1BGYE

Cytochrome bc1 complex from bovine
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
75
structure length
75
Chain Sequence
SHTDIKVPDFSDYRRPEVLDSTKSSKESSEARKGFSYLVTATTTVGVAYAAKNVVSQFVSSMSASADVLAMSKIE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
total genus 23
structure length 75
sequence length 75
chains with identical sequence Q
ec nomenclature ec 7.1.1.8: Quinol--cytochrome-c reductase.
pdb deposition date 1998-06-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
E PF00355 Rieske Rieske [2Fe-2S] domain
E PF02921 UCR_TM Ubiquinol cytochrome reductase transmembrane region
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.270 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Ubiquinol cytochrome reductase, transmembrane domain 1bgyE00
1KYOE 3L70E 1KB9E 4PD4E 2BCCE 3H1JE 1SQPE 1SQBE 1SQVE 1NTME 3L72E 3TGUE 3H1KE 3L74E 3H1HE 3CX5E 1L0LE 1NTKE 2FYUE 1SQXE 1SQQE 3H1IE 3H1LE 1BE3E 4U3FE 1PP9E 1EZVE 4D6TE 3CWBE 1BCCE 2A06E 1NTZE 2IBZE 1L0NE 1BGYE 3L71E 1NU1E 3CXHE 3L75E 1PPJE 1P84E 3L73E 3BCCE 5KLVE
chains in the Genus database with same CATH superfamily
3HUSB 4OGQC 1NTKK 2E5YA 3AEFC 3TGUJ 1NTKJ 2QA4P 2Q6QA 1N8RQ 4BRYB 5C39A 1BCCG 1L2PA 2V7QJ 2LXCB 1AVYA 1YHQP 3FWLA 1IFNA 3CC4P 4HJGH 3G3ZA 3JSVC 1LNQA 5AVVB 3HE5B 3P32A 2I8DA 4IOIH 1ZN5A 3KZIH 3PH0A 4EI2A 1FAVA 1PPJG 2VRSA 1IC2A 1L0NK 1RE3C 3BCCG 1NOHA 1N7LA 1LT9B 3B71A 1PZQA 5APTA 1NU1K 2QJPC 2YKQA 2E75B 1J1DB 3AECC 1ZRTD 2N9YB 1HGZA 2AEMA 1IFDA 1SQXJ 3N7NA 5KKZB 5M1BA 1K9MQ 4W7YA 3VOPA 3A5TA 1N7SC 1M1JA 1XTGB 3S9OA 1SQPJ 1L0NJ 1PL5A 1PPJD 3I5CA 4WBAA 1PPJE 1LJ2A 1SFCC 3TNUA 2I1KA 3BCCE 1JMMA 1L4AD 4OH8B 2FFDB 3R4YA 3H1IG 3RK2D 3V2QA 1GD2E 1RF0C 1CI6B 2FYUK 3H1LD 1SQPE 1U7MA 2YIUB 2E75D 2YXRB 3TGUD 1A02F 2KUBA 1VF5C 1L0NG 2YKOA 3L74E 2YMKA 3L74D 3L75D 3TGUE 1ZR2A 2QSIA 1S2EA 3V2NA 1EXJA 1FOSE 1NHLA 1OWAA 4WB4A 2FXPA 5AW3B 3H25A 2LXBA 1RY3A 3BVHA 1VF5B 4U3FJ 3H1JJ 2YIUC 2C9LY 4ZKUA 1BE3J 5AW0B 5CCHC 2NPSD 3AE3C 4Z1MH 1H0TA 3CWBE 2IDBA 2HODB 1NTZE 1URQA 2E5TA 3H1KJ 1KYOI 2JDIH 1LP1A 1LTIC 1L0NE 2IZ0A 1ZW0A 4AQRD 3E1RA 1K8AQ 2KOGA 1SFCB 1L0LG 1RF1A 4XFJA 3F89A 1KV4A 1YITP 1NJIQ 1N7SB 1LTGC 1KB9D 3HUSA 1LT1A 1KB9E 4OGQD 2BCCE 3GG2A 5KKZC 4AUWA 3AEBC 2YXQB 2RN0A 2PGDA 2FYUJ 1RF1C 3CWBG 1J1DC 2A06G 2E75C 1NTZG 1K73Q 2M5AA 2PFXA 1GK4A 2QJPB 3JC22 3OA7A 3CI9A 1LT9C 4XE5B 3L72J 4OWFA 1SQBK 5KAFE 1FJKA 2M0BA 3AE9C 4D6TJ 1YJ9P 2YO3A 4KJMA 1VQ5P 4K35A 1PGPA 5CJ4A 1BE3E 1KQLA 2W27A 2ZT9D 1SLQA 5AW5B 5AW8B 3V5BA 3K5BA 3WMM0 3SFEC 3CCMP 3OW2O 5GTIE 4I2LC 1BDDA 2A06E 3H1JD 2MKVA 3HUSC 4OGQB 3NMDA 1L4AB 1M1JB 4MN4C 2RMZA 4LC1A 1J1EB 1RQUA 3A0BH 3MGNA 1FZAA 3JCUH 3CX5D 2IZ1A 1AFOA 1G2CA 2WPRA 5APSA 1URQC 1LTBC 1GU4A 2WSFH 1IJDB 1FE6A 1GL2D 2CK3H 1SFCD 1DD3A 2O01H 4GIFA 4L74A 1KQFB 5B66H 1JY2O 1T2KC 2M8RA 4JPZB 2IX7C 4IFMA 2BCCJ 3WUTA 3VP8A 1T8ZA 2P67A 3WUVA 3L71G 2L5GB 4ZMDA 3WUUA 3FXDA 2OQQA 1K05A 1MZ9A 1ZR4A 2M3EA 3HTKB 1NTKE 2V7QH 4I7ZC 4H44D 1HF9A 3JCUE 4GT1A 2XU6A 5TISE 2FYNB 3CCVP 2KP8A 3D70A 3KYQA 3MUDA 1VL2A 3AEEC 3SWFA 1AQTA 1KB9I 3Q5RA 3AE4C 3GW6A 3TK1A 3B5NB 3RK2B 2N1TA 1YYCA 2O1JA 2QE7H 4IFFA 2KB7P 2NPSC 2JR8A 4HKZH 1HJ0A 2KLUA 2M3BA 3A0HH 3W68A 1DH3A 5CMZA 2FFDA 1FU1A 1IZNB 1FDIA 2K37A 4RKUJ 1URQD 5CJ0A 1OIPA 3FGAD 3H1LG 1QVFO 2R3SA 1USDA 1GK6A 1JY3N 2KSEA 4TLFA 4DCKA 2O01N 1L0LK 2M5AB 1FZGA 3KXDA 1JTHA 3AE5C 2OYIA 4WY4C 3CXHH 1KILE 3L73D 3H32B 4JYBA 3M0DC 5KLVK 2KS1B 3S1KA 1GL2A 1S3JA 2OYIC 2QM8A 3IN6A 1BCCJ 2K1AA 3H1IE 5APYA 3G9RA 3L70G 1MFTA 5APVA 1GTWA 1UIXA 1ZP0C 1AJYA 3TF5A 3NFQA 2IYOA 4N78D 2IBZD 4R4MA 2B87A 1L4AA 1BSNA 1PGJA 3L74G 4H13B 1Y47A 1QL1A 2WSFJ 3CX5H 1USEA 2FFDC 1IK7A 2R44A 3M91A 2AXTH 5APUA 4UB8H 1S5LE 3CXHD 2V4HA 2E43A 3CC2P 2WTYA 1PGQA 2FYUG 2N1TC 1JCCA 2Q1KA 2HG5D 2H43A 1BSHA 1KYOE 3L70E 1HGVA 1JY2N 4H0LC 2Q7CA 4ZKPA 2Y0CA 1M7LA 2WPSA 1SQVD 2P2UA 3MUDC 4L75A 2JP3A 1KMIZ 4PD4I 1VF5D 2WSEJ 4Y99C 3H6PA 1BGYG 1PIXA 3L36A 5AVTB 1P84H 2K9JA 1L0LE 1E79H 1Y9BA 2P10A 3L75G 4M3LA 3VMXA 1T2KD 4IFDK 3H1IJ 2LKMA 4H44C 3RBZA 1QGKB 2ZJSE 2W83C 2FY8A 1KD1Q 2BCCG 3EFFK 1HTLC 1KYOH 3H1JG 1EC5A 3L71J 5AW4B 5AVSB 1OFCX 1SQVG 3PP5A 2P1JA 3PLNA 4HYTB 4YTPC 2Z4EA 1SS1A 2YKPA 1JO5A 1YQ3C 2CPSA 1OZHA 2OYHB 1EQ7A 5CCGC 1VQNP 3VYIA 1CSBA 1FZCB 1R5LA 4GOEA 1HH0A 2Y9YA 3CCRP 1KQGB 1RE4A 1M56D 1YJNP 1K04A 4DT0A 1SQPK 1JY3P 3OJAB 3GF3A 1YBKA 1BE3G 3AE2C 4PD4E 2BEZF 1BGYJ 1NO4A 3PHLA 1EZVG 2H89C 3WU2H 2OTJP 3RL0D 1YI2P 4QMAA 1NU1J 3H1HE 3H1KD 3GMAA 2HPCB 2E76B 2E42A 1NKNA 2QG4A 5H2FE 1FDOA 5CCHD 3CCSP 1IO4A 2Z5IA 1NWQA 2ZYDA 1VQ9P 2D2CD 5KLVG 1VQPP 1FBMA 2BASA 1GZLA 1IFJA 5AVYB 1S72P 2FXOA 4PD4H 1EZVE 1M90Q 1NKZB 1QVGO 2Q3IA 5KLIB 4BXLA 3L71D 3P8CE 4PV1B 2JO1A 1E5WA 3FX0A 1GMJA 1RE4C 2E74C 3L71E 1N2DC 4WVZA 2W6AA 2ZYAA 3ABVC 3TYYA 1NTKG 1WT6A 4W80A 3TNUB 4AYCA 1LWUB 3EQ2A 3BCCD 2WQYC 5KLVE 3M9BA 3L37A 2YNYA 2QIWA 3MIWA 5TJHA 3CCUP 3BRTB 4RO0A 3I56P 1KILC 2K88A 2L91A 1SQBE 1PP9D 2GA1A 4XA4A 5AW6B 2WT7B 2AEFA 5EFWB 1Z56A 1LTAC 2OGUA 1VQ8P 2ZAEB 5BVZA 2K9JB 2XNXA 2Q5UA 5AW7B 2POHA 1SQBJ 3LIDA 3B8EB 1KB9H 4YPCA 3CCEP 3VMAA 3H1LE 3AE1C 4LLHA 4U3FE 2ZT9C 2J59M 3CLQA 4U3FD 1H0TB 2WMMA 5CHXA 1YIJP 3E1IA 1RF0A 5B66E 1KN7A 2QJKC 1L0ND 1LP1B 1X9VA 1VQLP 5KAFH 5CBOA 2OTLP 1LTJC 3Q5SA 1SFCA 2KI7B 4NPDA 1X22A 3GLMA 3VMYA 1JOCA 3HD7A 5TISH 1FZBA 1VQ6P 3R2PA 2HYNA 3M0AA 5GTIH 1KC8Q 3AE6C 2R32A 1XTCC 3GHGC 2H7HA 3O6QA 1NGMB 3EWKA 3LIEA 3RL0C 3KQGA 2D2CB 4WY4D 3C8VA 1GL2C 1JEKA 1GW3A 1CW5A 3CL3D 3M0DA 2KNCA 2FYZA 4WY4A 2FYUE 4N3YB 4C7RA 2O01J 1H8AA 3EFGA 2FBWC 2J58A 2O3JA 4IL6E 2N9BA 1Y8AA 1MKMA 1NAYA 3BATA 2R3CA 2WSCH 3GHGA 2HFED 1KYOD 1YTZI 2A06D 2G3AA 3HRNA 3L70D 3O8ZA 4K3AA 4WWIA 4PJ0E 4YXWH 1FZFA 1OW7A 1R5SA 3MTUE 3MD0A 2GM4A 1IFMA 3HD7C 1BGYE 1S5LX 1OVVA 2CPBA 1SQVJ 3L75E 4JQ0D 4B86A 2ZXXA 1RH5B 3RK3B 1LTJA 3MZWB 1OX3A 3CX5I 1L0LD 1LWUA 2PAJA 4I6MC 5E79H 1SQQG 1ZXGA 2Q3EA 2JWDA 5AW2B 1NTZK 3V2RA 3G4SP 3H1JE 3UIAA 1M8OB 2FKWB 3N4XA 1Q90D 1SQVE 1Q7YQ 4DOJA 1D7MA 1NTME 1VQ4P 3T97A 3L72E 1X79B 3CWBD 3VP9A 4UB6E 1H88A 3A3YB 2QJYC 5KAIH 1N73B 2QJYB 3E7KA 5AVRB 3HTKA 1N73C 2IFMA 1LGHB 1VQKP 5KJ7A 2J5UA 2Q9IA 1SQQE 2R5DA 3IF4A 1J2JB 2JEEA 2XKMA 2C0XA 1GW4A 1KILA 1OXZA 2C9NY 4HH2A 1NTMG 3CMEP 1G1IA 1RQVA 3V2PA 5AW9B 2B89A 2H88C 1S9KE 1N73A 1NAFA 2A45G 3H1HG 4U7JA 1Q2NA 1VQMP 1QL2A 3V4WA 3RK3C 3CWBJ 4GODA 4UB6H 3CCLP 1OMIA 1AVOA 2KLVA 4H0LD 5APWA 3U1AA 3B5ND 1JB0J 2W8ZA 2W6BA 1AA0A 2N1TD 2WSSH 3HD7B 4ASVA 1KTMA 4GDOA 1PP9G 3KHUA 1Q82Q 1IFPA 1DX7A 2BEQD 5AVZB 1EDKA 2KZJA 2ITAA 4BRYA 1W2BO 2KZIA 1HWTC 1NYHA 1JTHB 2IYPA 2WVRA 3FWNA 3HE5A 1PV3A 1OW6A 4JBZA 3RGUA 3G6EP 1S5LH 4BWNA 3GF7A 1A02J 1ZMEC 2KS1A 2YO2A 1GL2B 1G1JA 3A0HE 2D2CC 3PTZA 3L70J 3RL0B 2Y9ZA 1GDTA 1M1KQ 2OARA 3H1ID 3GHGB 3LW5J 3G71P 1SQBG 1EDIA 3FXEA 2B87B 3L4FA 2IBZE 1SVFA 2WPQA 5CCGD 2Y0DA 2GUSA 3PRJA 1IFIA 1LTJB 3CXHI 1FOSF 5KLVJ 3L73J 5CCGA 1NTKD 3LW5H 2QJKB 1UIIA 2WZ7A 3BRVB 4U3FG 2JJLA 1CI6A 2I1JA 1SQBD 2KSJA 3RK3E 4LGDE 1QLED 5CCHA 3Q2YA 2ZT9B 1GU5A 1BGYD 3A2AA 3T97B 3M06A 5DJUB 3VTPC 3W67A 1EDJA 3ZDMA 2WITA 3V4QA 1JCDA 3L73G 4UB8E 3Q3DA 4GOFA 1SQXD 2AEJA 1AV1A 3IR9A 1HUCA 1KILB 2H8PD 2JKVA 3KDPB 4IL6X 5APXA 1FZEA 2ZFCA 4C7NA 4D6TD 2QEXP 4JYCA 1JY2P 1PP9J 3V6IA 2OYHA 1LWUC 3H1LJ 3L35A 1JNMA 3A7OA 1VDFA 3RL0g 1H89A 2GUVA 1P84E 1KILD 2B88A 2E74B 1SP4A 3L73E 2LR2A 3M9QA 3QWOC 4PV1C 5AW1B 4EOTA 1N7SA 1RF1B 1NTMK 5KLIC 1T6AA 2FYUD 2PRRA 3AEDC 4YXDC 3CCJP 1BCCD 1DEBA 2B9BA 2QM7A 4PD4D 3BCCJ 1JUNA 3D71A 1CZQA 4N6JA 1DD4A 2P58A 3L75J 2QRXA 4TT3H 4EIJA 1BDCA 1AQ5A 2Y0EA 2Z5HA 1NTZJ 3H1KE 3A0BE 4I1LA 5AVWB 1RE3A 3TSIA 3D6ZA 1TU3F 2HPCA 2KIKA 3NXSA 2E76C 5DJTB 1OW8A 2WPVB 3CPWO 4EYYQ 5L8RJ 1R8EA 1DEEG 3IFMA 3HE4A 1MUUA 3AEGC 1T3JA 4GKGA 1SQXK 2ZXEB 2XNDH 3L74J 3H1HD 4RESB 2FXMA 1QEXA 3HD7D 3L72G 4KHXA 2K9YA 1VQ7P 2UWJE 2WSCJ 1SQQK 2PP6A 1RHZB 1MFZA 2NPSA 3CD6P 2KXPB 4KT0J 2XDJA 3I55P 3Q1MA 1G2CB 1FZCC 2OYHC 3S4RA 1PFIA 4H13D 1WMKA 1ZRTE 3TDKA 1JY3O 5KLVD 2NRGA 4IL6H 1OVRA 3VN0A 1KFMA 1NTMD 1S4XA 2WT7A 1FDMA 1SQPD 1LTTC 3L72D 3P8CD 3U1CA 1WRGA 1YTZT 4PJ0H 4W7ZA 2OYOA 4H44B 5KJ7D 1VQOP 1S9KD 1HBWA 3CMAP 5AVUB 2QVAA 1PGOA 1IK9A 1P84I 3MHVA 5APQA 1KFNA 4Y99B 1PP9E 1U7JA 4O9BA 1S1CX 4H0LB 4ASWA 1SQPG 4C46A 4C7NB 3P7KA 4DZOA 3B5NA 3TGUG 2N1TB 1EZVI 3KPEA 1NH4A 1EXIA 1DIPA 2KYVA 2JWAA 2A45H 1NU1E 2XV5A 3H1HJ 1M57D 3AE8C 1NU1D 3RBXA 1X8YA 3II6A 3F5HA 2ZVOB 4R4LA 5BU8B 5KTBA 4H13C 1SQVK 1ZV8A 2A45I 2G8YA 2ZVNB 2C0WA 2P7JA 3SSUA 1X0TA 3OAKA 1NTZD 1MV8A 2W6JH 4L73A 1FS0E 3O6QB 4PV1D 5K5GB 1FJPA 1HJBA 4RJTA 1Q86Q 4N78E 1HVVA 2IBZG 1OVUA 2OYIB 4NPFX 2AXTE 3H32A 3IAOA 1YJWP 1NU1G 3Q5PA 2HR3A 2WSEH 2YMYA 5GTHE 2W90A 2KNCB 3SFDC 4WY4B 5E79E 4HB1A 4EDFA 1LT9A 3D6YA 2MJZA 3C1LA 1KQSO 5B5EE 3U59A 3HE4B 3USSA 4NPEA 2E76D 3SWYA 4Y28J 5AVQB 1QX8A 2RKLA 2KK7A 1JMBA 1W5CE 2SPZA 3SWKA 3PJSK 2RH0A 4DJGA 2AXCA 1LTSC 4OVNF 5KAIE 1KORA 3CXHE 5BU5A 2NPSB 3B4SA 3P8MC 5GTHH 1BE3D 1SQXG 3AEAC 3B5NC 3RK2C 5CBNA 2ZYGA 1EZVD 2E74D 1L0LJ 2NZ2A 3RK3D 3CCQP 1U57A 3MP7B 5B5EH 1ZLLA 1Q81Q 2WWWA 2XZRA 4D6TG 2IPPA 3VMZA 4L76A 2O1KA 1N86A 1KZUB 1NTMJ 2FYNC 1JM0A 2OTKE 5KJ7C 1VPCA 3ITKA 5AVXB 4I7ZB 3CX5E 4A7PA 4CPGA 4ZNCA 2IBZI 1SQQD 4JF7A 1SQXE 2R5BA 1FC2C 2K3RA 3WU2E 2DW3A 4D6TE 2BCCD 1BCCE 2IFNA 2HODA 1URQB 3M9HA 3CC7P 3H1KG 1N7SD 1FZCA 3KZIE 1SQQJ 1EDLA 5H2FH 1P84D 3NTNA 1W2EA 3BASA 1T3UA 1YQ4C 1ZOYC 1J1EC 1NVOA 3QH9A 3C9IA 2HLOA 3AE7C 1M1JC 1L4AC
chains in the Genus database with same CATH topology
1KYOE 3L70E 1KB9E 4PD4E 2BCCE 3H1JE 1SQPE 1SQBE 1SQVE 1NTME 3L72E 3TGUE 3H1KE 3L74E 3H1HE 3CX5E 1L0LE 1NTKE 2FYUE 1SQXE 1SQQE 3H1IE 3H1LE 1BE3E 4U3FE 1PP9E 1EZVE 4D6TE 3CWBE 1BCCE 2A06E 1NTZE 2IBZE 1L0NE 1BGYE 3L71E 1NU1E 3CXHE 3L75E 1PPJE 1P84E 3L73E 3BCCE 5KLVE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO E;  3L70 E;  1KB9 E;  4PD4 E;  2BCC E;  3H1J E;  1SQP E;  1SQB E;  1SQV E;  1NTM E;  3L72 E;  3TGU E;  3H1K E;  3L74 E;  3H1H E;  3CX5 E;  1L0L E;  1NTK E;  2FYU E;  1SQX E;  1SQQ E;  3H1I E;  3H1L E;  1BE3 E;  4U3F E;  1PP9 E;  1EZV E;  4D6T E;  3CWB E;  1BCC E;  2A06 E;  1NTZ E;  2IBZ E;  1L0N E;  1BGY E;  3L71 E;  1NU1 E;  3CXH E;  3L75 E;  1PPJ E;  1P84 E;  3L73 E;  3BCC E;  5KLV E; 
#chains in the Genus database with same CATH topology
 3HUS B;  4OGQ C;  1NTK K;  2E5Y A;  3AEF C;  3TGU J;  1NTK J;  2QA4 P;  2Q6Q A;  1N8R Q;  4BRY B;  5C39 A;  1BCC G;  1L2P A;  2V7Q J;  2LXC B;  1AVY A;  1YHQ P;  3FWL A;  1IFN A;  3CC4 P;  4HJG H;  3G3Z A;  3JSV C;  1LNQ A;  5AVV B;  3HE5 B;  3P32 A;  2I8D A;  4IOI H;  1ZN5 A;  3KZI H;  3PH0 A;  4EI2 A;  1FAV A;  1PPJ G;  2VRS A;  1IC2 A;  1L0N K;  1RE3 C;  3BCC G;  1NOH A;  1N7L A;  1LT9 B;  3B71 A;  1PZQ A;  5APT A;  1NU1 K;  2QJP C;  2YKQ A;  2E75 B;  1J1D B;  3AEC C;  1ZRT D;  2N9Y B;  1HGZ A;  2AEM A;  1IFD A;  1SQX J;  3N7N A;  5KKZ B;  5M1B A;  1K9M Q;  4W7Y A;  3VOP A;  3A5T A;  1N7S C;  1M1J A;  1XTG B;  3S9O A;  1SQP J;  1L0N J;  1PL5 A;  1PPJ D;  3I5C A;  4WBA A;  1PPJ E;  1LJ2 A;  1SFC C;  3TNU A;  2I1K A;  3BCC E;  1JMM A;  1L4A D;  4OH8 B;  2FFD B;  3R4Y A;  3H1I G;  3RK2 D;  3V2Q A;  1GD2 E;  1RF0 C;  1CI6 B;  2FYU K;  3H1L D;  1SQP E;  1U7M A;  2YIU B;  2E75 D;  2YXR B;  3TGU D;  1A02 F;  2KUB A;  1VF5 C;  1L0N G;  2YKO A;  3L74 E;  2YMK A;  3L74 D;  3L75 D;  3TGU E;  1ZR2 A;  2QSI A;  1S2E A;  3V2N A;  1EXJ A;  1FOS E;  1NHL A;  1OWA A;  4WB4 A;  2FXP A;  5AW3 B;  3H25 A;  2LXB A;  1RY3 A;  3BVH A;  1VF5 B;  4U3F J;  3H1J J;  2YIU C;  2C9L Y;  4ZKU A;  1BE3 J;  5AW0 B;  5CCH C;  2NPS D;  3AE3 C;  4Z1M H;  1H0T A;  3CWB E;  2IDB A;  2HOD B;  1NTZ E;  1URQ A;  2E5T A;  3H1K J;  1KYO I;  2JDI H;  1LP1 A;  1LTI C;  1L0N E;  2IZ0 A;  1ZW0 A;  4AQR D;  3E1R A;  1K8A Q;  2KOG A;  1SFC B;  1L0L G;  1RF1 A;  4XFJ A;  3F89 A;  1KV4 A;  1YIT P;  1NJI Q;  1N7S B;  1LTG C;  1KB9 D;  3HUS A;  1LT1 A;  1KB9 E;  4OGQ D;  2BCC E;  3GG2 A;  5KKZ C;  4AUW A;  3AEB C;  2YXQ B;  2RN0 A;  2PGD A;  2FYU J;  1RF1 C;  3CWB G;  1J1D C;  2A06 G;  2E75 C;  1NTZ G;  1K73 Q;  2M5A A;  2PFX A;  1GK4 A;  2QJP B;  3JC2 2;  3OA7 A;  3CI9 A;  1LT9 C;  4XE5 B;  3L72 J;  4OWF A;  1SQB K;  5KAF E;  1FJK A;  2M0B A;  3AE9 C;  4D6T J;  1YJ9 P;  2YO3 A;  4KJM A;  1VQ5 P;  4K35 A;  1PGP A;  5CJ4 A;  1BE3 E;  1KQL A;  2W27 A;  2ZT9 D;  1SLQ A;  5AW5 B;  5AW8 B;  3V5B A;  3K5B A;  3WMM 0;  3SFE C;  3CCM P;  3OW2 O;  5GTI E;  4I2L C;  1BDD A;  2A06 E;  3H1J D;  2MKV A;  3HUS C;  4OGQ B;  3NMD A;  1L4A B;  1M1J B;  4MN4 C;  2RMZ A;  4LC1 A;  1J1E B;  1RQU A;  3A0B H;  3MGN A;  1FZA A;  3JCU H;  3CX5 D;  2IZ1 A;  1AFO A;  1G2C A;  2WPR A;  5APS A;  1URQ C;  1LTB C;  1GU4 A;  2WSF H;  1IJD B;  1FE6 A;  1GL2 D;  2CK3 H;  1SFC D;  1DD3 A;  2O01 H;  4GIF A;  4L74 A;  1KQF B;  5B66 H;  1JY2 O;  1T2K C;  2M8R A;  4JPZ B;  2IX7 C;  4IFM A;  2BCC J;  3WUT A;  3VP8 A;  1T8Z A;  2P67 A;  3WUV A;  3L71 G;  2L5G B;  4ZMD A;  3WUU A;  3FXD A;  2OQQ A;  1K05 A;  1MZ9 A;  1ZR4 A;  2M3E A;  3HTK B;  1NTK E;  2V7Q H;  4I7Z C;  4H44 D;  1HF9 A;  3JCU E;  4GT1 A;  2XU6 A;  5TIS E;  2FYN B;  3CCV P;  2KP8 A;  3D70 A;  3KYQ A;  3MUD A;  1VL2 A;  3AEE C;  3SWF A;  1AQT A;  1KB9 I;  3Q5R A;  3AE4 C;  3GW6 A;  3TK1 A;  3B5N B;  3RK2 B;  2N1T A;  1YYC A;  2O1J A;  2QE7 H;  4IFF A;  2KB7 P;  2NPS C;  2JR8 A;  4HKZ H;  1HJ0 A;  2KLU A;  2M3B A;  3A0H H;  3W68 A;  1DH3 A;  5CMZ A;  2FFD A;  1FU1 A;  1IZN B;  1FDI A;  2K37 A;  4RKU J;  1URQ D;  5CJ0 A;  1OIP A;  3FGA D;  3H1L G;  1QVF O;  2R3S A;  1USD A;  1GK6 A;  1JY3 N;  2KSE A;  4TLF A;  4DCK A;  2O01 N;  1L0L K;  2M5A B;  1FZG A;  3KXD A;  1JTH A;  3AE5 C;  2OYI A;  4WY4 C;  3CXH H;  1KIL E;  3L73 D;  3H32 B;  4JYB A;  3M0D C;  5KLV K;  2KS1 B;  3S1K A;  1GL2 A;  1S3J A;  2OYI C;  2QM8 A;  3IN6 A;  1BCC J;  2K1A A;  3H1I E;  5APY A;  3G9R A;  3L70 G;  1MFT A;  5APV A;  1GTW A;  1UIX A;  1ZP0 C;  1AJY A;  3TF5 A;  3NFQ A;  2IYO A;  4N78 D;  2IBZ D;  4R4M A;  2B87 A;  1L4A A;  1BSN A;  1PGJ A;  3L74 G;  4H13 B;  1Y47 A;  1QL1 A;  2WSF J;  3CX5 H;  1USE A;  2FFD C;  1IK7 A;  2R44 A;  3M91 A;  2AXT H;  5APU A;  4UB8 H;  1S5L E;  3CXH D;  2V4H A;  2E43 A;  3CC2 P;  2WTY A;  1PGQ A;  2FYU G;  2N1T C;  1JCC A;  2Q1K A;  2HG5 D;  2H43 A;  1BSH A;  1KYO E;  3L70 E;  1HGV A;  1JY2 N;  4H0L C;  2Q7C A;  4ZKP A;  2Y0C A;  1M7L A;  2WPS A;  1SQV D;  2P2U A;  3MUD C;  4L75 A;  2JP3 A;  1KMI Z;  4PD4 I;  1VF5 D;  2WSE J;  4Y99 C;  3H6P A;  1BGY G;  1PIX A;  3L36 A;  5AVT B;  1P84 H;  2K9J A;  1L0L E;  1E79 H;  1Y9B A;  2P10 A;  3L75 G;  4M3L A;  3VMX A;  1T2K D;  4IFD K;  3H1I J;  2LKM A;  4H44 C;  3RBZ A;  1QGK B;  2ZJS E;  2W83 C;  2FY8 A;  1KD1 Q;  2BCC G;  3EFF K;  1HTL C;  1KYO H;  3H1J G;  1EC5 A;  3L71 J;  5AW4 B;  5AVS B;  1OFC X;  1SQV G;  3PP5 A;  2P1J A;  3PLN A;  4HYT B;  4YTP C;  2Z4E A;  1SS1 A;  2YKP A;  1JO5 A;  1YQ3 C;  2CPS A;  1OZH A;  2OYH B;  1EQ7 A;  5CCG C;  1VQN P;  3VYI A;  1CSB A;  1FZC B;  1R5L A;  4GOE A;  1HH0 A;  2Y9Y A;  3CCR P;  1KQG B;  1RE4 A;  1M56 D;  1YJN P;  1K04 A;  4DT0 A;  1SQP K;  1JY3 P;  3OJA B;  3GF3 A;  1YBK A;  1BE3 G;  3AE2 C;  4PD4 E;  2BEZ F;  1BGY J;  1NO4 A;  3PHL A;  1EZV G;  2H89 C;  3WU2 H;  2OTJ P;  3RL0 D;  1YI2 P;  4QMA A;  1NU1 J;  3H1H E;  3H1K D;  3GMA A;  2HPC B;  2E76 B;  2E42 A;  1NKN A;  2QG4 A;  5H2F E;  1FDO A;  5CCH D;  3CCS P;  1IO4 A;  2Z5I A;  1NWQ A;  2ZYD A;  1VQ9 P;  2D2C D;  5KLV G;  1VQP P;  1FBM A;  2BAS A;  1GZL A;  1IFJ A;  5AVY B;  1S72 P;  2FXO A;  4PD4 H;  1EZV E;  1M90 Q;  1NKZ B;  1QVG O;  2Q3I A;  5KLI B;  4BXL A;  3L71 D;  3P8C E;  4PV1 B;  2JO1 A;  1E5W A;  3FX0 A;  1GMJ A;  1RE4 C;  2E74 C;  3L71 E;  1N2D C;  4WVZ A;  2W6A A;  2ZYA A;  3ABV C;  3TYY A;  1NTK G;  1WT6 A;  4W80 A;  3TNU B;  4AYC A;  1LWU B;  3EQ2 A;  3BCC D;  2WQY C;  5KLV E;  3M9B A;  3L37 A;  2YNY A;  2QIW A;  3MIW A;  5TJH A;  3CCU P;  3BRT B;  4RO0 A;  3I56 P;  1KIL C;  2K88 A;  2L91 A;  1SQB E;  1PP9 D;  2GA1 A;  4XA4 A;  5AW6 B;  2WT7 B;  2AEF A;  5EFW B;  1Z56 A;  1LTA C;  2OGU A;  1VQ8 P;  2ZAE B;  5BVZ A;  2K9J B;  2XNX A;  2Q5U A;  5AW7 B;  2POH A;  1SQB J;  3LID A;  3B8E B;  1KB9 H;  4YPC A;  3CCE P;  3VMA A;  3H1L E;  3AE1 C;  4LLH A;  4U3F E;  2ZT9 C;  2J59 M;  3CLQ A;  4U3F D;  1H0T B;  2WMM A;  5CHX A;  1YIJ P;  3E1I A;  1RF0 A;  5B66 E;  1KN7 A;  2QJK C;  1L0N D;  1LP1 B;  1X9V A;  1VQL P;  5KAF H;  5CBO A;  2OTL P;  1LTJ C;  3Q5S A;  1SFC A;  2KI7 B;  4NPD A;  1X22 A;  3GLM A;  3VMY A;  1JOC A;  3HD7 A;  5TIS H;  1FZB A;  1VQ6 P;  3R2P A;  2HYN A;  3M0A A;  5GTI H;  1KC8 Q;  3AE6 C;  2R32 A;  1XTC C;  3GHG C;  2H7H A;  3O6Q A;  1NGM B;  3EWK A;  3LIE A;  3RL0 C;  3KQG A;  2D2C B;  4WY4 D;  3C8V A;  1GL2 C;  1JEK A;  1GW3 A;  1CW5 A;  3CL3 D;  3M0D A;  2KNC A;  2FYZ A;  4WY4 A;  2FYU E;  4N3Y B;  4C7R A;  2O01 J;  1H8A A;  3EFG A;  2FBW C;  2J58 A;  2O3J A;  4IL6 E;  2N9B A;  1Y8A A;  1MKM A;  1NAY A;  3BAT A;  2R3C A;  2WSC H;  3GHG A;  2HFE D;  1KYO D;  1YTZ I;  2A06 D;  2G3A A;  3HRN A;  3L70 D;  3O8Z A;  4K3A A;  4WWI A;  4PJ0 E;  4YXW H;  1FZF A;  1OW7 A;  1R5S A;  3MTU E;  3MD0 A;  2GM4 A;  1IFM A;  3HD7 C;  1BGY E;  1S5L X;  1OVV A;  2CPB A;  1SQV J;  3L75 E;  4JQ0 D;  4B86 A;  2ZXX A;  1RH5 B;  3RK3 B;  1LTJ A;  3MZW B;  1OX3 A;  3CX5 I;  1L0L D;  1LWU A;  2PAJ A;  4I6M C;  5E79 H;  1SQQ G;  1ZXG A;  2Q3E A;  2JWD A;  5AW2 B;  1NTZ K;  3V2R A;  3G4S P;  3H1J E;  3UIA A;  1M8O B;  2FKW B;  3N4X A;  1Q90 D;  1SQV E;  1Q7Y Q;  4DOJ A;  1D7M A;  1NTM E;  1VQ4 P;  3T97 A;  3L72 E;  1X79 B;  3CWB D;  3VP9 A;  4UB6 E;  1H88 A;  3A3Y B;  2QJY C;  5KAI H;  1N73 B;  2QJY B;  3E7K A;  5AVR B;  3HTK A;  1N73 C;  2IFM A;  1LGH B;  1VQK P;  5KJ7 A;  2J5U A;  2Q9I A;  1SQQ E;  2R5D A;  3IF4 A;  1J2J B;  2JEE A;  2XKM A;  2C0X A;  1GW4 A;  1KIL A;  1OXZ A;  2C9N Y;  4HH2 A;  1NTM G;  3CME P;  1G1I A;  1RQV A;  3V2P A;  5AW9 B;  2B89 A;  2H88 C;  1S9K E;  1N73 A;  1NAF A;  2A45 G;  3H1H G;  4U7J A;  1Q2N A;  1VQM P;  1QL2 A;  3V4W A;  3RK3 C;  3CWB J;  4GOD A;  4UB6 H;  3CCL P;  1OMI A;  1AVO A;  2KLV A;  4H0L D;  5APW A;  3U1A A;  3B5N D;  1JB0 J;  2W8Z A;  2W6B A;  1AA0 A;  2N1T D;  2WSS H;  3HD7 B;  4ASV A;  1KTM A;  4GDO A;  1PP9 G;  3KHU A;  1Q82 Q;  1IFP A;  1DX7 A;  2BEQ D;  5AVZ B;  1EDK A;  2KZJ A;  2ITA A;  4BRY A;  1W2B O;  2KZI A;  1HWT C;  1NYH A;  1JTH B;  2IYP A;  2WVR A;  3FWN A;  3HE5 A;  1PV3 A;  1OW6 A;  4JBZ A;  3RGU A;  3G6E P;  1S5L H;  4BWN A;  3GF7 A;  1A02 J;  1ZME C;  2KS1 A;  2YO2 A;  1GL2 B;  1G1J A;  3A0H E;  2D2C C;  3PTZ A;  3L70 J;  3RL0 B;  2Y9Z A;  1GDT A;  1M1K Q;  2OAR A;  3H1I D;  3GHG B;  3LW5 J;  3G71 P;  1SQB G;  1EDI A;  3FXE A;  2B87 B;  3L4F A;  2IBZ E;  1SVF A;  2WPQ A;  5CCG D;  2Y0D A;  2GUS A;  3PRJ A;  1IFI A;  1LTJ B;  3CXH I;  1FOS F;  5KLV J;  3L73 J;  5CCG A;  1NTK D;  3LW5 H;  2QJK B;  1UII A;  2WZ7 A;  3BRV B;  4U3F G;  2JJL A;  1CI6 A;  2I1J A;  1SQB D;  2KSJ A;  3RK3 E;  4LGD E;  1QLE D;  5CCH A;  3Q2Y A;  2ZT9 B;  1GU5 A;  1BGY D;  3A2A A;  3T97 B;  3M06 A;  5DJU B;  3VTP C;  3W67 A;  1EDJ A;  3ZDM A;  2WIT A;  3V4Q A;  1JCD A;  3L73 G;  4UB8 E;  3Q3D A;  4GOF A;  1SQX D;  2AEJ A;  1AV1 A;  3IR9 A;  1HUC A;  1KIL B;  2H8P D;  2JKV A;  3KDP B;  4IL6 X;  5APX A;  1FZE A;  2ZFC A;  4C7N A;  4D6T D;  2QEX P;  4JYC A;  1JY2 P;  1PP9 J;  3V6I A;  2OYH A;  1LWU C;  3H1L J;  3L35 A;  1JNM A;  3A7O A;  1VDF A;  3RL0 g;  1H89 A;  2GUV A;  1P84 E;  1KIL D;  2B88 A;  2E74 B;  1SP4 A;  3L73 E;  2LR2 A;  3M9Q A;  3QWO C;  4PV1 C;  5AW1 B;  4EOT A;  1N7S A;  1RF1 B;  1NTM K;  5KLI C;  1T6A A;  2FYU D;  2PRR A;  3AED C;  4YXD C;  3CCJ P;  1BCC D;  1DEB A;  2B9B A;  2QM7 A;  4PD4 D;  3BCC J;  1JUN A;  3D71 A;  1CZQ A;  4N6J A;  1DD4 A;  2P58 A;  3L75 J;  2QRX A;  4TT3 H;  4EIJ A;  1BDC A;  1AQ5 A;  2Y0E A;  2Z5H A;  1NTZ J;  3H1K E;  3A0B E;  4I1L A;  5AVW B;  1RE3 A;  3TSI A;  3D6Z A;  1TU3 F;  2HPC A;  2KIK A;  3NXS A;  2E76 C;  5DJT B;  1OW8 A;  2WPV B;  3CPW O;  4EYY Q;  5L8R J;  1R8E A;  1DEE G;  3IFM A;  3HE4 A;  1MUU A;  3AEG C;  1T3J A;  4GKG A;  1SQX K;  2ZXE B;  2XND H;  3L74 J;  3H1H D;  4RES B;  2FXM A;  1QEX A;  3HD7 D;  3L72 G;  4KHX A;  2K9Y A;  1VQ7 P;  2UWJ E;  2WSC J;  1SQQ K;  2PP6 A;  1RHZ B;  1MFZ A;  2NPS A;  3CD6 P;  2KXP B;  4KT0 J;  2XDJ A;  3I55 P;  3Q1M A;  1G2C B;  1FZC C;  2OYH C;  3S4R A;  1PFI A;  4H13 D;  1WMK A;  1ZRT E;  3TDK A;  1JY3 O;  5KLV D;  2NRG A;  4IL6 H;  1OVR A;  3VN0 A;  1KFM A;  1NTM D;  1S4X A;  2WT7 A;  1FDM A;  1SQP D;  1LTT C;  3L72 D;  3P8C D;  3U1C A;  1WRG A;  1YTZ T;  4PJ0 H;  4W7Z A;  2OYO A;  4H44 B;  5KJ7 D;  1VQO P;  1S9K D;  1HBW A;  3CMA P;  5AVU B;  2QVA A;  1PGO A;  1IK9 A;  1P84 I;  3MHV A;  5APQ A;  1KFN A;  4Y99 B;  1PP9 E;  1U7J A;  4O9B A;  1S1C X;  4H0L B;  4ASW A;  1SQP G;  4C46 A;  4C7N B;  3P7K A;  4DZO A;  3B5N A;  3TGU G;  2N1T B;  1EZV I;  3KPE A;  1NH4 A;  1EXI A;  1DIP A;  2KYV A;  2JWA A;  2A45 H;  1NU1 E;  2XV5 A;  3H1H J;  1M57 D;  3AE8 C;  1NU1 D;  3RBX A;  1X8Y A;  3II6 A;  3F5H A;  2ZVO B;  4R4L A;  5BU8 B;  5KTB A;  4H13 C;  1SQV K;  1ZV8 A;  2A45 I;  2G8Y A;  2ZVN B;  2C0W A;  2P7J A;  3SSU A;  1X0T A;  3OAK A;  1NTZ D;  1MV8 A;  2W6J H;  4L73 A;  1FS0 E;  3O6Q B;  4PV1 D;  5K5G B;  1FJP A;  1HJB A;  4RJT A;  1Q86 Q;  4N78 E;  1HVV A;  2IBZ G;  1OVU A;  2OYI B;  4NPF X;  2AXT E;  3H32 A;  3IAO A;  1YJW P;  1NU1 G;  3Q5P A;  2HR3 A;  2WSE H;  2YMY A;  5GTH E;  2W90 A;  2KNC B;  3SFD C;  4WY4 B;  5E79 E;  4HB1 A;  4EDF A;  1LT9 A;  3D6Y A;  2MJZ A;  3C1L A;  1KQS O;  5B5E E;  3U59 A;  3HE4 B;  3USS A;  4NPE A;  2E76 D;  3SWY A;  4Y28 J;  5AVQ B;  1QX8 A;  2RKL A;  2KK7 A;  1JMB A;  1W5C E;  2SPZ A;  3SWK A;  3PJS K;  2RH0 A;  4DJG A;  2AXC A;  1LTS C;  4OVN F;  5KAI E;  1KOR A;  3CXH E;  5BU5 A;  2NPS B;  3B4S A;  3P8M C;  5GTH H;  1BE3 D;  1SQX G;  3AEA C;  3B5N C;  3RK2 C;  5CBN A;  2ZYG A;  1EZV D;  2E74 D;  1L0L J;  2NZ2 A;  3RK3 D;  3CCQ P;  1U57 A;  3MP7 B;  5B5E H;  1ZLL A;  1Q81 Q;  2WWW A;  2XZR A;  4D6T G;  2IPP A;  3VMZ A;  4L76 A;  2O1K A;  1N86 A;  1KZU B;  1NTM J;  2FYN C;  1JM0 A;  2OTK E;  5KJ7 C;  1VPC A;  3ITK A;  5AVX B;  4I7Z B;  3CX5 E;  4A7P A;  4CPG A;  4ZNC A;  2IBZ I;  1SQQ D;  4JF7 A;  1SQX E;  2R5B A;  1FC2 C;  2K3R A;  3WU2 E;  2DW3 A;  4D6T E;  2BCC D;  1BCC E;  2IFN A;  2HOD A;  1URQ B;  3M9H A;  3CC7 P;  3H1K G;  1N7S D;  1FZC A;  3KZI E;  1SQQ J;  1EDL A;  5H2F H;  1P84 D;  3NTN A;  1W2E A;  3BAS A;  1T3U A;  1YQ4 C;  1ZOY C;  1J1E C;  1NVO A;  3QH9 A;  3C9I A;  2HLO A;  3AE7 C;  1M1J C;  1L4A C; 
#chains in the Genus database with same CATH homology
 1KYO E;  3L70 E;  1KB9 E;  4PD4 E;  2BCC E;  3H1J E;  1SQP E;  1SQB E;  1SQV E;  1NTM E;  3L72 E;  3TGU E;  3H1K E;  3L74 E;  3H1H E;  3CX5 E;  1L0L E;  1NTK E;  2FYU E;  1SQX E;  1SQQ E;  3H1I E;  3H1L E;  1BE3 E;  4U3F E;  1PP9 E;  1EZV E;  4D6T E;  3CWB E;  1BCC E;  2A06 E;  1NTZ E;  2IBZ E;  1L0N E;  1BGY E;  3L71 E;  1NU1 E;  3CXH E;  3L75 E;  1PPJ E;  1P84 E;  3L73 E;  3BCC E;  5KLV E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...