1J2JB

Crystal structure of gga1 gat n-terminal region in complex with arf1 gtp form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
41
structure length
41
Chain Sequence
b'IFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRM'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords ADP-ribosylation factor 1
publication title Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
pubmed doi rcsb
source organism Mus musculus
molecule tags Protein transport
total genus 15
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2003-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1j2jB00
2YO2A 2P67A 4C7NA 2C9NY 3O8ZA 5AW3B 5AVWB 1GZLA 5AVQB 2Q7CA 1HWTC 1OXZA 2QM7A 3P32A 1S9KD 1A02F 4DZOA 2ZXEB 1MV8A 3M9HA 3L37A 3VMYA 5AVUB 3VN0A 5AVTB 4AUWA 2WWWA 3TNUA 3M91A 2C9LY 3M06A 1GK6A 5CMZA 3LIDA 3MD0A 1T2KD 1DH3A 5AW0B 2ZFCA 5AW6B 3A2AA 2WT7B 5APUA 2YO3A 4HYTB 3V5BA 5APSA 2Z5HA 1FAVA 1MFZA 5AVVB 3V4QA 5AW9B 1CSBA 3HE5B 1SLQA 3V4WA 3VTPC 1SP4A 2P7JA 2W6AA 2Z5IA 4GKGA 2QM8A 5AVRB 2Q5UA 1S9KE 1GU5A 2IPPA 4KHXA 3HE4B 4I2LC 3A3YB 3P7KA 3MGNA 3LIEA 1CI6B 1FOSE 2Q3IA 1H89A 3NFQA 1HUCA 3B8EB 2BASA 1H88A 5AW1B 5AW5B 4JYBA 2XZRA 4M3LA 2P2UA 3M0DA 3M0AA 3KDPB 3VYIA 3NXSA 1YYCA 2R32A 1HBWA 2E43A 1HJBA 5AVXB 1CZQA 3VMZA 4I6MC 4C7NB 1J2JB 5AW8B 3VMXA 3A7OA 2KP8A 3KQGA 3M9BA 3P8MC 1G2CB 2WPQA 5AW7B 2VRSA 5AVYB 2YNYA 5APWA 1GTWA 2R3CA 2WTYA 1GK4A 1IO4A 2E42A 1NAFA 2WT7A 2R5BA 3A5TA 4LC1A 5APYA 3UIAA 2W27A 3IR9A 1JNMA 5AVZB 4GT1A 5APXA 1A02J 3HE5A 3TNUB 1KQLA 3NMDA 2R5DA 1H8AA 4RESB 3NTNA 5APQA 5APVA 4AQRD 3L35A 5APTA 3T97A 1MUUA 2JJLA 3TK1A 2WPSA 2WPRA 5AVSB 3SWFA 3HE4A 3TYYA 4JYCA 1NWQA 3L36A 2H7HA 1CI6A 4XE5B 1X8YA 4B86A 4AYCA 3OAKA 5AW2B 1GD2E 3HTKA 2XV5A 3I5CA 2N9BA 1GU4A 1FOSF 1OWAA 4EOTA 1T2KC 2XU6A 1JUNA 4C46A 5AW4B
chains in the Genus database with same CATH superfamily
1VF5B 3KZIE 1G1JA 2C9NY 4HH2A 3RK3B 2OQQA 4YTPC 4GIFA 2Y0EA 1PGPA 3VN0A 4TT3H 1OVRA 4QMAA 3CCSP 1VQNP 1GK6A 3WU2E 3LIDA 4KJMA 2YO3A 2P1JA 3HD7D 1YBKA 4NPFX 3A0HH 4GOFA 1L0LD 1DEBA 2JWAA 2RH0A 1MKMA 1MZ9A 3HUSB 5KJ7D 3AEBC 1BE3D 1FC2C 3P8CD 1H88A 3NXSA 1SQBG 3H1JE 3C8VA 4EIJA 1SQVE 3A7OA 4UB8E 1RF0A 2WPQA 4NPDA 3V2PA 2R3CA 4N6JA 3V2QA 4JBZA 2KXPB 1JY3N 3CWBE 4GT1A 2GM4A 4U3FG 5APQA 1S2EA 3PRJA 1SQQJ 4U7JA 1VF5C 5C39A 1FBMA 4MN4C 2A06D 3RK3C 5CHXA 1N73A 1BDCA 1KFNA 2YKPA 2RKLA 1HVVA 1M8OB 1QLED 1QVGO 3S4RA 1EZVG 1ZV8A 3Q1MA 3L75E 3RK2D 1P84I 3RK3E 2WSFH 1W2BO 3MD0A 3AE8C 1X0TA 2JEEA 3A2AA 3L72J 1L0NK 2NPSD 3CX5E 3HUSC 3V5BA 1EQ7A 3G4SP 2FXOA 2IBZD 2WPVB 3GLMA 1SQXE 4ZNCA 3GHGA 1EDJA 4PV1D 3AE7C 4Y28J 3BCCG 3RL0D 3P7KA 2HFED 2ITAA 3B8EB 5GTHE 4PJ0H 3CCLP 1N73B 1T6AA 4D6TD 2NPSA 1IK9A 3FWLA 2KP8A 3P8MC 2KZIA 1ZMEC 3A0HE 2O01J 2YNYA 1GK4A 3KYQA 3A0BH 4YXWH 1KYOE 2W27A 3GG2A 3L72D 4H44B 2FYNB 4HB1A 3HE4A 2IDBA 2O1KA 3L74J 4WY4D 2OTKE 2J59M 1NOHA 1X8YA 3GHGB 2E75D 1PV3A 4JF7A 1YQ3C 1RQUA 1RF0C 3EWKA 2P58A 1G1IA 1A02F 4RO0A 2NPSB 2I1JA 2LXCB 3S9OA 1AA0A 2SPZA 3H1LJ 2R44A 1WRGA 3MIWA 3Q5PA 3H1KJ 5APUA 2FKWB 4PD4H 2OYOA 1T3JA 1X9VA 3LW5H 3WUUA 3GW6A 3H1HE 1L0LE 1SQPG 4NPEA 3H6PA 1CW5A 3QH9A 1HGVA 1S1CX 1RE4A 1N73C 3HE4B 1Z56A 4ZKPA 3L74D 3A3YB 1SQVK 2FYUK 1OW8A 1PGJA 5B66H 3M0DA 3M0AA 1FZFA 3CX5I 1MFTA 2A45I 1KB9D 5GTIE 2QEXP 4CPGA 3TGUD 2V7QH 2B9BA 3G9RA 2QJKB 4LC1A 4H44C 1KILD 2G8YA 3H1LD 2FYNC 1JM0A 1VQ9P 3H1KD 2Q6QA 3BATA 4YPCA 2YXQB 3GHGC 2E75B 1YHQP 3TK1A 4GOEA 3BASA 1SQBJ 2GA1A 1BE3G 4PJ0E 4GDOA 2QSIA 2BEQD 1YTZI 1Q86Q 1VL2A 1URQD 1BCCE 2A06E 2XV5A 3RL0g 2PP6A 1M1JA 3M9QA 2PRRA 2NPSC 1KYOI 3A0BE 4U3FJ 1G2CA 2MKVA 3PLNA 1S9KD 4PV1C 1RY3A 3M9HA 1GL2A 2KUBA 1L4AA 4EDFA 3C9IA 2W6JH 5CMZA 3CXHH 1DX7A 4W7ZA 2WSCH 3U59A 2FXMA 1CSBA 1SQBD 4OWFA 4C7RA 2AXTH 4DOJA 5CBOA 3MGNA 2LKMA 2UWJE 5AW5B 4JYBA 2FYUJ 1M1JB 3PP5A 2YMYA 1PGQA 2QJKC 3R2PA 4I6MC 2IYPA 4D6TE 4U3FD 3VMXA 1QL1A 4N3YB 4O9BA 1PP9J 4PD4E 3VOPA 1G2CB 2E76B 1SFCD 3BCCJ 2E75C 5APYA 1GL2B 1OX3A 1Y8AA 2ZAEB 4Y99B 3HRNA 1L4AB 1EDLA 1OMIA 1R5SA 5APTA 3T97A 1MUUA 1ZP0C 2K9JA 3L71J 1RE4C 1QEXA 4JYCA 1SQQG 3H1IE 1RH5B 2E5YA 1EZVD 1OIPA 3B5ND 1USEA 1VQLP 2NRGA 1YI2P 3M0DC 3I55P 4EOTA 1PGOA 4C46A 1LTJA 5AW3B 3MZWB 4Z1MH 1EXJA 4H0LB 3TDKA 3L37A 5AVUB 2W83C 1PP9D 4AUWA 4HKZH 4L75A 1OVVA 1AJYA 3BCCD 1YTZT 1YJNP 3L72G 3GF3A 5AW6B 1N2DC 4OGQD 2GUVA 3MP7B 1GW4A 3CL3D 1FS0E 3T97B 5KLVK 3L71D 2K9JB 2Q1KA 2O1JA 2BEZF 1M1JC 2FBWC 3L74E 2LXBA 1JMBA 1L2PA 2IFNA 2P2UA 1IFDA 2E76C 1FZEA 1ZRTD 2BCCE 3VMZA 3CXHE 1ZR4A 4R4MA 4RKUJ 5AW8B 1LTJB 1GL2C 2IBZI 4Y99C 1JY3O 3GF7A 1L4AC 2OYIA 3TGUE 1HJ0A 2Y9ZA 1U57A 2AXTE 2YXRB 3H1KE 4XFJA 5APVA 4AQRD 2WITA 5K5GB 2JJLA 4WB4A 2XDJA 3AE4C 1WT6A 1NYHA 4PD4I 1SS1A 5B5EH 1W5CE 2N9BA 1M90Q 5AW4B 5KKZB 2B89A 2ZYDA 2WQYC 1LWUA 3P32A 1OZHA 2KSJA 2D2CD 1D7MA 3B71A 4W7YA 2OYIB 3D6YA 1M7LA 1Q2NA 1T2KD 2AEMA 1L0NG 1NTMK 3V4QA 2H8PD 3V6IA 1W2EA 3MUDA 1NTKE 4KT0J 1S4XA 2ZVOB 5GTHH 5KLVJ 1FOSE 1H89A 1LTJC 2M3BA 3VYIA 1VQKP 2XNDH 1HJBA 2C0WA 1K05A 1PPJD 3ITKA 2YKOA 1OFCX 1LWUB 1GW3A 1KYOH 1BGYG 1LT9A 1FZAA 1A02J 1H8AA 2W8ZA 3CMEP 2K1AA 3IAOA 3EFFK 4K35A 3HD7A 3RBZA 1EDKA 3CXHI 3L73G 5KKZC 3CPWO 1KB9I 5AW2B 5KJ7A 1K73Q 2XU6A 2JO1A 1NU1K 3VP8A 1FU1A 2OYIC 4W80A 1MV8A 4OVNF 1S72P 1J1DB 2E5TA 3FGAD 3CCMP 1KQSO 1IC2A 1DH3A 2PAJA 1LT9B 5CJ4A 5B5EE 4I1LA 3WUTA 4GODA 1YITP 4K3AA 3IFMA 3AEFC 4ASVA 2Q5UA 4JPZB 3HD7B 3CC2P 3H1JG 3E1RA 2J5UA 5CCGD 4IL6H 1SQVG 2FYUG 3KXDA 1HF9A 3N4XA 4EYYQ 1LWUC 5GTIH 1YYCA 1K9MQ 3AE2C 3BVHA 1K8AQ 4RJTA 3BRVB 1PP9G 1M1KQ 2B87A 3CWBG 5L8RJ 5AW7B 4UB6E 1SQQD 1PL5A 3N7NA 1VDFA 5CCGA 3AE5C 4N78D 3PHLA 2WMMA 1GMJA 2RN0A 3MUDC 4JQ0D 3L35A 1NTZK 1NO4A 3L71G 2ZYAA 2LR2A 3L36A 2YKQA 2E74D 1IJDB 2RMZA 4BRYA 1T2KC 3OJAB 1R8EA 4C7NA 1HTLC 1NU1J 2H89C 3MHVA 1GZLA 1J1DC 1LT9C 2B87B 1SQPE 2A45G 2KSEA 1NTKK 1FDIA 1KV4A 1ZOYC 3F89A 2QJYB 2WSEH 5APSA 1MFZA 3HD7C 2OYHA 3E1IA 3RK2B 1JCDA 2P7JA 1OVUA 5KJ7C 3W67A 3Q3DA 4WY4A 2R3SA 2K9YA 5AW1B 4PV1B 3EFGA 2IFMA 3AEEC 2HODA 3RL0B 2JKVA 2NZ2A 4BRYB 1L0NJ 3CI9A 4C7NB 4OH8B 3RBXA 3AE6C 1BE3E 3PTZA 3P8CE 3G6EP 1LTTC 4IL6E 1EDIA 1IZNB 3I56P 2OYHB 3SWFA 3TYYA 1FDOA 3MTUE 1N86A 1KZUB 1BGYJ 2DW3A 2Q3EA 1OWAA 2N1TD 4WY4B 1LJ2A 1PPJG 5AVWB 5KLIB 2HODB 1LTBC 1VQ4P 1N7SD 4L74A 1L0ND 1K04A 2O01H 2QJYC 1Q81Q 2ZT9D 3L73J 2KLVA 4BWNA 5CCGC 3RK2C 1N7LA 3H1HG 2C9LY 2FFDA 5AW0B 2PFXA 2Y9YA 1XTCC 1YIJP 2Z5HA 3O6QA 1KILA 3ABVC 3SWKA 1LTSC 4ZMDA 3OW2O 1VQOP 5KLVG 1T8ZA 3CLQA 1JY2O 3RL0C 3D6ZA 3USSA 5TJHA 1SQXK 1HUCA 1BGYD 1DD3A 2V4HA 1URQA 1KB9H 3FXDA 2FY8A 2IBZE 1CZQA 2XKMA 3H25A 5EFWB 3L70G 4TLFA 1P84D 2VRSA 3FWNA 2WTYA 1Y47A 3AE3C 5DJTB 3L73D 1SQQE 3H1JJ 3PJSK 2OYHC 2WZ7A 3HE5A 1SQVJ 2QG4A 2M5AA 2FFDB 2M3EA 2K3RA 1JY2P 1BCCG 3O6QB 1KILB 1NWQA 4WY4C 3CWBJ 3D70A 5KLIC 1R5LA 2N9YB 3SFEC 3O8ZA 1URQB 1WMKA 1BSNA 1FJPA 3L72E 2QM7A 2Y0CA 2M8RA 3M91A 1KQFB 1SFCA 3H1JD 1VPCA 1LTAC 1SQVD 1NTMG 2FYUD 3HE5B 2I1KA 2M5AB 3VTPC 3L75J 1IFNA 1YQ4C 4IFFA 1VQ6P 3CWBD 1L0LK 3B5NA 1SQXJ 2IX7C 1NKNA 2CPSA 1NVOA 2FFDC 2JDIH 1ZN5A 1NAFA 2WT7A 2KLUA 2AEFA 1KILC 2I8DA 1U7MA 1AQTA 2KS1A 2R5DA 1JY2N 5KAIH 1SFCB 3JSVC 5AVSB 1KB9E 3L75D 1USDA 1ZXGA 3JCUE 3TSIA 1VQMP 3RK3D 4AYCA 1M57D 2G3AA 3OAKA 1URQC 1FOSF 3CX5D 1QL2A 1KILE 3H1LE 1NU1G 2O3JA 3B5NB 1SQXD 5AVQB 2Q9IA 2YIUB 1Q7YQ 1L0NE 3CC4P 5DJUB 3KPEA 1JTHA 2Y0DA 3GMAA 2ZFCA 2WT7B 4HJGH 1Q90D 4IL6X 1IFJA 1SLQA 2KS1B 2JR8A 2Z5IA 1S9KE 1JO5A 4KHXA 1H0TA 2Z4EA 4I2LC 4OGQB 3NFQA 2FYZA 3H1HJ 4M3LA 1BGYE 2KOGA 4YXDC 1TU3F 4UB6H 3SFDC 1KC8Q 2QE7H 1SQBE 1QGKB 1OW6A 2YMKA 1AVYA 1SFCC 4IFDK 1RE3A 2WSFJ 1JTHB 4ASWA 2H43A 1NAYA 3CMAP 1NTZG 4U3FE 3L70J 2JWDA 1S3JA 2L91A 3G3ZA 3B5NC 2OGUA 1H0TB 1GDTA 4XA4A 1JUNA 2YIUC 2YO2A 3FXEA 1S5LE 3H1HD 1UIXA 3AEGC 1Q82Q 1PFIA 1OXZA 2IYOA 2J58A 5KAIE 1BCCJ 1IFMA 3VMYA 1AQ5A 1N8RQ 3CCEP 2MJZA 4IOIH 1KN7A 1EZVE 2QJPB 3VMAA 5KLVD 3M06A 1NTKG 3SSUA 2D2CB 1LT1A 4HYTB 1DIPA 2C0XA 3E7KA 1HGZA 4EI2A 4OGQC 2FYUE 2HPCA 1KORA 5AVRB 3L70D 4ZKUA 1PP9E 1J1EB 2XZRA 2ZJSE 2QRXA 3BCCE 2WSEJ 3KDPB 2R32A 2AEJA 4H13D 4L76A 3RGUA 1FJKA 1NTMJ 1X79B 3CC7P 2POHA 3SWYA 1BCCD 5AVYB 3L71E 4H44D 3W68A 3A5TA 5CCHD 1LTIC 5APXA 4D6TJ 5H2FE 3NTNA 5BU5A 3LW5J 1QVFO 3L4FA 1ZRTE 2GUSA 2HPCB 4DT0A 1FE6A 5E79E 5CCHA 3H1IJ 2CPBA 3QWOC 2QJPC 1NTMD 2D2CC 1RE3C 2V7QJ 1AV1A 3TNUA 2JP3A 1KFMA 3CCUP 3Q5SA 3G71P 2M0BA 3L75G 4PD4D 3V4WA 1J1EC 2W6AA 5KAFH 4A7PA 1VQ7P 4H13B 1LP1A 3AE1C 1EZVI 1SQXG 3CCVP 1SQBK 2E43A 3H1ID 2XNXA 3B4SA 2KB7P 1E79H 2R5BA 1DD4A 3UIAA 2BCCJ 1VQ5P 1KTMA 3TNUB 3NMDA 2WSCJ 3TGUJ 2OARA 3AEAC 2WPRA 1T3UA 1NU1D 3H32A 1PPJE 1NGMB 1VQ8P 4B86A 3BRTB 5TISH 1FZBA 3HTKA 1GU4A 4LGDE 4WVZA 1LP1B 3IF4A 2E74B 2K37A 1LTGC 1NTZJ 2W90A 2OTJP 5CBNA 2KZJA 3U1CA 4WWIA 5KLVE 1PZQA 3WMM0 5BVZA 1E5WA 2BCCD 1FAVA 3CXHD 5AW9B 4H13C 1NKZB 4GKGA 1KQGB 3H32B 3L70E 5CCHC 3U1AA 1L0LG 2BASA 3HTKB 3KHUA 1NTKJ 1S5LX 2E76D 1HBWA 2N1TA 2KK7A 1J2JB 1GL2D 3S1KA 1NJIQ 1BDDA 1L4AD 1YJWP 1NTZD 1JMMA 1N7SA 2H88C 4DJGA 5KAFE 2FXPA 3IR9A 3AECC 5AVZB 2OTLP 2K88A 1JOCA 3Q5RA 1KQLA 1IFPA 2HG5D 5CJ0A 3JCUH 3OA7A 1DEEG 1RF1A 1EXIA 2ZYGA 3II6A 4XE5B 2E74C 1X22A 2ZVNB 1JEKA 4H0LD 2PGDA 2WSSH 1VQPP 1HH0A 1FZCA 4N78E 2KYVA 1NTKD 2AXCA 2HR3A 3VP9A 2A06G 4DZOA 2N1TB 4WBAA 2O01N 1NTME 4BXLA 1NHLA 1ZLLA 1JB0J 1M56D 1LNQA 1N7SB 3CCRP 5TISE 1U7JA 2QIWA 2ZT9B 5AVVB 1SQPK 2QM8A 3C1LA 2IPPA 1RF1B 1JCCA 3AE9C 3Q2YA 3CCJP 3LIEA 2Q3IA 2IBZG 2KNCA 2IZ0A 3PH0A 4LLHA 3F5HA 1SVFA 1P84H 5B66E 1FZCB 2HLOA 3M9BA 1BSHA 1GTWA 4I7ZB 3K5BA 1IO4A 1OW7A 2E42A 3KZIH 2KI7B 2HYNA 2QA4P 1LGHB 1JNMA 4IFMA 4D6TG 2KIKA 2W6BA 1AVOA 3JC22 1KD1Q 1QX8A 1IFIA 2WPSA 3CCQP 1NU1E 2H7HA 3WU2H 1CI6A 1GD2E 2L5GB 1S5LH 3I5CA 2N1TC 2P67A 1KMIZ 3H1IG 1YJ9P 2KNCB 3WUVA 2Q7CA 1HWTC 3EQ2A 1NH4A 2ZXEB 1N7SC 1VF5D 2WVRA 5AVTB 1RQVA 2ZT9C 2WWWA 4R4LA 4UB8H 1RF1C 4L73A 5KTBA 1FZGA 3IN6A 3AEDC 1SP4A 1SQPJ 1GU5A 3R4YA 3V2RA 1CI6B 1FZCC 2IZ1A 4I7ZC 2QVAA 1AFOA 5AVXB 1IK7A 3L74G 1FDMA 2P10A 3KQGA 2B88A 1Y9BA 5APWA 1NTZE 1ZR2A 3FX0A 5H2FH 4DCKA 1RHZB 1KYOD 2ZXXA 2BCCG 1UIIA 4H0LC 1ZW0A 1XTGB 1L0LJ 2CK3H 1JY3P 3ZDMA 4RESB 3D71A 3TGUG 1EC5A 5M1BA 1PIXA 3CD6P 3HUSA 1SQQK 1BE3J 3H1LG 1SQPD 1P84E 3H1KG 3CX5H 5E79H 2A45H 5BU8B 3V2NA 3L73E 3TF5A
chains in the Genus database with same CATH topology
4WY4B 5CCHA 1G1JA 2C9NY 4HH2A 1LTJA 5AW3B 5AVWB 3RK3B 2CPBA 2HODB 4GIFA 1LTBC 1N7SD 2O01H 3L37A 5AVUB 3VN0A 1RE3C 2KLVA 4AUWA 5CCGC 3RK2C 1N7LA 3TNUA 2C9LY 2FFDA 1GK6A 1YTZT 3LIDA 5AW0B 5AW6B 1XTCC 2YO3A 1KFMA 2P1JA 1N2DC 3HD7D 2Z5HA 1KILA 1LTSC 2GUVA 1DEBA 3V4WA 1J1EC 1GW4A 3CL3D 2W6AA 5KLVK 1MZ9A 3HUSB 1T8ZA 3CLQA 5KJ7D 1JY2O 2O1JA 3RL0C 1M1JC 1SQXK 1HUCA 3P8CD 2IFNA 1H88A 1URQA 2P2UA 1SQBK 3NXSA 1IFDA 1FZEA 2E43A 1CZQA 2XKMA 3VMZA 4EIJA 1ZR4A 5AW8B 1LTJB 1GL2C 3A7OA 4Y99C 1JY3O 1RF0A 1L4AC 2OYIA 2XNXA 2WPQA 2VRSA 3V2PA 2KB7P 2R3CA 4N6JA 2WTYA 3V2QA 2R5BA 3UIAA 1JY3N 2WZ7A 2OYHC 4GT1A 2GM4A 3HE5A 3TNUB 3NMDA 2FFDB 5APVA 5APQA 4AQRD 2WITA 2JJLA 1JY2P 4WB4A 2XDJA 2OARA 2WPRA 1T3UA 1KILB 1WT6A 1NWQA 3H32A 4WY4C 4B86A 1FBMA 3BRTB 3RK3C 5CHXA 1FZBA 3HTKA 2N9BA 1GU4A 1N73A 2YKPA 1KFNA 4LGDE 5AW4B 1HVVA 3O8ZA 1URQB 1LTGC 1FJPA 1ZV8A 1LWUA 2QM7A 3P32A 2KSJA 2M8RA 4W7YA 2OYIB 3RK2D 3U1CA 1M7LA 3M91A 2WSFH 3MD0A 1T2KD 1SFCA 2JEEA 3WMM0 3A2AA 5BVZA 1L0NK 2NPSD 3V5BA 3HUSC 1E5WA 1EQ7A 1FAVA 1NTMK 1VPCA 1LTAC 3V4QA 5AW9B 2H8PD 3HE5B 2I1KA 1NKZB 1W2EA 3VTPC 3MUDA 3GHGA 1IFNA 4GKGA 3RL0D 4IFFA 3P7KA 3H32B 1FOSE 1H89A 5CCHC 1L0LK 2HFED 3U1AA 3B8EB 2BASA 3B5NA 1LTJC 2M3BA 3HTKB 3VYIA 2IX7C 1N73B 1NKNA 2CPSA 1HBWA 2N1TA 1HJBA 2NPSA 1IK9A 2C0WA 1J2JB 1GL2D 1L4AD 2KP8A 2YKOA 3P8MC 1LWUB 1GW3A 1JMMA 2FFDC 2YNYA 1ZN5A 1GK4A 1N7SA 3KYQA 1NAFA 2WT7A 1LT9A 1FZAA 1KILC 2W27A 3IR9A 5AVZB 1JOCA 1A02J 1KQLA 2R5DA 1JY2N 1H8AA 2HG5D 1SFCB 5CJ0A 3OA7A 1RF1A 3HD7A 5AVSB 3HE4A 2O1KA 4WY4D 3II6A 4XE5B 2J59M 3TSIA 1NOHA 1X8YA 3GHGB 3RK3D 4AYCA 3OAKA 5AW2B 1URQC 4JF7A 5KJ7A 1FOSF 2XU6A 1QL2A 1NU1K 3VP8A 1HH0A 1FZCA 3B5NB 1FU1A 4N78E 1RF0C 2KYVA 5AVQB 2Q9IA 2OYIC 4W80A 3VP9A 1G1IA 1A02F 4DZOA 2N1TB 4WBAA 2NPSB 2I1JA 1MV8A 1J1DB 3KPEA 1JTHA 1WRGA 3MIWA 1NHLA 1ZLLA 1IC2A 1N7SB 1DH3A 2ZFCA 2WT7B 5APUA 2FKWB 2PAJA 1LT9B 5CJ4A 1T3JA 4I1LA 5AVVB 1X9VA 3LW5H 1IFJA 1SQPK 1SLQA 3H6PA 1CW5A 3IFMA 1HGVA 2Z5IA 2QM8A 1S9KE 2Q5UA 1JO5A 2IPPA 4KHXA 1RE4A 1JCCA 3HD7B 3HE4B 1Z56A 1RF1B 4ZKPA 1N73C 2Z4EA 4I2LC 3A3YB 3LIEA 5CCGD 2Q3IA 1SQVK 3NFQA 2FYUK 2FYZA 3N4XA 4M3LA 3M0DA 3M0AA 1LWUC 2KOGA 4LLHA 1FZFA 1YYCA 1SVFA 3BVHA 1FZCB 2A45I 3BRVB 2HLOA 3M9BA 5AW7B 1GTWA 1IO4A 1SFCC 2E42A 4IFDK 2HYNA 4LC1A 1KILD 1RE3A 1LGHB 1JNMA 4IFMA 3N7NA 1VDFA 1JTHB 2W6BA 5CCGA 2H43A 4N78D 3BATA 3GHGC 3L35A 1NTZK 1NO4A 3TK1A 3BASA 1IFIA 2WPSA 3L36A 2YKQA 2H7HA 1CI6A 3G3ZA 1IJDB 1YTZI 3B5NC 1URQD 1GD2E 2L5GB 2XV5A 3I5CA 2PP6A 1M1JA 1GDTA 1T2KC 4XA4A 1JUNA 3OJAB 3M9QA 2N1TC 2YO2A 2P67A 2NPSC 4C7NA 1HTLC 1GZLA 1J1DC 2Q7CA 1HWTC 1PFIA 1G2CA 3EQ2A 1OXZA 1S9KD 1NH4A 2J58A 2ZXEB 1N7SC 1RY3A 3M9HA 1IFMA 3VMYA 1AQ5A 1LT9C 1GL2A 5AVTB 2MJZA 1L4AA 2A45G 2WWWA 3C9IA 1NTKK 3M06A 5CMZA 1DX7A 2WSEH 4HYTB 5APSA 1RF1C 3HD7C 1MFZA 2OYHA 4W7ZA 5KTBA 2C0XA 2WSCH 3E1IA 3U59A 2FXMA 1FZGA 1CSBA 3RK2B 1HGZA 1JCDA 1SP4A 2P7JA 2HPCA 1GU5A 5AVRB 3V2RA 5KJ7C 4C7RA 4DOJA 4ZKUA 3MGNA 2LKMA 1CI6B 1J1EB 4WY4A 1FZCC 5AW1B 5AW5B 4JYBA 2XZRA 3EFGA 2IFMA 3KDPB 2HODA 3RL0B 1M1JB 3PP5A 2R32A 2YMYA 1AFOA 5AVXB 3CI9A 3R2PA 4I6MC 4C7NB 1FJKA 3VMXA 1X79B 1FDMA 1QL1A 3KQGA 4N3YB 4O9BA 2POHA 4OH8B 3VOPA 1G2CB 3SWYA 5AVYB 5APWA 1SFCD 1ZR2A 3A5TA 5APYA 5CCHD 1GL2B 4Y99B 1LTIC 3HRNA 1L4AB 5APXA 1XTGB 3P8CE 1JY3P 4RESB 1LTTC 3NTNA 5BU5A 5APTA 3T97A 1MUUA 3L4FA 3HUSA 1RE4C 2OYHB 1SQQK 3SWFA 3TYYA 4JYCA 3MTUE 1N86A 2GUSA 3B5ND 2HPCB 1KZUB 3M0DC 2A45H 5BU8B 1OWAA 4EOTA 3V2NA 2N1TD 4C46A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2YO2 A;  2P67 A;  4C7N A;  2C9N Y;  3O8Z A;  5AW3 B;  5AVW B;  1GZL A;  5AVQ B;  2Q7C A;  1HWT C;  1OXZ A;  2QM7 A;  3P32 A;  1S9K D;  1A02 F;  4DZO A;  2ZXE B;  1MV8 A;  3M9H A;  3L37 A;  3VMY A;  5AVU B;  3VN0 A;  5AVT B;  4AUW A;  2WWW A;  3TNU A;  3M91 A;  2C9L Y;  3M06 A;  1GK6 A;  5CMZ A;  3LID A;  3MD0 A;  1T2K D;  1DH3 A;  5AW0 B;  2ZFC A;  5AW6 B;  3A2A A;  2WT7 B;  5APU A;  2YO3 A;  4HYT B;  3V5B A;  5APS A;  2Z5H A;  1FAV A;  1MFZ A;  5AVV B;  3V4Q A;  5AW9 B;  1CSB A;  3HE5 B;  1SLQ A;  3V4W A;  3VTP C;  1SP4 A;  2P7J A;  2W6A A;  2Z5I A;  4GKG A;  2QM8 A;  5AVR B;  2Q5U A;  1S9K E;  1GU5 A;  2IPP A;  4KHX A;  3HE4 B;  4I2L C;  3A3Y B;  3P7K A;  3MGN A;  3LIE A;  1CI6 B;  1FOS E;  2Q3I A;  1H89 A;  3NFQ A;  1HUC A;  3B8E B;  2BAS A;  1H88 A;  5AW1 B;  5AW5 B;  4JYB A;  2XZR A;  4M3L A;  2P2U A;  3M0D A;  3M0A A;  3KDP B;  3VYI A;  3NXS A;  1YYC A;  2R32 A;  1HBW A;  2E43 A;  1HJB A;  5AVX B;  1CZQ A;  3VMZ A;  4I6M C;  4C7N B;  1J2J B;  5AW8 B;  3VMX A;  3A7O A;  2KP8 A;  3KQG A;  3M9B A;  3P8M C;  1G2C B;  2WPQ A;  5AW7 B;  2VRS A;  5AVY B;  2YNY A;  5APW A;  1GTW A;  2R3C A;  2WTY A;  1GK4 A;  1IO4 A;  2E42 A;  1NAF A;  2WT7 A;  2R5B A;  3A5T A;  4LC1 A;  5APY A;  3UIA A;  2W27 A;  3IR9 A;  1JNM A;  5AVZ B;  4GT1 A;  5APX A;  1A02 J;  3HE5 A;  3TNU B;  1KQL A;  3NMD A;  2R5D A;  1H8A A;  4RES B;  3NTN A;  5APQ A;  5APV A;  4AQR D;  3L35 A;  5APT A;  3T97 A;  1MUU A;  2JJL A;  3TK1 A;  2WPS A;  2WPR A;  5AVS B;  3SWF A;  3HE4 A;  3TYY A;  4JYC A;  1NWQ A;  3L36 A;  2H7H A;  1CI6 A;  4XE5 B;  1X8Y A;  4B86 A;  4AYC A;  3OAK A;  5AW2 B;  1GD2 E;  3HTK A;  2XV5 A;  3I5C A;  2N9B A;  1GU4 A;  1FOS F;  1OWA A;  4EOT A;  1T2K C;  2XU6 A;  1JUN A;  4C46 A;  5AW4 B; 
#chains in the Genus database with same CATH topology
 1VF5 B;  3KZI E;  1G1J A;  2C9N Y;  4HH2 A;  3RK3 B;  2OQQ A;  4YTP C;  4GIF A;  2Y0E A;  1PGP A;  3VN0 A;  4TT3 H;  1OVR A;  4QMA A;  3CCS P;  1VQN P;  1GK6 A;  3WU2 E;  3LID A;  4KJM A;  2YO3 A;  2P1J A;  3HD7 D;  1YBK A;  4NPF X;  3A0H H;  4GOF A;  1L0L D;  1DEB A;  2JWA A;  2RH0 A;  1MKM A;  1MZ9 A;  3HUS B;  5KJ7 D;  3AEB C;  1BE3 D;  1FC2 C;  3P8C D;  1H88 A;  3NXS A;  1SQB G;  3H1J E;  3C8V A;  4EIJ A;  1SQV E;  3A7O A;  4UB8 E;  1RF0 A;  2WPQ A;  4NPD A;  3V2P A;  2R3C A;  4N6J A;  3V2Q A;  4JBZ A;  2KXP B;  1JY3 N;  3CWB E;  4GT1 A;  2GM4 A;  4U3F G;  5APQ A;  1S2E A;  3PRJ A;  1SQQ J;  4U7J A;  1VF5 C;  5C39 A;  1FBM A;  4MN4 C;  2A06 D;  3RK3 C;  5CHX A;  1N73 A;  1BDC A;  1KFN A;  2YKP A;  2RKL A;  1HVV A;  1M8O B;  1QLE D;  1QVG O;  3S4R A;  1EZV G;  1ZV8 A;  3Q1M A;  3L75 E;  3RK2 D;  1P84 I;  3RK3 E;  2WSF H;  1W2B O;  3MD0 A;  3AE8 C;  1X0T A;  2JEE A;  3A2A A;  3L72 J;  1L0N K;  2NPS D;  3CX5 E;  3HUS C;  3V5B A;  1EQ7 A;  3G4S P;  2FXO A;  2IBZ D;  2WPV B;  3GLM A;  1SQX E;  4ZNC A;  3GHG A;  1EDJ A;  4PV1 D;  3AE7 C;  4Y28 J;  3BCC G;  3RL0 D;  3P7K A;  2HFE D;  2ITA A;  3B8E B;  5GTH E;  4PJ0 H;  3CCL P;  1N73 B;  1T6A A;  4D6T D;  2NPS A;  1IK9 A;  3FWL A;  2KP8 A;  3P8M C;  2KZI A;  1ZME C;  3A0H E;  2O01 J;  2YNY A;  1GK4 A;  3KYQ A;  3A0B H;  4YXW H;  1KYO E;  2W27 A;  3GG2 A;  3L72 D;  4H44 B;  2FYN B;  4HB1 A;  3HE4 A;  2IDB A;  2O1K A;  3L74 J;  4WY4 D;  2OTK E;  2J59 M;  1NOH A;  1X8Y A;  3GHG B;  2E75 D;  1PV3 A;  4JF7 A;  1YQ3 C;  1RQU A;  1RF0 C;  3EWK A;  2P58 A;  1G1I A;  1A02 F;  4RO0 A;  2NPS B;  2I1J A;  2LXC B;  3S9O A;  1AA0 A;  2SPZ A;  3H1L J;  2R44 A;  1WRG A;  3MIW A;  3Q5P A;  3H1K J;  5APU A;  2FKW B;  4PD4 H;  2OYO A;  1T3J A;  1X9V A;  3LW5 H;  3WUU A;  3GW6 A;  3H1H E;  1L0L E;  1SQP G;  4NPE A;  3H6P A;  1CW5 A;  3QH9 A;  1HGV A;  1S1C X;  1RE4 A;  1N73 C;  3HE4 B;  1Z56 A;  4ZKP A;  3L74 D;  3A3Y B;  1SQV K;  2FYU K;  1OW8 A;  1PGJ A;  5B66 H;  3M0D A;  3M0A A;  1FZF A;  3CX5 I;  1MFT A;  2A45 I;  1KB9 D;  5GTI E;  2QEX P;  4CPG A;  3TGU D;  2V7Q H;  2B9B A;  3G9R A;  2QJK B;  4LC1 A;  4H44 C;  1KIL D;  2G8Y A;  3H1L D;  2FYN C;  1JM0 A;  1VQ9 P;  3H1K D;  2Q6Q A;  3BAT A;  4YPC A;  2YXQ B;  3GHG C;  2E75 B;  1YHQ P;  3TK1 A;  4GOE A;  3BAS A;  1SQB J;  2GA1 A;  1BE3 G;  4PJ0 E;  4GDO A;  2QSI A;  2BEQ D;  1YTZ I;  1Q86 Q;  1VL2 A;  1URQ D;  1BCC E;  2A06 E;  2XV5 A;  3RL0 g;  2PP6 A;  1M1J A;  3M9Q A;  2PRR A;  2NPS C;  1KYO I;  3A0B E;  4U3F J;  1G2C A;  2MKV A;  3PLN A;  1S9K D;  4PV1 C;  1RY3 A;  3M9H A;  1GL2 A;  2KUB A;  1L4A A;  4EDF A;  3C9I A;  2W6J H;  5CMZ A;  3CXH H;  1DX7 A;  4W7Z A;  2WSC H;  3U59 A;  2FXM A;  1CSB A;  1SQB D;  4OWF A;  4C7R A;  2AXT H;  4DOJ A;  5CBO A;  3MGN A;  2LKM A;  2UWJ E;  5AW5 B;  4JYB A;  2FYU J;  1M1J B;  3PP5 A;  2YMY A;  1PGQ A;  2QJK C;  3R2P A;  4I6M C;  2IYP A;  4D6T E;  4U3F D;  3VMX A;  1QL1 A;  4N3Y B;  4O9B A;  1PP9 J;  4PD4 E;  3VOP A;  1G2C B;  2E76 B;  1SFC D;  3BCC J;  2E75 C;  5APY A;  1GL2 B;  1OX3 A;  1Y8A A;  2ZAE B;  4Y99 B;  3HRN A;  1L4A B;  1EDL A;  1OMI A;  1R5S A;  5APT A;  3T97 A;  1MUU A;  1ZP0 C;  2K9J A;  3L71 J;  1RE4 C;  1QEX A;  4JYC A;  1SQQ G;  3H1I E;  1RH5 B;  2E5Y A;  1EZV D;  1OIP A;  3B5N D;  1USE A;  1VQL P;  2NRG A;  1YI2 P;  3M0D C;  3I55 P;  4EOT A;  1PGO A;  4C46 A;  1LTJ A;  5AW3 B;  3MZW B;  4Z1M H;  1EXJ A;  4H0L B;  3TDK A;  3L37 A;  5AVU B;  2W83 C;  1PP9 D;  4AUW A;  4HKZ H;  4L75 A;  1OVV A;  1AJY A;  3BCC D;  1YTZ T;  1YJN P;  3L72 G;  3GF3 A;  5AW6 B;  1N2D C;  4OGQ D;  2GUV A;  3MP7 B;  1GW4 A;  3CL3 D;  1FS0 E;  3T97 B;  5KLV K;  3L71 D;  2K9J B;  2Q1K A;  2O1J A;  2BEZ F;  1M1J C;  2FBW C;  3L74 E;  2LXB A;  1JMB A;  1L2P A;  2IFN A;  2P2U A;  1IFD A;  2E76 C;  1FZE A;  1ZRT D;  2BCC E;  3VMZ A;  3CXH E;  1ZR4 A;  4R4M A;  4RKU J;  5AW8 B;  1LTJ B;  1GL2 C;  2IBZ I;  4Y99 C;  1JY3 O;  3GF7 A;  1L4A C;  2OYI A;  3TGU E;  1HJ0 A;  2Y9Z A;  1U57 A;  2AXT E;  2YXR B;  3H1K E;  4XFJ A;  5APV A;  4AQR D;  2WIT A;  5K5G B;  2JJL A;  4WB4 A;  2XDJ A;  3AE4 C;  1WT6 A;  1NYH A;  4PD4 I;  1SS1 A;  5B5E H;  1W5C E;  2N9B A;  1M90 Q;  5AW4 B;  5KKZ B;  2B89 A;  2ZYD A;  2WQY C;  1LWU A;  3P32 A;  1OZH A;  2KSJ A;  2D2C D;  1D7M A;  3B71 A;  4W7Y A;  2OYI B;  3D6Y A;  1M7L A;  1Q2N A;  1T2K D;  2AEM A;  1L0N G;  1NTM K;  3V4Q A;  2H8P D;  3V6I A;  1W2E A;  3MUD A;  1NTK E;  4KT0 J;  1S4X A;  2ZVO B;  5GTH H;  5KLV J;  1FOS E;  1H89 A;  1LTJ C;  2M3B A;  3VYI A;  1VQK P;  2XND H;  1HJB A;  2C0W A;  1K05 A;  1PPJ D;  3ITK A;  2YKO A;  1OFC X;  1LWU B;  1GW3 A;  1KYO H;  1BGY G;  1LT9 A;  1FZA A;  1A02 J;  1H8A A;  2W8Z A;  3CME P;  2K1A A;  3IAO A;  3EFF K;  4K35 A;  3HD7 A;  3RBZ A;  1EDK A;  3CXH I;  3L73 G;  5KKZ C;  3CPW O;  1KB9 I;  5AW2 B;  5KJ7 A;  1K73 Q;  2XU6 A;  2JO1 A;  1NU1 K;  3VP8 A;  1FU1 A;  2OYI C;  4W80 A;  1MV8 A;  4OVN F;  1S72 P;  1J1D B;  2E5T A;  3FGA D;  3CCM P;  1KQS O;  1IC2 A;  1DH3 A;  2PAJ A;  1LT9 B;  5CJ4 A;  5B5E E;  4I1L A;  3WUT A;  4GOD A;  1YIT P;  4K3A A;  3IFM A;  3AEF C;  4ASV A;  2Q5U A;  4JPZ B;  3HD7 B;  3CC2 P;  3H1J G;  3E1R A;  2J5U A;  5CCG D;  4IL6 H;  1SQV G;  2FYU G;  3KXD A;  1HF9 A;  3N4X A;  4EYY Q;  1LWU C;  5GTI H;  1YYC A;  1K9M Q;  3AE2 C;  3BVH A;  1K8A Q;  4RJT A;  3BRV B;  1PP9 G;  1M1K Q;  2B87 A;  3CWB G;  5L8R J;  5AW7 B;  4UB6 E;  1SQQ D;  1PL5 A;  3N7N A;  1VDF A;  5CCG A;  3AE5 C;  4N78 D;  3PHL A;  2WMM A;  1GMJ A;  2RN0 A;  3MUD C;  4JQ0 D;  3L35 A;  1NTZ K;  1NO4 A;  3L71 G;  2ZYA A;  2LR2 A;  3L36 A;  2YKQ A;  2E74 D;  1IJD B;  2RMZ A;  4BRY A;  1T2K C;  3OJA B;  1R8E A;  4C7N A;  1HTL C;  1NU1 J;  2H89 C;  3MHV A;  1GZL A;  1J1D C;  1LT9 C;  2B87 B;  1SQP E;  2A45 G;  2KSE A;  1NTK K;  1FDI A;  1KV4 A;  1ZOY C;  3F89 A;  2QJY B;  2WSE H;  5APS A;  1MFZ A;  3HD7 C;  2OYH A;  3E1I A;  3RK2 B;  1JCD A;  2P7J A;  1OVU A;  5KJ7 C;  3W67 A;  3Q3D A;  4WY4 A;  2R3S A;  2K9Y A;  5AW1 B;  4PV1 B;  3EFG A;  2IFM A;  3AEE C;  2HOD A;  3RL0 B;  2JKV A;  2NZ2 A;  4BRY B;  1L0N J;  3CI9 A;  4C7N B;  4OH8 B;  3RBX A;  3AE6 C;  1BE3 E;  3PTZ A;  3P8C E;  3G6E P;  1LTT C;  4IL6 E;  1EDI A;  1IZN B;  3I56 P;  2OYH B;  3SWF A;  3TYY A;  1FDO A;  3MTU E;  1N86 A;  1KZU B;  1BGY J;  2DW3 A;  2Q3E A;  1OWA A;  2N1T D;  4WY4 B;  1LJ2 A;  1PPJ G;  5AVW B;  5KLI B;  2HOD B;  1LTB C;  1VQ4 P;  1N7S D;  4L74 A;  1L0N D;  1K04 A;  2O01 H;  2QJY C;  1Q81 Q;  2ZT9 D;  3L73 J;  2KLV A;  4BWN A;  5CCG C;  3RK2 C;  1N7L A;  3H1H G;  2C9L Y;  2FFD A;  5AW0 B;  2PFX A;  2Y9Y A;  1XTC C;  1YIJ P;  2Z5H A;  3O6Q A;  1KIL A;  3ABV C;  3SWK A;  1LTS C;  4ZMD A;  3OW2 O;  1VQO P;  5KLV G;  1T8Z A;  3CLQ A;  1JY2 O;  3RL0 C;  3D6Z A;  3USS A;  5TJH A;  1SQX K;  1HUC A;  1BGY D;  1DD3 A;  2V4H A;  1URQ A;  1KB9 H;  3FXD A;  2FY8 A;  2IBZ E;  1CZQ A;  2XKM A;  3H25 A;  5EFW B;  3L70 G;  4TLF A;  1P84 D;  2VRS A;  3FWN A;  2WTY A;  1Y47 A;  3AE3 C;  5DJT B;  3L73 D;  1SQQ E;  3H1J J;  3PJS K;  2OYH C;  2WZ7 A;  3HE5 A;  1SQV J;  2QG4 A;  2M5A A;  2FFD B;  2M3E A;  2K3R A;  1JY2 P;  1BCC G;  3O6Q B;  1KIL B;  1NWQ A;  4WY4 C;  3CWB J;  3D70 A;  5KLI C;  1R5L A;  2N9Y B;  3SFE C;  3O8Z A;  1URQ B;  1WMK A;  1BSN A;  1FJP A;  3L72 E;  2QM7 A;  2Y0C A;  2M8R A;  3M91 A;  1KQF B;  1SFC A;  3H1J D;  1VPC A;  1LTA C;  1SQV D;  1NTM G;  2FYU D;  3HE5 B;  2I1K A;  2M5A B;  3VTP C;  3L75 J;  1IFN A;  1YQ4 C;  4IFF A;  1VQ6 P;  3CWB D;  1L0L K;  3B5N A;  1SQX J;  2IX7 C;  1NKN A;  2CPS A;  1NVO A;  2FFD C;  2JDI H;  1ZN5 A;  1NAF A;  2WT7 A;  2KLU A;  2AEF A;  1KIL C;  2I8D A;  1U7M A;  1AQT A;  2KS1 A;  2R5D A;  1JY2 N;  5KAI H;  1SFC B;  3JSV C;  5AVS B;  1KB9 E;  3L75 D;  1USD A;  1ZXG A;  3JCU E;  3TSI A;  1VQM P;  3RK3 D;  4AYC A;  1M57 D;  2G3A A;  3OAK A;  1URQ C;  1FOS F;  3CX5 D;  1QL2 A;  1KIL E;  3H1L E;  1NU1 G;  2O3J A;  3B5N B;  1SQX D;  5AVQ B;  2Q9I A;  2YIU B;  1Q7Y Q;  1L0N E;  3CC4 P;  5DJU B;  3KPE A;  1JTH A;  2Y0D A;  3GMA A;  2ZFC A;  2WT7 B;  4HJG H;  1Q90 D;  4IL6 X;  1IFJ A;  1SLQ A;  2KS1 B;  2JR8 A;  2Z5I A;  1S9K E;  1JO5 A;  4KHX A;  1H0T A;  2Z4E A;  4I2L C;  4OGQ B;  3NFQ A;  2FYZ A;  3H1H J;  4M3L A;  1BGY E;  2KOG A;  4YXD C;  1TU3 F;  4UB6 H;  3SFD C;  1KC8 Q;  2QE7 H;  1SQB E;  1QGK B;  1OW6 A;  2YMK A;  1AVY A;  1SFC C;  4IFD K;  1RE3 A;  2WSF J;  1JTH B;  4ASW A;  2H43 A;  1NAY A;  3CMA P;  1NTZ G;  4U3F E;  3L70 J;  2JWD A;  1S3J A;  2L91 A;  3G3Z A;  3B5N C;  2OGU A;  1H0T B;  1GDT A;  4XA4 A;  1JUN A;  2YIU C;  2YO2 A;  3FXE A;  1S5L E;  3H1H D;  1UIX A;  3AEG C;  1Q82 Q;  1PFI A;  1OXZ A;  2IYO A;  2J58 A;  5KAI E;  1BCC J;  1IFM A;  3VMY A;  1AQ5 A;  1N8R Q;  3CCE P;  2MJZ A;  4IOI H;  1KN7 A;  1EZV E;  2QJP B;  3VMA A;  5KLV D;  3M06 A;  1NTK G;  3SSU A;  2D2C B;  1LT1 A;  4HYT B;  1DIP A;  2C0X A;  3E7K A;  1HGZ A;  4EI2 A;  4OGQ C;  2FYU E;  2HPC A;  1KOR A;  5AVR B;  3L70 D;  4ZKU A;  1PP9 E;  1J1E B;  2XZR A;  2ZJS E;  2QRX A;  3BCC E;  2WSE J;  3KDP B;  2R32 A;  2AEJ A;  4H13 D;  4L76 A;  3RGU A;  1FJK A;  1NTM J;  1X79 B;  3CC7 P;  2POH A;  3SWY A;  1BCC D;  5AVY B;  3L71 E;  4H44 D;  3W68 A;  3A5T A;  5CCH D;  1LTI C;  5APX A;  4D6T J;  5H2F E;  3NTN A;  5BU5 A;  3LW5 J;  1QVF O;  3L4F A;  1ZRT E;  2GUS A;  2HPC B;  4DT0 A;  1FE6 A;  5E79 E;  5CCH A;  3H1I J;  2CPB A;  3QWO C;  2QJP C;  1NTM D;  2D2C C;  1RE3 C;  2V7Q J;  1AV1 A;  3TNU A;  2JP3 A;  1KFM A;  3CCU P;  3Q5S A;  3G71 P;  2M0B A;  3L75 G;  4PD4 D;  3V4W A;  1J1E C;  2W6A A;  5KAF H;  4A7P A;  1VQ7 P;  4H13 B;  1LP1 A;  3AE1 C;  1EZV I;  1SQX G;  3CCV P;  1SQB K;  2E43 A;  3H1I D;  2XNX A;  3B4S A;  2KB7 P;  1E79 H;  2R5B A;  1DD4 A;  3UIA A;  2BCC J;  1VQ5 P;  1KTM A;  3TNU B;  3NMD A;  2WSC J;  3TGU J;  2OAR A;  3AEA C;  2WPR A;  1T3U A;  1NU1 D;  3H32 A;  1PPJ E;  1NGM B;  1VQ8 P;  4B86 A;  3BRT B;  5TIS H;  1FZB A;  3HTK A;  1GU4 A;  4LGD E;  4WVZ A;  1LP1 B;  3IF4 A;  2E74 B;  2K37 A;  1LTG C;  1NTZ J;  2W90 A;  2OTJ P;  5CBN A;  2KZJ A;  3U1C A;  4WWI A;  5KLV E;  1PZQ A;  3WMM 0;  5BVZ A;  1E5W A;  2BCC D;  1FAV A;  3CXH D;  5AW9 B;  4H13 C;  1NKZ B;  4GKG A;  1KQG B;  3H32 B;  3L70 E;  5CCH C;  3U1A A;  1L0L G;  2BAS A;  3HTK B;  3KHU A;  1NTK J;  1S5L X;  2E76 D;  1HBW A;  2N1T A;  2KK7 A;  1J2J B;  1GL2 D;  3S1K A;  1NJI Q;  1BDD A;  1L4A D;  1YJW P;  1NTZ D;  1JMM A;  1N7S A;  2H88 C;  4DJG A;  5KAF E;  2FXP A;  3IR9 A;  3AEC C;  5AVZ B;  2OTL P;  2K88 A;  1JOC A;  3Q5R A;  1KQL A;  1IFP A;  2HG5 D;  5CJ0 A;  3JCU H;  3OA7 A;  1DEE G;  1RF1 A;  1EXI A;  2ZYG A;  3II6 A;  4XE5 B;  2E74 C;  1X22 A;  2ZVN B;  1JEK A;  4H0L D;  2PGD A;  2WSS H;  1VQP P;  1HH0 A;  1FZC A;  4N78 E;  2KYV A;  1NTK D;  2AXC A;  2HR3 A;  3VP9 A;  2A06 G;  4DZO A;  2N1T B;  4WBA A;  2O01 N;  1NTM E;  4BXL A;  1NHL A;  1ZLL A;  1JB0 J;  1M56 D;  1LNQ A;  1N7S B;  3CCR P;  5TIS E;  1U7J A;  2QIW A;  2ZT9 B;  5AVV B;  1SQP K;  2QM8 A;  3C1L A;  2IPP A;  1RF1 B;  1JCC A;  3AE9 C;  3Q2Y A;  3CCJ P;  3LIE A;  2Q3I A;  2IBZ G;  2KNC A;  2IZ0 A;  3PH0 A;  4LLH A;  3F5H A;  1SVF A;  1P84 H;  5B66 E;  1FZC B;  2HLO A;  3M9B A;  1BSH A;  1GTW A;  4I7Z B;  3K5B A;  1IO4 A;  1OW7 A;  2E42 A;  3KZI H;  2KI7 B;  2HYN A;  2QA4 P;  1LGH B;  1JNM A;  4IFM A;  4D6T G;  2KIK A;  2W6B A;  1AVO A;  3JC2 2;  1KD1 Q;  1QX8 A;  1IFI A;  2WPS A;  3CCQ P;  1NU1 E;  2H7H A;  3WU2 H;  1CI6 A;  1GD2 E;  2L5G B;  1S5L H;  3I5C A;  2N1T C;  2P67 A;  1KMI Z;  3H1I G;  1YJ9 P;  2KNC B;  3WUV A;  2Q7C A;  1HWT C;  3EQ2 A;  1NH4 A;  2ZXE B;  1N7S C;  1VF5 D;  2WVR A;  5AVT B;  1RQV A;  2ZT9 C;  2WWW A;  4R4L A;  4UB8 H;  1RF1 C;  4L73 A;  5KTB A;  1FZG A;  3IN6 A;  3AED C;  1SP4 A;  1SQP J;  1GU5 A;  3R4Y A;  3V2R A;  1CI6 B;  1FZC C;  2IZ1 A;  4I7Z C;  2QVA A;  1AFO A;  5AVX B;  1IK7 A;  3L74 G;  1FDM A;  2P10 A;  3KQG A;  2B88 A;  1Y9B A;  5APW A;  1NTZ E;  1ZR2 A;  3FX0 A;  5H2F H;  4DCK A;  1RHZ B;  1KYO D;  2ZXX A;  2BCC G;  1UII A;  4H0L C;  1ZW0 A;  1XTG B;  1L0L J;  2CK3 H;  1JY3 P;  3ZDM A;  4RES B;  3D71 A;  3TGU G;  1EC5 A;  5M1B A;  1PIX A;  3CD6 P;  3HUS A;  1SQQ K;  1BE3 J;  3H1L G;  1SQP D;  1P84 E;  3H1K G;  3CX5 H;  5E79 H;  2A45 H;  5BU8 B;  3V2N A;  3L73 E;  3TF5 A; 
#chains in the Genus database with same CATH homology
 4WY4 B;  5CCH A;  1G1J A;  2C9N Y;  4HH2 A;  1LTJ A;  5AW3 B;  5AVW B;  3RK3 B;  2CPB A;  2HOD B;  4GIF A;  1LTB C;  1N7S D;  2O01 H;  3L37 A;  5AVU B;  3VN0 A;  1RE3 C;  2KLV A;  4AUW A;  5CCG C;  3RK2 C;  1N7L A;  3TNU A;  2C9L Y;  2FFD A;  1GK6 A;  1YTZ T;  3LID A;  5AW0 B;  5AW6 B;  1XTC C;  2YO3 A;  1KFM A;  2P1J A;  1N2D C;  3HD7 D;  2Z5H A;  1KIL A;  1LTS C;  2GUV A;  1DEB A;  3V4W A;  1J1E C;  1GW4 A;  3CL3 D;  2W6A A;  5KLV K;  1MZ9 A;  3HUS B;  1T8Z A;  3CLQ A;  5KJ7 D;  1JY2 O;  2O1J A;  3RL0 C;  1M1J C;  1SQX K;  1HUC A;  3P8C D;  2IFN A;  1H88 A;  1URQ A;  2P2U A;  1SQB K;  3NXS A;  1IFD A;  1FZE A;  2E43 A;  1CZQ A;  2XKM A;  3VMZ A;  4EIJ A;  1ZR4 A;  5AW8 B;  1LTJ B;  1GL2 C;  3A7O A;  4Y99 C;  1JY3 O;  1RF0 A;  1L4A C;  2OYI A;  2XNX A;  2WPQ A;  2VRS A;  3V2P A;  2KB7 P;  2R3C A;  4N6J A;  2WTY A;  3V2Q A;  2R5B A;  3UIA A;  1JY3 N;  2WZ7 A;  2OYH C;  4GT1 A;  2GM4 A;  3HE5 A;  3TNU B;  3NMD A;  2FFD B;  5APV A;  5APQ A;  4AQR D;  2WIT A;  2JJL A;  1JY2 P;  4WB4 A;  2XDJ A;  2OAR A;  2WPR A;  1T3U A;  1KIL B;  1WT6 A;  1NWQ A;  3H32 A;  4WY4 C;  4B86 A;  1FBM A;  3BRT B;  3RK3 C;  5CHX A;  1FZB A;  3HTK A;  2N9B A;  1GU4 A;  1N73 A;  2YKP A;  1KFN A;  4LGD E;  5AW4 B;  1HVV A;  3O8Z A;  1URQ B;  1LTG C;  1FJP A;  1ZV8 A;  1LWU A;  2QM7 A;  3P32 A;  2KSJ A;  2M8R A;  4W7Y A;  2OYI B;  3RK2 D;  3U1C A;  1M7L A;  3M91 A;  2WSF H;  3MD0 A;  1T2K D;  1SFC A;  2JEE A;  3WMM 0;  3A2A A;  5BVZ A;  1L0N K;  2NPS D;  3V5B A;  3HUS C;  1E5W A;  1EQ7 A;  1FAV A;  1NTM K;  1VPC A;  1LTA C;  3V4Q A;  5AW9 B;  2H8P D;  3HE5 B;  2I1K A;  1NKZ B;  1W2E A;  3VTP C;  3MUD A;  3GHG A;  1IFN A;  4GKG A;  3RL0 D;  4IFF A;  3P7K A;  3H32 B;  1FOS E;  1H89 A;  5CCH C;  1L0L K;  2HFE D;  3U1A A;  3B8E B;  2BAS A;  3B5N A;  1LTJ C;  2M3B A;  3HTK B;  3VYI A;  2IX7 C;  1N73 B;  1NKN A;  2CPS A;  1HBW A;  2N1T A;  1HJB A;  2NPS A;  1IK9 A;  2C0W A;  1J2J B;  1GL2 D;  1L4A D;  2KP8 A;  2YKO A;  3P8M C;  1LWU B;  1GW3 A;  1JMM A;  2FFD C;  2YNY A;  1ZN5 A;  1GK4 A;  1N7S A;  3KYQ A;  1NAF A;  2WT7 A;  1LT9 A;  1FZA A;  1KIL C;  2W27 A;  3IR9 A;  5AVZ B;  1JOC A;  1A02 J;  1KQL A;  2R5D A;  1JY2 N;  1H8A A;  2HG5 D;  1SFC B;  5CJ0 A;  3OA7 A;  1RF1 A;  3HD7 A;  5AVS B;  3HE4 A;  2O1K A;  4WY4 D;  3II6 A;  4XE5 B;  2J59 M;  3TSI A;  1NOH A;  1X8Y A;  3GHG B;  3RK3 D;  4AYC A;  3OAK A;  5AW2 B;  1URQ C;  4JF7 A;  5KJ7 A;  1FOS F;  2XU6 A;  1QL2 A;  1NU1 K;  3VP8 A;  1HH0 A;  1FZC A;  3B5N B;  1FU1 A;  4N78 E;  1RF0 C;  2KYV A;  5AVQ B;  2Q9I A;  2OYI C;  4W80 A;  3VP9 A;  1G1I A;  1A02 F;  4DZO A;  2N1T B;  4WBA A;  2NPS B;  2I1J A;  1MV8 A;  1J1D B;  3KPE A;  1JTH A;  1WRG A;  3MIW A;  1NHL A;  1ZLL A;  1IC2 A;  1N7S B;  1DH3 A;  2ZFC A;  2WT7 B;  5APU A;  2FKW B;  2PAJ A;  1LT9 B;  5CJ4 A;  1T3J A;  4I1L A;  5AVV B;  1X9V A;  3LW5 H;  1IFJ A;  1SQP K;  1SLQ A;  3H6P A;  1CW5 A;  3IFM A;  1HGV A;  2Z5I A;  2QM8 A;  1S9K E;  2Q5U A;  1JO5 A;  2IPP A;  4KHX A;  1RE4 A;  1JCC A;  3HD7 B;  3HE4 B;  1Z56 A;  1RF1 B;  4ZKP A;  1N73 C;  2Z4E A;  4I2L C;  3A3Y B;  3LIE A;  5CCG D;  2Q3I A;  1SQV K;  3NFQ A;  2FYU K;  2FYZ A;  3N4X A;  4M3L A;  3M0D A;  3M0A A;  1LWU C;  2KOG A;  4LLH A;  1FZF A;  1YYC A;  1SVF A;  3BVH A;  1FZC B;  2A45 I;  3BRV B;  2HLO A;  3M9B A;  5AW7 B;  1GTW A;  1IO4 A;  1SFC C;  2E42 A;  4IFD K;  2HYN A;  4LC1 A;  1KIL D;  1RE3 A;  1LGH B;  1JNM A;  4IFM A;  3N7N A;  1VDF A;  1JTH B;  2W6B A;  5CCG A;  2H43 A;  4N78 D;  3BAT A;  3GHG C;  3L35 A;  1NTZ K;  1NO4 A;  3TK1 A;  3BAS A;  1IFI A;  2WPS A;  3L36 A;  2YKQ A;  2H7H A;  1CI6 A;  3G3Z A;  1IJD B;  1YTZ I;  3B5N C;  1URQ D;  1GD2 E;  2L5G B;  2XV5 A;  3I5C A;  2PP6 A;  1M1J A;  1GDT A;  1T2K C;  4XA4 A;  1JUN A;  3OJA B;  3M9Q A;  2N1T C;  2YO2 A;  2P67 A;  2NPS C;  4C7N A;  1HTL C;  1GZL A;  1J1D C;  2Q7C A;  1HWT C;  1PFI A;  1G2C A;  3EQ2 A;  1OXZ A;  1S9K D;  1NH4 A;  2J58 A;  2ZXE B;  1N7S C;  1RY3 A;  3M9H A;  1IFM A;  3VMY A;  1AQ5 A;  1LT9 C;  1GL2 A;  5AVT B;  2MJZ A;  1L4A A;  2A45 G;  2WWW A;  3C9I A;  1NTK K;  3M06 A;  5CMZ A;  1DX7 A;  2WSE H;  4HYT B;  5APS A;  1RF1 C;  3HD7 C;  1MFZ A;  2OYH A;  4W7Z A;  5KTB A;  2C0X A;  2WSC H;  3E1I A;  3U59 A;  2FXM A;  1FZG A;  1CSB A;  3RK2 B;  1HGZ A;  1JCD A;  1SP4 A;  2P7J A;  2HPC A;  1GU5 A;  5AVR B;  3V2R A;  5KJ7 C;  4C7R A;  4DOJ A;  4ZKU A;  3MGN A;  2LKM A;  1CI6 B;  1J1E B;  4WY4 A;  1FZC C;  5AW1 B;  5AW5 B;  4JYB A;  2XZR A;  3EFG A;  2IFM A;  3KDP B;  2HOD A;  3RL0 B;  1M1J B;  3PP5 A;  2R32 A;  2YMY A;  1AFO A;  5AVX B;  3CI9 A;  3R2P A;  4I6M C;  4C7N B;  1FJK A;  3VMX A;  1X79 B;  1FDM A;  1QL1 A;  3KQG A;  4N3Y B;  4O9B A;  2POH A;  4OH8 B;  3VOP A;  1G2C B;  3SWY A;  5AVY B;  5APW A;  1SFC D;  1ZR2 A;  3A5T A;  5APY A;  5CCH D;  1GL2 B;  4Y99 B;  1LTI C;  3HRN A;  1L4A B;  5APX A;  1XTG B;  3P8C E;  1JY3 P;  4RES B;  1LTT C;  3NTN A;  5BU5 A;  5APT A;  3T97 A;  1MUU A;  3L4F A;  3HUS A;  1RE4 C;  2OYH B;  1SQQ K;  3SWF A;  3TYY A;  4JYC A;  3MTU E;  1N86 A;  2GUS A;  3B5N D;  2HPC B;  1KZU B;  3M0D C;  2A45 H;  5BU8 B;  1OWA A;  4EOT A;  3V2N A;  2N1T D;  4C46 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...