1BGYE

Cytochrome bc1 complex from bovine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 23
structure length 75
sequence length 75
chains with identical sequence Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bgyE00
3L74E 4PD4E 1L0LE 1NTME 1SQXE 1KB9E 1SQVE 2BCCE 3L70E 1PPJE 1SQQE 3L72E 3CXHE 3H1IE 1BE3E 3L71E 1NTKE 1SQPE 5KLVE 1NU1E 3L75E 2A06E 2IBZE 3BCCE 3TGUE 1BCCE 3L73E 3H1LE 1BGYE 3CWBE 1KYOE 3H1KE 4U3FE 4D6TE 1EZVE 2FYUE 3H1HE 1NTZE 1P84E 3CX5E 1L0NE 1PP9E 1SQBE 3H1JE
chains in the Genus database with same CATH superfamily
4H13C 3TGUD 5GTIH 4NPFX 1NTME 1KYOD 3AE5C 4PV1C 3FXDA 3G9RA 1EZVD 3USSA 3RL0g 3EQ2A 3H1KJ 4ZKPA 5KKZB 1H88A 2QE7H 1DEBA 2SPZA 1J1DC 1W5CE 1FZAA 2KLUA 5APYA 2IFMA 2QM7A 1CW5A 3AEFC 3NTNA 3V5BA 5CJ4A 3I56P 1PP9G 3SFEC 1JCDA 2BCCD 1DD3A 1S5LX 1NTZE 3AEBC 4H44D 1NKNA 1DEEG 3CX5H 2E74B 2J58A 1VQ5P 3H1KG 4U7JA 1VQKP 3Q5PA 4WY4C 1UIIA 1PGQA 3C9IA 3AE1C 2W6JH 2OYOA 1ZP0C 3JCUH 1FZCC 3L71G 4IFDK 2OYHB 1NU1K 3MIWA 5KLVG 1KB9E 3U59A 1LTSC 3D70A 1QVFO 2R5DA 1KFNA 1KFMA 4DJGA 2AEFA 1K73Q 3ABVC 3AE6C 2W90A 3FX0A 3CCJP 2I1KA 1M1JC 3CXHD 2QA4P 3P8CD 2FFDB 1R5LA 5AVZB 2GUSA 1G2CB 3H1IE 1W2EA 3L71E 3KZIH 1GZLA 1KILD 3BATA 2C9NY 4IFFA 3H1HE 2QM8A 2IX7C 3WUTA 3L36A 3P32A 5TJHA 1LTJA 2M3BA 1FE6A 3W67A 3CCSP 2W6BA 1VQPP 1YTZI 2YXRB 3O8ZA 3FWLA 2FYUJ 2P7JA 4C7NA 1H89A 1J2JB 4GODA 1PL5A 4PJ0H 5CBOA 1QLED 1SQPK 1YJWP 4YXWH 1SP4A 2KNCA 2E5TA 1BE3J 1VQ7P 1RH5B 1FDMA 3L4FA 2O01H 1OW7A 2KK7A 1BSHA 1LWUB 2LXBA 2DW3A 2QJPC 2YNYA 2WSSH 1SQXJ 2OGUA 3RK3E 3I55P 1N7SA 1CSBA 2QJYB 1KTMA 3PH0A 4L76A 2WPQA 1HGZA 3VN0A 3IF4A 2KSJA 4GOFA 2Z5HA 3CCRP 1XTCC 1JOCA 3V4WA 5DJTB 4LLHA 4ASWA 4Y99C 2FY8A 2AEMA 3L74E 2WSFH 5CHXA 5AW4B 3VMZA 1T3UA 3SSUA 2E75D 2PRRA 1E79H 2B87A 4ZNCA 3L70D 1JEKA 2HR3A 1IFMA 2QJKC 1DH3A 5KAIH 2B88A 1IK9A 5AW8B 1GU4A 1MZ9A 3L75J 2IFNA 1BGYJ 1M8OB 1D7MA 4H44B 3H1LE 1VL2A 4PJ0E 1FDOA 3B5ND 1KQLA 2W27A 3AEAC 1GW3A 1N8RQ 1KN7A 2HLOA 3TGUJ 1PP9D 3B4SA 1KQFB 4GT1A 3CMAP 3RL0D 1LTJC 3B5NC 1M1JB 2NZ2A 1S4XA 1LT9C 1EQ7A 1K05A 4EI2A 1JY2N 3L75G 3H1KD 2BASA 3RL0C 2E42A 2UWJE 1YJ9P 5AW0B 1HTLC 2OYHA 2K1AA 1JB0J 3L71D 3H1JE 5KLVD 1YI2P 1H0TB 2BCCJ 2O1KA 1AV1A 1OWAA 5CCHD 1CZQA 1KILB 4DOJA 5KLIB 1NTZK 2KIKA 3PHLA 3L35A 1LTGC 1IFNA 1SQBJ 1N7LA 1OMIA 5AW7B 2Z5IA 2FFDA 2H43A 3OW2O 1YIJP 3D71A 4A7PA 1PPJG 1G2CA 5APVA 5AVXB 3HD7C 3CX5D 1NU1E 1J1EB 1S72P 2LXCB 5CCGA 4R4LA 3L72E 1GMJA 4DCKA 2JR8A 4N6JA 2Q7CA 3Q5SA 1YQ4C 1SQBG 3GW6A 2J59M 4D6TE 1N2DC 4U3FE 4HB1A 4AUWA 1IZNB 4JYCA 1R8EA 2GUVA 2XNDH 1SQPG 4C46A 1Q7YQ 2ZYAA 3PP5A 3F89A 5AW9B 3A5TA 2IYOA 1G1IA 1LWUA 1SFCD 3AEGC 1M1KQ 1PIXA 3O6QB 1DD4A 1S9KE 5B5EE 2JJLA 2KZJA 2E75B 2FYUD 5CBNA 4R4MA 2JDIH 2HODB 2OTKE 1SQPE 2WPRA 2ZYDA 3JSVC 4RJTA 2Y9YA 2OQQA 5APSA 2IPPA 3LIDA 1VQ4P 3V2RA 1BE3D 1LT1A 2O3JA 4PD4I 5B66H 2Y0CA 3R4YA 3CI9A 3II6A 2E5YA 1GK6A 1LTAC 1LT9B 3KYQA 2ZT9D 1HJ0A 3IFMA 1FOSF 1NTMJ 2G3AA 1LJ2A 2OTLP 3UIAA 1LNQA 2ZXEB 1OIPA 3RL0B 2WSCJ 1IO4A 4EDFA 1K04A 1L0NK 2N9BA 2ZT9C 1KQGB 3MHVA 4TLFA 5M1BA 2W6AA 1SS1A 2WMMA 3V2PA 3CCUP 4H0LD 2ZVNB 1NTKK 3L70J 2Q5UA 1ZOYC 5AVSB 1M1JA 1NYHA 4L75A 1JY3O 1RQUA 2WPVB 3K5BA 4H0LC 5KJ7D 1NTMG 2LKMA 2Y0DA 2YKOA 2E76D 2D2CB 2K37A 5EFWB 1ZRTE 3L75D 2M3EA 1M57D 1QGKB 1CI6B 1EXJA 1KB9H 1RE3A 1NOHA 5KJ7C 1RF1B 3GLMA 3S9OA 2HFED 3VMAA 1H0TA 2E76C 4RESB 1PP9J 3CD6P 3EFGA 3GHGB 2R3CA 1KILA 1NKZB 4M3LA 1R5SA 2M8RA 2QJYC 1SQQE 3CWBG 1NTZG 4CPGA 4MN4C 4IL6X 1URQD 1PPJD 1HBWA 1FC2C 2IBZD 1VF5D 3OA7A 2V7QH 3L71J 4WB4A 5KLVJ 1IK7A 3KPEA 4UB8E 5AVQB 1URQC 3H1HJ 3BCCE 2IZ0A 4HJGH 3L73E 3CWBE 4L74A 2JO1A 1EZVI 1M7LA 3PLNA 4NPDA 2R5BA 2KUBA 1LTTC 3CL3D 1SFCB 1SQBD 2JWAA 3PTZA 2QSIA 1L4AD 4DZOA 1RHZB 4H44C 5APXA 4OVNF 1SQPD 2FYNB 4HKZH 2Y9ZA 3H1IG 2KYVA 3E1IA 3O6QA 3H1HG 2YKQA 2FXPA 3TDKA 4Z1MH 2IZ1A 1PFIA 1VQMP 4GDOA 1X0TA 2HODA 1QEXA 2RMZA 1JNMA 1L0LE 3V4QA 1AA0A 3V2NA 3VMYA 2ZT9B 1Y47A 5AVYB 1FS0E 1EXIA 3L74J 2WSEH 2YIUB 3KQGA 1RE3C 2ZXXA 1FZFA 2C0XA 3TYYA 1IFDA 3MD0A 4OH8B 3B5NA 2A45I 2FXMA 1AQTA 1LT9A 3CXHI 1KILC 4LGDE 3HUSC 5KLIC 4H0LB 1OX3A 3EWKA 1U7MA 1QX8A 1ZV8A 5GTHE 5E79E 3M0DC 2MKVA 2XNXA 3H1LJ 1S3JA 4WWIA 3EFFK 3SWKA 3HRNA 2E76B 3TNUB 3TSIA 3L74G 4HYTB 1J1EC 1NGMB 3WMM0 5AW5B 3CCLP 2FBWC 3TF5A 1NTKG 2NPSD 2O01J 1EDIA 1HVVA 3B71A 3A2AA 5CCHA 1NTMD 3HD7A 1MV8A 2NPSC 1L0NE 4NPEA 2OTJP 3JC22 3NMDA 5K5GB 1GL2D 3G6EP 3SWFA 2WZ7A 1RF0C 2AXTE 4KJMA 3Q1MA 3H1LG 1GTWA 3IAOA 1URQB 3L37A 1NTKE 1M90Q 3GHGA 2WSFJ 1VF5B 3A3YB 1MFTA 1LTBC 4PD4E 1BCCG 1JMBA 1NTZD 3P7KA 1Q86Q 2E75C 3C8VA 1BSNA 5TISE 4YXDC 1KZUB 1ZLLA 2M5AB 3M91A 2XV5A 1HWTC 1JO5A 2YO3A 1EC5A 4K35A 4EYYQ 1NU1J 3NXSA 1NAYA 1KQSO 1L4AB 1JTHB 1MFZA 1JY2O 1BCCE 3H1JG 1KB9D 3L72J 2ZJSE 1P84I 1SFCA 1EDKA 1JY2P 2G8YA 1SQQK 2I1JA 1SQXE 3A0BE 4XFJA 1Q82Q 2YMKA 1G1JA 4D6TJ 2A06E 4JBZA 3TK1A 1HUCA 3H1ID 3PRJA 3GF3A 2CPBA 4GKGA 5APWA 3KDPB 3RBZA 1NU1G 3GG2A 5B5EH 3H1HD 2D2CD 1A02J 1IJDB 3HUSB 1WMKA 1YJNP 4I7ZB 3L72G 2XDJA 3HE5B 3AE8C 1AQ5A 3T97B 1IFIA 5AVVB 1GDTA 3AEEC 3G3ZA 5CCHC 4ASVA 2D2CC 1OVUA 3AE9C 1SQPJ 4C7RA 1GD2E 4D6TG 4U3FG 1H8AA 2YXQB 3E1RA 3M0AA 2PGDA 3N4XA 1JMMA 1BGYE 3CCQP 5KTBA 1RF1C 1OW6A 1SQVK 2IYPA 4ZMDA 2KXPB 2WT7B 3H32B 3GHGC 5AW2B 1IC2A 2ZAEB 1BDCA 5APUA 1E5WA 2A45H 1LGHB 3AE2C 2POHA 3RK3D 3CC2P 3TGUE 1USEA 1KYOE 1A02F 2NPSB 1L0LK 1EDLA 3CX5I 2GA1A 1EZVE 2ZVOB 3H6PA 1NHLA 1OFCX 1YBKA 5KJ7A 5CMZA 3WUUA 3RK3C 3TNUA 3M9BA 2FYZA 3A0HE 3L74D 2WQYC 3M9HA 1GL2B 3N7NA 4XA4A 1FZGA 4QMAA 1XTGB 3MP7B 2BCCE 3AE3C 3QH9A 1SFCC 1N73C 3G4SP 4W7YA 1YITP 2A45G 3P8MC 3CC4P 2CPSA 2QRXA 1URQA 1Q2NA 2R44A 3H1LD 2FYNC 3LIEA 3S4RA 3AE4C 2WPSA 1IFPA 1PGPA 3ITKA 2KS1B 1AJYA 2BEQD 1HJBA 3RBXA 3D6ZA 2JKVA 2OYIC 1AVOA 1FJPA 1K8AQ 1WT6A 2M5AA 3CXHE 2O01N 3P8CE 1S5LH 4UB8H 1VQ9P 1ZMEC 3CCMP 2YIUC 1TU3F 1JTHA 1KILE 5APQA 3VYIA 3H1JD 4JQ0D 3CWBJ 3BVHA 1RY3A 1NTZJ 3ZDMA 4ZKUA 2O1JA 1SQQG 3S1KA 1P84H 3LW5H 1X79B 1DX7A 3B8EB 2FYUK 3MUDA 2N1TD 3LW5J 5AVUB 4I1LA 4OGQD 3FXEA 3HTKB 5H2FE 1NU1D 1DIPA 1JY3N 3HUSA 2XKMA 3BCCG 4H13D 4AYCA 3L73G 3HE5A 2CK3H 4OGQC 2B9BA 3L72D 4PV1D 3T97A 5AW1B 1JCCA 1FAVA 1U57A 1VQ6P 1NH4A 1PGJA 1SQXK 3M0DA 2IDBA 3AECC 2AXCA 1S2EA 2B87B 2BEZF 2K9YA 3VTPC 3RK3B 3H1IJ 4D6TD 4U3FD 2QEXP 1QL1A 1T2KD 1BDDA 1S5LE 4AQRD 1ZR2A 4N78E 1K9MQ 2WT7A 1FBMA 1ZW0A 4IFMA 3M9QA 1KYOI 3H32A 2V7QJ 2KOGA 1SQVG 1AFOA 3SWYA 1VF5C 3MZWB 4JPZB 2H89C 1T2KC 3BRTB 3L70E 5C39A 1N73B 2YO2A 2NPSA 4O9BA 3Q3DA 2R32A 1S9KD 1L2PA 5GTHH 2IBZI 5E79H 3U1AA 1KC8Q 5AW3B 3RK2D 2P1JA 4WY4D 1LP1B 1L0LG 1RF0A 2KB7P 3Q5RA 1P84E 2WWWA 1KV4A 2HG5D 2LR2A 2OARA 4YTPC 1SQVE 2RH0A 4UB6E 1UIXA 1GL2A 4I6MC 3RK2C 1FDIA 1RE4C 5KAFE 1USDA 1L4AC 4RKUJ 2C9LY 2OYIB 1X8YA 1OW8A 1PP9E 1Z56A 3WU2E 5BU8B 3OJAB 3HE4B 1NJIQ 2AXTH 1OXZA 1L0NJ 3H1KE 3V6IA 1ZR4A 1T8ZA 5GTIE 3MUDC 1WRGA 3PJSK 3OAKA 2P10A 2KS1A 4WBAA 1NTKJ 4PD4H 4Y28J 2WSEJ 3CMEP 1N86A 5KLVE 2KSEA 3I5CA 5TISH 4I7ZC 1Q81Q 2QG4A 2HPCB 3V2QA 4W7ZA 5BU5A 3W68A 4BWNA 1ZRTD 1EDJA 1SQBK 1L0NG 1S1CX 1GK4A 1Y9BA 3WUVA 3VP9A 4HH2A 3CCEP 3CX5E 3F5HA 2YKPA 2N1TB 3A7OA 3CLQA 4OGQB 1BCCJ 3A0BH 2WVRA 2QIWA 3JCUE 1NO4A 2C0WA 2WITA 1SQQD 4H13B 4B86A 1RQVA 1CI6A 4PV1B 1RF1A 5AW6B 2FYUG 4I2LC 2L5GB 2M0BA 3HTKA 2Z4EA 2GM4A 3H1JJ 1GL2C 3RGUA 4N78D 1BE3G 1J1DB 3G71P 3BCCD 3L73D 3KHUA 1LTIC 2WTYA 3AE7C 3CWBD 2VRSA 3KZIE 1ZN5A 4BRYB 2MJZA 4RO0A 2FYUE 2JP3A 1QL2A 1SQXG 2ZYGA 4YPCA 2FKWB 1SVFA 2XZRA 4JF7A 5AVTB 2A06G 1P84D 3RK2B 2K9JB 2J5UA 4WY4B 1BE3E 2P58A 1JUNA 1SQVD 3AEDC 2Y0EA 1YTZT 1FZCB 1HGVA 2KLVA 1KYOH 1N73A 2FXOA 1GU5A 3D6YA 1VPCA 1LP1A 4U3FJ 1FJKA 1L0LD 3A0HH 1NTMK 2N9YB 2H88C 5CJ0A 3GMAA 1VQLP 1KB9I 5AVWB 3VOPA 1BGYG 2OYIA 1MUUA 2PFXA 1N7SD 5AVRB 3HE4A 3R2PA 3KXDA 4DT0A 2KZIA 4JYBA 4L73A 3TGUG 1KORA 2PAJA 3HD7D 1OVVA 3BASA 3H25A 1N7SC 1OVRA 1Q90D 3L75E 1EZVG 2I8DA 2JWDA 1GW4A 5KAIE 1KD1Q 2H7HA 2ZFCA 3FGAD 2IBZG 5APTA 4EOTA 2Q3IA 2NRGA 3CCVP 2HPCA 4KHXA 3CXHH 3MGNA 2P67A 4GIFA 3GF7A 3VMXA 4BXLA 2QJPB 5L8RJ 2K3RA 1PV3A 1FZEA 2BCCG 4TT3H 1FU1A 2Q3EA 1IFJA 1PPJE 1L0ND 2PP6A 1Y8AA 2IBZE 4GOEA 4K3AA 4Y99B 4LC1A 1X22A 2N1TA 5KKZC 2Q6QA 3U1CA 1M56D 1NTKD 2QVAA 3M06A 5KLVK 2L91A 2W83C 1VQOP 2E74D 4PD4D 4KT0J 2AEJA 3Q2YA 2HYNA 2QJKB 2ITAA 4IOIH 3SFDC 1SQBE 3IR9A 1YHQP 3FWNA 2Q9IA 5H2FH 1QVGO 2E74C 5DJUB 1KMIZ 3QWOC 1VQNP 4IL6H 2R3SA 4OWFA 1JM0A 2E43A 1YYCA 4WVZA 2W8ZA 1ZXGA 2B89A 1AVYA 2P2UA 1BCCD 1SQQJ 1OZHA 4BRYA 2OYHC 4XE5B 1FZBA 2YMYA 3NFQA 1LTJB 3B5NB 2RKLA 1SQXD 2WSCH 1NWQA 2K9JA 4C7NB 2K88A 1RE4A 1X9VA 2A06D 4WY4A 3CC7P 1L4AA 1W2BO 1PZQA 2FFDC 1U7JA 3BCCJ 1YQ3C 3L73J 2KNCB 3VP8A 1FZCA 3BRVB 5CCGD 1NVOA 1FOSE 1T6AA 2V4HA 2KI7B 3IN6A 2JEEA 1VDFA 4W80A 3E7KA 2RN0A 2Q1KA 3C1LA 5CCGC 1VQ8P 1NAFA 1N7SB 3MTUE 4UB6H 1PGOA 5KAFH 1JY3P 4N3YB 3CPWO 2H8PD 3HD7B 1SQVJ 1BGYD 3WU2H 4EIJA 1T3JA 2KP8A 1MKMA 2N1TC 4IL6E 1HF9A 1HH0A 1SLQA 2XU6A 5B66E 5BVZA 1LWUC 1L0LJ 3L70G
chains in the Genus database with same CATH topology
3L74E 4PD4E 1L0LE 1NTME 1SQXE 1KB9E 1SQVE 2BCCE 3L70E 1PPJE 1SQQE 3L72E 3CXHE 3H1IE 1BE3E 3L71E 1NTKE 1SQPE 5KLVE 1NU1E 3L75E 2A06E 2IBZE 3BCCE 3TGUE 1BCCE 3L73E 3H1LE 1BGYE 3CWBE 1KYOE 3H1KE 4U3FE 4D6TE 1EZVE 2FYUE 3H1HE 1NTZE 1P84E 3CX5E 1L0NE 1PP9E 1SQBE 3H1JE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L74 E;  4PD4 E;  1L0L E;  1NTM E;  1SQX E;  1KB9 E;  1SQV E;  2BCC E;  3L70 E;  1PPJ E;  1SQQ E;  3L72 E;  3CXH E;  3H1I E;  1BE3 E;  3L71 E;  1NTK E;  1SQP E;  5KLV E;  1NU1 E;  3L75 E;  2A06 E;  2IBZ E;  3BCC E;  3TGU E;  1BCC E;  3L73 E;  3H1L E;  1BGY E;  3CWB E;  1KYO E;  3H1K E;  4U3F E;  4D6T E;  1EZV E;  2FYU E;  3H1H E;  1NTZ E;  1P84 E;  3CX5 E;  1L0N E;  1PP9 E;  1SQB E;  3H1J E; 
#chains in the Genus database with same CATH topology
 4H13 C;  3TGU D;  5GTI H;  4NPF X;  1NTM E;  1KYO D;  3AE5 C;  4PV1 C;  3FXD A;  3G9R A;  1EZV D;  3USS A;  3RL0 g;  3EQ2 A;  3H1K J;  4ZKP A;  5KKZ B;  1H88 A;  2QE7 H;  1DEB A;  2SPZ A;  1J1D C;  1W5C E;  1FZA A;  2KLU A;  5APY A;  2IFM A;  2QM7 A;  1CW5 A;  3AEF C;  3NTN A;  3V5B A;  5CJ4 A;  3I56 P;  1PP9 G;  3SFE C;  1JCD A;  2BCC D;  1DD3 A;  1S5L X;  1NTZ E;  3AEB C;  4H44 D;  1NKN A;  1DEE G;  3CX5 H;  2E74 B;  2J58 A;  1VQ5 P;  3H1K G;  4U7J A;  1VQK P;  3Q5P A;  4WY4 C;  1UII A;  1PGQ A;  3C9I A;  3AE1 C;  2W6J H;  2OYO A;  1ZP0 C;  3JCU H;  1FZC C;  3L71 G;  4IFD K;  2OYH B;  1NU1 K;  3MIW A;  5KLV G;  1KB9 E;  3U59 A;  1LTS C;  3D70 A;  1QVF O;  2R5D A;  1KFN A;  1KFM A;  4DJG A;  2AEF A;  1K73 Q;  3ABV C;  3AE6 C;  2W90 A;  3FX0 A;  3CCJ P;  2I1K A;  1M1J C;  3CXH D;  2QA4 P;  3P8C D;  2FFD B;  1R5L A;  5AVZ B;  2GUS A;  1G2C B;  3H1I E;  1W2E A;  3L71 E;  3KZI H;  1GZL A;  1KIL D;  3BAT A;  2C9N Y;  4IFF A;  3H1H E;  2QM8 A;  2IX7 C;  3WUT A;  3L36 A;  3P32 A;  5TJH A;  1LTJ A;  2M3B A;  1FE6 A;  3W67 A;  3CCS P;  2W6B A;  1VQP P;  1YTZ I;  2YXR B;  3O8Z A;  3FWL A;  2FYU J;  2P7J A;  4C7N A;  1H89 A;  1J2J B;  4GOD A;  1PL5 A;  4PJ0 H;  5CBO A;  1QLE D;  1SQP K;  1YJW P;  4YXW H;  1SP4 A;  2KNC A;  2E5T A;  1BE3 J;  1VQ7 P;  1RH5 B;  1FDM A;  3L4F A;  2O01 H;  1OW7 A;  2KK7 A;  1BSH A;  1LWU B;  2LXB A;  2DW3 A;  2QJP C;  2YNY A;  2WSS H;  1SQX J;  2OGU A;  3RK3 E;  3I55 P;  1N7S A;  1CSB A;  2QJY B;  1KTM A;  3PH0 A;  4L76 A;  2WPQ A;  1HGZ A;  3VN0 A;  3IF4 A;  2KSJ A;  4GOF A;  2Z5H A;  3CCR P;  1XTC C;  1JOC A;  3V4W A;  5DJT B;  4LLH A;  4ASW A;  4Y99 C;  2FY8 A;  2AEM A;  3L74 E;  2WSF H;  5CHX A;  5AW4 B;  3VMZ A;  1T3U A;  3SSU A;  2E75 D;  2PRR A;  1E79 H;  2B87 A;  4ZNC A;  3L70 D;  1JEK A;  2HR3 A;  1IFM A;  2QJK C;  1DH3 A;  5KAI H;  2B88 A;  1IK9 A;  5AW8 B;  1GU4 A;  1MZ9 A;  3L75 J;  2IFN A;  1BGY J;  1M8O B;  1D7M A;  4H44 B;  3H1L E;  1VL2 A;  4PJ0 E;  1FDO A;  3B5N D;  1KQL A;  2W27 A;  3AEA C;  1GW3 A;  1N8R Q;  1KN7 A;  2HLO A;  3TGU J;  1PP9 D;  3B4S A;  1KQF B;  4GT1 A;  3CMA P;  3RL0 D;  1LTJ C;  3B5N C;  1M1J B;  2NZ2 A;  1S4X A;  1LT9 C;  1EQ7 A;  1K05 A;  4EI2 A;  1JY2 N;  3L75 G;  3H1K D;  2BAS A;  3RL0 C;  2E42 A;  2UWJ E;  1YJ9 P;  5AW0 B;  1HTL C;  2OYH A;  2K1A A;  1JB0 J;  3L71 D;  3H1J E;  5KLV D;  1YI2 P;  1H0T B;  2BCC J;  2O1K A;  1AV1 A;  1OWA A;  5CCH D;  1CZQ A;  1KIL B;  4DOJ A;  5KLI B;  1NTZ K;  2KIK A;  3PHL A;  3L35 A;  1LTG C;  1IFN A;  1SQB J;  1N7L A;  1OMI A;  5AW7 B;  2Z5I A;  2FFD A;  2H43 A;  3OW2 O;  1YIJ P;  3D71 A;  4A7P A;  1PPJ G;  1G2C A;  5APV A;  5AVX B;  3HD7 C;  3CX5 D;  1NU1 E;  1J1E B;  1S72 P;  2LXC B;  5CCG A;  4R4L A;  3L72 E;  1GMJ A;  4DCK A;  2JR8 A;  4N6J A;  2Q7C A;  3Q5S A;  1YQ4 C;  1SQB G;  3GW6 A;  2J59 M;  4D6T E;  1N2D C;  4U3F E;  4HB1 A;  4AUW A;  1IZN B;  4JYC A;  1R8E A;  2GUV A;  2XND H;  1SQP G;  4C46 A;  1Q7Y Q;  2ZYA A;  3PP5 A;  3F89 A;  5AW9 B;  3A5T A;  2IYO A;  1G1I A;  1LWU A;  1SFC D;  3AEG C;  1M1K Q;  1PIX A;  3O6Q B;  1DD4 A;  1S9K E;  5B5E E;  2JJL A;  2KZJ A;  2E75 B;  2FYU D;  5CBN A;  4R4M A;  2JDI H;  2HOD B;  2OTK E;  1SQP E;  2WPR A;  2ZYD A;  3JSV C;  4RJT A;  2Y9Y A;  2OQQ A;  5APS A;  2IPP A;  3LID A;  1VQ4 P;  3V2R A;  1BE3 D;  1LT1 A;  2O3J A;  4PD4 I;  5B66 H;  2Y0C A;  3R4Y A;  3CI9 A;  3II6 A;  2E5Y A;  1GK6 A;  1LTA C;  1LT9 B;  3KYQ A;  2ZT9 D;  1HJ0 A;  3IFM A;  1FOS F;  1NTM J;  2G3A A;  1LJ2 A;  2OTL P;  3UIA A;  1LNQ A;  2ZXE B;  1OIP A;  3RL0 B;  2WSC J;  1IO4 A;  4EDF A;  1K04 A;  1L0N K;  2N9B A;  2ZT9 C;  1KQG B;  3MHV A;  4TLF A;  5M1B A;  2W6A A;  1SS1 A;  2WMM A;  3V2P A;  3CCU P;  4H0L D;  2ZVN B;  1NTK K;  3L70 J;  2Q5U A;  1ZOY C;  5AVS B;  1M1J A;  1NYH A;  4L75 A;  1JY3 O;  1RQU A;  2WPV B;  3K5B A;  4H0L C;  5KJ7 D;  1NTM G;  2LKM A;  2Y0D A;  2YKO A;  2E76 D;  2D2C B;  2K37 A;  5EFW B;  1ZRT E;  3L75 D;  2M3E A;  1M57 D;  1QGK B;  1CI6 B;  1EXJ A;  1KB9 H;  1RE3 A;  1NOH A;  5KJ7 C;  1RF1 B;  3GLM A;  3S9O A;  2HFE D;  3VMA A;  1H0T A;  2E76 C;  4RES B;  1PP9 J;  3CD6 P;  3EFG A;  3GHG B;  2R3C A;  1KIL A;  1NKZ B;  4M3L A;  1R5S A;  2M8R A;  2QJY C;  1SQQ E;  3CWB G;  1NTZ G;  4CPG A;  4MN4 C;  4IL6 X;  1URQ D;  1PPJ D;  1HBW A;  1FC2 C;  2IBZ D;  1VF5 D;  3OA7 A;  2V7Q H;  3L71 J;  4WB4 A;  5KLV J;  1IK7 A;  3KPE A;  4UB8 E;  5AVQ B;  1URQ C;  3H1H J;  3BCC E;  2IZ0 A;  4HJG H;  3L73 E;  3CWB E;  4L74 A;  2JO1 A;  1EZV I;  1M7L A;  3PLN A;  4NPD A;  2R5B A;  2KUB A;  1LTT C;  3CL3 D;  1SFC B;  1SQB D;  2JWA A;  3PTZ A;  2QSI A;  1L4A D;  4DZO A;  1RHZ B;  4H44 C;  5APX A;  4OVN F;  1SQP D;  2FYN B;  4HKZ H;  2Y9Z A;  3H1I G;  2KYV A;  3E1I A;  3O6Q A;  3H1H G;  2YKQ A;  2FXP A;  3TDK A;  4Z1M H;  2IZ1 A;  1PFI A;  1VQM P;  4GDO A;  1X0T A;  2HOD A;  1QEX A;  2RMZ A;  1JNM A;  1L0L E;  3V4Q A;  1AA0 A;  3V2N A;  3VMY A;  2ZT9 B;  1Y47 A;  5AVY B;  1FS0 E;  1EXI A;  3L74 J;  2WSE H;  2YIU B;  3KQG A;  1RE3 C;  2ZXX A;  1FZF A;  2C0X A;  3TYY A;  1IFD A;  3MD0 A;  4OH8 B;  3B5N A;  2A45 I;  2FXM A;  1AQT A;  1LT9 A;  3CXH I;  1KIL C;  4LGD E;  3HUS C;  5KLI C;  4H0L B;  1OX3 A;  3EWK A;  1U7M A;  1QX8 A;  1ZV8 A;  5GTH E;  5E79 E;  3M0D C;  2MKV A;  2XNX A;  3H1L J;  1S3J A;  4WWI A;  3EFF K;  3SWK A;  3HRN A;  2E76 B;  3TNU B;  3TSI A;  3L74 G;  4HYT B;  1J1E C;  1NGM B;  3WMM 0;  5AW5 B;  3CCL P;  2FBW C;  3TF5 A;  1NTK G;  2NPS D;  2O01 J;  1EDI A;  1HVV A;  3B71 A;  3A2A A;  5CCH A;  1NTM D;  3HD7 A;  1MV8 A;  2NPS C;  1L0N E;  4NPE A;  2OTJ P;  3JC2 2;  3NMD A;  5K5G B;  1GL2 D;  3G6E P;  3SWF A;  2WZ7 A;  1RF0 C;  2AXT E;  4KJM A;  3Q1M A;  3H1L G;  1GTW A;  3IAO A;  1URQ B;  3L37 A;  1NTK E;  1M90 Q;  3GHG A;  2WSF J;  1VF5 B;  3A3Y B;  1MFT A;  1LTB C;  4PD4 E;  1BCC G;  1JMB A;  1NTZ D;  3P7K A;  1Q86 Q;  2E75 C;  3C8V A;  1BSN A;  5TIS E;  4YXD C;  1KZU B;  1ZLL A;  2M5A B;  3M91 A;  2XV5 A;  1HWT C;  1JO5 A;  2YO3 A;  1EC5 A;  4K35 A;  4EYY Q;  1NU1 J;  3NXS A;  1NAY A;  1KQS O;  1L4A B;  1JTH B;  1MFZ A;  1JY2 O;  1BCC E;  3H1J G;  1KB9 D;  3L72 J;  2ZJS E;  1P84 I;  1SFC A;  1EDK A;  1JY2 P;  2G8Y A;  1SQQ K;  2I1J A;  1SQX E;  3A0B E;  4XFJ A;  1Q82 Q;  2YMK A;  1G1J A;  4D6T J;  2A06 E;  4JBZ A;  3TK1 A;  1HUC A;  3H1I D;  3PRJ A;  3GF3 A;  2CPB A;  4GKG A;  5APW A;  3KDP B;  3RBZ A;  1NU1 G;  3GG2 A;  5B5E H;  3H1H D;  2D2C D;  1A02 J;  1IJD B;  3HUS B;  1WMK A;  1YJN P;  4I7Z B;  3L72 G;  2XDJ A;  3HE5 B;  3AE8 C;  1AQ5 A;  3T97 B;  1IFI A;  5AVV B;  1GDT A;  3AEE C;  3G3Z A;  5CCH C;  4ASV A;  2D2C C;  1OVU A;  3AE9 C;  1SQP J;  4C7R A;  1GD2 E;  4D6T G;  4U3F G;  1H8A A;  2YXQ B;  3E1R A;  3M0A A;  2PGD A;  3N4X A;  1JMM A;  1BGY E;  3CCQ P;  5KTB A;  1RF1 C;  1OW6 A;  1SQV K;  2IYP A;  4ZMD A;  2KXP B;  2WT7 B;  3H32 B;  3GHG C;  5AW2 B;  1IC2 A;  2ZAE B;  1BDC A;  5APU A;  1E5W A;  2A45 H;  1LGH B;  3AE2 C;  2POH A;  3RK3 D;  3CC2 P;  3TGU E;  1USE A;  1KYO E;  1A02 F;  2NPS B;  1L0L K;  1EDL A;  3CX5 I;  2GA1 A;  1EZV E;  2ZVO B;  3H6P A;  1NHL A;  1OFC X;  1YBK A;  5KJ7 A;  5CMZ A;  3WUU A;  3RK3 C;  3TNU A;  3M9B A;  2FYZ A;  3A0H E;  3L74 D;  2WQY C;  3M9H A;  1GL2 B;  3N7N A;  4XA4 A;  1FZG A;  4QMA A;  1XTG B;  3MP7 B;  2BCC E;  3AE3 C;  3QH9 A;  1SFC C;  1N73 C;  3G4S P;  4W7Y A;  1YIT P;  2A45 G;  3P8M C;  3CC4 P;  2CPS A;  2QRX A;  1URQ A;  1Q2N A;  2R44 A;  3H1L D;  2FYN C;  3LIE A;  3S4R A;  3AE4 C;  2WPS A;  1IFP A;  1PGP A;  3ITK A;  2KS1 B;  1AJY A;  2BEQ D;  1HJB A;  3RBX A;  3D6Z A;  2JKV A;  2OYI C;  1AVO A;  1FJP A;  1K8A Q;  1WT6 A;  2M5A A;  3CXH E;  2O01 N;  3P8C E;  1S5L H;  4UB8 H;  1VQ9 P;  1ZME C;  3CCM P;  2YIU C;  1TU3 F;  1JTH A;  1KIL E;  5APQ A;  3VYI A;  3H1J D;  4JQ0 D;  3CWB J;  3BVH A;  1RY3 A;  1NTZ J;  3ZDM A;  4ZKU A;  2O1J A;  1SQQ G;  3S1K A;  1P84 H;  3LW5 H;  1X79 B;  1DX7 A;  3B8E B;  2FYU K;  3MUD A;  2N1T D;  3LW5 J;  5AVU B;  4I1L A;  4OGQ D;  3FXE A;  3HTK B;  5H2F E;  1NU1 D;  1DIP A;  1JY3 N;  3HUS A;  2XKM A;  3BCC G;  4H13 D;  4AYC A;  3L73 G;  3HE5 A;  2CK3 H;  4OGQ C;  2B9B A;  3L72 D;  4PV1 D;  3T97 A;  5AW1 B;  1JCC A;  1FAV A;  1U57 A;  1VQ6 P;  1NH4 A;  1PGJ A;  1SQX K;  3M0D A;  2IDB A;  3AEC C;  2AXC A;  1S2E A;  2B87 B;  2BEZ F;  2K9Y A;  3VTP C;  3RK3 B;  3H1I J;  4D6T D;  4U3F D;  2QEX P;  1QL1 A;  1T2K D;  1BDD A;  1S5L E;  4AQR D;  1ZR2 A;  4N78 E;  1K9M Q;  2WT7 A;  1FBM A;  1ZW0 A;  4IFM A;  3M9Q A;  1KYO I;  3H32 A;  2V7Q J;  2KOG A;  1SQV G;  1AFO A;  3SWY A;  1VF5 C;  3MZW B;  4JPZ B;  2H89 C;  1T2K C;  3BRT B;  3L70 E;  5C39 A;  1N73 B;  2YO2 A;  2NPS A;  4O9B A;  3Q3D A;  2R32 A;  1S9K D;  1L2P A;  5GTH H;  2IBZ I;  5E79 H;  3U1A A;  1KC8 Q;  5AW3 B;  3RK2 D;  2P1J A;  4WY4 D;  1LP1 B;  1L0L G;  1RF0 A;  2KB7 P;  3Q5R A;  1P84 E;  2WWW A;  1KV4 A;  2HG5 D;  2LR2 A;  2OAR A;  4YTP C;  1SQV E;  2RH0 A;  4UB6 E;  1UIX A;  1GL2 A;  4I6M C;  3RK2 C;  1FDI A;  1RE4 C;  5KAF E;  1USD A;  1L4A C;  4RKU J;  2C9L Y;  2OYI B;  1X8Y A;  1OW8 A;  1PP9 E;  1Z56 A;  3WU2 E;  5BU8 B;  3OJA B;  3HE4 B;  1NJI Q;  2AXT H;  1OXZ A;  1L0N J;  3H1K E;  3V6I A;  1ZR4 A;  1T8Z A;  5GTI E;  3MUD C;  1WRG A;  3PJS K;  3OAK A;  2P10 A;  2KS1 A;  4WBA A;  1NTK J;  4PD4 H;  4Y28 J;  2WSE J;  3CME P;  1N86 A;  5KLV E;  2KSE A;  3I5C A;  5TIS H;  4I7Z C;  1Q81 Q;  2QG4 A;  2HPC B;  3V2Q A;  4W7Z A;  5BU5 A;  3W68 A;  4BWN A;  1ZRT D;  1EDJ A;  1SQB K;  1L0N G;  1S1C X;  1GK4 A;  1Y9B A;  3WUV A;  3VP9 A;  4HH2 A;  3CCE P;  3CX5 E;  3F5H A;  2YKP A;  2N1T B;  3A7O A;  3CLQ A;  4OGQ B;  1BCC J;  3A0B H;  2WVR A;  2QIW A;  3JCU E;  1NO4 A;  2C0W A;  2WIT A;  1SQQ D;  4H13 B;  4B86 A;  1RQV A;  1CI6 A;  4PV1 B;  1RF1 A;  5AW6 B;  2FYU G;  4I2L C;  2L5G B;  2M0B A;  3HTK A;  2Z4E A;  2GM4 A;  3H1J J;  1GL2 C;  3RGU A;  4N78 D;  1BE3 G;  1J1D B;  3G71 P;  3BCC D;  3L73 D;  3KHU A;  1LTI C;  2WTY A;  3AE7 C;  3CWB D;  2VRS A;  3KZI E;  1ZN5 A;  4BRY B;  2MJZ A;  4RO0 A;  2FYU E;  2JP3 A;  1QL2 A;  1SQX G;  2ZYG A;  4YPC A;  2FKW B;  1SVF A;  2XZR A;  4JF7 A;  5AVT B;  2A06 G;  1P84 D;  3RK2 B;  2K9J B;  2J5U A;  4WY4 B;  1BE3 E;  2P58 A;  1JUN A;  1SQV D;  3AED C;  2Y0E A;  1YTZ T;  1FZC B;  1HGV A;  2KLV A;  1KYO H;  1N73 A;  2FXO A;  1GU5 A;  3D6Y A;  1VPC A;  1LP1 A;  4U3F J;  1FJK A;  1L0L D;  3A0H H;  1NTM K;  2N9Y B;  2H88 C;  5CJ0 A;  3GMA A;  1VQL P;  1KB9 I;  5AVW B;  3VOP A;  1BGY G;  2OYI A;  1MUU A;  2PFX A;  1N7S D;  5AVR B;  3HE4 A;  3R2P A;  3KXD A;  4DT0 A;  2KZI A;  4JYB A;  4L73 A;  3TGU G;  1KOR A;  2PAJ A;  3HD7 D;  1OVV A;  3BAS A;  3H25 A;  1N7S C;  1OVR A;  1Q90 D;  3L75 E;  1EZV G;  2I8D A;  2JWD A;  1GW4 A;  5KAI E;  1KD1 Q;  2H7H A;  2ZFC A;  3FGA D;  2IBZ G;  5APT A;  4EOT A;  2Q3I A;  2NRG A;  3CCV P;  2HPC A;  4KHX A;  3CXH H;  3MGN A;  2P67 A;  4GIF A;  3GF7 A;  3VMX A;  4BXL A;  2QJP B;  5L8R J;  2K3R A;  1PV3 A;  1FZE A;  2BCC G;  4TT3 H;  1FU1 A;  2Q3E A;  1IFJ A;  1PPJ E;  1L0N D;  2PP6 A;  1Y8A A;  2IBZ E;  4GOE A;  4K3A A;  4Y99 B;  4LC1 A;  1X22 A;  2N1T A;  5KKZ C;  2Q6Q A;  3U1C A;  1M56 D;  1NTK D;  2QVA A;  3M06 A;  5KLV K;  2L91 A;  2W83 C;  1VQO P;  2E74 D;  4PD4 D;  4KT0 J;  2AEJ A;  3Q2Y A;  2HYN A;  2QJK B;  2ITA A;  4IOI H;  3SFD C;  1SQB E;  3IR9 A;  1YHQ P;  3FWN A;  2Q9I A;  5H2F H;  1QVG O;  2E74 C;  5DJU B;  1KMI Z;  3QWO C;  1VQN P;  4IL6 H;  2R3S A;  4OWF A;  1JM0 A;  2E43 A;  1YYC A;  4WVZ A;  2W8Z A;  1ZXG A;  2B89 A;  1AVY A;  2P2U A;  1BCC D;  1SQQ J;  1OZH A;  4BRY A;  2OYH C;  4XE5 B;  1FZB A;  2YMY A;  3NFQ A;  1LTJ B;  3B5N B;  2RKL A;  1SQX D;  2WSC H;  1NWQ A;  2K9J A;  4C7N B;  2K88 A;  1RE4 A;  1X9V A;  2A06 D;  4WY4 A;  3CC7 P;  1L4A A;  1W2B O;  1PZQ A;  2FFD C;  1U7J A;  3BCC J;  1YQ3 C;  3L73 J;  2KNC B;  3VP8 A;  1FZC A;  3BRV B;  5CCG D;  1NVO A;  1FOS E;  1T6A A;  2V4H A;  2KI7 B;  3IN6 A;  2JEE A;  1VDF A;  4W80 A;  3E7K A;  2RN0 A;  2Q1K A;  3C1L A;  5CCG C;  1VQ8 P;  1NAF A;  1N7S B;  3MTU E;  4UB6 H;  1PGO A;  5KAF H;  1JY3 P;  4N3Y B;  3CPW O;  2H8P D;  3HD7 B;  1SQV J;  1BGY D;  3WU2 H;  4EIJ A;  1T3J A;  2KP8 A;  1MKM A;  2N1T C;  4IL6 E;  1HF9 A;  1HH0 A;  1SLQ A;  2XU6 A;  5B66 E;  5BVZ A;  1LWU C;  1L0L J;  3L70 G; 
#chains in the Genus database with same CATH homology
 3L74 E;  4PD4 E;  1L0L E;  1NTM E;  1SQX E;  1KB9 E;  1SQV E;  2BCC E;  3L70 E;  1PPJ E;  1SQQ E;  3L72 E;  3CXH E;  3H1I E;  1BE3 E;  3L71 E;  1NTK E;  1SQP E;  5KLV E;  1NU1 E;  3L75 E;  2A06 E;  2IBZ E;  3BCC E;  3TGU E;  1BCC E;  3L73 E;  3H1L E;  1BGY E;  3CWB E;  1KYO E;  3H1K E;  4U3F E;  4D6T E;  1EZV E;  2FYU E;  3H1H E;  1NTZ E;  1P84 E;  3CX5 E;  1L0N E;  1PP9 E;  1SQB E;  3H1J E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...