1NH4A

Structure of the coat protein in fd filamentous bacteriophage particles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
44
structure length
44
Chain Sequence
PAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the coat protein in fd filamentous bacteriophage particles determined by solid-state NMR spectroscopy
pubmed doi rcsb
molecule tags Virus
molecule keywords Major coat protein
total genus 18
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nh4A00
1IFIA 1IFJA 1HH0A 1HGVA 1NH4A 2CPSA 1HGZA 2CPBA 1FDMA 2MJZA 2C0XA 1IFDA 2C0WA
chains in the Genus database with same CATH superfamily
3OJAB 1S9KE 2IYPA 2V7QH 3QH9A 4HYTB 2IBZI 3RK3D 3TF5A 1YJNP 2OYIA 1KB9E 1NU1G 5DJUB 3Q3DA 1FBMA 4A7PA 2E75D 2B87B 4XA4A 4EIJA 5AW6B 1HJBA 1GDTA 1KV4A 1RQVA 4N78D 3CXHI 1L4AA 1SQBG 1SQPK 2NPSC 5AW2B 1BE3E 2JO1A 1RY3A 2YKPA 1FZGA 1VQ7P 4PD4D 1Q81Q 3GMAA 1QLED 1FZCC 1BE3D 2FXOA 1FDOA 1JOCA 1N73A 1SQBJ 1H89A 3O8ZA 3B71A 3CC4P 3I5CA 1RE4C 2HODB 3IFMA 5TISH 3H1IJ 1YITP 2MJZA 1L0NG 1UIXA 1S4XA 1SQBD 2M5AA 3M0DA 4KHXA 2RKLA 3CXHD 5KLIC 3P8CD 4H44D 1VQ8P 1HVVA 2KP8A 4WVZA 2DW3A 2WQYC 1S9KD 1M1KQ 3H1HJ 3HUSA 5AVTB 1LT9B 3E1RA 3KXDA 2H7HA 1BGYD 3GG2A 3N4XA 3P32A 4AYCA 5APXA 3B5NA 2M0BA 1JMMA 3HD7B 3L37A 1QL2A 4XFJA 2KK7A 2JP3A 1RHZB 2NPSB 2KOGA 4WBAA 1T2KC 1N7SB 1X9VA 2WMMA 4AUWA 3M9HA 4KT0J 1JY3N 4PJ0H 1ZW0A 4JPZB 2E74D 2Y0EA 3H1IE 3L71G 3L74J 1KYOD 1X79B 4Z1MH 3L70E 2L5GB 3OW2O 2D2CD 3LIDA 1NU1J 1RF0A 4U3FE 3Q5SA 1YJWP 1NTMG 3B5NC 3MIWA 3D6YA 2YIUC 4OGQC 1K8AQ 3VMYA 2IBZG 2YNYA 1NU1D 1MFTA 1RE3C 2IYOA 1PIXA 1YJ9P 1LTJB 2QE7H 5GTIE 1RF1B 3MZWB 2POHA 3A3YB 1FZBA 5APTA 2FFDA 3GHGC 3USSA 1NOHA 3M0DC 4R4MA 4M3LA 1YBKA 3CCQP 1RE4A 3MTUE 1SQPG 1SQBK 1SQQE 3KPEA 4OWFA 1DD4A 2Z5IA 1URQA 4OVNF 3PH0A 1PGPA 1H88A 4EI2A 2Q9IA 5AW5B 2IBZD 2WSCJ 3B8EB 1P84D 1L0LJ 2GUSA 3H1KG 3WMM0 5B66E 2G3AA 2KNCB 1GU5A 3CD6P 4N78E 3H1ID 5KJ7D 4D6TE 2QM7A 4GOFA 3VTPC 1PP9E 2IPPA 3EFFK 1LJ2A 2QJYB 2J5UA 3BRVB 3O6QA 3V6IA 1BSHA 3FX0A 5KLIB 1GW4A 1KB9D 3G3ZA 1VQLP 1IO4A 1RF0C 1QVFO 1CW5A 1HF9A 3L75E 3AE5C 4ASVA 1L2PA 1SVFA 2JR8A 2LXCB 3ABVC 5KKZC 5KLVJ 2JWAA 3I56P 2W6AA 3AE6C 4IL6H 1LGHB 1SQQG 1SQPE 3HE5B 3R4YA 1L0LK 5BU5A 5AW1B 4YXDC 2BEQD 3W67A 2QA4P 1HTLC 2A06D 1EXJA 3M91A 4TT3H 5EFWB 3CCUP 2Z4EA 1AVOA 4W7YA 3K5BA 2WSCH 2ZVNB 2Y0DA 3CLQA 1YTZT 3H1HE 1OFCX 2FKWB 2WVRA 3N7NA 3TSIA 3WUUA 3Q2YA 1SQXG 3U1CA 2FY8A 3VN0A 3H1KE 1GL2A 1L0LG 4H13C 2QJKC 5APYA 2HG5D 3AECC 1J1EB 2P1JA 1VDFA 1OVVA 2QVAA 1CI6A 2R3SA 3EWKA 3L72G 1NTMK 3LW5H 4NPDA 2CPBA 3D71A 3V2NA 1YQ4C 2KZIA 1MFZA 4RKUJ 4U7JA 4UB6H 4EDFA 2ZJSE 4I2LC 3RBXA 3BCCJ 1FS0E 3TK1A 1ZLLA 1MZ9A 3A0HE 3CC7P 1LP1A 1LT9A 2BCCJ 3CL3D 1VQMP 2QSIA 1HH0A 2E76D 2FYZA 3BCCD 4W7ZA 5H2FH 4IL6X 3KHUA 3PHLA 3V5BA 2VRSA 1VF5D 1OW6A 2BCCD 1Y8AA 1OX3A 2NPSA 2XNDH 1NYHA 2B9BA 3AEGC 3L72E 4I7ZC 5KAIH 1DEBA 1USDA 2QEXP 1MKMA 3IN6A 3AEAC 2W6JH 5KAIE 3HTKA 3HE4A 5AW0B 3H1HD 1R8EA 3L71J 2P10A 2PGDA 3AE8C 3M06A 3RK2B 4IFFA 2WSEJ 3Q1MA 1NU1E 2CPSA 2A45I 4U3FJ 4PD4H 2JDIH 5KLVD 4CPGA 3OAKA 1JCCA 2KSJA 1LTJA 3CCLP 1SFCA 3A0HH 1OW8A 2KUBA 3T97B 1GZLA 2E74C 2WZ7A 2SPZA 3L75G 1DIPA 3P8CE 3LIEA 1L0NE 1BGYE 1QL1A 5CCHA 3H6PA 1Q90D 3M0AA 3CXHH 2ZYGA 5TJHA 1GD2E 4H13D 1LTTC 2K1AA 3MUDC 5APVA 3JC22 4ZKPA 1GL2C 1FAVA 1S1CX 1LP1B 3FXDA 5CBNA 1VQKP 1HBWA 1NTZJ 4C46A 2A06G 1A02F 1YYCA 1H0TA 1KQFB 1IFIA 1VQOP 1EDKA 2BEZF 3FGAD 3CCVP 1EC5A 2LR2A 4N6JA 1FOSF 4NPEA 2P58A 1NAYA 5B5EH 1NKNA 2A45G 3R2PA 2M8RA 3NTNA 1BDDA 4PD4I 1S5LE 5M1BA 2N1TB 2XV5A 3HTKB 4WY4C 3HE4B 3RK3B 3G6EP 4GIFA 1FZEA 1W2EA 4H0LC 1PGOA 5C39A 3L4FA 3RL0C 1KZUB 1PPJD 2N9YB 2WSFH 1M1JA 1X22A 3BATA 2E5YA 1FDIA 2YKOA 4I1LA 4LC1A 5CHXA 1JY2N 5AW7B 2E42A 2N9BA 3VMZA 1KC8Q 4JQ0D 3MD0A 3U1AA 1S5LX 1G2CB 4C7NB 2BCCG 2C0XA 2LKMA 2JWDA 3L35A 3KYQA 3TNUB 3MHVA 3BCCG 3AE9C 5CJ4A 2Q3EA 3IF4A 4B86A 1KORA 4NPFX 1SS1A 1Z56A 4EYYQ 2ITAA 1ZRTD 2M3BA 1SQVD 3L74D 4TLFA 4PV1D 2QIWA 3RK2D 1AQTA 1FJKA 1IFJA 1LWUA 1ZN5A 2FYNB 1FZAA 1G1JA 2K9YA 1ZRTE 2KS1B 2OYOA 2P2UA 3H1JG 4YPCA 1OVUA 1GK6A 1WT6A 2AEMA 1KD1Q 2AXCA 1X8YA 1P84H 1URQD 4H44B 5AVVB 1RQUA 1PGQA 2OYHA 3RGUA 4D6TJ 1EZVD 2H88C 2ZXXA 1YQ3C 1FE6A 3BCCE 3L75D 3PP5A 4L73A 5GTIH 1IFNA 3AE1C 3AEBC 2FFDC 3RL0D 1KQLA 2K9JB 1LTBC 3H1LD 3C8VA 1KB9H 3H1IG 1L0NK 3L71E 1IJDB 3VP8A 4PD4E 3L74G 1BCCD 1SP4A 3TGUG 4C7RA 1YI2P 2OYIC 1KILE 1NTZD 1PL5A 2O1KA 4PJ0E 5KKZB 3JCUH 2C9LY 2E74B 5KAFH 4BRYA 5AW9B 1KILD 1NTZE 2D2CC 1BCCJ 2R5BA 3CWBD 3PLNA 2QJYC 3TYYA 4GKGA 4U3FG 1NGMB 2GM4A 2Y9YA 1IC2A 1HJ0A 1AVYA 1KILA 2E75B 4H0LD 2FBWC 2W6BA 3L70G 2WPQA 5GTHE 5BVZA 2XKMA 1BSNA 3RK2C 3LW5J 1HGVA 3W68A 1DX7A 2RMZA 4KJMA 1VF5B 5B66H 5AW8B 5KJ7C 3A0BE 2H43A 1AA0A 1JY2P 3NFQA 4WY4A 2NZ2A 1L0ND 2XZRA 2H8PD 3CCRP 2FXMA 4HH2A 2FYUK 3TDKA 3NMDA 3ZDMA 3KZIH 2O3JA 1SQVE 1U7MA 2KZJA 3AE4C 2OYHB 1RF1C 3WU2H 3SSUA 1AQ5A 1ZV8A 2QG4A 3UIAA 1OW7A 3IR9A 1LTGC 1OMIA 2YIUB 5CJ0A 4L75A 5AVRB 1JO5A 3G9RA 3VP9A 1K05A 1SQXK 1XTCC 3HD7A 3S1KA 3F5HA 2QJPB 1FJPA 3L72J 1VQ4P 2ZT9C 3CXHE 3GF3A 1NTMJ 4OGQD 3C9IA 2HPCB 1PV3A 1SFCD 1LWUC 4BRYB 1ZR4A 2KSEA 1PPJE 1BCCE 1SFCC 3F89A 3GLMA 3L75J 4O9BA 2V4HA 1NTMD 1N7SC 4HKZH 4H13B 1EXIA 1LTAC 1J1DB 1KQGB 3AE2C 1DH3A 1BE3G 2AXTE 1LNQA 1M1JB 1M57D 1KTMA 2OARA 1JNMA 2ZFCA 1BCCG 3TGUD 3II6A 3SFEC 1GU4A 4IFMA 5KLVG 2OTJP 1DEEG 2H89C 3CWBJ 4RESB 5AVQB 1CI6B 1M8OB 2E76C 3L74E 1SLQA 3TGUE 1TU3F 3S4RA 4JBZA 5H2FE 1BGYG 1JUNA 2R3CA 3AEFC 3AEEC 1NJIQ 2OQQA 2YXRB 2PRRA 1IFPA 3B5ND 3U59A 1E5WA 5CCGA 3G4SP 5K5GB 1NTKK 3CWBG 3FXEA 4DJGA 4UB6E 3CPWO 4U3FD 2HYNA 1JY3O 2ZAEB 2FYUD 3BASA 1CZQA 2FXPA 1U57A 1J1DC 2HR3A 1EDIA 2Q5UA 1SQPJ 2Z5HA 5AVYB 3PJSK 3MUDA 1X0TA 1SQVJ 1ZP0C 2PP6A 1KFNA 1Y47A 5CCHD 5KLVE 1SQVK 3ITKA 2B87A 1CSBA 4K3AA 1PP9J 5APWA 3VOPA 2OTKE 1K04A 1IZNB 2WTYA 2QJPC 3RBZA 3GHGB 3JSVC 3WUTA 4ASWA 3L73E 1PP9D 2R5DA 1EDLA 5AVUB 4BWNA 1VPCA 1T6AA 4N3YB 1SQXE 5KLVK 1ZXGA 4OH8B 3H1LJ 4OGQB 1Q86Q 1EQ7A 1OZHA 2AEJA 2RN0A 3KQGA 2HODA 1VQPP 1Q82Q 1JTHA 2J58A 4ZKUA 1SQQJ 1NTZK 1OVRA 2M5AB 2WPVB 2KLVA 2IZ1A 2IFNA 1NTKE 3TGUJ 1A02J 2BCCE 1K73Q 2YMKA 1VF5C 3A7OA 2KLUA 1MV8A 2OGUA 3A2AA 2A06E 2MKVA 2HFED 2YMYA 3HD7C 3H1JE 1KFMA 4WB4A 1SQXJ 2E75C 4HB1A 1FZFA 1LT9C 2WPRA 3L70J 4GODA 3BVHA 3SWYA 3EFGA 3H1KD 1OXZA 2D2CB 4IOIH 4D6TD 3KZIE 2XU6A 5AVXB 1XTGB 2R32A 2WWWA 3CMEP 1GL2D 3CX5H 2PFXA 1KB9I 4DCKA 2OYIB 4WY4D 2Y9ZA 1MUUA 2E76B 2JKVA 2N1TD 1Q7YQ 1JY2O 2FYUJ 3E7KA 3FWNA 2HLOA 2CK3H 4GDOA 3V2QA 1RE3A 1KQSO 1Q2NA 3FWLA 1FZCB 5KJ7A 1GMJA 2E43A 2W90A 1G2CA 4GOEA 1NTZG 3PTZA 1FC2C 1M1JC 4H44C 1QVGO 2K37A 1LTSC 1R5LA 3MP7B 1JTHB 1UIIA 1OIPA 2FYNC 2ZVOB 3L73G 5AW4B 5CCGC 3RL0g 2Q3IA 1GK4A 1IK9A 1SFCB 2P67A 1E79H 2WT7A 3CMAP 1LWUB 2GA1A 3D6ZA 2ZYAA 2AEFA 2KS1A 2YKQA 3M9QA 4JF7A 4IL6E 2A45H 4YTPC 1NAFA 1M7LA 2ZT9B 3A0BH 1WRGA 3V4QA 1T2KD 3CCMP 3KDPB 1RH5B 3E1IA 3CC2P 3Q5PA 5GTHH 1L4AD 3L36A 2V7QJ 3HD7D 4UB8H 1VL2A 2O1JA 3O6QB 1U7JA 1BE3J 2K9JA 4JYCA 3V4WA 2Q1KA 2OYHC 4R4LA 3WU2E 1NTME 1S5LH 4C7NA 3CCSP 3RL0B 1FDMA 1N7SA 4RO0A 1L0NJ 1URQC 3RK3C 1N73C 3HE5A 3D70A 1N8RQ 3L73D 5E79E 3BRTB 1FZCA 3VMXA 3WUVA 2LXBA 1JB0J 1PPJG 1J2JB 3V2RA 4DT0A 1KILB 1GW3A 3AE7C 3AEDC 2C9NY 1BDCA 5CCGD 5CBOA 3EQ2A 4PV1C 2O01N 1K9MQ 2BASA 3P8MC 1AV1A 1L4AC 1GL2B 4MN4C 3PRJA 2WT7B 1RF1A 2I1JA 1HUCA 1NO4A 1USEA 2C0WA 3L72D 4Y99C 3TNUA 2FFDB 2KIKA 1NTKD 2Y0CA 1JCDA 3OA7A 5DJTB 1OWAA 4YXWH 2AXTH 1IFDA 1M56D 1VQ6P 2OTLP 1NTKJ 2ZXEB 4IFDK 3H1JD 4D6TG 3MGNA 4PV1B 3IAOA 1QX8A 1M90Q 5AVSB 1YIJP 2KNCA 1KILC 1SQQD 2KYVA 5AVWB 3HUSC 1IFMA 2HPCA 2J59M 1JM0A 1P84E 1SQBE 2ZT9D 4L76A 4LGDE 3A5TA 2XDJA 5APSA 1KYOH 5CCHC 1P84I 1ZMEC 1LTIC 2E5TA 1NU1K 3SFDC 1IK7A 1JMBA 1KYOI 2IFMA 1H8AA 1KN7A 1PFIA 1SQXD 1GTWA 5E79H 1S72P 1L0LD 1PGJA 2NRGA 1T3JA 2G8YA 2JEEA 2L91A 1N2DC 2M3EA 2RH0A 3HRNA 3L70D 4K35A 1DD3A 2IDBA 5CMZA 5L8RJ 1W2BO 3H1KJ 3H1HG 3CX5I 2WPSA 5APQA 3V2PA 2KXPB 3VYIA 3VMAA 3G71P 4W80A 3H25A 2JJLA 1EZVE 1S3JA 2W83C 3AE3C 3CCJP 5AW3B 2B89A 1SQPD 2O01H 4QMAA 4EOTA 2IX7C 4H0LB 3NXSA 1SQVG 4L74A 3H32B 4WY4B 1J1EC 2N1TC 5AVZB 3CCEP 1NVOA 1WMKA 1ZR2A 1D7MA 2W8ZA 1NWQA 1QEXA 1T3UA 2FYUE 1NHLA 2QJKB 3P7KA 3HUSB 2WSSH 1EZVI 3GW6A 2YXQB 3H1LG 5KAFE 1KMIZ 1YHQP 3I55P 2I1KA 2IZ0A 3CWBE 1FOSE 1HWTC 1NTKG 3SWFA 1S2EA 1EZVG 4AQRD 2W27A 1R5SA 4ZNCA 2B88A 2K88A 2I8DA 3GF7A 2PAJA 4Y28J 2N1TA 2WSEH 3SWKA 3H1JJ 1G1IA 5BU8B 1L0LE 1NH4A 3CX5D 1HGZA 2WITA 2FYUG 3B4SA 2O01J 2KI7B 3GHGA 2IBZE 2QM8A 3QWOC 4JYBA 2KB7P 4Y99B 4BXLA 4RJTA 3Q5RA 2YO3A 4I6MC 3C1LA 5TISE 3RK3E 1AJYA 3CX5E 4ZMDA 1L4AB 4DZOA 2YO2A 1VQ5P 2XNXA 1JEKA 5KTBA 4HJGH 2QRXA 1EDJA 1T8ZA 1KYOE 2Q6QA 2R44A 3H1LE 2UWJE 1PZQA 3H32A 1BGYJ 1AFOA 1N73B 3CI9A 3T97A 1URQB 3L73J 2NPSD 1PP9G 4DOJA 1N7SD 1YTZI 4I7ZB 1FU1A 1SQQK 3L71D 4LLHA 4WWIA 2Q7CA 1VQ9P 1QGKB 1N7LA 4UB8E 1N86A 4XE5B 1LTJC 2ZYDA 1W5CE 3S9OA 1JY3P 1NKZB 2GUVA 2K3RA 1VQNP 3M9BA 4GT1A 1LT1A 1H0TB 1ZOYC 2WSFJ 3JCUE 3B5NB 5B5EE 1Y9BA 2P7JA 5APUA
chains in the Genus database with same CATH topology
3OJAB 1S9KE 4HYTB 3RK3D 2OYIA 1FBMA 4XA4A 4EIJA 1GDTA 5AW6B 1HJBA 4N78D 1L4AA 1SQPK 2NPSC 5AW2B 1FZGA 1RY3A 2YKPA 1FZCC 1JOCA 1N73A 1H89A 3O8ZA 3I5CA 1RE4C 2HODB 3IFMA 2MJZA 3M0DA 4KHXA 3P8CD 1HVVA 2KP8A 1S9KD 3HUSA 5AVTB 1LT9B 3N4XA 3P32A 4AYCA 5APXA 3B5NA 1JMMA 3HD7B 3L37A 1QL2A 4WBAA 2NPSB 2KOGA 1T2KC 1N7SB 1X9VA 4AUWA 3M9HA 1JY3N 1JO5A 1X79B 2L5GB 3LIDA 1RF0A 3B5NC 3MIWA 3VMYA 2YNYA 1RE3C 1RF1B 1LTJB 2POHA 3A3YB 1FZBA 5APTA 2FFDA 3GHGC 1NOHA 3M0DC 4M3LA 1RE4A 3MTUE 1SQBK 3KPEA 2Z5IA 1URQA 1H88A 2Q9IA 5AW5B 3B8EB 2GUSA 3WMM0 1GU5A 4N78E 5KJ7D 2QM7A 3VTPC 2IPPA 1DX7A 3BRVB 1GW4A 3G3ZA 1IO4A 1RF0C 1CW5A 1SVFA 2W6AA 1LGHB 3HE5B 1L0LK 5BU5A 5AW1B 1HTLC 3M91A 2Z4EA 4W7YA 1A02F 2WSCH 3CLQA 1YTZT 3N7NA 3TSIA 2FKWB 3U1CA 3VN0A 1GL2A 5APYA 2HG5D 1J1EB 2P1JA 1VDFA 3LW5H 1CI6A 1NTMK 2CPBA 3V2NA 1MFZA 4I2LC 3TK1A 1ZLLA 1MZ9A 1LT9A 3CL3D 1HH0A 2FYZA 4W7ZA 3V5BA 2VRSA 2H7HA 2NPSA 1DEBA 3HTKA 3HE4A 5AW0B 3M06A 3RK2B 4IFFA 2CPSA 2A45I 3OAKA 1JCCA 2KSJA 1LTJA 1SFCA 1GZLA 2WZ7A 3P8CE 3LIEA 1QL1A 5CCHA 3H6PA 3M0AA 1GD2E 1LTTC 5APVA 4ZKPA 1GL2C 1FAVA 1HBWA 4C46A 1YYCA 1IFIA 4N6JA 1FOSF 1NKNA 2A45G 3R2PA 2M8RA 3NTNA 3RK3B 2N1TB 2XV5A 3HTKB 4WY4C 3HE4B 4GIFA 1FZEA 1W2EA 3RL0C 3L4FA 1KZUB 2WSFH 1M1JA 3BATA 2YKOA 4LC1A 5CHXA 4I1LA 2E42A 1JY2N 5AW7B 2N9BA 3VMZA 3MD0A 3U1AA 1G2CB 2C0XA 2LKMA 3L35A 3KYQA 3TNUB 5CJ4A 4B86A 1Z56A 2M3BA 3RK2D 1IFJA 1FJKA 1LWUA 1ZN5A 2P2UA 2WTYA 1FZAA 1G1JA 1WT6A 1GK6A 1X8YA 5AVVB 1URQD 2OYHA 3PP5A 1IFNA 3RL0D 1KQLA 1LTBC 1L0NK 1IJDB 3VP8A 1SP4A 4C7RA 2OYIC 2C9LY 2O1KA 5AW9B 1KILD 2R5BA 3TYYA 4GKGA 2GM4A 1IC2A 1KILA 2W6BA 2WPQA 5BVZA 2XKMA 3RK2C 1HGVA 5KJ7C 5AW8B 2H43A 3NFQA 1JY2P 4WY4A 2XZRA 2H8PD 2FXMA 4HH2A 2FYUK 3NMDA 2OYHB 1RF1C 1AQ5A 1ZV8A 3UIAA 3IR9A 1LTGC 5AVRB 5CJ0A 3VP9A 1SQXK 1XTCC 3HD7A 1FJPA 3C9IA 2HPCB 1SFCD 1LWUC 1ZR4A 1SFCC 4O9BA 1N7SC 1LTAC 1J1DB 1DH3A 1M1JB 2OARA 1JNMA 2ZFCA 3II6A 1GU4A 4IFMA 5AVQB 4RESB 1CI6B 1SLQA 1JUNA 2R3CA 3U59A 3B5ND 1E5WA 5CCGA 1NTKK 2HYNA 1JY3O 3BASA 1CZQA 2Q5UA 2Z5HA 1J1DC 5AVYB 4C7NB 3MUDA 2PP6A 1KFNA 5CCHD 1SQVK 1CSBA 5APWA 3VOPA 3GHGB 2R5DA 5AVUB 1VPCA 4N3YB 5KLVK 4OH8B 1EQ7A 3KQGA 2HODA 1JTHA 2J58A 4ZKUA 1NTZK 2KLVA 2IFNA 1A02J 3A7OA 1MV8A 3A2AA 3HD7C 2HFED 2YMYA 1KFMA 4WB4A 1FZFA 1LT9C 2WPRA 3BVHA 3SWYA 3EFGA 1OXZA 5AVXB 2XU6A 1XTGB 2R32A 2WWWA 1GL2D 2OYIB 4WY4D 1MUUA 2N1TD 1JY2O 2HLOA 3V2QA 1RE3A 2E43A 1FZCB 5KJ7A 1G2CA 1M1JC 1LTSC 1JTHB 5CCGC 5AW4B 2WT7A 2Q3IA 1GK4A 1IK9A 1SFCB 2P67A 1LWUB 3M9QA 2YKQA 4JF7A 2A45H 1NAFA 1M7LA 1T2KD 3V4QA 1WRGA 3KDPB 3E1IA 1L4AD 3L36A 3HD7D 2O1JA 4JYCA 3V4WA 2OYHC 4C7NA 3RL0B 1FDMA 1N7SA 1URQC 3RK3C 1N73C 3HE5A 3BRTB 1FZCA 3VMXA 3V2RA 2C9NY 1J2JB 1KILB 1GW3A 5CCGD 3EQ2A 2BASA 3P8MC 1L4AC 1GL2B 2WT7B 1RF1A 2I1JA 1HUCA 1NO4A 2C0WA 4Y99C 3TNUA 2FFDB 1JCDA 3OA7A 1OWAA 1IFDA 2ZXEB 4IFDK 3MGNA 5AVSB 1KILC 2KYVA 5AVWB 3HUSC 1IFMA 2HPCA 2J59M 4LGDE 3A5TA 2XDJA 5APSA 5CCHC 1LTIC 1NU1K 2IFMA 1H8AA 1PFIA 1GTWA 1T3JA 2JEEA 3HRNA 1N2DC 5CMZA 2WPSA 5APQA 3V2PA 3VYIA 4W80A 2JJLA 5AW3B 2O01H 4EOTA 2IX7C 3NXSA 3H32B 4WY4B 1J1EC 2N1TC 5AVZB 1NWQA 1ZR2A 1T3UA 1NHLA 3P7KA 3HUSB 2I1KA 1FOSE 1HWTC 3SWFA 4AQRD 2W27A 2PAJA 2N1TA 2WSEH 1G1IA 5BU8B 1NH4A 1HGZA 2WITA 3GHGA 2QM8A 4JYBA 2FFDC 2KB7P 4Y99B 2YO3A 4I6MC 1L4AB 4DZOA 2YO2A 2XNXA 5KTBA 1T8ZA 3H32A 1AFOA 1N73B 3CI9A 3T97A 1URQB 2NPSD 4DOJA 1N7SD 1YTZI 4LLHA 1FU1A 1SQQK 2Q7CA 1N7LA 1N86A 4XE5B 1LTJC 1JY3P 1NKZB 2GUVA 3M9BA 4GT1A 3B5NB 2P7JA 5APUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFI A;  1IFJ A;  1HH0 A;  1HGV A;  1NH4 A;  2CPS A;  1HGZ A;  2CPB A;  1FDM A;  2MJZ A;  2C0X A;  1IFD A;  2C0W A; 
#chains in the Genus database with same CATH topology
 3OJA B;  1S9K E;  2IYP A;  2V7Q H;  3QH9 A;  4HYT B;  2IBZ I;  3RK3 D;  3TF5 A;  1YJN P;  2OYI A;  1KB9 E;  1NU1 G;  5DJU B;  3Q3D A;  1FBM A;  4A7P A;  2E75 D;  2B87 B;  4XA4 A;  4EIJ A;  5AW6 B;  1HJB A;  1GDT A;  1KV4 A;  1RQV A;  4N78 D;  3CXH I;  1L4A A;  1SQB G;  1SQP K;  2NPS C;  5AW2 B;  1BE3 E;  2JO1 A;  1RY3 A;  2YKP A;  1FZG A;  1VQ7 P;  4PD4 D;  1Q81 Q;  3GMA A;  1QLE D;  1FZC C;  1BE3 D;  2FXO A;  1FDO A;  1JOC A;  1N73 A;  1SQB J;  1H89 A;  3O8Z A;  3B71 A;  3CC4 P;  3I5C A;  1RE4 C;  2HOD B;  3IFM A;  5TIS H;  3H1I J;  1YIT P;  2MJZ A;  1L0N G;  1UIX A;  1S4X A;  1SQB D;  2M5A A;  3M0D A;  4KHX A;  2RKL A;  3CXH D;  5KLI C;  3P8C D;  4H44 D;  1VQ8 P;  1HVV A;  2KP8 A;  4WVZ A;  2DW3 A;  2WQY C;  1S9K D;  1M1K Q;  3H1H J;  3HUS A;  5AVT B;  1LT9 B;  3E1R A;  3KXD A;  2H7H A;  1BGY D;  3GG2 A;  3N4X A;  3P32 A;  4AYC A;  5APX A;  3B5N A;  2M0B A;  1JMM A;  3HD7 B;  3L37 A;  1QL2 A;  4XFJ A;  2KK7 A;  2JP3 A;  1RHZ B;  2NPS B;  2KOG A;  4WBA A;  1T2K C;  1N7S B;  1X9V A;  2WMM A;  4AUW A;  3M9H A;  4KT0 J;  1JY3 N;  4PJ0 H;  1ZW0 A;  4JPZ B;  2E74 D;  2Y0E A;  3H1I E;  3L71 G;  3L74 J;  1KYO D;  1X79 B;  4Z1M H;  3L70 E;  2L5G B;  3OW2 O;  2D2C D;  3LID A;  1NU1 J;  1RF0 A;  4U3F E;  3Q5S A;  1YJW P;  1NTM G;  3B5N C;  3MIW A;  3D6Y A;  2YIU C;  4OGQ C;  1K8A Q;  3VMY A;  2IBZ G;  2YNY A;  1NU1 D;  1MFT A;  1RE3 C;  2IYO A;  1PIX A;  1YJ9 P;  1LTJ B;  2QE7 H;  5GTI E;  1RF1 B;  3MZW B;  2POH A;  3A3Y B;  1FZB A;  5APT A;  2FFD A;  3GHG C;  3USS A;  1NOH A;  3M0D C;  4R4M A;  4M3L A;  1YBK A;  3CCQ P;  1RE4 A;  3MTU E;  1SQP G;  1SQB K;  1SQQ E;  3KPE A;  4OWF A;  1DD4 A;  2Z5I A;  1URQ A;  4OVN F;  3PH0 A;  1PGP A;  1H88 A;  4EI2 A;  2Q9I A;  5AW5 B;  2IBZ D;  2WSC J;  3B8E B;  1P84 D;  1L0L J;  2GUS A;  3H1K G;  3WMM 0;  5B66 E;  2G3A A;  2KNC B;  1GU5 A;  3CD6 P;  4N78 E;  3H1I D;  5KJ7 D;  4D6T E;  2QM7 A;  4GOF A;  3VTP C;  1PP9 E;  2IPP A;  3EFF K;  1LJ2 A;  2QJY B;  2J5U A;  3BRV B;  3O6Q A;  3V6I A;  1BSH A;  3FX0 A;  5KLI B;  1GW4 A;  1KB9 D;  3G3Z A;  1VQL P;  1IO4 A;  1RF0 C;  1QVF O;  1CW5 A;  1HF9 A;  3L75 E;  3AE5 C;  4ASV A;  1L2P A;  1SVF A;  2JR8 A;  2LXC B;  3ABV C;  5KKZ C;  5KLV J;  2JWA A;  3I56 P;  2W6A A;  3AE6 C;  4IL6 H;  1LGH B;  1SQQ G;  1SQP E;  3HE5 B;  3R4Y A;  1L0L K;  5BU5 A;  5AW1 B;  4YXD C;  2BEQ D;  3W67 A;  2QA4 P;  1HTL C;  2A06 D;  1EXJ A;  3M91 A;  4TT3 H;  5EFW B;  3CCU P;  2Z4E A;  1AVO A;  4W7Y A;  3K5B A;  2WSC H;  2ZVN B;  2Y0D A;  3CLQ A;  1YTZ T;  3H1H E;  1OFC X;  2FKW B;  2WVR A;  3N7N A;  3TSI A;  3WUU A;  3Q2Y A;  1SQX G;  3U1C A;  2FY8 A;  3VN0 A;  3H1K E;  1GL2 A;  1L0L G;  4H13 C;  2QJK C;  5APY A;  2HG5 D;  3AEC C;  1J1E B;  2P1J A;  1VDF A;  1OVV A;  2QVA A;  1CI6 A;  2R3S A;  3EWK A;  3L72 G;  1NTM K;  3LW5 H;  4NPD A;  2CPB A;  3D71 A;  3V2N A;  1YQ4 C;  2KZI A;  1MFZ A;  4RKU J;  4U7J A;  4UB6 H;  4EDF A;  2ZJS E;  4I2L C;  3RBX A;  3BCC J;  1FS0 E;  3TK1 A;  1ZLL A;  1MZ9 A;  3A0H E;  3CC7 P;  1LP1 A;  1LT9 A;  2BCC J;  3CL3 D;  1VQM P;  2QSI A;  1HH0 A;  2E76 D;  2FYZ A;  3BCC D;  4W7Z A;  5H2F H;  4IL6 X;  3KHU A;  3PHL A;  3V5B A;  2VRS A;  1VF5 D;  1OW6 A;  2BCC D;  1Y8A A;  1OX3 A;  2NPS A;  2XND H;  1NYH A;  2B9B A;  3AEG C;  3L72 E;  4I7Z C;  5KAI H;  1DEB A;  1USD A;  2QEX P;  1MKM A;  3IN6 A;  3AEA C;  2W6J H;  5KAI E;  3HTK A;  3HE4 A;  5AW0 B;  3H1H D;  1R8E A;  3L71 J;  2P10 A;  2PGD A;  3AE8 C;  3M06 A;  3RK2 B;  4IFF A;  2WSE J;  3Q1M A;  1NU1 E;  2CPS A;  2A45 I;  4U3F J;  4PD4 H;  2JDI H;  5KLV D;  4CPG A;  3OAK A;  1JCC A;  2KSJ A;  1LTJ A;  3CCL P;  1SFC A;  3A0H H;  1OW8 A;  2KUB A;  3T97 B;  1GZL A;  2E74 C;  2WZ7 A;  2SPZ A;  3L75 G;  1DIP A;  3P8C E;  3LIE A;  1L0N E;  1BGY E;  1QL1 A;  5CCH A;  3H6P A;  1Q90 D;  3M0A A;  3CXH H;  2ZYG A;  5TJH A;  1GD2 E;  4H13 D;  1LTT C;  2K1A A;  3MUD C;  5APV A;  3JC2 2;  4ZKP A;  1GL2 C;  1FAV A;  1S1C X;  1LP1 B;  3FXD A;  5CBN A;  1VQK P;  1HBW A;  1NTZ J;  4C46 A;  2A06 G;  1A02 F;  1YYC A;  1H0T A;  1KQF B;  1IFI A;  1VQO P;  1EDK A;  2BEZ F;  3FGA D;  3CCV P;  1EC5 A;  2LR2 A;  4N6J A;  1FOS F;  4NPE A;  2P58 A;  1NAY A;  5B5E H;  1NKN A;  2A45 G;  3R2P A;  2M8R A;  3NTN A;  1BDD A;  4PD4 I;  1S5L E;  5M1B A;  2N1T B;  2XV5 A;  3HTK B;  4WY4 C;  3HE4 B;  3RK3 B;  3G6E P;  4GIF A;  1FZE A;  1W2E A;  4H0L C;  1PGO A;  5C39 A;  3L4F A;  3RL0 C;  1KZU B;  1PPJ D;  2N9Y B;  2WSF H;  1M1J A;  1X22 A;  3BAT A;  2E5Y A;  1FDI A;  2YKO A;  4I1L A;  4LC1 A;  5CHX A;  1JY2 N;  5AW7 B;  2E42 A;  2N9B A;  3VMZ A;  1KC8 Q;  4JQ0 D;  3MD0 A;  3U1A A;  1S5L X;  1G2C B;  4C7N B;  2BCC G;  2C0X A;  2LKM A;  2JWD A;  3L35 A;  3KYQ A;  3TNU B;  3MHV A;  3BCC G;  3AE9 C;  5CJ4 A;  2Q3E A;  3IF4 A;  4B86 A;  1KOR A;  4NPF X;  1SS1 A;  1Z56 A;  4EYY Q;  2ITA A;  1ZRT D;  2M3B A;  1SQV D;  3L74 D;  4TLF A;  4PV1 D;  2QIW A;  3RK2 D;  1AQT A;  1FJK A;  1IFJ A;  1LWU A;  1ZN5 A;  2FYN B;  1FZA A;  1G1J A;  2K9Y A;  1ZRT E;  2KS1 B;  2OYO A;  2P2U A;  3H1J G;  4YPC A;  1OVU A;  1GK6 A;  1WT6 A;  2AEM A;  1KD1 Q;  2AXC A;  1X8Y A;  1P84 H;  1URQ D;  4H44 B;  5AVV B;  1RQU A;  1PGQ A;  2OYH A;  3RGU A;  4D6T J;  1EZV D;  2H88 C;  2ZXX A;  1YQ3 C;  1FE6 A;  3BCC E;  3L75 D;  3PP5 A;  4L73 A;  5GTI H;  1IFN A;  3AE1 C;  3AEB C;  2FFD C;  3RL0 D;  1KQL A;  2K9J B;  1LTB C;  3H1L D;  3C8V A;  1KB9 H;  3H1I G;  1L0N K;  3L71 E;  1IJD B;  3VP8 A;  4PD4 E;  3L74 G;  1BCC D;  1SP4 A;  3TGU G;  4C7R A;  1YI2 P;  2OYI C;  1KIL E;  1NTZ D;  1PL5 A;  2O1K A;  4PJ0 E;  5KKZ B;  3JCU H;  2C9L Y;  2E74 B;  5KAF H;  4BRY A;  5AW9 B;  1KIL D;  1NTZ E;  2D2C C;  1BCC J;  2R5B A;  3CWB D;  3PLN A;  2QJY C;  3TYY A;  4GKG A;  4U3F G;  1NGM B;  2GM4 A;  2Y9Y A;  1IC2 A;  1HJ0 A;  1AVY A;  1KIL A;  2E75 B;  4H0L D;  2FBW C;  2W6B A;  3L70 G;  2WPQ A;  5GTH E;  5BVZ A;  2XKM A;  1BSN A;  3RK2 C;  3LW5 J;  1HGV A;  3W68 A;  1DX7 A;  2RMZ A;  4KJM A;  1VF5 B;  5B66 H;  5AW8 B;  5KJ7 C;  3A0B E;  2H43 A;  1AA0 A;  1JY2 P;  3NFQ A;  4WY4 A;  2NZ2 A;  1L0N D;  2XZR A;  2H8P D;  3CCR P;  2FXM A;  4HH2 A;  2FYU K;  3TDK A;  3NMD A;  3ZDM A;  3KZI H;  2O3J A;  1SQV E;  1U7M A;  2KZJ A;  3AE4 C;  2OYH B;  1RF1 C;  3WU2 H;  3SSU A;  1AQ5 A;  1ZV8 A;  2QG4 A;  3UIA A;  1OW7 A;  3IR9 A;  1LTG C;  1OMI A;  2YIU B;  5CJ0 A;  4L75 A;  5AVR B;  1JO5 A;  3G9R A;  3VP9 A;  1K05 A;  1SQX K;  1XTC C;  3HD7 A;  3S1K A;  3F5H A;  2QJP B;  1FJP A;  3L72 J;  1VQ4 P;  2ZT9 C;  3CXH E;  3GF3 A;  1NTM J;  4OGQ D;  3C9I A;  2HPC B;  1PV3 A;  1SFC D;  1LWU C;  4BRY B;  1ZR4 A;  2KSE A;  1PPJ E;  1BCC E;  1SFC C;  3F89 A;  3GLM A;  3L75 J;  4O9B A;  2V4H A;  1NTM D;  1N7S C;  4HKZ H;  4H13 B;  1EXI A;  1LTA C;  1J1D B;  1KQG B;  3AE2 C;  1DH3 A;  1BE3 G;  2AXT E;  1LNQ A;  1M1J B;  1M57 D;  1KTM A;  2OAR A;  1JNM A;  2ZFC A;  1BCC G;  3TGU D;  3II6 A;  3SFE C;  1GU4 A;  4IFM A;  5KLV G;  2OTJ P;  1DEE G;  2H89 C;  3CWB J;  4RES B;  5AVQ B;  1CI6 B;  1M8O B;  2E76 C;  3L74 E;  1SLQ A;  3TGU E;  1TU3 F;  3S4R A;  4JBZ A;  5H2F E;  1BGY G;  1JUN A;  2R3C A;  3AEF C;  3AEE C;  1NJI Q;  2OQQ A;  2YXR B;  2PRR A;  1IFP A;  3B5N D;  3U59 A;  1E5W A;  5CCG A;  3G4S P;  5K5G B;  1NTK K;  3CWB G;  3FXE A;  4DJG A;  4UB6 E;  3CPW O;  4U3F D;  2HYN A;  1JY3 O;  2ZAE B;  2FYU D;  3BAS A;  1CZQ A;  2FXP A;  1U57 A;  1J1D C;  2HR3 A;  1EDI A;  2Q5U A;  1SQP J;  2Z5H A;  5AVY B;  3PJS K;  3MUD A;  1X0T A;  1SQV J;  1ZP0 C;  2PP6 A;  1KFN A;  1Y47 A;  5CCH D;  5KLV E;  1SQV K;  3ITK A;  2B87 A;  1CSB A;  4K3A A;  1PP9 J;  5APW A;  3VOP A;  2OTK E;  1K04 A;  1IZN B;  2WTY A;  2QJP C;  3RBZ A;  3GHG B;  3JSV C;  3WUT A;  4ASW A;  3L73 E;  1PP9 D;  2R5D A;  1EDL A;  5AVU B;  4BWN A;  1VPC A;  1T6A A;  4N3Y B;  1SQX E;  5KLV K;  1ZXG A;  4OH8 B;  3H1L J;  4OGQ B;  1Q86 Q;  1EQ7 A;  1OZH A;  2AEJ A;  2RN0 A;  3KQG A;  2HOD A;  1VQP P;  1Q82 Q;  1JTH A;  2J58 A;  4ZKU A;  1SQQ J;  1NTZ K;  1OVR A;  2M5A B;  2WPV B;  2KLV A;  2IZ1 A;  2IFN A;  1NTK E;  3TGU J;  1A02 J;  2BCC E;  1K73 Q;  2YMK A;  1VF5 C;  3A7O A;  2KLU A;  1MV8 A;  2OGU A;  3A2A A;  2A06 E;  2MKV A;  2HFE D;  2YMY A;  3HD7 C;  3H1J E;  1KFM A;  4WB4 A;  1SQX J;  2E75 C;  4HB1 A;  1FZF A;  1LT9 C;  2WPR A;  3L70 J;  4GOD A;  3BVH A;  3SWY A;  3EFG A;  3H1K D;  1OXZ A;  2D2C B;  4IOI H;  4D6T D;  3KZI E;  2XU6 A;  5AVX B;  1XTG B;  2R32 A;  2WWW A;  3CME P;  1GL2 D;  3CX5 H;  2PFX A;  1KB9 I;  4DCK A;  2OYI B;  4WY4 D;  2Y9Z A;  1MUU A;  2E76 B;  2JKV A;  2N1T D;  1Q7Y Q;  1JY2 O;  2FYU J;  3E7K A;  3FWN A;  2HLO A;  2CK3 H;  4GDO A;  3V2Q A;  1RE3 A;  1KQS O;  1Q2N A;  3FWL A;  1FZC B;  5KJ7 A;  1GMJ A;  2E43 A;  2W90 A;  1G2C A;  4GOE A;  1NTZ G;  3PTZ A;  1FC2 C;  1M1J C;  4H44 C;  1QVG O;  2K37 A;  1LTS C;  1R5L A;  3MP7 B;  1JTH B;  1UII A;  1OIP A;  2FYN C;  2ZVO B;  3L73 G;  5AW4 B;  5CCG C;  3RL0 g;  2Q3I A;  1GK4 A;  1IK9 A;  1SFC B;  2P67 A;  1E79 H;  2WT7 A;  3CMA P;  1LWU B;  2GA1 A;  3D6Z A;  2ZYA A;  2AEF A;  2KS1 A;  2YKQ A;  3M9Q A;  4JF7 A;  4IL6 E;  2A45 H;  4YTP C;  1NAF A;  1M7L A;  2ZT9 B;  3A0B H;  1WRG A;  3V4Q A;  1T2K D;  3CCM P;  3KDP B;  1RH5 B;  3E1I A;  3CC2 P;  3Q5P A;  5GTH H;  1L4A D;  3L36 A;  2V7Q J;  3HD7 D;  4UB8 H;  1VL2 A;  2O1J A;  3O6Q B;  1U7J A;  1BE3 J;  2K9J A;  4JYC A;  3V4W A;  2Q1K A;  2OYH C;  4R4L A;  3WU2 E;  1NTM E;  1S5L H;  4C7N A;  3CCS P;  3RL0 B;  1FDM A;  1N7S A;  4RO0 A;  1L0N J;  1URQ C;  3RK3 C;  1N73 C;  3HE5 A;  3D70 A;  1N8R Q;  3L73 D;  5E79 E;  3BRT B;  1FZC A;  3VMX A;  3WUV A;  2LXB A;  1JB0 J;  1PPJ G;  1J2J B;  3V2R A;  4DT0 A;  1KIL B;  1GW3 A;  3AE7 C;  3AED C;  2C9N Y;  1BDC A;  5CCG D;  5CBO A;  3EQ2 A;  4PV1 C;  2O01 N;  1K9M Q;  2BAS A;  3P8M C;  1AV1 A;  1L4A C;  1GL2 B;  4MN4 C;  3PRJ A;  2WT7 B;  1RF1 A;  2I1J A;  1HUC A;  1NO4 A;  1USE A;  2C0W A;  3L72 D;  4Y99 C;  3TNU A;  2FFD B;  2KIK A;  1NTK D;  2Y0C A;  1JCD A;  3OA7 A;  5DJT B;  1OWA A;  4YXW H;  2AXT H;  1IFD A;  1M56 D;  1VQ6 P;  2OTL P;  1NTK J;  2ZXE B;  4IFD K;  3H1J D;  4D6T G;  3MGN A;  4PV1 B;  3IAO A;  1QX8 A;  1M90 Q;  5AVS B;  1YIJ P;  2KNC A;  1KIL C;  1SQQ D;  2KYV A;  5AVW B;  3HUS C;  1IFM A;  2HPC A;  2J59 M;  1JM0 A;  1P84 E;  1SQB E;  2ZT9 D;  4L76 A;  4LGD E;  3A5T A;  2XDJ A;  5APS A;  1KYO H;  5CCH C;  1P84 I;  1ZME C;  1LTI C;  2E5T A;  1NU1 K;  3SFD C;  1IK7 A;  1JMB A;  1KYO I;  2IFM A;  1H8A A;  1KN7 A;  1PFI A;  1SQX D;  1GTW A;  5E79 H;  1S72 P;  1L0L D;  1PGJ A;  2NRG A;  1T3J A;  2G8Y A;  2JEE A;  2L91 A;  1N2D C;  2M3E A;  2RH0 A;  3HRN A;  3L70 D;  4K35 A;  1DD3 A;  2IDB A;  5CMZ A;  5L8R J;  1W2B O;  3H1K J;  3H1H G;  3CX5 I;  2WPS A;  5APQ A;  3V2P A;  2KXP B;  3VYI A;  3VMA A;  3G71 P;  4W80 A;  3H25 A;  2JJL A;  1EZV E;  1S3J A;  2W83 C;  3AE3 C;  3CCJ P;  5AW3 B;  2B89 A;  1SQP D;  2O01 H;  4QMA A;  4EOT A;  2IX7 C;  4H0L B;  3NXS A;  1SQV G;  4L74 A;  3H32 B;  4WY4 B;  1J1E C;  2N1T C;  5AVZ B;  3CCE P;  1NVO A;  1WMK A;  1ZR2 A;  1D7M A;  2W8Z A;  1NWQ A;  1QEX A;  1T3U A;  2FYU E;  1NHL A;  2QJK B;  3P7K A;  3HUS B;  2WSS H;  1EZV I;  3GW6 A;  2YXQ B;  3H1L G;  5KAF E;  1KMI Z;  1YHQ P;  3I55 P;  2I1K A;  2IZ0 A;  3CWB E;  1FOS E;  1HWT C;  1NTK G;  3SWF A;  1S2E A;  1EZV G;  4AQR D;  2W27 A;  1R5S A;  4ZNC A;  2B88 A;  2K88 A;  2I8D A;  3GF7 A;  2PAJ A;  4Y28 J;  2N1T A;  2WSE H;  3SWK A;  3H1J J;  1G1I A;  5BU8 B;  1L0L E;  1NH4 A;  3CX5 D;  1HGZ A;  2WIT A;  2FYU G;  3B4S A;  2O01 J;  2KI7 B;  3GHG A;  2IBZ E;  2QM8 A;  3QWO C;  4JYB A;  2KB7 P;  4Y99 B;  4BXL A;  4RJT A;  3Q5R A;  2YO3 A;  4I6M C;  3C1L A;  5TIS E;  3RK3 E;  1AJY A;  3CX5 E;  4ZMD A;  1L4A B;  4DZO A;  2YO2 A;  1VQ5 P;  2XNX A;  1JEK A;  5KTB A;  4HJG H;  2QRX A;  1EDJ A;  1T8Z A;  1KYO E;  2Q6Q A;  2R44 A;  3H1L E;  2UWJ E;  1PZQ A;  3H32 A;  1BGY J;  1AFO A;  1N73 B;  3CI9 A;  3T97 A;  1URQ B;  3L73 J;  2NPS D;  1PP9 G;  4DOJ A;  1N7S D;  1YTZ I;  4I7Z B;  1FU1 A;  1SQQ K;  3L71 D;  4LLH A;  4WWI A;  2Q7C A;  1VQ9 P;  1QGK B;  1N7L A;  4UB8 E;  1N86 A;  4XE5 B;  1LTJ C;  2ZYD A;  1W5C E;  3S9O A;  1JY3 P;  1NKZ B;  2GUV A;  2K3R A;  1VQN P;  3M9B A;  4GT1 A;  1LT1 A;  1H0T B;  1ZOY C;  2WSF J;  3JCU E;  3B5N B;  5B5E E;  1Y9B A;  2P7J A;  5APU A; 
#chains in the Genus database with same CATH homology
 3OJA B;  1S9K E;  4HYT B;  3RK3 D;  2OYI A;  1FBM A;  4XA4 A;  4EIJ A;  1GDT A;  5AW6 B;  1HJB A;  4N78 D;  1L4A A;  1SQP K;  2NPS C;  5AW2 B;  1FZG A;  1RY3 A;  2YKP A;  1FZC C;  1JOC A;  1N73 A;  1H89 A;  3O8Z A;  3I5C A;  1RE4 C;  2HOD B;  3IFM A;  2MJZ A;  3M0D A;  4KHX A;  3P8C D;  1HVV A;  2KP8 A;  1S9K D;  3HUS A;  5AVT B;  1LT9 B;  3N4X A;  3P32 A;  4AYC A;  5APX A;  3B5N A;  1JMM A;  3HD7 B;  3L37 A;  1QL2 A;  4WBA A;  2NPS B;  2KOG A;  1T2K C;  1N7S B;  1X9V A;  4AUW A;  3M9H A;  1JY3 N;  1JO5 A;  1X79 B;  2L5G B;  3LID A;  1RF0 A;  3B5N C;  3MIW A;  3VMY A;  2YNY A;  1RE3 C;  1RF1 B;  1LTJ B;  2POH A;  3A3Y B;  1FZB A;  5APT A;  2FFD A;  3GHG C;  1NOH A;  3M0D C;  4M3L A;  1RE4 A;  3MTU E;  1SQB K;  3KPE A;  2Z5I A;  1URQ A;  1H88 A;  2Q9I A;  5AW5 B;  3B8E B;  2GUS A;  3WMM 0;  1GU5 A;  4N78 E;  5KJ7 D;  2QM7 A;  3VTP C;  2IPP A;  1DX7 A;  3BRV B;  1GW4 A;  3G3Z A;  1IO4 A;  1RF0 C;  1CW5 A;  1SVF A;  2W6A A;  1LGH B;  3HE5 B;  1L0L K;  5BU5 A;  5AW1 B;  1HTL C;  3M91 A;  2Z4E A;  4W7Y A;  1A02 F;  2WSC H;  3CLQ A;  1YTZ T;  3N7N A;  3TSI A;  2FKW B;  3U1C A;  3VN0 A;  1GL2 A;  5APY A;  2HG5 D;  1J1E B;  2P1J A;  1VDF A;  3LW5 H;  1CI6 A;  1NTM K;  2CPB A;  3V2N A;  1MFZ A;  4I2L C;  3TK1 A;  1ZLL A;  1MZ9 A;  1LT9 A;  3CL3 D;  1HH0 A;  2FYZ A;  4W7Z A;  3V5B A;  2VRS A;  2H7H A;  2NPS A;  1DEB A;  3HTK A;  3HE4 A;  5AW0 B;  3M06 A;  3RK2 B;  4IFF A;  2CPS A;  2A45 I;  3OAK A;  1JCC A;  2KSJ A;  1LTJ A;  1SFC A;  1GZL A;  2WZ7 A;  3P8C E;  3LIE A;  1QL1 A;  5CCH A;  3H6P A;  3M0A A;  1GD2 E;  1LTT C;  5APV A;  4ZKP A;  1GL2 C;  1FAV A;  1HBW A;  4C46 A;  1YYC A;  1IFI A;  4N6J A;  1FOS F;  1NKN A;  2A45 G;  3R2P A;  2M8R A;  3NTN A;  3RK3 B;  2N1T B;  2XV5 A;  3HTK B;  4WY4 C;  3HE4 B;  4GIF A;  1FZE A;  1W2E A;  3RL0 C;  3L4F A;  1KZU B;  2WSF H;  1M1J A;  3BAT A;  2YKO A;  4LC1 A;  5CHX A;  4I1L A;  2E42 A;  1JY2 N;  5AW7 B;  2N9B A;  3VMZ A;  3MD0 A;  3U1A A;  1G2C B;  2C0X A;  2LKM A;  3L35 A;  3KYQ A;  3TNU B;  5CJ4 A;  4B86 A;  1Z56 A;  2M3B A;  3RK2 D;  1IFJ A;  1FJK A;  1LWU A;  1ZN5 A;  2P2U A;  2WTY A;  1FZA A;  1G1J A;  1WT6 A;  1GK6 A;  1X8Y A;  5AVV B;  1URQ D;  2OYH A;  3PP5 A;  1IFN A;  3RL0 D;  1KQL A;  1LTB C;  1L0N K;  1IJD B;  3VP8 A;  1SP4 A;  4C7R A;  2OYI C;  2C9L Y;  2O1K A;  5AW9 B;  1KIL D;  2R5B A;  3TYY A;  4GKG A;  2GM4 A;  1IC2 A;  1KIL A;  2W6B A;  2WPQ A;  5BVZ A;  2XKM A;  3RK2 C;  1HGV A;  5KJ7 C;  5AW8 B;  2H43 A;  3NFQ A;  1JY2 P;  4WY4 A;  2XZR A;  2H8P D;  2FXM A;  4HH2 A;  2FYU K;  3NMD A;  2OYH B;  1RF1 C;  1AQ5 A;  1ZV8 A;  3UIA A;  3IR9 A;  1LTG C;  5AVR B;  5CJ0 A;  3VP9 A;  1SQX K;  1XTC C;  3HD7 A;  1FJP A;  3C9I A;  2HPC B;  1SFC D;  1LWU C;  1ZR4 A;  1SFC C;  4O9B A;  1N7S C;  1LTA C;  1J1D B;  1DH3 A;  1M1J B;  2OAR A;  1JNM A;  2ZFC A;  3II6 A;  1GU4 A;  4IFM A;  5AVQ B;  4RES B;  1CI6 B;  1SLQ A;  1JUN A;  2R3C A;  3U59 A;  3B5N D;  1E5W A;  5CCG A;  1NTK K;  2HYN A;  1JY3 O;  3BAS A;  1CZQ A;  2Q5U A;  2Z5H A;  1J1D C;  5AVY B;  4C7N B;  3MUD A;  2PP6 A;  1KFN A;  5CCH D;  1SQV K;  1CSB A;  5APW A;  3VOP A;  3GHG B;  2R5D A;  5AVU B;  1VPC A;  4N3Y B;  5KLV K;  4OH8 B;  1EQ7 A;  3KQG A;  2HOD A;  1JTH A;  2J58 A;  4ZKU A;  1NTZ K;  2KLV A;  2IFN A;  1A02 J;  3A7O A;  1MV8 A;  3A2A A;  3HD7 C;  2HFE D;  2YMY A;  1KFM A;  4WB4 A;  1FZF A;  1LT9 C;  2WPR A;  3BVH A;  3SWY A;  3EFG A;  1OXZ A;  5AVX B;  2XU6 A;  1XTG B;  2R32 A;  2WWW A;  1GL2 D;  2OYI B;  4WY4 D;  1MUU A;  2N1T D;  1JY2 O;  2HLO A;  3V2Q A;  1RE3 A;  2E43 A;  1FZC B;  5KJ7 A;  1G2C A;  1M1J C;  1LTS C;  1JTH B;  5CCG C;  5AW4 B;  2WT7 A;  2Q3I A;  1GK4 A;  1IK9 A;  1SFC B;  2P67 A;  1LWU B;  3M9Q A;  2YKQ A;  4JF7 A;  2A45 H;  1NAF A;  1M7L A;  1T2K D;  3V4Q A;  1WRG A;  3KDP B;  3E1I A;  1L4A D;  3L36 A;  3HD7 D;  2O1J A;  4JYC A;  3V4W A;  2OYH C;  4C7N A;  3RL0 B;  1FDM A;  1N7S A;  1URQ C;  3RK3 C;  1N73 C;  3HE5 A;  3BRT B;  1FZC A;  3VMX A;  3V2R A;  2C9N Y;  1J2J B;  1KIL B;  1GW3 A;  5CCG D;  3EQ2 A;  2BAS A;  3P8M C;  1L4A C;  1GL2 B;  2WT7 B;  1RF1 A;  2I1J A;  1HUC A;  1NO4 A;  2C0W A;  4Y99 C;  3TNU A;  2FFD B;  1JCD A;  3OA7 A;  1OWA A;  1IFD A;  2ZXE B;  4IFD K;  3MGN A;  5AVS B;  1KIL C;  2KYV A;  5AVW B;  3HUS C;  1IFM A;  2HPC A;  2J59 M;  4LGD E;  3A5T A;  2XDJ A;  5APS A;  5CCH C;  1LTI C;  1NU1 K;  2IFM A;  1H8A A;  1PFI A;  1GTW A;  1T3J A;  2JEE A;  3HRN A;  1N2D C;  5CMZ A;  2WPS A;  5APQ A;  3V2P A;  3VYI A;  4W80 A;  2JJL A;  5AW3 B;  2O01 H;  4EOT A;  2IX7 C;  3NXS A;  3H32 B;  4WY4 B;  1J1E C;  2N1T C;  5AVZ B;  1NWQ A;  1ZR2 A;  1T3U A;  1NHL A;  3P7K A;  3HUS B;  2I1K A;  1FOS E;  1HWT C;  3SWF A;  4AQR D;  2W27 A;  2PAJ A;  2N1T A;  2WSE H;  1G1I A;  5BU8 B;  1NH4 A;  1HGZ A;  2WIT A;  3GHG A;  2QM8 A;  4JYB A;  2FFD C;  2KB7 P;  4Y99 B;  2YO3 A;  4I6M C;  1L4A B;  4DZO A;  2YO2 A;  2XNX A;  5KTB A;  1T8Z A;  3H32 A;  1AFO A;  1N73 B;  3CI9 A;  3T97 A;  1URQ B;  2NPS D;  4DOJ A;  1N7S D;  1YTZ I;  4LLH A;  1FU1 A;  1SQQ K;  2Q7C A;  1N7L A;  1N86 A;  4XE5 B;  1LTJ C;  1JY3 P;  1NKZ B;  2GUV A;  3M9B A;  4GT1 A;  3B5N B;  2P7J A;  5APU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...