1BGYE

Cytochrome bc1 complex from bovine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
total genus 23
structure length 75
sequence length 75
chains with identical sequence Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bgyE00
3L72E 3H1LE 3H1IE 1BE3E 3L71E 3TGUE 2FYUE 3L74E 1SQPE 1BGYE 1BCCE 1P84E 3L70E 1SQVE 1SQXE 1PPJE 1PP9E 1L0NE 4U3FE 3CX5E 1NTME 5KLVE 1EZVE 1SQQE 1NU1E 1L0LE 3L75E 1KB9E 1SQBE 4D6TE 1NTZE 3H1KE 2A06E 3BCCE 1NTKE 3CWBE 2IBZE 3H1HE 3L73E 2BCCE 4PD4E 1KYOE 3H1JE 3CXHE
chains in the Genus database with same CATH superfamily
4BRYB 1HWTC 5CCGA 1BDDA 3V2PA 5AVZB 3O6QA 1URQA 1KB9D 4HYTB 4XA4A 1IFIA 1KILA 1M1JB 3F5HA 1SQBK 1NU1K 2KS1A 1S72P 2E76D 1SQQG 1IFDA 5KKZC 1LTTC 2ZFCA 3V2NA 3H1KG 4CPGA 1EZVI 2YIUC 1KQLA 2IYPA 4H13B 3A3YB 3IFMA 1PP9G 2B89A 3PHLA 3AEBC 1PGOA 1L4AB 1D7MA 1BE3D 1QL1A 3L75G 3II6A 3E7KA 1ZMEC 1GU4A 2FBWC 3HTKB 4L73A 1J1DC 4H44B 3CCJP 5AVXB 2FXPA 1SLQA 1Q90D 5KAFE 3AECC 1HBWA 1PIXA 2M5AB 4HB1A 3L73G 3BRTB 1BE3E 4D6TG 2WITA 4RESB 2NPSD 5CBNA 1X0TA 3CWBJ 4UB6E 1LP1A 4IFDK 2PRRA 1VDFA 1LWUB 1KB9H 3EWKA 3U1AA 1OVRA 3MP7B 1FC2C 1EZVG 3NXSA 3M0AA 3AE7C 3AE1C 2FYUK 3V4QA 1AVOA 4WBAA 3HD7B 3SFDC 2C9NY 1RF0C 1H0TA 3O8ZA 1IFMA 4U3FG 1FZBA 5KAFH 3GHGC 2IFMA 5B66H 1NKZB 2FFDA 1NU1G 2K37A 3C8VA 2W90A 2XNDH 3A2AA 3AEFC 4Z1MH 1DEEG 3L37A 1OXZA 4EDFA 1NVOA 2GA1A 2OARA 4UB6H 3BCCD 3B71A 5APVA 3KXDA 3P32A 2N1TD 2WPVB 2JEEA 3A0BE 2AXCA 1M90Q 1PL5A 2PP6A 2YO2A 2BCCJ 2O1JA 3CXHI 3V2QA 3IR9A 1FZCB 3MGNA 1NTZE 3BCCE 2QA4P 1GMJA 2WSCJ 1T8ZA 2KZIA 1GW4A 1N7SB 3S4RA 4B86A 3H1JJ 4I6MC 1G1IA 2V7QH 3H1ID 3EQ2A 2IZ1A 2C9LY 1EDKA 4XE5B 3A0BH 4KJMA 5B5EE 1A02F 2RMZA 3SFEC 2FXOA 1RF1B 1PGPA 2FYUG 1SQVK 1JM0A 2KP8A 3P7KA 2BEQD 1U7JA 4TLFA 3OAKA 1R5SA 2KNCA 3M9BA 5GTIH 1NWQA 3H1KE 1LTAC 1UIIA 1ZLLA 3B4SA 1JTHB 2YIUB 3ITKA 1USEA 2HODB 1EDJA 1L0LD 1ZP0C 4R4MA 1BCCG 1FE6A 3L70G 3AE2C 2KSEA 5KLIC 3L72D 2ZYDA 3AEGC 1K9MQ 2JKVA 4C7RA 5KLVJ 2G3AA 3G6EP 1X22A 5H2FE 1SQPK 3KZIE 2W6JH 2A45H 3AEAC 4GIFA 3L73E 5APSA 1JY2N 5DJUB 1FU1A 3B5NA 4JYBA 3L72E 4IL6H 5CJ0A 1HJBA 2OYIA 1H8AA 3CL3D 1KC8Q 3TGUG 1SQBD 1MFTA 2O01J 1NAYA 1OWAA 1HUCA 2BASA 2K88A 2QVAA 3M0DA 1KB9I 2R3SA 1K8AQ 3KHUA 5H2FH 3HE4A 2K9JB 2E75D 4U3FE 1BGYG 3T97B 1YBKA 3GHGB 1Z56A 1SQBE 2QEXP 2AXTH 1R5LA 1JY2P 1QX8A 3M9QA 2ZXXA 3H32A 4N3YB 2NRGA 2HR3A 1NTMD 5CCGD 1GL2C 1RHZB 5BU8B 1VPCA 3OW2O 1URQD 3NFQA 4LGDE 2WSSH 1KQFB 3HE5B 3USSA 1PGQA 2ZVOB 1KILD 1RE4C 1M1JC 2E76B 1PGJA 3CC2P 2I1KA 1SQPG 1FDIA 2QM8A 1NTME 5BU5A 5TISE 1XTCC 1S3JA 2UWJE 3L71D 5APWA 1CI6A 3KQGA 2Q6QA 1KILE 1L4AC 3U59A 1YQ4C 1GZLA 1OFCX 5CJ4A 1ZR4A 4H44C 1KYOH 1AQ5A 3L71E 2FYUE 1GK4A 3VOPA 3MUDC 4PV1D 3SWYA 3AE6C 1BE3G 2B87A 1YIJP 3OA7A 5TISH 2D2CD 1YQ3C 3CCQP 4IOIH 1LWUC 1JY3N 3RK3E 1IC2A 3RK2D 1LTJC 5CBOA 3L70E 2KXPB 5KLIB 4QMAA 3I55P 3E1IA 3WU2E 2YKOA 1VF5D 1KFMA 3HUSA 1SFCA 1QEXA 1AJYA 3A0HE 5L8RJ 1IO4A 1M57D 4PD4D 4OGQD 1NJIQ 5AW4B 5CCGC 2H7HA 1JY3P 1SQVD 2YMYA 1Q7YQ 1JB0J 1MKMA 3WU2H 1NKNA 1S9KE 3AE8C 2QRXA 1L0LK 3H1LD 5AVVB 4PD4E 1MUUA 4JYCA 2QSIA 3BCCG 3SWKA 3B8EB 3MTUE 1J1EB 2Y9ZA 1SQVE 1ZXGA 3I5CA 3CD6P 4OWFA 1S4XA 3L4FA 1N7SC 3SSUA 2FYZA 1YJ9P 4W80A 3RBZA 3HD7A 3H1LE 4L75A 1GL2B 3L36A 2WSEJ 3RK3C 1DH3A 3KPEA 1VQOP 3VMXA 1BSHA 1LTGC 2BEZF 2WPRA 3VMZA 3H25A 1X79B 4GOEA 1KFNA 1SS1A 1RF1C 4O9BA 2IDBA 3RL0D 5APUA 4U7JA 3L74D 4PD4H 3CCRP 1T3JA 2KYVA 3CPWO 4DZOA 5CCHC 3Q1MA 1SQPE 2RKLA 2K3RA 4UB8H 2H88C 3H1IG 2IZ0A 4NPDA 1KB9E 3LW5J 1Q82Q 2O1KA 1KQSO 1L0NJ 1SQXD 1JMMA 1ZR2A 2OTKE 3L74E 2Q1KA 3W68A 2P67A 2PAJA 5CHXA 5M1BA 1NTMK 2FFDC 2Q5UA 4GDOA 5B66E 2QG4A 4Y99B 1L0LG 3I56P 1N73C 4C7NA 3RGUA 3B5ND 4OGQC 4I7ZC 4EOTA 2E5TA 3M9HA 3L72G 4ASVA 2IBZD 2WZ7A 2OYHA 4YXDC 2JP3A 1LTJB 1QLED 5AW2B 4H0LD 2ITAA 1NTZJ 3VYIA 3BCCJ 2C0WA 5KJ7C 1AQTA 3K5BA 1VQKP 2OTLP 2E75B 2HODA 5GTHH 1NTKK 4DOJA 1N8RQ 1VQ8P 1SQBG 3WUVA 1VQPP 3CCMP 1N2DC 2JWAA 2LR2A 1T2KD 1JY2O 2ZAEB 3CWBD 1FZAA 2Q7CA 1FZFA 3O6QB 3PH0A 1PV3A 2HYNA 3Q5RA 1KILB 4YPCA 1SQQJ 2KS1B 3CX5D 3H1KJ 3RL0C 1HJ0A 2E76C 1JO5A 4EYYQ 2R44A 1M8OB 2P58A 4RO0A 5GTIE 3CWBE 1NTMG 1PP9J 1LT9C 1FJPA 1X9VA 3A5TA 3L75J 3M91A 2R5DA 3OJAB 4L74A 3LIEA 2ZJSE 3CX5E 3H1HD 2M0BA 1AFOA 3T97A 3AE9C 3GHGA 4IL6X 3RK3B 2POHA 1JNMA 2ZXEB 3JSVC 3L73J 4PJ0H 4JBZA 4D6TJ 4WY4A 2HPCB 2ZVNB 3L71G 1OW6A 2AEFA 2BCCD 4IFFA 1GTWA 3B5NC 1WRGA 2NPSC 1RE3C 3AEEC 3H1HE 1ZN5A 2D2CB 1DD3A 3WUUA 1LP1B 3H1IE 5E79H 4IL6E 1PPJD 1YTZI 3N4XA 3WMM0 4PD4I 3RK2B 1QVGO 3CX5H 1NYHA 5APTA 5AVTB 3S9OA 1ZOYC 1RH5B 3H1JD 1VF5B 4TT3H 1RQUA 4U3FJ 2WT7A 1H0TB 1MZ9A 2XKMA 1NU1J 1SFCD 1NH4A 1PPJE 2FFDB 2XDJA 2WMMA 1FDOA 2KOGA 2WWWA 4EIJA 1L0LE 2IX7C 1N73B 2AXTE 1YI2P 4OGQB 4I7ZB 3H1JE 3EFGA 1Q81Q 5C39A 2Y0CA 5KTBA 2VRSA 3Q5PA 2H8PD 1OMIA 3TDKA 1JCDA 4K3AA 2N1TC 3PTZA 1VL2A 3IN6A 4ZNCA 1JY3O 1GD2E 1YHQP 4XFJA 1RY3A 1JCCA 2WPSA 1Q86Q 2ZT9D 5KLVD 2WSCH 1SQXK 4LC1A 5AW3B 4MN4C 1UIXA 4GKGA 3BVHA 4NPEA 1J1EC 1SQVG 1KYOD 1KV4A 3HRNA 3HD7D 2K9YA 1IK9A 3AE4C 2KLUA 4WWIA 2QJKB 3H1LG 2FKWB 3FX0A 4KHXA 5KLVE 2LXBA 2FYUJ 1S5LX 1H88A 1KYOE 3IAOA 3QWOC 1NOHA 3RL0B 3F89A 2G8YA 2KNCB 1LNQA 4AYCA 1VQLP 5KAIH 4Y28J 1L0NK 1USDA 2AEJA 1LT9B 1EXIA 1BCCJ 1IZNB 3L70J 1FJKA 1FOSF 1G1JA 4BXLA 4A7PA 1KQGB 1WMKA 3AE3C 2E74D 2V4HA 2K1AA 2IBZI 3CCSP 4DJGA 2L91A 3L74G 5AVRB 1RQVA 3GMAA 1NTKD 3Q3DA 2XNXA 1GW3A 1M56D 3P8CD 3CMEP 4IFMA 5AW9B 4JQ0D 1TU3F 3TNUA 1FZGA 1MV8A 4Y99C 2YO3A 3B5NB 3G3ZA 1AVYA 2NPSB 1K05A 4BRYA 3VMAA 2OYIB 1GL2A 4W7ZA 2Q9IA 1SQXG 2IPPA 2Z5IA 1BDCA 3TGUJ 1S5LH 1Y47A 3VP9A 1NTKE 5AVQB 1E5WA 1RE4A 2O01H 3P8CE 5CMZA 1M1JA 1HTLC 2H43A 3VN0A 4H0LB 1KMIZ 2A06D 1Q2NA 2Q3EA 3HE4B 1BGYJ 2QJPB 3R4YA 1SQVJ 3MHVA 2E75C 3V2RA 3G71P 3CX5I 2IBZG 2J58A 3AEDC 2YXRB 1L4AA 1QVFO 3M06A 3FWNA 1SQQK 2PFXA 3JCUE 1S2EA 2FY8A 3HTKA 4JF7A 2A45I 2N1TB 3C9IA 1URQC 1KILC 2P10A 1J2JB 2M5AA 3MUDA 4N78D 1N7LA 1SQPJ 2Y0EA 4HJGH 1HH0A 3V4WA 3V6IA 2W27A 1VQ4P 2KZJA 3CWBG 1LWUA 3FGAD 5TJHA 2QIWA 4M3LA 4BWNA 4UB8E 2CPBA 1CI6B 1LTJA 3BRVB 3L74J 1YTZT 1EDLA 3JCUH 1LT1A 1W2BO 5AW7B 2MKVA 2P2UA 5AVWB 2N9BA 1AV1A 1SP4A 4WY4D 1BE3J 1LTIC 3N7NA 3TSIA 2A45G 4PV1C 2B87B 1NAFA 1HGVA 1KTMA 3D71A 3H1HG 3BASA 1BSNA 2D2CC 2OYHC 2GUVA 4L76A 4WVZA 1YYCA 5KLVK 3CC7P 1PFIA 3MZWB 3RK2C 1G2CB 2Z5HA 3PRJA 3ZDMA 3AE5C 1VF5C 3IF4A 2BCCG 4AUWA 1FZCA 1FBMA 2B9BA 3HUSB 1SFCB 4C46A 3FXDA 2LKMA 1IFNA 1PPJG 3GW6A 1EXJA 1N7SA 4NPFX 5GTHE 5APXA 2GUSA 2YKQA 3U1CA 1HF9A 5DJTB 2FYNC 4OVNF 2V7QJ 3H1JG 1SQXE 1DX7A 1KYOI 1U57A 1WT6A 2HPCA 1LTBC 1RF1A 1EQ7A 1P84D 3E1RA 1VQMP 3KYQA 1L0ND 1H89A 3CCVP 5CCHA 2WVRA 3NTNA 2OYOA 1JTHA 2ZT9B 1VQ5P 3Q2YA 1ZRTD 2IBZE 4N6JA 3CCEP 3CCUP 4DCKA 1M1KQ 1MFZA 3G9RA 1P84E 2JR8A 1L0NE 2Y9YA 1K04A 1IK7A 3C1LA 2QJKC 1NHLA 2AEMA 1KN7A 4OH8B 2SPZA 2WSEH 1K73Q 1FS0E 1N86A 1OW8A 1URQB 3PP5A 2QJYC 5KLVG 4DT0A 1ZRTE 1DD4A 1KZUB 4WY4C 3WUTA 1N73A 2R5BA 4PJ0E 3H1HJ 1GU5A 3G4SP 1NTZD 3H1IJ 2B88A 2WTYA 2NZ2A 2JJLA 4GODA 1XTGB 2W83C 5E79E 2Z4EA 3LW5H 2O01N 2CPSA 1P84H 2E74B 3ABVC 2XZRA 5KJ7A 3SWFA 3VTPC 1DEBA 3TYYA 1YJWP 2K9JA 1RF0A 1IFPA 3RBXA 3S1KA 1L0LJ 2KSJA 1QL2A 2W6AA 1EDIA 1GK6A 1SQQD 3H1KD 2JWDA 4C7NB 3L72J 4PV1B 4RJTA 5APQA 1ZW0A 1EC5A 2I8DA 1GL2D 2OYIC 2Y0DA 5AW0B 1VQ7P 2R3CA 1NTKG 2OYHB 1PP9D 2HLOA 2J59M 3HE5A 4RKUJ 2KIKA 1T6AA 3V5BA 3GG2A 2O3JA 1GDTA 3L75D 2C0XA 3A7OA 1SQQE 5KKZB 1OIPA 2M8RA 4H0LC 4YXWH 1JMBA 5AVSB 4HKZH 2BCCE 3M0DC 1DIPA 1KORA 2H89C 3CI9A 1IFJA 2QJPC 1LT9A 4I2LC 3VP8A 2N9YB 3MD0A 1SQBJ 1PP9E 2XU6A 4H13D 2Q3IA 1E79H 2HFED 5AW5B 1ZV8A 2KI7B 3L73D 4D6TD 2E43A 1A02J 1L4AD 3L75E 4GOFA 3PLNA 1W5CE 4YTPC 1OX3A 5AVUB 2FYNB 1T2KC 5B5EH 2A06G 3KDPB 1J1DB 3R2PA 5AW1B 1PZQA 4H44D 2IYOA 1EZVD 2R32A 1HVVA 3GF7A 2RN0A 3L35A 3TF5A 4D6TE 4K35A 2NPSA 1RE3A 2DW3A 4JPZB 4ZKUA 1NTMJ 1CZQA 4U3FD 3P8MC 3VMYA 3CC4P 2CK3H 5APYA 1NU1D 5KAIE 1KD1Q 1EZVE 1LGHB 1JUNA 4KT0J 3EFFK 2IFNA 3CLQA 3KZIH 3LIDA 1QGKB 2WSFJ 2P1JA 2QJYB 1NU1E 3L71J 4WY4B 3QH9A 1U7MA 2OGUA 3JC22 2JO1A 1NTKJ 2WQYC 3UIAA 1YJNP 1FZEA 2N1TA 1W2EA 1YITP 1CW5A 1S5LE 2ZYAA 4WB4A 1VQNP 3W67A 1L2PA 1NO4A 3NMDA 2PGDA 1Y9BA 2KUBA 3MIWA 2M3EA 2YXQB 2WT7B 2HG5D 2MJZA 1P84I 4ASWA 3HUSC 1SFCC 2FYUD 4H13C 2YNYA 2P7JA 1N7SD 2OTJP 5AW6B 3FXEA 4GT1A 1LTSC 2LXCB 2QE7H 4ZMDA 1OVVA 2W6BA 3CXHD 1NTZK 3RK3D 1VQ6P 1BCCD 3L70D 2KB7P 1OVUA 3GLMA 3D6YA 2XV5A 3RL0g 1CSBA 3CCLP 2JDIH 5CCHD 2KLVA 2FXMA 3Q5SA 5EFWB 1HGZA 4AQRD 2ZT9C 3CXHE 2YKPA 5K5GB 2M3BA 3CMAP 1BCCE 1LJ2A 1VQ9P 1SVFA 2L5GB 1G2CA 1M7LA 1X8YA 1FAVA 3H32B 2J5UA 3H1LJ 4LLHA 2I1JA 3HD7C 1L0NG 2A06E 2KK7A 2OQQA 2YMKA 2WSFH 3TGUD 5AVYB 4I1LA 3GF3A 2QM7A 4W7YA 1S9KD 1AA0A 2E5YA 1Y8AA 1FOSE 2WPQA 3D6ZA 1BGYD 3CXHH 3TGUE 3PJSK 3H6PA 2ZYGA 3TK1A 2RH0A 2E74C 4R4LA 4HH2A 4N78E 5KJ7D 2W8ZA 4ZKPA 1FZCC 1NTZG 3D70A 1BGYE 1R8EA 3FWLA 3A0HH 1JEKA 1IJDB 1OZHA 1OW7A 3BATA 5AW8B 1NGMB 1FDMA 1T3UA 2GM4A 3TNUB 1S1CX 1JOCA 2E42A 1SQXJ 1SQPD 5BVZA 4EI2A
chains in the Genus database with same CATH topology
3L72E 3H1LE 3H1IE 1BE3E 3L71E 3TGUE 2FYUE 3L74E 1SQPE 1BGYE 1BCCE 1P84E 3L70E 1SQVE 1SQXE 1PPJE 1PP9E 1L0NE 4U3FE 3CX5E 1NTME 5KLVE 1EZVE 1SQQE 1NU1E 1L0LE 3L75E 1KB9E 1SQBE 4D6TE 1NTZE 3H1KE 2A06E 3BCCE 1NTKE 3CWBE 2IBZE 3H1HE 3L73E 2BCCE 4PD4E 1KYOE 3H1JE 3CXHE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3L72 E;  3H1L E;  3H1I E;  1BE3 E;  3L71 E;  3TGU E;  2FYU E;  3L74 E;  1SQP E;  1BGY E;  1BCC E;  1P84 E;  3L70 E;  1SQV E;  1SQX E;  1PPJ E;  1PP9 E;  1L0N E;  4U3F E;  3CX5 E;  1NTM E;  5KLV E;  1EZV E;  1SQQ E;  1NU1 E;  1L0L E;  3L75 E;  1KB9 E;  1SQB E;  4D6T E;  1NTZ E;  3H1K E;  2A06 E;  3BCC E;  1NTK E;  3CWB E;  2IBZ E;  3H1H E;  3L73 E;  2BCC E;  4PD4 E;  1KYO E;  3H1J E;  3CXH E; 
#chains in the Genus database with same CATH topology
 4BRY B;  1HWT C;  5CCG A;  1BDD A;  3V2P A;  5AVZ B;  3O6Q A;  1URQ A;  1KB9 D;  4HYT B;  4XA4 A;  1IFI A;  1KIL A;  1M1J B;  3F5H A;  1SQB K;  1NU1 K;  2KS1 A;  1S72 P;  2E76 D;  1SQQ G;  1IFD A;  5KKZ C;  1LTT C;  2ZFC A;  3V2N A;  3H1K G;  4CPG A;  1EZV I;  2YIU C;  1KQL A;  2IYP A;  4H13 B;  3A3Y B;  3IFM A;  1PP9 G;  2B89 A;  3PHL A;  3AEB C;  1PGO A;  1L4A B;  1D7M A;  1BE3 D;  1QL1 A;  3L75 G;  3II6 A;  3E7K A;  1ZME C;  1GU4 A;  2FBW C;  3HTK B;  4L73 A;  1J1D C;  4H44 B;  3CCJ P;  5AVX B;  2FXP A;  1SLQ A;  1Q90 D;  5KAF E;  3AEC C;  1HBW A;  1PIX A;  2M5A B;  4HB1 A;  3L73 G;  3BRT B;  1BE3 E;  4D6T G;  2WIT A;  4RES B;  2NPS D;  5CBN A;  1X0T A;  3CWB J;  4UB6 E;  1LP1 A;  4IFD K;  2PRR A;  1VDF A;  1LWU B;  1KB9 H;  3EWK A;  3U1A A;  1OVR A;  3MP7 B;  1FC2 C;  1EZV G;  3NXS A;  3M0A A;  3AE7 C;  3AE1 C;  2FYU K;  3V4Q A;  1AVO A;  4WBA A;  3HD7 B;  3SFD C;  2C9N Y;  1RF0 C;  1H0T A;  3O8Z A;  1IFM A;  4U3F G;  1FZB A;  5KAF H;  3GHG C;  2IFM A;  5B66 H;  1NKZ B;  2FFD A;  1NU1 G;  2K37 A;  3C8V A;  2W90 A;  2XND H;  3A2A A;  3AEF C;  4Z1M H;  1DEE G;  3L37 A;  1OXZ A;  4EDF A;  1NVO A;  2GA1 A;  2OAR A;  4UB6 H;  3BCC D;  3B71 A;  5APV A;  3KXD A;  3P32 A;  2N1T D;  2WPV B;  2JEE A;  3A0B E;  2AXC A;  1M90 Q;  1PL5 A;  2PP6 A;  2YO2 A;  2BCC J;  2O1J A;  3CXH I;  3V2Q A;  3IR9 A;  1FZC B;  3MGN A;  1NTZ E;  3BCC E;  2QA4 P;  1GMJ A;  2WSC J;  1T8Z A;  2KZI A;  1GW4 A;  1N7S B;  3S4R A;  4B86 A;  3H1J J;  4I6M C;  1G1I A;  2V7Q H;  3H1I D;  3EQ2 A;  2IZ1 A;  2C9L Y;  1EDK A;  4XE5 B;  3A0B H;  4KJM A;  5B5E E;  1A02 F;  2RMZ A;  3SFE C;  2FXO A;  1RF1 B;  1PGP A;  2FYU G;  1SQV K;  1JM0 A;  2KP8 A;  3P7K A;  2BEQ D;  1U7J A;  4TLF A;  3OAK A;  1R5S A;  2KNC A;  3M9B A;  5GTI H;  1NWQ A;  3H1K E;  1LTA C;  1UII A;  1ZLL A;  3B4S A;  1JTH B;  2YIU B;  3ITK A;  1USE A;  2HOD B;  1EDJ A;  1L0L D;  1ZP0 C;  4R4M A;  1BCC G;  1FE6 A;  3L70 G;  3AE2 C;  2KSE A;  5KLI C;  3L72 D;  2ZYD A;  3AEG C;  1K9M Q;  2JKV A;  4C7R A;  5KLV J;  2G3A A;  3G6E P;  1X22 A;  5H2F E;  1SQP K;  3KZI E;  2W6J H;  2A45 H;  3AEA C;  4GIF A;  3L73 E;  5APS A;  1JY2 N;  5DJU B;  1FU1 A;  3B5N A;  4JYB A;  3L72 E;  4IL6 H;  5CJ0 A;  1HJB A;  2OYI A;  1H8A A;  3CL3 D;  1KC8 Q;  3TGU G;  1SQB D;  1MFT A;  2O01 J;  1NAY A;  1OWA A;  1HUC A;  2BAS A;  2K88 A;  2QVA A;  3M0D A;  1KB9 I;  2R3S A;  1K8A Q;  3KHU A;  5H2F H;  3HE4 A;  2K9J B;  2E75 D;  4U3F E;  1BGY G;  3T97 B;  1YBK A;  3GHG B;  1Z56 A;  1SQB E;  2QEX P;  2AXT H;  1R5L A;  1JY2 P;  1QX8 A;  3M9Q A;  2ZXX A;  3H32 A;  4N3Y B;  2NRG A;  2HR3 A;  1NTM D;  5CCG D;  1GL2 C;  1RHZ B;  5BU8 B;  1VPC A;  3OW2 O;  1URQ D;  3NFQ A;  4LGD E;  2WSS H;  1KQF B;  3HE5 B;  3USS A;  1PGQ A;  2ZVO B;  1KIL D;  1RE4 C;  1M1J C;  2E76 B;  1PGJ A;  3CC2 P;  2I1K A;  1SQP G;  1FDI A;  2QM8 A;  1NTM E;  5BU5 A;  5TIS E;  1XTC C;  1S3J A;  2UWJ E;  3L71 D;  5APW A;  1CI6 A;  3KQG A;  2Q6Q A;  1KIL E;  1L4A C;  3U59 A;  1YQ4 C;  1GZL A;  1OFC X;  5CJ4 A;  1ZR4 A;  4H44 C;  1KYO H;  1AQ5 A;  3L71 E;  2FYU E;  1GK4 A;  3VOP A;  3MUD C;  4PV1 D;  3SWY A;  3AE6 C;  1BE3 G;  2B87 A;  1YIJ P;  3OA7 A;  5TIS H;  2D2C D;  1YQ3 C;  3CCQ P;  4IOI H;  1LWU C;  1JY3 N;  3RK3 E;  1IC2 A;  3RK2 D;  1LTJ C;  5CBO A;  3L70 E;  2KXP B;  5KLI B;  4QMA A;  3I55 P;  3E1I A;  3WU2 E;  2YKO A;  1VF5 D;  1KFM A;  3HUS A;  1SFC A;  1QEX A;  1AJY A;  3A0H E;  5L8R J;  1IO4 A;  1M57 D;  4PD4 D;  4OGQ D;  1NJI Q;  5AW4 B;  5CCG C;  2H7H A;  1JY3 P;  1SQV D;  2YMY A;  1Q7Y Q;  1JB0 J;  1MKM A;  3WU2 H;  1NKN A;  1S9K E;  3AE8 C;  2QRX A;  1L0L K;  3H1L D;  5AVV B;  4PD4 E;  1MUU A;  4JYC A;  2QSI A;  3BCC G;  3SWK A;  3B8E B;  3MTU E;  1J1E B;  2Y9Z A;  1SQV E;  1ZXG A;  3I5C A;  3CD6 P;  4OWF A;  1S4X A;  3L4F A;  1N7S C;  3SSU A;  2FYZ A;  1YJ9 P;  4W80 A;  3RBZ A;  3HD7 A;  3H1L E;  4L75 A;  1GL2 B;  3L36 A;  2WSE J;  3RK3 C;  1DH3 A;  3KPE A;  1VQO P;  3VMX A;  1BSH A;  1LTG C;  2BEZ F;  2WPR A;  3VMZ A;  3H25 A;  1X79 B;  4GOE A;  1KFN A;  1SS1 A;  1RF1 C;  4O9B A;  2IDB A;  3RL0 D;  5APU A;  4U7J A;  3L74 D;  4PD4 H;  3CCR P;  1T3J A;  2KYV A;  3CPW O;  4DZO A;  5CCH C;  3Q1M A;  1SQP E;  2RKL A;  2K3R A;  4UB8 H;  2H88 C;  3H1I G;  2IZ0 A;  4NPD A;  1KB9 E;  3LW5 J;  1Q82 Q;  2O1K A;  1KQS O;  1L0N J;  1SQX D;  1JMM A;  1ZR2 A;  2OTK E;  3L74 E;  2Q1K A;  3W68 A;  2P67 A;  2PAJ A;  5CHX A;  5M1B A;  1NTM K;  2FFD C;  2Q5U A;  4GDO A;  5B66 E;  2QG4 A;  4Y99 B;  1L0L G;  3I56 P;  1N73 C;  4C7N A;  3RGU A;  3B5N D;  4OGQ C;  4I7Z C;  4EOT A;  2E5T A;  3M9H A;  3L72 G;  4ASV A;  2IBZ D;  2WZ7 A;  2OYH A;  4YXD C;  2JP3 A;  1LTJ B;  1QLE D;  5AW2 B;  4H0L D;  2ITA A;  1NTZ J;  3VYI A;  3BCC J;  2C0W A;  5KJ7 C;  1AQT A;  3K5B A;  1VQK P;  2OTL P;  2E75 B;  2HOD A;  5GTH H;  1NTK K;  4DOJ A;  1N8R Q;  1VQ8 P;  1SQB G;  3WUV A;  1VQP P;  3CCM P;  1N2D C;  2JWA A;  2LR2 A;  1T2K D;  1JY2 O;  2ZAE B;  3CWB D;  1FZA A;  2Q7C A;  1FZF A;  3O6Q B;  3PH0 A;  1PV3 A;  2HYN A;  3Q5R A;  1KIL B;  4YPC A;  1SQQ J;  2KS1 B;  3CX5 D;  3H1K J;  3RL0 C;  1HJ0 A;  2E76 C;  1JO5 A;  4EYY Q;  2R44 A;  1M8O B;  2P58 A;  4RO0 A;  5GTI E;  3CWB E;  1NTM G;  1PP9 J;  1LT9 C;  1FJP A;  1X9V A;  3A5T A;  3L75 J;  3M91 A;  2R5D A;  3OJA B;  4L74 A;  3LIE A;  2ZJS E;  3CX5 E;  3H1H D;  2M0B A;  1AFO A;  3T97 A;  3AE9 C;  3GHG A;  4IL6 X;  3RK3 B;  2POH A;  1JNM A;  2ZXE B;  3JSV C;  3L73 J;  4PJ0 H;  4JBZ A;  4D6T J;  4WY4 A;  2HPC B;  2ZVN B;  3L71 G;  1OW6 A;  2AEF A;  2BCC D;  4IFF A;  1GTW A;  3B5N C;  1WRG A;  2NPS C;  1RE3 C;  3AEE C;  3H1H E;  1ZN5 A;  2D2C B;  1DD3 A;  3WUU A;  1LP1 B;  3H1I E;  5E79 H;  4IL6 E;  1PPJ D;  1YTZ I;  3N4X A;  3WMM 0;  4PD4 I;  3RK2 B;  1QVG O;  3CX5 H;  1NYH A;  5APT A;  5AVT B;  3S9O A;  1ZOY C;  1RH5 B;  3H1J D;  1VF5 B;  4TT3 H;  1RQU A;  4U3F J;  2WT7 A;  1H0T B;  1MZ9 A;  2XKM A;  1NU1 J;  1SFC D;  1NH4 A;  1PPJ E;  2FFD B;  2XDJ A;  2WMM A;  1FDO A;  2KOG A;  2WWW A;  4EIJ A;  1L0L E;  2IX7 C;  1N73 B;  2AXT E;  1YI2 P;  4OGQ B;  4I7Z B;  3H1J E;  3EFG A;  1Q81 Q;  5C39 A;  2Y0C A;  5KTB A;  2VRS A;  3Q5P A;  2H8P D;  1OMI A;  3TDK A;  1JCD A;  4K3A A;  2N1T C;  3PTZ A;  1VL2 A;  3IN6 A;  4ZNC A;  1JY3 O;  1GD2 E;  1YHQ P;  4XFJ A;  1RY3 A;  1JCC A;  2WPS A;  1Q86 Q;  2ZT9 D;  5KLV D;  2WSC H;  1SQX K;  4LC1 A;  5AW3 B;  4MN4 C;  1UIX A;  4GKG A;  3BVH A;  4NPE A;  1J1E C;  1SQV G;  1KYO D;  1KV4 A;  3HRN A;  3HD7 D;  2K9Y A;  1IK9 A;  3AE4 C;  2KLU A;  4WWI A;  2QJK B;  3H1L G;  2FKW B;  3FX0 A;  4KHX A;  5KLV E;  2LXB A;  2FYU J;  1S5L X;  1H88 A;  1KYO E;  3IAO A;  3QWO C;  1NOH A;  3RL0 B;  3F89 A;  2G8Y A;  2KNC B;  1LNQ A;  4AYC A;  1VQL P;  5KAI H;  4Y28 J;  1L0N K;  1USD A;  2AEJ A;  1LT9 B;  1EXI A;  1BCC J;  1IZN B;  3L70 J;  1FJK A;  1FOS F;  1G1J A;  4BXL A;  4A7P A;  1KQG B;  1WMK A;  3AE3 C;  2E74 D;  2V4H A;  2K1A A;  2IBZ I;  3CCS P;  4DJG A;  2L91 A;  3L74 G;  5AVR B;  1RQV A;  3GMA A;  1NTK D;  3Q3D A;  2XNX A;  1GW3 A;  1M56 D;  3P8C D;  3CME P;  4IFM A;  5AW9 B;  4JQ0 D;  1TU3 F;  3TNU A;  1FZG A;  1MV8 A;  4Y99 C;  2YO3 A;  3B5N B;  3G3Z A;  1AVY A;  2NPS B;  1K05 A;  4BRY A;  3VMA A;  2OYI B;  1GL2 A;  4W7Z A;  2Q9I A;  1SQX G;  2IPP A;  2Z5I A;  1BDC A;  3TGU J;  1S5L H;  1Y47 A;  3VP9 A;  1NTK E;  5AVQ B;  1E5W A;  1RE4 A;  2O01 H;  3P8C E;  5CMZ A;  1M1J A;  1HTL C;  2H43 A;  3VN0 A;  4H0L B;  1KMI Z;  2A06 D;  1Q2N A;  2Q3E A;  3HE4 B;  1BGY J;  2QJP B;  3R4Y A;  1SQV J;  3MHV A;  2E75 C;  3V2R A;  3G71 P;  3CX5 I;  2IBZ G;  2J58 A;  3AED C;  2YXR B;  1L4A A;  1QVF O;  3M06 A;  3FWN A;  1SQQ K;  2PFX A;  3JCU E;  1S2E A;  2FY8 A;  3HTK A;  4JF7 A;  2A45 I;  2N1T B;  3C9I A;  1URQ C;  1KIL C;  2P10 A;  1J2J B;  2M5A A;  3MUD A;  4N78 D;  1N7L A;  1SQP J;  2Y0E A;  4HJG H;  1HH0 A;  3V4W A;  3V6I A;  2W27 A;  1VQ4 P;  2KZJ A;  3CWB G;  1LWU A;  3FGA D;  5TJH A;  2QIW A;  4M3L A;  4BWN A;  4UB8 E;  2CPB A;  1CI6 B;  1LTJ A;  3BRV B;  3L74 J;  1YTZ T;  1EDL A;  3JCU H;  1LT1 A;  1W2B O;  5AW7 B;  2MKV A;  2P2U A;  5AVW B;  2N9B A;  1AV1 A;  1SP4 A;  4WY4 D;  1BE3 J;  1LTI C;  3N7N A;  3TSI A;  2A45 G;  4PV1 C;  2B87 B;  1NAF A;  1HGV A;  1KTM A;  3D71 A;  3H1H G;  3BAS A;  1BSN A;  2D2C C;  2OYH C;  2GUV A;  4L76 A;  4WVZ A;  1YYC A;  5KLV K;  3CC7 P;  1PFI A;  3MZW B;  3RK2 C;  1G2C B;  2Z5H A;  3PRJ A;  3ZDM A;  3AE5 C;  1VF5 C;  3IF4 A;  2BCC G;  4AUW A;  1FZC A;  1FBM A;  2B9B A;  3HUS B;  1SFC B;  4C46 A;  3FXD A;  2LKM A;  1IFN A;  1PPJ G;  3GW6 A;  1EXJ A;  1N7S A;  4NPF X;  5GTH E;  5APX A;  2GUS A;  2YKQ A;  3U1C A;  1HF9 A;  5DJT B;  2FYN C;  4OVN F;  2V7Q J;  3H1J G;  1SQX E;  1DX7 A;  1KYO I;  1U57 A;  1WT6 A;  2HPC A;  1LTB C;  1RF1 A;  1EQ7 A;  1P84 D;  3E1R A;  1VQM P;  3KYQ A;  1L0N D;  1H89 A;  3CCV P;  5CCH A;  2WVR A;  3NTN A;  2OYO A;  1JTH A;  2ZT9 B;  1VQ5 P;  3Q2Y A;  1ZRT D;  2IBZ E;  4N6J A;  3CCE P;  3CCU P;  4DCK A;  1M1K Q;  1MFZ A;  3G9R A;  1P84 E;  2JR8 A;  1L0N E;  2Y9Y A;  1K04 A;  1IK7 A;  3C1L A;  2QJK C;  1NHL A;  2AEM A;  1KN7 A;  4OH8 B;  2SPZ A;  2WSE H;  1K73 Q;  1FS0 E;  1N86 A;  1OW8 A;  1URQ B;  3PP5 A;  2QJY C;  5KLV G;  4DT0 A;  1ZRT E;  1DD4 A;  1KZU B;  4WY4 C;  3WUT A;  1N73 A;  2R5B A;  4PJ0 E;  3H1H J;  1GU5 A;  3G4S P;  1NTZ D;  3H1I J;  2B88 A;  2WTY A;  2NZ2 A;  2JJL A;  4GOD A;  1XTG B;  2W83 C;  5E79 E;  2Z4E A;  3LW5 H;  2O01 N;  2CPS A;  1P84 H;  2E74 B;  3ABV C;  2XZR A;  5KJ7 A;  3SWF A;  3VTP C;  1DEB A;  3TYY A;  1YJW P;  2K9J A;  1RF0 A;  1IFP A;  3RBX A;  3S1K A;  1L0L J;  2KSJ A;  1QL2 A;  2W6A A;  1EDI A;  1GK6 A;  1SQQ D;  3H1K D;  2JWD A;  4C7N B;  3L72 J;  4PV1 B;  4RJT A;  5APQ A;  1ZW0 A;  1EC5 A;  2I8D A;  1GL2 D;  2OYI C;  2Y0D A;  5AW0 B;  1VQ7 P;  2R3C A;  1NTK G;  2OYH B;  1PP9 D;  2HLO A;  2J59 M;  3HE5 A;  4RKU J;  2KIK A;  1T6A A;  3V5B A;  3GG2 A;  2O3J A;  1GDT A;  3L75 D;  2C0X A;  3A7O A;  1SQQ E;  5KKZ B;  1OIP A;  2M8R A;  4H0L C;  4YXW H;  1JMB A;  5AVS B;  4HKZ H;  2BCC E;  3M0D C;  1DIP A;  1KOR A;  2H89 C;  3CI9 A;  1IFJ A;  2QJP C;  1LT9 A;  4I2L C;  3VP8 A;  2N9Y B;  3MD0 A;  1SQB J;  1PP9 E;  2XU6 A;  4H13 D;  2Q3I A;  1E79 H;  2HFE D;  5AW5 B;  1ZV8 A;  2KI7 B;  3L73 D;  4D6T D;  2E43 A;  1A02 J;  1L4A D;  3L75 E;  4GOF A;  3PLN A;  1W5C E;  4YTP C;  1OX3 A;  5AVU B;  2FYN B;  1T2K C;  5B5E H;  2A06 G;  3KDP B;  1J1D B;  3R2P A;  5AW1 B;  1PZQ A;  4H44 D;  2IYO A;  1EZV D;  2R32 A;  1HVV A;  3GF7 A;  2RN0 A;  3L35 A;  3TF5 A;  4D6T E;  4K35 A;  2NPS A;  1RE3 A;  2DW3 A;  4JPZ B;  4ZKU A;  1NTM J;  1CZQ A;  4U3F D;  3P8M C;  3VMY A;  3CC4 P;  2CK3 H;  5APY A;  1NU1 D;  5KAI E;  1KD1 Q;  1EZV E;  1LGH B;  1JUN A;  4KT0 J;  3EFF K;  2IFN A;  3CLQ A;  3KZI H;  3LID A;  1QGK B;  2WSF J;  2P1J A;  2QJY B;  1NU1 E;  3L71 J;  4WY4 B;  3QH9 A;  1U7M A;  2OGU A;  3JC2 2;  2JO1 A;  1NTK J;  2WQY C;  3UIA A;  1YJN P;  1FZE A;  2N1T A;  1W2E A;  1YIT P;  1CW5 A;  1S5L E;  2ZYA A;  4WB4 A;  1VQN P;  3W67 A;  1L2P A;  1NO4 A;  3NMD A;  2PGD A;  1Y9B A;  2KUB A;  3MIW A;  2M3E A;  2YXQ B;  2WT7 B;  2HG5 D;  2MJZ A;  1P84 I;  4ASW A;  3HUS C;  1SFC C;  2FYU D;  4H13 C;  2YNY A;  2P7J A;  1N7S D;  2OTJ P;  5AW6 B;  3FXE A;  4GT1 A;  1LTS C;  2LXC B;  2QE7 H;  4ZMD A;  1OVV A;  2W6B A;  3CXH D;  1NTZ K;  3RK3 D;  1VQ6 P;  1BCC D;  3L70 D;  2KB7 P;  1OVU A;  3GLM A;  3D6Y A;  2XV5 A;  3RL0 g;  1CSB A;  3CCL P;  2JDI H;  5CCH D;  2KLV A;  2FXM A;  3Q5S A;  5EFW B;  1HGZ A;  4AQR D;  2ZT9 C;  3CXH E;  2YKP A;  5K5G B;  2M3B A;  3CMA P;  1BCC E;  1LJ2 A;  1VQ9 P;  1SVF A;  2L5G B;  1G2C A;  1M7L A;  1X8Y A;  1FAV A;  3H32 B;  2J5U A;  3H1L J;  4LLH A;  2I1J A;  3HD7 C;  1L0N G;  2A06 E;  2KK7 A;  2OQQ A;  2YMK A;  2WSF H;  3TGU D;  5AVY B;  4I1L A;  3GF3 A;  2QM7 A;  4W7Y A;  1S9K D;  1AA0 A;  2E5Y A;  1Y8A A;  1FOS E;  2WPQ A;  3D6Z A;  1BGY D;  3CXH H;  3TGU E;  3PJS K;  3H6P A;  2ZYG A;  3TK1 A;  2RH0 A;  2E74 C;  4R4L A;  4HH2 A;  4N78 E;  5KJ7 D;  2W8Z A;  4ZKP A;  1FZC C;  1NTZ G;  3D70 A;  1BGY E;  1R8E A;  3FWL A;  3A0H H;  1JEK A;  1IJD B;  1OZH A;  1OW7 A;  3BAT A;  5AW8 B;  1NGM B;  1FDM A;  1T3U A;  2GM4 A;  3TNU B;  1S1C X;  1JOC A;  2E42 A;  1SQX J;  1SQP D;  5BVZ A;  4EI2 A; 
#chains in the Genus database with same CATH homology
 3L72 E;  3H1L E;  3H1I E;  1BE3 E;  3L71 E;  3TGU E;  2FYU E;  3L74 E;  1SQP E;  1BGY E;  1BCC E;  1P84 E;  3L70 E;  1SQV E;  1SQX E;  1PPJ E;  1PP9 E;  1L0N E;  4U3F E;  3CX5 E;  1NTM E;  5KLV E;  1EZV E;  1SQQ E;  1NU1 E;  1L0L E;  3L75 E;  1KB9 E;  1SQB E;  4D6T E;  1NTZ E;  3H1K E;  2A06 E;  3BCC E;  1NTK E;  3CWB E;  2IBZ E;  3H1H E;  3L73 E;  2BCC E;  4PD4 E;  1KYO E;  3H1J E;  3CXH E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...