1BGYE

Cytochrome bc1 complex from bovine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
b'SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 75
sequence length 75
chains with identical sequence Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bgyE00
1NTME 1PP9E 2A06E 3H1IE 3L72E 1BE3E 3L75E 1SQPE 1SQQE 3H1LE 1P84E 2FYUE 4PD4E 3H1HE 1BCCE 3H1JE 3L71E 1L0NE 3L73E 1NTKE 3L74E 4D6TE 1SQVE 1KYOE 3CWBE 1PPJE 4U3FE 5KLVE 1BGYE 2BCCE 3BCCE 1NTZE 3CXHE 1EZVE 3CX5E 1L0LE 3L70E 1KB9E 3TGUE 2IBZE 1SQXE 1NU1E 3H1KE 1SQBE
chains in the Genus database with same CATH superfamily
3L73D 1LGHB 3H1LE 4N6JA 4ASVA 1NAFA 1D7MA 2PP6A 1GTWA 1SFCA 1NO4A 2XDJA 4GT1A 2KZJA 1IZNB 4EDFA 2IBZD 2KIKA 2DW3A 5KJ7C 2KLUA 2KNCB 2ZYGA 3L74J 2Z5HA 1VQ8P 1JCCA 2QM8A 1Z56A 4JQ0D 2E76B 2WSEJ 1KD1Q 3RL0C 1BE3D 5APVA 4C46A 2WSEH 2Q7CA 2JJLA 3W67A 4H13D 3B5ND 3KYQA 2IDBA 1YYCA 4U7JA 1BGYJ 2C0XA 3Q2YA 1CZQA 2WTYA 3CCJP 2E75D 3AE3C 1YTZT 3L36A 3BRVB 2AXTH 4OGQC 1HJ0A 1S1CX 1YBKA 2W6BA 4IL6H 1LNQA 1J1EB 3VMYA 2OYOA 3CC4P 5CJ4A 1SVFA 2Y0DA 3L72E 5AVQB 5KLIB 1IFIA 4A7PA 1NTKE 1S3JA 1L0NG 1IFMA 1L0LD 2HYNA 3FXDA 1LTTC 2WT7A 2K3RA 1LWUC 2WWWA 3VYIA 1MZ9A 5GTHE 5KKZB 2KB7P 4ZMDA 3CMAP 4KT0J 3L75E 2JEEA 2YIUC 1L4AC 2ZT9B 3BASA 3CX5D 3CWBE 1AQTA 3TK1A 1AA0A 4N3YB 5KAIE 2A45H 1S4XA 1HTLC 1URQD 1Q86Q 3GHGA 1KQLA 3GF7A 2KSEA 3BCCD 4U3FJ 1DX7A 2M3BA 1NTZG 1LTAC 3AE4C 5GTHH 1NTMJ 1SQXE 1P84D 2WPSA 2QE7H 1DEEG 1Q82Q 3EWKA 3H1LG 4GOEA 1ZN5A 3CXHD 4DZOA 3TNUB 2GUSA 5KAIH 2XNDH 1CI6B 1PZQA 5CCGD 1LTJC 1FJPA 2A06E 3L74D 1SQPE 5CCHD 2C9NY 1KB9I 1AV1A 4D6TD 4UB8E 1FZGA 1A02J 1OWAA 2B89A 4PD4I 3CCQP 1CSBA 1PFIA 3VMZA 3C9IA 2JP3A 1H8AA 3WU2E 3V4QA 3OW2O 2JWDA 2K9JA 4HYTB 2BCCJ 2O3JA 2YKOA 3BATA 3AEAC 3CPWO 2I1JA 3AEBC 2FYNB 2AEJA 3D70A 1VQPP 1SLQA 3MGNA 2YMYA 3CLQA 4PJ0E 3H25A 5KLVJ 3AE9C 2R32A 1JOCA 1CI6A 4HH2A 2R5BA 1YQ4C 1QX8A 3H1KJ 3TGUE 3U1CA 2A45G 5APUA 1KN7A 1JNMA 2W27A 3L72G 2Z4EA 3LW5J 1S5LH 1RY3A 1NTKG 1IFJA 1MV8A 3VTPC 3IFMA 1N7SB 3B4SA 5C39A 1URQB 3LW5H 3G71P 2HPCB 3RBZA 2YNYA 1NU1E 2FYUE 3KZIE 3L75G 3WMM0 4EYYQ 1M1JC 5K5GB 2AXCA 3RK2D 3FWNA 5AVUB 4RJTA 3EFGA 4UB6E 1SQBK 1QLED 3H1JD 1PGJA 2FYUK 1TU3F 1BCCE 1VQ7P 1W2EA 2FYZA 3L73E 2OGUA 1CW5A 1VQLP 1GDTA 3L70D 4WWIA 1U7JA 3SWKA 1E79H 2HODB 2IBZE 1PIXA 3L37A 1PP9G 1NAYA 3V5BA 2Y9YA 1N7SA 1URQA 4N78D 2B88A 2YMKA 3M9BA 4H44C 2HPCA 1ZR4A 1NOHA 3I55P 1UIIA 1IFDA 3VP8A 1FZAA 3HD7D 3D71A 2WSCH 4H0LC 1VPCA 1BE3E 2NPSB 1YJ9P 2A06G 1KILB 1SQPG 2JR8A 3L71G 3PRJA 1ZRTD 2JO1A 1GMJA 3M06A 5AW1B 5KTBA 5AVWB 3FX0A 3L71D 1T2KC 2KYVA 5CCHA 1KV4A 4R4MA 1G2CA 1VQ4P 2KXPB 3UIAA 3KDPB 3AECC 2K88A 3CL3D 5AVYB 2E5TA 2J5UA 2E76D 3O8ZA 4PV1C 2PGDA 4AYCA 1ZW0A 2KLVA 2NPSA 5AW2B 1L0LE 2ZXEB 2V4HA 1KILA 1NKZB 3TGUG 2XZRA 2GM4A 3OJAB 1FZBA 3V6IA 1QL2A 1XTGB 3G6EP 2G8YA 1GZLA 3HE5B 4ASWA 2IZ1A 3CX5E 1L0LK 3FWLA 4L73A 3G9RA 1M1JB 2SPZA 1SQQK 1ZMEC 1NHLA 4JF7A 2FYUG 2CPBA 1SQVK 3HE4A 1KB9D 3BCCE 1Q81Q 3V2QA 1SQBD 1GK6A 2PRRA 2IYOA 4PD4D 1L0NJ 3H32A 1P84E 2Q5UA 1JCDA 3LIEA 5M1BA 1QGKB 5BVZA 3MUDA 1BCCG 3L73G 4BWNA 3IAOA 4RESB 3CXHE 1N8RQ 2ZT9D 3CX5H 1OZHA 4I6MC 4YXDC 1R5LA 1FZEA 4AQRD 3SSUA 2IBZG 4Y28J 1XTCC 2O01J 4WY4C 3HE5A 3RK3B 4H0LB 4D6TE 3PH0A 2O01H 1HH0A 5APSA 5AVVB 4GOFA 3M0DC 3Q5RA 1EZVI 2R3SA 3MHVA 1YI2P 1ZR2A 1BE3G 1P84H 3NTNA 2CK3H 3AE6C 3TYYA 1WMKA 2W83C 1NTZJ 1DIPA 3PLNA 4KHXA 4DCKA 3HUSA 5KJ7D 1ZV8A 2R5DA 2JKVA 3HD7A 3USSA 1JY2O 3H1LJ 2H88C 2FY8A 1DD3A 2YKPA 3PP5A 4W7ZA 1N86A 1RE3C 2VRSA 3MIWA 5AW7B 3KXDA 2YO2A 2XU6A 5H2FE 1OW7A 2QM7A 1RE4C 1K04A 2E74B 2WSSH 1S72P 1OW6A 3H1HD 2E75C 2Q1KA 2OYHC 5TJHA 1USEA 2KI7B 1DEBA 1BDCA 1OW8A 1FZCC 2KNCA 1QVGO 4YTPC 5BU8B 2PFXA 3AEEC 1L0LG 1U57A 1PGPA 4XFJA 2E43A 2CPSA 1LTSC 2QVAA 1GW3A 4R4LA 3U59A 3KPEA 1EDLA 5H2FH 3BRTB 2MKVA 4W7YA 3H1ID 2OTLP 1N73B 1BSNA 1SQQD 2WMMA 3Q3DA 2IPPA 1LT9B 3N7NA 1SQVD 2N1TC 3H1JE 3I5CA 1RF0C 3IN6A 2LXBA 1PV3A 1OVUA 2UWJE 5AW0B 4KJMA 3BCCG 1Y47A 3L70E 4WB4A 3L72J 1PL5A 3G3ZA 3H6PA 2D2CC 1N7SD 1G1JA 1NTKJ 1G1IA 5APYA 1KQGB 3MZWB 1RF1C 2K1AA 4L74A 1JMMA 2J58A 4N78E 5KAFE 4WY4B 4BXLA 1BDDA 2H8PD 3CD6P 3VP9A 1NTMK 3L75J 1PP9E 4CPGA 5AVXB 2QJPC 2QIWA 2YO3A 3KHUA 5DJTB 3CWBJ 4EI2A 3L74G 3WUTA 1N73A 4D6TG 1ZRTE 3M9QA 3EFFK 1LT9A 4ZNCA 1OX3A 3SWFA 1JEKA 5CCGC 3D6ZA 3RL0B 2XKMA 2OTJP 3L71E 1PPJD 3S1KA 1KFNA 2ZXXA 4K3AA 1LTGC 1QEXA 5KAFH 1BGYG 4GODA 1SQXJ 3C1LA 2FXOA 1VQOP 2ITAA 2FXMA 1T8ZA 1VQKP 1OVVA 1KORA 2QEXP 4I7ZC 2P58A 1BGYD 2I8DA 3A3YB 4OGQB 2NPSD 1KILD 3V2PA 5KJ7A 2QJYC 1SQPJ 1K9MQ 3A0BE 4GIFA 1ZOYC 1J2JB 1AJYA 3G4SP 4UB8H 3FXEA 1E5WA 5KLVK 3TNUA 4YPCA 1YIJP 4YXWH 1MFTA 2OYIC 3WU2H 1LWUB 1BSHA 1N2DC 3B8EB 1NVOA 2FFDC 2KOGA 4NPFX 1KQSO 4JYCA 2N1TB 2QJKC 2V7QJ 2YIUB 1L4AB 4IFDK 3ZDMA 1KYOI 2Q6QA 2V7QH 3O6QB 1KB9E 2OARA 1NH4A 2KUBA 2QRXA 1EQ7A 1SQBE 1H88A 3A0BH 2WPQA 3P8CD 1GL2C 4RKUJ 2W6JH 3F89A 4PD4E 1A02F 2D2CB 3H1JG 2C0WA 1EZVD 2IZ0A 4PJ0H 5CHXA 3TGUJ 3RK2C 1W2BO 1JY3O 4XE5B 3L70G 4HB1A 5E79E 3JCUE 1Q7YQ 1NTMG 4ZKPA 1JUNA 1FU1A 1MFZA 1SFCC 4U3FD 3GW6A 3P32A 1OFCX 1IFNA 5L8RJ 1YQ3C 1LWUA 1NTMD 1NU1J 1HGVA 1JM0A 2FYUJ 4OH8B 2BASA 1L4AA 3KZIH 1LTJB 2M0BA 4BRYB 2Q3EA 1KZUB 2WSCJ 1FBMA 4W80A 4UB6H 1BCCJ 3JCUH 3L73J 1IK7A 1VQ5P 3Q5PA 3AE1C 1X0TA 5GTIE 1Y8AA 1ZXGA 1K8AQ 4OVNF 4K35A 3RK3D 4H0LD 3CI9A 4LLHA 3H1HE 3AEDC 1EXJA 2QJYB 2O1JA 2GUVA 2BCCD 3AEGC 2HODA 3CCSP 2ZFCA 2B87B 3B71A 2POHA 2MJZA 1Q90D 1BE3J 1LTJA 1AFOA 1T2KD 1U7MA 2KP8A 3R2PA 1T3UA 1MKMA 2OYIB 5KLVD 3OAKA 5GTIH 3CC2P 1LJ2A 3H1KD 1FS0E 1IK9A 3GMAA 2RN0A 2QJKB 1Q2NA 3H1IE 1SQQE 1VF5C 4QMAA 4IOIH 2E74D 2H7HA 1NWQA 4AUWA 1SQVE 1EDJA 1GL2B 2ZVOB 3T97B 2AEMA 3JC22 2Q9IA 2RMZA 2ZYAA 1LTBC 3GHGC 1SQBG 3OA7A 1W5CE 1FOSF 3IF4A 3S4RA 3F5HA 1SFCB 1L0LJ 2ZJSE 5AVSB 3GF3A 2WVRA 3K5BA 3TDKA 1JY2P 2JDIH 1GD2E 1PGOA 3CCEP 1PGQA 1VQNP 2IFMA 5KKZC 1HWTC 1RQVA 1NU1D 3V2NA 4H44B 2IX7C 2ZT9C 5B66E 3RBXA 2WSFJ 3S9OA 2HR3A 1GL2A 1SP4A 2WSFH 5CJ0A 1VQ9P 4LGDE 2IFNA 3L74E 1JB0J 1VL2A 3AEFC 1N7LA 3T97A 1PPJE 3BCCJ 1M1JA 3MTUE 4DJGA 3D6YA 1QL1A 2P67A 4MN4C 2A45I 4WY4D 4B86A 5AW5B 2HLOA 2GA1A 5TISE 2P7JA 3I56P 2OTKE 1NTZK 1BGYE 3AE7C 3II6A 3CXHH 5B66H 3QWOC 1GW4A 2AXTE 1KILE 1LTIC 2BEQD 4IL6E 1KYOD 4H13C 4D6TJ 1M1KQ 3B5NC 3H1HG 1SS1A 4JYBA 1DH3A 1AVYA 4PV1B 2KS1B 1KMIZ 3RL0D 3L4FA 2KK7A 2WT7B 2IYPA 3P8MC 3A5TA 4TLFA 3GLMA 5TISH 1AQ5A 3CCRP 1JY3N 1VF5B 1M90Q 1OXZA 1FE6A 2B9BA 3CC7P 1HGZA 5AVTB 1X79B 2NZ2A 4OGQD 3H1IG 3CCLP 1SQQG 3P8CE 3GHGB 1HUCA 2FYNC 2WPRA 1SQVG 1M7LA 1KTMA 1EZVE 1FDOA 1X9VA 2HFED 5CBOA 3CCMP 4M3LA 3P7KA 4L76A 2KS1A 3R4YA 1WRGA 4IFMA 1WT6A 1T6AA 1IFPA 4U3FE 3A0HE 1GU5A 1YTZI 3SFEC 4IFFA 3AE8C 3MD0A 1L0ND 1NTME 2N1TD 1N7SC 1L4AD 1URQC 1NTKK 2J59M 1X8YA 1NYHA 4ZKUA 1ZP0C 3E1IA 1VQMP 4I1LA 3A7OA 5AW3B 3GG2A 1FDIA 3VMXA 2D2CD 3A2AA 1VQ6P 2P2UA 1S9KD 2YKQA 3H1JJ 5EFWB 2ZYDA 1FZFA 3M91A 1PPJG 3A0HH 3L70J 1MUUA 2K9JB 3ABVC 3SFDC 1JO5A 3RGUA 1LT1A 2W6AA 1RHZB 3JSVC 4IL6X 4GDOA 3RK3E 5CCHC 1M57D 3TF5A 3ITKA 1NTZD 1FDMA 4DT0A 4H13B 2BCCE 3VMAA 3B5NB 3WUVA 2YXRB 1GU4A 1SQXK 3HTKB 3H1LD 1HJBA 1PP9J 2O1KA 2RKLA 4WY4A 2E75B 2OYHB 4GKGA 5KLVE 2NPSC 2R3CA 1KILC 1HF9A 2AEFA 2BEZF 3H1KE 3M0DA 1SQPK 2PAJA 1JY3P 3L71J 1FZCB 1RH5B 1S5LE 2JWAA 3FGAD 4Y99C 2YXQB 2L5GB 3SWYA 1EC5A 1EDIA 3NFQA 1J1DC 1DD4A 1FAVA 3LIDA 3W68A 2IBZI 2K9YA 3M9HA 1RE3A 3B5NA 2W8ZA 1HBWA 2M8RA 3HTKA 1NJIQ 1IO4A 3VOPA 2WITA 1RE4A 3Q1MA 1EZVG 3Q5SA 1OMIA 3U1AA 2H43A 2OYHA 2Z5IA 1M56D 3MUDC 1R8EA 4TT3H 2WZ7A 4U3FG 5AW9B 2K37A 3VN0A 1FZCA 1NGMB 1VDFA 3L72D 1RF1B 2QG4A 4O9BA 1GL2D 1Y9BA 5BU5A 1NTKD 5APTA 1JMBA 3E1RA 2L91A 1NKNA 3EQ2A 3AE2C 4EIJA 1EXIA 2ZAEB 3PTZA 2LR2A 1S2EA 3CWBG 1JY2N 1YHQP 3PJSK 2QJPB 2WPVB 1NU1K 1SQBJ 2NRGA 3L75D 1KB9H 1SFCD 1OVRA 1ZLLA 3CWBD 2N1TA 4PD4H 2QSIA 2WQYC 1RF0A 2ZVNB 5AW4B 1OIPA 3KQGA 3O6QA 1JTHB 3HUSC 4C7NB 1KC8Q 1QVFO 1H0TB 1G2CB 4WVZA 1FOSE 3HD7C 4L75A 3V2RA 1SQXG 2O01N 4XA4A 5E79H 1FJKA 3L35A 2LKMA 4H44D 4DOJA 3QH9A 5APWA 3NMDA 1KYOE 2FKWB 3M0AA 2Y0CA 1RF1A 1SQXD 4I7ZB 1PP9D 2BCCG 3CMEP 3RK3C 3CX5I 3CCVP 5AW6B 1S5LX 3PHLA 2E42A 5APQA 1FC2C 3IR9A 2XV5A 2G3AA 2M3EA 1USDA 2N9BA 4Y99B 4I2LC 2M5AB 5KLVG 2N9YB 4HJGH 1KFMA 1IJDB 2A06D 1L2PA 1SQPD 4WBAA 5B5EE 1J1DB 1IC2A 3H1KG 5CCGA 3C8VA 4BRYA 5AVZB 1JTHA 2E76C 4C7NA 3BVHA 1H0TA 4NPDA 5AW8B 1M8OB 4JBZA 1P84I 2C9LY 1KYOH 1YJNP 1T3JA 4Z1MH 1GK4A 3HE4B 1YJWP 2FFDB 2P10A 3V4WA 2P1JA 3CXHI 3H1HJ 3NXSA 4PV1D 2W90A 2HG5D 1RQUA 2E74C 3HRNA 3H32B 3N4XA 2Y9ZA 3RL0g 4HKZH 3AE5C 1H89A 3CCUP 2I1KA 1X22A 5B5EH 1VF5D 3RK2B 1K05A 1R5SA 1J1EC 1LP1B 2E5YA 2Y0EA 1L0NE 2M5AA 2B87A 1EDKA 4C7RA 2FBWC 3TGUD 5KLIC 5DJUB 1YITP 3H1IJ 1SQQJ 1NU1G 2OYIA 1S9KE 4RO0A 1L0NK 1SQVJ 5CMZA 2KZIA 2FFDA 1N73C 2RH0A 4LC1A 1LT9C 4NPEA 5CBNA 2KSJA 3WUUA 2XNXA 2LXCB 2FYUD 2QA4P 3HUSB 2Q3IA 2R44A 2H89C 3HD7B 3TSIA 3MP7B 4EOTA 5APXA 3E7KA 4OWFA 1AVOA 4JPZB 1K73Q 1NTZE 1HVVA 2FXPA 5AVRB 1UIXA 2OQQA 1KQFB 1LP1A 1BCCD
chains in the Genus database with same CATH topology
1NTME 1PP9E 2A06E 3H1IE 3L72E 1BE3E 3L75E 1SQPE 1SQQE 3H1LE 1P84E 2FYUE 4PD4E 3H1HE 1BCCE 3H1JE 3L71E 1L0NE 3L73E 1NTKE 3L74E 4D6TE 1SQVE 1KYOE 3CWBE 1PPJE 4U3FE 5KLVE 1BGYE 2BCCE 3BCCE 1NTZE 3CXHE 1EZVE 3CX5E 1L0LE 3L70E 1KB9E 3TGUE 2IBZE 1SQXE 1NU1E 3H1KE 1SQBE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM E;  1PP9 E;  2A06 E;  3H1I E;  3L72 E;  1BE3 E;  3L75 E;  1SQP E;  1SQQ E;  3H1L E;  1P84 E;  2FYU E;  4PD4 E;  3H1H E;  1BCC E;  3H1J E;  3L71 E;  1L0N E;  3L73 E;  1NTK E;  3L74 E;  4D6T E;  1SQV E;  1KYO E;  3CWB E;  1PPJ E;  4U3F E;  5KLV E;  1BGY E;  2BCC E;  3BCC E;  1NTZ E;  3CXH E;  1EZV E;  3CX5 E;  1L0L E;  3L70 E;  1KB9 E;  3TGU E;  2IBZ E;  1SQX E;  1NU1 E;  3H1K E;  1SQB E; 
#chains in the Genus database with same CATH topology
 3L73 D;  1LGH B;  3H1L E;  4N6J A;  4ASV A;  1NAF A;  1D7M A;  2PP6 A;  1GTW A;  1SFC A;  1NO4 A;  2XDJ A;  4GT1 A;  2KZJ A;  1IZN B;  4EDF A;  2IBZ D;  2KIK A;  2DW3 A;  5KJ7 C;  2KLU A;  2KNC B;  2ZYG A;  3L74 J;  2Z5H A;  1VQ8 P;  1JCC A;  2QM8 A;  1Z56 A;  4JQ0 D;  2E76 B;  2WSE J;  1KD1 Q;  3RL0 C;  1BE3 D;  5APV A;  4C46 A;  2WSE H;  2Q7C A;  2JJL A;  3W67 A;  4H13 D;  3B5N D;  3KYQ A;  2IDB A;  1YYC A;  4U7J A;  1BGY J;  2C0X A;  3Q2Y A;  1CZQ A;  2WTY A;  3CCJ P;  2E75 D;  3AE3 C;  1YTZ T;  3L36 A;  3BRV B;  2AXT H;  4OGQ C;  1HJ0 A;  1S1C X;  1YBK A;  2W6B A;  4IL6 H;  1LNQ A;  1J1E B;  3VMY A;  2OYO A;  3CC4 P;  5CJ4 A;  1SVF A;  2Y0D A;  3L72 E;  5AVQ B;  5KLI B;  1IFI A;  4A7P A;  1NTK E;  1S3J A;  1L0N G;  1IFM A;  1L0L D;  2HYN A;  3FXD A;  1LTT C;  2WT7 A;  2K3R A;  1LWU C;  2WWW A;  3VYI A;  1MZ9 A;  5GTH E;  5KKZ B;  2KB7 P;  4ZMD A;  3CMA P;  4KT0 J;  3L75 E;  2JEE A;  2YIU C;  1L4A C;  2ZT9 B;  3BAS A;  3CX5 D;  3CWB E;  1AQT A;  3TK1 A;  1AA0 A;  4N3Y B;  5KAI E;  2A45 H;  1S4X A;  1HTL C;  1URQ D;  1Q86 Q;  3GHG A;  1KQL A;  3GF7 A;  2KSE A;  3BCC D;  4U3F J;  1DX7 A;  2M3B A;  1NTZ G;  1LTA C;  3AE4 C;  5GTH H;  1NTM J;  1SQX E;  1P84 D;  2WPS A;  2QE7 H;  1DEE G;  1Q82 Q;  3EWK A;  3H1L G;  4GOE A;  1ZN5 A;  3CXH D;  4DZO A;  3TNU B;  2GUS A;  5KAI H;  2XND H;  1CI6 B;  1PZQ A;  5CCG D;  1LTJ C;  1FJP A;  2A06 E;  3L74 D;  1SQP E;  5CCH D;  2C9N Y;  1KB9 I;  1AV1 A;  4D6T D;  4UB8 E;  1FZG A;  1A02 J;  1OWA A;  2B89 A;  4PD4 I;  3CCQ P;  1CSB A;  1PFI A;  3VMZ A;  3C9I A;  2JP3 A;  1H8A A;  3WU2 E;  3V4Q A;  3OW2 O;  2JWD A;  2K9J A;  4HYT B;  2BCC J;  2O3J A;  2YKO A;  3BAT A;  3AEA C;  3CPW O;  2I1J A;  3AEB C;  2FYN B;  2AEJ A;  3D70 A;  1VQP P;  1SLQ A;  3MGN A;  2YMY A;  3CLQ A;  4PJ0 E;  3H25 A;  5KLV J;  3AE9 C;  2R32 A;  1JOC A;  1CI6 A;  4HH2 A;  2R5B A;  1YQ4 C;  1QX8 A;  3H1K J;  3TGU E;  3U1C A;  2A45 G;  5APU A;  1KN7 A;  1JNM A;  2W27 A;  3L72 G;  2Z4E A;  3LW5 J;  1S5L H;  1RY3 A;  1NTK G;  1IFJ A;  1MV8 A;  3VTP C;  3IFM A;  1N7S B;  3B4S A;  5C39 A;  1URQ B;  3LW5 H;  3G71 P;  2HPC B;  3RBZ A;  2YNY A;  1NU1 E;  2FYU E;  3KZI E;  3L75 G;  3WMM 0;  4EYY Q;  1M1J C;  5K5G B;  2AXC A;  3RK2 D;  3FWN A;  5AVU B;  4RJT A;  3EFG A;  4UB6 E;  1SQB K;  1QLE D;  3H1J D;  1PGJ A;  2FYU K;  1TU3 F;  1BCC E;  1VQ7 P;  1W2E A;  2FYZ A;  3L73 E;  2OGU A;  1CW5 A;  1VQL P;  1GDT A;  3L70 D;  4WWI A;  1U7J A;  3SWK A;  1E79 H;  2HOD B;  2IBZ E;  1PIX A;  3L37 A;  1PP9 G;  1NAY A;  3V5B A;  2Y9Y A;  1N7S A;  1URQ A;  4N78 D;  2B88 A;  2YMK A;  3M9B A;  4H44 C;  2HPC A;  1ZR4 A;  1NOH A;  3I55 P;  1UII A;  1IFD A;  3VP8 A;  1FZA A;  3HD7 D;  3D71 A;  2WSC H;  4H0L C;  1VPC A;  1BE3 E;  2NPS B;  1YJ9 P;  2A06 G;  1KIL B;  1SQP G;  2JR8 A;  3L71 G;  3PRJ A;  1ZRT D;  2JO1 A;  1GMJ A;  3M06 A;  5AW1 B;  5KTB A;  5AVW B;  3FX0 A;  3L71 D;  1T2K C;  2KYV A;  5CCH A;  1KV4 A;  4R4M A;  1G2C A;  1VQ4 P;  2KXP B;  3UIA A;  3KDP B;  3AEC C;  2K88 A;  3CL3 D;  5AVY B;  2E5T A;  2J5U A;  2E76 D;  3O8Z A;  4PV1 C;  2PGD A;  4AYC A;  1ZW0 A;  2KLV A;  2NPS A;  5AW2 B;  1L0L E;  2ZXE B;  2V4H A;  1KIL A;  1NKZ B;  3TGU G;  2XZR A;  2GM4 A;  3OJA B;  1FZB A;  3V6I A;  1QL2 A;  1XTG B;  3G6E P;  2G8Y A;  1GZL A;  3HE5 B;  4ASW A;  2IZ1 A;  3CX5 E;  1L0L K;  3FWL A;  4L73 A;  3G9R A;  1M1J B;  2SPZ A;  1SQQ K;  1ZME C;  1NHL A;  4JF7 A;  2FYU G;  2CPB A;  1SQV K;  3HE4 A;  1KB9 D;  3BCC E;  1Q81 Q;  3V2Q A;  1SQB D;  1GK6 A;  2PRR A;  2IYO A;  4PD4 D;  1L0N J;  3H32 A;  1P84 E;  2Q5U A;  1JCD A;  3LIE A;  5M1B A;  1QGK B;  5BVZ A;  3MUD A;  1BCC G;  3L73 G;  4BWN A;  3IAO A;  4RES B;  3CXH E;  1N8R Q;  2ZT9 D;  3CX5 H;  1OZH A;  4I6M C;  4YXD C;  1R5L A;  1FZE A;  4AQR D;  3SSU A;  2IBZ G;  4Y28 J;  1XTC C;  2O01 J;  4WY4 C;  3HE5 A;  3RK3 B;  4H0L B;  4D6T E;  3PH0 A;  2O01 H;  1HH0 A;  5APS A;  5AVV B;  4GOF A;  3M0D C;  3Q5R A;  1EZV I;  2R3S A;  3MHV A;  1YI2 P;  1ZR2 A;  1BE3 G;  1P84 H;  3NTN A;  2CK3 H;  3AE6 C;  3TYY A;  1WMK A;  2W83 C;  1NTZ J;  1DIP A;  3PLN A;  4KHX A;  4DCK A;  3HUS A;  5KJ7 D;  1ZV8 A;  2R5D A;  2JKV A;  3HD7 A;  3USS A;  1JY2 O;  3H1L J;  2H88 C;  2FY8 A;  1DD3 A;  2YKP A;  3PP5 A;  4W7Z A;  1N86 A;  1RE3 C;  2VRS A;  3MIW A;  5AW7 B;  3KXD A;  2YO2 A;  2XU6 A;  5H2F E;  1OW7 A;  2QM7 A;  1RE4 C;  1K04 A;  2E74 B;  2WSS H;  1S72 P;  1OW6 A;  3H1H D;  2E75 C;  2Q1K A;  2OYH C;  5TJH A;  1USE A;  2KI7 B;  1DEB A;  1BDC A;  1OW8 A;  1FZC C;  2KNC A;  1QVG O;  4YTP C;  5BU8 B;  2PFX A;  3AEE C;  1L0L G;  1U57 A;  1PGP A;  4XFJ A;  2E43 A;  2CPS A;  1LTS C;  2QVA A;  1GW3 A;  4R4L A;  3U59 A;  3KPE A;  1EDL A;  5H2F H;  3BRT B;  2MKV A;  4W7Y A;  3H1I D;  2OTL P;  1N73 B;  1BSN A;  1SQQ D;  2WMM A;  3Q3D A;  2IPP A;  1LT9 B;  3N7N A;  1SQV D;  2N1T C;  3H1J E;  3I5C A;  1RF0 C;  3IN6 A;  2LXB A;  1PV3 A;  1OVU A;  2UWJ E;  5AW0 B;  4KJM A;  3BCC G;  1Y47 A;  3L70 E;  4WB4 A;  3L72 J;  1PL5 A;  3G3Z A;  3H6P A;  2D2C C;  1N7S D;  1G1J A;  1NTK J;  1G1I A;  5APY A;  1KQG B;  3MZW B;  1RF1 C;  2K1A A;  4L74 A;  1JMM A;  2J58 A;  4N78 E;  5KAF E;  4WY4 B;  4BXL A;  1BDD A;  2H8P D;  3CD6 P;  3VP9 A;  1NTM K;  3L75 J;  1PP9 E;  4CPG A;  5AVX B;  2QJP C;  2QIW A;  2YO3 A;  3KHU A;  5DJT B;  3CWB J;  4EI2 A;  3L74 G;  3WUT A;  1N73 A;  4D6T G;  1ZRT E;  3M9Q A;  3EFF K;  1LT9 A;  4ZNC A;  1OX3 A;  3SWF A;  1JEK A;  5CCG C;  3D6Z A;  3RL0 B;  2XKM A;  2OTJ P;  3L71 E;  1PPJ D;  3S1K A;  1KFN A;  2ZXX A;  4K3A A;  1LTG C;  1QEX A;  5KAF H;  1BGY G;  4GOD A;  1SQX J;  3C1L A;  2FXO A;  1VQO P;  2ITA A;  2FXM A;  1T8Z A;  1VQK P;  1OVV A;  1KOR A;  2QEX P;  4I7Z C;  2P58 A;  1BGY D;  2I8D A;  3A3Y B;  4OGQ B;  2NPS D;  1KIL D;  3V2P A;  5KJ7 A;  2QJY C;  1SQP J;  1K9M Q;  3A0B E;  4GIF A;  1ZOY C;  1J2J B;  1AJY A;  3G4S P;  4UB8 H;  3FXE A;  1E5W A;  5KLV K;  3TNU A;  4YPC A;  1YIJ P;  4YXW H;  1MFT A;  2OYI C;  3WU2 H;  1LWU B;  1BSH A;  1N2D C;  3B8E B;  1NVO A;  2FFD C;  2KOG A;  4NPF X;  1KQS O;  4JYC A;  2N1T B;  2QJK C;  2V7Q J;  2YIU B;  1L4A B;  4IFD K;  3ZDM A;  1KYO I;  2Q6Q A;  2V7Q H;  3O6Q B;  1KB9 E;  2OAR A;  1NH4 A;  2KUB A;  2QRX A;  1EQ7 A;  1SQB E;  1H88 A;  3A0B H;  2WPQ A;  3P8C D;  1GL2 C;  4RKU J;  2W6J H;  3F89 A;  4PD4 E;  1A02 F;  2D2C B;  3H1J G;  2C0W A;  1EZV D;  2IZ0 A;  4PJ0 H;  5CHX A;  3TGU J;  3RK2 C;  1W2B O;  1JY3 O;  4XE5 B;  3L70 G;  4HB1 A;  5E79 E;  3JCU E;  1Q7Y Q;  1NTM G;  4ZKP A;  1JUN A;  1FU1 A;  1MFZ A;  1SFC C;  4U3F D;  3GW6 A;  3P32 A;  1OFC X;  1IFN A;  5L8R J;  1YQ3 C;  1LWU A;  1NTM D;  1NU1 J;  1HGV A;  1JM0 A;  2FYU J;  4OH8 B;  2BAS A;  1L4A A;  3KZI H;  1LTJ B;  2M0B A;  4BRY B;  2Q3E A;  1KZU B;  2WSC J;  1FBM A;  4W80 A;  4UB6 H;  1BCC J;  3JCU H;  3L73 J;  1IK7 A;  1VQ5 P;  3Q5P A;  3AE1 C;  1X0T A;  5GTI E;  1Y8A A;  1ZXG A;  1K8A Q;  4OVN F;  4K35 A;  3RK3 D;  4H0L D;  3CI9 A;  4LLH A;  3H1H E;  3AED C;  1EXJ A;  2QJY B;  2O1J A;  2GUV A;  2BCC D;  3AEG C;  2HOD A;  3CCS P;  2ZFC A;  2B87 B;  3B71 A;  2POH A;  2MJZ A;  1Q90 D;  1BE3 J;  1LTJ A;  1AFO A;  1T2K D;  1U7M A;  2KP8 A;  3R2P A;  1T3U A;  1MKM A;  2OYI B;  5KLV D;  3OAK A;  5GTI H;  3CC2 P;  1LJ2 A;  3H1K D;  1FS0 E;  1IK9 A;  3GMA A;  2RN0 A;  2QJK B;  1Q2N A;  3H1I E;  1SQQ E;  1VF5 C;  4QMA A;  4IOI H;  2E74 D;  2H7H A;  1NWQ A;  4AUW A;  1SQV E;  1EDJ A;  1GL2 B;  2ZVO B;  3T97 B;  2AEM A;  3JC2 2;  2Q9I A;  2RMZ A;  2ZYA A;  1LTB C;  3GHG C;  1SQB G;  3OA7 A;  1W5C E;  1FOS F;  3IF4 A;  3S4R A;  3F5H A;  1SFC B;  1L0L J;  2ZJS E;  5AVS B;  3GF3 A;  2WVR A;  3K5B A;  3TDK A;  1JY2 P;  2JDI H;  1GD2 E;  1PGO A;  3CCE P;  1PGQ A;  1VQN P;  2IFM A;  5KKZ C;  1HWT C;  1RQV A;  1NU1 D;  3V2N A;  4H44 B;  2IX7 C;  2ZT9 C;  5B66 E;  3RBX A;  2WSF J;  3S9O A;  2HR3 A;  1GL2 A;  1SP4 A;  2WSF H;  5CJ0 A;  1VQ9 P;  4LGD E;  2IFN A;  3L74 E;  1JB0 J;  1VL2 A;  3AEF C;  1N7L A;  3T97 A;  1PPJ E;  3BCC J;  1M1J A;  3MTU E;  4DJG A;  3D6Y A;  1QL1 A;  2P67 A;  4MN4 C;  2A45 I;  4WY4 D;  4B86 A;  5AW5 B;  2HLO A;  2GA1 A;  5TIS E;  2P7J A;  3I56 P;  2OTK E;  1NTZ K;  1BGY E;  3AE7 C;  3II6 A;  3CXH H;  5B66 H;  3QWO C;  1GW4 A;  2AXT E;  1KIL E;  1LTI C;  2BEQ D;  4IL6 E;  1KYO D;  4H13 C;  4D6T J;  1M1K Q;  3B5N C;  3H1H G;  1SS1 A;  4JYB A;  1DH3 A;  1AVY A;  4PV1 B;  2KS1 B;  1KMI Z;  3RL0 D;  3L4F A;  2KK7 A;  2WT7 B;  2IYP A;  3P8M C;  3A5T A;  4TLF A;  3GLM A;  5TIS H;  1AQ5 A;  3CCR P;  1JY3 N;  1VF5 B;  1M90 Q;  1OXZ A;  1FE6 A;  2B9B A;  3CC7 P;  1HGZ A;  5AVT B;  1X79 B;  2NZ2 A;  4OGQ D;  3H1I G;  3CCL P;  1SQQ G;  3P8C E;  3GHG B;  1HUC A;  2FYN C;  2WPR A;  1SQV G;  1M7L A;  1KTM A;  1EZV E;  1FDO A;  1X9V A;  2HFE D;  5CBO A;  3CCM P;  4M3L A;  3P7K A;  4L76 A;  2KS1 A;  3R4Y A;  1WRG A;  4IFM A;  1WT6 A;  1T6A A;  1IFP A;  4U3F E;  3A0H E;  1GU5 A;  1YTZ I;  3SFE C;  4IFF A;  3AE8 C;  3MD0 A;  1L0N D;  1NTM E;  2N1T D;  1N7S C;  1L4A D;  1URQ C;  1NTK K;  2J59 M;  1X8Y A;  1NYH A;  4ZKU A;  1ZP0 C;  3E1I A;  1VQM P;  4I1L A;  3A7O A;  5AW3 B;  3GG2 A;  1FDI A;  3VMX A;  2D2C D;  3A2A A;  1VQ6 P;  2P2U A;  1S9K D;  2YKQ A;  3H1J J;  5EFW B;  2ZYD A;  1FZF A;  3M91 A;  1PPJ G;  3A0H H;  3L70 J;  1MUU A;  2K9J B;  3ABV C;  3SFD C;  1JO5 A;  3RGU A;  1LT1 A;  2W6A A;  1RHZ B;  3JSV C;  4IL6 X;  4GDO A;  3RK3 E;  5CCH C;  1M57 D;  3TF5 A;  3ITK A;  1NTZ D;  1FDM A;  4DT0 A;  4H13 B;  2BCC E;  3VMA A;  3B5N B;  3WUV A;  2YXR B;  1GU4 A;  1SQX K;  3HTK B;  3H1L D;  1HJB A;  1PP9 J;  2O1K A;  2RKL A;  4WY4 A;  2E75 B;  2OYH B;  4GKG A;  5KLV E;  2NPS C;  2R3C A;  1KIL C;  1HF9 A;  2AEF A;  2BEZ F;  3H1K E;  3M0D A;  1SQP K;  2PAJ A;  1JY3 P;  3L71 J;  1FZC B;  1RH5 B;  1S5L E;  2JWA A;  3FGA D;  4Y99 C;  2YXQ B;  2L5G B;  3SWY A;  1EC5 A;  1EDI A;  3NFQ A;  1J1D C;  1DD4 A;  1FAV A;  3LID A;  3W68 A;  2IBZ I;  2K9Y A;  3M9H A;  1RE3 A;  3B5N A;  2W8Z A;  1HBW A;  2M8R A;  3HTK A;  1NJI Q;  1IO4 A;  3VOP A;  2WIT A;  1RE4 A;  3Q1M A;  1EZV G;  3Q5S A;  1OMI A;  3U1A A;  2H43 A;  2OYH A;  2Z5I A;  1M56 D;  3MUD C;  1R8E A;  4TT3 H;  2WZ7 A;  4U3F G;  5AW9 B;  2K37 A;  3VN0 A;  1FZC A;  1NGM B;  1VDF A;  3L72 D;  1RF1 B;  2QG4 A;  4O9B A;  1GL2 D;  1Y9B A;  5BU5 A;  1NTK D;  5APT A;  1JMB A;  3E1R A;  2L91 A;  1NKN A;  3EQ2 A;  3AE2 C;  4EIJ A;  1EXI A;  2ZAE B;  3PTZ A;  2LR2 A;  1S2E A;  3CWB G;  1JY2 N;  1YHQ P;  3PJS K;  2QJP B;  2WPV B;  1NU1 K;  1SQB J;  2NRG A;  3L75 D;  1KB9 H;  1SFC D;  1OVR A;  1ZLL A;  3CWB D;  2N1T A;  4PD4 H;  2QSI A;  2WQY C;  1RF0 A;  2ZVN B;  5AW4 B;  1OIP A;  3KQG A;  3O6Q A;  1JTH B;  3HUS C;  4C7N B;  1KC8 Q;  1QVF O;  1H0T B;  1G2C B;  4WVZ A;  1FOS E;  3HD7 C;  4L75 A;  3V2R A;  1SQX G;  2O01 N;  4XA4 A;  5E79 H;  1FJK A;  3L35 A;  2LKM A;  4H44 D;  4DOJ A;  3QH9 A;  5APW A;  3NMD A;  1KYO E;  2FKW B;  3M0A A;  2Y0C A;  1RF1 A;  1SQX D;  4I7Z B;  1PP9 D;  2BCC G;  3CME P;  3RK3 C;  3CX5 I;  3CCV P;  5AW6 B;  1S5L X;  3PHL A;  2E42 A;  5APQ A;  1FC2 C;  3IR9 A;  2XV5 A;  2G3A A;  2M3E A;  1USD A;  2N9B A;  4Y99 B;  4I2L C;  2M5A B;  5KLV G;  2N9Y B;  4HJG H;  1KFM A;  1IJD B;  2A06 D;  1L2P A;  1SQP D;  4WBA A;  5B5E E;  1J1D B;  1IC2 A;  3H1K G;  5CCG A;  3C8V A;  4BRY A;  5AVZ B;  1JTH A;  2E76 C;  4C7N A;  3BVH A;  1H0T A;  4NPD A;  5AW8 B;  1M8O B;  4JBZ A;  1P84 I;  2C9L Y;  1KYO H;  1YJN P;  1T3J A;  4Z1M H;  1GK4 A;  3HE4 B;  1YJW P;  2FFD B;  2P10 A;  3V4W A;  2P1J A;  3CXH I;  3H1H J;  3NXS A;  4PV1 D;  2W90 A;  2HG5 D;  1RQU A;  2E74 C;  3HRN A;  3H32 B;  3N4X A;  2Y9Z A;  3RL0 g;  4HKZ H;  3AE5 C;  1H89 A;  3CCU P;  2I1K A;  1X22 A;  5B5E H;  1VF5 D;  3RK2 B;  1K05 A;  1R5S A;  1J1E C;  1LP1 B;  2E5Y A;  2Y0E A;  1L0N E;  2M5A A;  2B87 A;  1EDK A;  4C7R A;  2FBW C;  3TGU D;  5KLI C;  5DJU B;  1YIT P;  3H1I J;  1SQQ J;  1NU1 G;  2OYI A;  1S9K E;  4RO0 A;  1L0N K;  1SQV J;  5CMZ A;  2KZI A;  2FFD A;  1N73 C;  2RH0 A;  4LC1 A;  1LT9 C;  4NPE A;  5CBN A;  2KSJ A;  3WUU A;  2XNX A;  2LXC B;  2FYU D;  2QA4 P;  3HUS B;  2Q3I A;  2R44 A;  2H89 C;  3HD7 B;  3TSI A;  3MP7 B;  4EOT A;  5APX A;  3E7K A;  4OWF A;  1AVO A;  4JPZ B;  1K73 Q;  1NTZ E;  1HVV A;  2FXP A;  5AVR B;  1UIX A;  2OQQ A;  1KQF B;  1LP1 A;  1BCC D; 
#chains in the Genus database with same CATH homology
 1NTM E;  1PP9 E;  2A06 E;  3H1I E;  3L72 E;  1BE3 E;  3L75 E;  1SQP E;  1SQQ E;  3H1L E;  1P84 E;  2FYU E;  4PD4 E;  3H1H E;  1BCC E;  3H1J E;  3L71 E;  1L0N E;  3L73 E;  1NTK E;  3L74 E;  4D6T E;  1SQV E;  1KYO E;  3CWB E;  1PPJ E;  4U3F E;  5KLV E;  1BGY E;  2BCC E;  3BCC E;  1NTZ E;  3CXH E;  1EZV E;  3CX5 E;  1L0L E;  3L70 E;  1KB9 E;  3TGU E;  2IBZ E;  1SQX E;  1NU1 E;  3H1K E;  1SQB E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...