1NH4A

Structure of the coat protein in fd filamentous bacteriophage particles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
44
structure length
44
Chain Sequence
PAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure of the coat protein in fd filamentous bacteriophage particles determined by solid-state NMR spectroscopy
pubmed doi rcsb
molecule tags Virus
molecule keywords Major coat protein
total genus 18
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nh4A00
1NH4A 1HH0A 1HGZA 1IFIA 2MJZA 2C0WA 2CPSA 1IFDA 2C0XA 2CPBA 1FDMA 1IFJA 1HGVA
chains in the Genus database with same CATH superfamily
5AW8B 3GF7A 2B9BA 1L0NG 5APTA 2GUVA 2PRRA 1PPJD 2ZT9C 5GTHH 3RL0B 1M1JC 3IAOA 1A02F 1ZR2A 3I56P 1PL5A 1NJIQ 3A5TA 1LTJA 1EDJA 2FBWC 3RGUA 2QJPC 1PZQA 3H1ID 4MN4C 1K9MQ 3WU2E 4EOTA 4LGDE 1H8AA 2D2CC 1YHQP 1NKZB 4L73A 4WBAA 3M9BA 3G9RA 4GT1A 1SQBJ 1T6AA 1NGMB 4UB8E 2XDJA 2IYOA 1GL2A 1CSBA 1ZRTD 1HJBA 2E75B 2C9NY 1PIXA 1EZVD 4KT0J 3B71A 3ITKA 3CCEP 1X9VA 2A45I 2XV5A 2IBZD 1YYCA 2W6AA 3KQGA 1L0LE 2NPSA 3KYQA 2OYOA 3MIWA 1HGVA 1WT6A 1ZXGA 2B87B 2BCCE 2FYNC 3AE3C 3E7KA 1SQBK 3M0DA 4N78E 4PV1B 2R3CA 5AVWB 4EYYQ 4AYCA 5KJ7C 1NVOA 1BDCA 1KYOE 2AXTE 1PV3A 2O01N 2P10A 1Q90D 2KI7B 2KSJA 2Z5IA 3BCCE 3JCUE 1NYHA 3PLNA 4H13B 4ZKUA 2J59M 5GTIE 1IFPA 4HB1A 3HE4A 2KLUA 4BRYA 3A0BE 2QJKB 3V2NA 1LT1A 3TK1A 1SQPD 1SQXJ 1YBKA 2ZFCA 1IK7A 3NMDA 4IL6E 1NTMK 1JNMA 1NKNA 2Y0EA 4K3AA 4JQ0D 2QM7A 1N73C 1URQD 3H1HJ 4YXDC 2YMYA 1BCCE 1M1JA 1SQXG 1KFNA 1FDOA 3L71D 1R8EA 2H7HA 1LTJB 1HH0A 2QE7H 3IF4A 3C9IA 1S5LE 2IFMA 2POHA 3H1IJ 5KLVD 3CC7P 2Y0CA 2ZVOB 2QJKC 3HE5A 3H1KD 4OH8B 1BCCD 3L71E 2BASA 4C7NB 1X79B 1NO4A 2BEQD 3A7OA 2W83C 1LWUB 1S3JA 1XTCC 2XNXA 4UB8H 1SLQA 1HF9A 4OGQC 3S1KA 1BSNA 2MJZA 1UIXA 3L37A 1VQ4P 3N7NA 2R44A 3MZWB 4I7ZC 3AE6C 2IZ1A 2FYUE 4UB6E 5CJ0A 2R5BA 1N86A 1SFCB 4IFFA 2FYUG 1LNQA 2NPSD 2L5GB 4N3YB 2C0WA 2ZAEB 3CX5E 2OYHB 1BE3G 1OW7A 3D6ZA 3L71G 1VQPP 1KN7A 2K9YA 4LLHA 1L0LG 3TNUA 5E79H 1TU3F 1S2EA 3OW2O 1VQ8P 1SQVD 3VN0A 3GHGB 2W27A 1NTKG 3L72J 1CI6A 1LP1A 1BE3J 4GIFA 1GK6A 1KILA 3HE4B 4LC1A 4I1LA 5AVVB 3RK3C 2XNDH 1U7MA 3IR9A 1DEEG 1L4AB 3N4XA 1PP9E 5L8RJ 1JMBA 1AVYA 2WVRA 1NTZD 3JC22 1LTSC 2GUSA 4M3LA 5K5GB 1N73A 5KAFH 3H1LJ 2NRGA 1VQ9P 1BE3E 1MUUA 1URQC 4WY4D 4TT3H 3BASA 1FZGA 2FFDC 3HRNA 3TYYA 1NTZE 3U59A 2WT7A 2IBZG 1PP9J 3HE5B 4C7RA 1W5CE 3WUTA 1OWAA 2WSFJ 1NH4A 3BCCG 2WSCJ 3U1AA 1H89A 1U7JA 1N7SA 2E75C 1ZN5A 3P32A 4KJMA 2YIUB 2V4HA 1PFIA 3R4YA 2RN0A 1U57A 4PJ0H 1VQNP 1L0NK 5AW5B 3W67A 3H1IG 1URQB 3C8VA 3EWKA 2V7QJ 1AQTA 2AEMA 2FFDB 3P8CE 4IL6X 1KILE 3QWOC 5AVYB 5KLIC 5KAIH 2OYHA 4EIJA 1T2KD 1PPJG 1RE4A 2OARA 3MD0A 2V7QH 2E74B 1IJDB 2R3SA 2W6JH 1RE3A 2B89A 3HD7C 4H0LB 4L76A 4H0LD 3CXHH 1RQVA 5APQA 1KB9H 1RF0A 1VF5B 3GHGA 3P8CD 1CI6B 1LP1B 1P84H 3HTKB 3MHVA 3JCUH 5AVRB 2KB7P 5GTIH 2K88A 2M5AA 2WMMA 1H0TB 1EZVI 3L74E 2E42A 2O1KA 2ZJSE 2WSFH 2I1JA 2QJYC 1JY3O 3E1IA 1X22A 1OW6A 4CPGA 2E74C 1NHLA 2W8ZA 1RF1C 1DX7A 1YQ4C 1J1DC 2AEFA 1NU1J 5TJHA 1HJ0A 2WWWA 2XZRA 3Q5SA 3L75G 1J1EC 3B4SA 1FU1A 1KILC 4NPFX 2K37A 2WT7B 3G4SP 3FGAD 1S9KD 4C46A 3L75J 4WY4B 3CCJP 2Y9YA 1RQUA 4PD4D 2O1JA 1S4XA 5AW1B 2NPSB 3W68A 4D6TG 5B5EH 1FZAA 2JKVA 4HKZH 1P84D 1KB9D 2WSEH 2OYHC 2KLVA 2H8PD 1J1EB 1Q2NA 4KHXA 4PD4E 3L75E 1M90Q 3CMAP 3CXHI 2AXCA 1Z56A 2KNCB 2Q3EA 3IFMA 4AQRD 2D2CD 1FDMA 1X8YA 3AEAC 3AECC 3K5BA 1KB9E 4RJTA 4H44B 4QMAA 2QEXP 1BCCG 1JY3P 1NTZG 3CWBG 4L75A 1SQBE 3VMXA 2E5YA 1AV1A 1SQQK 5KKZB 3MP7B 1OIPA 1JY2P 1OVUA 2Q1KA 1RHZB 2OQQA 3L74J 3E1RA 4U3FG 1IC2A 2RKLA 3AEBC 3OJAB 3PJSK 4YTPC 5M1BA 5GTHE 3BRVB 1NAYA 1FOSE 1GU4A 2HG5D 4XA4A 2YMKA 1NWQA 2WSEJ 2WZ7A 2ZT9D 2C9LY 4DCKA 3H1HD 2FKWB 5EFWB 4R4MA 3RK3E 2O01H 1LT9C 2JO1A 2BCCG 3QH9A 5B66E 1VQOP 2QJPB 3RBXA 1FZFA 1FJKA 2M8RA 3CWBD 5KLVJ 2JWAA 3PTZA 2W6BA 3H6PA 1BGYG 5CCHA 2M3BA 1LTIC 1ZV8A 4K35A 3TGUE 3AE8C 2QA4P 1Q82Q 3RL0D 1M57D 3F89A 1YJWP 1WRGA 1GD2E 4Y28J 1VF5C 3RK2D 2M3EA 1IO4A 2IDBA 3EFFK 2OYIA 2IX7C 1KYOI 1SQVK 2P2UA 1R5SA 3H1KE 3L36A 1OVRA 3MUDA 3KXDA 5APXA 1G2CA 1QVGO 2AEJA 2UWJE 2KOGA 2DW3A 4D6TD 2E76B 1VQ7P 3B5NC 3HUSB 1M7LA 3NTNA 2CK3H 1FZCA 3AE5C 2KXPB 2FYUJ 4Z1MH 2Y9ZA 3H1JE 3L74D 2YKPA 3AE1C 1NTMD 1IFJA 1OX3A 1QEXA 1LTGC 2GA1A 1YTZT 2JP3A 1N7SB 2PFXA 2JDIH 5TISH 4OGQD 3WUUA 3TDKA 1LT9A 1FC2C 3L73G 1QL2A 2KS1A 1EZVG 2B87A 3KZIH 3H32A 3S4RA 4B86A 1JY3N 2QVAA 1URQA 1KV4A 1KTMA 3LW5J 3H1JG 3M0AA 4I6MC 2H88C 2YO3A 4DT0A 2J5UA 1ZLLA 5CMZA 4RKUJ 1S5LX 4DOJA 1E79H 1HUCA 4OGQB 3L4FA 1MV8A 1DIPA 3AE7C 2IZ0A 4Y99B 1FJPA 3CL3D 2LXCB 4L74A 3TSIA 3CPWO 3Q1MA 2PGDA 4PD4H 5KLVE 1CZQA 1YIJP 1VQKP 2OTKE 3VTPC 3BCCJ 5E79E 2E5TA 2Q7CA 2OYIC 2G8YA 2N1TD 3M9QA 1PP9G 2KSEA 5APVA 4D6TJ 5CCGA 5KKZC 2KUBA 2P1JA 3VMZA 1IK9A 3PP5A 4WWIA 3CCQP 1SQBD 2ZYAA 3L70D 1YQ3C 4XE5B 1RE4C 2WPQA 2XKMA 5CCHC 1WMKA 4Y99C 1EDIA 1Q81Q 4ZNCA 1IFNA 1SQQJ 1BCCJ 3BRTB 4N6JA 2KZIA 4TLFA 5KAFE 1T3JA 1SFCD 3WMM0 3MTUE 1M56D 1SQXK 4JPZB 4HJGH 5AW9B 3T97B 2QSIA 3II6A 1MKMA 1QGKB 3VOPA 4W7YA 3S9OA 4ZKPA 4WY4A 4ASVA 1GDTA 1K73Q 3H1JJ 3Q5PA 1NTKD 1PGPA 2HFED 2FYNB 3KZIE 1KD1Q 1L0LD 1AFOA 3V5BA 1GZLA 1IFDA 4U3FE 3V2RA 1LJ2A 1OVVA 5APSA 1N7SD 1K04A 3M9HA 5B66H 4OWFA 3TNUB 1L4AD 1USDA 3CWBE 2ZVNB 1KMIZ 2QG4A 1IFIA 1VQLP 1L0NE 4ASWA 2ZXEB 3A2AA 3CCRP 1JTHB 5KAIE 2VRSA 4HH2A 4NPEA 1AQ5A 5KTBA 1ZP0C 4XFJA 2M0BA 5AW2B 5CCGC 1HTLC 1SQXE 2I8DA 2WTYA 1GTWA 1VL2A 2FYUK 2WQYC 1N73B 2HODA 3VP8A 1NU1K 2E76C 2HR3A 3TGUG 5KLIB 1NTKJ 2O3JA 3L72G 3H1LD 1BGYE 1PGJA 2HLOA 2ITAA 3SWKA 5KLVG 3HD7B 3CI9A 4GDOA 3GLMA 4H0LC 5AW4B 5AW6B 5KLVK 2BCCD 2K1AA 4N78D 2NZ2A 4PV1D 2K9JA 1Y47A 3H1HG 3H1IE 1JCCA 1LWUC 1GU5A 2I1KA 4DZOA 3CCVP 1EDLA 1AA0A 1KQLA 2N1TA 1KB9I 1BGYJ 1VPCA 2YO2A 4JBZA 1SQQG 3SFDC 1A02J 1FOSF 1Y9BA 4H13C 1KFMA 3JSVC 3AEGC 3V2QA 4O9BA 1S1CX 2FFDA 1SQPK 1W2EA 1J1DB 2H43A 1BDDA 1SQPG 3D6YA 1GL2C 1KILB 1M8OB 2A06D 2YKOA 5B5EE 5BU5A 2RH0A 1ZMEC 2LKMA 1RF0C 1T8ZA 2A06G 3GHGC 2SPZA 4PJ0E 1NOHA 3CX5I 4I2LC 4W80A 3CLQA 3RK3B 3VMYA 1L4AC 4U3FJ 3O6QA 5H2FH 2OYIB 2P58A 1L0NJ 4OVNF 2ZXXA 1SQBG 3GMAA 1SP4A 2E43A 1EC5A 1G2CB 2JR8A 1KYOH 2AXTH 1PP9D 2YKQA 3T97A 3UIAA 1HGZA 1YJNP 3LIDA 1M1KQ 3L73J 1EQ7A 2E76D 3HD7A 5APYA 2BCCJ 1NTKE 4H44C 1LWUA 1KQSO 4I7ZB 2JWDA 1Q7YQ 3P8MC 3CX5D 2KP8A 2K9JB 2KIKA 3AE2C 2H89C 4YPCA 1CW5A 2Q6QA 4NPDA 3H1LG 5AVTB 2C0XA 3TGUD 5CHXA 1NU1E 1NU1G 1LTTC 1SVFA 3CD6P 2Y0DA 3H1HE 3NFQA 1S5LH 3KDPB 3M91A 1OZHA 2D2CB 3A3YB 4H13D 1PGOA 2P67A 1FS0E 3LIEA 3O8ZA 2YXQB 2Q5UA 1SQVJ 2K3RA 3ABVC 1QLED 3D71A 3ZDMA 3P7KA 3GF3A 2GM4A 1GL2D 1L4AA 1JY2O 1FE6A 1LTBC 2CPBA 1S72P 2BEZF 1FZEA 1N2DC 1SQPE 3Q3DA 3L74G 1LGHB 1GW4A 1XTGB 2FYZA 2MKVA 1H88A 4GOFA 1DD3A 1ZRTE 3A0HE 3B8EB 2KK7A 3CX5H 1QL1A 1T3UA 3PHLA 1ZW0A 1OMIA 1PPJE 2JEEA 3FX0A 3RK3D 3Q5RA 3CC4P 3L35A 4YXWH 3OA7A 1JOCA 2YIUC 1VF5D 3RK2C 1BE3D 3FWLA 3BVHA 4JYBA 3AEDC 5BU8B 1KYOD 1JB0J 1KILD 1HBWA 3BCCD 1AVOA 1DD4A 3L70G 1KORA 3G3ZA 4WY4C 5AVXB 1BSHA 3B5NB 3HUSC 5AVUB 1T2KC 1Q86Q 1JMMA 1G1JA 2W90A 3AE4C 3IN6A 3L73E 3U1CA 1GMJA 2KNCA 3RK2B 2E75D 1GK4A 1NTKK 1L2PA 1OXZA 3F5HA 3H1KG 3PRJA 4JYCA 3CCUP 2QIWA 5DJUB 1N8RQ 4DJGA 1LTAC 1QX8A 1YTZI 3TGUJ 3D70A 2N9YB 5KJ7D 1P84I 4HYTB 2QJYB 2QRXA 3H1JD 1JTHA 3MUDC 3M0DC 1DEBA 2N9BA 1RF1B 1DH3A 1KQGB 3A0HH 3HD7D 2HODB 1E5WA 2L91A 1GW3A 3M06A 1S9KE 3OAKA 5H2FE 5C39A 2JJLA 2FYUD 3RBZA 1VQ6P 1SS1A 1NU1D 1RE3C 1SQPJ 1NTMG 2IPPA 4RESB 1USEA 1P84E 4ZMDA 3NXSA 2NPSC 1VDFA 1QVFO 3USSA 5AVZB 5BVZA 2N1TC 1HVVA 3L71J 3CWBJ 2FXMA 4WB4A 1OFCX 3CCLP 1YITP 3BATA 1LT9B 2R32A 4EI2A 1X0TA 2KS1B 3WUVA 5APUA 2B88A 1FDIA 3B5NA 3H32B 2IYPA 3SSUA 1YJ9P 1AJYA 3Q2YA 3LW5H 2Q9IA 1UIIA 3FWNA 2YNYA 1KC8Q 3G6EP 1SQXD 3HTKA 2A45G 1VQMP 1NAFA 2M5AB 4PD4I 1H0TA 3R2PA 2ZT9B 2LXBA 5TISE 1M1JB 3RL0C 3VYIA 1BGYD 3EFGA 3L75D 2HPCA 5AW0B 4U7JA 5AW3B 3RL0g 2G3AA 2P7JA 2WSCH 1JCDA 3HUSA 2OTLP 1L0ND 3O6QB 2WPVB 3C1LA 5AVSB 2ZYGA 1HWTC 4C7NA 3MGNA 1RF1A 5CCGD 3H1KJ 1MZ9A 5CJ4A 3VMAA 2XU6A 1FAVA 1NTMJ 2ZYDA 4D6TE 4A7PA 1JM0A 4WVZA 3CC2P 3CCSP 1KQFB 3CCMP 3H25A 3SWYA 3H1LE 2A45H 1SQQD 3CMEP 4GKGA 3FXEA 5APWA 2WSSH 1OW8A 1SFCA 4BXLA 2WPRA 4PV1C 4U3FD 2J58A 4IFMA 1NTME 1Y8AA 1NTZJ 2O01J 3CXHE 2KZJA 3AE9C 4GODA 1EZVE 3VP9A 1SQQE 3PH0A 2IBZE 3V4QA 2FXOA 1D7MA 3GW6A 3I5CA 4IOIH 1W2BO 2Z4EA 1IFMA 3L72D 3TF5A 2KYVA 1RY3A 3CXHD 1ZOYC 4AUWA 1NTZK 5AW7B 3AEEC 3KPEA 3SWFA 5CBNA 1J2JB 4W7ZA 2OTJP 2LR2A 3I55P 2WPSA 3KHUA 1KZUB 4H44D 2Z5HA 3L72E 3AEFC 2A06E 1PGQA 2RMZA 2IFNA 3GG2A 4BWNA 2HPCB 2PP6A 1LTJC 1JO5A 5KJ7A 3L70J 3SFEC 1L0LJ 1EXJA 3FXDA 3WU2H 1FZCB 1FBMA 1FZBA 1MFTA 1K8AQ 3EQ2A 2Q3IA 1ZR4A 1GL2B 4UB6H 1JY2N 2R5DA 1R5LA 4JF7A 1K05A 2WITA 1N7SC 2OGUA 1MFZA 3L70E 4EDFA 3V2PA 1SFCC 3B5ND 1SQVG 5AVQB 5CBOA 4R4LA 2FXPA 1EDKA 1SQVE 2E74D 2N1TB 2CPSA 1FZCC 2FY8A 1JEKA 2YXRB 1N7LA 4GOEA 4RO0A 5DJTB 1VQ5P 3L73D 5CCHD 1JUNA 3V6IA 1IZNB 1RH5B 2IBZI 2PAJA 3V4WA 4BRYB 1EXIA 3A0BH 1G1IA 2HYNA 1YI2P 1L0LK 2QM8A 4IFDK 4IL6H 3G71P
chains in the Genus database with same CATH topology
5AW8B 5APTA 2GUVA 1A02F 3RL0B 1M1JC 1ZR2A 3A5TA 1LTJA 4EOTA 4LGDE 1H8AA 1NKZB 4WBAA 3M9BA 4GT1A 2XDJA 1GL2A 1CSBA 1HJBA 2C9NY 1X9VA 2A45I 2XV5A 3KQGA 1YYCA 2W6AA 3KYQA 2NPSA 3BVHA 3MIWA 1HGVA 1WT6A 4N78E 3T97A 3M0DA 5AVWB 1SQBK 2R3CA 5KJ7C 4AYCA 3V2NA 2Z5IA 5CMZA 1FDMA 2KSJA 4ZKUA 2J59M 3HE4A 3TK1A 2ZFCA 3NMDA 1NTMK 1JNMA 1NKNA 2QM7A 1N73C 1URQD 2YMYA 1M1JA 1KFNA 2H7HA 1LTJB 1HH0A 3C9IA 2IFMA 2POHA 3HE5A 4OH8B 4C7NB 2BASA 1X79B 1NO4A 3A7OA 1LWUB 1XTCC 2XNXA 1SLQA 2MJZA 3L37A 3N7NA 5CJ0A 2R5BA 1N86A 1SFCB 4IFFA 2NPSD 2L5GB 4N3YB 2C0WA 2OYHB 4LLHA 3TNUA 3VN0A 3GHGB 2W27A 4GIFA 4LC1A 1CI6A 1AQ5A 5AVVB 1GK6A 1KILA 3HE4B 4I1LA 3RK3C 3IR9A 1L4AB 3N4XA 1N73A 1LTSC 2GUSA 4M3LA 1MUUA 1URQC 4WY4D 3BASA 1FZGA 2FFDC 3HRNA 3TYYA 3U59A 2WT7A 3HE5B 4C7RA 1OWAA 1NH4A 3U1AA 1H89A 1N7SA 3P32A 1ZN5A 1PFIA 1L0NK 5AW5B 1URQB 2FFDB 3P8CE 5AVYB 2OYHA 4EIJA 1T2KD 3MD0A 1RE4A 2OARA 4I6MC 1IJDB 3HD7C 1RE3A 5APQA 3P8CD 1RF0A 3GHGA 1CI6B 3HTKB 5AVRB 2KB7P 2E42A 2O1KA 2WSFH 2I1JA 1JY3O 3E1IA 1DX7A 1NHLA 1RF1C 1J1DC 2WWWA 2XZRA 1J1EC 1FU1A 1KILC 2WT7B 1S9KD 4C46A 4WY4B 5AW1B 2O1JA 2NPSB 1FZAA 2WSEH 2OYHC 2KLVA 2H8PD 1J1EB 4KHXA 1Z56A 3IFMA 4AQRD 1X8YA 1JY3P 3VMXA 1SQQK 1JY2P 1IC2A 3OJAB 3BRVB 1FOSE 1GU4A 2HG5D 4XA4A 1NWQA 2WZ7A 2C9LY 2FKWB 2O01H 1LT9C 1FZFA 1FJKA 2M8RA 2W6BA 3H6PA 5CCHA 2M3BA 1LTIC 1ZV8A 3RL0D 1WRGA 1GD2E 3RK2D 1IO4A 2OYIA 2IX7C 1SQVK 3L36A 2P2UA 3MUDA 5APXA 1G2CA 2KOGA 3B5NC 3HUSB 1M7LA 3NTNA 1FZCA 2YKPA 1IFJA 1LTGC 1YTZT 1N7SB 1LT9A 1QL2A 3H32A 4B86A 1JY3N 1URQA 3M0AA 2YO3A 1ZLLA 4DOJA 1HUCA 3L4FA 1MV8A 1FJPA 4Y99B 3CL3D 3TSIA 1CZQA 3VTPC 2OYIC 2Q7CA 2N1TD 3M9QA 5APVA 5CCGA 2P1JA 3VMZA 1IK9A 3PP5A 4XE5B 5CCHC 1RE4C 2WPQA 2XKMA 4Y99C 1IFNA 3BRTB 4N6JA 1T3JA 1SFCD 3WMM0 3MTUE 1SQXK 5AW9B 3II6A 3VOPA 4W7YA 4ZKPA 1GDTA 4WY4A 2HFED 1AFOA 3V5BA 1GZLA 1IFDA 3V2RA 5APSA 1N7SD 3M9HA 3TNUB 1L4AD 1IFIA 2ZXEB 3A2AA 1JTHB 2VRSA 4HH2A 5KTBA 2WTYA 5AW2B 5CCGC 1GTWA 1HTLC 1N73B 2FYUK 2HODA 3VP8A 1NU1K 2HLOA 3HD7B 3CI9A 5AW4B 5AW6B 5KLVK 4N78D 1JCCA 1LWUC 1GU5A 2I1KA 4DZOA 1KQLA 2N1TA 1VPCA 2YO2A 1FOSF 1A02J 1KFMA 3V2QA 4O9BA 2FFDA 1SQPK 1W2EA 1J1DB 2H43A 1GL2C 1KILB 2YKOA 5BU5A 2LKMA 1RF0C 1T8ZA 3GHGC 4W80A 1NOHA 4I2LC 3RK3B 3CLQA 3VMYA 1L4AC 2OYIB 2E43A 1SP4A 1G2CB 2YKQA 3UIAA 1HGZA 3LIDA 1EQ7A 3HD7A 5APYA 1LWUA 3P8MC 2KP8A 1CW5A 5AVTB 2C0XA 5CHXA 1LTTC 1SVFA 3NFQA 3KDPB 3M91A 3A3YB 3O8ZA 2P67A 3LIEA 2Q5UA 3P7KA 2GM4A 1GL2D 1L4AA 1JY2O 2CPBA 1LTBC 1FZEA 1N2DC 1LGHB 1GW4A 1XTGB 2FYZA 1H88A 3B8EB 1QL1A 1T3UA 2JEEA 3RK3D 3L35A 3OA7A 1JOCA 3RK2C 4JYBA 5BU8B 1KILD 1HBWA 3G3ZA 4WY4C 5AVXB 3B5NB 3HUSC 5AVUB 1T2KC 1JMMA 1G1JA 3U1CA 3RK2B 1GK4A 1NTKK 1OXZA 4JYCA 1LTAC 1YTZI 5KJ7D 4HYTB 1JTHA 3M0DC 1DEBA 2N9BA 1RF1B 1DH3A 3HD7D 2HODB 1E5WA 1GW3A 3M06A 1S9KE 3OAKA 2JJLA 1RE3C 2IPPA 4RESB 3NXSA 2NPSC 1VDFA 5AVZB 5BVZA 2N1TC 1HVVA 4WB4A 2FXMA 3BATA 1LT9B 2R32A 5APUA 3H32B 3B5NA 3LW5H 2Q9IA 2YNYA 3HTKA 2A45G 1NAFA 3R2PA 3RL0C 1M1JB 3VYIA 3EFGA 2HPCA 5AW0B 5AW3B 2P7JA 2WSCH 1JCDA 3HUSA 1HWTC 5AVSB 4C7NA 3MGNA 1RF1A 5CCGD 1MZ9A 5CJ4A 2XU6A 1FAVA 3SWYA 2A45H 4GKGA 5APWA 1SFCA 2WPRA 2J58A 4IFMA 3VP9A 3V4QA 3I5CA 2Z4EA 1IFMA 2KYVA 1RY3A 4AUWA 1NTZK 5AW7B 3KPEA 3SWFA 1J2JB 4W7ZA 2WPSA 1KZUB 2Z5HA 2IFNA 2HPCB 2PP6A 1LTJC 1JO5A 5KJ7A 1FZCB 1FBMA 1FZBA 3EQ2A 2Q3IA 1ZR4A 1GL2B 1JY2N 2R5DA 4JF7A 2WITA 1N7SC 1MFZA 3V2PA 1SFCC 3B5ND 5AVQB 2N1TB 2CPSA 1FZCC 1N7LA 1JUNA 5CCHD 2PAJA 3V4WA 1G1IA 2HYNA 1L0LK 2QM8A 4IFDK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NH4 A;  1HH0 A;  1HGZ A;  1IFI A;  2MJZ A;  2C0W A;  2CPS A;  1IFD A;  2C0X A;  2CPB A;  1FDM A;  1IFJ A;  1HGV A; 
#chains in the Genus database with same CATH topology
 5AW8 B;  3GF7 A;  2B9B A;  1L0N G;  5APT A;  2GUV A;  2PRR A;  1PPJ D;  2ZT9 C;  5GTH H;  3RL0 B;  1M1J C;  3IAO A;  1A02 F;  1ZR2 A;  3I56 P;  1PL5 A;  1NJI Q;  3A5T A;  1LTJ A;  1EDJ A;  2FBW C;  3RGU A;  2QJP C;  1PZQ A;  3H1I D;  4MN4 C;  1K9M Q;  3WU2 E;  4EOT A;  4LGD E;  1H8A A;  2D2C C;  1YHQ P;  1NKZ B;  4L73 A;  4WBA A;  3M9B A;  3G9R A;  4GT1 A;  1SQB J;  1T6A A;  1NGM B;  4UB8 E;  2XDJ A;  2IYO A;  1GL2 A;  1CSB A;  1ZRT D;  1HJB A;  2E75 B;  2C9N Y;  1PIX A;  1EZV D;  4KT0 J;  3B71 A;  3ITK A;  3CCE P;  1X9V A;  2A45 I;  2XV5 A;  2IBZ D;  1YYC A;  2W6A A;  3KQG A;  1L0L E;  2NPS A;  3KYQ A;  2OYO A;  3MIW A;  1HGV A;  1WT6 A;  1ZXG A;  2B87 B;  2BCC E;  2FYN C;  3AE3 C;  3E7K A;  1SQB K;  3M0D A;  4N78 E;  4PV1 B;  2R3C A;  5AVW B;  4EYY Q;  4AYC A;  5KJ7 C;  1NVO A;  1BDC A;  1KYO E;  2AXT E;  1PV3 A;  2O01 N;  2P10 A;  1Q90 D;  2KI7 B;  2KSJ A;  2Z5I A;  3BCC E;  3JCU E;  1NYH A;  3PLN A;  4H13 B;  4ZKU A;  2J59 M;  5GTI E;  1IFP A;  4HB1 A;  3HE4 A;  2KLU A;  4BRY A;  3A0B E;  2QJK B;  3V2N A;  1LT1 A;  3TK1 A;  1SQP D;  1SQX J;  1YBK A;  2ZFC A;  1IK7 A;  3NMD A;  4IL6 E;  1NTM K;  1JNM A;  1NKN A;  2Y0E A;  4K3A A;  4JQ0 D;  2QM7 A;  1N73 C;  1URQ D;  3H1H J;  4YXD C;  2YMY A;  1BCC E;  1M1J A;  1SQX G;  1KFN A;  1FDO A;  3L71 D;  1R8E A;  2H7H A;  1LTJ B;  1HH0 A;  2QE7 H;  3IF4 A;  3C9I A;  1S5L E;  2IFM A;  2POH A;  3H1I J;  5KLV D;  3CC7 P;  2Y0C A;  2ZVO B;  2QJK C;  3HE5 A;  3H1K D;  4OH8 B;  1BCC D;  3L71 E;  2BAS A;  4C7N B;  1X79 B;  1NO4 A;  2BEQ D;  3A7O A;  2W83 C;  1LWU B;  1S3J A;  1XTC C;  2XNX A;  4UB8 H;  1SLQ A;  1HF9 A;  4OGQ C;  3S1K A;  1BSN A;  2MJZ A;  1UIX A;  3L37 A;  1VQ4 P;  3N7N A;  2R44 A;  3MZW B;  4I7Z C;  3AE6 C;  2IZ1 A;  2FYU E;  4UB6 E;  5CJ0 A;  2R5B A;  1N86 A;  1SFC B;  4IFF A;  2FYU G;  1LNQ A;  2NPS D;  2L5G B;  4N3Y B;  2C0W A;  2ZAE B;  3CX5 E;  2OYH B;  1BE3 G;  1OW7 A;  3D6Z A;  3L71 G;  1VQP P;  1KN7 A;  2K9Y A;  4LLH A;  1L0L G;  3TNU A;  5E79 H;  1TU3 F;  1S2E A;  3OW2 O;  1VQ8 P;  1SQV D;  3VN0 A;  3GHG B;  2W27 A;  1NTK G;  3L72 J;  1CI6 A;  1LP1 A;  1BE3 J;  4GIF A;  1GK6 A;  1KIL A;  3HE4 B;  4LC1 A;  4I1L A;  5AVV B;  3RK3 C;  2XND H;  1U7M A;  3IR9 A;  1DEE G;  1L4A B;  3N4X A;  1PP9 E;  5L8R J;  1JMB A;  1AVY A;  2WVR A;  1NTZ D;  3JC2 2;  1LTS C;  2GUS A;  4M3L A;  5K5G B;  1N73 A;  5KAF H;  3H1L J;  2NRG A;  1VQ9 P;  1BE3 E;  1MUU A;  1URQ C;  4WY4 D;  4TT3 H;  3BAS A;  1FZG A;  2FFD C;  3HRN A;  3TYY A;  1NTZ E;  3U59 A;  2WT7 A;  2IBZ G;  1PP9 J;  3HE5 B;  4C7R A;  1W5C E;  3WUT A;  1OWA A;  2WSF J;  1NH4 A;  3BCC G;  2WSC J;  3U1A A;  1H89 A;  1U7J A;  1N7S A;  2E75 C;  1ZN5 A;  3P32 A;  4KJM A;  2YIU B;  2V4H A;  1PFI A;  3R4Y A;  2RN0 A;  1U57 A;  4PJ0 H;  1VQN P;  1L0N K;  5AW5 B;  3W67 A;  3H1I G;  1URQ B;  3C8V A;  3EWK A;  2V7Q J;  1AQT A;  2AEM A;  2FFD B;  3P8C E;  4IL6 X;  1KIL E;  3QWO C;  5AVY B;  5KLI C;  5KAI H;  2OYH A;  4EIJ A;  1T2K D;  1PPJ G;  1RE4 A;  2OAR A;  3MD0 A;  2V7Q H;  2E74 B;  1IJD B;  2R3S A;  2W6J H;  1RE3 A;  2B89 A;  3HD7 C;  4H0L B;  4L76 A;  4H0L D;  3CXH H;  1RQV A;  5APQ A;  1KB9 H;  1RF0 A;  1VF5 B;  3GHG A;  3P8C D;  1CI6 B;  1LP1 B;  1P84 H;  3HTK B;  3MHV A;  3JCU H;  5AVR B;  2KB7 P;  5GTI H;  2K88 A;  2M5A A;  2WMM A;  1H0T B;  1EZV I;  3L74 E;  2E42 A;  2O1K A;  2ZJS E;  2WSF H;  2I1J A;  2QJY C;  1JY3 O;  3E1I A;  1X22 A;  1OW6 A;  4CPG A;  2E74 C;  1NHL A;  2W8Z A;  1RF1 C;  1DX7 A;  1YQ4 C;  1J1D C;  2AEF A;  1NU1 J;  5TJH A;  1HJ0 A;  2WWW A;  2XZR A;  3Q5S A;  3L75 G;  1J1E C;  3B4S A;  1FU1 A;  1KIL C;  4NPF X;  2K37 A;  2WT7 B;  3G4S P;  3FGA D;  1S9K D;  4C46 A;  3L75 J;  4WY4 B;  3CCJ P;  2Y9Y A;  1RQU A;  4PD4 D;  2O1J A;  1S4X A;  5AW1 B;  2NPS B;  3W68 A;  4D6T G;  5B5E H;  1FZA A;  2JKV A;  4HKZ H;  1P84 D;  1KB9 D;  2WSE H;  2OYH C;  2KLV A;  2H8P D;  1J1E B;  1Q2N A;  4KHX A;  4PD4 E;  3L75 E;  1M90 Q;  3CMA P;  3CXH I;  2AXC A;  1Z56 A;  2KNC B;  2Q3E A;  3IFM A;  4AQR D;  2D2C D;  1FDM A;  1X8Y A;  3AEA C;  3AEC C;  3K5B A;  1KB9 E;  4RJT A;  4H44 B;  4QMA A;  2QEX P;  1BCC G;  1JY3 P;  1NTZ G;  3CWB G;  4L75 A;  1SQB E;  3VMX A;  2E5Y A;  1AV1 A;  1SQQ K;  5KKZ B;  3MP7 B;  1OIP A;  1JY2 P;  1OVU A;  2Q1K A;  1RHZ B;  2OQQ A;  3L74 J;  3E1R A;  4U3F G;  1IC2 A;  2RKL A;  3AEB C;  3OJA B;  3PJS K;  4YTP C;  5M1B A;  5GTH E;  3BRV B;  1NAY A;  1FOS E;  1GU4 A;  2HG5 D;  4XA4 A;  2YMK A;  1NWQ A;  2WSE J;  2WZ7 A;  2ZT9 D;  2C9L Y;  4DCK A;  3H1H D;  2FKW B;  5EFW B;  4R4M A;  3RK3 E;  2O01 H;  1LT9 C;  2JO1 A;  2BCC G;  3QH9 A;  5B66 E;  1VQO P;  2QJP B;  3RBX A;  1FZF A;  1FJK A;  2M8R A;  3CWB D;  5KLV J;  2JWA A;  3PTZ A;  2W6B A;  3H6P A;  1BGY G;  5CCH A;  2M3B A;  1LTI C;  1ZV8 A;  4K35 A;  3TGU E;  3AE8 C;  2QA4 P;  1Q82 Q;  3RL0 D;  1M57 D;  3F89 A;  1YJW P;  1WRG A;  1GD2 E;  4Y28 J;  1VF5 C;  3RK2 D;  2M3E A;  1IO4 A;  2IDB A;  3EFF K;  2OYI A;  2IX7 C;  1KYO I;  1SQV K;  2P2U A;  1R5S A;  3H1K E;  3L36 A;  1OVR A;  3MUD A;  3KXD A;  5APX A;  1G2C A;  1QVG O;  2AEJ A;  2UWJ E;  2KOG A;  2DW3 A;  4D6T D;  2E76 B;  1VQ7 P;  3B5N C;  3HUS B;  1M7L A;  3NTN A;  2CK3 H;  1FZC A;  3AE5 C;  2KXP B;  2FYU J;  4Z1M H;  2Y9Z A;  3H1J E;  3L74 D;  2YKP A;  3AE1 C;  1NTM D;  1IFJ A;  1OX3 A;  1QEX A;  1LTG C;  2GA1 A;  1YTZ T;  2JP3 A;  1N7S B;  2PFX A;  2JDI H;  5TIS H;  4OGQ D;  3WUU A;  3TDK A;  1LT9 A;  1FC2 C;  3L73 G;  1QL2 A;  2KS1 A;  1EZV G;  2B87 A;  3KZI H;  3H32 A;  3S4R A;  4B86 A;  1JY3 N;  2QVA A;  1URQ A;  1KV4 A;  1KTM A;  3LW5 J;  3H1J G;  3M0A A;  4I6M C;  2H88 C;  2YO3 A;  4DT0 A;  2J5U A;  1ZLL A;  5CMZ A;  4RKU J;  1S5L X;  4DOJ A;  1E79 H;  1HUC A;  4OGQ B;  3L4F A;  1MV8 A;  1DIP A;  3AE7 C;  2IZ0 A;  4Y99 B;  1FJP A;  3CL3 D;  2LXC B;  4L74 A;  3TSI A;  3CPW O;  3Q1M A;  2PGD A;  4PD4 H;  5KLV E;  1CZQ A;  1YIJ P;  1VQK P;  2OTK E;  3VTP C;  3BCC J;  5E79 E;  2E5T A;  2Q7C A;  2OYI C;  2G8Y A;  2N1T D;  3M9Q A;  1PP9 G;  2KSE A;  5APV A;  4D6T J;  5CCG A;  5KKZ C;  2KUB A;  2P1J A;  3VMZ A;  1IK9 A;  3PP5 A;  4WWI A;  3CCQ P;  1SQB D;  2ZYA A;  3L70 D;  1YQ3 C;  4XE5 B;  1RE4 C;  2WPQ A;  2XKM A;  5CCH C;  1WMK A;  4Y99 C;  1EDI A;  1Q81 Q;  4ZNC A;  1IFN A;  1SQQ J;  1BCC J;  3BRT B;  4N6J A;  2KZI A;  4TLF A;  5KAF E;  1T3J A;  1SFC D;  3WMM 0;  3MTU E;  1M56 D;  1SQX K;  4JPZ B;  4HJG H;  5AW9 B;  3T97 B;  2QSI A;  3II6 A;  1MKM A;  1QGK B;  3VOP A;  4W7Y A;  3S9O A;  4ZKP A;  4WY4 A;  4ASV A;  1GDT A;  1K73 Q;  3H1J J;  3Q5P A;  1NTK D;  1PGP A;  2HFE D;  2FYN B;  3KZI E;  1KD1 Q;  1L0L D;  1AFO A;  3V5B A;  1GZL A;  1IFD A;  4U3F E;  3V2R A;  1LJ2 A;  1OVV A;  5APS A;  1N7S D;  1K04 A;  3M9H A;  5B66 H;  4OWF A;  3TNU B;  1L4A D;  1USD A;  3CWB E;  2ZVN B;  1KMI Z;  2QG4 A;  1IFI A;  1VQL P;  1L0N E;  4ASW A;  2ZXE B;  3A2A A;  3CCR P;  1JTH B;  5KAI E;  2VRS A;  4HH2 A;  4NPE A;  1AQ5 A;  5KTB A;  1ZP0 C;  4XFJ A;  2M0B A;  5AW2 B;  5CCG C;  1HTL C;  1SQX E;  2I8D A;  2WTY A;  1GTW A;  1VL2 A;  2FYU K;  2WQY C;  1N73 B;  2HOD A;  3VP8 A;  1NU1 K;  2E76 C;  2HR3 A;  3TGU G;  5KLI B;  1NTK J;  2O3J A;  3L72 G;  3H1L D;  1BGY E;  1PGJ A;  2HLO A;  2ITA A;  3SWK A;  5KLV G;  3HD7 B;  3CI9 A;  4GDO A;  3GLM A;  4H0L C;  5AW4 B;  5AW6 B;  5KLV K;  2BCC D;  2K1A A;  4N78 D;  2NZ2 A;  4PV1 D;  2K9J A;  1Y47 A;  3H1H G;  3H1I E;  1JCC A;  1LWU C;  1GU5 A;  2I1K A;  4DZO A;  3CCV P;  1EDL A;  1AA0 A;  1KQL A;  2N1T A;  1KB9 I;  1BGY J;  1VPC A;  2YO2 A;  4JBZ A;  1SQQ G;  3SFD C;  1A02 J;  1FOS F;  1Y9B A;  4H13 C;  1KFM A;  3JSV C;  3AEG C;  3V2Q A;  4O9B A;  1S1C X;  2FFD A;  1SQP K;  1W2E A;  1J1D B;  2H43 A;  1BDD A;  1SQP G;  3D6Y A;  1GL2 C;  1KIL B;  1M8O B;  2A06 D;  2YKO A;  5B5E E;  5BU5 A;  2RH0 A;  1ZME C;  2LKM A;  1RF0 C;  1T8Z A;  2A06 G;  3GHG C;  2SPZ A;  4PJ0 E;  1NOH A;  3CX5 I;  4I2L C;  4W80 A;  3CLQ A;  3RK3 B;  3VMY A;  1L4A C;  4U3F J;  3O6Q A;  5H2F H;  2OYI B;  2P58 A;  1L0N J;  4OVN F;  2ZXX A;  1SQB G;  3GMA A;  1SP4 A;  2E43 A;  1EC5 A;  1G2C B;  2JR8 A;  1KYO H;  2AXT H;  1PP9 D;  2YKQ A;  3T97 A;  3UIA A;  1HGZ A;  1YJN P;  3LID A;  1M1K Q;  3L73 J;  1EQ7 A;  2E76 D;  3HD7 A;  5APY A;  2BCC J;  1NTK E;  4H44 C;  1LWU A;  1KQS O;  4I7Z B;  2JWD A;  1Q7Y Q;  3P8M C;  3CX5 D;  2KP8 A;  2K9J B;  2KIK A;  3AE2 C;  2H89 C;  4YPC A;  1CW5 A;  2Q6Q A;  4NPD A;  3H1L G;  5AVT B;  2C0X A;  3TGU D;  5CHX A;  1NU1 E;  1NU1 G;  1LTT C;  1SVF A;  3CD6 P;  2Y0D A;  3H1H E;  3NFQ A;  1S5L H;  3KDP B;  3M91 A;  1OZH A;  2D2C B;  3A3Y B;  4H13 D;  1PGO A;  2P67 A;  1FS0 E;  3LIE A;  3O8Z A;  2YXQ B;  2Q5U A;  1SQV J;  2K3R A;  3ABV C;  1QLE D;  3D71 A;  3ZDM A;  3P7K A;  3GF3 A;  2GM4 A;  1GL2 D;  1L4A A;  1JY2 O;  1FE6 A;  1LTB C;  2CPB A;  1S72 P;  2BEZ F;  1FZE A;  1N2D C;  1SQP E;  3Q3D A;  3L74 G;  1LGH B;  1GW4 A;  1XTG B;  2FYZ A;  2MKV A;  1H88 A;  4GOF A;  1DD3 A;  1ZRT E;  3A0H E;  3B8E B;  2KK7 A;  3CX5 H;  1QL1 A;  1T3U A;  3PHL A;  1ZW0 A;  1OMI A;  1PPJ E;  2JEE A;  3FX0 A;  3RK3 D;  3Q5R A;  3CC4 P;  3L35 A;  4YXW H;  3OA7 A;  1JOC A;  2YIU C;  1VF5 D;  3RK2 C;  1BE3 D;  3FWL A;  3BVH A;  4JYB A;  3AED C;  5BU8 B;  1KYO D;  1JB0 J;  1KIL D;  1HBW A;  3BCC D;  1AVO A;  1DD4 A;  3L70 G;  1KOR A;  3G3Z A;  4WY4 C;  5AVX B;  1BSH A;  3B5N B;  3HUS C;  5AVU B;  1T2K C;  1Q86 Q;  1JMM A;  1G1J A;  2W90 A;  3AE4 C;  3IN6 A;  3L73 E;  3U1C A;  1GMJ A;  2KNC A;  3RK2 B;  2E75 D;  1GK4 A;  1NTK K;  1L2P A;  1OXZ A;  3F5H A;  3H1K G;  3PRJ A;  4JYC A;  3CCU P;  2QIW A;  5DJU B;  1N8R Q;  4DJG A;  1LTA C;  1QX8 A;  1YTZ I;  3TGU J;  3D70 A;  2N9Y B;  5KJ7 D;  1P84 I;  4HYT B;  2QJY B;  2QRX A;  3H1J D;  1JTH A;  3MUD C;  3M0D C;  1DEB A;  2N9B A;  1RF1 B;  1DH3 A;  1KQG B;  3A0H H;  3HD7 D;  2HOD B;  1E5W A;  2L91 A;  1GW3 A;  3M06 A;  1S9K E;  3OAK A;  5H2F E;  5C39 A;  2JJL A;  2FYU D;  3RBZ A;  1VQ6 P;  1SS1 A;  1NU1 D;  1RE3 C;  1SQP J;  1NTM G;  2IPP A;  4RES B;  1USE A;  1P84 E;  4ZMD A;  3NXS A;  2NPS C;  1VDF A;  1QVF O;  3USS A;  5AVZ B;  5BVZ A;  2N1T C;  1HVV A;  3L71 J;  3CWB J;  2FXM A;  4WB4 A;  1OFC X;  3CCL P;  1YIT P;  3BAT A;  1LT9 B;  2R32 A;  4EI2 A;  1X0T A;  2KS1 B;  3WUV A;  5APU A;  2B88 A;  1FDI A;  3B5N A;  3H32 B;  2IYP A;  3SSU A;  1YJ9 P;  1AJY A;  3Q2Y A;  3LW5 H;  2Q9I A;  1UII A;  3FWN A;  2YNY A;  1KC8 Q;  3G6E P;  1SQX D;  3HTK A;  2A45 G;  1VQM P;  1NAF A;  2M5A B;  4PD4 I;  1H0T A;  3R2P A;  2ZT9 B;  2LXB A;  5TIS E;  1M1J B;  3RL0 C;  3VYI A;  1BGY D;  3EFG A;  3L75 D;  2HPC A;  5AW0 B;  4U7J A;  5AW3 B;  3RL0 g;  2G3A A;  2P7J A;  2WSC H;  1JCD A;  3HUS A;  2OTL P;  1L0N D;  3O6Q B;  2WPV B;  3C1L A;  5AVS B;  2ZYG A;  1HWT C;  4C7N A;  3MGN A;  1RF1 A;  5CCG D;  3H1K J;  1MZ9 A;  5CJ4 A;  3VMA A;  2XU6 A;  1FAV A;  1NTM J;  2ZYD A;  4D6T E;  4A7P A;  1JM0 A;  4WVZ A;  3CC2 P;  3CCS P;  1KQF B;  3CCM P;  3H25 A;  3SWY A;  3H1L E;  2A45 H;  1SQQ D;  3CME P;  4GKG A;  3FXE A;  5APW A;  2WSS H;  1OW8 A;  1SFC A;  4BXL A;  2WPR A;  4PV1 C;  4U3F D;  2J58 A;  4IFM A;  1NTM E;  1Y8A A;  1NTZ J;  2O01 J;  3CXH E;  2KZJ A;  3AE9 C;  4GOD A;  1EZV E;  3VP9 A;  1SQQ E;  3PH0 A;  2IBZ E;  3V4Q A;  2FXO A;  1D7M A;  3GW6 A;  3I5C A;  4IOI H;  1W2B O;  2Z4E A;  1IFM A;  3L72 D;  3TF5 A;  2KYV A;  1RY3 A;  3CXH D;  1ZOY C;  4AUW A;  1NTZ K;  5AW7 B;  3AEE C;  3KPE A;  3SWF A;  5CBN A;  1J2J B;  4W7Z A;  2OTJ P;  2LR2 A;  3I55 P;  2WPS A;  3KHU A;  1KZU B;  4H44 D;  2Z5H A;  3L72 E;  3AEF C;  2A06 E;  1PGQ A;  2RMZ A;  2IFN A;  3GG2 A;  4BWN A;  2HPC B;  2PP6 A;  1LTJ C;  1JO5 A;  5KJ7 A;  3L70 J;  3SFE C;  1L0L J;  1EXJ A;  3FXD A;  3WU2 H;  1FZC B;  1FBM A;  1FZB A;  1MFT A;  1K8A Q;  3EQ2 A;  2Q3I A;  1ZR4 A;  1GL2 B;  4UB6 H;  1JY2 N;  2R5D A;  1R5L A;  4JF7 A;  1K05 A;  2WIT A;  1N7S C;  2OGU A;  1MFZ A;  3L70 E;  4EDF A;  3V2P A;  1SFC C;  3B5N D;  1SQV G;  5AVQ B;  5CBO A;  4R4L A;  2FXP A;  1EDK A;  1SQV E;  2E74 D;  2N1T B;  2CPS A;  1FZC C;  2FY8 A;  1JEK A;  2YXR B;  1N7L A;  4GOE A;  4RO0 A;  5DJT B;  1VQ5 P;  3L73 D;  5CCH D;  1JUN A;  3V6I A;  1IZN B;  1RH5 B;  2IBZ I;  2PAJ A;  3V4W A;  4BRY B;  1EXI A;  3A0B H;  1G1I A;  2HYN A;  1YI2 P;  1L0L K;  2QM8 A;  4IFD K;  4IL6 H;  3G71 P; 
#chains in the Genus database with same CATH homology
 5AW8 B;  5APT A;  2GUV A;  1A02 F;  3RL0 B;  1M1J C;  1ZR2 A;  3A5T A;  1LTJ A;  4EOT A;  4LGD E;  1H8A A;  1NKZ B;  4WBA A;  3M9B A;  4GT1 A;  2XDJ A;  1GL2 A;  1CSB A;  1HJB A;  2C9N Y;  1X9V A;  2A45 I;  2XV5 A;  3KQG A;  1YYC A;  2W6A A;  3KYQ A;  2NPS A;  3BVH A;  3MIW A;  1HGV A;  1WT6 A;  4N78 E;  3T97 A;  3M0D A;  5AVW B;  1SQB K;  2R3C A;  5KJ7 C;  4AYC A;  3V2N A;  2Z5I A;  5CMZ A;  1FDM A;  2KSJ A;  4ZKU A;  2J59 M;  3HE4 A;  3TK1 A;  2ZFC A;  3NMD A;  1NTM K;  1JNM A;  1NKN A;  2QM7 A;  1N73 C;  1URQ D;  2YMY A;  1M1J A;  1KFN A;  2H7H A;  1LTJ B;  1HH0 A;  3C9I A;  2IFM A;  2POH A;  3HE5 A;  4OH8 B;  4C7N B;  2BAS A;  1X79 B;  1NO4 A;  3A7O A;  1LWU B;  1XTC C;  2XNX A;  1SLQ A;  2MJZ A;  3L37 A;  3N7N A;  5CJ0 A;  2R5B A;  1N86 A;  1SFC B;  4IFF A;  2NPS D;  2L5G B;  4N3Y B;  2C0W A;  2OYH B;  4LLH A;  3TNU A;  3VN0 A;  3GHG B;  2W27 A;  4GIF A;  4LC1 A;  1CI6 A;  1AQ5 A;  5AVV B;  1GK6 A;  1KIL A;  3HE4 B;  4I1L A;  3RK3 C;  3IR9 A;  1L4A B;  3N4X A;  1N73 A;  1LTS C;  2GUS A;  4M3L A;  1MUU A;  1URQ C;  4WY4 D;  3BAS A;  1FZG A;  2FFD C;  3HRN A;  3TYY A;  3U59 A;  2WT7 A;  3HE5 B;  4C7R A;  1OWA A;  1NH4 A;  3U1A A;  1H89 A;  1N7S A;  3P32 A;  1ZN5 A;  1PFI A;  1L0N K;  5AW5 B;  1URQ B;  2FFD B;  3P8C E;  5AVY B;  2OYH A;  4EIJ A;  1T2K D;  3MD0 A;  1RE4 A;  2OAR A;  4I6M C;  1IJD B;  3HD7 C;  1RE3 A;  5APQ A;  3P8C D;  1RF0 A;  3GHG A;  1CI6 B;  3HTK B;  5AVR B;  2KB7 P;  2E42 A;  2O1K A;  2WSF H;  2I1J A;  1JY3 O;  3E1I A;  1DX7 A;  1NHL A;  1RF1 C;  1J1D C;  2WWW A;  2XZR A;  1J1E C;  1FU1 A;  1KIL C;  2WT7 B;  1S9K D;  4C46 A;  4WY4 B;  5AW1 B;  2O1J A;  2NPS B;  1FZA A;  2WSE H;  2OYH C;  2KLV A;  2H8P D;  1J1E B;  4KHX A;  1Z56 A;  3IFM A;  4AQR D;  1X8Y A;  1JY3 P;  3VMX A;  1SQQ K;  1JY2 P;  1IC2 A;  3OJA B;  3BRV B;  1FOS E;  1GU4 A;  2HG5 D;  4XA4 A;  1NWQ A;  2WZ7 A;  2C9L Y;  2FKW B;  2O01 H;  1LT9 C;  1FZF A;  1FJK A;  2M8R A;  2W6B A;  3H6P A;  5CCH A;  2M3B A;  1LTI C;  1ZV8 A;  3RL0 D;  1WRG A;  1GD2 E;  3RK2 D;  1IO4 A;  2OYI A;  2IX7 C;  1SQV K;  3L36 A;  2P2U A;  3MUD A;  5APX A;  1G2C A;  2KOG A;  3B5N C;  3HUS B;  1M7L A;  3NTN A;  1FZC A;  2YKP A;  1IFJ A;  1LTG C;  1YTZ T;  1N7S B;  1LT9 A;  1QL2 A;  3H32 A;  4B86 A;  1JY3 N;  1URQ A;  3M0A A;  2YO3 A;  1ZLL A;  4DOJ A;  1HUC A;  3L4F A;  1MV8 A;  1FJP A;  4Y99 B;  3CL3 D;  3TSI A;  1CZQ A;  3VTP C;  2OYI C;  2Q7C A;  2N1T D;  3M9Q A;  5APV A;  5CCG A;  2P1J A;  3VMZ A;  1IK9 A;  3PP5 A;  4XE5 B;  5CCH C;  1RE4 C;  2WPQ A;  2XKM A;  4Y99 C;  1IFN A;  3BRT B;  4N6J A;  1T3J A;  1SFC D;  3WMM 0;  3MTU E;  1SQX K;  5AW9 B;  3II6 A;  3VOP A;  4W7Y A;  4ZKP A;  1GDT A;  4WY4 A;  2HFE D;  1AFO A;  3V5B A;  1GZL A;  1IFD A;  3V2R A;  5APS A;  1N7S D;  3M9H A;  3TNU B;  1L4A D;  1IFI A;  2ZXE B;  3A2A A;  1JTH B;  2VRS A;  4HH2 A;  5KTB A;  2WTY A;  5AW2 B;  5CCG C;  1GTW A;  1HTL C;  1N73 B;  2FYU K;  2HOD A;  3VP8 A;  1NU1 K;  2HLO A;  3HD7 B;  3CI9 A;  5AW4 B;  5AW6 B;  5KLV K;  4N78 D;  1JCC A;  1LWU C;  1GU5 A;  2I1K A;  4DZO A;  1KQL A;  2N1T A;  1VPC A;  2YO2 A;  1FOS F;  1A02 J;  1KFM A;  3V2Q A;  4O9B A;  2FFD A;  1SQP K;  1W2E A;  1J1D B;  2H43 A;  1GL2 C;  1KIL B;  2YKO A;  5BU5 A;  2LKM A;  1RF0 C;  1T8Z A;  3GHG C;  4W80 A;  1NOH A;  4I2L C;  3RK3 B;  3CLQ A;  3VMY A;  1L4A C;  2OYI B;  2E43 A;  1SP4 A;  1G2C B;  2YKQ A;  3UIA A;  1HGZ A;  3LID A;  1EQ7 A;  3HD7 A;  5APY A;  1LWU A;  3P8M C;  2KP8 A;  1CW5 A;  5AVT B;  2C0X A;  5CHX A;  1LTT C;  1SVF A;  3NFQ A;  3KDP B;  3M91 A;  3A3Y B;  3O8Z A;  2P67 A;  3LIE A;  2Q5U A;  3P7K A;  2GM4 A;  1GL2 D;  1L4A A;  1JY2 O;  2CPB A;  1LTB C;  1FZE A;  1N2D C;  1LGH B;  1GW4 A;  1XTG B;  2FYZ A;  1H88 A;  3B8E B;  1QL1 A;  1T3U A;  2JEE A;  3RK3 D;  3L35 A;  3OA7 A;  1JOC A;  3RK2 C;  4JYB A;  5BU8 B;  1KIL D;  1HBW A;  3G3Z A;  4WY4 C;  5AVX B;  3B5N B;  3HUS C;  5AVU B;  1T2K C;  1JMM A;  1G1J A;  3U1C A;  3RK2 B;  1GK4 A;  1NTK K;  1OXZ A;  4JYC A;  1LTA C;  1YTZ I;  5KJ7 D;  4HYT B;  1JTH A;  3M0D C;  1DEB A;  2N9B A;  1RF1 B;  1DH3 A;  3HD7 D;  2HOD B;  1E5W A;  1GW3 A;  3M06 A;  1S9K E;  3OAK A;  2JJL A;  1RE3 C;  2IPP A;  4RES B;  3NXS A;  2NPS C;  1VDF A;  5AVZ B;  5BVZ A;  2N1T C;  1HVV A;  4WB4 A;  2FXM A;  3BAT A;  1LT9 B;  2R32 A;  5APU A;  3H32 B;  3B5N A;  3LW5 H;  2Q9I A;  2YNY A;  3HTK A;  2A45 G;  1NAF A;  3R2P A;  3RL0 C;  1M1J B;  3VYI A;  3EFG A;  2HPC A;  5AW0 B;  5AW3 B;  2P7J A;  2WSC H;  1JCD A;  3HUS A;  1HWT C;  5AVS B;  4C7N A;  3MGN A;  1RF1 A;  5CCG D;  1MZ9 A;  5CJ4 A;  2XU6 A;  1FAV A;  3SWY A;  2A45 H;  4GKG A;  5APW A;  1SFC A;  2WPR A;  2J58 A;  4IFM A;  3VP9 A;  3V4Q A;  3I5C A;  2Z4E A;  1IFM A;  2KYV A;  1RY3 A;  4AUW A;  1NTZ K;  5AW7 B;  3KPE A;  3SWF A;  1J2J B;  4W7Z A;  2WPS A;  1KZU B;  2Z5H A;  2IFN A;  2HPC B;  2PP6 A;  1LTJ C;  1JO5 A;  5KJ7 A;  1FZC B;  1FBM A;  1FZB A;  3EQ2 A;  2Q3I A;  1ZR4 A;  1GL2 B;  1JY2 N;  2R5D A;  4JF7 A;  2WIT A;  1N7S C;  1MFZ A;  3V2P A;  1SFC C;  3B5N D;  5AVQ B;  2N1T B;  2CPS A;  1FZC C;  1N7L A;  1JUN A;  5CCH D;  2PAJ A;  3V4W A;  1G1I A;  2HYN A;  1L0L K;  2QM8 A;  4IFD K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...