA 3GLMA 1X22A 2N1TB 4TT3H 5CCHA 2ZYGA 1OMIA 2QJPC 2W8ZA 2PGDA 3HUSC 1HH0A 3RK3C 1EZVG 3HE4B 2D2CC 1L0NJ 1KB9E 2JEEA 2N1TD 4Y99C 2ZFCA 3L72D 3K5BA 1JCDA 3CWBJ 2AEJA 1VQ6P 3RL0B 2J59M 1KB9H 2FFDC 1YQ4C 4RESB 3PH0A 4RO0A 3P32A 5KLVE 1GL2B 4H44B 1RF0C 1L4AA 2FYNC 2OTJP 1FJPA 3RL0D 2W6BA 5APXA 3L75E 3CLQA 3V2RA 1HJBA 2ZT9C 1JO5A 5KKZC 4PV1D 1SS1A 2W6AA 2IDBA 3S1KA 1G1JA 3HUSA 4H44D 2LXCB 3V6IA 3TGUE 1N8RQ 2J58A 1YJNP 1CI6A 1NJIQ 1BSHA 3RBZA 1T6AA 2V4HA 4YPCA 4O9BA 1PL5A 3O6QA 2WPVB 4NPEA 3TNUB 3P8CD 3I56P 3OW2O 3G3ZA 3IFMA 1IFNA 2IBZE 3OA7A 3L74G 2KI7B 2QJPB 4UB6E 3AEAC 2J5UA 4OGQD 1FAVA 2HODB 1IFIA 1M1JB 1IC2A 1K04A 3RK3B 4PD4D 1PV3A 2M5AB 2WSCJ 2D2CB 4IFDK 1KYOE 4Y99B 1Y8AA 2K88A 4BXLA 4I6MC 4IL6E 5KJ7D 2GUSA
chains in the Genus database with same CATH topology
4XE5B 1S9KE 1SFCD 1SFCC 2KYVA 2Z4EA 2YKOA 3H6PA 1M1JC 2C0WA 1M7LA 1H89A 3P8CE 4M3LA 4N78D 3EFGA 3V4WA 3VN0A 2FFDB 1JOCA 1J1DC 1KFMA 1NKZB 3SWFA 1T2KC 1T2KD 1KFNA 3M9HA 3HE5B 1SQPK 4W7ZA 2QM7A 3A2AA 5CJ4A 1KILD 1NKNA 1KILC 2PAJA 3CL3D 1HGZA 2IX7C 2Z5IA 2YKPA 1N73C 1MFZA 2OYIB 4I1LA 3VMYA 2L5GB 1FZEA 1LTBC 1WRGA 1ZLLA 1NO4A 2C9NY 5AVSB 1YYCA 2O1JA 1FU1A 1HWTC 1RE3A 1RE4A 3H32B 5AW7B 2HFED 1JY2P 2R5DA 3HTKA 5AW6B 5AW5B 3TNUA 4I2LC 1L0LK 2OYIC 5KTBA 3RK2B 5AVZB 3VP8A 2VRSA 2HG5D 2OARA 1NH4A 1HBWA 2E43A 1RF1B 2NPSB 4ZKPA 5KJ7A 3BVHA 1MUUA 1FZAA 3M06A 1N2DC 2YO2A 5CHXA 2HPCB 1LT9B 1IJDB 2HODA 1M1JA 1LTJB 2Q9IA 1JTHA 2CPBA 3BASA 3CI9A 3RK2D 3RK2C 1IO4A 3LIEA 3KDPB 1HGVA 3P7KA 2GUVA 3NXSA 3UIAA 1H88A 1N7SB 1N73A 2NPSD 1RF1C 2NPSC 4ZKUA 2W27A 1SVFA 1LTAC 1SQBK 4N3YB 3OAKA 1DH3A 1NWQA 5APVA 1LWUB 1LTJC 3II6A 1LTIC 2Q7CA 2FFDA 3HE5A 2POHA 3TYYA 5AVWB 3L4FA 4WB4A 3T97A 1NTKK 1N7SD 1RF0A 1SFCB 1N7SC 2OYIA 1SLQA 1CW5A 2H43A 3MTUE 1FZCB 5AVVB 3O8ZA 1GDTA 1RY3A 5APUA 1A02J 2WT7B 1J1DB 1G1IA 1E5WA 1LWUC 3H32A 1GW3A 4W80A 3M0DC 2P2UA 1G2CB 3P8MC 1KILB 1GTWA 4HYTB 1NTZK 2A45I 2IFMA 4GT1A 3L36A 1SQVK 1VPCA 2H7HA 2PP6A 4GKGA 3R2PA 5KLVK 1FZCC 1DEBA 2A45H 1JY3O 4AQRD 1RF1A 2NPSA 3V4QA 1ZV8A 5APYA 3LIDA 2HPCA 4LC1A 2GM4A 3PP5A 1KZUB 1LT9A 2N9BA 5AW2B 1LTJA 3U1AA 4OH8B 3M9BA 3BRTB 2R3CA 5BVZA 1X8YA 3VTPC 2OYHB 2WITA 3TK1A 1N7SA 3A3YB 3I5CA 1EQ7A 1GK4A 2O01H 3B8EB 1JY3N 1N86A 2O1KA 3EQ2A 1JY2O 1LWUA 1GD2E 2R32A 1Z56A 5AW1B 3V2PA 2YMYA 4DOJA 2XV5A 3TSIA 1MZ9A 1NHLA 4B86A 2OYHC 1FZFA 1IK9A 1SFCA 1JNMA 5CCGD 3V2NA 2LKMA 2IFNA 5CCGC 1FZCA 1FOSF 2WT7A 4WBAA 1A02F 2R5BA 1AFOA 2H8PD 2WZ7A 1G2CA 4XA4A 1KILA 2Q3IA 2P7JA 2MJZA 2QM8A 3L35A 5CCHD 4AYCA 1J1EC 2A45G 5CCHC 1JY2N 4KHXA 1HVVA 3HRNA 2HLOA 5CJ0A 3A7OA 2WPQA 3NMDA 1GL2D 1GL2C 4JYBA 3U59A 1T3JA 1IFDA 3GHGB 1OXZA 4IFFA 5APSA 3VOPA 3HD7B 1L0NK 4WY4B 2M3BA 1GW4A 1CSBA 1NU1K 1X79B 2ZXEB 3MGNA 4IFMA 1VDFA 3SWYA 1URQB 4N6JA 3C9IA 3MD0A 4C7NB 5AW0B 4AUWA 1L4AB 3NFQA 1GU4A 5AW9B 3KYQA 1LTTC 1KQLA 5APWA 3GHGC 1JMMA 3U1CA 1YTZT 4JYCA 3BATA 1FZBA 2OYHA 3HD7D 3HD7C 4WY4D 1T3UA 4WY4C 3V5BA 2KP8A 2WSCH 2YNYA 3VMZA 2BASA 2CPSA 4C7RA 2XKMA 4JF7A 1URQD 4LLHA 1SQXK 1URQC 2JJLA 3HUSB 2XDJA 1HTLC 1L4AD 3N4XA 1L4AC 5AW4B 1CI6B 3E1IA 2WPRA 2WPSA 1GU5A 2N1TB 5CCHA 3M91A 3A5TA 3B5NB 1XTCC 2WTYA 2IPPA 1NOHA 4W7YA 3HUSC 1HH0A 3RK3D 5AVYB 3RK3C 1DX7A 3KPEA 1QL2A 3HE4B 2FYZA 2C9LY 2JEEA 2N1TD 4Y99C 2ZFCA 2N1TC 3IR9A 1T8ZA 5AW3B 3V2QA 2KOGA 1QL1A 4HH2A 3B5ND 1H8AA 3B5NC 1ZN5A 2P1JA 1JCDA 1LTGC 2KB7P 3GHGA 3RL0B 1PFIA 3M0DA 3HD7A 4GIFA 4WY4A 1JUNA 2KSJA 2J59M 3VYIA 1FZGA 2FFDC 4RESB 1J1EB 5BU5A 5APQA 2I1JA 2YKQA 4LGDE 3P32A 1URQA 1GL2B 4C7NA 1RF0C 1L4AA 1YTZI 2XNXA 4EOTA 2HYNA 1FJKA 3M9QA 2YO3A 1FJPA 3RL0D 2W6BA 3RL0C 5APXA 2WWWA 3CLQA 3V2RA 1HJBA 1JO5A 1JCCA 4N78E 1GK6A 2FKWB 5AW8B 5BU8B 2W6AA 2M8RA 1G1JA 1LGHB 2WSEH 5CMZA 3WMM0 5AVQB 1MV8A 3HUSA 1J2JB 2Q5UA 1SP4A 2J58A 1CI6A 5AVRB 1ZR4A 3VP9A 3MUDA 1FOSE 2N1TA 3LW5H 2XZRA 1LTSC 4O9BA 5AVUB 1S9KD 3BRVB 3B5NA 3HTKB 3KQGA 2FYUK 1FDMA 3TNUB 1HUCA 3P8CD 1LT9C 3L37A 1SQQK 3OJAB 1OWAA 4EIJA 3G3ZA 3HE4A 1GZLA 3IFMA 1FBMA 1IFNA 2E42A 2XU6A 4DZOA 3OA7A 5AVXB 1IFJA 1RE3C 1RE4C 2WSFH 3M0AA 1X9VA 1ZR2A 1NTMK 1FAVA 5CCGA 2Z5HA 3NTNA 2C0XA 2HODB 3VMXA 2I1KA 2KLVA 1IFIA 1M1JB 1NAFA 1IC2A 4C46A 1XTGB 1JTHB 3RK3B 2P67A 2FXMA 5APTA 1N7LA 1WT6A 4IFDK 1W2EA 4Y99B 3MIWA 1IFMA 1AQ5A 3N7NA 1CZQA 1N73B 4I6MC 5KJ7D 5KJ7C 2GUSA 5AVTB 1JY3P 1GL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3RL0 B;  1SFC D;  1SFC C;  1KIL A;  1N7S D;  1SFC B;  1N7S C;  3HD7 A;  4WY4 A;  5CCH D;  5CCH C;  1HVV A;  3P8C E;  1GL2 A;  1GL2 D;  4LGD E;  1URQ A;  1GL2 C;  4W7Z A;  1T3J A;  4W80 A;  1GL2 B;  1KIL D;  3M0D C;  1KIL C;  1L4A A;  1KIL B;  3VOP A;  3HD7 B;  4WY4 B;  3RL0 D;  3RL0 C;  2PP6 A;  4N78 E;  1URQ B;  2HFE D;  1L4A B;  2M8R A;  3KYQ A;  2NPS A;  3HD7 D;  3HD7 C;  3PP5 A;  4WY4 D;  4WY4 C;  3RK2 B;  2N1T A;  2HG5 D;  4OH8 B;  3B5N A;  4JF7 A;  1URQ D;  3HTK B;  1URQ C;  2NPS B;  5KJ7 A;  2XDJ A;  1L4A D;  1L4A C;  1N7S A;  2N1T B;  5CCH A;  1JTH A;  3B5N B;  3RK2 D;  3RK2 C;  5CCG A;  1N7S B;  2YMY A;  2NPS D;  4W7Y A;  2NPS C;  3RK3 D;  3TSI A;  3RK3 C;  1NHL A;  1XTG B;  1JTH B;  3RK3 B;  1SFC A;  2N1T D;  2N1T C;  2KOG A;  5CCG D;  5CCG C;  3B5N D;  3B5N C;  5KJ7 D;  5KJ7 C;  2H8P D;  2WZ7 A; 
#chains in the Genus database with same CATH topology
 1S9K E;  1S5L X;  2RH0 A;  1JMB A;  2C0W A;  1H89 A;  4M3L A;  3VN0 A;  4N78 D;  2FFD B;  1NTK E;  2W6J H;  1JOC A;  1KFM A;  4H13 C;  2PAJ A;  1EZV D;  1PP9 E;  3AED C;  1N73 C;  2OYI B;  4I1L A;  1LJ2 A;  5CBN A;  3Q5P A;  4GDO A;  2L5G B;  1FZE A;  1ZLL A;  2C9N Y;  1NTZ E;  5AVS B;  1FU1 A;  3H32 B;  4PJ0 H;  1P84 I;  2E75 B;  3IN6 A;  1JY2 P;  3AE8 C;  1SQX E;  2G8Y A;  3H1H D;  5AW6 B;  2Q1K A;  3FGA D;  3L74 J;  2E5Y A;  2Y0D A;  5TIS E;  1DD4 A;  1EDJ A;  3AE6 C;  2VRS A;  3G6E P;  4XFJ A;  5KAI E;  4ZKP A;  2E75 D;  1FZA A;  2A06 E;  3M06 A;  5TIS H;  3CCU P;  1IJD B;  1R5S A;  3W67 A;  1KIL E;  2QRX A;  1JTH A;  3RK2 C;  1IO4 A;  1JEK A;  2WSE J;  2QIW A;  3UIA A;  1N73 A;  2NPS C;  4ZKU A;  5C39 A;  1LTA C;  3PTZ A;  5APV A;  1Q81 Q;  2QJK C;  1VQP P;  3HE5 A;  1ZOY C;  4WWI A;  3I55 P;  3L4F A;  4CPG A;  1NTK K;  1QGK B;  4H0L D;  3E7K A;  1SLQ A;  2LXB A;  2SPZ A;  1RY3 A;  3Q3D A;  1A02 J;  1M8O B;  4W80 A;  4H13 B;  3EWK A;  4K35 A;  1GTW A;  2B87 A;  1NTZ K;  2A45 I;  1E79 H;  1BGY D;  3C1L A;  1KD1 Q;  3H1J E;  2PP6 A;  1AVO A;  4GKG A;  5KLV G;  1FZC C;  1YJW P;  3KZI E;  1TU3 F;  2AEF A;  2NPS A;  3CWB E;  3BCC D;  4OWF A;  2FY8 A;  5AW2 B;  4L74 A;  3U1A A;  3M9B A;  1RQV A;  4I7Z B;  4IOI H;  3L71 G;  1X8Y A;  2ZAE B;  3JC2 2;  3I5C A;  4Z1M H;  2ZJS E;  3AEC C;  1JY3 N;  3AE7 C;  1KQG B;  2E76 B;  3S4R A;  1BDC A;  2BEQ D;  1D7M A;  1KQF B;  2O01 N;  4B86 A;  2OYH C;  1FZF A;  1IK9 A;  2IBZ G;  1R5L A;  4JQ0 D;  3QH9 A;  1FOS F;  5CCG C;  1FZC A;  2M3E A;  2WT7 A;  1OFC X;  2QJY B;  2R5B A;  2E76 D;  3H1L G;  2WZ7 A;  5KLV J;  2MJZ A;  2QM8 A;  3L35 A;  4AYC A;  1LNQ A;  2KK7 A;  1HVV A;  1KTM A;  3GG2 A;  3WU2 E;  3VMA A;  3A7O A;  2WPQ A;  1BE3 J;  1IFD A;  1L0N K;  2M3B A;  3FX0 A;  3ITK A;  1NU1 G;  3L71 J;  1NTK G;  3MGN A;  2Q6Q A;  3WU2 H;  1URQ B;  3MD0 A;  4C7N B;  1PP9 G;  5AW9 B;  1KB9 D;  1JMM A;  4JYC A;  2OYH A;  3HD7 C;  2KP8 A;  2WSC H;  5KLI B;  1SQX G;  4JF7 A;  1URQ D;  2JJL A;  2XDJ A;  2WPR A;  2H88 C;  3H1L J;  2JR8 A;  1XTC C;  1QEX A;  2AXT E;  2KS1 B;  3L75 D;  4YXD C;  4W7Y A;  3L74 E;  1S3J A;  3KPE A;  1QL2 A;  3CME P;  2OGU A;  3IAO A;  2N1T C;  3G4S P;  5AW3 B;  1NU1 J;  3TGU D;  3CXH E;  1EDK A;  2YXQ B;  1LTG C;  3HD7 A;  4GIF A;  1BDD A;  1JUN A;  3VYI A;  2GA1 A;  2KZJ A;  2YKQ A;  4ZMD A;  1JM0 A;  2Y9Z A;  1SQX J;  2HYN A;  3M9Q A;  3RL0 C;  2WWW A;  1JCC A;  1GK6 A;  4PV1 C;  2M8R A;  2WSE H;  1MV8 A;  3AE5 C;  1AQT A;  4H44 C;  2Q5U A;  1SP4 A;  1KYO D;  1YBK A;  3H1J G;  3FXE A;  5KAF E;  2N1T A;  3LW5 H;  1LTS C;  1S9K D;  1L0L E;  2JDI H;  3HTK B;  1PGP A;  1OX3 A;  1HUC A;  3L70 J;  2BEZ F;  1NTK D;  1SQQ G;  1NVO A;  1USE A;  5CBO A;  4EIJ A;  1R8E A;  3HE4 A;  1S72 P;  1GZL A;  4A7P A;  1FBM A;  1PP9 D;  2XU6 A;  4DZO A;  1IFJ A;  1ZR2 A;  2IZ1 A;  4OGQ C;  1MFT A;  1NTZ D;  2KLV A;  1M90 Q;  1YI2 P;  2OYO A;  1ZME C;  1WT6 A;  3KXD A;  3D6Y A;  2JWA A;  1AQ5 A;  1NGM B;  5KJ7 C;  5AVT B;  1JY3 P;  1GL2 A;  4YXW H;  3H1K E;  1SFC D;  1Q90 D;  1M1J C;  3V4W A;  1NKZ B;  3H1J J;  2A06 D;  2RMZ A;  3A2A A;  1KIL D;  1NKN A;  3T97 B;  3ZDM A;  1RHZ B;  1BSN A;  1LTB C;  1SQQ J;  3PJS K;  1YYC A;  2O1J A;  1HWT C;  5AW7 B;  2HFE D;  4PV1 B;  2R5D A;  4PD4 I;  2ZXX A;  3TNU A;  2MKV A;  2WSS H;  1L0L K;  2OYI C;  3C8V A;  1Y47 A;  4JPZ B;  1HJ0 A;  5KJ7 A;  1MUU A;  1BE3 E;  3FWL A;  2E75 C;  2YO2 A;  2HPC B;  3TDK A;  2Y0C A;  2HOD A;  1NAY A;  4D6T E;  1M1J A;  1LTJ B;  3L71 E;  3BAS A;  2M5A A;  1EZV I;  1ZW0 A;  4OGQ B;  1N7S B;  3H1J D;  1L0N D;  4MN4 C;  2W27 A;  1SVF A;  1WMK A;  3OAK A;  4U3F J;  1NWQ A;  3CMA P;  2Q7C A;  2FFD A;  3CWB D;  3QWO C;  3CC7 P;  2PFX A;  3TYY A;  4WB4 A;  2QEX P;  1N7S D;  1RF0 A;  2OYI A;  4H0L C;  1CW5 A;  2H43 A;  4BRY B;  3H1L E;  3MTU E;  3Q2Y A;  3CX5 E;  4ZNC A;  1G1I A;  3CCM P;  2ZYA A;  5GTH E;  3H32 A;  1GW3 A;  2UWJ E;  3M0D C;  1G2C B;  4UB6 H;  4HYT B;  4YTP C;  1SQV G;  4GT1 A;  1VPC A;  2Q3E A;  3CX5 H;  1K73 Q;  5KLV K;  1YHQ P;  1NU1 E;  5GTH H;  1KYO H;  2KZI A;  5APY A;  4IL6 H;  1KZU B;  1IFP A;  3USS A;  3GF3 A;  3R4Y A;  3VTP C;  2WIT A;  3A0H E;  2JWD A;  1L0L G;  1AJY A;  1N86 A;  3A0B E;  2LR2 A;  2KNC B;  1Z56 A;  4I7Z C;  3V2P A;  2ZVO B;  3A0H H;  5K5G B;  1KC8 Q;  1SQV J;  3A0B H;  3AE2 C;  1SQP E;  1PGO A;  4WBA A;  2E76 C;  2Q3I A;  3L70 E;  5KAI H;  3GF7 A;  1W2B O;  4H0L B;  2A45 G;  4KHX A;  3HRN A;  2HLO A;  3CCV P;  3AEG C;  1AA0 A;  3GHG B;  3H1K G;  4Y28 J;  5APS A;  3VOP A;  1QX8 A;  4WY4 B;  2QJY C;  1VQO P;  1NU1 K;  1U7J A;  1X79 B;  3CCE P;  2Y9Y A;  1VDF A;  1ZP0 C;  1UIX A;  3SWY A;  3L74 D;  3NFQ A;  1L0L J;  1LTT C;  2B9B A;  5APW A;  1VQ5 P;  1FZB A;  3CXH D;  4WY4 D;  1T3U A;  3V5B A;  2YNY A;  3CCJ P;  3KHU A;  4C7R A;  1S4X A;  1EC5 A;  4LLH A;  1SQX K;  1URQ C;  3N4X A;  5AW4 B;  1PPJ E;  1DIP A;  1GU5 A;  3JCU E;  4UB8 E;  2YXR B;  3B5N B;  1SQQ E;  4EYY Q;  1BE3 G;  5KLI C;  2IPP A;  1NOH A;  3KZI H;  4D6T G;  3JCU H;  3H1K J;  2FYZ A;  1DEE G;  1OVV A;  3AE9 C;  1HF9 A;  4KJM A;  3IR9 A;  1T8Z A;  1KB9 I;  1U7M A;  4HH2 A;  3B5N D;  1ZN5 A;  1KN7 A;  2K37 A;  1L0L D;  2KSJ A;  2O01 J;  1FZG A;  3SSU A;  3B71 A;  2I1J A;  2Y0E A;  1URQ A;  2NRG A;  4C7N A;  1YTZ I;  1OVU A;  2BCC G;  3AE1 C;  4U3F E;  5B66 E;  3RK3 E;  4N78 E;  2QSI A;  1VL2 A;  3PHL A;  2FKW B;  1ZRT E;  3CD6 P;  2YMK A;  5AVQ B;  1J2J B;  4DJG A;  2W83 C;  2IYP A;  4R4M A;  3W68 A;  3VP9 A;  1IK7 A;  4D6T J;  2XZR A;  5B66 H;  3H1K D;  2QG4 A;  3H1I E;  2K9J B;  3KQG A;  1LP1 B;  2FYU G;  1VQK P;  2KS1 A;  1VQM P;  2RN0 A;  1LT9 C;  2FXO A;  1SQQ K;  1H0T B;  2E42 A;  5AVX B;  1RE3 C;  1NTM G;  3M0A A;  1X9V A;  3F89 A;  5CCG A;  2Z5H A;  2I1K A;  2E74 B;  2P67 A;  5APT A;  1N7L A;  1W2E A;  1QLE D;  1SQB E;  3MIW A;  1OVR A;  2BCC J;  5KLV D;  3L73 J;  3RBX A;  3N7N A;  2DW3 A;  4R4L A;  1SFC C;  3GW6 A;  4GOE A;  2YKO A;  1USD A;  2P10 A;  2XND H;  1M7L A;  2E74 D;  1BE3 D;  1J1D C;  1SQP G;  2JO1 A;  1T2K D;  1KFN A;  2QM7 A;  4EI2 A;  1MKM A;  4D6T D;  1KIL C;  2KUB A;  1HGZ A;  3L71 D;  2IX7 C;  3L70 G;  2AXT H;  1MFZ A;  2FYU J;  1WRG A;  1P84 E;  1SQV E;  1RE3 A;  3L72 G;  5B5E E;  2FXP A;  3FXD A;  3HTK A;  3CXH H;  3G71 P;  1NTM J;  4I2L C;  1YQ3 C;  3MHV A;  5E79 E;  2IBZ D;  5AVZ B;  1P84 H;  4GOF A;  2HG5 D;  2OAR A;  1HBW A;  2E43 A;  1RF1 B;  3MZW B;  1EXI A;  3H1L D;  4NPF X;  3CX5 D;  1LT9 B;  1Q82 Q;  5TJH A;  2H89 C;  2Q9I A;  3CI9 A;  3RGU A;  1DD3 A;  3JSV C;  1HGV A;  2ITA A;  3P7K A;  2GUV A;  1PPJ G;  1SQP J;  1SQB K;  4N3Y B;  1NU1 D;  1DH3 A;  1LWU B;  2B88 A;  1LTJ C;  5KAF H;  1VQ4 P;  2KSE A;  5GTI E;  3IF4 A;  1VF5 D;  2POH A;  3Q5S A;  3L72 J;  3D6Z A;  3T97 A;  1BCC E;  1SFC B;  1N7S C;  2QVA A;  1NYH A;  5AVV B;  3O8Z A;  1GDT A;  5APU A;  1OZH A;  1J1D B;  2WSF J;  5GTI H;  1E5W A;  1SQX D;  1YJ9 P;  2P2U A;  1KIL B;  2N9Y B;  2HR3 A;  3TF5 A;  4NPD A;  3L36 A;  1SQV K;  1KOR A;  3R2P A;  1DEB A;  2A45 H;  4AQR D;  1ZV8 A;  2G3A A;  3LID A;  2HPC A;  2GM4 A;  3PP5 A;  1SQP D;  2K1A A;  4U3F G;  5L8R J;  1LTJ A;  1Y9B A;  2QE7 H;  1PIX A;  4L75 A;  1GMJ A;  3L70 D;  2R3C A;  5BVZ A;  1N7S A;  1FDO A;  1EQ7 A;  3SWK A;  1GK4 A;  2O01 H;  3H1I G;  3B8E B;  4DCK A;  1JB0 J;  1JY2 O;  2OTL P;  2R32 A;  3H1H G;  5AW1 B;  2CK3 H;  2YMY A;  4DOJ A;  2O3J A;  1MZ9 A;  1NHL A;  5H2F E;  1JNM A;  1IZN B;  4BRY A;  1ZXG A;  3V2N A;  2LKM A;  3RL0 g;  1FS0 E;  1A02 F;  2H8P D;  1G2C A;  4XA4 A;  5H2F H;  2P7J A;  5CCH D;  1OIP A;  1J1E C;  1SQB G;  1Q86 Q;  2JP3 A;  5CJ0 A;  1PPJ D;  3NMD A;  1GL2 D;  4JYB A;  2L91 A;  1OXZ A;  1GW4 A;  1SQQ D;  4L76 A;  1CSB A;  1LT1 A;  2ZXE B;  4IFM A;  4N6J A;  3C9I A;  1RH5 B;  2BCC E;  5AW0 B;  3L73 E;  1L4A B;  4QMA A;  1U57 A;  3H1I J;  1W5C E;  3GHG C;  3U1C A;  3CCL P;  3H1H J;  4WY4 C;  4KT0 J;  1EDL A;  2BAS A;  2CPS A;  3SFE C;  2KNC A;  3HUS B;  1L4A D;  2KXP B;  1CI6 B;  4L73 A;  1S5L E;  4IL6 X;  1BGY G;  3G9R A;  2FYU E;  3M91 A;  1M56 D;  3A5T A;  3WUV A;  3CC4 P;  2V7Q J;  3O6Q B;  2WTY A;  1SQB J;  1K8A Q;  3BCC G;  4U3F D;  3RK3 D;  1S5L H;  5AVY B;  1DX7 A;  1NTM E;  2D2C D;  4U7J A;  2KLU A;  4PJ0 E;  2C9L Y;  1ZRT D;  2NZ2 A;  3MUD C;  3V2Q A;  2KOG A;  1QL1 A;  3AEE C;  2FYN B;  1H8A A;  3B5N C;  2P1J A;  3AE4 C;  3CXH I;  2KB7 P;  4HKZ H;  3GHG A;  1PFI A;  3M0D A;  1Q7Y Q;  4RJT A;  3H1I D;  4WY4 A;  4HB1 A;  2ZT9 B;  5KKZ B;  1J1E B;  3E1R A;  5BU5 A;  5APQ A;  3CCS P;  4LGD E;  2KIK A;  1BCC G;  2XNX A;  4EOT A;  1FJK A;  1KV4 A;  1OW6 A;  2YO3 A;  3ABV C;  3AEB C;  2ZT9 D;  1BGY J;  4K3A A;  5AW8 B;  3D71 A;  5BU8 B;  1LGH B;  3CC2 P;  5CMZ A;  3WMM 0;  1EXJ A;  1FE6 A;  1PGJ A;  2W90 A;  2WMM A;  3L72 E;  1SQB D;  5AVR B;  1ZR4 A;  3MUD A;  3BCC J;  1FOS E;  5AVU B;  3BRV B;  3B5N A;  3H25 A;  1QVG O;  1Q2N A;  2WVR A;  2FYU K;  1PZQ A;  1FDM A;  4HJG H;  3LW5 J;  3L37 A;  3OJA B;  2OQQ A;  1OWA A;  1VQ9 P;  1KQS O;  2OTK E;  1RE4 C;  2WSF H;  1NTM K;  3NTN A;  2FBW C;  2C0X A;  1P84 D;  3VMX A;  1NAF A;  4C46 A;  1XTG B;  1JTH B;  1SQV D;  2FXM A;  1BCC J;  4ASW A;  2WQY C;  3F5H A;  1IFM A;  1CZQ A;  1N73 B;  1K9M Q;  4XE5 B;  3SFD C;  1L0N E;  2KYV A;  2ZVN B;  4BWN A;  2Z4E A;  3H6P A;  2JKV A;  2E74 C;  3P8C E;  3S9O A;  3EFG A;  1AV1 A;  1VQL P;  2YIU C;  1T2K C;  3SWF A;  4UB8 H;  3M9H A;  1L2P A;  1SQP K;  3HE5 B;  4H13 D;  4W7Z A;  5CJ4 A;  3GMA A;  1FDI A;  3L75 G;  3CL3 D;  2Z5I A;  2YKP A;  5M1B A;  3VMY A;  1KMI Z;  4ASV A;  1NO4 A;  3WUT A;  3FWN A;  2AXC A;  2ZYD A;  3TGU G;  1RE4 A;  4PD4 E;  2B87 B;  2K9J A;  1LP1 A;  1RQU A;  5AW5 B;  3CPW O;  5KTB A;  3RK2 B;  3VP8 A;  2B89 A;  3EFF K;  1H0T A;  1NH4 A;  3L73 G;  1K05 A;  4PD4 H;  1BCC D;  2NPS B;  1EDI A;  3BVH A;  4GOD A;  3AE3 C;  1N2D C;  5CHX A;  2QJK B;  2PRR A;  1EZV E;  2CPB A;  3RK2 D;  2I8D A;  2R3S A;  4TLF A;  2K9Y A;  3LIE A;  3Q5R A;  1VQN P;  3KDP B;  3NXS A;  1H88 A;  3CCR P;  2NPS D;  3B4S A;  1RF1 C;  3L75 J;  3H1H E;  3II6 A;  1LTI C;  3Q1M A;  3D70 A;  1VF5 C;  2AEM A;  5AVW B;  3TGU J;  2IBZ I;  1AVY A;  5EFW B;  1YIT P;  4EDF A;  1FZC B;  2WT7 B;  1PGQ A;  2YIU B;  1LWU C;  3CX5 I;  2IYO A;  3P8M C;  1NTZ G;  2RKL A;  1KYO I;  2IFM A;  2QA4 P;  3CCQ P;  2H7H A;  4WVZ A;  2V7Q H;  1JY3 O;  4RKU J;  1RF1 A;  3V4Q A;  1YIJ P;  1FC2 C;  4LC1 A;  1LT9 A;  1S2E A;  2N9B A;  1M1K Q;  2A06 G;  4OH8 B;  3BRT B;  5DJU B;  2OYH B;  3TK1 A;  1X0T A;  3A3Y B;  1QVF O;  1NTK J;  4OVN F;  3PLN A;  1GD2 E;  2O1K A;  3EQ2 A;  1BGY E;  1LWU A;  1S1C X;  1PP9 J;  4JBZ A;  2E5T A;  2XV5 A;  3TSI A;  5B5E H;  2BCC D;  1SFC A;  3L73 D;  1NTZ J;  2K3R A;  3WUU A;  3BCC E;  5CCG D;  2IFN A;  5E79 H;  1OW7 A;  1AFO A;  1VF5 B;  1UII A;  1KIL A;  1VQ8 P;  4DT0 A;  5CCH C;  1JY2 N;  3PRJ A;  1GL2 C;  3U59 A;  1T3J A;  4IFF A;  2FYU D;  1L0N G;  3HD7 B;  3CWB G;  2IZ0 A;  2R44 A;  4AUW A;  1NTM D;  1GU4 A;  3KYQ A;  1KQL A;  1YTZ T;  3BAT A;  3HD7 D;  1OW8 A;  3AEF C;  3VMZ A;  1VQ7 P;  5DJT B;  2XKM A;  3MP7 B;  2M0B A;  1M57 D;  1HTL C;  1L4A C;  3E1I A;  2P58 A;  2WPS A;  3GLM A;  1X22 A;  2N1T B;  4TT3 H;  5CCH A;  2ZYG A;  1OMI A;  2QJP C;  2W8Z A;  2PGD A;  3HUS C;  1HH0 A;  3RK3 C;  1EZV G;  3HE4 B;  2D2C C;  1L0N J;  1KB9 E;  2JEE A;  2N1T D;  4Y99 C;  2ZFC A;  3L72 D;  3K5B A;  1JCD A;  3CWB J;  2AEJ A;  1VQ6 P;  3RL0 B;  2J59 M;  1KB9 H;  2FFD C;  1YQ4 C;  4RES B;  3PH0 A;  4RO0 A;  3P32 A;  5KLV E;  1GL2 B;  4H44 B;  1RF0 C;  1L4A A;  2FYN C;  2OTJ P;  1FJP A;  3RL0 D;  2W6B A;  5APX A;  3L75 E;  3CLQ A;  3V2R A;  1HJB A;  2ZT9 C;  1JO5 A;  5KKZ C;  4PV1 D;  1SS1 A;  2W6A A;  2IDB A;  3S1K A;  1G1J A;  3HUS A;  4H44 D;  2LXC B;  3V6I A;  3TGU E;  1N8R Q;  2J58 A;  1YJN P;  1CI6 A;  1NJI Q;  1BSH A;  3RBZ A;  1T6A A;  2V4H A;  4YPC A;  4O9B A;  1PL5 A;  3O6Q A;  2WPV B;  4NPE A;  3TNU B;  3P8C D;  3I56 P;  3OW2 O;  3G3Z A;  3IFM A;  1IFN A;  2IBZ E;  3OA7 A;  3L74 G;  2KI7 B;  2QJP B;  4UB6 E;  3AEA C;  2J5U A;  4OGQ D;  1FAV A;  2HOD B;  1IFI A;  1M1J B;  1IC2 A;  1K04 A;  3RK3 B;  4PD4 D;  1PV3 A;  2M5A B;  2WSC J;  2D2C B;  4IFD K;  1KYO E;  4Y99 B;  1Y8A A;  2K88 A;  4BXL A;  4I6M C;  4IL6 E;  5KJ7 D;  2GUS A; 
#chains in the Genus database with same CATH homology
 4XE5 B;  1S9K E;  1SFC D;  1SFC C;  2KYV A;  2Z4E A;  2YKO A;  3H6P A;  1M1J C;  2C0W A;  1M7L A;  1H89 A;  3P8C E;  4M3L A;  4N78 D;  3EFG A;  3V4W A;  3VN0 A;  2FFD B;  1JOC A;  1J1D C;  1KFM A;  1NKZ B;  3SWF A;  1T2K C;  1T2K D;  1KFN A;  3M9H A;  3HE5 B;  1SQP K;  4W7Z A;  2QM7 A;  3A2A A;  5CJ4 A;  1KIL D;  1NKN A;  1KIL C;  2PAJ A;  3CL3 D;  1HGZ A;  2IX7 C;  2Z5I A;  2YKP A;  1N73 C;  1MFZ A;  2OYI B;  4I1L A;  3VMY A;  2L5G B;  1FZE A;  1LTB C;  1WRG A;  1ZLL A;  1NO4 A;  2C9N Y;  5AVS B;  1YYC A;  2O1J A;  1FU1 A;  1HWT C;  1RE3 A;  1RE4 A;  3H32 B;  5AW7 B;  2HFE D;  1JY2 P;  2R5D A;  3HTK A;  5AW6 B;  5AW5 B;  3TNU A;  4I2L C;  1L0L K;  2OYI C;  5KTB A;  3RK2 B;  5AVZ B;  3VP8 A;  2VRS A;  2HG5 D;  2OAR A;  1NH4 A;  1HBW A;  2E43 A;  1RF1 B;  2NPS B;  4ZKP A;  5KJ7 A;  3BVH A;  1MUU A;  1FZA A;  3M06 A;  1N2D C;  2YO2 A;  5CHX A;  2HPC B;  1LT9 B;  1IJD B;  2HOD A;  1M1J A;  1LTJ B;  2Q9I A;  1JTH A;  2CPB A;  3BAS A;  3CI9 A;  3RK2 D;  3RK2 C;  1IO4 A;  3LIE A;  3KDP B;  1HGV A;  3P7K A;  2GUV A;  3NXS A;  3UIA A;  1H88 A;  1N7S B;  1N73 A;  2NPS D;  1RF1 C;  2NPS C;  4ZKU A;  2W27 A;  1SVF A;  1LTA C;  1SQB K;  4N3Y B;  3OAK A;  1DH3 A;  1NWQ A;  5APV A;  1LWU B;  1LTJ C;  3II6 A;  1LTI C;  2Q7C A;  2FFD A;  3HE5 A;  2POH A;  3TYY A;  5AVW B;  3L4F A;  4WB4 A;  3T97 A;  1NTK K;  1N7S D;  1RF0 A;  1SFC B;  1N7S C;  2OYI A;  1SLQ A;  1CW5 A;  2H43 A;  3MTU E;  1FZC B;  5AVV B;  3O8Z A;  1GDT A;  1RY3 A;  5APU A;  1A02 J;  2WT7 B;  1J1D B;  1G1I A;  1E5W A;  1LWU C;  3H32 A;  1GW3 A;  4W80 A;  3M0D C;  2P2U A;  1G2C B;  3P8M C;  1KIL B;  1GTW A;  4HYT B;  1NTZ K;  2A45 I;  2IFM A;  4GT1 A;  3L36 A;  1SQV K;  1VPC A;  2H7H A;  2PP6 A;  4GKG A;  3R2P A;  5KLV K;  1FZC C;  1DEB A;  2A45 H;  1JY3 O;  4AQR D;  1RF1 A;  2NPS A;  3V4Q A;  1ZV8 A;  5APY A;  3LID A;  2HPC A;  4LC1 A;  2GM4 A;  3PP5 A;  1KZU B;  1LT9 A;  2N9B A;  5AW2 B;  1LTJ A;  3U1A A;  4OH8 B;  3M9B A;  3BRT B;  2R3C A;  5BVZ A;  1X8Y A;  3VTP C;  2OYH B;  2WIT A;  3TK1 A;  1N7S A;  3A3Y B;  3I5C A;  1EQ7 A;  1GK4 A;  2O01 H;  3B8E B;  1JY3 N;  1N86 A;  2O1K A;  3EQ2 A;  1JY2 O;  1LWU A;  1GD2 E;  2R32 A;  1Z56 A;  5AW1 B;  3V2P A;  2YMY A;  4DOJ A;  2XV5 A;  3TSI A;  1MZ9 A;  1NHL A;  4B86 A;  2OYH C;  1FZF A;  1IK9 A;  1SFC A;  1JNM A;  5CCG D;  3V2N A;  2LKM A;  2IFN A;  5CCG C;  1FZC A;  1FOS F;  2WT7 A;  4WBA A;  1A02 F;  2R5B A;  1AFO A;  2H8P D;  2WZ7 A;  1G2C A;  4XA4 A;  1KIL A;  2Q3I A;  2P7J A;  2MJZ A;  2QM8 A;  3L35 A;  5CCH D;  4AYC A;  1J1E C;  2A45 G;  5CCH C;  1JY2 N;  4KHX A;  1HVV A;  3HRN A;  2HLO A;  5CJ0 A;  3A7O A;  2WPQ A;  3NMD A;  1GL2 D;  1GL2 C;  4JYB A;  3U59 A;  1T3J A;  1IFD A;  3GHG B;  1OXZ A;  4IFF A;  5APS A;  3VOP A;  3HD7 B;  1L0N K;  4WY4 B;  2M3B A;  1GW4 A;  1CSB A;  1NU1 K;  1X79 B;  2ZXE B;  3MGN A;  4IFM A;  1VDF A;  3SWY A;  1URQ B;  4N6J A;  3C9I A;  3MD0 A;  4C7N B;  5AW0 B;  4AUW A;  1L4A B;  3NFQ A;  1GU4 A;  5AW9 B;  3KYQ A;  1LTT C;  1KQL A;  5APW A;  3GHG C;  1JMM A;  3U1C A;  1YTZ T;  4JYC A;  3BAT A;  1FZB A;  2OYH A;  3HD7 D;  3HD7 C;  4WY4 D;  1T3U A;  4WY4 C;  3V5B A;  2KP8 A;  2WSC H;  2YNY A;  3VMZ A;  2BAS A;  2CPS A;  4C7R A;  2XKM A;  4JF7 A;  1URQ D;  4LLH A;  1SQX K;  1URQ C;  2JJL A;  3HUS B;  2XDJ A;  1HTL C;  1L4A D;  3N4X A;  1L4A C;  5AW4 B;  1CI6 B;  3E1I A;  2WPR A;  2WPS A;  1GU5 A;  2N1T B;  5CCH A;  3M91 A;  3A5T A;  3B5N B;  1XTC C;  2WTY A;  2IPP A;  1NOH A;  4W7Y A;  3HUS C;  1HH0 A;  3RK3 D;  5AVY B;  3RK3 C;  1DX7 A;  3KPE A;  1QL2 A;  3HE4 B;  2FYZ A;  2C9L Y;  2JEE A;  2N1T D;  4Y99 C;  2ZFC A;  2N1T C;  3IR9 A;  1T8Z A;  5AW3 B;  3V2Q A;  2KOG A;  1QL1 A;  4HH2 A;  3B5N D;  1H8A A;  3B5N C;  1ZN5 A;  2P1J A;  1JCD A;  1LTG C;  2KB7 P;  3GHG A;  3RL0 B;  1PFI A;  3M0D A;  3HD7 A;  4GIF A;  4WY4 A;  1JUN A;  2KSJ A;  2J59 M;  3VYI A;  1FZG A;  2FFD C;  4RES B;  1J1E B;  5BU5 A;  5APQ A;  2I1J A;  2YKQ A;  4LGD E;  3P32 A;  1URQ A;  1GL2 B;  4C7N A;  1RF0 C;  1L4A A;  1YTZ I;  2XNX A;  4EOT A;  2HYN A;  1FJK A;  3M9Q A;  2YO3 A;  1FJP A;  3RL0 D;  2W6B A;  3RL0 C;  5APX A;  2WWW A;  3CLQ A;  3V2R A;  1HJB A;  1JO5 A;  1JCC A;  4N78 E;  1GK6 A;  2FKW B;  5AW8 B;  5BU8 B;  2W6A A;  2M8R A;  1G1J A;  1LGH B;  2WSE H;  5CMZ A;  3WMM 0;  5AVQ B;  1MV8 A;  3HUS A;  1J2J B;  2Q5U A;  1SP4 A;  2J58 A;  1CI6 A;  5AVR B;  1ZR4 A;  3VP9 A;  3MUD A;  1FOS E;  2N1T A;  3LW5 H;  2XZR A;  1LTS C;  4O9B A;  5AVU B;  1S9K D;  3BRV B;  3B5N A;  3HTK B;  3KQG A;  2FYU K;  1FDM A;  3TNU B;  1HUC A;  3P8C D;  1LT9 C;  3L37 A;  1SQQ K;  3OJA B;  1OWA A;  4EIJ A;  3G3Z A;  3HE4 A;  1GZL A;  3IFM A;  1FBM A;  1IFN A;  2E42 A;  2XU6 A;  4DZO A;  3OA7 A;  5AVX B;  1IFJ A;  1RE3 C;  1RE4 C;  2WSF H;  3M0A A;  1X9V A;  1ZR2 A;  1NTM K;  1FAV A;  5CCG A;  2Z5H A;  3NTN A;  2C0X A;  2HOD B;  3VMX A;  2I1K A;  2KLV A;  1IFI A;  1M1J B;  1NAF A;  1IC2 A;  4C46 A;  1XTG B;  1JTH B;  3RK3 B;  2P67 A;  2FXM A;  5APT A;  1N7L A;  1WT6 A;  4IFD K;  1W2E A;  4Y99 B;  3MIW A;  1IFM A;  1AQ5 A;  3N7N A;  1CZQ A;  1N73 B;  4I6M C;  5KJ7 D;  5KJ7 C;  2GUS A;  5AVT B;  1JY3 P;  1GL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...