1NH4A

Structure of the coat protein in fd filamentous bacteriophage particles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
44
structure length
44
Chain Sequence
PAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major coat protein
publication title Structure of the coat protein in fd filamentous bacteriophage particles determined by solid-state NMR spectroscopy
pubmed doi rcsb
molecule tags Virus
total genus 18
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nh4A00
2CPSA 2CPBA 1NH4A 1IFIA 1IFDA 2MJZA 1FDMA 1HGZA 2C0WA 1HH0A 2C0XA 1IFJA 1HGVA
chains in the Genus database with same CATH superfamily
1SQPK 1FBMA 3U1AA 1VPCA 2NPSD 2HLOA 2J5UA 3L72G 4ZNCA 4GODA 3HD7B 4U3FG 3CD6P 4AUWA 3CXHI 3D71A 3L74D 5AVUB 4C7NA 1NTMG 1MV8A 3MHVA 1BE3D 4C46A 1BSHA 1M1JA 1E79H 2HODB 1EZVI 3HTKA 3L71J 4D6TJ 3V2NA 2LXCB 3H1KE 1LTGC 3RK3B 1PGOA 1SQVE 1GK4A 2N1TB 1SFCA 1USDA 1EDJA 4H44D 3Q5PA 1NTZG 3NFQA 3H1KJ 2O01N 3CI9A 2P58A 1KQSO 4Y28J 3IAOA 3KZIE 2E74B 5H2FE 3S9OA 4H13C 2OYIC 3OW2O 3VP9A 3L35A 3W67A 3LIEA 5AW5B 3A5TA 1BE3E 2L5GB 4DOJA 1NTKD 2PGDA 2QJKB 3H1HG 2HPCB 2B87B 1M56D 1KQLA 4LLHA 1JY2O 2H88C 4ASVA 2A06E 3CC4P 1HGVA 4I2LC 2BASA 2JWAA 1PIXA 2XV5A 4ASWA 3B5NB 3HD7C 1ZRTE 3CX5D 2BCCD 2WPRA 4HJGH 4GIFA 3A0BH 1W2BO 4TT3H 3TDKA 2E75D 3AEGC 4IFFA 1HGZA 1NTKE 1BGYG 3P8CD 1CI6A 2JKVA 3RK3C 1LT9A 4C7NB 1M90Q 3D6YA 3OAKA 2N1TC 2WSCJ 1L4AA 1RE4A 2AXCA 2K3RA 2ZT9D 2Z5IA 1X8YA 3ITKA 3HTKB 2YKOA 1LTAC 4IL6X 1IO4A 3AE4C 1NHLA 1BCCJ 1SQPD 4NPEA 2E74C 1NU1J 3CCEP 3CX5E 2BCCE 2CPSA 3SWFA 4C7RA 3L70J 1VQNP 1LTBC 1FS0E 3PTZA 2QJKC 3E1IA 3L73D 2V4HA 1PPJG 2FYUJ 1BDCA 4PJ0E 1OVUA 1JTHA 1SQVG 1FJPA 1FDOA 3CMAP 2QE7H 3CCJP 2B88A 1Y8AA 2Y0EA 5M1BA 3RK2B 3B5NC 1SQPE 2C9NY 2JO1A 3BASA 1EC5A 2R5DA 1FOSE 3MIWA 5TISH 1DEEG 1SQXJ 3L74G 2AXTH 2QIWA 3H1IG 2KNCB 5CCHA 3FX0A 1HF9A 3M0DA 3L73E 1HJ0A 3CX5I 3H1LD 4EOTA 1T2KC 3QH9A 2IZ0A 1JUNA 3AEEC 2C0WA 1IC2A 1EXIA 5KLVG 2OYHB 1CI6B 1L0NE 1LT9B 1SQQG 5KAIE 1L4AB 3Q2YA 1IFJA 5AW8B 3TSIA 3G3ZA 4YPCA 1T6AA 3N4XA 4K3AA 2Y0CA 1L0NJ 4N78D 1VQKP 2YMKA 3CCUP 2H7HA 3WU2E 5AW3B 2FBWC 3P32A 3BRTB 1X0TA 1NTKG 3H1LE 3VMYA 4JYBA 3TF5A 3AEFC 1JEKA 3FGAD 4IOIH 2WSFJ 5GTIE 3KPEA 4JBZA 4UB6E 3CC7P 3RGUA 4WB4A 1NH4A 2BEQD 3L36A 2PAJA 3RK2C 3IN6A 4YTPC 2N1TD 3BCCE 1JTHB 3CXHH 1YQ4C 1LP1A 2H43A 2R3CA 1K8AQ 2OARA 4L75A 1RF0A 1ZOYC 4RESB 1H0TB 2BCCG 3BCCJ 1YYCA 2IBZD 3A7OA 1X22A 4WBAA 2Q1KA 5AW2B 1N7SB 2YXRB 3H6PA 4ZKUA 3CL3D 1CSBA 3L75D 3SSUA 3PRJA 4MN4C 1PGPA 3IR9A 3JSVC 4WWIA 2OYHC 3L72J 4PV1B 1RH5B 1URQB 1LT9C 1S2EA 2K88A 1JMMA 1L4AC 1M57D 1RE4C 4U3FJ 1Y47A 4I1LA 1HWTC 1SQPG 2KOGA 1SQBD 3Q5RA 1NTMJ 2OTLP 1KYOD 3HE4A 5B5EE 5AVVB 2M5AB 1NAYA 1LTTC 2YO2A 3PJSK 3JCUE 2ITAA 1QVGO 3G4SP 2P67A 3H32A 5APQA 1L0LG 3GHGB 3CCVP 1K9MQ 3IF4A 1N7LA 3L75E 4QMAA 4W7YA 2IYOA 1VQ5P 1NTZJ 5DJUB 1NU1K 1KN7A 1GW4A 1EXJA 4UB8E 2RMZA 2ZVOB 5APYA 3CWBE 1KFMA 1OW7A 2OQQA 4WY4B 3NTNA 1QX8A 3M9HA 4WVZA 1KYOE 3KZIH 1S5LE 2FYUK 3AECC 2IYPA 2FFDA 5H2FH 1LP1B 1TU3F 1N7SC 3L71D 1PP9E 4D6TD 2XNDH 2XNXA 2W83C 2Z5HA 1X79B 1BSNA 1NKZB 2O3JA 2FY8A 4GOEA 1QLED 3AEBC 4LC1A 5CCHC 2IBZI 2B89A 4JQ0D 2IPPA 3M0DC 2KYVA 3RBZA 1PP9J 1G1IA 1ZV8A 4PV1C 1URQC 5AVWB 3H1KD 1N73A 1YQ3C 2O01J 2OYOA 1SQXK 3D6ZA 2E42A 5KJ7D 2K9JA 1D7MA 4OGQD 1YJNP 2KLUA 3WUUA 1PZQA 2W6BA 2UWJE 3L71E 4PD4E 4D6TE 1J2JB 3W68A 3GHGC 1KB9D 3AEAC 3HE4B 1KYOI 2OGUA 2WQYC 4XA4A 1Y9BA 4KJMA 3TGUE 3VMAA 3H32B 5APSA 2J59M 4I7ZB 5E79E 5AW9B 4HH2A 5AW0B 2W6JH 1L0NK 1KILD 1IFMA 5CCGD 5APWA 4BRYA 4WY4C 3TGUJ 1ZXGA 2A06D 3EWKA 1AFOA 5L8RJ 3R4YA 1EDLA 1IFPA 2ZYGA 3CCSP 1G1JA 2ZFCA 2JDIH 2W6AA 1OVVA 1GK6A 3RBXA 3CX5H 1MFZA 2IBZG 1OW8A 2E76D 1ZRTD 4O9BA 1S4XA 1HJBA 1KB9E 2W27A 3TK1A 4EDFA 3BRVB 2E5TA 2Q6QA 1DX7A 2ZXXA 1YITP 2ZYAA 1UIXA 2OTKE 4PJ0H 2Q7CA 1GL2B 2PRRA 4Z1MH 3S1KA 3V2RA 1BCCD 1FJKA 3AE6C 2M8RA 3AE2C 1VQ6P 2FXOA 1NU1D 1KC8Q 1KILE 4W7ZA 1MKMA 1AVOA 2FYZA 4N3YB 1FDIA 1SQBG 3L74J 1NYHA 2SPZA 2NPSA 1KQFB 1OW6A 3L70D 3H1IJ 5EFWB 2I8DA 1N73B 2QJPB 3L37A 1FE6A 4N6JA 1VQPP 1XTGB 1EZVG 3M91A 2K37A 2FYUD 1R8EA 2K9JB 2YKPA 4GDOA 1S1CX 1Q2NA 2FKWB 2W90A 1N7SD 3PP5A 4AYCA 5KLVJ 3CCRP 1SQQJ 4I7ZC 2WTYA 1BCCE 1KB9I 1NTMK 1YTZT 5KKZB 4H0LB 3L4FA 3MD0A 1NU1E 1M1JB 3A2AA 3V6IA 3CLQA 1URQD 2Y9ZA 1S9KD 5KAIH 3RL0D 1SQXD 3L70E 2D2CB 1MZ9A 3EFFK 1SFCB 1VF5B 4BRYB 2Q3EA 1KMIZ 3EQ2A 3KQGA 3TNUA 2HYNA 3GLMA 2MJZA 1NTZK 2FYUE 3V5BA 1FZEA 1A02F 2M0BA 3WU2H 1X9VA 2QVAA 1FZGA 1RE3C 5KTBA 2QA4P 2M3BA 5AVTB 2CPBA 1GL2C 1JY2P 3TYYA 1GTWA 2WZ7A 3H1KG 5GTIH 1U7MA 3M9QA 3VOPA 4UB6H 1MUUA 2MKVA 1K05A 1BDDA 1S9KE 1QVFO 1RHZB 1P84E 3RL0g 4ZMDA 4I6MC 1L0ND 1SQXE 1N73C 4IL6E 1AA0A 1FZFA 2QJPC 2P2UA 4WY4D 3P8MC 4OVNF 2JEEA 1KFNA 1LGHB 1H88A 3C8VA 2NPSB 3I56P 1JY3P 1AVYA 2M3EA 2QJYB 2GA1A 1FOSF 1H8AA 1BE3G 3GW6A 3FXEA 4H13D 3UIAA 2CK3H 5KAFE 4NPFX 1NVOA 5AVYB 5KKZC 4H0LC 3GG2A 1YHQP 1M1JC 5APTA 2H8PD 2A06G 1PL5A 3S4RA 2D2CC 3BCCD 5BU8B 2K1AA 1SFCC 2WPVB 1VF5C 4GOFA 2WITA 1J1EB 3SFEC 3VTPC 2BEZF 1L0LJ 2HR3A 4H44B 5CMZA 5B5EH 3R2PA 3HD7D 2PFXA 1LJ2A 2ZYDA 1EDIA 2JWDA 3JCUH 3M0AA 3L72D 1DEBA 1LTJA 1DIPA 1HVVA 3GMAA 3H1JJ 4Y99B 4U3FD 1NJIQ 1JO5A 5CJ4A 1PV3A 2O1KA 2RH0A 3VYIA 1QEXA 4UB8H 3RK3D 1OXZA 2KSEA 1NTMD 1OX3A 2WSEH 2C9LY 3A3YB 2KZJA 4W80A 2YXQB 2Z4EA 3LIDA 1FZBA 1KYOH 1FZCA 3V4WA 1S5LH 3AE1C 3B4SA 1GU4A 2NPSC 2E74D 2QJYC 5AW7B 1VQ8P 3OJAB 2B9BA 1NTZD 2E43A 2K9YA 2NZ2A 2DW3A 1YJWP 5AW6B 3L72E 3T97A 5CBOA 2XZRA 2KI7B 1T3UA 3AE9C 1FDMA 4U3FE 1KD1Q 2E75B 4XE5B 1LT1A 3SFDC 2YO3A 5AW1B 3VN0A 1ZN5A 2KB7P 3V2PA 3RK3E 5APUA 1NTME 1XTCC 1AQTA 1VQ9P 3B8EB 1QL1A 1SQXG 1RY3A 1Q82Q 1J1EC 1IFIA 2KZIA 3CWBD 1EQ7A 2C0XA 2N9YB 1LWUA 2ZT9B 4H44C 3WMM0 2GUSA 5KLVK 1OWAA 3MTUE 3B5ND 1SQQK 1SVFA 4PD4H 5AW4B 1NTZE 1PP9D 2IDBA 1S5LX 4YXWH 3F89A 1NKNA 3L73G 1RQUA 4Y99C 3CC2P 4HB1A 5GTHE 3HE5A 3U1CA 3V2QA 3EFGA 1VQOP 2AEJA 1S72P 2WVRA 3CCQP 5E79H 1LTJB 3E7KA 1T2KD 1GU5A 1FAVA 2R32A 1L0NG 3CPWO 2N1TA 2KS1A 2WMMA 2POHA 4DCKA 3H1HE 2JR8A 3F5HA 1ZMEC 4R4MA 1U7JA 2Q5UA 3IFMA 4EI2A 4RKUJ 2Q3IA 4HKZH 3FWNA 3H1HJ 4PD4D 1WT6A 1QL2A 1KB9H 1FZCB 3H1LG 2AEMA 1KQGB 2E75C 2O1JA 1HUCA 3TGUD 2WT7A 3U59A 5KLIB 1NGMB 2V7QJ 2HPCA 3T97B 2KUBA 4XFJA 3MGNA 3BCCG 1BGYE 3BATA 2ZT9C 4IFMA 1K73Q 3G9RA 4L74A 3RK2D 1ZR4A 1E5WA 2QM8A 2P7JA 3B5NA 5BVZA 1BGYJ 1LWUB 5APVA 3Q1MA 2WSCH 3G6EP 5CHXA 4BXLA 1JCDA 5AVXB 3A0HE 3Q5SA 3O8ZA 1LTJC 1OVRA 1YBKA 3QWOC 1L0LK 3H1ID 3H25A 3HE5B 4ZKPA 1PPJE 2QSIA 5APXA 1SP4A 1OIPA 4KHXA 1L4AD 1U57A 1PGJA 3FWLA 3M06A 2KS1B 3I5CA 1OMIA 1UIIA 5KLVD 2ZXEB 1RF0C 1FZCC 3SWYA 1SQQD 2LR2A 5DJTB 2YIUB 1SLQA 2KLVA 1AV1A 1VL2A 1SQVJ 1S3JA 1NWQA 3VP8A 2FFDB 2QM7A 3L75G 1VDFA 2IFMA 5B66E 5KLIC 2QEXP 3CCLP 4PD4I 1R5LA 2GM4A 2KIKA 3L74E 4YXDC 4RJTA 3H1IE 4JPZB 1VQ7P 3N7NA 3ABVC 2W8ZA 2FXPA 3O6QA 1P84H 2WT7B 1YTZI 3CWBG 5KJ7A 2XU6A 4IL6H 4TLFA 1KZUB 1JMBA 3G71P 2HFED 5AVZB 1BE3J 2R3SA 3KYQA 5KLVE 1JM0A 3LW5J 1LWUC 2YKQA 2KK7A 1H89A 3I55P 1SQQE 1PP9G 3P7KA 4BWNA 1GDTA 1W5CE 2KNCA 2WSSH 3V4QA 2R44A 3MUDA 3D70A 5KAFH 1KV4A 1JNMA 4AQRD 1RQVA 1KTMA 5CCHD 1AQ5A 4JYCA 4L76A 1WMKA 4PV1D 2XDJA 1KILA 5CCGA 1RF1A 1JY3O 1SS1A 2OYHA 1GMJA 2JJLA 2G8YA 1P84D 4K35A 3NXSA 1Q86Q 3PH0A 3KDPB 1NTKJ 3USSA 5CBNA 3L71G 4D6TG 2YIUC 2WSFH 2QG4A 1VQMP 2I1JA 2IZ1A 2FFDC 5AVRB 2Y9YA 3AE7C 2GUVA 3TGUG 3SWKA 1EDKA 3PHLA 3PLNA 1A02J 4U7JA 5CJ0A 1J1DB 3P8CE 1L0LD 2BCCJ 2A45H 1LNQA 1NAFA 1K04A 1W2EA 4OH8B 1JB0J 3O6QB 1Q81Q 2IX7C 3KHUA 1OFCX 1H0TA 2HG5D 3H1JD 2XKMA 3M9BA 3MZWB 1SQBK 2G3AA 1YJ9P 4OGQB 2N9BA 3AE5C 2LXBA 3GF3A 1N7SA 3JC22 3AE8C 3MP7B 2ZJSE 1FC2C 2LKMA 3A0BE 1GW3A 1SQPJ 4RO0A 4EIJA 4NPDA 1N2DC 1L0LE 1WRGA 1LTSC 3HUSA 1KORA 5K5GB 1URQA 1N86A 1FZAA 4A7PA 2NRGA 2OTJP 4GT1A 2P10A 1KILB 3L73J 1RF1B 3H1JE 1P84I 2YNYA 4M3LA 1IZNB 2M5AA 1CW5A 3HRNA 1VQ4P 3BVHA 1NOHA 5TJHA 3WUVA 2I1KA 3TNUB 2WPSA 3VMZA 2KXPB 2E76B 5GTHH 1YIJP 3GHGA 1M8OB 1CZQA 1BCCG 2L91A 1J1DC 1G2CA 3K5BA 1YI2P 1NU1G 3ZDMA 3WUTA 1IK9A 1FU1A 1M1KQ 5AVSB 1DD3A 3L70G 1SQVK 3VMXA 2RN0A 3KXDA 4WY4A 3H1LJ 5KJ7C 3C9IA 2FYUG 5BU5A 4OGQC 3C1LA 2E5YA 1ZR2A 1USEA 5C39A 3II6A 2V7QH 1ZW0A 1R5SA 1T8ZA 2OYIA 2O01H 1ZP0C 1IFDA 4N78E 5TISE 2AEFA 1Z56A 3MUDC 2AXTE 3E1RA 1GL2D 2J58A 2FXMA 2JP3A 2RKLA 1IFNA 1N8RQ 2WWWA 1AJYA 2H89C 3Q3DA 3NMDA 3CMEP 2FYNB 1PGQA 3H1HD 1JCCA 1KILC 5CCGC 3HUSB 1RF1C 4LGDE 1LTIC 1HBWA 2QRXA 1Q90D 2R5BA 1OZHA 2Q9IA 3RL0B 3HD7A 2A45I 1IK7A 4GKGA 4KT0J 3CXHD 2ZVNB 1T3JA 2E76C 1NO4A 2WPQA 1Q7YQ 1VQLP 2IBZE 1L2PA 2P1JA 3A0HH 1HH0A 2YMYA 2ZAEB 1EZVD 2HODA 4L73A 4HYTB 1DD4A 3B71A 2IFNA 1NTKK 4EYYQ 4H0LD 4JF7A 1DH3A 4OWFA 1JOCA 1PFIA 1BGYD 1G2CB 4DT0A 4R4LA 3AEDC 4DJGA 2D2CD 1GZLA 2PP6A 3L75J 1SFCD 3H1JG 1VF5D 2VRSA 3CXHE 1JY2N 1SQBE 3AE3C 1IJDB 5B66H 2WSEJ 1GD2E 5AVQB 1EZVE 3CWBJ 1RE3A 1M7LA 2KP8A 1SQBJ 1MFTA 2B87A 1GL2A 4H13B 2OYIB 1HTLC 3OA7A 1QGKB 3GF7A 3LW5H 2FYNC 2A45G 3FXDA 2KSJA 3HUSC 1PPJD 3CCMP 4DZOA 4IFDK 4CPGA 1JY3N 1SQVD 3RL0C 4B86A 2Y0DA 1ZLLA
chains in the Genus database with same CATH topology
1SQPK 1FBMA 5AVYB 1URQB 1LT9C 3U1AA 3V4QA 1M1JC 5APTA 1VPCA 2NPSD 1JMMA 2HLOA 3MUDA 1L4AC 2H8PD 1RE4C 4I1LA 1HWTC 1JNMA 2KOGA 4AQRD 3HD7B 5CCHD 1AQ5A 4JYCA 4AUWA 5BU8B 1SFCC 3HE4A 2XDJA 5AVUB 1KILA 2WITA 1J1EB 4C7NA 1JY3O 5CCGA 1RF1A 5AVVB 1MV8A 2OYHA 2JJLA 1LTTC 3VTPC 2YO2A 4C46A 5CMZA 1M1JA 3NXSA 3R2PA 2HODB 3HD7D 2P67A 3H32A 3HTKA 5APQA 3KDPB 3GHGB 3V2NA 1N7LA 3M0AA 1LTGC 4W7YA 3RK3B 2WSFH 1DEBA 1GK4A 2I1JA 2N1TB 1LTJA 1SFCA 1HVVA 2FFDC 1NU1K 4Y99B 1GW4A 5AVRB 1JO5A 5CJ4A 3NFQA 2O1KA 2GUVA 3VYIA 3CI9A 5APYA 1KFMA 3RK3D 1OXZA 2WSEH 2C9LY 1A02J 4WY4B 3NTNA 3M9HA 3A3YB 4W80A 5CJ0A 2OYIC 1J1DB 3P8CE 3VP9A 3L35A 2FYUK 2Z4EA 3LIEA 2FFDA 3LIDA 5AW5B 2A45H 1FZBA 3A5TA 1N7SC 3V4WA 1FZCA 2L5GB 1GU4A 4DOJA 1NAFA 2NPSC 2XNXA 2Z5HA 1X79B 1W2EA 1NKZB 4OH8B 5AW7B 3OJAB 2HPCB 4LC1A 2E43A 2IX7C 5CCHC 5AW6B 1KQLA 2HG5D 4LLHA 2IPPA 2XKMA 3M0DC 3M9BA 2KYVA 3T97A 1SQBK 1JY2O 1G1IA 1ZV8A 2XZRA 1URQC 2N9BA 5AVWB 1T3UA 1FDMA 1HGVA 4I2LC 1N7SA 2BASA 4XE5B 2YO3A 5AW1B 1N73A 3VN0A 2XV5A 1ZN5A 1SQXK 3B5NB 2KB7P 3HD7C 3V2PA 5APUA 1XTCC 2LKMA 2E42A 1GW3A 5KJ7D 4EIJA 3B8EB 1N2DC 1QL1A 2WPRA 4GIFA 1RY3A 1J1EC 1IFIA 1WRGA 1LTSC 3HUSA 1EQ7A 2C0XA 2W6BA 1LWUA 1URQA 1N86A 1FZAA 3WMM0 4IFFA 1HGZA 2GUSA 5KLVK 1OWAA 1J2JB 3B5ND 3MTUE 3P8CD 4GT1A 3GHGC 1SQQK 1SVFA 1CI6A 5AW4B 3HE4B 1KILB 3RK3C 1LT9A 4C7NB 1RF1B 4XA4A 3OAKA 2N1TC 1L4AA 1RE4A 2YNYA 1NKNA 4Y99C 2Z5IA 1X8YA 4M3LA 1CW5A 3H32B 3HTKB 2YKOA 5APSA 2J59M 1LTAC 3HE5A 3HRNA 3U1CA 1IO4A 5AW9B 3EFGA 3V2QA 3BVHA 4HH2A 1NOHA 5AW0B 2I1KA 3TNUB 1NHLA 2WPSA 3VMZA 1L0NK 1KILD 1IFMA 3GHGA 5CCGD 5APWA 1LTJB 4WY4C 1T2KD 1GU5A 1CZQA 1AFOA 1FAVA 1G1JA 1J1DC 1G2CA 2R32A 2ZFCA 2CPSA 2N1TA 2W6AA 1IK9A 2POHA 1GK6A 1FU1A 3SWFA 1MFZA 5AVSB 4C7RA 1LTBC 4O9BA 1HJBA 2Q5UA 3E1IA 3IFMA 2W27A 3TK1A 1SQVK 3VMXA 3BRVB 2Q3IA 4WY4A 5KJ7C 1WT6A 1QL2A 1DX7A 1JTHA 1FZCB 3C9IA 1FJPA 5BU5A 2Q7CA 1GL2B 1ZR2A 3II6A 3V2RA 2O1JA 1FJKA 2M8RA 1T8ZA 1HUCA 3RK2B 3B5NC 2WT7A 2OYIA 3U59A 2O01H 4W7ZA 2C9NY 3BASA 1IFDA 4N78E 2HPCA 2R5DA 1FOSE 2FYZA 4N3YB 3MGNA 1Z56A 3MIWA 2NPSA 1GL2D 2J58A 2FXMA 1N73B 3BATA 1IFNA 3L37A 4N6JA 4IFMA 1XTGB 3RK2D 5CCHA 2WWWA 1ZR4A 1E5WA 2QM8A 2P7JA 3M91A 3NMDA 3M0DA 3B5NA 2YKPA 5BVZA 1JCCA 1KILC 4EOTA 5CCGC 3HUSB 1RF1C 2FKWB 1T2KC 4LGDE 1N7SD 1LWUB 3PP5A 5APVA 4AYCA 1LTIC 1JUNA 1HBWA 2C0WA 1IC2A 2WSCH 5CHXA 2R5BA 2Q9IA 3RL0B 1JCDA 3HD7A 2A45I 2WTYA 4GKGA 5AVXB 2OYHB 1CI6B 1NTMK 1T3JA 1YTZT 1LT9B 3L4FA 3MD0A 1M1JB 3A2AA 1NO4A 3O8ZA 1L4AB 1LTJC 3CLQA 1IFJA 2WPQA 5AW8B 1URQD 3TSIA 2P1JA 3G3ZA 1S9KD 1L0LK 1HH0A 2YMYA 2HODA 3RL0D 3HE5B 4HYTB 3N4XA 1MZ9A 2IFNA 4N78D 4ZKPA 1NTKK 1SFCB 5APXA 1SP4A 4JF7A 1DH3A 4KHXA 2H7HA 1JOCA 3EQ2A 3KQGA 1L4AD 5AW3B 3TNUA 2HYNA 1PFIA 2MJZA 1NTZK 3P32A 3V5BA 3BRTB 1FZEA 1G2CB 3VMYA 4JYBA 1A02F 3M06A 3I5CA 1X9VA 2ZXEB 1GZLA 1RF0C 1FZGA 1FZCC 1RE3C 3SWYA 2PP6A 5KTBA 1SFCD 2M3BA 1SLQA 5AVTB 2CPBA 3KPEA 1GL2C 2KLVA 4WB4A 1JY2P 3TYYA 1GTWA 1NWQA 2VRSA 3VP8A 2WZ7A 1NH4A 2QM7A 2FFDB 3M9QA 3VOPA 1JY2N 1VDFA 2IFMA 2PAJA 3L36A 3RK2C 1MUUA 2N1TD 1IJDB 1JTHB 2GM4A 1S9KE 2H43A 2R3CA 3N7NA 5AVQB 1GD2E 2OARA 4I6MC 1RF0A 4RESB 1RE3A 1M7LA 1N73C 2KP8A 1FZFA 1GL2A 2WT7B 2OYIB 1YTZI 1HTLC 1YYCA 2P2UA 4WY4D 3OA7A 3A7OA 3P8MC 4WBAA 5KJ7A 3LW5H 2XU6A 5AW2B 2JEEA 1KFNA 1N7SB 1LGHB 2A45G 1KZUB 1H88A 2HFED 2KSJA 2NPSB 3HUSC 5AVZB 3H6PA 3KYQA 1JY3P 4ZKUA 3CL3D 4DZOA 1LWUC 1CSBA 2YKQA 1H89A 4IFDK 1FOSF 1H8AA 1JY3N 3P7KA 3RL0C 1GDTA 4B86A 3IR9A 3UIAA 1ZLLA 2OYHC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CPS A;  2CPB A;  1NH4 A;  1IFI A;  1IFD A;  2MJZ A;  1FDM A;  1HGZ A;  2C0W A;  1HH0 A;  2C0X A;  1IFJ A;  1HGV A; 
#chains in the Genus database with same CATH topology
 1SQP K;  1FBM A;  3U1A A;  1VPC A;  2NPS D;  2HLO A;  2J5U A;  3L72 G;  4ZNC A;  4GOD A;  3HD7 B;  4U3F G;  3CD6 P;  4AUW A;  3CXH I;  3D71 A;  3L74 D;  5AVU B;  4C7N A;  1NTM G;  1MV8 A;  3MHV A;  1BE3 D;  4C46 A;  1BSH A;  1M1J A;  1E79 H;  2HOD B;  1EZV I;  3HTK A;  3L71 J;  4D6T J;  3V2N A;  2LXC B;  3H1K E;  1LTG C;  3RK3 B;  1PGO A;  1SQV E;  1GK4 A;  2N1T B;  1SFC A;  1USD A;  1EDJ A;  4H44 D;  3Q5P A;  1NTZ G;  3NFQ A;  3H1K J;  2O01 N;  3CI9 A;  2P58 A;  1KQS O;  4Y28 J;  3IAO A;  3KZI E;  2E74 B;  5H2F E;  3S9O A;  4H13 C;  2OYI C;  3OW2 O;  3VP9 A;  3L35 A;  3W67 A;  3LIE A;  5AW5 B;  3A5T A;  1BE3 E;  2L5G B;  4DOJ A;  1NTK D;  2PGD A;  2QJK B;  3H1H G;  2HPC B;  2B87 B;  1M56 D;  1KQL A;  4LLH A;  1JY2 O;  2H88 C;  4ASV A;  2A06 E;  3CC4 P;  1HGV A;  4I2L C;  2BAS A;  2JWA A;  1PIX A;  2XV5 A;  4ASW A;  3B5N B;  3HD7 C;  1ZRT E;  3CX5 D;  2BCC D;  2WPR A;  4HJG H;  4GIF A;  3A0B H;  1W2B O;  4TT3 H;  3TDK A;  2E75 D;  3AEG C;  4IFF A;  1HGZ A;  1NTK E;  1BGY G;  3P8C D;  1CI6 A;  2JKV A;  3RK3 C;  1LT9 A;  4C7N B;  1M90 Q;  3D6Y A;  3OAK A;  2N1T C;  2WSC J;  1L4A A;  1RE4 A;  2AXC A;  2K3R A;  2ZT9 D;  2Z5I A;  1X8Y A;  3ITK A;  3HTK B;  2YKO A;  1LTA C;  4IL6 X;  1IO4 A;  3AE4 C;  1NHL A;  1BCC J;  1SQP D;  4NPE A;  2E74 C;  1NU1 J;  3CCE P;  3CX5 E;  2BCC E;  2CPS A;  3SWF A;  4C7R A;  3L70 J;  1VQN P;  1LTB C;  1FS0 E;  3PTZ A;  2QJK C;  3E1I A;  3L73 D;  2V4H A;  1PPJ G;  2FYU J;  1BDC A;  4PJ0 E;  1OVU A;  1JTH A;  1SQV G;  1FJP A;  1FDO A;  3CMA P;  2QE7 H;  3CCJ P;  2B88 A;  1Y8A A;  2Y0E A;  5M1B A;  3RK2 B;  3B5N C;  1SQP E;  2C9N Y;  2JO1 A;  3BAS A;  1EC5 A;  2R5D A;  1FOS E;  3MIW A;  5TIS H;  1DEE G;  1SQX J;  3L74 G;  2AXT H;  2QIW A;  3H1I G;  2KNC B;  5CCH A;  3FX0 A;  1HF9 A;  3M0D A;  3L73 E;  1HJ0 A;  3CX5 I;  3H1L D;  4EOT A;  1T2K C;  3QH9 A;  2IZ0 A;  1JUN A;  3AEE C;  2C0W A;  1IC2 A;  1EXI A;  5KLV G;  2OYH B;  1CI6 B;  1L0N E;  1LT9 B;  1SQQ G;  5KAI E;  1L4A B;  3Q2Y A;  1IFJ A;  5AW8 B;  3TSI A;  3G3Z A;  4YPC A;  1T6A A;  3N4X A;  4K3A A;  2Y0C A;  1L0N J;  4N78 D;  1VQK P;  2YMK A;  3CCU P;  2H7H A;  3WU2 E;  5AW3 B;  2FBW C;  3P32 A;  3BRT B;  1X0T A;  1NTK G;  3H1L E;  3VMY A;  4JYB A;  3TF5 A;  3AEF C;  1JEK A;  3FGA D;  4IOI H;  2WSF J;  5GTI E;  3KPE A;  4JBZ A;  4UB6 E;  3CC7 P;  3RGU A;  4WB4 A;  1NH4 A;  2BEQ D;  3L36 A;  2PAJ A;  3RK2 C;  3IN6 A;  4YTP C;  2N1T D;  3BCC E;  1JTH B;  3CXH H;  1YQ4 C;  1LP1 A;  2H43 A;  2R3C A;  1K8A Q;  2OAR A;  4L75 A;  1RF0 A;  1ZOY C;  4RES B;  1H0T B;  2BCC G;  3BCC J;  1YYC A;  2IBZ D;  3A7O A;  1X22 A;  4WBA A;  2Q1K A;  5AW2 B;  1N7S B;  2YXR B;  3H6P A;  4ZKU A;  3CL3 D;  1CSB A;  3L75 D;  3SSU A;  3PRJ A;  4MN4 C;  1PGP A;  3IR9 A;  3JSV C;  4WWI A;  2OYH C;  3L72 J;  4PV1 B;  1RH5 B;  1URQ B;  1LT9 C;  1S2E A;  2K88 A;  1JMM A;  1L4A C;  1M57 D;  1RE4 C;  4U3F J;  1Y47 A;  4I1L A;  1HWT C;  1SQP G;  2KOG A;  1SQB D;  3Q5R A;  1NTM J;  2OTL P;  1KYO D;  3HE4 A;  5B5E E;  5AVV B;  2M5A B;  1NAY A;  1LTT C;  2YO2 A;  3PJS K;  3JCU E;  2ITA A;  1QVG O;  3G4S P;  2P67 A;  3H32 A;  5APQ A;  1L0L G;  3GHG B;  3CCV P;  1K9M Q;  3IF4 A;  1N7L A;  3L75 E;  4QMA A;  4W7Y A;  2IYO A;  1VQ5 P;  1NTZ J;  5DJU B;  1NU1 K;  1KN7 A;  1GW4 A;  1EXJ A;  4UB8 E;  2RMZ A;  2ZVO B;  5APY A;  3CWB E;  1KFM A;  1OW7 A;  2OQQ A;  4WY4 B;  3NTN A;  1QX8 A;  3M9H A;  4WVZ A;  1KYO E;  3KZI H;  1S5L E;  2FYU K;  3AEC C;  2IYP A;  2FFD A;  5H2F H;  1LP1 B;  1TU3 F;  1N7S C;  3L71 D;  1PP9 E;  4D6T D;  2XND H;  2XNX A;  2W83 C;  2Z5H A;  1X79 B;  1BSN A;  1NKZ B;  2O3J A;  2FY8 A;  4GOE A;  1QLE D;  3AEB C;  4LC1 A;  5CCH C;  2IBZ I;  2B89 A;  4JQ0 D;  2IPP A;  3M0D C;  2KYV A;  3RBZ A;  1PP9 J;  1G1I A;  1ZV8 A;  4PV1 C;  1URQ C;  5AVW B;  3H1K D;  1N73 A;  1YQ3 C;  2O01 J;  2OYO A;  1SQX K;  3D6Z A;  2E42 A;  5KJ7 D;  2K9J A;  1D7M A;  4OGQ D;  1YJN P;  2KLU A;  3WUU A;  1PZQ A;  2W6B A;  2UWJ E;  3L71 E;  4PD4 E;  4D6T E;  1J2J B;  3W68 A;  3GHG C;  1KB9 D;  3AEA C;  3HE4 B;  1KYO I;  2OGU A;  2WQY C;  4XA4 A;  1Y9B A;  4KJM A;  3TGU E;  3VMA A;  3H32 B;  5APS A;  2J59 M;  4I7Z B;  5E79 E;  5AW9 B;  4HH2 A;  5AW0 B;  2W6J H;  1L0N K;  1KIL D;  1IFM A;  5CCG D;  5APW A;  4BRY A;  4WY4 C;  3TGU J;  1ZXG A;  2A06 D;  3EWK A;  1AFO A;  5L8R J;  3R4Y A;  1EDL A;  1IFP A;  2ZYG A;  3CCS P;  1G1J A;  2ZFC A;  2JDI H;  2W6A A;  1OVV A;  1GK6 A;  3RBX A;  3CX5 H;  1MFZ A;  2IBZ G;  1OW8 A;  2E76 D;  1ZRT D;  4O9B A;  1S4X A;  1HJB A;  1KB9 E;  2W27 A;  3TK1 A;  4EDF A;  3BRV B;  2E5T A;  2Q6Q A;  1DX7 A;  2ZXX A;  1YIT P;  2ZYA A;  1UIX A;  2OTK E;  4PJ0 H;  2Q7C A;  1GL2 B;  2PRR A;  4Z1M H;  3S1K A;  3V2R A;  1BCC D;  1FJK A;  3AE6 C;  2M8R A;  3AE2 C;  1VQ6 P;  2FXO A;  1NU1 D;  1KC8 Q;  1KIL E;  4W7Z A;  1MKM A;  1AVO A;  2FYZ A;  4N3Y B;  1FDI A;  1SQB G;  3L74 J;  1NYH A;  2SPZ A;  2NPS A;  1KQF B;  1OW6 A;  3L70 D;  3H1I J;  5EFW B;  2I8D A;  1N73 B;  2QJP B;  3L37 A;  1FE6 A;  4N6J A;  1VQP P;  1XTG B;  1EZV G;  3M91 A;  2K37 A;  2FYU D;  1R8E A;  2K9J B;  2YKP A;  4GDO A;  1S1C X;  1Q2N A;  2FKW B;  2W90 A;  1N7S D;  3PP5 A;  4AYC A;  5KLV J;  3CCR P;  1SQQ J;  4I7Z C;  2WTY A;  1BCC E;  1KB9 I;  1NTM K;  1YTZ T;  5KKZ B;  4H0L B;  3L4F A;  3MD0 A;  1NU1 E;  1M1J B;  3A2A A;  3V6I A;  3CLQ A;  1URQ D;  2Y9Z A;  1S9K D;  5KAI H;  3RL0 D;  1SQX D;  3L70 E;  2D2C B;  1MZ9 A;  3EFF K;  1SFC B;  1VF5 B;  4BRY B;  2Q3E A;  1KMI Z;  3EQ2 A;  3KQG A;  3TNU A;  2HYN A;  3GLM A;  2MJZ A;  1NTZ K;  2FYU E;  3V5B A;  1FZE A;  1A02 F;  2M0B A;  3WU2 H;  1X9V A;  2QVA A;  1FZG A;  1RE3 C;  5KTB A;  2QA4 P;  2M3B A;  5AVT B;  2CPB A;  1GL2 C;  1JY2 P;  3TYY A;  1GTW A;  2WZ7 A;  3H1K G;  5GTI H;  1U7M A;  3M9Q A;  3VOP A;  4UB6 H;  1MUU A;  2MKV A;  1K05 A;  1BDD A;  1S9K E;  1QVF O;  1RHZ B;  1P84 E;  3RL0 g;  4ZMD A;  4I6M C;  1L0N D;  1SQX E;  1N73 C;  4IL6 E;  1AA0 A;  1FZF A;  2QJP C;  2P2U A;  4WY4 D;  3P8M C;  4OVN F;  2JEE A;  1KFN A;  1LGH B;  1H88 A;  3C8V A;  2NPS B;  3I56 P;  1JY3 P;  1AVY A;  2M3E A;  2QJY B;  2GA1 A;  1FOS F;  1H8A A;  1BE3 G;  3GW6 A;  3FXE A;  4H13 D;  3UIA A;  2CK3 H;  5KAF E;  4NPF X;  1NVO A;  5AVY B;  5KKZ C;  4H0L C;  3GG2 A;  1YHQ P;  1M1J C;  5APT A;  2H8P D;  2A06 G;  1PL5 A;  3S4R A;  2D2C C;  3BCC D;  5BU8 B;  2K1A A;  1SFC C;  2WPV B;  1VF5 C;  4GOF A;  2WIT A;  1J1E B;  3SFE C;  3VTP C;  2BEZ F;  1L0L J;  2HR3 A;  4H44 B;  5CMZ A;  5B5E H;  3R2P A;  3HD7 D;  2PFX A;  1LJ2 A;  2ZYD A;  1EDI A;  2JWD A;  3JCU H;  3M0A A;  3L72 D;  1DEB A;  1LTJ A;  1DIP A;  1HVV A;  3GMA A;  3H1J J;  4Y99 B;  4U3F D;  1NJI Q;  1JO5 A;  5CJ4 A;  1PV3 A;  2O1K A;  2RH0 A;  3VYI A;  1QEX A;  4UB8 H;  3RK3 D;  1OXZ A;  2KSE A;  1NTM D;  1OX3 A;  2WSE H;  2C9L Y;  3A3Y B;  2KZJ A;  4W80 A;  2YXQ B;  2Z4E A;  3LID A;  1FZB A;  1KYO H;  1FZC A;  3V4W A;  1S5L H;  3AE1 C;  3B4S A;  1GU4 A;  2NPS C;  2E74 D;  2QJY C;  5AW7 B;  1VQ8 P;  3OJA B;  2B9B A;  1NTZ D;  2E43 A;  2K9Y A;  2NZ2 A;  2DW3 A;  1YJW P;  5AW6 B;  3L72 E;  3T97 A;  5CBO A;  2XZR A;  2KI7 B;  1T3U A;  3AE9 C;  1FDM A;  4U3F E;  1KD1 Q;  2E75 B;  4XE5 B;  1LT1 A;  3SFD C;  2YO3 A;  5AW1 B;  3VN0 A;  1ZN5 A;  2KB7 P;  3V2P A;  3RK3 E;  5APU A;  1NTM E;  1XTC C;  1AQT A;  1VQ9 P;  3B8E B;  1QL1 A;  1SQX G;  1RY3 A;  1Q82 Q;  1J1E C;  1IFI A;  2KZI A;  3CWB D;  1EQ7 A;  2C0X A;  2N9Y B;  1LWU A;  2ZT9 B;  4H44 C;  3WMM 0;  2GUS A;  5KLV K;  1OWA A;  3MTU E;  3B5N D;  1SQQ K;  1SVF A;  4PD4 H;  5AW4 B;  1NTZ E;  1PP9 D;  2IDB A;  1S5L X;  4YXW H;  3F89 A;  1NKN A;  3L73 G;  1RQU A;  4Y99 C;  3CC2 P;  4HB1 A;  5GTH E;  3HE5 A;  3U1C A;  3V2Q A;  3EFG A;  1VQO P;  2AEJ A;  1S72 P;  2WVR A;  3CCQ P;  5E79 H;  1LTJ B;  3E7K A;  1T2K D;  1GU5 A;  1FAV A;  2R32 A;  1L0N G;  3CPW O;  2N1T A;  2KS1 A;  2WMM A;  2POH A;  4DCK A;  3H1H E;  2JR8 A;  3F5H A;  1ZME C;  4R4M A;  1U7J A;  2Q5U A;  3IFM A;  4EI2 A;  4RKU J;  2Q3I A;  4HKZ H;  3FWN A;  3H1H J;  4PD4 D;  1WT6 A;  1QL2 A;  1KB9 H;  1FZC B;  3H1L G;  2AEM A;  1KQG B;  2E75 C;  2O1J A;  1HUC A;  3TGU D;  2WT7 A;  3U59 A;  5KLI B;  1NGM B;  2V7Q J;  2HPC A;  3T97 B;  2KUB A;  4XFJ A;  3MGN A;  3BCC G;  1BGY E;  3BAT A;  2ZT9 C;  4IFM A;  1K73 Q;  3G9R A;  4L74 A;  3RK2 D;  1ZR4 A;  1E5W A;  2QM8 A;  2P7J A;  3B5N A;  5BVZ A;  1BGY J;  1LWU B;  5APV A;  3Q1M A;  2WSC H;  3G6E P;  5CHX A;  4BXL A;  1JCD A;  5AVX B;  3A0H E;  3Q5S A;  3O8Z A;  1LTJ C;  1OVR A;  1YBK A;  3QWO C;  1L0L K;  3H1I D;  3H25 A;  3HE5 B;  4ZKP A;  1PPJ E;  2QSI A;  5APX A;  1SP4 A;  1OIP A;  4KHX A;  1L4A D;  1U57 A;  1PGJ A;  3FWL A;  3M06 A;  2KS1 B;  3I5C A;  1OMI A;  1UII A;  5KLV D;  2ZXE B;  1RF0 C;  1FZC C;  3SWY A;  1SQQ D;  2LR2 A;  5DJT B;  2YIU B;  1SLQ A;  2KLV A;  1AV1 A;  1VL2 A;  1SQV J;  1S3J A;  1NWQ A;  3VP8 A;  2FFD B;  2QM7 A;  3L75 G;  1VDF A;  2IFM A;  5B66 E;  5KLI C;  2QEX P;  3CCL P;  4PD4 I;  1R5L A;  2GM4 A;  2KIK A;  3L74 E;  4YXD C;  4RJT A;  3H1I E;  4JPZ B;  1VQ7 P;  3N7N A;  3ABV C;  2W8Z A;  2FXP A;  3O6Q A;  1P84 H;  2WT7 B;  1YTZ I;  3CWB G;  5KJ7 A;  2XU6 A;  4IL6 H;  4TLF A;  1KZU B;  1JMB A;  3G71 P;  2HFE D;  5AVZ B;  1BE3 J;  2R3S A;  3KYQ A;  5KLV E;  1JM0 A;  3LW5 J;  1LWU C;  2YKQ A;  2KK7 A;  1H89 A;  3I55 P;  1SQQ E;  1PP9 G;  3P7K A;  4BWN A;  1GDT A;  1W5C E;  2KNC A;  2WSS H;  3V4Q A;  2R44 A;  3MUD A;  3D70 A;  5KAF H;  1KV4 A;  1JNM A;  4AQR D;  1RQV A;  1KTM A;  5CCH D;  1AQ5 A;  4JYC A;  4L76 A;  1WMK A;  4PV1 D;  2XDJ A;  1KIL A;  5CCG A;  1RF1 A;  1JY3 O;  1SS1 A;  2OYH A;  1GMJ A;  2JJL A;  2G8Y A;  1P84 D;  4K35 A;  3NXS A;  1Q86 Q;  3PH0 A;  3KDP B;  1NTK J;  3USS A;  5CBN A;  3L71 G;  4D6T G;  2YIU C;  2WSF H;  2QG4 A;  1VQM P;  2I1J A;  2IZ1 A;  2FFD C;  5AVR B;  2Y9Y A;  3AE7 C;  2GUV A;  3TGU G;  3SWK A;  1EDK A;  3PHL A;  3PLN A;  1A02 J;  4U7J A;  5CJ0 A;  1J1D B;  3P8C E;  1L0L D;  2BCC J;  2A45 H;  1LNQ A;  1NAF A;  1K04 A;  1W2E A;  4OH8 B;  1JB0 J;  3O6Q B;  1Q81 Q;  2IX7 C;  3KHU A;  1OFC X;  1H0T A;  2HG5 D;  3H1J D;  2XKM A;  3M9B A;  3MZW B;  1SQB K;  2G3A A;  1YJ9 P;  4OGQ B;  2N9B A;  3AE5 C;  2LXB A;  3GF3 A;  1N7S A;  3JC2 2;  3AE8 C;  3MP7 B;  2ZJS E;  1FC2 C;  2LKM A;  3A0B E;  1GW3 A;  1SQP J;  4RO0 A;  4EIJ A;  4NPD A;  1N2D C;  1L0L E;  1WRG A;  1LTS C;  3HUS A;  1KOR A;  5K5G B;  1URQ A;  1N86 A;  1FZA A;  4A7P A;  2NRG A;  2OTJ P;  4GT1 A;  2P10 A;  1KIL B;  3L73 J;  1RF1 B;  3H1J E;  1P84 I;  2YNY A;  4M3L A;  1IZN B;  2M5A A;  1CW5 A;  3HRN A;  1VQ4 P;  3BVH A;  1NOH A;  5TJH A;  3WUV A;  2I1K A;  3TNU B;  2WPS A;  3VMZ A;  2KXP B;  2E76 B;  5GTH H;  1YIJ P;  3GHG A;  1M8O B;  1CZQ A;  1BCC G;  2L91 A;  1J1D C;  1G2C A;  3K5B A;  1YI2 P;  1NU1 G;  3ZDM A;  3WUT A;  1IK9 A;  1FU1 A;  1M1K Q;  5AVS B;  1DD3 A;  3L70 G;  1SQV K;  3VMX A;  2RN0 A;  3KXD A;  4WY4 A;  3H1L J;  5KJ7 C;  3C9I A;  2FYU G;  5BU5 A;  4OGQ C;  3C1L A;  2E5Y A;  1ZR2 A;  1USE A;  5C39 A;  3II6 A;  2V7Q H;  1ZW0 A;  1R5S A;  1T8Z A;  2OYI A;  2O01 H;  1ZP0 C;  1IFD A;  4N78 E;  5TIS E;  2AEF A;  1Z56 A;  3MUD C;  2AXT E;  3E1R A;  1GL2 D;  2J58 A;  2FXM A;  2JP3 A;  2RKL A;  1IFN A;  1N8R Q;  2WWW A;  1AJY A;  2H89 C;  3Q3D A;  3NMD A;  3CME P;  2FYN B;  1PGQ A;  3H1H D;  1JCC A;  1KIL C;  5CCG C;  3HUS B;  1RF1 C;  4LGD E;  1LTI C;  1HBW A;  2QRX A;  1Q90 D;  2R5B A;  1OZH A;  2Q9I A;  3RL0 B;  3HD7 A;  2A45 I;  1IK7 A;  4GKG A;  4KT0 J;  3CXH D;  2ZVN B;  1T3J A;  2E76 C;  1NO4 A;  2WPQ A;  1Q7Y Q;  1VQL P;  2IBZ E;  1L2P A;  2P1J A;  3A0H H;  1HH0 A;  2YMY A;  2ZAE B;  1EZV D;  2HOD A;  4L73 A;  4HYT B;  1DD4 A;  3B71 A;  2IFN A;  1NTK K;  4EYY Q;  4H0L D;  4JF7 A;  1DH3 A;  4OWF A;  1JOC A;  1PFI A;  1BGY D;  1G2C B;  4DT0 A;  4R4L A;  3AED C;  4DJG A;  2D2C D;  1GZL A;  2PP6 A;  3L75 J;  1SFC D;  3H1J G;  1VF5 D;  2VRS A;  3CXH E;  1JY2 N;  1SQB E;  3AE3 C;  1IJD B;  5B66 H;  2WSE J;  1GD2 E;  5AVQ B;  1EZV E;  3CWB J;  1RE3 A;  1M7L A;  2KP8 A;  1SQB J;  1MFT A;  2B87 A;  1GL2 A;  4H13 B;  2OYI B;  1HTL C;  3OA7 A;  1QGK B;  3GF7 A;  3LW5 H;  2FYN C;  2A45 G;  3FXD A;  2KSJ A;  3HUS C;  1PPJ D;  3CCM P;  4DZO A;  4IFD K;  4CPG A;  1JY3 N;  1SQV D;  3RL0 C;  4B86 A;  2Y0D A;  1ZLL A; 
#chains in the Genus database with same CATH homology
 1SQP K;  1FBM A;  5AVY B;  1URQ B;  1LT9 C;  3U1A A;  3V4Q A;  1M1J C;  5APT A;  1VPC A;  2NPS D;  1JMM A;  2HLO A;  3MUD A;  1L4A C;  2H8P D;  1RE4 C;  4I1L A;  1HWT C;  1JNM A;  2KOG A;  4AQR D;  3HD7 B;  5CCH D;  1AQ5 A;  4JYC A;  4AUW A;  5BU8 B;  1SFC C;  3HE4 A;  2XDJ A;  5AVU B;  1KIL A;  2WIT A;  1J1E B;  4C7N A;  1JY3 O;  5CCG A;  1RF1 A;  5AVV B;  1MV8 A;  2OYH A;  2JJL A;  1LTT C;  3VTP C;  2YO2 A;  4C46 A;  5CMZ A;  1M1J A;  3NXS A;  3R2P A;  2HOD B;  3HD7 D;  2P67 A;  3H32 A;  3HTK A;  5APQ A;  3KDP B;  3GHG B;  3V2N A;  1N7L A;  3M0A A;  1LTG C;  4W7Y A;  3RK3 B;  2WSF H;  1DEB A;  1GK4 A;  2I1J A;  2N1T B;  1LTJ A;  1SFC A;  1HVV A;  2FFD C;  1NU1 K;  4Y99 B;  1GW4 A;  5AVR B;  1JO5 A;  5CJ4 A;  3NFQ A;  2O1K A;  2GUV A;  3VYI A;  3CI9 A;  5APY A;  1KFM A;  3RK3 D;  1OXZ A;  2WSE H;  2C9L Y;  1A02 J;  4WY4 B;  3NTN A;  3M9H A;  3A3Y B;  4W80 A;  5CJ0 A;  2OYI C;  1J1D B;  3P8C E;  3VP9 A;  3L35 A;  2FYU K;  2Z4E A;  3LIE A;  2FFD A;  3LID A;  5AW5 B;  2A45 H;  1FZB A;  3A5T A;  1N7S C;  3V4W A;  1FZC A;  2L5G B;  1GU4 A;  4DOJ A;  1NAF A;  2NPS C;  2XNX A;  2Z5H A;  1X79 B;  1W2E A;  1NKZ B;  4OH8 B;  5AW7 B;  3OJA B;  2HPC B;  4LC1 A;  2E43 A;  2IX7 C;  5CCH C;  5AW6 B;  1KQL A;  2HG5 D;  4LLH A;  2IPP A;  2XKM A;  3M0D C;  3M9B A;  2KYV A;  3T97 A;  1SQB K;  1JY2 O;  1G1I A;  1ZV8 A;  2XZR A;  1URQ C;  2N9B A;  5AVW B;  1T3U A;  1FDM A;  1HGV A;  4I2L C;  1N7S A;  2BAS A;  4XE5 B;  2YO3 A;  5AW1 B;  1N73 A;  3VN0 A;  2XV5 A;  1ZN5 A;  1SQX K;  3B5N B;  2KB7 P;  3HD7 C;  3V2P A;  5APU A;  1XTC C;  2LKM A;  2E42 A;  1GW3 A;  5KJ7 D;  4EIJ A;  3B8E B;  1N2D C;  1QL1 A;  2WPR A;  4GIF A;  1RY3 A;  1J1E C;  1IFI A;  1WRG A;  1LTS C;  3HUS A;  1EQ7 A;  2C0X A;  2W6B A;  1LWU A;  1URQ A;  1N86 A;  1FZA A;  3WMM 0;  4IFF A;  1HGZ A;  2GUS A;  5KLV K;  1OWA A;  1J2J B;  3B5N D;  3MTU E;  3P8C D;  4GT1 A;  3GHG C;  1SQQ K;  1SVF A;  1CI6 A;  5AW4 B;  3HE4 B;  1KIL B;  3RK3 C;  1LT9 A;  4C7N B;  1RF1 B;  4XA4 A;  3OAK A;  2N1T C;  1L4A A;  1RE4 A;  2YNY A;  1NKN A;  4Y99 C;  2Z5I A;  1X8Y A;  4M3L A;  1CW5 A;  3H32 B;  3HTK B;  2YKO A;  5APS A;  2J59 M;  1LTA C;  3HE5 A;  3HRN A;  3U1C A;  1IO4 A;  5AW9 B;  3EFG A;  3V2Q A;  3BVH A;  4HH2 A;  1NOH A;  5AW0 B;  2I1K A;  3TNU B;  1NHL A;  2WPS A;  3VMZ A;  1L0N K;  1KIL D;  1IFM A;  3GHG A;  5CCG D;  5APW A;  1LTJ B;  4WY4 C;  1T2K D;  1GU5 A;  1CZQ A;  1AFO A;  1FAV A;  1G1J A;  1J1D C;  1G2C A;  2R32 A;  2ZFC A;  2CPS A;  2N1T A;  2W6A A;  1IK9 A;  2POH A;  1GK6 A;  1FU1 A;  3SWF A;  1MFZ A;  5AVS B;  4C7R A;  1LTB C;  4O9B A;  1HJB A;  2Q5U A;  3E1I A;  3IFM A;  2W27 A;  3TK1 A;  1SQV K;  3VMX A;  3BRV B;  2Q3I A;  4WY4 A;  5KJ7 C;  1WT6 A;  1QL2 A;  1DX7 A;  1JTH A;  1FZC B;  3C9I A;  1FJP A;  5BU5 A;  2Q7C A;  1GL2 B;  1ZR2 A;  3II6 A;  3V2R A;  2O1J A;  1FJK A;  2M8R A;  1T8Z A;  1HUC A;  3RK2 B;  3B5N C;  2WT7 A;  2OYI A;  3U59 A;  2O01 H;  4W7Z A;  2C9N Y;  3BAS A;  1IFD A;  4N78 E;  2HPC A;  2R5D A;  1FOS E;  2FYZ A;  4N3Y B;  3MGN A;  1Z56 A;  3MIW A;  2NPS A;  1GL2 D;  2J58 A;  2FXM A;  1N73 B;  3BAT A;  1IFN A;  3L37 A;  4N6J A;  4IFM A;  1XTG B;  3RK2 D;  5CCH A;  2WWW A;  1ZR4 A;  1E5W A;  2QM8 A;  2P7J A;  3M91 A;  3NMD A;  3M0D A;  3B5N A;  2YKP A;  5BVZ A;  1JCC A;  1KIL C;  4EOT A;  5CCG C;  3HUS B;  1RF1 C;  2FKW B;  1T2K C;  4LGD E;  1N7S D;  1LWU B;  3PP5 A;  5APV A;  4AYC A;  1LTI C;  1JUN A;  1HBW A;  2C0W A;  1IC2 A;  2WSC H;  5CHX A;  2R5B A;  2Q9I A;  3RL0 B;  1JCD A;  3HD7 A;  2A45 I;  2WTY A;  4GKG A;  5AVX B;  2OYH B;  1CI6 B;  1NTM K;  1T3J A;  1YTZ T;  1LT9 B;  3L4F A;  3MD0 A;  1M1J B;  3A2A A;  1NO4 A;  3O8Z A;  1L4A B;  1LTJ C;  3CLQ A;  1IFJ A;  2WPQ A;  5AW8 B;  1URQ D;  3TSI A;  2P1J A;  3G3Z A;  1S9K D;  1L0L K;  1HH0 A;  2YMY A;  2HOD A;  3RL0 D;  3HE5 B;  4HYT B;  3N4X A;  1MZ9 A;  2IFN A;  4N78 D;  4ZKP A;  1NTK K;  1SFC B;  5APX A;  1SP4 A;  4JF7 A;  1DH3 A;  4KHX A;  2H7H A;  1JOC A;  3EQ2 A;  3KQG A;  1L4A D;  5AW3 B;  3TNU A;  2HYN A;  1PFI A;  2MJZ A;  1NTZ K;  3P32 A;  3V5B A;  3BRT B;  1FZE A;  1G2C B;  3VMY A;  4JYB A;  1A02 F;  3M06 A;  3I5C A;  1X9V A;  2ZXE B;  1GZL A;  1RF0 C;  1FZG A;  1FZC C;  1RE3 C;  3SWY A;  2PP6 A;  5KTB A;  1SFC D;  2M3B A;  1SLQ A;  5AVT B;  2CPB A;  3KPE A;  1GL2 C;  2KLV A;  4WB4 A;  1JY2 P;  3TYY A;  1GTW A;  1NWQ A;  2VRS A;  3VP8 A;  2WZ7 A;  1NH4 A;  2QM7 A;  2FFD B;  3M9Q A;  3VOP A;  1JY2 N;  1VDF A;  2IFM A;  2PAJ A;  3L36 A;  3RK2 C;  1MUU A;  2N1T D;  1IJD B;  1JTH B;  2GM4 A;  1S9K E;  2H43 A;  2R3C A;  3N7N A;  5AVQ B;  1GD2 E;  2OAR A;  4I6M C;  1RF0 A;  4RES B;  1RE3 A;  1M7L A;  1N73 C;  2KP8 A;  1FZF A;  1GL2 A;  2WT7 B;  2OYI B;  1YTZ I;  1HTL C;  1YYC A;  2P2U A;  4WY4 D;  3OA7 A;  3A7O A;  3P8M C;  4WBA A;  5KJ7 A;  3LW5 H;  2XU6 A;  5AW2 B;  2JEE A;  1KFN A;  1N7S B;  1LGH B;  2A45 G;  1KZU B;  1H88 A;  2HFE D;  2KSJ A;  2NPS B;  3HUS C;  5AVZ B;  3H6P A;  3KYQ A;  1JY3 P;  4ZKU A;  3CL3 D;  4DZO A;  1LWU C;  1CSB A;  2YKQ A;  1H89 A;  4IFD K;  1FOS F;  1H8A A;  1JY3 N;  3P7K A;  3RL0 C;  1GDT A;  4B86 A;  3IR9 A;  3UIA A;  1ZLL A;  2OYH C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...