4W7ZA

Tetrameric bap29 vded without disulfide bonds
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
64
structure length
64
Chain Sequence
b'SMDEECVLEAENKKLVEDQEKLKTELRKTSDALSKAQNDVMEMKMQSERLSKEYDQLLKEHSEL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords B-cell receptor-associated protein 29
publication title A disulfide polymerized protein crystal.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transport protein
total genus 28
structure length 64
sequence length 64
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-08-22
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4w7zA00
2N1TC 5CCGA 3HD7B 3HD7D 4N78E 5KJ7A 2WZ7A 2N1TD 5CCGC 3B5NB 3B5ND 1KILA 4W7YA 2M8RA 2N1TA 2PP6A 3RK3B 1HVVA 2HFED 5KJ7C 2KOGA 2XDJA 1T3JA 3PP5A 5CCGD 4JF7A 3RK2C 2H8PD 4LGDE 1KILC 3M0DC 4W7ZA 5KJ7D 2YMYA 3RK2D 1L4AC 1KILB 1N7SA 1KILD 2N1TB 1URQA 3P8CE 5CCHA 4W80A 3TSIA 1XTGB 3RL0C 2HG5D 1N7SC 1L4AD 1JTHA 1URQC 4WY4C 5CCHC 1L4AA 4OH8B 3RL0B 1N7SB 3RL0D 1N7SD 1URQB 1URQD 2NPSA 3HTKB 4WY4D 3RK2B 5CCHD 1GL2A 3KYQA 4WY4A 1JTHB 1SFCA 2NPSC 1L4AB 1GL2C 3B5NC 1SFCC 2NPSB 2NPSD 3RK3C 3HD7A 1GL2B 1GL2D 4WY4B 1SFCB 1SFCD 3RK3D 3HD7C 3B5NA 1NHLA 3VOPA
chains in the Genus database with same CATH superfamily
2ZJSE 4B86A 3BASA 2BCCD 1ZXGA 3V2NA 2OTKE 1G1JA 3D6ZA 2WZ7A 1LT9B 3EWKA 4NPEA 1QLED 1BSHA 3TF5A 1W5CE 1J1EC 1IFJA 3BCCJ 4W7YA 5CBOA 1VDFA 2R3CA 5APWA 4LC1A 1T6AA 2G3AA 3CLQA 5AW4B 3M0DC 3WUUA 3B4SA 3VP8A 2YMYA 1RF0A 5AW6B 2YXRB 2FXMA 3O6QA 4XE5B 3CX5E 3V2QA 3R2PA 5KLIC 5KLVJ 1NGMB 1FE6A 1H88A 4U7JA 3HUSA 2K1AA 2JR8A 2LXCB 1M1JA 2AEFA 4OGQB 1KYOE 3OW2O 1CI6B 3VMZA 1K05A 2O01J 1NU1J 2NPSB 2HPCA 3FX0A 3HE5B 4A7PA 4KT0J 2AXTH 3GG2A 5B66H 1JMMA 3A7OA 2HODB 1JEKA 3WU2H 4EDFA 1LTGC 1HTLC 1QX8A 4H13D 2ZXEB 1N86A 1OWAA 1DIPA 1FZCA 2QSIA 1Y8AA 3A2AA 1PL5A 2PAJA 3CCRP 5BVZA 3SFEC 2IZ1A 1LTJA 3L73D 4C7NB 4H0LB 1RH5B 1VQMP 1YITP 2KOGA 3NMDA 5CCGD 4XA4A 1IFIA 3H1LE 2OYIB 1YJWP 2Q3IA 1OW8A 4JYCA 1GMJA 1IJDB 1NO4A 1ZRTE 2IYPA 3BRVB 4HKZH 4YXDC 5CBNA 1PPJG 1FU1A 2AEMA 2FXPA 3OA7A 2RN0A 3AEDC 3MHVA 2KK7A 3RL0B 3ITKA 1NJIQ 1FZGA 1X79B 3H32B 2Z5HA 3AE2C 3CCJP 1M1KQ 1N73A 2K88A 3U59A 5AW0B 2QJYC 2IFNA 1PP9J 3HUSC 4YXWH 1NTKG 1M1JC 2XKMA 2W6AA 2I1JA 4DCKA 1S9KE 1SS1A 2CK3H 2YIUB 1QVFO 1RQUA 2JWDA 4ASWA 1QEXA 1BDDA 2A45H 1K9MQ 3H1JG 4K35A 2QJKC 4TLFA 1S5LE 1MV8A 2KYVA 2WSCJ 3B71A 5APQA 1SQXK 2L91A 2OYHA 1FZCC 2E74C 3WUTA 3CMEP 1JY3N 4U3FG 3RK2C 1LTJC 2A45I 1LWUA 2O01H 3L75J 1N7SA 3AEFC 1KILE 4PD4D 3L4FA 1SQQK 2KI7B 1LTAC 4KHXA 1NOHA 5TISH 1SQBJ 3H25A 1MUUA 2JWAA 4WY4C 3D6YA 1JY2N 3VYIA 1ZW0A 2RKLA 2W6BA 5K5GB 2M5AB 4IL6E 3S9OA 3RK2B 2PRRA 4PD4E 1DEBA 2QM8A 1L2PA 1AVYA 1HF9A 1L0NG 1FBMA 1QGKB 2QRXA 1VQOP 3P8MC 1Q2NA 4WB4A 2H7HA 2P1JA 4WY4B 1OFCX 3VN0A 1M90Q 2KLVA 1BGYE 1EDKA 4JQ0D 1M56D 1GW4A 1FDMA 3P32A 1IC2A 1R5SA 2D2CD 1KMIZ 2UWJE 4L74A 3TGUJ 1K8AQ 2XZRA 2PGDA 1AQTA 1PPJD 1AA0A 2E43A 3N7NA 1D7MA 1RF1B 1T3JA 4Y99C 1ZP0C 1KB9H 4N6JA 3W68A 1FZEA 4LGDE 2QEXP 2G8YA 4D6TE 3KDPB 4ZKPA 1VQKP 1JUNA 1H89A 3BATA 1LWUC 1VPCA 1ZV8A 2ZT9D 1NTZJ 1RE3A 1KQSO 3VP9A 1KB9I 1N7SC 1NTKD 2FYUJ 2E42A 1EZVI 1L4AA 3AE3C 3IN6A 1SQPE 2WSFJ 1J1DC 1KN7A 2WSCH 2KZIA 2E75D 2V7QJ 1ZMEC 1SFCA 1JO5A 3FWNA 1M8OB 3H1JD 1NTKE 3AE8C 5CMZA 1VF5D 1NAFA 1SQPK 1Q7YQ 2YKQA 2J59M 1LT9A 2JEEA 4U3FD 4IFFA 3GHGC 3L71J 1UIXA 3CC4P 1J1DB 1LJ2A 3VOPA 3USSA 1VQNP 2XU6A 1NTMK 3HD7D 1HJBA 4NPFX 1IFDA 2Q5UA 2K3RA 1IZNB 1KTMA 1G2CB 2M3EA 1T2KC 4U3FE 1JB0J 1JM0A 3CXHD 1IO4A 3Q5RA 1H0TB 3CMAP 3H6PA 2DW3A 3GHGB 3H1IJ 1BCCJ 1S5LX 1VQ8P 3G6EP 1FDIA 2Q9IA 2K9JB 1PGJA 3P8CE 1L0ND 2QJPC 4I7ZC 3ABVC 3CC7P 1OW6A 4DT0A 5DJUB 3E1IA 1LTTC 5H2FH 3H1LG 1RE3C 5B66E 1NKZB 1CI6A 3AE5C 1BDCA 2NPSA 3WU2E 3HE5A 2IX7C 1L0LE 3A0BE 1QVGO 3CWBE 1OIPA 4O9BA 2HODA 3R4YA 1KFMA 5AVVB 1VQ4P 2MKVA 2O1KA 3VTPC 1SFCC 3VMXA 4PV1D 1S2EA 2OQQA 4IL6X 3KHUA 3M91A 3RK3D 3LIDA 1L0LK 3AEEC 4C7NA 3Q3DA 3V6IA 5AW9B 1LT9C 3L72J 2D2CB 2OYIA 1KD1Q 1YQ3C 2WSFH 1N7LA 4N78E 3CD6P 5KJ7A 1Q90D 2IDBA 4HYTB 3GW6A 1SQXG 2V7QH 2ZYGA 3H1HE 1USDA 1EQ7A 3RBXA 3RK3E 3V5BA 4Z1MH 3L70G 4DOJA 4H44D 1BE3G 2H43A 2B87B 1SQQG 1FZBA 3H32A 3CX5D 1P84D 3TNUB 3E1RA 1Q86Q 1NAYA 4ZNCA 4OGQC 1DD4A 2E75B 1AJYA 2E76D 1JTHB 1HUCA 2NPSC 1P84E 5KLVE 1YI2P 1SQVJ 2Y9YA 1KYOD 2IFMA 3PLNA 3K5BA 1KQFB 5KKZB 1GL2D 1VF5B 2BCCJ 2OGUA 3AE7C 1W2BO 3IF4A 3KZIH 1NU1E 1GK6A 2Q1KA 3TK1A 1AVOA 2N1TC 5KLVK 2IYOA 5APXA 3HD7B 2WSEJ 1HWTC 4H0LC 5EFWB 4JYBA 1VL2A 3M06A 5AVYB 4EOTA 5AVTB 2OYIC 1UIIA 5AW1B 1HJ0A 1JNMA 5KJ7C 1BGYG 1VQ6P 3EFFK 3H1LD 3HE4B 1NU1K 3CXHH 1GU5A 1LNQA 1ZLLA 2M5AA 1ZRTD 5TJHA 2N1TB 2WPSA 2KS1B 3CCSP 1ZR4A 3RL0C 2OTLP 2K9YA 1G1IA 1S1CX 3F5HA 3CXHI 3E7KA 1SP4A 3TYYA 2Y0EA 4D6TG 2LKMA 2P7JA 5AW3B 3A3YB 1OVVA 5APVA 3I56P 3CCQP 3W67A 5CCHD 3D71A 4IFDK 2H88C 4WY4A 1KQLA 4M3LA 3TDKA 2HYNA 4PJ0H 2YIUC 3CCVP 1S9KD 1GU4A 4PV1B 1SQXD 1SQPG 2FFDB 2IBZE 4BXLA 1PP9E 5KAFH 2QA4P 3AEGC 4QMAA 3I5CA 1JOCA 1YJNP 1VQPP 2ZVOB 1NHLA 3KPEA 1NH4A 3L73J 1RF1A 1NTMG 3V4WA 2Q6QA 2NZ2A 5CCGA 4ZMDA 4R4MA 2QIWA 5AW5B 1SQQD 1SQXE 5E79E 2XNDH 3L71G 2Z5IA 1CSBA 4HJGH 4GDOA 2C0WA 3WMM0 3L74G 2XDJA 3SFDC 5GTIE 3I55P 1VQ7P 3L70E 4LLHA 2WTYA 4H44B 3A0HE 3HRNA 3H1KG 1BE3E 1KILD 1SQQE 2FYZA 2A06E 5AW8B 3L75E 1PFIA 3MUDA 3EQ2A 2WSEH 1URQD 2ZXXA 1T3UA 3HTKB 2QG4A 3GMAA 1CW5A 2JKVA 2KSEA 3CX5I 1J2JB 1A02J 2WT7B 3OJAB 1GD2E 2KB7P 1LP1B 3AEBC 2WPVB 4AYCA 1GL2B 3S1KA 4UB8H 3T97B 1PZQA 3AE1C 4H13C 1MZ9A 1BGYD 1L0LG 2OTJP 1AFOA 2E5YA 1SQBK 3CWBG 4RO0A 1M7LA 4NPDA 4UB6H 1G2CA 3MD0A 3SWFA 1YTZI 3PJSK 1RHZB 3IFMA 1KYOI 3CCUP 1H0TA 5GTHE 1Y47A 1FC2C 5B5EH 3M9HA 3V4QA 1RF1C 3GHGA 5CCGC 3U1CA 1PV3A 2M8RA 5BU8B 2K9JA 1E79H 5AVZB 2BASA 3P7KA 1KQGB 2WSSH 4H13B 3QH9A 4D6TD 3AE4C 5BU5A 5APSA 3U1AA 2QM7A 4R4LA 2KSJA 4K3AA 5APUA 3H1HG 2RH0A 3C8VA 1L4AD 3JSVC 1U7JA 4EIJA 1NTZE 1SQPD 1RY3A 2AEJA 2R5BA 3O8ZA 1GK4A 3BCCG 1AV1A 3MUDC 5KTBA 2FYUE 2FKWB 3RBZA 2B9BA 1HH0A 1NTZK 1DH3A 1YQ4C 4WBAA 1HGVA 2W83C 1USEA 1SQVG 3PHLA 2A45G 2FYUK 5KLVG 3AE6C 4BWNA 1NTME 3H1KD 3CPWO 2JO1A 1GTWA 4JBZA 1X22A 3IR9A 3L71E 3B5ND 3MIWA 2B87A 2PP6A 1HVVA 3L74E 3TNUA 3PP5A 2H8PD 3FXEA 1NU1G 2O1JA 4DZOA 4RKUJ 2O3JA 2YKPA 1NTKJ 3H1KE 1M57D 2R3SA 1IK9A 2M0BA 1KILB 3P8CD 2L5GB 2E5TA 2M3BA 1JTHA 4GOFA 3H1IE 1BCCE 2XV5A 1H8AA 2R5DA 5M1BA 3FGAD 3H1JJ 1URQB 3BVHA 3KZIE 1L0LD 3CWBD 4IL6H 2YO2A 3UIAA 2WITA 4PD4H 3CCEP 2IPPA 4U3FJ 1N8RQ 1ZOYC 3MGNA 2AXTE 3QWOC 3VMYA 3AEAC 3HD7A 2ZFCA 1PIXA 2D2CC 4PD4I 2Y9ZA 4GOEA 4EI2A 1IK7A 2KIKA 2W6JH 2GA1A 2FYNB 3HE4A 1X8YA 2B88A 4N78D 3H1HD 2V4HA 1WMKA 2IBZG 1PP9G 1KV4A 4GIFA 2N1TA 3L72E 2Y0CA 2KS1A 2JDIH 1L0NJ 1EZVG 2ZT9C 2GUVA 2P58A 1JCDA 2N9YB 3CCMP 3G3ZA 1Y9BA 5CHXA 3BCCD 4C7RA 3AE9C 2P10A 1FDOA 1KZUB 4PJ0E 3NXSA 3F89A 2KNCB 3TSIA 2WPQA 2E75C 3MZWB 4L73A 5KAFE 1OVRA 2RMZA 3BCCE 1LTBC 2ZT9B 2B89A 1NYHA 2FFDA 4ZKUA 5KLVD 3BRTB 1HGZA 2C9NY 2WMMA 3L35A 2A06G 5KKZC 1VF5C 3L75G 3B5NC 5AVQB 1EXJA 2GUSA 4BRYB 2KLUA 5C39A 1SQVE 4GKGA 1YYCA 1SQBG 1K04A 3HD7C 1WT6A 1SVFA 2BEZF 1NU1D 5KAIH 2W90A 3IAOA 2BCCE 1IFNA 1VQ9P 2QVAA 3C9IA 3SWYA 3B5NB 2WQYC 2I8DA 1SQVK 1X0TA 2FY8A 4CPGA 4JF7A 1NWQA 1J1EB 1QL2A 2MJZA 3GF3A 2E74D 3RK2D 4I2LC 3Q5PA 1LT1A 5TISE 3HTKA 3CC2P 1EXIA 3SWKA 1EDLA 2ZYAA 5DJTB 2P2UA 1OZHA 2FXOA 1T8ZA 2WT7A 4UB8E 3TGUG 1VQ5P 2KUBA 1W2EA 1LP1A 4WY4D 5KLIB 1R5LA 2BEQD 1GL2A 4UB6E 3KYQA 3T97A 4HH2A 3G4SP 3C1LA 3A0BH 4PV1C 3Q1MA 1S4XA 3GF7A 2FFDC 5AVSB 3KQGA 5B5EE 2C9LY 4OVNF 4YTPC 2AXCA 3L37A 1CZQA 3RK3C 2LXBA 1NTZG 2KP8A 4RESB 1U7MA 2IBZD 1PP9D 1KB9D 2C0XA 2Y0DA 1MKMA 1Q82Q 2FYUG 1EZVD 1IFPA 1QL1A 3AECC 4L76A 3JCUH 3H1LJ 5AVUB 4XFJA 3SSUA 1JY3P 3L73E 1GZLA 1KB9E 4H44C 1RF0C 3V2PA 3RK3B 1EZVE 3L70D 5APYA 2J58A 3GLMA 4I6MC 4W7ZA 1BE3D 1LGHB 5CCHA 4W80A 5AW7B 4L75A 2VRSA 1JY2P 2A06D 2HG5D 3A5TA 3L75D 1YJ9P 4AQRD 1VQLP 2E76C 3NFQA 1N7SD 1WRGA 2JJLA 3O6QB 1MFZA 1SQBD 1SQXJ 2ZYDA 3PH0A 2N9BA 2R44A 1GL2C 3PRJA 3CX5H 1P84H 3H1IG 2QJYB 1BCCG 1EC5A 1OX3A 2HLOA 3HUSB 3L70J 1DX7A 3OAKA 3RL0g 3EFGA 1BE3J 4RJTA 1M1JB 1EDJA 2E76B 1SQBE 3G9RA 1SQQJ 5L8RJ 3KXDA 3NTNA 4EYYQ 1FJPA 1P84I 2ZAEB 2HPCB 1R8EA 2YKOA 1TU3F 1JMBA 3V2RA 3G71P 2XNXA 1KYOH 1NVOA 1N2DC 2O01N 1KILA 2QJKB 3LW5J 2WWWA 1KFNA 4WWIA 1PGOA 1FZCB 3TGUD 2E74B 5AW2B 1T2KD 3CI9A 1IFMA 2YNYA 1S72P 1LTJB 2ZVNB 1URQA 1Z56A 2FBWC 4N3YB 4TT3H 3II6A 5H2FE 1N73C 3L72G 2Q3EA 1S3JA 5AVWB 5CCHC 1A02F 1NTZD 3TGUE 2K37A 1GDTA 3Q2YA 1FZFA 1ZN5A 2FYUD 1EDIA 1RQVA 2Q7CA 3FXDA 1YIJP 1K73Q 3JC22 1BGYJ 1PGPA 2YO3A 2CPSA 3RGUA 4Y28J 2JP3A 1N73B 1YBKA 3M0AA 4GT1A 1RE4A 3B8EB 4JPZB 1SFCD 3Q5SA 2OYHC 1OMIA 1NTMD 1X9VA 1ZR2A 2W8ZA 4D6TJ 2CPBA 3L71D 2IBZI 3CL3D 5E79H 1LTIC 1PPJE 3L74D 1U57A 3LIEA 2KNCA 4IOIH 2KZJA 3M9BA 4KJMA 1KILC 2HR3A 5GTIH 1E5WA 2BCCG 2ITAA 1LTSC 2WVRA 4Y99B 3VMAA 1KC8Q 2OYHB 3A0HH 3D70A 1JY3O 2SPZA 1SQPJ 1S5LH 1FZAA 2H89C 1LWUB 1URQC 3H1ID 3WUVA 1BCCD 3M9QA 4OH8B 2OYOA 1NTMJ 1N7SB 4WVZA 1YTZT 2IZ0A 2YXQB 4BRYA 5KAIE 1JY2O 3LW5H 3N4XA 4OGQD 1MFTA 4HB1A 3L74J 3H1JE 1NTKK 1OVUA 3L36A 1HBWA 2NPSD 2LR2A 2PFXA 1KORA 2WPRA 3H1KJ 2Z4EA 2YMKA 1XTCC 2POHA 3CCLP 3ZDMA 2FYNC 3B5NA 1FJKA 1RE4C 3FWLA 2OARA 1FS0E 1NKNA 1Q81Q 2P67A 2J5UA 5CJ4A 1DEEG 2N1TD 1SLQA 5GTHH 4C46A 2R32A 1FAVA 2I1KA 1JCCA 2QE7H 1FOSE 4H0LD 3M0DA 1PGQA 3L72D 2HFED 4YPCA 3CXHE 1DD3A 4OWFA 4IFMA 5KJ7D 2NRGA 1AQ5A 1L4AC 1L0NE 4MN4C 1OXZA 1OW7A 1XTGB 3L73G 1L0LJ 5CJ0A 5AVXB 3CWBJ 2QJPB 4I7ZB 4ASVA 2KXPB 3RL0D 4DJGA 3MP7B 1YHQP 4AUWA 1BSNA 4I1LA 2GM4A 5APTA 1L0NK 1L4AB 3JCUE 3PTZA 1FOSF 5AVRB 2W27A 1SFCB 3S4RA 1SQVD 3MTUE 4GODA 1GW3A 3H1HJ
chains in the Genus database with same CATH topology
3SWFA 1YTZI 4B86A 3BASA 3IFMA 2XU6A 1NTMK 3HD7D 1HJBA 3V2NA 1G1JA 3M9HA 5AVUB 3V4QA 1IFDA 1RF1C 3GHGA 2WZ7A 1LT9B 5CCGC 3U1CA 2Q5UA 1JY3P 1J1EC 1IFJA 4W7YA 1GZLA 2M8RA 1RF0C 3V2PA 1G2CB 5BU8B 3RK3B 1T2KC 5AVZB 1VDFA 2R3CA 5APWA 2BASA 1IO4A 3P7KA 4LC1A 3CLQA 5APYA 5AW4B 2J58A 3M0DC 4I6MC 4W7ZA 5BU5A 3H6PA 3VP8A 3GHGB 1LGHB 5APSA 2YMYA 3U1AA 1RF0A 5AW6B 2QM7A 2KSJA 2Q9IA 3P8CE 2FXMA 5APUA 5CCHA 4W80A 4XE5B 5AW7B 3V2QA 2VRSA 1JY2P 2HG5D 3A5TA 3R2PA 1L4AD 3E1IA 1LTTC 4AQRD 1RE3C 4EIJA 1NKZB 1CI6A 3NFQA 1N7SD 1RY3A 1WRGA 2JJLA 2R5BA 3O8ZA 2NPSA 1GK4A 1H88A 3HE5A 3HUSA 1MFZA 5KTBA 2IX7C 1M1JA 4O9BA 2HODA 2FKWB 2N9BA 1KFMA 1GL2C 5AVVB 1CI6B 3VMZA 2O1KA 3VTPC 1SFCC 2NPSB 2HPCA 2HLOA 3HE5B 3HUSB 3VMXA 1DX7A 1HH0A 3OAKA 1NTZK 3M91A 3EFGA 1DH3A 1JMMA 1M1JB 3A7OA 2HODB 4WBAA 1HGVA 3RK3D 3LIDA 1LTGC 1HTLC 1L0LK 3NTNA 2A45G 2FYUK 4C7NA 1FJPA 5AW9B 2HPCB 1LT9C 2ZXEB 2YKOA 1N86A 1OWAA 3V2RA 2OYIA 1FZCA 2XNXA 3A2AA 2WSFH 1GTWA 1N7LA 2PAJA 4N78E 1N2DC 5BVZA 5KJ7A 4HYTB 3IR9A 3B5ND 3MIWA 1LTJA 1KILA 4C7NB 2PP6A 1EQ7A 1HVVA 2WWWA 2KOGA 3NMDA 3V5BA 1KFNA 3TNUA 3PP5A 5CCGD 4XA4A 2H8PD 1IFIA 2OYIB 2O1JA 1FZCB 4DZOA 2Q3IA 4DOJA 5AW2B 1T2KD 3CI9A 1IFMA 2YKPA 2YNYA 4JYCA 1IJDB 2H43A 1LTJB 1IK9A 1NO4A 1KILB 3P8CD 1URQA 2L5GB 3BRVB 1FZBA 1Z56A 4N3YB 3H32A 3II6A 3TNUB 1FU1A 2M3BA 1N73C 1JTHA 3OA7A 5AVWB 5CCHC 2XV5A 1H8AA 1A02F 2R5DA 3RL0B 1GDTA 1URQB 1FZGA 1X79B 3BVHA 3H32B 2Z5HA 1N73A 1FZFA 1ZN5A 3U59A 5AW0B 2YO2A 1JTHB 1HUCA 2NPSC 2IFNA 2Q7CA 3UIAA 2WITA 3HUSC 2IPPA 2IFMA 1M1JC 2XKMA 2W6AA 2I1JA 2YO3A 2CPSA 3MGNA 1S9KE 3VMYA 3HD7A 1N73B 1GL2D 3M0AA 4GT1A 1RE4A 3B8EB 2ZFCA 1SFCD 1GK6A 2OYHC 3TK1A 5KLVK 2N1TC 2A45H 5APXA 3HD7B 3HE4A 1X8YA 1X9VA 1HWTC 1ZR2A 4JYBA 4N78D 1MV8A 3M06A 2CPBA 2KYVA 5AVYB 4EOTA 5APQA 1SQXK 5AVTB 2OYHA 2OYIC 1FZCC 3CL3D 1LTIC 4GIFA 2N1TA 5AW1B 1JNMA 5KJ7C 1JY3N 3LIEA 3M9BA 3RK2C 1LTJC 2A45I 1LWUA 2GUVA 3HE4B 1JCDA 1KILC 1NU1K 3G3ZA 2O01H 1GU5A 1E5WA 5CHXA 1LTSC 4Y99B 1ZLLA 2OYHB 4C7RA 1N7SA 1JY3O 2N1TB 2WPSA 1KZUB 3L4FA 3NXSA 1SQQK 1FZAA 1LTAC 4KHXA 3TSIA 1ZR4A 1NOHA 1LWUB 3RL0C 1URQC 2WPQA 1MUUA 4WY4C 1G1IA 1JY2N 3VYIA 1SP4A 3TYYA 3M9QA 4OH8B 2W6BA 2LKMA 2P7JA 5AW3B 1N7SB 3A3YB 5APVA 1YTZT 3RK2B 1LTBC 5CCHD 4IFDK 2FFDA 1DEBA 2QM8A 4WY4A 1JY2O 1KQLA 4ZKUA 4M3LA 1FBMA 3LW5H 3BRTB 2HYNA 1HGZA 2C9NY 3N4XA 3L35A 3P8MC 3B5NC 5AVQB 1NTKK 3L36A 1HBWA 4WB4A 2NPSD 1S9KD 2GUSA 2H7HA 1GU4A 2FFDB 2P1JA 2WPRA 4WY4B 2Z4EA 1XTCC 2POHA 1YYCA 3I5CA 4GKGA 3VN0A 2KLVA 3HD7C 1JOCA 1WT6A 3B5NA 1SVFA 1FJKA 1RE4C 1NHLA 2OARA 3KPEA 1GW4A 1NH4A 1FDMA 3P32A 1IC2A 1RF1A 1NKNA 3V4WA 5CCGA 2P67A 1IFNA 5CJ4A 3C9IA 5AW5B 2N1TD 2XZRA 1SLQA 3SWYA 3B5NB 4C46A 2R32A 2Z5IA 1FAVA 2I1KA 1CSBA 2E43A 1JCCA 1FOSE 3N7NA 3M0DA 2C0WA 2HFED 1SQVK 3WMM0 1RF1B 2XDJA 1T3JA 4Y99C 4JF7A 4N6JA 1FZEA 1NWQA 4LGDE 1J1EB 1QL2A 2MJZA 4LLHA 2WTYA 4IFMA 3KDPB 5KJ7D 3HRNA 4ZKPA 1JUNA 1H89A 3BATA 1LWUC 1VPCA 1AQ5A 1ZV8A 3RK2D 4I2LC 1L4AC 1KILD 3HTKA 1OXZA 1RE3A 3VP9A 1XTGB 2FYZA 2P2UA 1N7SC 5AW8B 5CJ0A 5AVXB 2E42A 1PFIA 1T8ZA 1L4AA 3MUDA 3EQ2A 2WT7A 2WSEH 3RL0D 1URQD 1T3UA 1W2EA 1J1DC 3HTKB 4WY4D 2WSCH 1GL2A 4AUWA 3KYQA 4I1LA 3T97A 1SFCA 4HH2A 1CW5A 2GM4A 5APTA 1L0NK 1JO5A 1L4AB 1J2JB 2FFDC 2WT7B 1A02J 3OJAB 5AVSB 3KQGA 2C9LY 1GD2E 2KB7P 1FOSF 5AVRB 3L37A 1CZQA 3RK3C 2KP8A 4AYCA 2W27A 5CMZA 1GL2B 4RESB 1NAFA 1SQPK 1SFCB 2YKQA 2J59M 3MTUE 2C0XA 1MZ9A 1LT9A 2JEEA 4IFFA 1AFOA 3GHGC 1SQBK 1GW3A 1J1DB 1M7LA 1QL1A 1G2CA 3MD0A 3VOPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1T C;  5CCG A;  3HD7 B;  3HD7 D;  4N78 E;  5KJ7 A;  2WZ7 A;  2N1T D;  5CCG C;  3B5N B;  3B5N D;  1KIL A;  4W7Y A;  2M8R A;  2N1T A;  2PP6 A;  3RK3 B;  1HVV A;  2HFE D;  5KJ7 C;  2KOG A;  2XDJ A;  1T3J A;  3PP5 A;  5CCG D;  4JF7 A;  3RK2 C;  2H8P D;  4LGD E;  1KIL C;  3M0D C;  4W7Z A;  5KJ7 D;  2YMY A;  3RK2 D;  1L4A C;  1KIL B;  1N7S A;  1KIL D;  2N1T B;  1URQ A;  3P8C E;  5CCH A;  4W80 A;  3TSI A;  1XTG B;  3RL0 C;  2HG5 D;  1N7S C;  1L4A D;  1JTH A;  1URQ C;  4WY4 C;  5CCH C;  1L4A A;  4OH8 B;  3RL0 B;  1N7S B;  3RL0 D;  1N7S D;  1URQ B;  1URQ D;  2NPS A;  3HTK B;  4WY4 D;  3RK2 B;  5CCH D;  1GL2 A;  3KYQ A;  4WY4 A;  1JTH B;  1SFC A;  2NPS C;  1L4A B;  1GL2 C;  3B5N C;  1SFC C;  2NPS B;  2NPS D;  3RK3 C;  3HD7 A;  1GL2 B;  1GL2 D;  4WY4 B;  1SFC B;  1SFC D;  3RK3 D;  3HD7 C;  3B5N A;  1NHL A;  3VOP A; 
#chains in the Genus database with same CATH topology
 2ZJS E;  4B86 A;  3BAS A;  2BCC D;  1ZXG A;  3V2N A;  2OTK E;  1G1J A;  3D6Z A;  2WZ7 A;  1LT9 B;  3EWK A;  4NPE A;  1QLE D;  1BSH A;  3TF5 A;  1W5C E;  1J1E C;  1IFJ A;  3BCC J;  4W7Y A;  5CBO A;  1VDF A;  2R3C A;  5APW A;  4LC1 A;  1T6A A;  2G3A A;  3CLQ A;  5AW4 B;  3M0D C;  3WUU A;  3B4S A;  3VP8 A;  2YMY A;  1RF0 A;  5AW6 B;  2YXR B;  2FXM A;  3O6Q A;  4XE5 B;  3CX5 E;  3V2Q A;  3R2P A;  5KLI C;  5KLV J;  1NGM B;  1FE6 A;  1H88 A;  4U7J A;  3HUS A;  2K1A A;  2JR8 A;  2LXC B;  1M1J A;  2AEF A;  4OGQ B;  1KYO E;  3OW2 O;  1CI6 B;  3VMZ A;  1K05 A;  2O01 J;  1NU1 J;  2NPS B;  2HPC A;  3FX0 A;  3HE5 B;  4A7P A;  4KT0 J;  2AXT H;  3GG2 A;  5B66 H;  1JMM A;  3A7O A;  2HOD B;  1JEK A;  3WU2 H;  4EDF A;  1LTG C;  1HTL C;  1QX8 A;  4H13 D;  2ZXE B;  1N86 A;  1OWA A;  1DIP A;  1FZC A;  2QSI A;  1Y8A A;  3A2A A;  1PL5 A;  2PAJ A;  3CCR P;  5BVZ A;  3SFE C;  2IZ1 A;  1LTJ A;  3L73 D;  4C7N B;  4H0L B;  1RH5 B;  1VQM P;  1YIT P;  2KOG A;  3NMD A;  5CCG D;  4XA4 A;  1IFI A;  3H1L E;  2OYI B;  1YJW P;  2Q3I A;  1OW8 A;  4JYC A;  1GMJ A;  1IJD B;  1NO4 A;  1ZRT E;  2IYP A;  3BRV B;  4HKZ H;  4YXD C;  5CBN A;  1PPJ G;  1FU1 A;  2AEM A;  2FXP A;  3OA7 A;  2RN0 A;  3AED C;  3MHV A;  2KK7 A;  3RL0 B;  3ITK A;  1NJI Q;  1FZG A;  1X79 B;  3H32 B;  2Z5H A;  3AE2 C;  3CCJ P;  1M1K Q;  1N73 A;  2K88 A;  3U59 A;  5AW0 B;  2QJY C;  2IFN A;  1PP9 J;  3HUS C;  4YXW H;  1NTK G;  1M1J C;  2XKM A;  2W6A A;  2I1J A;  4DCK A;  1S9K E;  1SS1 A;  2CK3 H;  2YIU B;  1QVF O;  1RQU A;  2JWD A;  4ASW A;  1QEX A;  1BDD A;  2A45 H;  1K9M Q;  3H1J G;  4K35 A;  2QJK C;  4TLF A;  1S5L E;  1MV8 A;  2KYV A;  2WSC J;  3B71 A;  5APQ A;  1SQX K;  2L91 A;  2OYH A;  1FZC C;  2E74 C;  3WUT A;  3CME P;  1JY3 N;  4U3F G;  3RK2 C;  1LTJ C;  2A45 I;  1LWU A;  2O01 H;  3L75 J;  1N7S A;  3AEF C;  1KIL E;  4PD4 D;  3L4F A;  1SQQ K;  2KI7 B;  1LTA C;  4KHX A;  1NOH A;  5TIS H;  1SQB J;  3H25 A;  1MUU A;  2JWA A;  4WY4 C;  3D6Y A;  1JY2 N;  3VYI A;  1ZW0 A;  2RKL A;  2W6B A;  5K5G B;  2M5A B;  4IL6 E;  3S9O A;  3RK2 B;  2PRR A;  4PD4 E;  1DEB A;  2QM8 A;  1L2P A;  1AVY A;  1HF9 A;  1L0N G;  1FBM A;  1QGK B;  2QRX A;  1VQO P;  3P8M C;  1Q2N A;  4WB4 A;  2H7H A;  2P1J A;  4WY4 B;  1OFC X;  3VN0 A;  1M90 Q;  2KLV A;  1BGY E;  1EDK A;  4JQ0 D;  1M56 D;  1GW4 A;  1FDM A;  3P32 A;  1IC2 A;  1R5S A;  2D2C D;  1KMI Z;  2UWJ E;  4L74 A;  3TGU J;  1K8A Q;  2XZR A;  2PGD A;  1AQT A;  1PPJ D;  1AA0 A;  2E43 A;  3N7N A;  1D7M A;  1RF1 B;  1T3J A;  4Y99 C;  1ZP0 C;  1KB9 H;  4N6J A;  3W68 A;  1FZE A;  4LGD E;  2QEX P;  2G8Y A;  4D6T E;  3KDP B;  4ZKP A;  1VQK P;  1JUN A;  1H89 A;  3BAT A;  1LWU C;  1VPC A;  1ZV8 A;  2ZT9 D;  1NTZ J;  1RE3 A;  1KQS O;  3VP9 A;  1KB9 I;  1N7S C;  1NTK D;  2FYU J;  2E42 A;  1EZV I;  1L4A A;  3AE3 C;  3IN6 A;  1SQP E;  2WSF J;  1J1D C;  1KN7 A;  2WSC H;  2KZI A;  2E75 D;  2V7Q J;  1ZME C;  1SFC A;  1JO5 A;  3FWN A;  1M8O B;  3H1J D;  1NTK E;  3AE8 C;  5CMZ A;  1VF5 D;  1NAF A;  1SQP K;  1Q7Y Q;  2YKQ A;  2J59 M;  1LT9 A;  2JEE A;  4U3F D;  4IFF A;  3GHG C;  3L71 J;  1UIX A;  3CC4 P;  1J1D B;  1LJ2 A;  3VOP A;  3USS A;  1VQN P;  2XU6 A;  1NTM K;  3HD7 D;  1HJB A;  4NPF X;  1IFD A;  2Q5U A;  2K3R A;  1IZN B;  1KTM A;  1G2C B;  2M3E A;  1T2K C;  4U3F E;  1JB0 J;  1JM0 A;  3CXH D;  1IO4 A;  3Q5R A;  1H0T B;  3CMA P;  3H6P A;  2DW3 A;  3GHG B;  3H1I J;  1BCC J;  1S5L X;  1VQ8 P;  3G6E P;  1FDI A;  2Q9I A;  2K9J B;  1PGJ A;  3P8C E;  1L0N D;  2QJP C;  4I7Z C;  3ABV C;  3CC7 P;  1OW6 A;  4DT0 A;  5DJU B;  3E1I A;  1LTT C;  5H2F H;  3H1L G;  1RE3 C;  5B66 E;  1NKZ B;  1CI6 A;  3AE5 C;  1BDC A;  2NPS A;  3WU2 E;  3HE5 A;  2IX7 C;  1L0L E;  3A0B E;  1QVG O;  3CWB E;  1OIP A;  4O9B A;  2HOD A;  3R4Y A;  1KFM A;  5AVV B;  1VQ4 P;  2MKV A;  2O1K A;  3VTP C;  1SFC C;  3VMX A;  4PV1 D;  1S2E A;  2OQQ A;  4IL6 X;  3KHU A;  3M91 A;  3RK3 D;  3LID A;  1L0L K;  3AEE C;  4C7N A;  3Q3D A;  3V6I A;  5AW9 B;  1LT9 C;  3L72 J;  2D2C B;  2OYI A;  1KD1 Q;  1YQ3 C;  2WSF H;  1N7L A;  4N78 E;  3CD6 P;  5KJ7 A;  1Q90 D;  2IDB A;  4HYT B;  3GW6 A;  1SQX G;  2V7Q H;  2ZYG A;  3H1H E;  1USD A;  1EQ7 A;  3RBX A;  3RK3 E;  3V5B A;  4Z1M H;  3L70 G;  4DOJ A;  4H44 D;  1BE3 G;  2H43 A;  2B87 B;  1SQQ G;  1FZB A;  3H32 A;  3CX5 D;  1P84 D;  3TNU B;  3E1R A;  1Q86 Q;  1NAY A;  4ZNC A;  4OGQ C;  1DD4 A;  2E75 B;  1AJY A;  2E76 D;  1JTH B;  1HUC A;  2NPS C;  1P84 E;  5KLV E;  1YI2 P;  1SQV J;  2Y9Y A;  1KYO D;  2IFM A;  3PLN A;  3K5B A;  1KQF B;  5KKZ B;  1GL2 D;  1VF5 B;  2BCC J;  2OGU A;  3AE7 C;  1W2B O;  3IF4 A;  3KZI H;  1NU1 E;  1GK6 A;  2Q1K A;  3TK1 A;  1AVO A;  2N1T C;  5KLV K;  2IYO A;  5APX A;  3HD7 B;  2WSE J;  1HWT C;  4H0L C;  5EFW B;  4JYB A;  1VL2 A;  3M06 A;  5AVY B;  4EOT A;  5AVT B;  2OYI C;  1UII A;  5AW1 B;  1HJ0 A;  1JNM A;  5KJ7 C;  1BGY G;  1VQ6 P;  3EFF K;  3H1L D;  3HE4 B;  1NU1 K;  3CXH H;  1GU5 A;  1LNQ A;  1ZLL A;  2M5A A;  1ZRT D;  5TJH A;  2N1T B;  2WPS A;  2KS1 B;  3CCS P;  1ZR4 A;  3RL0 C;  2OTL P;  2K9Y A;  1G1I A;  1S1C X;  3F5H A;  3CXH I;  3E7K A;  1SP4 A;  3TYY A;  2Y0E A;  4D6T G;  2LKM A;  2P7J A;  5AW3 B;  3A3Y B;  1OVV A;  5APV A;  3I56 P;  3CCQ P;  3W67 A;  5CCH D;  3D71 A;  4IFD K;  2H88 C;  4WY4 A;  1KQL A;  4M3L A;  3TDK A;  2HYN A;  4PJ0 H;  2YIU C;  3CCV P;  1S9K D;  1GU4 A;  4PV1 B;  1SQX D;  1SQP G;  2FFD B;  2IBZ E;  4BXL A;  1PP9 E;  5KAF H;  2QA4 P;  3AEG C;  4QMA A;  3I5C A;  1JOC A;  1YJN P;  1VQP P;  2ZVO B;  1NHL A;  3KPE A;  1NH4 A;  3L73 J;  1RF1 A;  1NTM G;  3V4W A;  2Q6Q A;  2NZ2 A;  5CCG A;  4ZMD A;  4R4M A;  2QIW A;  5AW5 B;  1SQQ D;  1SQX E;  5E79 E;  2XND H;  3L71 G;  2Z5I A;  1CSB A;  4HJG H;  4GDO A;  2C0W A;  3WMM 0;  3L74 G;  2XDJ A;  3SFD C;  5GTI E;  3I55 P;  1VQ7 P;  3L70 E;  4LLH A;  2WTY A;  4H44 B;  3A0H E;  3HRN A;  3H1K G;  1BE3 E;  1KIL D;  1SQQ E;  2FYZ A;  2A06 E;  5AW8 B;  3L75 E;  1PFI A;  3MUD A;  3EQ2 A;  2WSE H;  1URQ D;  2ZXX A;  1T3U A;  3HTK B;  2QG4 A;  3GMA A;  1CW5 A;  2JKV A;  2KSE A;  3CX5 I;  1J2J B;  1A02 J;  2WT7 B;  3OJA B;  1GD2 E;  2KB7 P;  1LP1 B;  3AEB C;  2WPV B;  4AYC A;  1GL2 B;  3S1K A;  4UB8 H;  3T97 B;  1PZQ A;  3AE1 C;  4H13 C;  1MZ9 A;  1BGY D;  1L0L G;  2OTJ P;  1AFO A;  2E5Y A;  1SQB K;  3CWB G;  4RO0 A;  1M7L A;  4NPD A;  4UB6 H;  1G2C A;  3MD0 A;  3SWF A;  1YTZ I;  3PJS K;  1RHZ B;  3IFM A;  1KYO I;  3CCU P;  1H0T A;  5GTH E;  1Y47 A;  1FC2 C;  5B5E H;  3M9H A;  3V4Q A;  1RF1 C;  3GHG A;  5CCG C;  3U1C A;  1PV3 A;  2M8R A;  5BU8 B;  2K9J A;  1E79 H;  5AVZ B;  2BAS A;  3P7K A;  1KQG B;  2WSS H;  4H13 B;  3QH9 A;  4D6T D;  3AE4 C;  5BU5 A;  5APS A;  3U1A A;  2QM7 A;  4R4L A;  2KSJ A;  4K3A A;  5APU A;  3H1H G;  2RH0 A;  3C8V A;  1L4A D;  3JSV C;  1U7J A;  4EIJ A;  1NTZ E;  1SQP D;  1RY3 A;  2AEJ A;  2R5B A;  3O8Z A;  1GK4 A;  3BCC G;  1AV1 A;  3MUD C;  5KTB A;  2FYU E;  2FKW B;  3RBZ A;  2B9B A;  1HH0 A;  1NTZ K;  1DH3 A;  1YQ4 C;  4WBA A;  1HGV A;  2W83 C;  1USE A;  1SQV G;  3PHL A;  2A45 G;  2FYU K;  5KLV G;  3AE6 C;  4BWN A;  1NTM E;  3H1K D;  3CPW O;  2JO1 A;  1GTW A;  4JBZ A;  1X22 A;  3IR9 A;  3L71 E;  3B5N D;  3MIW A;  2B87 A;  2PP6 A;  1HVV A;  3L74 E;  3TNU A;  3PP5 A;  2H8P D;  3FXE A;  1NU1 G;  2O1J A;  4DZO A;  4RKU J;  2O3J A;  2YKP A;  1NTK J;  3H1K E;  1M57 D;  2R3S A;  1IK9 A;  2M0B A;  1KIL B;  3P8C D;  2L5G B;  2E5T A;  2M3B A;  1JTH A;  4GOF A;  3H1I E;  1BCC E;  2XV5 A;  1H8A A;  2R5D A;  5M1B A;  3FGA D;  3H1J J;  1URQ B;  3BVH A;  3KZI E;  1L0L D;  3CWB D;  4IL6 H;  2YO2 A;  3UIA A;  2WIT A;  4PD4 H;  3CCE P;  2IPP A;  4U3F J;  1N8R Q;  1ZOY C;  3MGN A;  2AXT E;  3QWO C;  3VMY A;  3AEA C;  3HD7 A;  2ZFC A;  1PIX A;  2D2C C;  4PD4 I;  2Y9Z A;  4GOE A;  4EI2 A;  1IK7 A;  2KIK A;  2W6J H;  2GA1 A;  2FYN B;  3HE4 A;  1X8Y A;  2B88 A;  4N78 D;  3H1H D;  2V4H A;  1WMK A;  2IBZ G;  1PP9 G;  1KV4 A;  4GIF A;  2N1T A;  3L72 E;  2Y0C A;  2KS1 A;  2JDI H;  1L0N J;  1EZV G;  2ZT9 C;  2GUV A;  2P58 A;  1JCD A;  2N9Y B;  3CCM P;  3G3Z A;  1Y9B A;  5CHX A;  3BCC D;  4C7R A;  3AE9 C;  2P10 A;  1FDO A;  1KZU B;  4PJ0 E;  3NXS A;  3F89 A;  2KNC B;  3TSI A;  2WPQ A;  2E75 C;  3MZW B;  4L73 A;  5KAF E;  1OVR A;  2RMZ A;  3BCC E;  1LTB C;  2ZT9 B;  2B89 A;  1NYH A;  2FFD A;  4ZKU A;  5KLV D;  3BRT B;  1HGZ A;  2C9N Y;  2WMM A;  3L35 A;  2A06 G;  5KKZ C;  1VF5 C;  3L75 G;  3B5N C;  5AVQ B;  1EXJ A;  2GUS A;  4BRY B;  2KLU A;  5C39 A;  1SQV E;  4GKG A;  1YYC A;  1SQB G;  1K04 A;  3HD7 C;  1WT6 A;  1SVF A;  2BEZ F;  1NU1 D;  5KAI H;  2W90 A;  3IAO A;  2BCC E;  1IFN A;  1VQ9 P;  2QVA A;  3C9I A;  3SWY A;  3B5N B;  2WQY C;  2I8D A;  1SQV K;  1X0T A;  2FY8 A;  4CPG A;  4JF7 A;  1NWQ A;  1J1E B;  1QL2 A;  2MJZ A;  3GF3 A;  2E74 D;  3RK2 D;  4I2L C;  3Q5P A;  1LT1 A;  5TIS E;  3HTK A;  3CC2 P;  1EXI A;  3SWK A;  1EDL A;  2ZYA A;  5DJT B;  2P2U A;  1OZH A;  2FXO A;  1T8Z A;  2WT7 A;  4UB8 E;  3TGU G;  1VQ5 P;  2KUB A;  1W2E A;  1LP1 A;  4WY4 D;  5KLI B;  1R5L A;  2BEQ D;  1GL2 A;  4UB6 E;  3KYQ A;  3T97 A;  4HH2 A;  3G4S P;  3C1L A;  3A0B H;  4PV1 C;  3Q1M A;  1S4X A;  3GF7 A;  2FFD C;  5AVS B;  3KQG A;  5B5E E;  2C9L Y;  4OVN F;  4YTP C;  2AXC A;  3L37 A;  1CZQ A;  3RK3 C;  2LXB A;  1NTZ G;  2KP8 A;  4RES B;  1U7M A;  2IBZ D;  1PP9 D;  1KB9 D;  2C0X A;  2Y0D A;  1MKM A;  1Q82 Q;  2FYU G;  1EZV D;  1IFP A;  1QL1 A;  3AEC C;  4L76 A;  3JCU H;  3H1L J;  5AVU B;  4XFJ A;  3SSU A;  1JY3 P;  3L73 E;  1GZL A;  1KB9 E;  4H44 C;  1RF0 C;  3V2P A;  3RK3 B;  1EZV E;  3L70 D;  5APY A;  2J58 A;  3GLM A;  4I6M C;  4W7Z A;  1BE3 D;  1LGH B;  5CCH A;  4W80 A;  5AW7 B;  4L75 A;  2VRS A;  1JY2 P;  2A06 D;  2HG5 D;  3A5T A;  3L75 D;  1YJ9 P;  4AQR D;  1VQL P;  2E76 C;  3NFQ A;  1N7S D;  1WRG A;  2JJL A;  3O6Q B;  1MFZ A;  1SQB D;  1SQX J;  2ZYD A;  3PH0 A;  2N9B A;  2R44 A;  1GL2 C;  3PRJ A;  3CX5 H;  1P84 H;  3H1I G;  2QJY B;  1BCC G;  1EC5 A;  1OX3 A;  2HLO A;  3HUS B;  3L70 J;  1DX7 A;  3OAK A;  3RL0 g;  3EFG A;  1BE3 J;  4RJT A;  1M1J B;  1EDJ A;  2E76 B;  1SQB E;  3G9R A;  1SQQ J;  5L8R J;  3KXD A;  3NTN A;  4EYY Q;  1FJP A;  1P84 I;  2ZAE B;  2HPC B;  1R8E A;  2YKO A;  1TU3 F;  1JMB A;  3V2R A;  3G71 P;  2XNX A;  1KYO H;  1NVO A;  1N2D C;  2O01 N;  1KIL A;  2QJK B;  3LW5 J;  2WWW A;  1KFN A;  4WWI A;  1PGO A;  1FZC B;  3TGU D;  2E74 B;  5AW2 B;  1T2K D;  3CI9 A;  1IFM A;  2YNY A;  1S72 P;  1LTJ B;  2ZVN B;  1URQ A;  1Z56 A;  2FBW C;  4N3Y B;  4TT3 H;  3II6 A;  5H2F E;  1N73 C;  3L72 G;  2Q3E A;  1S3J A;  5AVW B;  5CCH C;  1A02 F;  1NTZ D;  3TGU E;  2K37 A;  1GDT A;  3Q2Y A;  1FZF A;  1ZN5 A;  2FYU D;  1EDI A;  1RQV A;  2Q7C A;  3FXD A;  1YIJ P;  1K73 Q;  3JC2 2;  1BGY J;  1PGP A;  2YO3 A;  2CPS A;  3RGU A;  4Y28 J;  2JP3 A;  1N73 B;  1YBK A;  3M0A A;  4GT1 A;  1RE4 A;  3B8E B;  4JPZ B;  1SFC D;  3Q5S A;  2OYH C;  1OMI A;  1NTM D;  1X9V A;  1ZR2 A;  2W8Z A;  4D6T J;  2CPB A;  3L71 D;  2IBZ I;  3CL3 D;  5E79 H;  1LTI C;  1PPJ E;  3L74 D;  1U57 A;  3LIE A;  2KNC A;  4IOI H;  2KZJ A;  3M9B A;  4KJM A;  1KIL C;  2HR3 A;  5GTI H;  1E5W A;  2BCC G;  2ITA A;  1LTS C;  2WVR A;  4Y99 B;  3VMA A;  1KC8 Q;  2OYH B;  3A0H H;  3D70 A;  1JY3 O;  2SPZ A;  1SQP J;  1S5L H;  1FZA A;  2H89 C;  1LWU B;  1URQ C;  3H1I D;  3WUV A;  1BCC D;  3M9Q A;  4OH8 B;  2OYO A;  1NTM J;  1N7S B;  4WVZ A;  1YTZ T;  2IZ0 A;  2YXQ B;  4BRY A;  5KAI E;  1JY2 O;  3LW5 H;  3N4X A;  4OGQ D;  1MFT A;  4HB1 A;  3L74 J;  3H1J E;  1NTK K;  1OVU A;  3L36 A;  1HBW A;  2NPS D;  2LR2 A;  2PFX A;  1KOR A;  2WPR A;  3H1K J;  2Z4E A;  2YMK A;  1XTC C;  2POH A;  3CCL P;  3ZDM A;  2FYN C;  3B5N A;  1FJK A;  1RE4 C;  3FWL A;  2OAR A;  1FS0 E;  1NKN A;  1Q81 Q;  2P67 A;  2J5U A;  5CJ4 A;  1DEE G;  2N1T D;  1SLQ A;  5GTH H;  4C46 A;  2R32 A;  1FAV A;  2I1K A;  1JCC A;  2QE7 H;  1FOS E;  4H0L D;  3M0D A;  1PGQ A;  3L72 D;  2HFE D;  4YPC A;  3CXH E;  1DD3 A;  4OWF A;  4IFM A;  5KJ7 D;  2NRG A;  1AQ5 A;  1L4A C;  1L0N E;  4MN4 C;  1OXZ A;  1OW7 A;  1XTG B;  3L73 G;  1L0L J;  5CJ0 A;  5AVX B;  3CWB J;  2QJP B;  4I7Z B;  4ASV A;  2KXP B;  3RL0 D;  4DJG A;  3MP7 B;  1YHQ P;  4AUW A;  1BSN A;  4I1L A;  2GM4 A;  5APT A;  1L0N K;  1L4A B;  3JCU E;  3PTZ A;  1FOS F;  5AVR B;  2W27 A;  1SFC B;  3S4R A;  1SQV D;  3MTU E;  4GOD A;  1GW3 A;  3H1H J; 
#chains in the Genus database with same CATH homology
 3SWF A;  1YTZ I;  4B86 A;  3BAS A;  3IFM A;  2XU6 A;  1NTM K;  3HD7 D;  1HJB A;  3V2N A;  1G1J A;  3M9H A;  5AVU B;  3V4Q A;  1IFD A;  1RF1 C;  3GHG A;  2WZ7 A;  1LT9 B;  5CCG C;  3U1C A;  2Q5U A;  1JY3 P;  1J1E C;  1IFJ A;  4W7Y A;  1GZL A;  2M8R A;  1RF0 C;  3V2P A;  1G2C B;  5BU8 B;  3RK3 B;  1T2K C;  5AVZ B;  1VDF A;  2R3C A;  5APW A;  2BAS A;  1IO4 A;  3P7K A;  4LC1 A;  3CLQ A;  5APY A;  5AW4 B;  2J58 A;  3M0D C;  4I6M C;  4W7Z A;  5BU5 A;  3H6P A;  3VP8 A;  3GHG B;  1LGH B;  5APS A;  2YMY A;  3U1A A;  1RF0 A;  5AW6 B;  2QM7 A;  2KSJ A;  2Q9I A;  3P8C E;  2FXM A;  5APU A;  5CCH A;  4W80 A;  4XE5 B;  5AW7 B;  3V2Q A;  2VRS A;  1JY2 P;  2HG5 D;  3A5T A;  3R2P A;  1L4A D;  3E1I A;  1LTT C;  4AQR D;  1RE3 C;  4EIJ A;  1NKZ B;  1CI6 A;  3NFQ A;  1N7S D;  1RY3 A;  1WRG A;  2JJL A;  2R5B A;  3O8Z A;  2NPS A;  1GK4 A;  1H88 A;  3HE5 A;  3HUS A;  1MFZ A;  5KTB A;  2IX7 C;  1M1J A;  4O9B A;  2HOD A;  2FKW B;  2N9B A;  1KFM A;  1GL2 C;  5AVV B;  1CI6 B;  3VMZ A;  2O1K A;  3VTP C;  1SFC C;  2NPS B;  2HPC A;  2HLO A;  3HE5 B;  3HUS B;  3VMX A;  1DX7 A;  1HH0 A;  3OAK A;  1NTZ K;  3M91 A;  3EFG A;  1DH3 A;  1JMM A;  1M1J B;  3A7O A;  2HOD B;  4WBA A;  1HGV A;  3RK3 D;  3LID A;  1LTG C;  1HTL C;  1L0L K;  3NTN A;  2A45 G;  2FYU K;  4C7N A;  1FJP A;  5AW9 B;  2HPC B;  1LT9 C;  2ZXE B;  2YKO A;  1N86 A;  1OWA A;  3V2R A;  2OYI A;  1FZC A;  2XNX A;  3A2A A;  2WSF H;  1GTW A;  1N7L A;  2PAJ A;  4N78 E;  1N2D C;  5BVZ A;  5KJ7 A;  4HYT B;  3IR9 A;  3B5N D;  3MIW A;  1LTJ A;  1KIL A;  4C7N B;  2PP6 A;  1EQ7 A;  1HVV A;  2WWW A;  2KOG A;  3NMD A;  3V5B A;  1KFN A;  3TNU A;  3PP5 A;  5CCG D;  4XA4 A;  2H8P D;  1IFI A;  2OYI B;  2O1J A;  1FZC B;  4DZO A;  2Q3I A;  4DOJ A;  5AW2 B;  1T2K D;  3CI9 A;  1IFM A;  2YKP A;  2YNY A;  4JYC A;  1IJD B;  2H43 A;  1LTJ B;  1IK9 A;  1NO4 A;  1KIL B;  3P8C D;  1URQ A;  2L5G B;  3BRV B;  1FZB A;  1Z56 A;  4N3Y B;  3H32 A;  3II6 A;  3TNU B;  1FU1 A;  2M3B A;  1N73 C;  1JTH A;  3OA7 A;  5AVW B;  5CCH C;  2XV5 A;  1H8A A;  1A02 F;  2R5D A;  3RL0 B;  1GDT A;  1URQ B;  1FZG A;  1X79 B;  3BVH A;  3H32 B;  2Z5H A;  1N73 A;  1FZF A;  1ZN5 A;  3U59 A;  5AW0 B;  2YO2 A;  1JTH B;  1HUC A;  2NPS C;  2IFN A;  2Q7C A;  3UIA A;  2WIT A;  3HUS C;  2IPP A;  2IFM A;  1M1J C;  2XKM A;  2W6A A;  2I1J A;  2YO3 A;  2CPS A;  3MGN A;  1S9K E;  3VMY A;  3HD7 A;  1N73 B;  1GL2 D;  3M0A A;  4GT1 A;  1RE4 A;  3B8E B;  2ZFC A;  1SFC D;  1GK6 A;  2OYH C;  3TK1 A;  5KLV K;  2N1T C;  2A45 H;  5APX A;  3HD7 B;  3HE4 A;  1X8Y A;  1X9V A;  1HWT C;  1ZR2 A;  4JYB A;  4N78 D;  1MV8 A;  3M06 A;  2CPB A;  2KYV A;  5AVY B;  4EOT A;  5APQ A;  1SQX K;  5AVT B;  2OYH A;  2OYI C;  1FZC C;  3CL3 D;  1LTI C;  4GIF A;  2N1T A;  5AW1 B;  1JNM A;  5KJ7 C;  1JY3 N;  3LIE A;  3M9B A;  3RK2 C;  1LTJ C;  2A45 I;  1LWU A;  2GUV A;  3HE4 B;  1JCD A;  1KIL C;  1NU1 K;  3G3Z A;  2O01 H;  1GU5 A;  1E5W A;  5CHX A;  1LTS C;  4Y99 B;  1ZLL A;  2OYH B;  4C7R A;  1N7S A;  1JY3 O;  2N1T B;  2WPS A;  1KZU B;  3L4F A;  3NXS A;  1SQQ K;  1FZA A;  1LTA C;  4KHX A;  3TSI A;  1ZR4 A;  1NOH A;  1LWU B;  3RL0 C;  1URQ C;  2WPQ A;  1MUU A;  4WY4 C;  1G1I A;  1JY2 N;  3VYI A;  1SP4 A;  3TYY A;  3M9Q A;  4OH8 B;  2W6B A;  2LKM A;  2P7J A;  5AW3 B;  1N7S B;  3A3Y B;  5APV A;  1YTZ T;  3RK2 B;  1LTB C;  5CCH D;  4IFD K;  2FFD A;  1DEB A;  2QM8 A;  4WY4 A;  1JY2 O;  1KQL A;  4ZKU A;  4M3L A;  1FBM A;  3LW5 H;  3BRT B;  2HYN A;  1HGZ A;  2C9N Y;  3N4X A;  3L35 A;  3P8M C;  3B5N C;  5AVQ B;  1NTK K;  3L36 A;  1HBW A;  4WB4 A;  2NPS D;  1S9K D;  2GUS A;  2H7H A;  1GU4 A;  2FFD B;  2P1J A;  2WPR A;  4WY4 B;  2Z4E A;  1XTC C;  2POH A;  1YYC A;  3I5C A;  4GKG A;  3VN0 A;  2KLV A;  3HD7 C;  1JOC A;  1WT6 A;  3B5N A;  1SVF A;  1FJK A;  1RE4 C;  1NHL A;  2OAR A;  3KPE A;  1GW4 A;  1NH4 A;  1FDM A;  3P32 A;  1IC2 A;  1RF1 A;  1NKN A;  3V4W A;  5CCG A;  2P67 A;  1IFN A;  5CJ4 A;  3C9I A;  5AW5 B;  2N1T D;  2XZR A;  1SLQ A;  3SWY A;  3B5N B;  4C46 A;  2R32 A;  2Z5I A;  1FAV A;  2I1K A;  1CSB A;  2E43 A;  1JCC A;  1FOS E;  3N7N A;  3M0D A;  2C0W A;  2HFE D;  1SQV K;  3WMM 0;  1RF1 B;  2XDJ A;  1T3J A;  4Y99 C;  4JF7 A;  4N6J A;  1FZE A;  1NWQ A;  4LGD E;  1J1E B;  1QL2 A;  2MJZ A;  4LLH A;  2WTY A;  4IFM A;  3KDP B;  5KJ7 D;  3HRN A;  4ZKP A;  1JUN A;  1H89 A;  3BAT A;  1LWU C;  1VPC A;  1AQ5 A;  1ZV8 A;  3RK2 D;  4I2L C;  1L4A C;  1KIL D;  3HTK A;  1OXZ A;  1RE3 A;  3VP9 A;  1XTG B;  2FYZ A;  2P2U A;  1N7S C;  5AW8 B;  5CJ0 A;  5AVX B;  2E42 A;  1PFI A;  1T8Z A;  1L4A A;  3MUD A;  3EQ2 A;  2WT7 A;  2WSE H;  3RL0 D;  1URQ D;  1T3U A;  1W2E A;  1J1D C;  3HTK B;  4WY4 D;  2WSC H;  1GL2 A;  4AUW A;  3KYQ A;  4I1L A;  3T97 A;  1SFC A;  4HH2 A;  1CW5 A;  2GM4 A;  5APT A;  1L0N K;  1JO5 A;  1L4A B;  1J2J B;  2FFD C;  2WT7 B;  1A02 J;  3OJA B;  5AVS B;  3KQG A;  2C9L Y;  1GD2 E;  2KB7 P;  1FOS F;  5AVR B;  3L37 A;  1CZQ A;  3RK3 C;  2KP8 A;  4AYC A;  2W27 A;  5CMZ A;  1GL2 B;  4RES B;  1NAF A;  1SQP K;  1SFC B;  2YKQ A;  2J59 M;  3MTU E;  2C0X A;  1MZ9 A;  1LT9 A;  2JEE A;  4IFF A;  1AFO A;  3GHG C;  1SQB K;  1GW3 A;  1J1D B;  1M7L A;  1QL1 A;  1G2C A;  3MD0 A;  3VOP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...