1NH4A

Structure of the coat protein in fd filamentous bacteriophage particles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
44
structure length
44
Chain Sequence
b'PAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major coat protein
molecule tags Virus
publication title Structure of the coat protein in fd filamentous bacteriophage particles determined by solid-state NMR spectroscopy
pubmed doi rcsb
total genus 18
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nh4A00
2MJZA 1NH4A 1HH0A 2C0XA 2CPSA 1HGZA 2C0WA 1IFJA 1IFDA 1FDMA 2CPBA 1IFIA 1HGVA
chains in the Genus database with same CATH superfamily
2IFNA 1JMMA 2FYNB 3HD7A 1SQQD 3B71A 3L70E 1SQXG 1VL2A 2WSFH 3A7OA 3F5HA 4WY4C 3S4RA 1JNMA 4GIFA 4IL6X 1NJIQ 2N1TC 3D6YA 2KYVA 1SQQE 1YQ4C 2Y9YA 4PD4D 1IFPA 1H0TB 2FXMA 3CCEP 1G1IA 1VQ5P 2H43A 1VPCA 3N4XA 5CBNA 1YYCA 2LKMA 3BVHA 1BSHA 3OAKA 1MFZA 3P8CE 2HODB 4XE5B 3VTPC 4Z1MH 1BE3D 2VRSA 3GW6A 1T6AA 3MHVA 1AV1A 3VN0A 3H1HE 4C46A 5AW7B 1KB9H 4ASWA 2JEEA 1SQVE 1SS1A 1JY3N 2KNCA 2M3EA 2M5AB 1RY3A 3KZIH 4YXDC 2R32A 1QVFO 4DOJA 1EQ7A 1NU1D 5C39A 3Q1MA 3MIWA 3L36A 2NPSB 1YHQP 3CD6P 1IC2A 1KTMA 3AEDC 3TK1A 4Y99B 1HVVA 1KZUB 2P7JA 3VMXA 2GUVA 3KQGA 3PHLA 1N73A 3AE6C 1KMIZ 4PV1C 1KB9E 3M06A 1SQQG 2FYUJ 3E7KA 4XA4A 1OXZA 1KFNA 1GL2B 4PJ0E 1GK4A 1SQPK 3L73J 4A7PA 4BWNA 2K88A 1U57A 1G2CA 2O1JA 2Y9ZA 2KK7A 2XZRA 1IFMA 1JY3O 1L0LD 3AEAC 1SQBJ 5M1BA 2WT7A 3Q3DA 1AJYA 3L74E 1YQ3C 3BCCG 3CCLP 1NTMG 1NU1J 2DW3A 1SQBE 2J58A 3AE8C 3L72G 3TNUA 5KJ7C 5TISH 1NWQA 5AW5B 4K35A 1IZNB 2BEQD 2O1KA 3AE5C 4Y28J 3W67A 3L71J 1HGZA 4YXWH 3H1KD 2NPSD 1YJNP 1L4AA 3RK3E 1W2EA 2JWAA 1GU4A 1BE3E 2OTLP 1Q81Q 1LTAC 2O01J 1SQPD 3A5TA 3HE4A 3MZWB 4JYBA 2ZVNB 1N7SD 2N9BA 4HB1A 5AVTB 5AW3B 4EDFA 1VQOP 1EXJA 3H1LG 5H2FE 3B5ND 1BCCE 1PGQA 1SFCA 3IR9A 3WU2H 3SWKA 1X79B 1BCCJ 1EDJA 3HTKA 1W2BO 1OFCX 3B4SA 1VQ7P 3HD7C 3CCMP 1S5LX 2G8YA 3C9IA 3HUSB 1U7JA 4WWIA 1RHZB 5B5EH 1SQBK 4RESB 1CZQA 5APVA 2B87A 1HJBA 2W90A 3BCCE 3VMZA 3CI9A 2BCCD 1USEA 2KS1A 5CCHD 1OW6A 2FYZA 3H1LD 1NTZE 3M9QA 3PP5A 2FYNC 2YKPA 1IK9A 1SFCB 1RQUA 3KYQA 5KAIH 1RE3C 2D2CD 2R44A 3M9BA 1SQPE 2PP6A 3HTKB 3IN6A 3SSUA 1RH5B 3WMM0 4C7NA 4ZNCA 1JEKA 2NZ2A 3H1IJ 1X8YA 3PH0A 5DJTB 1QVGO 1URQA 1FZFA 3U59A 1OVRA 1WRGA 1L0NG 3K5BA 5AW4B 2FXPA 2OYOA 4U3FD 1KQFB 4H13C 4L75A 5KJ7D 3RL0C 2YXRB 3PRJA 4HH2A 3CL3D 4UB8E 1ZMEC 2Q9IA 1P84E 3FXEA 2HR3A 4M3LA 1P84I 1VQLP 4TLFA 3BRVB 1PP9D 2NPSC 1K04A 2R3CA 1DIPA 3C1LA 3V4QA 3NXSA 3TGUG 3IF4A 1ZLLA 3KZIE 1IFIA 1GW3A 1DD4A 2PAJA 1LTJC 1JY2O 2HLOA 1E5WA 1PL5A 2RN0A 1L2PA 2AEMA 5AVYB 3ZDMA 3RBXA 3CCUP 1FZAA 1VQMP 2FFDC 4DZOA 3G4SP 2KIKA 2Q6QA 2JKVA 3AE2C 2IBZD 4TT3H 1S9KE 2QIWA 1YTZI 4WY4D 3G71P 2N1TB 5DJUB 3V5BA 1SQVJ 2A45G 2KB7P 2POHA 3O6QA 4RKUJ 1ZV8A 2IYPA 3IFMA 2E76C 3M91A 3MTUE 5CCHA 2YIUB 1FZGA 5CHXA 1S9KD 1MKMA 1LTGC 1YJ9P 1FDOA 2FFDA 4WVZA 1RF0C 3GHGB 2YKQA 4UB8H 3MP7B 1QL2A 2XNDH 2QSIA 1PP9J 2E75D 2YKOA 3G9RA 3CC2P 1FZBA 1BGYD 4B86A 3V4WA 2KNCB 2M5AA 3GF3A 1Q86Q 3EQ2A 1VQPP 1OVUA 3GHGC 3Q5RA 1PGPA 2P58A 4HJGH 2N1TA 2CPBA 1T8ZA 2ZYGA 3JCUH 1OW7A 1S5LH 1KQLA 1NVOA 2OGUA 4H13D 1BE3G 1Q90D 4MN4C 2FYUG 1WMKA 3PLNA 2W6AA 2E5YA 2A45I 3AE3C 5GTIH 3L4FA 1DEEG 2WSEH 4BRYA 1L0LE 2NPSA 2R5BA 1EZVI 2IZ1A 3AE4C 3VOPA 2JDIH 4PD4H 5GTIE 1DH3A 3E1IA 1KN7A 1FC2C 2WT7B 1PGJA 3BASA 1FS0E 1NTME 3JCUE 3L72E 5AVRB 1JCDA 3II6A 1J2JB 2J59M 5BU5A 4LLHA 3SFDC 1MUUA 2XDJA 1NTMJ 3L72J 4OVNF 1VQ8P 5AVVB 5KLVJ 3PTZA 1PPJG 2FYUK 1HH0A 1URQD 1LTTC 2C9NY 3TGUD 4QMAA 2W6BA 2WSEJ 3L71E 3M0AA 1OW8A 1JB0J 2WITA 3CX5D 1N86A 1PGOA 3QH9A 4RJTA 3S1KA 3W68A 3WUVA 1GTWA 3L75G 1KQGB 5GTHH 4WB4A 4H0LC 5B66E 1NKZB 3CPWO 3JSVC 2ZXXA 2QJKC 2ZAEB 5APYA 3S9OA 4GKGA 5CJ4A 1P84H 1ZR4A 3H1JG 3CCRP 3ITKA 1Q2NA 2P10A 1X9VA 3AEGC 5KLVK 2PRRA 2V7QH 5KAFE 2BEZF 3TGUE 1J1DB 2OYHB 3CXHD 1HUCA 3ABVC 4W7ZA 2IFMA 2IDBA 2LXBA 4JPZB 4AQRD 1BGYE 2WZ7A 3RGUA 1NHLA 1L4AB 3FWNA 1JY2P 1T2KD 2KS1B 4I7ZC 4C7RA 3BCCJ 1M1JA 1SFCD 1EZVG 3HE4B 5AW0B 3R4YA 3JC22 3B5NC 3D71A 3USSA 1PPJE 1NTZJ 1N7SA 2BCCE 4NPFX 5L8RJ 3CC4P 1L0LJ 2H88C 2XNXA 3CC7P 1NU1K 3V2PA 2W6JH 3L70D 2IYOA 4LGDE 1NTKJ 3A2AA 4EOTA 1G1JA 1RF0A 1H8AA 3H1IE 3A0HE 3D70A 5B5EE 2AEFA 4EI2A 2E76B 3RK2C 3L74J 2QJYC 2R3SA 2Z5HA 1R8EA 2QJPC 1GU5A 2IBZE 3WU2E 3L75D 5AW6B 4OGQC 1JOCA 1NGMB 1JY2N 1N7SB 1SQPG 3Q5SA 2V4HA 1S72P 3CX5H 3L71D 3L37A 5KAIE 2E42A 5TJHA 3R2PA 1Y47A 4L73A 2KZJA 1FOSF 5APTA 5AW1B 2ITAA 1VQ4P 2A45H 4U3FJ 1NAYA 1OZHA 1P84D 2ZXEB 2Z4EA 1NTMD 3L72D 4GOFA 3RBZA 4D6TE 4D6TD 1FZCA 3CCJP 2GM4A 1CI6A 2ZT9B 4JQ0D 3CCVP 2E74B 1RF1B 5CMZA 2R5DA 1HBWA 1LGHB 2B89A 3C8VA 3H1IG 3U1CA 1S5LE 3CCSP 1KYOI 2J5UA 1OVVA 2MKVA 4KT0J 3RL0B 2YNYA 1VQKP 1SQVG 2SPZA 1IFDA 2Y0DA 2BCCJ 2UWJE 1NTKK 3QWOC 3H1JJ 5CCGC 2K9JA 1FBMA 1XTCC 2QVAA 2W27A 3L35A 4R4MA 1NTZK 3CLQA 2LR2A 4OWFA 3H25A 3KXDA 1RE3A 1OIPA 2KOGA 1EC5A 1LWUB 5TISE 3HD7B 1JM0A 3VMAA 3AEEC 5AVZB 3WUTA 1M56D 1VF5B 2WPRA 1ZP0C 2IX7C 2N1TD 2HPCA 2HYNA 2JP3A 2OARA 4N3YB 1BE3J 3M0DC 2JO1A 2I8DA 3MUDC 3G6EP 2H7HA 1GZLA 1L0NE 2Q3IA 1DD3A 2HODA 1AA0A 2KUBA 3I5CA 3AE1C 2WQYC 3CXHH 3L70J 1NTKG 2JJLA 2BASA 2WSCJ 2W8ZA 1FJKA 5BVZA 1KILE 2WPQA 1EDKA 1AFOA 2RKLA 3TYYA 1M1JC 2FFDB 1N2DC 1GMJA 1JY3P 3RL0D 3MGNA 2HFED 4WY4A 1JTHA 3L74D 2ZYAA 1PP9G 1KFMA 3H6PA 3L73E 4K3AA 4R4LA 1A02F 2KP8A 1MZ9A 2C9LY 1YIJP 3CWBG 3FGAD 3E1RA 5APWA 3Q5PA 3M9HA 2NRGA 1FZEA 4PV1D 2Y0CA 4U3FG 3CMAP 1LT1A 1NOHA 1JO5A 1KB9D 4YPCA 1AVYA 1KV4A 2D2CC 2V7QJ 3P8MC 1NYHA 3U1AA 1S2EA 1T3UA 2CPSA 2QE7H 2M8RA 1RE4A 2XU6A 4Y99C 1RF1A 1BGYJ 1M57D 1NTMK 4H44D 4NPDA 4UB6H 2WWWA 3FXDA 1EZVE 3L73D 3LW5H 1VDFA 3AECC 4H0LD 5E79H 3EFFK 1U7MA 1HGVA 2BCCG 2AXTH 2E76D 4JBZA 5AVXB 1NTZG 1AQ5A 1BDCA 3SWFA 5AVSB 1KILD 2P1JA 2B9BA 1L0NK 1QX8A 4UB6E 1CSBA 5AW9B 1LP1B 1FAVA 4D6TG 1N7LA 3CCQP 1KYOD 5APQA 5KLVD 1M1JB 1SQXJ 1BCCD 2QM8A 1N7SC 2K37A 3LW5J 1D7MA 3AEBC 4HKZH 3L75E 4OGQB 1SQXE 1NTZD 2A06G 3KHUA 1KYOE 5KLVE 3LIDA 2B88A 2G3AA 2RH0A 2ZVOB 3AE7C 3HE5B 3RK2B 1K73Q 1M1KQ 3H1KG 1AQTA 1YJWP 1ZOYC 1VF5D 2B87B 3FWLA 1HF9A 2A06D 5E79E 3H1HG 1LWUC 1PPJD 5EFWB 2Q3EA 3T97B 2WVRA 2YO2A 3CXHI 4OGQD 3A0BH 1L0LG 2WPVB 5KKZC 2WTYA 2M3BA 3A3YB 4C7NB 1H0TA 4I2LC 1L4AC 4PJ0H 3TF5A 1VQ9P 1LT9C 1GL2C 4N78E 2WSCH 4GT1A 2GUSA 1TU3F 3CXHE 1NH4A 1J1DC 3CWBJ 3EWKA 2E74C 3L74G 2E74D 2C0WA 4I6MC 2ZT9C 5KAFH 2O3JA 1Z56A 3TSIA 2L5GB 3UIAA 4OH8B 5KLVG 1SQQJ 1NTKE 3V2RA 1GK6A 1GDTA 1JMBA 2OYIC 1YBKA 4BRYB 4EYYQ 1H88A 4H0LB 1RE4C 1J1EB 1QL1A 5KLIC 4H44B 1RF1C 2QRXA 1NTKD 4YTPC 3FX0A 1MV8A 1E79H 1VQNP 3L75J 3VYIA 1PV3A 2M0BA 3IAOA 1NU1E 4GDOA 4JF7A 3V2QA 1N8RQ 2HPCB 3KPEA 3SWYA 4KHXA 1XTGB 1BDDA 2QJPB 1NAFA 4GOEA 4NPEA 1N73C 1URQC 1JUNA 1G2CB 2Q5UA 2OQQA 1SQQK 2QJYB 4KJMA 4ZKUA 1QEXA 1KQSO 1GD2E 1LTSC 1K05A 5AVWB 2KLVA 2IBZG 1KD1Q 1UIIA 3LIEA 4PD4E 3RL0g 1EDIA 4D6TJ 1VQ6P 3NFQA 2C0XA 3O6QB 4EIJA 1VF5C 4IOIH 4ZMDA 3H32A 3I55P 1KC8Q 1USDA 1ZRTE 2O01N 3B5NA 5B66H 5GTHE 4WY4B 3D6ZA 1HJ0A 4O9BA 1PFIA 2I1KA 3NMDA 2WMMA 1SQXD 3EFGA 1SQVD 3V6IA 1KILC 4I7ZB 2KI7B 3AE9C 1LTIC 4W80A 1DX7A 1Y8AA 1L4AD 2KXPB 2AEJA 3CWBE 2FYUE 1HWTC 2FYUD 4IL6E 1HTLC 2I1JA 3H1KE 2WSFJ 1JCCA 3B5NB 3M0DA 1LTBC 1KILB 2YXQB 4AYCA 3I56P 2KLUA 2QEXP 2QA4P 2N9YB 2E43A 2IBZI 4U7JA 2OTKE 2P2UA 3H1JE 1ZRTD 1SQBD 3PJSK 3Q2YA 1SQPJ 1PP9E 3HD7D 2Y0EA 3V2NA 2E5TA 2OYHC 3O8ZA 1JTHB 2PGDA 3A0HH 1SQXK 3AEFC 1SQVK 4L76A 2FXOA 1RQVA 1SP4A 2YMKA 2QJKB 1FZCB 1L0NJ 1EDLA 1URQB 1M90Q 2K9JB 2LXCB 1LJ2A 2KSJA 3B8EB 1FU1A 1CW5A 3CX5E 2KZIA 3P32A 1OMIA 4L74A 2H8PD 3GLMA 1GL2D 2ZFCA 4CPGA 2GA1A 1S3JA 2K3RA 2ZJSE 2XKMA 5BU8B 1S1CX 3GMAA 3TGUJ 5KLIB 2WPSA 3H1LE 1QLED 1BSNA 2RMZA 5APUA 4ASVA 5K5GB 1R5SA 2OYIB 2K1AA 1LWUA 1CI6B 3H1LJ 3NTNA 4DCKA 1AVOA 1L0LK 3F89A 3HRNA 4H13B 3GHGA 3H1ID 4PD4I 3TNUB 1IFNA 1NO4A 3VP8A 3OW2O 1IJDB 3CMEP 3GG2A 1LT9A 2FBWC 1W5CE 2E75C 3H1KJ 4N78D 2JWDA 3RK3B 2OYHA 3H32B 1Y9BA 1YITP 2MJZA 4RO0A 2L91A 1T2KC 3MUDA 4I1LA 1LP1A 5AVQB 1L0ND 3CX5I 3T97A 3WUUA 5KKZB 1SFCC 4DJGA 3H1HD 3A0BE 2YIUC 4IFDK 1X0TA 1KB9I 5CCGD 2A06E 1PIXA 3N7NA 4IFMA 3P8CD 5CJ0A 2E75B 3HUSA 3BCCD 3RK3C 3L71G 2HG5D 2KSEA 3KDPB 3RK3D 1K9MQ 1H89A 1K8AQ 1DEBA 3L70G 1EXIA 1KILA 1Q82Q 3HUSC 1ZXGA 2JR8A 1UIXA 2WSSH 4W7YA 2IZ0A 3RK2D 3VMYA 5CCGA 5CCHC 1FDMA 1LTJB 2CK3H 2FY8A 4HYTB 1EZVD 4WBAA 1KYOH 1M8OB 1X22A 1BCCG 3SFEC 4DT0A 1YTZT 1NKNA 4AUWA 1WT6A 1FJPA 2K9YA 1R5LA 2IPPA 5AW2B 3G3ZA 2W83C 4IFFA 3MD0A 4JYCA 3OA7A 4IL6H 1FDIA 1LNQA 3GF7A 5KJ7A 1N73B 4H44C 1FE6A 1LTJA 4LC1A 2YMYA 5AVUB 3VP9A 5KTBA 1Q7YQ 2OTJP 5APXA 1FZCC 3H1HJ 2QG4A 1KORA 2ZT9D 2P67A 3BRTB 1FOSE 1ZR2A 1IK7A 5AW8B 2AXTE 3L73G 1M7LA 1PZQA 1A02J 1J1EC 3TDKA 1SLQA 1IO4A 1GL2A 2YO3A 2XV5A 2QM7A 2Z5IA 3P7KA 1BGYG 4XFJA 4ZKPA 4GODA 1GW4A 2O01H 3H1JD 5APSA 1SQBG 1OX3A 4U3FE 1T3JA 2OYIA 2AXCA 5H2FH 2D2CB 2ZYDA 2Q1KA 1ZW0A 1NU1G 2FKWB 5CBOA 1S4XA 1QGKB 3BATA 2PFXA 1SVFA 3HE5A 4PV1B 1YI2P 1OWAA 3OJAB 1LT9B 3CWBD 2Q7CA 4BXLA 2H89C 1IFJA 4N6JA 1MFTA 1ZN5A
chains in the Genus database with same CATH topology
2IFNA 1JMMA 3HD7A 4WY4C 2WSFH 3A7OA 1JNMA 4GIFA 2N1TC 2KYVA 2FXMA 1G1IA 2H43A 1VPCA 3N4XA 1YYCA 2LKMA 3BVHA 3OAKA 1MFZA 3P8CE 2HODB 4XE5B 3VTPC 2VRSA 3VN0A 4C46A 5AW7B 2JEEA 1JY3N 1RY3A 2R32A 4DOJA 1EQ7A 3MIWA 3L36A 2NPSB 1IC2A 3TK1A 4Y99B 1HVVA 1KZUB 2P7JA 3VMXA 2GUVA 3KQGA 1N73A 3M06A 4XA4A 1OXZA 1KFNA 1GL2B 1GK4A 1SQPK 1G2CA 2O1JA 2XZRA 1IFMA 1JY3O 2WT7A 2J58A 3TNUA 5KJ7C 1NWQA 5AW5B 2O1KA 1HGZA 2NPSD 1GU4A 1L4AA 1W2EA 1LTAC 3A5TA 3HE4A 4JYBA 1N7SD 2N9BA 5AVTB 5AW3B 3B5ND 1SFCA 3IR9A 1X79B 3HTKA 3HD7C 3C9IA 3HUSB 1SQBK 4RESB 1CZQA 5APVA 1HJBA 3VMZA 3CI9A 5CCHD 2FYZA 3M9QA 3PP5A 2YKPA 1IK9A 1SFCB 3KYQA 1RE3C 3M9BA 3HTKB 2PP6A 3WMM0 4C7NA 1X8YA 1URQA 1FZFA 1WRGA 5AW4B 5KJ7D 3RL0C 4HH2A 3CL3D 2Q9IA 4M3LA 3BRVB 2NPSC 2R3CA 3V4QA 3NXSA 1ZLLA 1IFIA 1GW3A 2PAJA 1LTJC 1JY2O 2HLOA 1E5WA 5AVZB 5AVYB 1FZAA 4DZOA 1S9KE 1YTZI 4WY4D 2N1TB 3V5BA 2GM4A 2A45G 2KB7P 2POHA 1ZV8A 3IFMA 3M91A 5CCHA 3MTUE 1FZGA 5CHXA 1S9KD 1LTGC 2FFDA 1RF0C 3GHGB 2YKQA 1QL2A 2YKOA 1FZBA 4B86A 3V4WA 3EQ2A 3GHGC 2N1TA 2CPBA 1T8ZA 1KQLA 2W6AA 2A45I 3L4FA 2WSEH 2NPSA 2R5BA 3VOPA 1DH3A 3E1IA 3BASA 5AVRB 5BU5A 1JCDA 3II6A 1J2JB 2J59M 5KJ7A 4LLHA 1MUUA 2XDJA 5AVVB 2FYUK 1HH0A 1URQD 1LTTC 2C9NY 2W6BA 3M0AA 2WITA 1N86A 1GTWA 4WB4A 1NKZB 5APYA 1ZR4A 4GKGA 5CJ4A 1X9VA 5KLVK 2OYHB 1J1DB 1HUCA 4W7ZA 2IFMA 4AQRD 2WZ7A 1NHLA 1L4AB 1JY2P 1T2KD 4C7RA 1M1JA 1SFCD 5AW0B 3HE4B 3B5NC 1N7SA 2XNXA 1NU1K 3V2PA 4LGDE 4EOTA 3A2AA 1G1JA 1RF0A 1H8AA 3RK2C 2Z5HA 1GU5A 5AW6B 1JOCA 1JY2N 1N7SB 3L37A 2E42A 3R2PA 1FOSF 5APTA 5AW1B 2A45H 2ZXEB 2Z4EA 1FZCA 1CI6A 1RF1B 5CMZA 2R5DA 1HBWA 1LGHB 3U1CA 3RL0B 2YNYA 1IFDA 1NTKK 5CCGC 1FBMA 1XTCC 2W27A 3L35A 3CLQA 1NTZK 1RE3A 2KOGA 1LWUB 3HD7B 2WPRA 2IX7C 2N1TD 2HPCA 2HYNA 2OARA 4N3YB 3M0DC 1GZLA 2Q3IA 2HODA 3I5CA 2JJLA 2BASA 1FJKA 5BVZA 2WPQA 1AFOA 3TYYA 1M1JC 2FFDB 1N2DC 1JY3P 3RL0D 3MGNA 2HFED 4WY4A 1JTHA 1KFMA 3H6PA 1A02F 2KP8A 1MZ9A 2C9LY 5APWA 3M9HA 1FZEA 1NOHA 1JO5A 3P8MC 3U1AA 2CPSA 1T3UA 2M8RA 1RE4A 2XU6A 4Y99C 1RF1A 1NTMK 2WT7B 2WWWA 3LW5H 1VDFA 1HGVA 5AVXB 1AQ5A 3SWFA 5AVSB 1KILD 2P1JA 1L0NK 1CSBA 5AW9B 1FAVA 1N7LA 5APQA 1M1JB 2QM8A 2FFDC 1N7SC 3LIDA 3HE5B 3RK2B 1LWUC 2YO2A 2WTYA 2M3BA 3A3YB 4C7NB 4I2LC 1L4AC 1LT9C 1GL2C 4N78E 2WSCH 4GT1A 2GUSA 1NH4A 1J1DC 4I6MC 2C0WA 1Z56A 3TSIA 2L5GB 3UIAA 4OH8B 3V2RA 1GK6A 1GDTA 2OYIC 1H88A 1RE4C 1J1EB 1QL1A 1RF1C 1MV8A 3VYIA 4JF7A 3V2QA 2HPCB 3KPEA 3SWYA 4KHXA 1XTGB 1NAFA 1N73C 1URQC 1JUNA 1G2CB 2Q5UA 1SQQK 4ZKUA 1GD2E 1LTSC 5AVWB 2KLVA 3LIEA 3NFQA 2C0XA 4EIJA 3H32A 3B5NA 4WY4B 4O9BA 1PFIA 2I1KA 3NMDA 3EFGA 1KILC 1LTIC 4W80A 1DX7A 1L4AD 1HWTC 1HTLC 2I1JA 3M0DA 3B5NB 1JCCA 4AYCA 1LTBC 1KILB 2E43A 2P2UA 3HD7D 3V2NA 2OYHC 3O8ZA 1JTHB 1SQXK 1SQVK 1SP4A 1FZCB 1URQB 2KSJA 3B8EB 1FU1A 1CW5A 3P32A 2H8PD 1GL2D 2ZFCA 2XKMA 5BU8B 2WPSA 5APUA 2OYIB 3NTNA 1LWUA 1CI6B 1L0LK 3HRNA 3TNUB 3GHGA 3VP8A 1IFNA 1NO4A 1IJDB 1LT9A 3RK3B 4N78D 2OYHA 3H32B 2MJZA 1T2KC 3MUDA 4I1LA 5AVQB 3T97A 1SFCC 4IFDK 5CCGD 3N7NA 4IFMA 5CJ0A 3P8CD 3U59A 3HUSA 3RK3C 3RK3D 2HG5D 3KDPB 1H89A 1DEBA 1KILA 3HUSC 3RK2D 4W7YA 5CCGA 3VMYA 5CCHC 1FDMA 1LTJB 4HYTB 4WBAA 4AUWA 1YTZT 1NKNA 1WT6A 1FJPA 2IPPA 5AW2B 3G3ZA 4IFFA 4JYCA 3MD0A 3OA7A 1N73B 5AVUB 1LTJA 4LC1A 2YMYA 3VP9A 5KTBA 5APXA 1FZCC 2P67A 3BRTB 1FOSE 1ZR2A 5AW8B 1M7LA 1A02J 1J1EC 1IO4A 1SLQA 3P7KA 1GL2A 2XV5A 2QM7A 2YO3A 2Z5IA 4ZKPA 1GW4A 2O01H 5APSA 2H7HA 2OYIA 1T3JA 2FKWB 3BATA 3HE5A 1SVFA 1OWAA 3OJAB 1LT9B 2Q7CA 1IFJA 4N6JA 1ZN5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJZ A;  1NH4 A;  1HH0 A;  2C0X A;  2CPS A;  1HGZ A;  2C0W A;  1IFJ A;  1IFD A;  1FDM A;  2CPB A;  1IFI A;  1HGV A; 
#chains in the Genus database with same CATH topology
 2IFN A;  1JMM A;  2FYN B;  3HD7 A;  1SQQ D;  3B71 A;  3L70 E;  1SQX G;  1VL2 A;  2WSF H;  3A7O A;  3F5H A;  4WY4 C;  3S4R A;  1JNM A;  4GIF A;  4IL6 X;  1NJI Q;  2N1T C;  3D6Y A;  2KYV A;  1SQQ E;  1YQ4 C;  2Y9Y A;  4PD4 D;  1IFP A;  1H0T B;  2FXM A;  3CCE P;  1G1I A;  1VQ5 P;  2H43 A;  1VPC A;  3N4X A;  5CBN A;  1YYC A;  2LKM A;  3BVH A;  1BSH A;  3OAK A;  1MFZ A;  3P8C E;  2HOD B;  4XE5 B;  3VTP C;  4Z1M H;  1BE3 D;  2VRS A;  3GW6 A;  1T6A A;  3MHV A;  1AV1 A;  3VN0 A;  3H1H E;  4C46 A;  5AW7 B;  1KB9 H;  4ASW A;  2JEE A;  1SQV E;  1SS1 A;  1JY3 N;  2KNC A;  2M3E A;  2M5A B;  1RY3 A;  3KZI H;  4YXD C;  2R32 A;  1QVF O;  4DOJ A;  1EQ7 A;  1NU1 D;  5C39 A;  3Q1M A;  3MIW A;  3L36 A;  2NPS B;  1YHQ P;  3CD6 P;  1IC2 A;  1KTM A;  3AED C;  3TK1 A;  4Y99 B;  1HVV A;  1KZU B;  2P7J A;  3VMX A;  2GUV A;  3KQG A;  3PHL A;  1N73 A;  3AE6 C;  1KMI Z;  4PV1 C;  1KB9 E;  3M06 A;  1SQQ G;  2FYU J;  3E7K A;  4XA4 A;  1OXZ A;  1KFN A;  1GL2 B;  4PJ0 E;  1GK4 A;  1SQP K;  3L73 J;  4A7P A;  4BWN A;  2K88 A;  1U57 A;  1G2C A;  2O1J A;  2Y9Z A;  2KK7 A;  2XZR A;  1IFM A;  1JY3 O;  1L0L D;  3AEA C;  1SQB J;  5M1B A;  2WT7 A;  3Q3D A;  1AJY A;  3L74 E;  1YQ3 C;  3BCC G;  3CCL P;  1NTM G;  1NU1 J;  2DW3 A;  1SQB E;  2J58 A;  3AE8 C;  3L72 G;  3TNU A;  5KJ7 C;  5TIS H;  1NWQ A;  5AW5 B;  4K35 A;  1IZN B;  2BEQ D;  2O1K A;  3AE5 C;  4Y28 J;  3W67 A;  3L71 J;  1HGZ A;  4YXW H;  3H1K D;  2NPS D;  1YJN P;  1L4A A;  3RK3 E;  1W2E A;  2JWA A;  1GU4 A;  1BE3 E;  2OTL P;  1Q81 Q;  1LTA C;  2O01 J;  1SQP D;  3A5T A;  3HE4 A;  3MZW B;  4JYB A;  2ZVN B;  1N7S D;  2N9B A;  4HB1 A;  5AVT B;  5AW3 B;  4EDF A;  1VQO P;  1EXJ A;  3H1L G;  5H2F E;  3B5N D;  1BCC E;  1PGQ A;  1SFC A;  3IR9 A;  3WU2 H;  3SWK A;  1X79 B;  1BCC J;  1EDJ A;  3HTK A;  1W2B O;  1OFC X;  3B4S A;  1VQ7 P;  3HD7 C;  3CCM P;  1S5L X;  2G8Y A;  3C9I A;  3HUS B;  1U7J A;  4WWI A;  1RHZ B;  5B5E H;  1SQB K;  4RES B;  1CZQ A;  5APV A;  2B87 A;  1HJB A;  2W90 A;  3BCC E;  3VMZ A;  3CI9 A;  2BCC D;  1USE A;  2KS1 A;  5CCH D;  1OW6 A;  2FYZ A;  3H1L D;  1NTZ E;  3M9Q A;  3PP5 A;  2FYN C;  2YKP A;  1IK9 A;  1SFC B;  1RQU A;  3KYQ A;  5KAI H;  1RE3 C;  2D2C D;  2R44 A;  3M9B A;  1SQP E;  2PP6 A;  3HTK B;  3IN6 A;  3SSU A;  1RH5 B;  3WMM 0;  4C7N A;  4ZNC A;  1JEK A;  2NZ2 A;  3H1I J;  1X8Y A;  3PH0 A;  5DJT B;  1QVG O;  1URQ A;  1FZF A;  3U59 A;  1OVR A;  1WRG A;  1L0N G;  3K5B A;  5AW4 B;  2FXP A;  2OYO A;  4U3F D;  1KQF B;  4H13 C;  4L75 A;  5KJ7 D;  3RL0 C;  2YXR B;  3PRJ A;  4HH2 A;  3CL3 D;  4UB8 E;  1ZME C;  2Q9I A;  1P84 E;  3FXE A;  2HR3 A;  4M3L A;  1P84 I;  1VQL P;  4TLF A;  3BRV B;  1PP9 D;  2NPS C;  1K04 A;  2R3C A;  1DIP A;  3C1L A;  3V4Q A;  3NXS A;  3TGU G;  3IF4 A;  1ZLL A;  3KZI E;  1IFI A;  1GW3 A;  1DD4 A;  2PAJ A;  1LTJ C;  1JY2 O;  2HLO A;  1E5W A;  1PL5 A;  2RN0 A;  1L2P A;  2AEM A;  5AVY B;  3ZDM A;  3RBX A;  3CCU P;  1FZA A;  1VQM P;  2FFD C;  4DZO A;  3G4S P;  2KIK A;  2Q6Q A;  2JKV A;  3AE2 C;  2IBZ D;  4TT3 H;  1S9K E;  2QIW A;  1YTZ I;  4WY4 D;  3G71 P;  2N1T B;  5DJU B;  3V5B A;  1SQV J;  2A45 G;  2KB7 P;  2POH A;  3O6Q A;  4RKU J;  1ZV8 A;  2IYP A;  3IFM A;  2E76 C;  3M91 A;  3MTU E;  5CCH A;  2YIU B;  1FZG A;  5CHX A;  1S9K D;  1MKM A;  1LTG C;  1YJ9 P;  1FDO A;  2FFD A;  4WVZ A;  1RF0 C;  3GHG B;  2YKQ A;  4UB8 H;  3MP7 B;  1QL2 A;  2XND H;  2QSI A;  1PP9 J;  2E75 D;  2YKO A;  3G9R A;  3CC2 P;  1FZB A;  1BGY D;  4B86 A;  3V4W A;  2KNC B;  2M5A A;  3GF3 A;  1Q86 Q;  3EQ2 A;  1VQP P;  1OVU A;  3GHG C;  3Q5R A;  1PGP A;  2P58 A;  4HJG H;  2N1T A;  2CPB A;  1T8Z A;  2ZYG A;  3JCU H;  1OW7 A;  1S5L H;  1KQL A;  1NVO A;  2OGU A;  4H13 D;  1BE3 G;  1Q90 D;  4MN4 C;  2FYU G;  1WMK A;  3PLN A;  2W6A A;  2E5Y A;  2A45 I;  3AE3 C;  5GTI H;  3L4F A;  1DEE G;  2WSE H;  4BRY A;  1L0L E;  2NPS A;  2R5B A;  1EZV I;  2IZ1 A;  3AE4 C;  3VOP A;  2JDI H;  4PD4 H;  5GTI E;  1DH3 A;  3E1I A;  1KN7 A;  1FC2 C;  2WT7 B;  1PGJ A;  3BAS A;  1FS0 E;  1NTM E;  3JCU E;  3L72 E;  5AVR B;  1JCD A;  3II6 A;  1J2J B;  2J59 M;  5BU5 A;  4LLH A;  3SFD C;  1MUU A;  2XDJ A;  1NTM J;  3L72 J;  4OVN F;  1VQ8 P;  5AVV B;  5KLV J;  3PTZ A;  1PPJ G;  2FYU K;  1HH0 A;  1URQ D;  1LTT C;  2C9N Y;  3TGU D;  4QMA A;  2W6B A;  2WSE J;  3L71 E;  3M0A A;  1OW8 A;  1JB0 J;  2WIT A;  3CX5 D;  1N86 A;  1PGO A;  3QH9 A;  4RJT A;  3S1K A;  3W68 A;  3WUV A;  1GTW A;  3L75 G;  1KQG B;  5GTH H;  4WB4 A;  4H0L C;  5B66 E;  1NKZ B;  3CPW O;  3JSV C;  2ZXX A;  2QJK C;  2ZAE B;  5APY A;  3S9O A;  4GKG A;  5CJ4 A;  1P84 H;  1ZR4 A;  3H1J G;  3CCR P;  3ITK A;  1Q2N A;  2P10 A;  1X9V A;  3AEG C;  5KLV K;  2PRR A;  2V7Q H;  5KAF E;  2BEZ F;  3TGU E;  1J1D B;  2OYH B;  3CXH D;  1HUC A;  3ABV C;  4W7Z A;  2IFM A;  2IDB A;  2LXB A;  4JPZ B;  4AQR D;  1BGY E;  2WZ7 A;  3RGU A;  1NHL A;  1L4A B;  3FWN A;  1JY2 P;  1T2K D;  2KS1 B;  4I7Z C;  4C7R A;  3BCC J;  1M1J A;  1SFC D;  1EZV G;  3HE4 B;  5AW0 B;  3R4Y A;  3JC2 2;  3B5N C;  3D71 A;  3USS A;  1PPJ E;  1NTZ J;  1N7S A;  2BCC E;  4NPF X;  5L8R J;  3CC4 P;  1L0L J;  2H88 C;  2XNX A;  3CC7 P;  1NU1 K;  3V2P A;  2W6J H;  3L70 D;  2IYO A;  4LGD E;  1NTK J;  3A2A A;  4EOT A;  1G1J A;  1RF0 A;  1H8A A;  3H1I E;  3A0H E;  3D70 A;  5B5E E;  2AEF A;  4EI2 A;  2E76 B;  3RK2 C;  3L74 J;  2QJY C;  2R3S A;  2Z5H A;  1R8E A;  2QJP C;  1GU5 A;  2IBZ E;  3WU2 E;  3L75 D;  5AW6 B;  4OGQ C;  1JOC A;  1NGM B;  1JY2 N;  1N7S B;  1SQP G;  3Q5S A;  2V4H A;  1S72 P;  3CX5 H;  3L71 D;  3L37 A;  5KAI E;  2E42 A;  5TJH A;  3R2P A;  1Y47 A;  4L73 A;  2KZJ A;  1FOS F;  5APT A;  5AW1 B;  2ITA A;  1VQ4 P;  2A45 H;  4U3F J;  1NAY A;  1OZH A;  1P84 D;  2ZXE B;  2Z4E A;  1NTM D;  3L72 D;  4GOF A;  3RBZ A;  4D6T E;  4D6T D;  1FZC A;  3CCJ P;  2GM4 A;  1CI6 A;  2ZT9 B;  4JQ0 D;  3CCV P;  2E74 B;  1RF1 B;  5CMZ A;  2R5D A;  1HBW A;  1LGH B;  2B89 A;  3C8V A;  3H1I G;  3U1C A;  1S5L E;  3CCS P;  1KYO I;  2J5U A;  1OVV A;  2MKV A;  4KT0 J;  3RL0 B;  2YNY A;  1VQK P;  1SQV G;  2SPZ A;  1IFD A;  2Y0D A;  2BCC J;  2UWJ E;  1NTK K;  3QWO C;  3H1J J;  5CCG C;  2K9J A;  1FBM A;  1XTC C;  2QVA A;  2W27 A;  3L35 A;  4R4M A;  1NTZ K;  3CLQ A;  2LR2 A;  4OWF A;  3H25 A;  3KXD A;  1RE3 A;  1OIP A;  2KOG A;  1EC5 A;  1LWU B;  5TIS E;  3HD7 B;  1JM0 A;  3VMA A;  3AEE C;  5AVZ B;  3WUT A;  1M56 D;  1VF5 B;  2WPR A;  1ZP0 C;  2IX7 C;  2N1T D;  2HPC A;  2HYN A;  2JP3 A;  2OAR A;  4N3Y B;  1BE3 J;  3M0D C;  2JO1 A;  2I8D A;  3MUD C;  3G6E P;  2H7H A;  1GZL A;  1L0N E;  2Q3I A;  1DD3 A;  2HOD A;  1AA0 A;  2KUB A;  3I5C A;  3AE1 C;  2WQY C;  3CXH H;  3L70 J;  1NTK G;  2JJL A;  2BAS A;  2WSC J;  2W8Z A;  1FJK A;  5BVZ A;  1KIL E;  2WPQ A;  1EDK A;  1AFO A;  2RKL A;  3TYY A;  1M1J C;  2FFD B;  1N2D C;  1GMJ A;  1JY3 P;  3RL0 D;  3MGN A;  2HFE D;  4WY4 A;  1JTH A;  3L74 D;  2ZYA A;  1PP9 G;  1KFM A;  3H6P A;  3L73 E;  4K3A A;  4R4L A;  1A02 F;  2KP8 A;  1MZ9 A;  2C9L Y;  1YIJ P;  3CWB G;  3FGA D;  3E1R A;  5APW A;  3Q5P A;  3M9H A;  2NRG A;  1FZE A;  4PV1 D;  2Y0C A;  4U3F G;  3CMA P;  1LT1 A;  1NOH A;  1JO5 A;  1KB9 D;  4YPC A;  1AVY A;  1KV4 A;  2D2C C;  2V7Q J;  3P8M C;  1NYH A;  3U1A A;  1S2E A;  1T3U A;  2CPS A;  2QE7 H;  2M8R A;  1RE4 A;  2XU6 A;  4Y99 C;  1RF1 A;  1BGY J;  1M57 D;  1NTM K;  4H44 D;  4NPD A;  4UB6 H;  2WWW A;  3FXD A;  1EZV E;  3L73 D;  3LW5 H;  1VDF A;  3AEC C;  4H0L D;  5E79 H;  3EFF K;  1U7M A;  1HGV A;  2BCC G;  2AXT H;  2E76 D;  4JBZ A;  5AVX B;  1NTZ G;  1AQ5 A;  1BDC A;  3SWF A;  5AVS B;  1KIL D;  2P1J A;  2B9B A;  1L0N K;  1QX8 A;  4UB6 E;  1CSB A;  5AW9 B;  1LP1 B;  1FAV A;  4D6T G;  1N7L A;  3CCQ P;  1KYO D;  5APQ A;  5KLV D;  1M1J B;  1SQX J;  1BCC D;  2QM8 A;  1N7S C;  2K37 A;  3LW5 J;  1D7M A;  3AEB C;  4HKZ H;  3L75 E;  4OGQ B;  1SQX E;  1NTZ D;  2A06 G;  3KHU A;  1KYO E;  5KLV E;  3LID A;  2B88 A;  2G3A A;  2RH0 A;  2ZVO B;  3AE7 C;  3HE5 B;  3RK2 B;  1K73 Q;  1M1K Q;  3H1K G;  1AQT A;  1YJW P;  1ZOY C;  1VF5 D;  2B87 B;  3FWL A;  1HF9 A;  2A06 D;  5E79 E;  3H1H G;  1LWU C;  1PPJ D;  5EFW B;  2Q3E A;  3T97 B;  2WVR A;  2YO2 A;  3CXH I;  4OGQ D;  3A0B H;  1L0L G;  2WPV B;  5KKZ C;  2WTY A;  2M3B A;  3A3Y B;  4C7N B;  1H0T A;  4I2L C;  1L4A C;  4PJ0 H;  3TF5 A;  1VQ9 P;  1LT9 C;  1GL2 C;  4N78 E;  2WSC H;  4GT1 A;  2GUS A;  1TU3 F;  3CXH E;  1NH4 A;  1J1D C;  3CWB J;  3EWK A;  2E74 C;  3L74 G;  2E74 D;  2C0W A;  4I6M C;  2ZT9 C;  5KAF H;  2O3J A;  1Z56 A;  3TSI A;  2L5G B;  3UIA A;  4OH8 B;  5KLV G;  1SQQ J;  1NTK E;  3V2R A;  1GK6 A;  1GDT A;  1JMB A;  2OYI C;  1YBK A;  4BRY B;  4EYY Q;  1H88 A;  4H0L B;  1RE4 C;  1J1E B;  1QL1 A;  5KLI C;  4H44 B;  1RF1 C;  2QRX A;  1NTK D;  4YTP C;  3FX0 A;  1MV8 A;  1E79 H;  1VQN P;  3L75 J;  3VYI A;  1PV3 A;  2M0B A;  3IAO A;  1NU1 E;  4GDO A;  4JF7 A;  3V2Q A;  1N8R Q;  2HPC B;  3KPE A;  3SWY A;  4KHX A;  1XTG B;  1BDD A;  2QJP B;  1NAF A;  4GOE A;  4NPE A;  1N73 C;  1URQ C;  1JUN A;  1G2C B;  2Q5U A;  2OQQ A;  1SQQ K;  2QJY B;  4KJM A;  4ZKU A;  1QEX A;  1KQS O;  1GD2 E;  1LTS C;  1K05 A;  5AVW B;  2KLV A;  2IBZ G;  1KD1 Q;  1UII A;  3LIE A;  4PD4 E;  3RL0 g;  1EDI A;  4D6T J;  1VQ6 P;  3NFQ A;  2C0X A;  3O6Q B;  4EIJ A;  1VF5 C;  4IOI H;  4ZMD A;  3H32 A;  3I55 P;  1KC8 Q;  1USD A;  1ZRT E;  2O01 N;  3B5N A;  5B66 H;  5GTH E;  4WY4 B;  3D6Z A;  1HJ0 A;  4O9B A;  1PFI A;  2I1K A;  3NMD A;  2WMM A;  1SQX D;  3EFG A;  1SQV D;  3V6I A;  1KIL C;  4I7Z B;  2KI7 B;  3AE9 C;  1LTI C;  4W80 A;  1DX7 A;  1Y8A A;  1L4A D;  2KXP B;  2AEJ A;  3CWB E;  2FYU E;  1HWT C;  2FYU D;  4IL6 E;  1HTL C;  2I1J A;  3H1K E;  2WSF J;  1JCC A;  3B5N B;  3M0D A;  1LTB C;  1KIL B;  2YXQ B;  4AYC A;  3I56 P;  2KLU A;  2QEX P;  2QA4 P;  2N9Y B;  2E43 A;  2IBZ I;  4U7J A;  2OTK E;  2P2U A;  3H1J E;  1ZRT D;  1SQB D;  3PJS K;  3Q2Y A;  1SQP J;  1PP9 E;  3HD7 D;  2Y0E A;  3V2N A;  2E5T A;  2OYH C;  3O8Z A;  1JTH B;  2PGD A;  3A0H H;  1SQX K;  3AEF C;  1SQV K;  4L76 A;  2FXO A;  1RQV A;  1SP4 A;  2YMK A;  2QJK B;  1FZC B;  1L0N J;  1EDL A;  1URQ B;  1M90 Q;  2K9J B;  2LXC B;  1LJ2 A;  2KSJ A;  3B8E B;  1FU1 A;  1CW5 A;  3CX5 E;  2KZI A;  3P32 A;  1OMI A;  4L74 A;  2H8P D;  3GLM A;  1GL2 D;  2ZFC A;  4CPG A;  2GA1 A;  1S3J A;  2K3R A;  2ZJS E;  2XKM A;  5BU8 B;  1S1C X;  3GMA A;  3TGU J;  5KLI B;  2WPS A;  3H1L E;  1QLE D;  1BSN A;  2RMZ A;  5APU A;  4ASV A;  5K5G B;  1R5S A;  2OYI B;  2K1A A;  1LWU A;  1CI6 B;  3H1L J;  3NTN A;  4DCK A;  1AVO A;  1L0L K;  3F89 A;  3HRN A;  4H13 B;  3GHG A;  3H1I D;  4PD4 I;  3TNU B;  1IFN A;  1NO4 A;  3VP8 A;  3OW2 O;  1IJD B;  3CME P;  3GG2 A;  1LT9 A;  2FBW C;  1W5C E;  2E75 C;  3H1K J;  4N78 D;  2JWD A;  3RK3 B;  2OYH A;  3H32 B;  1Y9B A;  1YIT P;  2MJZ A;  4RO0 A;  2L91 A;  1T2K C;  3MUD A;  4I1L A;  1LP1 A;  5AVQ B;  1L0N D;  3CX5 I;  3T97 A;  3WUU A;  5KKZ B;  1SFC C;  4DJG A;  3H1H D;  3A0B E;  2YIU C;  4IFD K;  1X0T A;  1KB9 I;  5CCG D;  2A06 E;  1PIX A;  3N7N A;  4IFM A;  3P8C D;  5CJ0 A;  2E75 B;  3HUS A;  3BCC D;  3RK3 C;  3L71 G;  2HG5 D;  2KSE A;  3KDP B;  3RK3 D;  1K9M Q;  1H89 A;  1K8A Q;  1DEB A;  3L70 G;  1EXI A;  1KIL A;  1Q82 Q;  3HUS C;  1ZXG A;  2JR8 A;  1UIX A;  2WSS H;  4W7Y A;  2IZ0 A;  3RK2 D;  3VMY A;  5CCG A;  5CCH C;  1FDM A;  1LTJ B;  2CK3 H;  2FY8 A;  4HYT B;  1EZV D;  4WBA A;  1KYO H;  1M8O B;  1X22 A;  1BCC G;  3SFE C;  4DT0 A;  1YTZ T;  1NKN A;  4AUW A;  1WT6 A;  1FJP A;  2K9Y A;  1R5L A;  2IPP A;  5AW2 B;  3G3Z A;  2W83 C;  4IFF A;  3MD0 A;  4JYC A;  3OA7 A;  4IL6 H;  1FDI A;  1LNQ A;  3GF7 A;  5KJ7 A;  1N73 B;  4H44 C;  1FE6 A;  1LTJ A;  4LC1 A;  2YMY A;  5AVU B;  3VP9 A;  5KTB A;  1Q7Y Q;  2OTJ P;  5APX A;  1FZC C;  3H1H J;  2QG4 A;  1KOR A;  2ZT9 D;  2P67 A;  3BRT B;  1FOS E;  1ZR2 A;  1IK7 A;  5AW8 B;  2AXT E;  3L73 G;  1M7L A;  1PZQ A;  1A02 J;  1J1E C;  3TDK A;  1SLQ A;  1IO4 A;  1GL2 A;  2YO3 A;  2XV5 A;  2QM7 A;  2Z5I A;  3P7K A;  1BGY G;  4XFJ A;  4ZKP A;  4GOD A;  1GW4 A;  2O01 H;  3H1J D;  5APS A;  1SQB G;  1OX3 A;  4U3F E;  1T3J A;  2OYI A;  2AXC A;  5H2F H;  2D2C B;  2ZYD A;  2Q1K A;  1ZW0 A;  1NU1 G;  2FKW B;  5CBO A;  1S4X A;  1QGK B;  3BAT A;  2PFX A;  1SVF A;  3HE5 A;  4PV1 B;  1YI2 P;  1OWA A;  3OJA B;  1LT9 B;  3CWB D;  2Q7C A;  4BXL A;  2H89 C;  1IFJ A;  4N6J A;  1MFT A;  1ZN5 A; 
#chains in the Genus database with same CATH homology
 2IFN A;  1JMM A;  3HD7 A;  4WY4 C;  2WSF H;  3A7O A;  1JNM A;  4GIF A;  2N1T C;  2KYV A;  2FXM A;  1G1I A;  2H43 A;  1VPC A;  3N4X A;  1YYC A;  2LKM A;  3BVH A;  3OAK A;  1MFZ A;  3P8C E;  2HOD B;  4XE5 B;  3VTP C;  2VRS A;  3VN0 A;  4C46 A;  5AW7 B;  2JEE A;  1JY3 N;  1RY3 A;  2R32 A;  4DOJ A;  1EQ7 A;  3MIW A;  3L36 A;  2NPS B;  1IC2 A;  3TK1 A;  4Y99 B;  1HVV A;  1KZU B;  2P7J A;  3VMX A;  2GUV A;  3KQG A;  1N73 A;  3M06 A;  4XA4 A;  1OXZ A;  1KFN A;  1GL2 B;  1GK4 A;  1SQP K;  1G2C A;  2O1J A;  2XZR A;  1IFM A;  1JY3 O;  2WT7 A;  2J58 A;  3TNU A;  5KJ7 C;  1NWQ A;  5AW5 B;  2O1K A;  1HGZ A;  2NPS D;  1GU4 A;  1L4A A;  1W2E A;  1LTA C;  3A5T A;  3HE4 A;  4JYB A;  1N7S D;  2N9B A;  5AVT B;  5AW3 B;  3B5N D;  1SFC A;  3IR9 A;  1X79 B;  3HTK A;  3HD7 C;  3C9I A;  3HUS B;  1SQB K;  4RES B;  1CZQ A;  5APV A;  1HJB A;  3VMZ A;  3CI9 A;  5CCH D;  2FYZ A;  3M9Q A;  3PP5 A;  2YKP A;  1IK9 A;  1SFC B;  3KYQ A;  1RE3 C;  3M9B A;  3HTK B;  2PP6 A;  3WMM 0;  4C7N A;  1X8Y A;  1URQ A;  1FZF A;  1WRG A;  5AW4 B;  5KJ7 D;  3RL0 C;  4HH2 A;  3CL3 D;  2Q9I A;  4M3L A;  3BRV B;  2NPS C;  2R3C A;  3V4Q A;  3NXS A;  1ZLL A;  1IFI A;  1GW3 A;  2PAJ A;  1LTJ C;  1JY2 O;  2HLO A;  1E5W A;  5AVZ B;  5AVY B;  1FZA A;  4DZO A;  1S9K E;  1YTZ I;  4WY4 D;  2N1T B;  3V5B A;  2GM4 A;  2A45 G;  2KB7 P;  2POH A;  1ZV8 A;  3IFM A;  3M91 A;  5CCH A;  3MTU E;  1FZG A;  5CHX A;  1S9K D;  1LTG C;  2FFD A;  1RF0 C;  3GHG B;  2YKQ A;  1QL2 A;  2YKO A;  1FZB A;  4B86 A;  3V4W A;  3EQ2 A;  3GHG C;  2N1T A;  2CPB A;  1T8Z A;  1KQL A;  2W6A A;  2A45 I;  3L4F A;  2WSE H;  2NPS A;  2R5B A;  3VOP A;  1DH3 A;  3E1I A;  3BAS A;  5AVR B;  5BU5 A;  1JCD A;  3II6 A;  1J2J B;  2J59 M;  5KJ7 A;  4LLH A;  1MUU A;  2XDJ A;  5AVV B;  2FYU K;  1HH0 A;  1URQ D;  1LTT C;  2C9N Y;  2W6B A;  3M0A A;  2WIT A;  1N86 A;  1GTW A;  4WB4 A;  1NKZ B;  5APY A;  1ZR4 A;  4GKG A;  5CJ4 A;  1X9V A;  5KLV K;  2OYH B;  1J1D B;  1HUC A;  4W7Z A;  2IFM A;  4AQR D;  2WZ7 A;  1NHL A;  1L4A B;  1JY2 P;  1T2K D;  4C7R A;  1M1J A;  1SFC D;  5AW0 B;  3HE4 B;  3B5N C;  1N7S A;  2XNX A;  1NU1 K;  3V2P A;  4LGD E;  4EOT A;  3A2A A;  1G1J A;  1RF0 A;  1H8A A;  3RK2 C;  2Z5H A;  1GU5 A;  5AW6 B;  1JOC A;  1JY2 N;  1N7S B;  3L37 A;  2E42 A;  3R2P A;  1FOS F;  5APT A;  5AW1 B;  2A45 H;  2ZXE B;  2Z4E A;  1FZC A;  1CI6 A;  1RF1 B;  5CMZ A;  2R5D A;  1HBW A;  1LGH B;  3U1C A;  3RL0 B;  2YNY A;  1IFD A;  1NTK K;  5CCG C;  1FBM A;  1XTC C;  2W27 A;  3L35 A;  3CLQ A;  1NTZ K;  1RE3 A;  2KOG A;  1LWU B;  3HD7 B;  2WPR A;  2IX7 C;  2N1T D;  2HPC A;  2HYN A;  2OAR A;  4N3Y B;  3M0D C;  1GZL A;  2Q3I A;  2HOD A;  3I5C A;  2JJL A;  2BAS A;  1FJK A;  5BVZ A;  2WPQ A;  1AFO A;  3TYY A;  1M1J C;  2FFD B;  1N2D C;  1JY3 P;  3RL0 D;  3MGN A;  2HFE D;  4WY4 A;  1JTH A;  1KFM A;  3H6P A;  1A02 F;  2KP8 A;  1MZ9 A;  2C9L Y;  5APW A;  3M9H A;  1FZE A;  1NOH A;  1JO5 A;  3P8M C;  3U1A A;  2CPS A;  1T3U A;  2M8R A;  1RE4 A;  2XU6 A;  4Y99 C;  1RF1 A;  1NTM K;  2WT7 B;  2WWW A;  3LW5 H;  1VDF A;  1HGV A;  5AVX B;  1AQ5 A;  3SWF A;  5AVS B;  1KIL D;  2P1J A;  1L0N K;  1CSB A;  5AW9 B;  1FAV A;  1N7L A;  5APQ A;  1M1J B;  2QM8 A;  2FFD C;  1N7S C;  3LID A;  3HE5 B;  3RK2 B;  1LWU C;  2YO2 A;  2WTY A;  2M3B A;  3A3Y B;  4C7N B;  4I2L C;  1L4A C;  1LT9 C;  1GL2 C;  4N78 E;  2WSC H;  4GT1 A;  2GUS A;  1NH4 A;  1J1D C;  4I6M C;  2C0W A;  1Z56 A;  3TSI A;  2L5G B;  3UIA A;  4OH8 B;  3V2R A;  1GK6 A;  1GDT A;  2OYI C;  1H88 A;  1RE4 C;  1J1E B;  1QL1 A;  1RF1 C;  1MV8 A;  3VYI A;  4JF7 A;  3V2Q A;  2HPC B;  3KPE A;  3SWY A;  4KHX A;  1XTG B;  1NAF A;  1N73 C;  1URQ C;  1JUN A;  1G2C B;  2Q5U A;  1SQQ K;  4ZKU A;  1GD2 E;  1LTS C;  5AVW B;  2KLV A;  3LIE A;  3NFQ A;  2C0X A;  4EIJ A;  3H32 A;  3B5N A;  4WY4 B;  4O9B A;  1PFI A;  2I1K A;  3NMD A;  3EFG A;  1KIL C;  1LTI C;  4W80 A;  1DX7 A;  1L4A D;  1HWT C;  1HTL C;  2I1J A;  3M0D A;  3B5N B;  1JCC A;  4AYC A;  1LTB C;  1KIL B;  2E43 A;  2P2U A;  3HD7 D;  3V2N A;  2OYH C;  3O8Z A;  1JTH B;  1SQX K;  1SQV K;  1SP4 A;  1FZC B;  1URQ B;  2KSJ A;  3B8E B;  1FU1 A;  1CW5 A;  3P32 A;  2H8P D;  1GL2 D;  2ZFC A;  2XKM A;  5BU8 B;  2WPS A;  5APU A;  2OYI B;  3NTN A;  1LWU A;  1CI6 B;  1L0L K;  3HRN A;  3TNU B;  3GHG A;  3VP8 A;  1IFN A;  1NO4 A;  1IJD B;  1LT9 A;  3RK3 B;  4N78 D;  2OYH A;  3H32 B;  2MJZ A;  1T2K C;  3MUD A;  4I1L A;  5AVQ B;  3T97 A;  1SFC C;  4IFD K;  5CCG D;  3N7N A;  4IFM A;  5CJ0 A;  3P8C D;  3U59 A;  3HUS A;  3RK3 C;  3RK3 D;  2HG5 D;  3KDP B;  1H89 A;  1DEB A;  1KIL A;  3HUS C;  3RK2 D;  4W7Y A;  5CCG A;  3VMY A;  5CCH C;  1FDM A;  1LTJ B;  4HYT B;  4WBA A;  4AUW A;  1YTZ T;  1NKN A;  1WT6 A;  1FJP A;  2IPP A;  5AW2 B;  3G3Z A;  4IFF A;  4JYC A;  3MD0 A;  3OA7 A;  1N73 B;  5AVU B;  1LTJ A;  4LC1 A;  2YMY A;  3VP9 A;  5KTB A;  5APX A;  1FZC C;  2P67 A;  3BRT B;  1FOS E;  1ZR2 A;  5AW8 B;  1M7L A;  1A02 J;  1J1E C;  1IO4 A;  1SLQ A;  3P7K A;  1GL2 A;  2XV5 A;  2QM7 A;  2YO3 A;  2Z5I A;  4ZKP A;  1GW4 A;  2O01 H;  5APS A;  2H7H A;  2OYI A;  1T3J A;  2FKW B;  3BAT A;  3HE5 A;  1SVF A;  1OWA A;  3OJA B;  1LT9 B;  2Q7C A;  1IFJ A;  4N6J A;  1ZN5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...