1BGYE

Cytochrome bc1 complex from bovine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 23
structure length 75
sequence length 75
chains with identical sequence Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bgyE00
1P84E 4D6TE 1BGYE 2FYUE 3L75E 2IBZE 1L0NE 3BCCE 1SQVE 1SQQE 3H1KE 1SQXE 3H1JE 1NU1E 4PD4E 4U3FE 3H1HE 3CXHE 2BCCE 1SQBE 3L71E 1KYOE 3H1LE 1EZVE 1PPJE 1KB9E 1NTZE 1SQPE 1L0LE 3L74E 3L70E 1NTKE 1PP9E 1BCCE 1BE3E 3CWBE 3H1IE 3CX5E 5KLVE 1NTME 2A06E 3TGUE 3L72E 3L73E
chains in the Genus database with same CATH superfamily
1HTLC 4TLFA 4GODA 2W6JH 3VTPC 1JM0A 1IFPA 2QM7A 2CPSA 2JKVA 1KQLA 2KK7A 1EZVD 2O01J 4Z1MH 2KOGA 1PGOA 1EZVI 1QEXA 2B87B 2RH0A 2AXTH 3BATA 3CWBG 4GOEA 3WMM0 1S5LX 4AYCA 3AE2C 3H1HE 3V5BA 2OYHA 3D6ZA 2BCCE 1YJ9P 1FOSF 2IBZD 1IO4A 2W6AA 2Z5IA 1QVGO 2FFDA 3MUDC 5CJ4A 3MP7B 5AW7B 1ZMEC 3B71A 1W2BO 2N1TB 1LTGC 1N7SD 1NAYA 1NTZE 1VQ5P 2YO2A 2XV5A 1D7MA 3A7OA 1RF1C 4L74A 4WBAA 4KHXA 1GW4A 1PZQA 3KDPB 1KMIZ 1Y9BA 2H88C 2Q1KA 1PP9E 3H1ID 5AW8B 3S4RA 5AVUB 2WMMA 2WSEJ 1JY3P 2K9JA 4GKGA 1N2DC 2B89A 2KLVA 4N78D 1A02J 2ZFCA 1ZN5A 1ZP0C 3EFGA 3PTZA 1RHZB 2ZAEB 2JR8A 1IFJA 5KAIH 2Y0CA 2QJYB 2YMKA 4XA4A 1FJKA 2NPSC 3N4XA 3AE8C 2C0XA 3S9OA 2C9LY 4N6JA 1LGHB 1WMKA 5APVA 4YXWH 1BCCJ 1SQXE 3FXDA 3H1JE 1BDDA 2WPRA 3VN0A 1VQ7P 1HF9A 2L5GB 1S9KE 2I1KA 2YIUC 3O8ZA 4DT0A 3PLNA 4JYCA 1KYOE 3BCCD 2B88A 1SQPK 2A06G 3HRNA 1URQA 3L73G 4H13B 1JY3O 1X22A 1NGMB 1KB9E 3L71D 2E5TA 2BASA 3LIDA 3PHLA 4Y99B 2HR3A 2A45I 1NKNA 2NZ2A 3M0AA 3SWYA 4EDFA 5KLVJ 1SP4A 2D2CD 1VQMP 1JUNA 2A45G 1E5WA 1FZCC 3AEFC 3H1LJ 1P84I 3RGUA 3TSIA 3IF4A 2OYIB 1EDIA 1Y8AA 2KIKA 4OGQB 2Y0DA 3II6A 3KYQA 3NFQA 5E79E 1N73C 2NPSB 2PRRA 4PV1D 2QJKC 2RN0A 3L36A 5H2FE 1N73B 4D6TE 1EXIA 1SQVK 2O1JA 3KZIH 1L4AB 1FZFA 4AUWA 1SFCD 3M9BA 3D71A 3CD6P 4C7NA 1SQQD 1UIIA 1NU1D 5KKZC 2OGUA 4PD4H 3MUDA 2BCCJ 1NWQA 1H88A 1RF1B 3FWNA 2OYHC 3AECC 2HLOA 1WT6A 2Q6QA 2PFXA 3AEDC 4RO0A 3CCSP 3V2RA 1L0LE 2A45H 2KUBA 1RH5B 4O9BA 1M57D 2WITA 1PP9D 5AVWB 1OVRA 1JCDA 1FDIA 4L73A 2IBZI 2ZT9D 1BE3E 3C9IA 2B9BA 3SSUA 2YMYA 3L75D 4KT0J 2ZXEB 3CLQA 3MGNA 3R2PA 1PGJA 2AXCA 3ZDMA 2W27A 5APXA 1YJNP 1FOSE 4EOTA 1KILC 3SFEC 1EDLA 1GL2C 2KSJA 3NMDA 5E79H 3V2PA 4RJTA 1P84D 1GD2E 2K3RA 3AE5C 1X9VA 1IK7A 2C9NY 1AQ5A 3G71P 3WUUA 2FKWB 2PP6A 3A2AA 1S9KD 3CWBJ 1QL1A 1URQB 3H1HD 4U3FE 1SQQJ 2YO3A 5APQA 1VQ8P 5KLVG 1DIPA 1OVUA 2ZVOB 3CMAP 1LTJA 2CPBA 3V4WA 1IFIA 1NTZK 2FYZA 2V4HA 3GHGB 3L73J 5GTHH 1MFTA 1NHLA 2HODA 3L74J 1YI2P 1KQFB 2V7QH 1ZV8A 2IFNA 2XDJA 3HE4B 3OJAB 3L70E 4HB1A 4UB8E 4DJGA 1Q81Q 2ZT9B 3WU2E 4L76A 1T6AA 2E75D 3CX5E 3RL0D 1N73A 1QX8A 4UB6H 4JBZA 4K35A 2OTKE 3BRVB 5AW5B 1PPJG 5KJ7C 2K88A 3IN6A 1Q86Q 3LIEA 1OW8A 1RF1A 2E5YA 3PH0A 1K04A 4H44D 3TGUE 1U7MA 2E76B 3MD0A 4PJ0E 4UB8H 2FYUE 2W8ZA 5AW0B 3CCUP 1K73Q 3RK2B 5GTIH 3Q2YA 3Q5SA 2WPVB 5KKZB 1W2EA 1SQQE 4HJGH 1L0LJ 3IR9A 5AVTB 1NO4A 1M1JC 1XTGB 1J1DC 1NU1E 2N1TA 5AVZB 2WPSA 1SFCC 1SQBK 1JY2N 3HTKA 3H1IG 1ZXGA 1FC2C 1SFCB 5AW2B 3L70G 5KLVK 1RE3A 1EZVE 5EFWB 5KLIB 2QJKB 1PGPA 3L74D 1SLQA 1KB9D 5CHXA 1ZR2A 1S2EA 2NPSD 1KB9I 3CCQP 1ZRTD 2WTYA 2HYNA 1IJDB 2HG5D 1DX7A 1AJYA 3TNUB 3VMAA 1NTKE 4IFMA 3KPEA 3M0DC 2R32A 2FYUK 1JEKA 4IL6H 3VMXA 3Q5PA 4I7ZC 2E43A 1NTZD 1RF0C 1SQQK 3FXEA 3R4YA 5AVYB 2E76D 3F5HA 2FBWC 1RE4C 3NXSA 1LWUC 4W7ZA 3AEAC 2G8YA 2A06D 3L73D 4OH8B 1T2KC 2H43A 2UWJE 1E79H 3L71G 1L0NE 4N78E 1Q90D 1R5LA 5CJ0A 3TK1A 4C46A 1HJBA 1QVFO 1AVYA 3CXHH 1T3JA 3TF5A 2J5UA 2WSCH 1KFMA 3LW5H 1H89A 2D2CC 3GHGC 2L91A 3AEGC 4ZNCA 3C8VA 5APTA 5AVQB 2QVAA 3GF7A 4YTPC 1KYOH 2KZJA 2OYHB 1KQGB 2M5AA 2QRXA 3AEBC 3GW6A 2W83C 3FGAD 3A0HE 1URQD 2XZRA 3CX5D 1NTMK 1NU1J 1Y47A 2QE7H 4N3YB 3K5BA 2WT7A 4XE5B 1VQNP 2WZ7A 1KN7A 1EC5A 2H89C 2J58A 1M1JB 2N1TD 3H32B 4I6MC 2HFED 1P84E 2QIWA 1BGYE 2YIUB 1OXZA 2JDIH 1OVVA 4MN4C 3RK2C 1DD4A 5K5GB 2IFMA 1MKMA 3CCJP 2IZ0A 5GTHE 1KC8Q 3H1KE 5AVVB 1J1EC 1M90Q 1PP9G 3RK3E 4U3FD 2M5AB 4ZKPA 1KV4A 1KORA 2Q3EA 1N7LA 1VQ4P 2YNYA 1MFZA 4DZOA 4CPGA 3HTKB 3L72J 1N7SC 4I1LA 3IAOA 3P7KA 1AV1A 1L4AC 2WQYC 3GG2A 4I2LC 4I7ZB 2KP8A 4ASVA 3M0DA 1A02F 3BCCJ 4W7YA 1DEBA 1SQXG 3H1JG 2P67A 3JCUE 1NTKJ 1IC2A 3CWBE 5TISE 3RBZA 1LTJC 2M0BA 1ZLLA 2ZXXA 4NPEA 3H1HG 3RK3B 1L0LD 3MTUE 3IFMA 4BXLA 1T8ZA 3H1KG 1BGYJ 1YITP 2YXQB 2A06E 5CCGA 1JO5A 3TGUD 1UIXA 1L0LK 1YQ4C 2KXPB 2OTJP 2K9YA 1PIXA 1QL2A 1GL2D 3L75E 3JCUH 2KB7P 3H1LD 2Q9IA 3P32A 3LW5J 3OW2O 1FE6A 3HD7A 5DJTB 2PGDA 2D2CB 4JYBA 1S1CX 3CXHE 1KZUB 1L0NK 2FYUG 4WB4A 1VQ9P 1NYHA 4H0LB 3D70A 3G6EP 4GT1A 1PPJD 2R5DA 2E42A 3HUSA 3L35A 1LTBC 1MV8A 3G9RA 5AW6B 1MUUA 2O01N 4PJ0H 5C39A 2DW3A 1SFCA 1T3UA 2OYIA 1VQKP 1LT9A 1NTKD 1EZVG 1NTZJ 2E74D 2NPSA 3D6YA 2Q7CA 1YYCA 1JOCA 2QJYC 3P8MC 1GTWA 2G3AA 2Y0EA 3HD7C 1VQLP 2XNDH 2GUSA 1J1EB 2P7JA 3HD7D 1ZR4A 4OVNF 3SWKA 1LT9B 3L72E 4D6TJ 3EQ2A 3L73E 3USSA 1U7JA 1Q7YQ 1VPCA 1SQBG 2RKLA 1KB9H 2XU6A 4JF7A 1AA0A 3W67A 3O6QA 3RK3D 1FZBA 4EYYQ 3HUSC 1YTZT 2C0WA 3RBXA 1HUCA 5BU5A 1YHQP 2HODB 1VF5C 1FJPA 3A5TA 2AEMA 5AW1B 1QLED 3CCEP 4QMAA 3B4SA 5KTBA 1N8RQ 3L71E 1L0NG 3RK2D 5TJHA 1NTMJ 1NU1K 4NPFX 5BU8B 5CBOA 3S1KA 2N9BA 4H44B 2ZYGA 1VQOP 3I55P 5H2FH 1CZQA 1N7SA 1Z56A 1FZAA 2IZ1A 2P1JA 1T2KD 3A0BE 3CWBD 2E75B 1GU4A 3CC2P 1BE3J 2W6BA 2Y9ZA 4C7RA 1BCCE 2GM4A 5KLVE 1VQPP 3WU2H 1NTME 2QJPC 1LWUA 1M8OB 2Z4EA 3AE9C 1RQUA 4A7PA 1HJ0A 2IYPA 1BGYD 1X79B 2GUVA 2J59M 1RQVA 5B5EE 3WUTA 1SQVJ 2WPQA 3L75J 3P8CD 1LWUB 3QH9A 4KJMA 1KD1Q 1G1JA 3AE1C 5AW9B 1OIPA 2JWAA 5B66E 5KJ7A 1DEEG 2OQQA 2RMZA 3CMEP 3A3YB 1URQC 3HUSB 2WSSH 1FAVA 2B87A 3EWKA 4HH2A 2OTLP 4JQ0D 1NTMG 4Y28J 2KI7B 1KILA 4R4MA 3VMZA 1K8AQ 4GDOA 2H7HA 1ZOYC 3H32A 4U3FJ 2FYNB 1SQPJ 2YKPA 3EFFK 2BEZF 1JY2P 2KNCB 2ZYDA 5KAFE 1S72P 1GK4A 1H8AA 3TDKA 1JMBA 1N86A 4M3LA 1CI6B 2Q5UA 2KSEA 4IL6E 1FS0E 3BCCG 3M06A 3OA7A 1KILB 2ZVNB 4K3AA 2MKVA 3U1AA 1U57A 2LXCB 2WSFJ 4ZMDA 3AE6C 3CC4P 3H25A 2H8PD 2PAJA 1SQXK 2E76C 3AE7C 2YKQA 1LP1B 5APSA 1LTTC 5KAFH 1AQTA 3GLMA 5M1BA 1RF0A 2P2UA 1G1IA 2QEXP 4GIFA 2FFDB 2QM8A 1EDKA 3L75G 2ZYAA 4BWNA 3V6IA 1Q82Q 1HBWA 1JY2O 3Q5RA 1R8EA 1PPJE 3ITKA 3KQGA 5CMZA 3TGUJ 1FDOA 4DCKA 5CCHD 3TGUG 3CCRP 1DH3A 2QA4P 1LTAC 1SQPE 4WY4A 4BRYB 2IYOA 5KLIC 3AE3C 3BASA 3UIAA 1IK9A 1JY3N 2O3JA 4OGQD 3VMYA 4DOJA 1YBKA 4IOIH 3VP9A 4ASWA 3CC7P 2WVRA 1KYOI 5CBNA 1NU1G 1LNQA 1K9MQ 1VF5B 5KAIE 2KYVA 1LTIC 1KILE 4R4LA 4OWFA 5AVXB 1OW6A 2FYUD 1OWAA 1JNMA 3V2NA 3HE4A 2LR2A 1OFCX 1OMIA 3L72D 2K9JB 2OYIC 4H13D 1LTSC 1LT9C 2BEQD 2QSIA 1L0NJ 2R5BA 4TT3H 2POHA 3CX5H 4UB6E 1GW3A 3T97B 3RL0B 1SQVE 1HH0A 3H1HJ 4YPCA 1KQSO 5AW4B 1SS1A 1NTKG 2E75C 2IPPA 2VRSA 1SQPG 3O6QB 1TU3F 1PL5A 1SQBE 3H1LE 4H13C 3MZWB 4NPDA 3E7KA 3CL3D 3VP8A 4D6TG 1PFIA 3CXHI 5APYA 5L8RJ 1BDCA 1W5CE 3CXHD 2ITAA 1VQ6P 1KTMA 3E1RA 4EIJA 1ZW0A 2JO1A 1OW7A 3U1CA 1H0TB 4IL6X 1BCCD 3M9HA 4IFFA 2R3SA 5KLVD 2LKMA 1VL2A 5TISH 1G2CB 3B5NC 2P10A 1SVFA 1SQVG 2OYOA 2R3CA 2W90A 3KHUA 3VYIA 1GU5A 5CCHC 3I56P 2QJPB 1N7SB 1L0ND 3B5ND 3M9QA 2JJLA 4B86A 3TNUA 3AE4C 4LLHA 4AQRD 2BCCD 1M1JA 1USDA 2IBZE 2N1TC 3L70J 1NJIQ 2QG4A 1Q2NA 2LXBA 3P8CE 3H1IJ 3Q3DA 1L2PA 4WWIA 1BE3G 1LTJB 2WWWA 4PD4D 1NTKK 1FZCB 1NOHA 4W80A 4C7NB 4EI2A 1IZNB 4GOFA 2NRGA 3I5CA 4WY4C 2HPCA 1XTCC 2KS1B 3SWFA 4IFDK 2V7QJ 5B66H 4HYTB 4RESB 3CCMP 1BGYG 2GA1A 3H1KJ 5APUA 3GF3A 2KZIA 4XFJA 2AXTE 3PRJA 1BSHA 4LC1A 1CSBA 4JPZB 4RKUJ 1KFNA 2IBZG 2YXRB 3L70D 1L4AD 1SQBJ 1WRGA 3A0HH 3L71J 1IFDA 1PV3A 3L74G 2FXOA 1EDJA 5AVRB 1YJWP 3B5NB 4PV1B 1GDTA 3AEEC 2JEEA 2K1AA 1VDFA 1S3JA 1NTMD 4PV1C 1KYOD 3BCCE 3CX5I 4OGQC 3WUVA 1YIJP 1FU1A 3CCVP 3BVHA 1HGZA 1LJ2A 1PP9J 3GHGA 3L37A 1NVOA 1NTZG 5APWA 2M8RA 1J1DB 1GK6A 1M1KQ 2YKOA 3JC22 2FXMA 2SPZA 1AVOA 3CPWO 1K05A 5GTIE 3VOPA 4WY4D 3L74E 1G2CA 2FYUJ 1FZEA 2Y9YA 3B5NA 3HE5A 1FZGA 2MJZA 2OARA 2XKMA 3H1IE 1RE3C 2WSFH 4LGDE 1ZRTE 1AFOA 5B5EH 3BRTB 1RY3A 3PJSK 2M3EA 2O01H 1HVVA 3B8EB 3N7NA 3TYYA 3PP5A 3L4FA 2Q3IA 4WVZA 5AVSB 1NAFA 2JP3A 2O1KA 3CI9A 3HE5B 2CK3H 2I1JA 3CCLP 1X0TA 1M7LA 1VF5D 1SQXD 3H1JD 4PD4E 5CCHA 2KS1A 5AW3B 1JCCA 1HWTC 1PGQA 2I8DA 1SQXJ 3H1JJ 3SFDC 5BVZA 3T97A 1CW5A 3MHVA 2ZJSE 2JWDA 1JB0J 3L72G 4ZKUA 1DD3A 3HD7B 3U59A 3M91A 2R44A 3H1LG 3F89A 1SQQG 2E74C 2Z5HA 2HPCB 4HKZH 2K37A 1YTZI 1QGKB 5CCGC 2E74B 4PD4I 1SQPD 3KZIE 3QWOC 1EXJA 3G4SP 1X8YA 3GMAA 4L75A 2AEFA 4WY4B 5KJ7D 2FXPA 1IFMA 4BRYA 5CCGD 1GZLA 3RL0C 3V4QA 3W68A 1H0TA 4D6TD 2M3BA 1HGVA 1JMMA 1KILD 4H0LD 1J2JB 1GL2A 1JTHB 1NH4A 2FYNC 3V2QA 4YXDC 1S5LH 1OX3A 2ZT9C 1BCCG 1L0LG 3FWLA 2WT7B 1LP1A 3H1KD 3KXDA 1FDMA 1SQVD 1USEA 4H44C 5DJUB 1GL2B 1JTHA 2N9YB 3E1IA 3JSVC 2IDBA 3NTNA 3ABVC 2XNXA 2AEJA 1RE4A 1YQ3C 3MIWA 1IFNA 2BCCG 3RL0g 3RK3C 1S5LE 1CI6A 1SQBD 2WSCJ 1FZCA 3FX0A 2WSEH 4U7JA 2IX7C 1EQ7A 4U3FG 2KLUA 3Q1MA 1LT1A 1NKZB 1OZHA 1BE3D 1P84H 1R5SA 2FY8A 1BSNA 3C1LA 2FFDC 3A0BH 1M56D 1FBMA 4Y99C 1L4AA 2P58A 2KNCA 3G3ZA 3H6PA 1MZ9A 4H0LC 1GMJA 3OAKA 1S4XA
chains in the Genus database with same CATH topology
1P84E 4D6TE 1BGYE 2FYUE 3L75E 2IBZE 1L0NE 3BCCE 1SQVE 1SQQE 3H1KE 1SQXE 3H1JE 1NU1E 4PD4E 4U3FE 3H1HE 3CXHE 2BCCE 1SQBE 3L71E 1KYOE 3H1LE 1EZVE 1PPJE 1KB9E 1NTZE 1SQPE 1L0LE 3L74E 3L70E 1NTKE 1PP9E 1BCCE 1BE3E 3CWBE 3H1IE 3CX5E 5KLVE 1NTME 2A06E 3TGUE 3L72E 3L73E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P84 E;  4D6T E;  1BGY E;  2FYU E;  3L75 E;  2IBZ E;  1L0N E;  3BCC E;  1SQV E;  1SQQ E;  3H1K E;  1SQX E;  3H1J E;  1NU1 E;  4PD4 E;  4U3F E;  3H1H E;  3CXH E;  2BCC E;  1SQB E;  3L71 E;  1KYO E;  3H1L E;  1EZV E;  1PPJ E;  1KB9 E;  1NTZ E;  1SQP E;  1L0L E;  3L74 E;  3L70 E;  1NTK E;  1PP9 E;  1BCC E;  1BE3 E;  3CWB E;  3H1I E;  3CX5 E;  5KLV E;  1NTM E;  2A06 E;  3TGU E;  3L72 E;  3L73 E; 
#chains in the Genus database with same CATH topology
 1HTL C;  4TLF A;  4GOD A;  2W6J H;  3VTP C;  1JM0 A;  1IFP A;  2QM7 A;  2CPS A;  2JKV A;  1KQL A;  2KK7 A;  1EZV D;  2O01 J;  4Z1M H;  2KOG A;  1PGO A;  1EZV I;  1QEX A;  2B87 B;  2RH0 A;  2AXT H;  3BAT A;  3CWB G;  4GOE A;  3WMM 0;  1S5L X;  4AYC A;  3AE2 C;  3H1H E;  3V5B A;  2OYH A;  3D6Z A;  2BCC E;  1YJ9 P;  1FOS F;  2IBZ D;  1IO4 A;  2W6A A;  2Z5I A;  1QVG O;  2FFD A;  3MUD C;  5CJ4 A;  3MP7 B;  5AW7 B;  1ZME C;  3B71 A;  1W2B O;  2N1T B;  1LTG C;  1N7S D;  1NAY A;  1NTZ E;  1VQ5 P;  2YO2 A;  2XV5 A;  1D7M A;  3A7O A;  1RF1 C;  4L74 A;  4WBA A;  4KHX A;  1GW4 A;  1PZQ A;  3KDP B;  1KMI Z;  1Y9B A;  2H88 C;  2Q1K A;  1PP9 E;  3H1I D;  5AW8 B;  3S4R A;  5AVU B;  2WMM A;  2WSE J;  1JY3 P;  2K9J A;  4GKG A;  1N2D C;  2B89 A;  2KLV A;  4N78 D;  1A02 J;  2ZFC A;  1ZN5 A;  1ZP0 C;  3EFG A;  3PTZ A;  1RHZ B;  2ZAE B;  2JR8 A;  1IFJ A;  5KAI H;  2Y0C A;  2QJY B;  2YMK A;  4XA4 A;  1FJK A;  2NPS C;  3N4X A;  3AE8 C;  2C0X A;  3S9O A;  2C9L Y;  4N6J A;  1LGH B;  1WMK A;  5APV A;  4YXW H;  1BCC J;  1SQX E;  3FXD A;  3H1J E;  1BDD A;  2WPR A;  3VN0 A;  1VQ7 P;  1HF9 A;  2L5G B;  1S9K E;  2I1K A;  2YIU C;  3O8Z A;  4DT0 A;  3PLN A;  4JYC A;  1KYO E;  3BCC D;  2B88 A;  1SQP K;  2A06 G;  3HRN A;  1URQ A;  3L73 G;  4H13 B;  1JY3 O;  1X22 A;  1NGM B;  1KB9 E;  3L71 D;  2E5T A;  2BAS A;  3LID A;  3PHL A;  4Y99 B;  2HR3 A;  2A45 I;  1NKN A;  2NZ2 A;  3M0A A;  3SWY A;  4EDF A;  5KLV J;  1SP4 A;  2D2C D;  1VQM P;  1JUN A;  2A45 G;  1E5W A;  1FZC C;  3AEF C;  3H1L J;  1P84 I;  3RGU A;  3TSI A;  3IF4 A;  2OYI B;  1EDI A;  1Y8A A;  2KIK A;  4OGQ B;  2Y0D A;  3II6 A;  3KYQ A;  3NFQ A;  5E79 E;  1N73 C;  2NPS B;  2PRR A;  4PV1 D;  2QJK C;  2RN0 A;  3L36 A;  5H2F E;  1N73 B;  4D6T E;  1EXI A;  1SQV K;  2O1J A;  3KZI H;  1L4A B;  1FZF A;  4AUW A;  1SFC D;  3M9B A;  3D71 A;  3CD6 P;  4C7N A;  1SQQ D;  1UII A;  1NU1 D;  5KKZ C;  2OGU A;  4PD4 H;  3MUD A;  2BCC J;  1NWQ A;  1H88 A;  1RF1 B;  3FWN A;  2OYH C;  3AEC C;  2HLO A;  1WT6 A;  2Q6Q A;  2PFX A;  3AED C;  4RO0 A;  3CCS P;  3V2R A;  1L0L E;  2A45 H;  2KUB A;  1RH5 B;  4O9B A;  1M57 D;  2WIT A;  1PP9 D;  5AVW B;  1OVR A;  1JCD A;  1FDI A;  4L73 A;  2IBZ I;  2ZT9 D;  1BE3 E;  3C9I A;  2B9B A;  3SSU A;  2YMY A;  3L75 D;  4KT0 J;  2ZXE B;  3CLQ A;  3MGN A;  3R2P A;  1PGJ A;  2AXC A;  3ZDM A;  2W27 A;  5APX A;  1YJN P;  1FOS E;  4EOT A;  1KIL C;  3SFE C;  1EDL A;  1GL2 C;  2KSJ A;  3NMD A;  5E79 H;  3V2P A;  4RJT A;  1P84 D;  1GD2 E;  2K3R A;  3AE5 C;  1X9V A;  1IK7 A;  2C9N Y;  1AQ5 A;  3G71 P;  3WUU A;  2FKW B;  2PP6 A;  3A2A A;  1S9K D;  3CWB J;  1QL1 A;  1URQ B;  3H1H D;  4U3F E;  1SQQ J;  2YO3 A;  5APQ A;  1VQ8 P;  5KLV G;  1DIP A;  1OVU A;  2ZVO B;  3CMA P;  1LTJ A;  2CPB A;  3V4W A;  1IFI A;  1NTZ K;  2FYZ A;  2V4H A;  3GHG B;  3L73 J;  5GTH H;  1MFT A;  1NHL A;  2HOD A;  3L74 J;  1YI2 P;  1KQF B;  2V7Q H;  1ZV8 A;  2IFN A;  2XDJ A;  3HE4 B;  3OJA B;  3L70 E;  4HB1 A;  4UB8 E;  4DJG A;  1Q81 Q;  2ZT9 B;  3WU2 E;  4L76 A;  1T6A A;  2E75 D;  3CX5 E;  3RL0 D;  1N73 A;  1QX8 A;  4UB6 H;  4JBZ A;  4K35 A;  2OTK E;  3BRV B;  5AW5 B;  1PPJ G;  5KJ7 C;  2K88 A;  3IN6 A;  1Q86 Q;  3LIE A;  1OW8 A;  1RF1 A;  2E5Y A;  3PH0 A;  1K04 A;  4H44 D;  3TGU E;  1U7M A;  2E76 B;  3MD0 A;  4PJ0 E;  4UB8 H;  2FYU E;  2W8Z A;  5AW0 B;  3CCU P;  1K73 Q;  3RK2 B;  5GTI H;  3Q2Y A;  3Q5S A;  2WPV B;  5KKZ B;  1W2E A;  1SQQ E;  4HJG H;  1L0L J;  3IR9 A;  5AVT B;  1NO4 A;  1M1J C;  1XTG B;  1J1D C;  1NU1 E;  2N1T A;  5AVZ B;  2WPS A;  1SFC C;  1SQB K;  1JY2 N;  3HTK A;  3H1I G;  1ZXG A;  1FC2 C;  1SFC B;  5AW2 B;  3L70 G;  5KLV K;  1RE3 A;  1EZV E;  5EFW B;  5KLI B;  2QJK B;  1PGP A;  3L74 D;  1SLQ A;  1KB9 D;  5CHX A;  1ZR2 A;  1S2E A;  2NPS D;  1KB9 I;  3CCQ P;  1ZRT D;  2WTY A;  2HYN A;  1IJD B;  2HG5 D;  1DX7 A;  1AJY A;  3TNU B;  3VMA A;  1NTK E;  4IFM A;  3KPE A;  3M0D C;  2R32 A;  2FYU K;  1JEK A;  4IL6 H;  3VMX A;  3Q5P A;  4I7Z C;  2E43 A;  1NTZ D;  1RF0 C;  1SQQ K;  3FXE A;  3R4Y A;  5AVY B;  2E76 D;  3F5H A;  2FBW C;  1RE4 C;  3NXS A;  1LWU C;  4W7Z A;  3AEA C;  2G8Y A;  2A06 D;  3L73 D;  4OH8 B;  1T2K C;  2H43 A;  2UWJ E;  1E79 H;  3L71 G;  1L0N E;  4N78 E;  1Q90 D;  1R5L A;  5CJ0 A;  3TK1 A;  4C46 A;  1HJB A;  1QVF O;  1AVY A;  3CXH H;  1T3J A;  3TF5 A;  2J5U A;  2WSC H;  1KFM A;  3LW5 H;  1H89 A;  2D2C C;  3GHG C;  2L91 A;  3AEG C;  4ZNC A;  3C8V A;  5APT A;  5AVQ B;  2QVA A;  3GF7 A;  4YTP C;  1KYO H;  2KZJ A;  2OYH B;  1KQG B;  2M5A A;  2QRX A;  3AEB C;  3GW6 A;  2W83 C;  3FGA D;  3A0H E;  1URQ D;  2XZR A;  3CX5 D;  1NTM K;  1NU1 J;  1Y47 A;  2QE7 H;  4N3Y B;  3K5B A;  2WT7 A;  4XE5 B;  1VQN P;  2WZ7 A;  1KN7 A;  1EC5 A;  2H89 C;  2J58 A;  1M1J B;  2N1T D;  3H32 B;  4I6M C;  2HFE D;  1P84 E;  2QIW A;  1BGY E;  2YIU B;  1OXZ A;  2JDI H;  1OVV A;  4MN4 C;  3RK2 C;  1DD4 A;  5K5G B;  2IFM A;  1MKM A;  3CCJ P;  2IZ0 A;  5GTH E;  1KC8 Q;  3H1K E;  5AVV B;  1J1E C;  1M90 Q;  1PP9 G;  3RK3 E;  4U3F D;  2M5A B;  4ZKP A;  1KV4 A;  1KOR A;  2Q3E A;  1N7L A;  1VQ4 P;  2YNY A;  1MFZ A;  4DZO A;  4CPG A;  3HTK B;  3L72 J;  1N7S C;  4I1L A;  3IAO A;  3P7K A;  1AV1 A;  1L4A C;  2WQY C;  3GG2 A;  4I2L C;  4I7Z B;  2KP8 A;  4ASV A;  3M0D A;  1A02 F;  3BCC J;  4W7Y A;  1DEB A;  1SQX G;  3H1J G;  2P67 A;  3JCU E;  1NTK J;  1IC2 A;  3CWB E;  5TIS E;  3RBZ A;  1LTJ C;  2M0B A;  1ZLL A;  2ZXX A;  4NPE A;  3H1H G;  3RK3 B;  1L0L D;  3MTU E;  3IFM A;  4BXL A;  1T8Z A;  3H1K G;  1BGY J;  1YIT P;  2YXQ B;  2A06 E;  5CCG A;  1JO5 A;  3TGU D;  1UIX A;  1L0L K;  1YQ4 C;  2KXP B;  2OTJ P;  2K9Y A;  1PIX A;  1QL2 A;  1GL2 D;  3L75 E;  3JCU H;  2KB7 P;  3H1L D;  2Q9I A;  3P32 A;  3LW5 J;  3OW2 O;  1FE6 A;  3HD7 A;  5DJT B;  2PGD A;  2D2C B;  4JYB A;  1S1C X;  3CXH E;  1KZU B;  1L0N K;  2FYU G;  4WB4 A;  1VQ9 P;  1NYH A;  4H0L B;  3D70 A;  3G6E P;  4GT1 A;  1PPJ D;  2R5D A;  2E42 A;  3HUS A;  3L35 A;  1LTB C;  1MV8 A;  3G9R A;  5AW6 B;  1MUU A;  2O01 N;  4PJ0 H;  5C39 A;  2DW3 A;  1SFC A;  1T3U A;  2OYI A;  1VQK P;  1LT9 A;  1NTK D;  1EZV G;  1NTZ J;  2E74 D;  2NPS A;  3D6Y A;  2Q7C A;  1YYC A;  1JOC A;  2QJY C;  3P8M C;  1GTW A;  2G3A A;  2Y0E A;  3HD7 C;  1VQL P;  2XND H;  2GUS A;  1J1E B;  2P7J A;  3HD7 D;  1ZR4 A;  4OVN F;  3SWK A;  1LT9 B;  3L72 E;  4D6T J;  3EQ2 A;  3L73 E;  3USS A;  1U7J A;  1Q7Y Q;  1VPC A;  1SQB G;  2RKL A;  1KB9 H;  2XU6 A;  4JF7 A;  1AA0 A;  3W67 A;  3O6Q A;  3RK3 D;  1FZB A;  4EYY Q;  3HUS C;  1YTZ T;  2C0W A;  3RBX A;  1HUC A;  5BU5 A;  1YHQ P;  2HOD B;  1VF5 C;  1FJP A;  3A5T A;  2AEM A;  5AW1 B;  1QLE D;  3CCE P;  4QMA A;  3B4S A;  5KTB A;  1N8R Q;  3L71 E;  1L0N G;  3RK2 D;  5TJH A;  1NTM J;  1NU1 K;  4NPF X;  5BU8 B;  5CBO A;  3S1K A;  2N9B A;  4H44 B;  2ZYG A;  1VQO P;  3I55 P;  5H2F H;  1CZQ A;  1N7S A;  1Z56 A;  1FZA A;  2IZ1 A;  2P1J A;  1T2K D;  3A0B E;  3CWB D;  2E75 B;  1GU4 A;  3CC2 P;  1BE3 J;  2W6B A;  2Y9Z A;  4C7R A;  1BCC E;  2GM4 A;  5KLV E;  1VQP P;  3WU2 H;  1NTM E;  2QJP C;  1LWU A;  1M8O B;  2Z4E A;  3AE9 C;  1RQU A;  4A7P A;  1HJ0 A;  2IYP A;  1BGY D;  1X79 B;  2GUV A;  2J59 M;  1RQV A;  5B5E E;  3WUT A;  1SQV J;  2WPQ A;  3L75 J;  3P8C D;  1LWU B;  3QH9 A;  4KJM A;  1KD1 Q;  1G1J A;  3AE1 C;  5AW9 B;  1OIP A;  2JWA A;  5B66 E;  5KJ7 A;  1DEE G;  2OQQ A;  2RMZ A;  3CME P;  3A3Y B;  1URQ C;  3HUS B;  2WSS H;  1FAV A;  2B87 A;  3EWK A;  4HH2 A;  2OTL P;  4JQ0 D;  1NTM G;  4Y28 J;  2KI7 B;  1KIL A;  4R4M A;  3VMZ A;  1K8A Q;  4GDO A;  2H7H A;  1ZOY C;  3H32 A;  4U3F J;  2FYN B;  1SQP J;  2YKP A;  3EFF K;  2BEZ F;  1JY2 P;  2KNC B;  2ZYD A;  5KAF E;  1S72 P;  1GK4 A;  1H8A A;  3TDK A;  1JMB A;  1N86 A;  4M3L A;  1CI6 B;  2Q5U A;  2KSE A;  4IL6 E;  1FS0 E;  3BCC G;  3M06 A;  3OA7 A;  1KIL B;  2ZVN B;  4K3A A;  2MKV A;  3U1A A;  1U57 A;  2LXC B;  2WSF J;  4ZMD A;  3AE6 C;  3CC4 P;  3H25 A;  2H8P D;  2PAJ A;  1SQX K;  2E76 C;  3AE7 C;  2YKQ A;  1LP1 B;  5APS A;  1LTT C;  5KAF H;  1AQT A;  3GLM A;  5M1B A;  1RF0 A;  2P2U A;  1G1I A;  2QEX P;  4GIF A;  2FFD B;  2QM8 A;  1EDK A;  3L75 G;  2ZYA A;  4BWN A;  3V6I A;  1Q82 Q;  1HBW A;  1JY2 O;  3Q5R A;  1R8E A;  1PPJ E;  3ITK A;  3KQG A;  5CMZ A;  3TGU J;  1FDO A;  4DCK A;  5CCH D;  3TGU G;  3CCR P;  1DH3 A;  2QA4 P;  1LTA C;  1SQP E;  4WY4 A;  4BRY B;  2IYO A;  5KLI C;  3AE3 C;  3BAS A;  3UIA A;  1IK9 A;  1JY3 N;  2O3J A;  4OGQ D;  3VMY A;  4DOJ A;  1YBK A;  4IOI H;  3VP9 A;  4ASW A;  3CC7 P;  2WVR A;  1KYO I;  5CBN A;  1NU1 G;  1LNQ A;  1K9M Q;  1VF5 B;  5KAI E;  2KYV A;  1LTI C;  1KIL E;  4R4L A;  4OWF A;  5AVX B;  1OW6 A;  2FYU D;  1OWA A;  1JNM A;  3V2N A;  3HE4 A;  2LR2 A;  1OFC X;  1OMI A;  3L72 D;  2K9J B;  2OYI C;  4H13 D;  1LTS C;  1LT9 C;  2BEQ D;  2QSI A;  1L0N J;  2R5B A;  4TT3 H;  2POH A;  3CX5 H;  4UB6 E;  1GW3 A;  3T97 B;  3RL0 B;  1SQV E;  1HH0 A;  3H1H J;  4YPC A;  1KQS O;  5AW4 B;  1SS1 A;  1NTK G;  2E75 C;  2IPP A;  2VRS A;  1SQP G;  3O6Q B;  1TU3 F;  1PL5 A;  1SQB E;  3H1L E;  4H13 C;  3MZW B;  4NPD A;  3E7K A;  3CL3 D;  3VP8 A;  4D6T G;  1PFI A;  3CXH I;  5APY A;  5L8R J;  1BDC A;  1W5C E;  3CXH D;  2ITA A;  1VQ6 P;  1KTM A;  3E1R A;  4EIJ A;  1ZW0 A;  2JO1 A;  1OW7 A;  3U1C A;  1H0T B;  4IL6 X;  1BCC D;  3M9H A;  4IFF A;  2R3S A;  5KLV D;  2LKM A;  1VL2 A;  5TIS H;  1G2C B;  3B5N C;  2P10 A;  1SVF A;  1SQV G;  2OYO A;  2R3C A;  2W90 A;  3KHU A;  3VYI A;  1GU5 A;  5CCH C;  3I56 P;  2QJP B;  1N7S B;  1L0N D;  3B5N D;  3M9Q A;  2JJL A;  4B86 A;  3TNU A;  3AE4 C;  4LLH A;  4AQR D;  2BCC D;  1M1J A;  1USD A;  2IBZ E;  2N1T C;  3L70 J;  1NJI Q;  2QG4 A;  1Q2N A;  2LXB A;  3P8C E;  3H1I J;  3Q3D A;  1L2P A;  4WWI A;  1BE3 G;  1LTJ B;  2WWW A;  4PD4 D;  1NTK K;  1FZC B;  1NOH A;  4W80 A;  4C7N B;  4EI2 A;  1IZN B;  4GOF A;  2NRG A;  3I5C A;  4WY4 C;  2HPC A;  1XTC C;  2KS1 B;  3SWF A;  4IFD K;  2V7Q J;  5B66 H;  4HYT B;  4RES B;  3CCM P;  1BGY G;  2GA1 A;  3H1K J;  5APU A;  3GF3 A;  2KZI A;  4XFJ A;  2AXT E;  3PRJ A;  1BSH A;  4LC1 A;  1CSB A;  4JPZ B;  4RKU J;  1KFN A;  2IBZ G;  2YXR B;  3L70 D;  1L4A D;  1SQB J;  1WRG A;  3A0H H;  3L71 J;  1IFD A;  1PV3 A;  3L74 G;  2FXO A;  1EDJ A;  5AVR B;  1YJW P;  3B5N B;  4PV1 B;  1GDT A;  3AEE C;  2JEE A;  2K1A A;  1VDF A;  1S3J A;  1NTM D;  4PV1 C;  1KYO D;  3BCC E;  3CX5 I;  4OGQ C;  3WUV A;  1YIJ P;  1FU1 A;  3CCV P;  3BVH A;  1HGZ A;  1LJ2 A;  1PP9 J;  3GHG A;  3L37 A;  1NVO A;  1NTZ G;  5APW A;  2M8R A;  1J1D B;  1GK6 A;  1M1K Q;  2YKO A;  3JC2 2;  2FXM A;  2SPZ A;  1AVO A;  3CPW O;  1K05 A;  5GTI E;  3VOP A;  4WY4 D;  3L74 E;  1G2C A;  2FYU J;  1FZE A;  2Y9Y A;  3B5N A;  3HE5 A;  1FZG A;  2MJZ A;  2OAR A;  2XKM A;  3H1I E;  1RE3 C;  2WSF H;  4LGD E;  1ZRT E;  1AFO A;  5B5E H;  3BRT B;  1RY3 A;  3PJS K;  2M3E A;  2O01 H;  1HVV A;  3B8E B;  3N7N A;  3TYY A;  3PP5 A;  3L4F A;  2Q3I A;  4WVZ A;  5AVS B;  1NAF A;  2JP3 A;  2O1K A;  3CI9 A;  3HE5 B;  2CK3 H;  2I1J A;  3CCL P;  1X0T A;  1M7L A;  1VF5 D;  1SQX D;  3H1J D;  4PD4 E;  5CCH A;  2KS1 A;  5AW3 B;  1JCC A;  1HWT C;  1PGQ A;  2I8D A;  1SQX J;  3H1J J;  3SFD C;  5BVZ A;  3T97 A;  1CW5 A;  3MHV A;  2ZJS E;  2JWD A;  1JB0 J;  3L72 G;  4ZKU A;  1DD3 A;  3HD7 B;  3U59 A;  3M91 A;  2R44 A;  3H1L G;  3F89 A;  1SQQ G;  2E74 C;  2Z5H A;  2HPC B;  4HKZ H;  2K37 A;  1YTZ I;  1QGK B;  5CCG C;  2E74 B;  4PD4 I;  1SQP D;  3KZI E;  3QWO C;  1EXJ A;  3G4S P;  1X8Y A;  3GMA A;  4L75 A;  2AEF A;  4WY4 B;  5KJ7 D;  2FXP A;  1IFM A;  4BRY A;  5CCG D;  1GZL A;  3RL0 C;  3V4Q A;  3W68 A;  1H0T A;  4D6T D;  2M3B A;  1HGV A;  1JMM A;  1KIL D;  4H0L D;  1J2J B;  1GL2 A;  1JTH B;  1NH4 A;  2FYN C;  3V2Q A;  4YXD C;  1S5L H;  1OX3 A;  2ZT9 C;  1BCC G;  1L0L G;  3FWL A;  2WT7 B;  1LP1 A;  3H1K D;  3KXD A;  1FDM A;  1SQV D;  1USE A;  4H44 C;  5DJU B;  1GL2 B;  1JTH A;  2N9Y B;  3E1I A;  3JSV C;  2IDB A;  3NTN A;  3ABV C;  2XNX A;  2AEJ A;  1RE4 A;  1YQ3 C;  3MIW A;  1IFN A;  2BCC G;  3RL0 g;  3RK3 C;  1S5L E;  1CI6 A;  1SQB D;  2WSC J;  1FZC A;  3FX0 A;  2WSE H;  4U7J A;  2IX7 C;  1EQ7 A;  4U3F G;  2KLU A;  3Q1M A;  1LT1 A;  1NKZ B;  1OZH A;  1BE3 D;  1P84 H;  1R5S A;  2FY8 A;  1BSN A;  3C1L A;  2FFD C;  3A0B H;  1M56 D;  1FBM A;  4Y99 C;  1L4A A;  2P58 A;  2KNC A;  3G3Z A;  3H6P A;  1MZ9 A;  4H0L C;  1GMJ A;  3OAK A;  1S4X A; 
#chains in the Genus database with same CATH homology
 1P84 E;  4D6T E;  1BGY E;  2FYU E;  3L75 E;  2IBZ E;  1L0N E;  3BCC E;  1SQV E;  1SQQ E;  3H1K E;  1SQX E;  3H1J E;  1NU1 E;  4PD4 E;  4U3F E;  3H1H E;  3CXH E;  2BCC E;  1SQB E;  3L71 E;  1KYO E;  3H1L E;  1EZV E;  1PPJ E;  1KB9 E;  1NTZ E;  1SQP E;  1L0L E;  3L74 E;  3L70 E;  1NTK E;  1PP9 E;  1BCC E;  1BE3 E;  3CWB E;  3H1I E;  3CX5 E;  5KLV E;  1NTM E;  2A06 E;  3TGU E;  3L72 E;  3L73 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...