1J2JB

Crystal structure of gga1 gat n-terminal region in complex with arf1 gtp form
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
41
structure length
41
Chain Sequence
IFEDEEKSKMLARLLKSSHPEDLRAANKLIKEMVQEDQKRM
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Protein transport
molecule keywords ADP-ribosylation factor 1
publication title Molecular mechanism of membrane recruitment of GGA by ARF in lysosomal protein transport
pubmed doi rcsb
source organism Mus musculus
total genus 15
structure length 41
sequence length 41
ec nomenclature
pdb deposition date 2003-01-05

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF18308 GGA_N-GAT GGA N-GAT domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1j2jB00
2R5BA 2C9LY 2WPRA 1GU4A 1SLQA 3NFQA 3MD0A 1NWQA 1CZQA 5AW4B 1GK4A 2YO2A 1GU5A 2R32A 2QM8A 5AW6B 2JJLA 1HUCA 1G2CB 1A02F 3KDPB 3VMXA 2XV5A 3NXSA 5APSA 5AVSB 5AW3B 3TK1A 2Z5HA 3VMYA 3VN0A 1GTWA 5CMZA 2BASA 3M0DA 3O8ZA 5APQA 5AVUB 5AVTB 3A2AA 5AVQB 1FOSF 1DH3A 1T2KC 1GK6A 4HYTB 1CI6A 2ZFCA 1IO4A 3MGNA 4JYBA 5AW8B 4DZOA 1CI6B 2E42A 1NAFA 3HE5A 3M91A 3LIEA 3UIAA 1MUUA 2VRSA 3HE5B 4XE5B 2ZXEB 3VYIA 1GD2E 1OXZA 3V4WA 1FAVA 2P2UA 2W27A 4GT1A 4RESB 5AVRB 1SP4A 2E43A 3L37A 1FOSE 1YYCA 3SWFA 4B86A 3IR9A 2Q7CA 1JNMA 2WPQA 2IPPA 5AVZB 2KP8A 5APXA 2Q3IA 1T2KD 2P67A 3TYYA 4GKGA 4I2LC 3V5BA 2H7HA 4AYCA 5AW5B 3VTPC 2YO3A 2W6AA 5AVVB 5APWA 3L36A 4JYCA 5AW1B 2YNYA 2Z5IA 1OWAA 3NTNA 2WWWA 5APTA 3TNUA 4LC1A 3M0AA 5APYA 3A7OA 3TNUB 4EOTA 3LIDA 3I5CA 3NMDA 3KQGA 4M3LA 1H88A 2P7JA 1HWTC 4AUWA 3T97A 2R3CA 5AW0B 3HTKA 1S9KD 2C9NY 1X8YA 4KHXA 1H8AA 1CSBA 1HJBA 1A02J 5AVWB 1MV8A 2XU6A 1KQLA 3A3YB 4AQRD 3HE4A 3P32A 5APVA 1HBWA 1MFZA 1GZLA 3B8EB 3L35A 4C7NA 5AVXB 3OAKA 3M9BA 5APUA 2WT7A 2XZRA 3HE4B 5AVYB 3V4QA 1J2JB 3P8MC 2Q5UA 4I6MC 3M06A 1JUNA 4C7NB 2WT7B 1H89A 5AW2B 5AW9B 2N9BA 2R5DA 3P7KA 2WTYA 3A5TA 3VMZA 4C46A 5AW7B 2QM7A 3M9HA 1S9KE 2WPSA
chains in the Genus database with same CATH superfamily
3ITKA 1PPJE 2YO2A 2HLOA 1NU1E 1IFMA 2V7QH 1RF1B 3FWNA 1DD4A 4IL6H 2ZT9B 3AEDC 5AVUB 1SQXJ 3I55P 1IK9A 1ZV8A 1UIXA 1KN7A 4H13B 2OYHB 1KMIZ 3H1IG 1KYOE 1MKMA 3V2QA 1YITP 2Y0DA 2P67A 3Q5RA 3U1AA 1SQVG 2B88A 1AV1A 3RK3C 5AW5B 2JKVA 1NU1J 2XKMA 1SQQG 4LC1A 3L74G 1SQBK 1K8AQ 1H0TB 3RGUA 3QWOC 2CPSA 3CD6P 3IF4A 2ZAEB 1VDFA 1LTTC 3H32A 1PPJD 3HD7A 1JY3P 2D2CB 1BDDA 2W6BA 3CCRP 1NU1D 2QA4P 1MFZA 1LGHB 2Q3EA 1HH0A 4H0LC 1KB9I 4H44C 2JWDA 3A5TA 2E75D 2IZ0A 3KZIE 1R5SA 3KPEA 5CHXA 3CCEP 3BCCE 2HYNA 3RBXA 1KYOD 1PZQA 2E76C 1RF1A 4DT0A 5CCGD 1K04A 1SQXK 1Y47A 3VMYA 1GTWA 1VF5C 4EIJA 1T2KC 1GK6A 1NTMD 2CK3H 1ZOYC 2OYHA 3M91A 3HD7D 3UIAA 1FDIA 2WZ7A 1OXZA 1YTZT 1S5LX 2E74D 2J58A 2BEZF 3GHGB 5AVZB 1BDCA 1EDIA 1OW8A 1NU1K 1LTSC 3BCCJ 5KAFE 2KYVA 1PL5A 3Q5SA 5KAIE 2W6AA 4JYCA 2AEMA 1H0TA 3A7OA 3GLMA 4RJTA 3L73G 1EZVE 2OTKE 3KZIH 1UIIA 3CCLP 3BCCD 1FU1A 2BCCG 4L74A 3AEAC 5CCHA 3AE7C 2FXOA 1VQPP 3HE4B 4U3FD 2N9BA 3B71A 3WUUA 4YPCA 1R5LA 3RK2C 2PFXA 1OFCX 3HTKB 1CZQA 3RK3E 4N78D 1A02F 4NPFX 3JCUE 2OYIB 1YHQP 3EQ2A 1T8ZA 2D2CD 5KAIH 3VMAA 3CCJP 1J1EB 3CCUP 1USDA 1JY2P 3HE5B 1M1JC 3GHGA 1EZVD 4TT3H 2WPQA 1NJIQ 4DCKA 1ZW0A 2Q3IA 2QJKB 4WY4C 4W7ZA 4BXLA 2G8YA 1FC2C 5APWA 4Y28J 2ZXXA 5KTBA 2CPBA 3NTNA 4PD4I 1QL2A 2PGDA 3KQGA 2QE7H 3H1IE 2KUBA 2FYUD 2JR8A 1VQ7P 1HJBA 3RK3D 1T3JA 4AQRD 3PP5A 3HE4A 2R44A 1HBWA 5BU8B 2SPZA 5APUA 2XZRA 1YJWP 4I6MC 3JCUH 3M06A 1SQVE 1OIPA 3WUVA 2YIUC 2OYOA 3TSIA 4YXDC 3M9HA 4L76A 1SQQE 3V6IA 2N1TB 1GU4A 3EFFK 3L74E 3ZDMA 1PP9G 3RL0C 1HUCA 1T3UA 1FZAA 3NXSA 1QVFO 1U7MA 2ZYAA 4H0LD 4H44D 2Z5HA 3H1LG 2BASA 2OYIA 3H1IJ 1JOCA 1FOSF 2GUSA 2HPCB 2KSJA 1IO4A 1LT9C 4NPDA 3CMAP 3HE5A 2VRSA 3C8VA 4OVNF 3S4RA 1FDOA 4XE5B 1NTMG 1SQVJ 2E76D 3FXDA 2MJZA 3QH9A 1VF5D 4BRYB 3Q1MA 3PHLA 1NAYA 3H1ID 1VPCA 3M9QA 1SQQJ 1T2KD 3OA7A 3VP8A 3L74J 4KT0J 2H8PD 5L8RJ 1ZR4A 4XA4A 2LXBA 1M56D 4XFJA 1RF0C 4IL6X 2YMYA 2KI7B 3CCMP 1SS1A 2IBZI 3L74D 2XU6A 3AE8C 1NHLA 4ZMDA 3G3ZA 4GDOA 2HODB 1IC2A 4ZKUA 5KJ7C 4Z1MH 1RY3A 2OQQA 1CW5A 2R5DA 2WTYA 3VMZA 2N1TA 3PH0A 3CL3D 3MUDC 2O01J 4U3FG 3L73E 5E79E 1HTLC 1OVVA 3PJSK 3AEFC 2BCCE 2HPCA 1U7JA 5AVQB 4N3YB 2AXTE 2ZFCA 3RK2D 5AW8B 1SQVK 3C9IA 1MUUA 5KLIB 5H2FE 3V4WA 1SQQK 4BRYA 1VQLP 3HUSC 3TDKA 1S2EA 2ZVOB 1IK7A 3Q3DA 3O6QB 3L73J 3E1RA 1EZVG 2P58A 2Z5IA 2WSCJ 2BCCJ 4UB8E 1N86A 4DJGA 1EC5A 2DW3A 3LIDA 3FX0A 4AUWA 2KOGA 1X8YA 4YTPC 1YI2P 2E75B 2HODA 4WY4D 1GW3A 3SWYA 3AE6C 2WSFJ 2GM4A 3MIWA 5AVXB 2WSCH 1ZLLA 2ZJSE 3V4QA 1J2JB 2FYUG 2FBWC 1R8EA 1EDLA 4D6TG 3AE3C 2AXTH 2RH0A 1GL2C 1BE3D 2JWAA 2OGUA 5APSA 4HB1A 4PD4D 2C9LY 2QSIA 1LT9A 2Y9YA 4HH2A 5H2FH 3ABVC 4I7ZC 4I1LA 3Q5PA 2E74B 3A2AA 1VQKP 1M90Q 2H88C 2NPSC 4ASVA 2R3SA 1DD3A 5CJ0A 1EXJA 2WSSH 3RL0D 2V4HA 1PGJA 3E7KA 4UB8H 2KZIA 3L37A 2W83C 3SWFA 3N7NA 2IPPA 3O6QA 2QJPC 1PP9E 1LTJC 2G3AA 2POHA 1M8OB 2KSEA 2Q1KA 3C1LA 4AYCA 5TJHA 3H1LE 1S4XA 5KJ7A 1LTBC 1QX8A 3I5CA 2P10A 2NZ2A 3F89A 5K5GB 1NTME 1N73B 3MUDA 4GIFA 2XNDH 3AE1C 2Q6QA 3OJAB 1VQNP 3R2PA 4IFFA 3B8EB 2FY8A 4NPEA 5CCGA 2W6JH 3FGAD 3H25A 1NYHA 1JMBA 1PP9J 1G1JA 2A06D 2K9YA 2A45H 3CX5D 1PGOA 3U59A 1NKNA 3H1LJ 1VQ4P 4YXWH 1ZN5A 2HFED 4MN4C 5KJ7D 1NVOA 3GMAA 1QVGO 2IBZD 3AEEC 5AW3B 2K1AA 5CBOA 1W2BO 5APQA 1PP9D 4HYTB 1NTMJ 2O1KA 1FZEA 1NAFA 2M5AB 3LIEA 3H1LD 1KYOH 4KJMA 5B66E 3L4FA 3H1KG 2E5YA 4U3FE 3IR9A 1Q81Q 4LGDE 3JSVC 2YKPA 1EQ7A 3SFDC 2Y0CA 3E1IA 1W5CE 5AW1B 3USSA 3RK3B 3VOPA 1NGMB 1IZNB 4N78E 5APYA 2FKWB 1KQGB 3B5NC 1KC8Q 4HJGH 3CXHI 1RE3C 3GF7A 1N73A 2IYPA 1MFTA 3JC22 1H8AA 1HGZA 3A3YB 1Q2NA 1URQC 5AVYB 2WPVB 4W7YA 4U3FJ 5TISE 3CI9A 1L0ND 4H0LB 4H44B 3IN6A 5AW7B 5GTIE 2WPSA 3NFQA 1G2CB 2KNCB 5B66H 3RL0g 1BE3G 1NTMK 2E76B 1Z56A 2JO1A 1OW7A 1L4AC 1OMIA 1VF5B 1GL2D 2M5AA 2FYUE 3AE5C 2LR2A 4PV1C 2L5GB 4U7JA 4D6TE 3D71A 1L0LE 3CWBE 1WRGA 3BRTB 3M0DC 2I8DA 3B5NB 2KK7A 2NPSD 5KAFH 1PIXA 2YO3A 2Y0EA 3CPWO 2AEJA 2OARA 4RKUJ 1AVOA 5GTIH 2FYUJ 2FYNC 1QGKB 2PRRA 1KB9E 1JCDA 4D6TJ 1NOHA 1GZLA 1L0LJ 3CWBJ 3M9BA 3SFEC 3P8MC 2HR3A 4C7NB 5AW2B 3D6ZA 2GA1A 1PV3A 4IFMA 1IFIA 2MKVA 1N2DC 1G2CA 1P84I 2KNCA 2LXCB 3RK2B 4D6TD 2A06G 1L0LD 3CWBD 1SQPD 3F5HA 2WSEJ 2H89C 2AEFA 2W8ZA 2RKLA 1VQ9P 4C7RA 4UB6E 2IBZG 1CI6B 4GODA 2FYZA 3S1KA 1NTZJ 1YJ9P 2KXPB 4GT1A 1KILC 4RESB 2WSEH 3B5NA 4B86A 1M1JB 2FXPA 1JNMA 3H1HG 5GTHE 1JTHA 1HJ0A 5KKZC 1KB9D 1KB9H 2KLVA 4WY4B 1KQFB 2WWWA 1N7SC 1OX3A 1NTZD 1FBMA 4EOTA 1NH4A 2FYUK 1FZFA 1WT6A 2IX7C 1H88A 2P7JA 1NTKD 1CSBA 5B5EE 1YQ4C 1Q90D 1BSNA 3FWLA 3H1KE 1K05A 2FFDC 5APVA 1GDTA 1DEBA 4C7NA 3OAKA 2K37A 3A0HE 3B5ND 1EDJA 4UB6H 4PJ0E 3L70G 2YIUB 1AFOA 3CXHD 4WB4A 2A45I 1L0NG 1URQD 2I1KA 3VMXA 2E5TA 1AJYA 4OGQC 2XV5A 1VQ6P 3RL0B 3A0BE 1XTCC 3L72G 3M0DA 1FZCC 5GTHH 1KILB 3O8ZA 4JF7A 3TF5A 2N9YB 1CI6A 2BEQD 1M7LA 2M3EA 3H1KJ 1JB0J 3AEGC 1LT9B 1GD2E 1N7LA 1FAVA 1M1JA 1XTGB 4EYYQ 1YYCA 2KS1B 3H6PA 3B4SA 1KYOI 3G6EP 3G9RA 5EFWB 1LTAC 1L4AD 3TYYA 3SWKA 2FXMA 5B5EH 1JCCA 1BE3E 2H7HA 3CC2P 4WY4A 3H1KD 4PD4E 2O01H 1RH5B 2O01N 4PV1D 4L75A 5APTA 4O9BA 3A0HH 3CCVP 1WMKA 1HWTC 4Y99C 1HVVA 3L75D 2ZVNB 3MZWB 2QG4A 2QJYC 2KB7P 4CPGA 3A0BH 3CMEP 1KILE 4OGQB 1RE4C 1FZCB 1BE3J 3WUTA 2WPRA 1FZBA 1GK4A 3CC4P 1GU5A 5E79H 3II6A 1PGPA 2R32A 3KXDA 2WITA 1RF1C 4JQ0D 2IFMA 2ZT9C 1KILA 3AE4C 3TGUD 4IL6E 1L2PA 4LLHA 4H13C 1L0LG 3CWBG 2OYHC 1VQMP 1SQPG 4PD4H 1RHZB 2WSFH 1OZHA 1JY3O 2YMKA 3VYIA 1BGYG 3H1JD 2H43A 2KS1A 1P84D 1QLED 1J1DC 3G71P 1S1CX 1YJNP 4IOIH 2KP8A 3HUSB 2A06E 4I2LC 3MHVA 4Y99B 3CX5E 4BWNA 3L36A 2WMMA 1OWAA 1U57A 1KORA 2M3BA 1KILD 3AE2C 2IBZE 1RF0A 1NTZG 5CCHC 1A02J 1EZVI 3MTUE 1Y9BA 4IFDK 2GUVA 3AEBC 3H1HE 1N7SD 1DIPA 1BCCG 1GMJA 2Q5UA 1NTKG 1JO5A 1YBKA 5AW9B 1LP1B 5DJUB 1FZCA 2QM7A 2P1JA 1LNQA 3V2PA 3MD0A 1GL2B 5BU5A 1AVYA 1K9MQ 2WQYC 3KHUA 3D6YA 1JMMA 4I7ZB 3KYQA 1SQXD 1J1DB 1M1KQ 3L71G 3CX5H 1SVFA 4DZOA 3CLQA 2NPSB 3PLNA 3H1HJ 1GW4A 2YXQB 3GHGC 3L70E 4OGQD 1FOSE 1VL2A 3HUSA 1LWUC 3OW2O 5APXA 1EDKA 1L0NE 3LW5J 1IJDB 3V5BA 2QJPB 4EI2A 1LTJB 5AVVB 3L72E 3H1HD 3S9OA 1RQUA 2K88A 1OVUA 1QL1A 3D70A 1X79B 1X22A 2ZYDA 1RE4A 4N6JA 1S72P 1OVRA 3VP9A 3LW5H 1YIJP 5AVWB 4DOJA 2W90A 2M0BA 3L70J 1LP1A 3G4SP 1E5WA 3L75G 2JEEA 2WT7B 1JY2O 5M1BA 2J5UA 2YXRB 3K5BA 1N8RQ 1L0NJ 1Y8AA 1S3JA 4C46A 1Q86Q 1S9KE 2Z4EA 1GL2A 1FS0E 5KLVG 1SLQA 2B89A 1MZ9A 5AW4B 3L72J 2RMZA 2C0WA 1HF9A 1QEXA 2K9JB 1IFPA 1KFMA 4GOFA 3L70D 1JY3N 3TK1A 2OYIC 5CMZA 3PTZA 1USEA 2ITAA 1DH3A 1RQVA 1LWUB 1J1EC 2NPSA 3MGNA 1Q82Q 1LTGC 2E42A 3TGUG 3V2RA 3L72D 3V2NA 2YKQA 2IDBA 2JDIH 2P2UA 2ZT9D 2KZJA 5AVRB 4ZNCA 2KLUA 3R4YA 2QJKC 1E79H 1NKZB 3FXEA 4GKGA 1LTJA 4H13D 3CCSP 3H1JG 3IFMA 2XNXA 4WBAA 1YQ3C 1D7MA 3WMM0 2B9BA 1K73Q 1SQPE 4OWFA 1SFCC 2K3RA 1DEEG 1S9KD 2C9NY 1BGYE 4K35A 3T97B 1JTHB 2OTJP 1MV8A 2IYOA 2WT7A 1L0NK 1SQBG 3P8CE 1JM0A 1URQB 5DJTB 5TISH 3Q2YA 3SSUA 2N1TC 1PGQA 1LJ2A 2J59M 3BASA 2R5BA 2K9JA 5CCHD 2O1JA 2JJLA 1S5LE 1ZMEC 1SQPJ 5AVSB 1NTZE 1X9VA 1LWUA 1HGVA 5CBNA 1BGYJ 1BCCE 1L4AB 1NTKE 2L91A 2IZ1A 1FE6A 1SQXG 1Q7YQ 1KFNA 4PV1B 1SP4A 2C0XA 2O3JA 1BGYD 3RBZA 3GG2A 1SFCB 4W80A 2NRGA 2A45G 4ZKPA 3CXHE 3M0AA 3P8CD 3L71E 3TNUB 1VQ8P 1PPJG 2QRXA 1VQOP 3NMDA 1JY2N 1NU1G 2ZYGA 3T97A 1RE3A 3HTKA 1BCCJ 1X0TA 2PAJA 1NTKJ 1KQSO 1PFIA 3AE9C 2FYNB 1S5LH 1YTZI 3L35A 1URQA 1JUNA 1IFNA 1JEKA 1KD1Q 1BCCD 2XDJA 3MP7B 1BSHA 1L0LK 1NWQA 4QMAA 1SQPK 5CJ4A 2AXCA 1NO4A 4L73A 1KTMA 3HRNA 4A7PA 3CC7P 3L71J 1IFJA 3PRJA 3BVHA 3GF3A 1L4AA 3CCQP 1FDMA 3L75E 4JYBA 5KLIC 1FZGA 1OW6A 1ZR2A 1AQTA 3CXHH 3CX5I 2ZXEB 1SQVD 3L71D 2W27A 5KLVE 1SFCA 1G1IA 2QVAA 1SQQD 4EDFA 1NTZK 3U1CA 3TNUA 2WVRA 5KKZB 3BCCG 1FJKA 3IAOA 1N7SB 1NTKK 3TGUE 4M3LA 2E75C 2Q9IA 3EWKA 3L75J 4KHXA 4WWIA 2RN0A 2YKOA 1LT1A 4RO0A 4HKZH 2UWJE 1KQLA 1TU3F 2HG5D 5CCGC 5C39A 5KLVJ 2FFDB 1H89A 3H1JE 3N4XA 3WU2E 1P84E 4K3AA 2QIWA 1DX7A 1SFCD 2B87B 4PJ0H 1W2EA 4GOEA 4JPZB 3HD7C 3AECC 1AQ5A 5AW6B 2QM8A 4R4LA 3KDPB 3I56P 2E74C 4R4MA 5KLVD 2Y9ZA 1ZRTE 3TGUJ 1EXIA 1AA0A 3VN0A 5AVTB 2N1TD 1KV4A 1SQBE 2OTLP 2LKMA 2JP3A 2M8RA 1ZXGA 3H1JJ 1VQ5P 4WVZA 2E43A 2Q7CA 1ZP0C 1IFDA 1M57D 1T6AA 3GW6A 3L73D 1LTIC 4JBZA 3VTPC 2YNYA 1N7SA 2BCCD 2PP6A 1FJPA 2IFNA 3WU2H 1P84H 1N73C 2QEXP 3W68A 4ASWA 4TLFA 2R3CA 5AW0B 1SQXE 4OH8B 1SQBJ 3W67A 5KLVK 3BRVB 3P32A 3H32B 3HD7B 2FFDA 2QJYB 3EFGA 2KIKA 2V7QJ 1ZRTD 2I1JA 1KZUB 3BATA 2B87A 3P7KA 5BVZA 2D2CC 1SQBD
chains in the Genus database with same CATH topology
3CL3D 4IFMA 1IFIA 1SLQA 1MZ9A 1G2CA 1N2DC 5AW4B 2C0WA 2YO2A 3RK2B 1KFMA 2HLOA 1IFMA 1HTLC 1RF1B 1JY3N 3TK1A 2OYIC 5CMZA 2HPCA 5AVUB 5AVQB 1DH3A 4N3YB 4C7RA 1LWUB 1J1EC 2NPSA 2ZFCA 3MGNA 3RK2D 1IK9A 5AW8B 1CI6B 1LTGC 1SQVK 1ZV8A 2E42A 3V2RA 3C9IA 3V2NA 2FYZA 2OYHB 1MUUA 2YKQA 3V4WA 2P2UA 3V2QA 4GT1A 1KILC 1SQQK 4RESB 5AVRB 2WSEH 3HUSC 3B5NA 4B86A 1M1JB 1JNMA 1JTHA 2P67A 1NKZB 4GKGA 3U1AA 1LTJA 3IFMA 4WBAA 2XNXA 3RK3C 5AW5B 3WMM0 2KLVA 4WY4B 2Z5IA 2XKMA 2WWWA 1N7SC 4LC1A 1FBMA 4EOTA 1N86A 1NH4A 1SQBK 2FYUK 3LIDA 1FZFA 1WT6A 2IX7C 1H88A 2CPSA 1SFCC 2P7JA 4AUWA 1S9KD 2KOGA 2C9NY 1X8YA 1CSBA 1VDFA 2HODA 1JTHB 4WY4D 1LTTC 1GW3A 3H32A 3SWYA 1MV8A 3HD7A 2GM4A 1JY3P 2W6BA 5APVA 2FFDC 1GDTA 1DEBA 1MFZA 3MIWA 4C7NA 2WT7A 5AVXB 3OAKA 1LGHB 2WSCH 1ZLLA 3V4QA 1J2JB 1L0NK 3P8CE 1HH0A 1URQB 3B5ND 3A5TA 2N1TC 1GL2C 2J59M 3KPEA 3BASA 1AFOA 5APSA 5CHXA 2R5BA 2C9LY 1LT9A 2HYNA 5CCHD 2O1JA 4WB4A 2A45I 2JJLA 4HH2A 1URQD 1RF1A 2I1KA 3VMXA 5CCGD 2XV5A 1SQXK 5AVSB 4I1LA 3RL0B 1X9VA 3VMYA 1XTCC 1GTWA 3M0DA 1FZCC 1LWUA 1KILB 3O8ZA 1HGVA 4JF7A 3A2AA 4EIJA 1T2KC 2NPSC 1GK6A 1CI6A 1M7LA 5CJ0A 2OYHA 1L4AB 3M91A 3HD7D 3UIAA 2WZ7A 1LT9B 3RL0D 1GD2E 1N7LA 1OXZA 1YTZT 1FAVA 1KFNA 1M1JA 1XTGB 1SP4A 2J58A 3L37A 1YYCA 3SWFA 3N7NA 3H6PA 3GHGB 2IPPA 5AVZB 2C0XA 1LTAC 1L4AD 1LTJC 1NU1K 3TYYA 1LTSC 2POHA 2FXMA 1JCCA 1SFCB 2KYVA 4W80A 2H7HA 4WY4A 4AYCA 2O01H 2W6AA 4JYCA 5KJ7A 2A45G 5APTA 4ZKPA 4O9BA 3M0AA 3P8CD 3A7OA 3TNUB 1LTBC 3I5CA 3NMDA 1JY2N 1HWTC 3T97A 4Y99C 1RE3A 3HTKA 1HVVA 2PAJA 1N73B 1FU1A 3MUDA 4GIFA 5CCHA 2KB7P 3OJAB 1PFIA 3R2PA 1YTZI 4IFFA 3B8EB 3L35A 1URQA 3HE4B 5CCGA 1JUNA 2N9BA 1IFNA 1RE4C 1G1JA 2A45H 1FZCB 2XDJA 3RK2C 2WPRA 1L0LK 1FZBA 1NWQA 3U59A 1SQPK 1NKNA 1CZQA 3HTKB 5CJ4A 1GK4A 1NO4A 1GU5A 3II6A 1ZN5A 2HFED 2R32A 4N78D 2WITA 1RF1C 1A02F 2IFMA 3HRNA 5KJ7D 1IFJA 1KILA 5AW3B 5APQA 3BVHA 4LLHA 1L4AA 4HYTB 2OYIB 1FDMA 3EQ2A 1T8ZA 2OYHC 2O1KA 4JYBA 1FZGA 1FZEA 1NAFA 3LIEA 1J1EB 1ZR2A 2WSFH 1JY2P 3HE5B 1JY3O 2ZXEB 3VYIA 1M1JC 3L4FA 2H43A 2W27A 3GHGA 3IR9A 1J1DC 2WPQA 4LGDE 2YKPA 1SFCA 1G1IA 1EQ7A 2KP8A 3HUSB 2Q3IA 4I2LC 4WY4C 3E1IA 4Y99B 4W7ZA 1NTZK 5AW1B 5APWA 3L36A 3U1CA 3RK3B 5KTBA 2CPBA 1OWAA 3NTNA 3TNUA 3VOPA 4N78E 5APYA 2FKWB 1FJKA 2M3BA 1KILD 1QL2A 3B5NC 1N7SB 1NTKK 3KQGA 4M3LA 1RE3C 1RF0A 1N73A 2Q9IA 4KHXA 2YKOA 1H8AA 1HJBA 5CCHC 1A02J 1HGZA 3RK3D 1T3JA 1KQLA 3A3YB 3MTUE 4AQRD 4IFDK 3PP5A 3HE4A 2GUVA 1HBWA 1URQC 5BU8B 5APUA 2HG5D 1N7SD 5CCGC 2XZRA 5AVYB 2Q5UA 4I6MC 3M06A 2FFDB 1H89A 4W7YA 1JO5A 5AW9B 3N4XA 1FZCA 3CI9A 1DX7A 1SFCD 3TSIA 5AW7B 2QM7A 2P1JA 3M9HA 3V2PA 1W2EA 2WPSA 2N1TB 1GU4A 3NFQA 3MD0A 3HD7C 1GL2B 5BU5A 1AQ5A 5AW6B 2QM8A 3RL0C 1HUCA 1G2CB 1T3UA 1FZAA 3KDPB 3NXSA 1NTMK 2Z5HA 3VN0A 1Z56A 2BASA 2OYIA 1JMMA 5AVTB 1JOCA 1L4AC 2N1TD 3KYQA 1FOSF 2GUSA 1J1DB 2HPCB 2KSJA 1GL2D 1SVFA 1IO4A 1LT9C 2LKMA 4DZOA 3CLQA 2NPSB 3HE5A 2M8RA 1GW4A 2VRSA 2L5GB 4XE5B 3GHGC 1WRGA 2E43A 2MJZA 1FOSE 3BRTB 3HUSA 3M0DC 2Q7CA 1LWUC 3B5NB 1IFDA 3M9QA 1VPCA 5APXA 1T2KD 2NPSD 3OA7A 3VP8A 1IJDB 3V5BA 2H8PD 1LTIC 1LTJB 3VTPC 2YO3A 5AVVB 2YNYA 1ZR4A 4XA4A 1N7SA 2PP6A 1FJPA 2OARA 1QL1A 2IFNA 1X79B 1RF0C 1N73C 1RE4A 4N6JA 2R3CA 5AW0B 4OH8B 2YMYA 3VP9A 3LW5H 5AVWB 2XU6A 4DOJA 1NHLA 5KLVK 3G3ZA 3BRVB 2HODB 3P32A 1IC2A 1JCDA 3H32B 4ZKUA 5KJ7C 1NOHA 3HD7B 1GZLA 2FFDA 1RY3A 3M9BA 3EFGA 1E5WA 3P8MC 4C7NB 2JEEA 2I1JA 2WT7B 1CW5A 1JY2O 1KZUB 5AW2B 2R5DA 3BATA 3P7KA 2WTYA 5BVZA 3VMZA 2N1TA 4C46A 1S9KE 2Z4EA 1GL2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R5B A;  2C9L Y;  2WPR A;  1GU4 A;  1SLQ A;  3NFQ A;  3MD0 A;  1NWQ A;  1CZQ A;  5AW4 B;  1GK4 A;  2YO2 A;  1GU5 A;  2R32 A;  2QM8 A;  5AW6 B;  2JJL A;  1HUC A;  1G2C B;  1A02 F;  3KDP B;  3VMX A;  2XV5 A;  3NXS A;  5APS A;  5AVS B;  5AW3 B;  3TK1 A;  2Z5H A;  3VMY A;  3VN0 A;  1GTW A;  5CMZ A;  2BAS A;  3M0D A;  3O8Z A;  5APQ A;  5AVU B;  5AVT B;  3A2A A;  5AVQ B;  1FOS F;  1DH3 A;  1T2K C;  1GK6 A;  4HYT B;  1CI6 A;  2ZFC A;  1IO4 A;  3MGN A;  4JYB A;  5AW8 B;  4DZO A;  1CI6 B;  2E42 A;  1NAF A;  3HE5 A;  3M91 A;  3LIE A;  3UIA A;  1MUU A;  2VRS A;  3HE5 B;  4XE5 B;  2ZXE B;  3VYI A;  1GD2 E;  1OXZ A;  3V4W A;  1FAV A;  2P2U A;  2W27 A;  4GT1 A;  4RES B;  5AVR B;  1SP4 A;  2E43 A;  3L37 A;  1FOS E;  1YYC A;  3SWF A;  4B86 A;  3IR9 A;  2Q7C A;  1JNM A;  2WPQ A;  2IPP A;  5AVZ B;  2KP8 A;  5APX A;  2Q3I A;  1T2K D;  2P67 A;  3TYY A;  4GKG A;  4I2L C;  3V5B A;  2H7H A;  4AYC A;  5AW5 B;  3VTP C;  2YO3 A;  2W6A A;  5AVV B;  5APW A;  3L36 A;  4JYC A;  5AW1 B;  2YNY A;  2Z5I A;  1OWA A;  3NTN A;  2WWW A;  5APT A;  3TNU A;  4LC1 A;  3M0A A;  5APY A;  3A7O A;  3TNU B;  4EOT A;  3LID A;  3I5C A;  3NMD A;  3KQG A;  4M3L A;  1H88 A;  2P7J A;  1HWT C;  4AUW A;  3T97 A;  2R3C A;  5AW0 B;  3HTK A;  1S9K D;  2C9N Y;  1X8Y A;  4KHX A;  1H8A A;  1CSB A;  1HJB A;  1A02 J;  5AVW B;  1MV8 A;  2XU6 A;  1KQL A;  3A3Y B;  4AQR D;  3HE4 A;  3P32 A;  5APV A;  1HBW A;  1MFZ A;  1GZL A;  3B8E B;  3L35 A;  4C7N A;  5AVX B;  3OAK A;  3M9B A;  5APU A;  2WT7 A;  2XZR A;  3HE4 B;  5AVY B;  3V4Q A;  1J2J B;  3P8M C;  2Q5U A;  4I6M C;  3M06 A;  1JUN A;  4C7N B;  2WT7 B;  1H89 A;  5AW2 B;  5AW9 B;  2N9B A;  2R5D A;  3P7K A;  2WTY A;  3A5T A;  3VMZ A;  4C46 A;  5AW7 B;  2QM7 A;  3M9H A;  1S9K E;  2WPS A; 
#chains in the Genus database with same CATH topology
 3ITK A;  1PPJ E;  2YO2 A;  2HLO A;  1NU1 E;  1IFM A;  2V7Q H;  1RF1 B;  3FWN A;  1DD4 A;  4IL6 H;  2ZT9 B;  3AED C;  5AVU B;  1SQX J;  3I55 P;  1IK9 A;  1ZV8 A;  1UIX A;  1KN7 A;  4H13 B;  2OYH B;  1KMI Z;  3H1I G;  1KYO E;  1MKM A;  3V2Q A;  1YIT P;  2Y0D A;  2P67 A;  3Q5R A;  3U1A A;  1SQV G;  2B88 A;  1AV1 A;  3RK3 C;  5AW5 B;  2JKV A;  1NU1 J;  2XKM A;  1SQQ G;  4LC1 A;  3L74 G;  1SQB K;  1K8A Q;  1H0T B;  3RGU A;  3QWO C;  2CPS A;  3CD6 P;  3IF4 A;  2ZAE B;  1VDF A;  1LTT C;  3H32 A;  1PPJ D;  3HD7 A;  1JY3 P;  2D2C B;  1BDD A;  2W6B A;  3CCR P;  1NU1 D;  2QA4 P;  1MFZ A;  1LGH B;  2Q3E A;  1HH0 A;  4H0L C;  1KB9 I;  4H44 C;  2JWD A;  3A5T A;  2E75 D;  2IZ0 A;  3KZI E;  1R5S A;  3KPE A;  5CHX A;  3CCE P;  3BCC E;  2HYN A;  3RBX A;  1KYO D;  1PZQ A;  2E76 C;  1RF1 A;  4DT0 A;  5CCG D;  1K04 A;  1SQX K;  1Y47 A;  3VMY A;  1GTW A;  1VF5 C;  4EIJ A;  1T2K C;  1GK6 A;  1NTM D;  2CK3 H;  1ZOY C;  2OYH A;  3M91 A;  3HD7 D;  3UIA A;  1FDI A;  2WZ7 A;  1OXZ A;  1YTZ T;  1S5L X;  2E74 D;  2J58 A;  2BEZ F;  3GHG B;  5AVZ B;  1BDC A;  1EDI A;  1OW8 A;  1NU1 K;  1LTS C;  3BCC J;  5KAF E;  2KYV A;  1PL5 A;  3Q5S A;  5KAI E;  2W6A A;  4JYC A;  2AEM A;  1H0T A;  3A7O A;  3GLM A;  4RJT A;  3L73 G;  1EZV E;  2OTK E;  3KZI H;  1UII A;  3CCL P;  3BCC D;  1FU1 A;  2BCC G;  4L74 A;  3AEA C;  5CCH A;  3AE7 C;  2FXO A;  1VQP P;  3HE4 B;  4U3F D;  2N9B A;  3B71 A;  3WUU A;  4YPC A;  1R5L A;  3RK2 C;  2PFX A;  1OFC X;  3HTK B;  1CZQ A;  3RK3 E;  4N78 D;  1A02 F;  4NPF X;  3JCU E;  2OYI B;  1YHQ P;  3EQ2 A;  1T8Z A;  2D2C D;  5KAI H;  3VMA A;  3CCJ P;  1J1E B;  3CCU P;  1USD A;  1JY2 P;  3HE5 B;  1M1J C;  3GHG A;  1EZV D;  4TT3 H;  2WPQ A;  1NJI Q;  4DCK A;  1ZW0 A;  2Q3I A;  2QJK B;  4WY4 C;  4W7Z A;  4BXL A;  2G8Y A;  1FC2 C;  5APW A;  4Y28 J;  2ZXX A;  5KTB A;  2CPB A;  3NTN A;  4PD4 I;  1QL2 A;  2PGD A;  3KQG A;  2QE7 H;  3H1I E;  2KUB A;  2FYU D;  2JR8 A;  1VQ7 P;  1HJB A;  3RK3 D;  1T3J A;  4AQR D;  3PP5 A;  3HE4 A;  2R44 A;  1HBW A;  5BU8 B;  2SPZ A;  5APU A;  2XZR A;  1YJW P;  4I6M C;  3JCU H;  3M06 A;  1SQV E;  1OIP A;  3WUV A;  2YIU C;  2OYO A;  3TSI A;  4YXD C;  3M9H A;  4L76 A;  1SQQ E;  3V6I A;  2N1T B;  1GU4 A;  3EFF K;  3L74 E;  3ZDM A;  1PP9 G;  3RL0 C;  1HUC A;  1T3U A;  1FZA A;  3NXS A;  1QVF O;  1U7M A;  2ZYA A;  4H0L D;  4H44 D;  2Z5H A;  3H1L G;  2BAS A;  2OYI A;  3H1I J;  1JOC A;  1FOS F;  2GUS A;  2HPC B;  2KSJ A;  1IO4 A;  1LT9 C;  4NPD A;  3CMA P;  3HE5 A;  2VRS A;  3C8V A;  4OVN F;  3S4R A;  1FDO A;  4XE5 B;  1NTM G;  1SQV J;  2E76 D;  3FXD A;  2MJZ A;  3QH9 A;  1VF5 D;  4BRY B;  3Q1M A;  3PHL A;  1NAY A;  3H1I D;  1VPC A;  3M9Q A;  1SQQ J;  1T2K D;  3OA7 A;  3VP8 A;  3L74 J;  4KT0 J;  2H8P D;  5L8R J;  1ZR4 A;  4XA4 A;  2LXB A;  1M56 D;  4XFJ A;  1RF0 C;  4IL6 X;  2YMY A;  2KI7 B;  3CCM P;  1SS1 A;  2IBZ I;  3L74 D;  2XU6 A;  3AE8 C;  1NHL A;  4ZMD A;  3G3Z A;  4GDO A;  2HOD B;  1IC2 A;  4ZKU A;  5KJ7 C;  4Z1M H;  1RY3 A;  2OQQ A;  1CW5 A;  2R5D A;  2WTY A;  3VMZ A;  2N1T A;  3PH0 A;  3CL3 D;  3MUD C;  2O01 J;  4U3F G;  3L73 E;  5E79 E;  1HTL C;  1OVV A;  3PJS K;  3AEF C;  2BCC E;  2HPC A;  1U7J A;  5AVQ B;  4N3Y B;  2AXT E;  2ZFC A;  3RK2 D;  5AW8 B;  1SQV K;  3C9I A;  1MUU A;  5KLI B;  5H2F E;  3V4W A;  1SQQ K;  4BRY A;  1VQL P;  3HUS C;  3TDK A;  1S2E A;  2ZVO B;  1IK7 A;  3Q3D A;  3O6Q B;  3L73 J;  3E1R A;  1EZV G;  2P58 A;  2Z5I A;  2WSC J;  2BCC J;  4UB8 E;  1N86 A;  4DJG A;  1EC5 A;  2DW3 A;  3LID A;  3FX0 A;  4AUW A;  2KOG A;  1X8Y A;  4YTP C;  1YI2 P;  2E75 B;  2HOD A;  4WY4 D;  1GW3 A;  3SWY A;  3AE6 C;  2WSF J;  2GM4 A;  3MIW A;  5AVX B;  2WSC H;  1ZLL A;  2ZJS E;  3V4Q A;  1J2J B;  2FYU G;  2FBW C;  1R8E A;  1EDL A;  4D6T G;  3AE3 C;  2AXT H;  2RH0 A;  1GL2 C;  1BE3 D;  2JWA A;  2OGU A;  5APS A;  4HB1 A;  4PD4 D;  2C9L Y;  2QSI A;  1LT9 A;  2Y9Y A;  4HH2 A;  5H2F H;  3ABV C;  4I7Z C;  4I1L A;  3Q5P A;  2E74 B;  3A2A A;  1VQK P;  1M90 Q;  2H88 C;  2NPS C;  4ASV A;  2R3S A;  1DD3 A;  5CJ0 A;  1EXJ A;  2WSS H;  3RL0 D;  2V4H A;  1PGJ A;  3E7K A;  4UB8 H;  2KZI A;  3L37 A;  2W83 C;  3SWF A;  3N7N A;  2IPP A;  3O6Q A;  2QJP C;  1PP9 E;  1LTJ C;  2G3A A;  2POH A;  1M8O B;  2KSE A;  2Q1K A;  3C1L A;  4AYC A;  5TJH A;  3H1L E;  1S4X A;  5KJ7 A;  1LTB C;  1QX8 A;  3I5C A;  2P10 A;  2NZ2 A;  3F89 A;  5K5G B;  1NTM E;  1N73 B;  3MUD A;  4GIF A;  2XND H;  3AE1 C;  2Q6Q A;  3OJA B;  1VQN P;  3R2P A;  4IFF A;  3B8E B;  2FY8 A;  4NPE A;  5CCG A;  2W6J H;  3FGA D;  3H25 A;  1NYH A;  1JMB A;  1PP9 J;  1G1J A;  2A06 D;  2K9Y A;  2A45 H;  3CX5 D;  1PGO A;  3U59 A;  1NKN A;  3H1L J;  1VQ4 P;  4YXW H;  1ZN5 A;  2HFE D;  4MN4 C;  5KJ7 D;  1NVO A;  3GMA A;  1QVG O;  2IBZ D;  3AEE C;  5AW3 B;  2K1A A;  5CBO A;  1W2B O;  5APQ A;  1PP9 D;  4HYT B;  1NTM J;  2O1K A;  1FZE A;  1NAF A;  2M5A B;  3LIE A;  3H1L D;  1KYO H;  4KJM A;  5B66 E;  3L4F A;  3H1K G;  2E5Y A;  4U3F E;  3IR9 A;  1Q81 Q;  4LGD E;  3JSV C;  2YKP A;  1EQ7 A;  3SFD C;  2Y0C A;  3E1I A;  1W5C E;  5AW1 B;  3USS A;  3RK3 B;  3VOP A;  1NGM B;  1IZN B;  4N78 E;  5APY A;  2FKW B;  1KQG B;  3B5N C;  1KC8 Q;  4HJG H;  3CXH I;  1RE3 C;  3GF7 A;  1N73 A;  2IYP A;  1MFT A;  3JC2 2;  1H8A A;  1HGZ A;  3A3Y B;  1Q2N A;  1URQ C;  5AVY B;  2WPV B;  4W7Y A;  4U3F J;  5TIS E;  3CI9 A;  1L0N D;  4H0L B;  4H44 B;  3IN6 A;  5AW7 B;  5GTI E;  2WPS A;  3NFQ A;  1G2C B;  2KNC B;  5B66 H;  3RL0 g;  1BE3 G;  1NTM K;  2E76 B;  1Z56 A;  2JO1 A;  1OW7 A;  1L4A C;  1OMI A;  1VF5 B;  1GL2 D;  2M5A A;  2FYU E;  3AE5 C;  2LR2 A;  4PV1 C;  2L5G B;  4U7J A;  4D6T E;  3D71 A;  1L0L E;  3CWB E;  1WRG A;  3BRT B;  3M0D C;  2I8D A;  3B5N B;  2KK7 A;  2NPS D;  5KAF H;  1PIX A;  2YO3 A;  2Y0E A;  3CPW O;  2AEJ A;  2OAR A;  4RKU J;  1AVO A;  5GTI H;  2FYU J;  2FYN C;  1QGK B;  2PRR A;  1KB9 E;  1JCD A;  4D6T J;  1NOH A;  1GZL A;  1L0L J;  3CWB J;  3M9B A;  3SFE C;  3P8M C;  2HR3 A;  4C7N B;  5AW2 B;  3D6Z A;  2GA1 A;  1PV3 A;  4IFM A;  1IFI A;  2MKV A;  1N2D C;  1G2C A;  1P84 I;  2KNC A;  2LXC B;  3RK2 B;  4D6T D;  2A06 G;  1L0L D;  3CWB D;  1SQP D;  3F5H A;  2WSE J;  2H89 C;  2AEF A;  2W8Z A;  2RKL A;  1VQ9 P;  4C7R A;  4UB6 E;  2IBZ G;  1CI6 B;  4GOD A;  2FYZ A;  3S1K A;  1NTZ J;  1YJ9 P;  2KXP B;  4GT1 A;  1KIL C;  4RES B;  2WSE H;  3B5N A;  4B86 A;  1M1J B;  2FXP A;  1JNM A;  3H1H G;  5GTH E;  1JTH A;  1HJ0 A;  5KKZ C;  1KB9 D;  1KB9 H;  2KLV A;  4WY4 B;  1KQF B;  2WWW A;  1N7S C;  1OX3 A;  1NTZ D;  1FBM A;  4EOT A;  1NH4 A;  2FYU K;  1FZF A;  1WT6 A;  2IX7 C;  1H88 A;  2P7J A;  1NTK D;  1CSB A;  5B5E E;  1YQ4 C;  1Q90 D;  1BSN A;  3FWL A;  3H1K E;  1K05 A;  2FFD C;  5APV A;  1GDT A;  1DEB A;  4C7N A;  3OAK A;  2K37 A;  3A0H E;  3B5N D;  1EDJ A;  4UB6 H;  4PJ0 E;  3L70 G;  2YIU B;  1AFO A;  3CXH D;  4WB4 A;  2A45 I;  1L0N G;  1URQ D;  2I1K A;  3VMX A;  2E5T A;  1AJY A;  4OGQ C;  2XV5 A;  1VQ6 P;  3RL0 B;  3A0B E;  1XTC C;  3L72 G;  3M0D A;  1FZC C;  5GTH H;  1KIL B;  3O8Z A;  4JF7 A;  3TF5 A;  2N9Y B;  1CI6 A;  2BEQ D;  1M7L A;  2M3E A;  3H1K J;  1JB0 J;  3AEG C;  1LT9 B;  1GD2 E;  1N7L A;  1FAV A;  1M1J A;  1XTG B;  4EYY Q;  1YYC A;  2KS1 B;  3H6P A;  3B4S A;  1KYO I;  3G6E P;  3G9R A;  5EFW B;  1LTA C;  1L4A D;  3TYY A;  3SWK A;  2FXM A;  5B5E H;  1JCC A;  1BE3 E;  2H7H A;  3CC2 P;  4WY4 A;  3H1K D;  4PD4 E;  2O01 H;  1RH5 B;  2O01 N;  4PV1 D;  4L75 A;  5APT A;  4O9B A;  3A0H H;  3CCV P;  1WMK A;  1HWT C;  4Y99 C;  1HVV A;  3L75 D;  2ZVN B;  3MZW B;  2QG4 A;  2QJY C;  2KB7 P;  4CPG A;  3A0B H;  3CME P;  1KIL E;  4OGQ B;  1RE4 C;  1FZC B;  1BE3 J;  3WUT A;  2WPR A;  1FZB A;  1GK4 A;  3CC4 P;  1GU5 A;  5E79 H;  3II6 A;  1PGP A;  2R32 A;  3KXD A;  2WIT A;  1RF1 C;  4JQ0 D;  2IFM A;  2ZT9 C;  1KIL A;  3AE4 C;  3TGU D;  4IL6 E;  1L2P A;  4LLH A;  4H13 C;  1L0L G;  3CWB G;  2OYH C;  1VQM P;  1SQP G;  4PD4 H;  1RHZ B;  2WSF H;  1OZH A;  1JY3 O;  2YMK A;  3VYI A;  1BGY G;  3H1J D;  2H43 A;  2KS1 A;  1P84 D;  1QLE D;  1J1D C;  3G71 P;  1S1C X;  1YJN P;  4IOI H;  2KP8 A;  3HUS B;  2A06 E;  4I2L C;  3MHV A;  4Y99 B;  3CX5 E;  4BWN A;  3L36 A;  2WMM A;  1OWA A;  1U57 A;  1KOR A;  2M3B A;  1KIL D;  3AE2 C;  2IBZ E;  1RF0 A;  1NTZ G;  5CCH C;  1A02 J;  1EZV I;  3MTU E;  1Y9B A;  4IFD K;  2GUV A;  3AEB C;  3H1H E;  1N7S D;  1DIP A;  1BCC G;  1GMJ A;  2Q5U A;  1NTK G;  1JO5 A;  1YBK A;  5AW9 B;  1LP1 B;  5DJU B;  1FZC A;  2QM7 A;  2P1J A;  1LNQ A;  3V2P A;  3MD0 A;  1GL2 B;  5BU5 A;  1AVY A;  1K9M Q;  2WQY C;  3KHU A;  3D6Y A;  1JMM A;  4I7Z B;  3KYQ A;  1SQX D;  1J1D B;  1M1K Q;  3L71 G;  3CX5 H;  1SVF A;  4DZO A;  3CLQ A;  2NPS B;  3PLN A;  3H1H J;  1GW4 A;  2YXQ B;  3GHG C;  3L70 E;  4OGQ D;  1FOS E;  1VL2 A;  3HUS A;  1LWU C;  3OW2 O;  5APX A;  1EDK A;  1L0N E;  3LW5 J;  1IJD B;  3V5B A;  2QJP B;  4EI2 A;  1LTJ B;  5AVV B;  3L72 E;  3H1H D;  3S9O A;  1RQU A;  2K88 A;  1OVU A;  1QL1 A;  3D70 A;  1X79 B;  1X22 A;  2ZYD A;  1RE4 A;  4N6J A;  1S72 P;  1OVR A;  3VP9 A;  3LW5 H;  1YIJ P;  5AVW B;  4DOJ A;  2W90 A;  2M0B A;  3L70 J;  1LP1 A;  3G4S P;  1E5W A;  3L75 G;  2JEE A;  2WT7 B;  1JY2 O;  5M1B A;  2J5U A;  2YXR B;  3K5B A;  1N8R Q;  1L0N J;  1Y8A A;  1S3J A;  4C46 A;  1Q86 Q;  1S9K E;  2Z4E A;  1GL2 A;  1FS0 E;  5KLV G;  1SLQ A;  2B89 A;  1MZ9 A;  5AW4 B;  3L72 J;  2RMZ A;  2C0W A;  1HF9 A;  1QEX A;  2K9J B;  1IFP A;  1KFM A;  4GOF A;  3L70 D;  1JY3 N;  3TK1 A;  2OYI C;  5CMZ A;  3PTZ A;  1USE A;  2ITA A;  1DH3 A;  1RQV A;  1LWU B;  1J1E C;  2NPS A;  3MGN A;  1Q82 Q;  1LTG C;  2E42 A;  3TGU G;  3V2R A;  3L72 D;  3V2N A;  2YKQ A;  2IDB A;  2JDI H;  2P2U A;  2ZT9 D;  2KZJ A;  5AVR B;  4ZNC A;  2KLU A;  3R4Y A;  2QJK C;  1E79 H;  1NKZ B;  3FXE A;  4GKG A;  1LTJ A;  4H13 D;  3CCS P;  3H1J G;  3IFM A;  2XNX A;  4WBA A;  1YQ3 C;  1D7M A;  3WMM 0;  2B9B A;  1K73 Q;  1SQP E;  4OWF A;  1SFC C;  2K3R A;  1DEE G;  1S9K D;  2C9N Y;  1BGY E;  4K35 A;  3T97 B;  1JTH B;  2OTJ P;  1MV8 A;  2IYO A;  2WT7 A;  1L0N K;  1SQB G;  3P8C E;  1JM0 A;  1URQ B;  5DJT B;  5TIS H;  3Q2Y A;  3SSU A;  2N1T C;  1PGQ A;  1LJ2 A;  2J59 M;  3BAS A;  2R5B A;  2K9J A;  5CCH D;  2O1J A;  2JJL A;  1S5L E;  1ZME C;  1SQP J;  5AVS B;  1NTZ E;  1X9V A;  1LWU A;  1HGV A;  5CBN A;  1BGY J;  1BCC E;  1L4A B;  1NTK E;  2L91 A;  2IZ1 A;  1FE6 A;  1SQX G;  1Q7Y Q;  1KFN A;  4PV1 B;  1SP4 A;  2C0X A;  2O3J A;  1BGY D;  3RBZ A;  3GG2 A;  1SFC B;  4W80 A;  2NRG A;  2A45 G;  4ZKP A;  3CXH E;  3M0A A;  3P8C D;  3L71 E;  3TNU B;  1VQ8 P;  1PPJ G;  2QRX A;  1VQO P;  3NMD A;  1JY2 N;  1NU1 G;  2ZYG A;  3T97 A;  1RE3 A;  3HTK A;  1BCC J;  1X0T A;  2PAJ A;  1NTK J;  1KQS O;  1PFI A;  3AE9 C;  2FYN B;  1S5L H;  1YTZ I;  3L35 A;  1URQ A;  1JUN A;  1IFN A;  1JEK A;  1KD1 Q;  1BCC D;  2XDJ A;  3MP7 B;  1BSH A;  1L0L K;  1NWQ A;  4QMA A;  1SQP K;  5CJ4 A;  2AXC A;  1NO4 A;  4L73 A;  1KTM A;  3HRN A;  4A7P A;  3CC7 P;  3L71 J;  1IFJ A;  3PRJ A;  3BVH A;  3GF3 A;  1L4A A;  3CCQ P;  1FDM A;  3L75 E;  4JYB A;  5KLI C;  1FZG A;  1OW6 A;  1ZR2 A;  1AQT A;  3CXH H;  3CX5 I;  2ZXE B;  1SQV D;  3L71 D;  2W27 A;  5KLV E;  1SFC A;  1G1I A;  2QVA A;  1SQQ D;  4EDF A;  1NTZ K;  3U1C A;  3TNU A;  2WVR A;  5KKZ B;  3BCC G;  1FJK A;  3IAO A;  1N7S B;  1NTK K;  3TGU E;  4M3L A;  2E75 C;  2Q9I A;  3EWK A;  3L75 J;  4KHX A;  4WWI A;  2RN0 A;  2YKO A;  1LT1 A;  4RO0 A;  4HKZ H;  2UWJ E;  1KQL A;  1TU3 F;  2HG5 D;  5CCG C;  5C39 A;  5KLV J;  2FFD B;  1H89 A;  3H1J E;  3N4X A;  3WU2 E;  1P84 E;  4K3A A;  2QIW A;  1DX7 A;  1SFC D;  2B87 B;  4PJ0 H;  1W2E A;  4GOE A;  4JPZ B;  3HD7 C;  3AEC C;  1AQ5 A;  5AW6 B;  2QM8 A;  4R4L A;  3KDP B;  3I56 P;  2E74 C;  4R4M A;  5KLV D;  2Y9Z A;  1ZRT E;  3TGU J;  1EXI A;  1AA0 A;  3VN0 A;  5AVT B;  2N1T D;  1KV4 A;  1SQB E;  2OTL P;  2LKM A;  2JP3 A;  2M8R A;  1ZXG A;  3H1J J;  1VQ5 P;  4WVZ A;  2E43 A;  2Q7C A;  1ZP0 C;  1IFD A;  1M57 D;  1T6A A;  3GW6 A;  3L73 D;  1LTI C;  4JBZ A;  3VTP C;  2YNY A;  1N7S A;  2BCC D;  2PP6 A;  1FJP A;  2IFN A;  3WU2 H;  1P84 H;  1N73 C;  2QEX P;  3W68 A;  4ASW A;  4TLF A;  2R3C A;  5AW0 B;  1SQX E;  4OH8 B;  1SQB J;  3W67 A;  5KLV K;  3BRV B;  3P32 A;  3H32 B;  3HD7 B;  2FFD A;  2QJY B;  3EFG A;  2KIK A;  2V7Q J;  1ZRT D;  2I1J A;  1KZU B;  3BAT A;  2B87 A;  3P7K A;  5BVZ A;  2D2C C;  1SQB D; 
#chains in the Genus database with same CATH homology
 3CL3 D;  4IFM A;  1IFI A;  1SLQ A;  1MZ9 A;  1G2C A;  1N2D C;  5AW4 B;  2C0W A;  2YO2 A;  3RK2 B;  1KFM A;  2HLO A;  1IFM A;  1HTL C;  1RF1 B;  1JY3 N;  3TK1 A;  2OYI C;  5CMZ A;  2HPC A;  5AVU B;  5AVQ B;  1DH3 A;  4N3Y B;  4C7R A;  1LWU B;  1J1E C;  2NPS A;  2ZFC A;  3MGN A;  3RK2 D;  1IK9 A;  5AW8 B;  1CI6 B;  1LTG C;  1SQV K;  1ZV8 A;  2E42 A;  3V2R A;  3C9I A;  3V2N A;  2FYZ A;  2OYH B;  1MUU A;  2YKQ A;  3V4W A;  2P2U A;  3V2Q A;  4GT1 A;  1KIL C;  1SQQ K;  4RES B;  5AVR B;  2WSE H;  3HUS C;  3B5N A;  4B86 A;  1M1J B;  1JNM A;  1JTH A;  2P67 A;  1NKZ B;  4GKG A;  3U1A A;  1LTJ A;  3IFM A;  4WBA A;  2XNX A;  3RK3 C;  5AW5 B;  3WMM 0;  2KLV A;  4WY4 B;  2Z5I A;  2XKM A;  2WWW A;  1N7S C;  4LC1 A;  1FBM A;  4EOT A;  1N86 A;  1NH4 A;  1SQB K;  2FYU K;  3LID A;  1FZF A;  1WT6 A;  2IX7 C;  1H88 A;  2CPS A;  1SFC C;  2P7J A;  4AUW A;  1S9K D;  2KOG A;  2C9N Y;  1X8Y A;  1CSB A;  1VDF A;  2HOD A;  1JTH B;  4WY4 D;  1LTT C;  1GW3 A;  3H32 A;  3SWY A;  1MV8 A;  3HD7 A;  2GM4 A;  1JY3 P;  2W6B A;  5APV A;  2FFD C;  1GDT A;  1DEB A;  1MFZ A;  3MIW A;  4C7N A;  2WT7 A;  5AVX B;  3OAK A;  1LGH B;  2WSC H;  1ZLL A;  3V4Q A;  1J2J B;  1L0N K;  3P8C E;  1HH0 A;  1URQ B;  3B5N D;  3A5T A;  2N1T C;  1GL2 C;  2J59 M;  3KPE A;  3BAS A;  1AFO A;  5APS A;  5CHX A;  2R5B A;  2C9L Y;  1LT9 A;  2HYN A;  5CCH D;  2O1J A;  4WB4 A;  2A45 I;  2JJL A;  4HH2 A;  1URQ D;  1RF1 A;  2I1K A;  3VMX A;  5CCG D;  2XV5 A;  1SQX K;  5AVS B;  4I1L A;  3RL0 B;  1X9V A;  3VMY A;  1XTC C;  1GTW A;  3M0D A;  1FZC C;  1LWU A;  1KIL B;  3O8Z A;  1HGV A;  4JF7 A;  3A2A A;  4EIJ A;  1T2K C;  2NPS C;  1GK6 A;  1CI6 A;  1M7L A;  5CJ0 A;  2OYH A;  1L4A B;  3M91 A;  3HD7 D;  3UIA A;  2WZ7 A;  1LT9 B;  3RL0 D;  1GD2 E;  1N7L A;  1OXZ A;  1YTZ T;  1FAV A;  1KFN A;  1M1J A;  1XTG B;  1SP4 A;  2J58 A;  3L37 A;  1YYC A;  3SWF A;  3N7N A;  3H6P A;  3GHG B;  2IPP A;  5AVZ B;  2C0X A;  1LTA C;  1L4A D;  1LTJ C;  1NU1 K;  3TYY A;  1LTS C;  2POH A;  2FXM A;  1JCC A;  1SFC B;  2KYV A;  4W80 A;  2H7H A;  4WY4 A;  4AYC A;  2O01 H;  2W6A A;  4JYC A;  5KJ7 A;  2A45 G;  5APT A;  4ZKP A;  4O9B A;  3M0A A;  3P8C D;  3A7O A;  3TNU B;  1LTB C;  3I5C A;  3NMD A;  1JY2 N;  1HWT C;  3T97 A;  4Y99 C;  1RE3 A;  3HTK A;  1HVV A;  2PAJ A;  1N73 B;  1FU1 A;  3MUD A;  4GIF A;  5CCH A;  2KB7 P;  3OJA B;  1PFI A;  3R2P A;  1YTZ I;  4IFF A;  3B8E B;  3L35 A;  1URQ A;  3HE4 B;  5CCG A;  1JUN A;  2N9B A;  1IFN A;  1RE4 C;  1G1J A;  2A45 H;  1FZC B;  2XDJ A;  3RK2 C;  2WPR A;  1L0L K;  1FZB A;  1NWQ A;  3U59 A;  1SQP K;  1NKN A;  1CZQ A;  3HTK B;  5CJ4 A;  1GK4 A;  1NO4 A;  1GU5 A;  3II6 A;  1ZN5 A;  2HFE D;  2R32 A;  4N78 D;  2WIT A;  1RF1 C;  1A02 F;  2IFM A;  3HRN A;  5KJ7 D;  1IFJ A;  1KIL A;  5AW3 B;  5APQ A;  3BVH A;  4LLH A;  1L4A A;  4HYT B;  2OYI B;  1FDM A;  3EQ2 A;  1T8Z A;  2OYH C;  2O1K A;  4JYB A;  1FZG A;  1FZE A;  1NAF A;  3LIE A;  1J1E B;  1ZR2 A;  2WSF H;  1JY2 P;  3HE5 B;  1JY3 O;  2ZXE B;  3VYI A;  1M1J C;  3L4F A;  2H43 A;  2W27 A;  3GHG A;  3IR9 A;  1J1D C;  2WPQ A;  4LGD E;  2YKP A;  1SFC A;  1G1I A;  1EQ7 A;  2KP8 A;  3HUS B;  2Q3I A;  4I2L C;  4WY4 C;  3E1I A;  4Y99 B;  4W7Z A;  1NTZ K;  5AW1 B;  5APW A;  3L36 A;  3U1C A;  3RK3 B;  5KTB A;  2CPB A;  1OWA A;  3NTN A;  3TNU A;  3VOP A;  4N78 E;  5APY A;  2FKW B;  1FJK A;  2M3B A;  1KIL D;  1QL2 A;  3B5N C;  1N7S B;  1NTK K;  3KQG A;  4M3L A;  1RE3 C;  1RF0 A;  1N73 A;  2Q9I A;  4KHX A;  2YKO A;  1H8A A;  1HJB A;  5CCH C;  1A02 J;  1HGZ A;  3RK3 D;  1T3J A;  1KQL A;  3A3Y B;  3MTU E;  4AQR D;  4IFD K;  3PP5 A;  3HE4 A;  2GUV A;  1HBW A;  1URQ C;  5BU8 B;  5APU A;  2HG5 D;  1N7S D;  5CCG C;  2XZR A;  5AVY B;  2Q5U A;  4I6M C;  3M06 A;  2FFD B;  1H89 A;  4W7Y A;  1JO5 A;  5AW9 B;  3N4X A;  1FZC A;  3CI9 A;  1DX7 A;  1SFC D;  3TSI A;  5AW7 B;  2QM7 A;  2P1J A;  3M9H A;  3V2P A;  1W2E A;  2WPS A;  2N1T B;  1GU4 A;  3NFQ A;  3MD0 A;  3HD7 C;  1GL2 B;  5BU5 A;  1AQ5 A;  5AW6 B;  2QM8 A;  3RL0 C;  1HUC A;  1G2C B;  1T3U A;  1FZA A;  3KDP B;  3NXS A;  1NTM K;  2Z5H A;  3VN0 A;  1Z56 A;  2BAS A;  2OYI A;  1JMM A;  5AVT B;  1JOC A;  1L4A C;  2N1T D;  3KYQ A;  1FOS F;  2GUS A;  1J1D B;  2HPC B;  2KSJ A;  1GL2 D;  1SVF A;  1IO4 A;  1LT9 C;  2LKM A;  4DZO A;  3CLQ A;  2NPS B;  3HE5 A;  2M8R A;  1GW4 A;  2VRS A;  2L5G B;  4XE5 B;  3GHG C;  1WRG A;  2E43 A;  2MJZ A;  1FOS E;  3BRT B;  3HUS A;  3M0D C;  2Q7C A;  1LWU C;  3B5N B;  1IFD A;  3M9Q A;  1VPC A;  5APX A;  1T2K D;  2NPS D;  3OA7 A;  3VP8 A;  1IJD B;  3V5B A;  2H8P D;  1LTI C;  1LTJ B;  3VTP C;  2YO3 A;  5AVV B;  2YNY A;  1ZR4 A;  4XA4 A;  1N7S A;  2PP6 A;  1FJP A;  2OAR A;  1QL1 A;  2IFN A;  1X79 B;  1RF0 C;  1N73 C;  1RE4 A;  4N6J A;  2R3C A;  5AW0 B;  4OH8 B;  2YMY A;  3VP9 A;  3LW5 H;  5AVW B;  2XU6 A;  4DOJ A;  1NHL A;  5KLV K;  3G3Z A;  3BRV B;  2HOD B;  3P32 A;  1IC2 A;  1JCD A;  3H32 B;  4ZKU A;  5KJ7 C;  1NOH A;  3HD7 B;  1GZL A;  2FFD A;  1RY3 A;  3M9B A;  3EFG A;  1E5W A;  3P8M C;  4C7N B;  2JEE A;  2I1J A;  2WT7 B;  1CW5 A;  1JY2 O;  1KZU B;  5AW2 B;  2R5D A;  3BAT A;  3P7K A;  2WTY A;  5BVZ A;  3VMZ A;  2N1T A;  4C46 A;  1S9K E;  2Z4E A;  1GL2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...