1NH4A

Structure of the coat protein in fd filamentous bacteriophage particles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
44
structure length
44
Chain Sequence
PAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords Major coat protein
publication title Structure of the coat protein in fd filamentous bacteriophage particles determined by solid-state NMR spectroscopy
pubmed doi rcsb
total genus 18
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nh4A00
1IFJA 1NH4A 1IFDA 1HGVA 2MJZA 1HH0A 2CPBA 1HGZA 2CPSA 2C0WA 1FDMA 1IFIA 2C0XA
chains in the Genus database with same CATH superfamily
1NTKG 1ZR4A 5KTBA 1EDKA 3M9HA 2WT7B 1L4AA 1NGMB 2RKLA 3AE9C 1P84I 4B86A 2C9LY 4IOIH 3H1HE 1JY3O 2KZJA 1W2EA 4L74A 2KZIA 3JCUH 3CCVP 2J59M 4W7YA 3M9BA 4H44C 1GW3A 1A02F 1RF0C 4ZKUA 1FC2C 1BGYG 1KB9I 1YQ3C 2K9JB 1S5LH 1HBWA 2LR2A 1AVOA 2FXMA 1KQGB 1LT9A 2YIUC 1M7LA 3RK3C 3CCUP 1SQVE 3U1CA 3H1KJ 2YMKA 1YJNP 3EFGA 3RK2C 5KKZC 3TGUG 3RBXA 2MKVA 5AW1B 3II6A 1ZRTE 1N73B 4HH2A 3L4FA 4GKGA 3H1KD 1OMIA 1VL2A 2KSJA 3I5CA 4H13B 4BWNA 1AQTA 2BCCG 2Z5IA 1NAYA 5KLIC 1RF1C 1N2DC 1OVUA 2O3JA 1ZXGA 3KYQA 2IZ0A 4PD4H 1Z56A 1QVFO 1DD4A 1KMIZ 2W6BA 3IAOA 2QJPB 2JKVA 1M1JB 1JY2P 3M91A 1ZN5A 1S9KD 3G9RA 3M0DA 1IFNA 3HD7A 2XV5A 4GODA 1RF1A 1KC8Q 2FFDB 3CMAP 4D6TG 2XNDH 3CCSP 2K1AA 1SQQD 1QL1A 2RN0A 4XA4A 2O1JA 3U59A 3HUSA 1MV8A 3R4YA 3CWBD 3GHGA 4PJ0H 2YKQA 1KILB 2OARA 2QJYB 4PD4D 1GD2E 3P8CE 2OGUA 2W6AA 4Y99B 3PLNA 1Q90D 2PGDA 1OVRA 3QH9A 2M0BA 1YTZT 2YKPA 2HPCA 2P67A 4EYYQ 3BASA 3I56P 2XZRA 1VPCA 2K9YA 2H89C 2QVAA 4IFDK 4Y28J 1JY2N 2Q7CA 1OZHA 4EIJA 3PJSK 2WT7A 5KLVE 3PP5A 1HH0A 1OXZA 5APSA 3MUDA 2FY8A 5BVZA 1CW5A 1PPJD 1SQQG 5AW4B 3E1RA 1KYOE 3SSUA 4YPCA 4W80A 2Z5HA 1HGZA 3UIAA 3CWBG 1ZR2A 2WQYC 3L74J 1BCCE 3MGNA 1YI2P 4JF7A 1R8EA 4N78E 4C7RA 1MFZA 3L74D 2R32A 1GK4A 5DJTB 4PV1D 3VMZA 5AVQB 1AVYA 1N73A 1NU1K 2GUSA 1BE3E 1NTZK 3AE3C 1LJ2A 2QJPC 1VF5B 1M1JC 3SWYA 1PL5A 2JWAA 2W6JH 1YHQP 3SFEC 5B66H 3W68A 1USDA 1FOSE 4EDFA 1IFDA 2QM7A 3V2QA 4YXWH 2NRGA 2FKWB 3CX5I 4XFJA 2K37A 1SQBK 2IFMA 1ZOYC 2IZ1A 1R5SA 2M8RA 2E43A 1M1KQ 4WVZA 2KSEA 3ITKA 1GL2B 1YQ4C 2KP8A 4JPZB 4O9BA 2IBZE 3H1IJ 1HTLC 3R2PA 1GK6A 1URQB 2IYPA 3CXHE 3H25A 2AXTH 1LP1B 3Q2YA 2FFDA 4Y99C 2AEFA 5E79E 4JYBA 1W5CE 4IL6E 3FWLA 2QIWA 3H1ID 4BXLA 1ZLLA 3O6QB 1QL2A 1UIXA 3BCCG 4IL6H 4AQRD 1GU4A 2N1TA 2M5AA 1IK7A 2WWWA 2SPZA 1NTME 1KILA 5B5EE 1SFCA 3NFQA 3D6ZA 1J1DC 5AVRB 2WVRA 2ZJSE 5AVXB 3AE5C 1H0TA 4K35A 1PGPA 1EZVE 1JNMA 2P1JA 3L70E 4WY4D 1KZUB 4EI2A 2A45I 3E7KA 3MZWB 1E5WA 5CMZA 1GL2D 1T8ZA 1S72P 1NKZB 3L71D 2A06D 2K88A 3GF7A 2FYUG 3L36A 2JDIH 2CPSA 3EQ2A 2B88A 3V2RA 5AVSB 2Q5UA 2O01N 3C8VA 3WU2E 5CBNA 1QLED 4H44B 3AE2C 2R44A 3WU2H 5GTHE 1SP4A 1N7SD 1NTKE 5H2FE 2HG5D 3CCQP 3H1JJ 3RK3B 1VQ8P 5GTHH 2HODA 3RK2B 5KKZB 2ITAA 2JWDA 1NU1G 2Y9ZA 1IZNB 2QE7H 1NTZG 5APWA 1ZV8A 3FWNA 4YXDC 5KJ7D 3H1JD 4WY4C 1BGYE 2IDBA 3BRVB 3L37A 1L4AD 3W67A 3L71G 4PD4I 1X9VA 3T97B 1GL2C 1G2CB 1FAVA 3L73J 1G1IA 5AW2B 1M8OB 1IFPA 3HE5A 3GMAA 3MIWA 1EDIA 2YXRB 2KIKA 4ASVA 2QSIA 3CX5E 3TGUE 4N6JA 1PP9G 1YYCA 2KNCA 1S3JA 1IJDB 1AFOA 3L73D 2M3EA 3TF5A 1JY2O 1PZQA 1PGJA 1Q7YQ 3E1IA 3PTZA 1L0NE 2NPSD 3B5NA 3TK1A 1NKNA 2BCCE 2WSCJ 1YJWP 1URQA 2E74D 2HR3A 3AE7C 3WMM0 1HGVA 1LP1A 1LTTC 2WSFH 3M9QA 3VP8A 2XU6A 3FXEA 4LC1A 3L35A 4U3FG 1OWAA 3EWKA 5CCGC 5C39A 5KJ7C 1DEBA 2JP3A 1LTBC 4GT1A 4I7ZB 5CCHA 2I1KA 1GZLA 2WMMA 2YMYA 3HE4B 1L0NJ 1L0LJ 2N9YB 4KHXA 1VQOP 1WRGA 4JQ0D 3V2NA 2WSFJ 2OYIA 1CSBA 3LIDA 3L75D 3H1LG 2C0XA 1GTWA 4I6MC 4D6TE 1IFMA 3C1LA 3CCJP 2ZYGA 2L5GB 1VDFA 1HJ0A 1SQQK 1M90Q 2H7HA 3HD7D 2M3BA 4KJMA 3ABVC 1OW7A 2NPSC 4ZMDA 3VN0A 2V4HA 2HLOA 1SQPE 1ZW0A 3MTUE 2E74C 1G1JA 1OW6A 1VQLP 4GIFA 5BU8B 1QX8A 4LGDE 2Q3IA 3GF3A 3HTKB 2ZYDA 1SQXG 1X0TA 1KQSO 1AJYA 2VRSA 2JJLA 1RF0A 3PHLA 1FDIA 3H1HJ 1CZQA 1KQFB 1VQ6P 4QMAA 3WUVA 2Q3EA 2H43A 1RY3A 1S9KE 2RH0A 1IK9A 3L75G 4I2LC 2V7QH 3H1HD 2E75D 1SQPJ 1SQVJ 2BEZF 1S5LX 3VTPC 4L76A 3P7KA 1UIIA 5AVYB 3V2PA 1QEXA 1FZGA 1SQVD 4GOFA 1G2CA 3KXDA 1KTMA 2WPQA 1LTGC 1ZMEC 1ZRTD 2B87B 4Z1MH 2IYOA 1XTGB 1JCCA 3H1KG 2A45G 2OTJP 4I7ZC 1VQMP 1Q81Q 2AEJA 4H0LD 4C7NA 1RE4C 1JTHB 5KAIE 1YTZI 1FOSF 2K3RA 2E75C 1K73Q 3CC4P 1MUUA 3MHVA 2OTKE 4DT0A 1OX3A 3FXDA 1EDLA 4HJGH 4PV1B 2PP6A 2QG4A 1SQVG 1A02J 2OYOA 5CHXA 5APXA 1KILE 3N4XA 2P10A 4TT3H 1J1DB 2Y0EA 2L91A 2FYUK 1OFCX 1P84E 1JUNA 1AA0A 1LTJC 3M06A 3BCCE 1P84H 2K9JA 1KB9E 3P8CD 1KYOH 2AXCA 1NAFA 2IPPA 1SLQA 2OYHC 2WPVB 3I55P 1KB9H 5KLVJ 1H8AA 2KXPB 4NPFX 1NO4A 5M1BA 1MKMA 2N1TD 5APUA 3V4WA 1OW8A 1YITP 1CI6B 3HRNA 5GTIE 3G71P 1NH4A 1SFCD 5KLVD 2ZVNB 3L72E 5GTIH 1JMMA 2FXOA 4DCKA 1BCCJ 2FYNC 2FYUE 3VMYA 5EFWB 1KYOD 1HWTC 4RKUJ 3CMEP 1PPJG 2POHA 1LTAC 4UB8E 3H32B 1JEKA 1S1CX 2H88C 3BVHA 1KQLA 1Y9BA 3G6EP 3FGAD 1DEEG 4WY4B 1BCCD 3AEDC 1H88A 1EQ7A 3LIEA 1YJ9P 1M1JA 1BE3J 1N86A 4NPEA 2Y0DA 4N78D 3GW6A 4WWIA 3L72J 3OW2O 1H89A 3Q5SA 1T3UA 2PFXA 3F89A 3L74G 3PRJA 4OWFA 1NU1E 4WB4A 1BE3D 1T2KD 2KOGA 1EXJA 1NTZE 3CXHH 3Q1MA 4PV1C 5E79H 1Q2NA 3VMXA 3A3YB 1GU5A 1N7SB 1RQUA 1VQKP 3P32A 3NMDA 1OIPA 1DD3A 2ZT9D 3V6IA 1SQBE 3D6YA 3A0HE 5B5EH 4A7PA 1NOHA 3IR9A 1PP9E 2KS1B 3NXSA 1YIJP 2D2CD 1YBKA 1VQPP 4C46A 3A0HH 3S9OA 4RESB 5TJHA 1DH3A 2IBZD 1L4AB 4I1LA 3KQGA 1IC2A 4UB6E 1N8RQ 1HUCA 2C0WA 3CXHD 1LGHB 3IF4A 4WBAA 2YNYA 1VQNP 1NTMJ 2UWJE 3TYYA 4BRYB 4HYTB 3TDKA 1OVVA 1LTSC 1SQBJ 1J1EC 3B5ND 4R4MA 3H1IG 3RL0D 4U3FE 1FU1A 1T2KC 2CK3H 3PH0A 4M3LA 1NTMD 3L70J 1SQXK 2QM8A 4ZKPA 2NPSB 1RHZB 1EDJA 5AVUB 1IFJA 1EXIA 5AW6B 2B9BA 1X79B 2E74B 1QGKB 1JO5A 1EZVD 3CC2P 5DJUB 5H2FH 1IO4A 3L70D 2KB7P 3H1LE 3KZIE 4XE5B 1CI6A 3Q5RA 1AQ5A 3B8EB 3TSIA 2WSEH 2A06G 1LWUC 3RK3E 2KK7A 3MP7B 3SWKA 2OTLP 1NTKJ 2WZ7A 2ZFCA 1K8AQ 3OA7A 1DX7A 1VQ4P 1RE3C 3RL0C 1SQXE 4WY4A 1GW4A 2N9BA 1NTKD 2WSEJ 3CX5H 1KV4A 1PV3A 3HD7B 1GL2A 1BGYJ 1N7SC 1BDDA 2O01H 3L75E 4L73A 1BSHA 2WITA 3O8ZA 1FZCC 3AE8C 1USEA 2O1KA 3HUSB 3QWOC 1BGYD 3H1JG 3TGUJ 2XDJA 1XTCC 1PFIA 3O6QA 1PGOA 4AUWA 1L4AC 1FS0E 3F5HA 1VQ9P 2O01J 2E42A 2ZXEB 1SQVK 2LXCB 4ASWA 3CX5D 4OGQD 3TGUD 5AW5B 2BCCJ 5AVWB 2E75B 2LKMA 1LNQA 5AW7B 1LT1A 2C9NY 2R5DA 2BEQD 3SWFA 2KS1A 3L73G 4IFMA 2W27A 5CCGA 4HB1A 1L0ND 1L0LD 2Y0CA 3SFDC 5KJ7A 3H1KE 1FZEA 1LT9C 1W2BO 2BCCD 3EFFK 3JCUE 3V4QA 1J2JB 3G3ZA 3CCRP 1KYOI 3Q3DA 3AE4C 2A45H 1ZP0C 1WMKA 4BRYA 1S5LE 2WSSH 2KUBA 3D71A 1KN7A 3OAKA 1Q82Q 2KYVA 3CC7P 4D6TJ 1FDOA 1LTJB 4DJGA 3K5BA 3WUUA 1MFTA 2XNXA 2GUVA 1LTIC 2NPSA 3AE1C 3A2AA 3IN6A 1FZFA 2QRXA 1K9MQ 2OYHB 4H0LB 3FX0A 2QJKB 4LLHA 5APQA 2NZ2A 4OGQC 4D6TD 2ZXXA 1U7JA 1L0NG 1L0LG 2E76D 1M56D 1SQQE 1VQ5P 3USSA 1Q86Q 1FBMA 2KLUA 2MJZA 3G4SP 3CWBE 1X22A 3M0DC 1SQPD 3WUTA 3HD7C 3T97A 4PD4E 2ZAEB 2E5YA 2JO1A 2V7QJ 1HF9A 2FYNB 5AVZB 3U1AA 3A0BE 3JC22 5AVTB 5AW8B 4ZNCA 1FDMA 3OJAB 3A0BH 3HUSC 1JM0A 2IBZI 1KD1Q 1SQQJ 3GHGC 3VOPA 3CXHI 3RL0g 5KLVK 3CWBJ 5BU5A 3H1HG 2Q6QA 4PJ0E 3TNUB 1PPJE 2XKMA 1GMJA 2I1JA 3KDPB 2WTYA 3B71A 4CPGA 2E76C 3VYIA 2N1TB 2M5AB 5KAIH 4H13D 2P58A 5L8RJ 1SQPG 3VMAA 1SFCB 2OQQA 4KT0J 3P8MC 3AE6C 3HE4A 3NTNA 3MUDC 1M57D 3IFMA 1H0TB 1RE4A 1EZVI 2AEMA 4JYCA 5AW9B 1NJIQ 2IX7C 2ZVOB 2YO3A 3L74E 3CCLP 2DW3A 3S1KA 1JY3P 4RJTA 5CJ4A 2KLVA 3GLMA 3CCEP 3Q5PA 1NVOA 4H0LC 2QJKC 2GA1A 1TU3F 1WT6A 4NPDA 1N73C 2QEXP 1J1EB 3S4RA 3HTKA 2Y9YA 3A5TA 2GM4A 4H13C 1FJPA 1LTJA 1KILD 2FYZA 2YKOA 2HODB 3H6PA 1HJBA 2P2UA 1FZBA 1Y8AA 2OYHA 3BCCJ 2P7JA 4IFFA 2YO2A 4R4LA 2R3CA 2ZT9B 4AYCA 5KAFE 3CPWO 1P84D 1KORA 2B89A 5B66E 1FZAA 2RMZA 4OH8B 5KAFH 1JY3N 3H1IE 3BCCD 2D2CB 1KB9D 1RH5B 4K3AA 3CI9A 2R3SA 3HE5B 4UB8H 3MD0A 4U7JA 1NTMK 2QA4P 1LWUB 2JR8A 2E5TA 2FFDC 2KNCB 3CL3D 2J5UA 1R5LA 2FYUJ 2B87A 4L75A 1FJKA 3B5NB 2N1TC 3RL0B 5CBOA 2AXTE 3L72D 1KILC 5KLVG 2QJYC 2JEEA 1U7MA 1KFMA 1SFCC 1QVGO 1NHLA 3L71E 2FYUD 2A06E 1MZ9A 1JTHA 2HYNA 1S4XA 2W90A 3C9IA 3TNUA 1PGQA 1FZCB 1S2EA 4YTPC 1BCCG 1VF5D 4GOEA 1NU1J 2WPRA 3CLQA 3AECC 5APYA 3AEEC 1NTZJ 4N3YB 1GDTA 4TLFA 1NTKK 2OYIB 5AW3B 3VP9A 1KFNA 2W8ZA 2WPSA 3L71J 1D7MA 1E79H 5K5GB 2ZYAA 2W83C 2G8YA 1NU1D 5AW0B 1NTZD 4UB6H 1BE3G 2I8DA 5TISE 1K05A 3L72G 3H1JE 4IL6X 4W7ZA 3BRTB 1PP9J 1SS1A 3CCMP 4MN4C 1LT9B 1URQD 1T3JA 5TISH 3D70A 1NYHA 1AV1A 1JOCA 1SQBD 4DZOA 2BASA 3JSVC 2R5BA 3B4SA 4DOJA 2ZT9C 1JCDA 1PP9D 1SVFA 3KHUA 3AEAC 2IFNA 2Z4EA 5CCHD 3L73E 2D2CC 1JMBA 1VF5C 1L0NK 1EC5A 1L0LK 2IBZG 2YIUB 4U3FJ 3KZIH 1L2PA 2G3AA 2H8PD 2KI7B 2Q1KA 3RGUA 4HKZH 2PAJA 3GG2A 5CCGD 4OGQB 3A7OA 2PRRA 1T6AA 4U3FD 1IFIA 1VQ7P 3H32A 3M0AA 5AVVB 4JBZA 3CD6P 3B5NC 1NTMG 3H1LJ 2CPBA 3AEGC 1U57A 2FXPA 1Y47A 1K04A 1SQBG 1URQC 2WSCH 1N7LA 1LWUA 5KLIB 5CJ0A 2LXBA 1RF1B 1FE6A 2J58A 3ZDMA 1EZVG 3H1LD 4H44D 3L70G 4GDOA 3BATA 2Q9IA 1BSNA 1HVVA 3AEBC 3LW5H 1L0LE 5CCHC 1DIPA 1RE3A 1PIXA 3RBZA 1JB0J 3GHGB 3KPEA 4EOTA 5APTA 4C7NB 1BDCA 3RK3D 3AEFC 1SQXJ 1X8YA 2HFED 2OYIC 5APVA 3RK2D 1N7SA 1SQPK 2FBWC 3N7NA 2HPCB 4OVNF 3LW5J 1FZCA 1RQVA 1SQXD 3L75J 4RO0A 3V5BA 1NWQA 2E76B 2YXQB
chains in the Genus database with same CATH topology
1ZR4A 1HWTC 5KLVK 2POHA 5KTBA 1LTAC 5BU5A 3H32B 3M9HA 2WT7B 1L4AA 3BVHA 1KQLA 1SP4A 1N7SD 3TNUB 2XKMA 4WY4B 2I1JA 3KDPB 2WTYA 2HG5D 4B86A 2C9LY 3RK3B 1H88A 1EQ7A 3VYIA 3LIEA 2N1TB 1JY3O 2HODA 1W2EA 1M1JA 2J59M 4W7YA 1N86A 3M9BA 1GW3A 3RK2B 1A02F 1RF0C 4ZKUA 4N78D 1SFCB 1HBWA 5APWA 3P8MC 1H89A 1ZV8A 3HE4A 1T3UA 3NTNA 5KJ7D 4WY4C 2FXMA 3IFMA 1LT9A 1RE4A 1M7LA 3BRVB 3L37A 4WB4A 3RK3C 1L4AD 3U1CA 1T2KD 2KOGA 1X9VA 4JYCA 1GL2C 5AW9B 3EFGA 1G2CB 3RK2C 1FAVA 2IX7C 2YO3A 1G1IA 5AW2B 3HE5A 3VMXA 3A3YB 5AW1B 3MIWA 1JY3P 3II6A 1GU5A 5CJ4A 2KLVA 1N7SB 1N73B 4HH2A 3P32A 3L4FA 3NMDA 4N6JA 4GKGA 1YYCA 2KSJA 3I5CA 1IJDB 1AFOA 1JY2O 2Z5IA 3E1IA 1NOHA 3IR9A 3NXSA 2NPSD 1WT6A 3B5NA 3TK1A 4C46A 1NKNA 1N73C 4RESB 1RF1C 1DH3A 1J1EB 1URQA 1N2DC 1L4AB 3HTKA 3A5TA 2GM4A 4I1LA 3KQGA 1HGVA 3KYQA 1IC2A 3WMM0 1FJPA 1HUCA 1LTJA 1KILD 1LTTC 2C0WA 1LGHB 1Z56A 2WSFH 3M9QA 4WBAA 3VP8A 2XU6A 2YNYA 2FYZA 2W6BA 2YKOA 3TYYA 4LC1A 3L35A 4HYTB 1OWAA 2HODB 3H6PA 1M1JB 1HJBA 2P2UA 5CCGC 1FZBA 2OYHA 1JY2P 5KJ7C 2P7JA 1LTSC 1ZN5A 1DEBA 3M91A 4IFFA 2YO2A 1LTBC 4GT1A 5CCHA 1S9KD 1J1EC 2R3CA 3M0DA 2I1KA 3B5ND 1IFNA 4AYCA 3HD7A 3RL0D 2XV5A 1GZLA 1FU1A 2YMYA 1T2KC 1RF1A 3HE4B 4M3LA 2FFDB 4KHXA 1FZAA 1WRGA 3V2NA 2OYIA 1SQXK 4OH8B 2QM8A 1JY3N 4ZKPA 2NPSB 1CSBA 3LIDA 1QL1A 4XA4A 5AVUB 3CI9A 2O1JA 2C0XA 1IFJA 3U59A 3HE5B 5AW6B 1GTWA 3HUSA 3MD0A 4I6MC 1IFMA 1MV8A 1NTMK 1X79B 1JO5A 1LWUB 3GHGA 2L5GB 1VDFA 1SQQK 2YKQA 1KILB 2OARA 1IO4A 2KB7P 2FFDC 1GD2E 3P8CE 2H7HA 3HD7D 4XE5B 2M3BA 1CI6A 2W6AA 3CL3D 2NPSC 3VN0A 1AQ5A 4Y99B 3B8EB 2HLOA 1FJKA 3TSIA 2WSEH 3MTUE 1YTZT 2YKPA 1G1JA 2N1TC 3B5NB 2HPCA 3RL0B 1LWUC 2P67A 4GIFA 5BU8B 4LGDE 3BASA 1KILC 2Q3IA 2JEEA 2XZRA 1KFMA 1SFCC 3HTKB 1NHLA 1VPCA 2WZ7A 4IFDK 2ZFCA 2VRSA 1JY2N 2JJLA 1RF0A 2Q7CA 1CZQA 4EIJA 2WT7A 1MZ9A 3PP5A 1HH0A 1OXZA 3OA7A 1DX7A 1JTHA 2HYNA 3C9IA 1RE3C 3RL0C 5APSA 3TNUA 4WY4A 2H43A 1RY3A 3MUDA 1GW4A 1S9KE 1FZCB 2N9BA 5BVZA 1CW5A 1IK9A 5AW4B 3HD7B 4I2LC 1GL2A 4W80A 2Z5HA 1HGZA 1N7SC 2WPRA 3CLQA 5APYA 3UIAA 4N3YB 1ZR2A 1GDTA 2O01H 1NTKK 2OYIB 5AW3B 3VP9A 3MGNA 3VTPC 2WITA 1KFNA 3P7KA 3O8ZA 1FZCC 2WPSA 5AVYB 3V2PA 2O1KA 3HUSB 1FZGA 4JF7A 5AW0B 1G2CA 4N78E 2XDJA 1XTCC 1PFIA 4AUWA 4C7RA 1MFZA 2WPQA 2R32A 1GK4A 1L4AC 1LTGC 3VMZA 5AVQB 1N73A 1NU1K 4W7ZA 3BRTB 2E42A 2GUSA 2ZXEB 1SQVK 1LT9B 1NTZK 1URQD 1T3JA 5AW5B 1M1JC 3SWYA 1JOCA 5AVWB 1XTGB 2LKMA 1JCCA 5AW7B 4DZOA 2C9NY 2R5DA 2BASA 2A45G 3SWFA 2R5BA 4DOJA 4IFMA 2W27A 1FOSE 5CCGA 1JCDA 1IFDA 2QM7A 3V2QA 1SVFA 5KJ7A 2FKWB 4C7NA 2IFNA 1FZEA 2Z4EA 1LT9C 1RE4C 1SQBK 5CCHD 1JTHB 2IFMA 1YTZI 1FOSF 3V4QA 1J2JB 2M8RA 2E43A 3G3ZA 1L0NK 1L0LK 2A45H 1MUUA 2H8PD 1GL2B 2PP6A 2KP8A 4O9BA 3OAKA 1HTLC 3R2PA 2KYVA 1GK6A 2PAJA 1URQB 1A02J 5CCGD 5CHXA 5APXA 3A7OA 3N4XA 2FFDA 4Y99C 1LTJB 1IFIA 4JYBA 3H32A 3M0AA 5AVVB 2XNXA 1J1DB 2GUVA 1LTIC 2NPSA 3A2AA 1FZFA 3B5NC 2CPBA 2OYHB 1ZLLA 1QL2A 2FYUK 4LLHA 5APQA 4AQRD 1GU4A 2N1TA 1URQC 2WSCH 1N7LA 2WWWA 1LWUA 1JUNA 5CJ0A 1RF1B 1KILA 2J58A 1LTJC 3M06A 1SFCA 3NFQA 1J1DC 3P8CD 1NAFA 2IPPA 1SLQA 5AVRB 1FBMA 3BATA 5AVXB 2OYHC 2Q9IA 1HVVA 2MJZA 3LW5H 5CCHC 1RE3A 3M0DC 1JNMA 2P1JA 3HD7C 3T97A 4WY4D 1KZUB 1H8AA 3GHGB 3KPEA 2A45I 4EOTA 5APTA 4C7NB 3RK3D 1NO4A 2N1TD 5AVZB 5APUA 1X8YA 3U1AA 3V4WA 2HFED 1E5WA 5CMZA 2OYIC 1GL2D 1T8ZA 1CI6B 5APVA 5AVTB 3RK2D 1N7SA 1NKZB 3HRNA 5AW8B 1SQPK 1FDMA 3OJAB 1NH4A 1SFCD 3L36A 2CPSA 3HUSC 3EQ2A 3N7NA 2HPCB 1JMMA 1FZCA 3GHGC 3V2RA 5AVSB 2Q5UA 3VOPA 3V5BA 1NWQA 3VMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFJ A;  1NH4 A;  1IFD A;  1HGV A;  2MJZ A;  1HH0 A;  2CPB A;  1HGZ A;  2CPS A;  2C0W A;  1FDM A;  1IFI A;  2C0X A; 
#chains in the Genus database with same CATH topology
 1NTK G;  1ZR4 A;  5KTB A;  1EDK A;  3M9H A;  2WT7 B;  1L4A A;  1NGM B;  2RKL A;  3AE9 C;  1P84 I;  4B86 A;  2C9L Y;  4IOI H;  3H1H E;  1JY3 O;  2KZJ A;  1W2E A;  4L74 A;  2KZI A;  3JCU H;  3CCV P;  2J59 M;  4W7Y A;  3M9B A;  4H44 C;  1GW3 A;  1A02 F;  1RF0 C;  4ZKU A;  1FC2 C;  1BGY G;  1KB9 I;  1YQ3 C;  2K9J B;  1S5L H;  1HBW A;  2LR2 A;  1AVO A;  2FXM A;  1KQG B;  1LT9 A;  2YIU C;  1M7L A;  3RK3 C;  3CCU P;  1SQV E;  3U1C A;  3H1K J;  2YMK A;  1YJN P;  3EFG A;  3RK2 C;  5KKZ C;  3TGU G;  3RBX A;  2MKV A;  5AW1 B;  3II6 A;  1ZRT E;  1N73 B;  4HH2 A;  3L4F A;  4GKG A;  3H1K D;  1OMI A;  1VL2 A;  2KSJ A;  3I5C A;  4H13 B;  4BWN A;  1AQT A;  2BCC G;  2Z5I A;  1NAY A;  5KLI C;  1RF1 C;  1N2D C;  1OVU A;  2O3J A;  1ZXG A;  3KYQ A;  2IZ0 A;  4PD4 H;  1Z56 A;  1QVF O;  1DD4 A;  1KMI Z;  2W6B A;  3IAO A;  2QJP B;  2JKV A;  1M1J B;  1JY2 P;  3M91 A;  1ZN5 A;  1S9K D;  3G9R A;  3M0D A;  1IFN A;  3HD7 A;  2XV5 A;  4GOD A;  1RF1 A;  1KC8 Q;  2FFD B;  3CMA P;  4D6T G;  2XND H;  3CCS P;  2K1A A;  1SQQ D;  1QL1 A;  2RN0 A;  4XA4 A;  2O1J A;  3U59 A;  3HUS A;  1MV8 A;  3R4Y A;  3CWB D;  3GHG A;  4PJ0 H;  2YKQ A;  1KIL B;  2OAR A;  2QJY B;  4PD4 D;  1GD2 E;  3P8C E;  2OGU A;  2W6A A;  4Y99 B;  3PLN A;  1Q90 D;  2PGD A;  1OVR A;  3QH9 A;  2M0B A;  1YTZ T;  2YKP A;  2HPC A;  2P67 A;  4EYY Q;  3BAS A;  3I56 P;  2XZR A;  1VPC A;  2K9Y A;  2H89 C;  2QVA A;  4IFD K;  4Y28 J;  1JY2 N;  2Q7C A;  1OZH A;  4EIJ A;  3PJS K;  2WT7 A;  5KLV E;  3PP5 A;  1HH0 A;  1OXZ A;  5APS A;  3MUD A;  2FY8 A;  5BVZ A;  1CW5 A;  1PPJ D;  1SQQ G;  5AW4 B;  3E1R A;  1KYO E;  3SSU A;  4YPC A;  4W80 A;  2Z5H A;  1HGZ A;  3UIA A;  3CWB G;  1ZR2 A;  2WQY C;  3L74 J;  1BCC E;  3MGN A;  1YI2 P;  4JF7 A;  1R8E A;  4N78 E;  4C7R A;  1MFZ A;  3L74 D;  2R32 A;  1GK4 A;  5DJT B;  4PV1 D;  3VMZ A;  5AVQ B;  1AVY A;  1N73 A;  1NU1 K;  2GUS A;  1BE3 E;  1NTZ K;  3AE3 C;  1LJ2 A;  2QJP C;  1VF5 B;  1M1J C;  3SWY A;  1PL5 A;  2JWA A;  2W6J H;  1YHQ P;  3SFE C;  5B66 H;  3W68 A;  1USD A;  1FOS E;  4EDF A;  1IFD A;  2QM7 A;  3V2Q A;  4YXW H;  2NRG A;  2FKW B;  3CX5 I;  4XFJ A;  2K37 A;  1SQB K;  2IFM A;  1ZOY C;  2IZ1 A;  1R5S A;  2M8R A;  2E43 A;  1M1K Q;  4WVZ A;  2KSE A;  3ITK A;  1GL2 B;  1YQ4 C;  2KP8 A;  4JPZ B;  4O9B A;  2IBZ E;  3H1I J;  1HTL C;  3R2P A;  1GK6 A;  1URQ B;  2IYP A;  3CXH E;  3H25 A;  2AXT H;  1LP1 B;  3Q2Y A;  2FFD A;  4Y99 C;  2AEF A;  5E79 E;  4JYB A;  1W5C E;  4IL6 E;  3FWL A;  2QIW A;  3H1I D;  4BXL A;  1ZLL A;  3O6Q B;  1QL2 A;  1UIX A;  3BCC G;  4IL6 H;  4AQR D;  1GU4 A;  2N1T A;  2M5A A;  1IK7 A;  2WWW A;  2SPZ A;  1NTM E;  1KIL A;  5B5E E;  1SFC A;  3NFQ A;  3D6Z A;  1J1D C;  5AVR B;  2WVR A;  2ZJS E;  5AVX B;  3AE5 C;  1H0T A;  4K35 A;  1PGP A;  1EZV E;  1JNM A;  2P1J A;  3L70 E;  4WY4 D;  1KZU B;  4EI2 A;  2A45 I;  3E7K A;  3MZW B;  1E5W A;  5CMZ A;  1GL2 D;  1T8Z A;  1S72 P;  1NKZ B;  3L71 D;  2A06 D;  2K88 A;  3GF7 A;  2FYU G;  3L36 A;  2JDI H;  2CPS A;  3EQ2 A;  2B88 A;  3V2R A;  5AVS B;  2Q5U A;  2O01 N;  3C8V A;  3WU2 E;  5CBN A;  1QLE D;  4H44 B;  3AE2 C;  2R44 A;  3WU2 H;  5GTH E;  1SP4 A;  1N7S D;  1NTK E;  5H2F E;  2HG5 D;  3CCQ P;  3H1J J;  3RK3 B;  1VQ8 P;  5GTH H;  2HOD A;  3RK2 B;  5KKZ B;  2ITA A;  2JWD A;  1NU1 G;  2Y9Z A;  1IZN B;  2QE7 H;  1NTZ G;  5APW A;  1ZV8 A;  3FWN A;  4YXD C;  5KJ7 D;  3H1J D;  4WY4 C;  1BGY E;  2IDB A;  3BRV B;  3L37 A;  1L4A D;  3W67 A;  3L71 G;  4PD4 I;  1X9V A;  3T97 B;  1GL2 C;  1G2C B;  1FAV A;  3L73 J;  1G1I A;  5AW2 B;  1M8O B;  1IFP A;  3HE5 A;  3GMA A;  3MIW A;  1EDI A;  2YXR B;  2KIK A;  4ASV A;  2QSI A;  3CX5 E;  3TGU E;  4N6J A;  1PP9 G;  1YYC A;  2KNC A;  1S3J A;  1IJD B;  1AFO A;  3L73 D;  2M3E A;  3TF5 A;  1JY2 O;  1PZQ A;  1PGJ A;  1Q7Y Q;  3E1I A;  3PTZ A;  1L0N E;  2NPS D;  3B5N A;  3TK1 A;  1NKN A;  2BCC E;  2WSC J;  1YJW P;  1URQ A;  2E74 D;  2HR3 A;  3AE7 C;  3WMM 0;  1HGV A;  1LP1 A;  1LTT C;  2WSF H;  3M9Q A;  3VP8 A;  2XU6 A;  3FXE A;  4LC1 A;  3L35 A;  4U3F G;  1OWA A;  3EWK A;  5CCG C;  5C39 A;  5KJ7 C;  1DEB A;  2JP3 A;  1LTB C;  4GT1 A;  4I7Z B;  5CCH A;  2I1K A;  1GZL A;  2WMM A;  2YMY A;  3HE4 B;  1L0N J;  1L0L J;  2N9Y B;  4KHX A;  1VQO P;  1WRG A;  4JQ0 D;  3V2N A;  2WSF J;  2OYI A;  1CSB A;  3LID A;  3L75 D;  3H1L G;  2C0X A;  1GTW A;  4I6M C;  4D6T E;  1IFM A;  3C1L A;  3CCJ P;  2ZYG A;  2L5G B;  1VDF A;  1HJ0 A;  1SQQ K;  1M90 Q;  2H7H A;  3HD7 D;  2M3B A;  4KJM A;  3ABV C;  1OW7 A;  2NPS C;  4ZMD A;  3VN0 A;  2V4H A;  2HLO A;  1SQP E;  1ZW0 A;  3MTU E;  2E74 C;  1G1J A;  1OW6 A;  1VQL P;  4GIF A;  5BU8 B;  1QX8 A;  4LGD E;  2Q3I A;  3GF3 A;  3HTK B;  2ZYD A;  1SQX G;  1X0T A;  1KQS O;  1AJY A;  2VRS A;  2JJL A;  1RF0 A;  3PHL A;  1FDI A;  3H1H J;  1CZQ A;  1KQF B;  1VQ6 P;  4QMA A;  3WUV A;  2Q3E A;  2H43 A;  1RY3 A;  1S9K E;  2RH0 A;  1IK9 A;  3L75 G;  4I2L C;  2V7Q H;  3H1H D;  2E75 D;  1SQP J;  1SQV J;  2BEZ F;  1S5L X;  3VTP C;  4L76 A;  3P7K A;  1UII A;  5AVY B;  3V2P A;  1QEX A;  1FZG A;  1SQV D;  4GOF A;  1G2C A;  3KXD A;  1KTM A;  2WPQ A;  1LTG C;  1ZME C;  1ZRT D;  2B87 B;  4Z1M H;  2IYO A;  1XTG B;  1JCC A;  3H1K G;  2A45 G;  2OTJ P;  4I7Z C;  1VQM P;  1Q81 Q;  2AEJ A;  4H0L D;  4C7N A;  1RE4 C;  1JTH B;  5KAI E;  1YTZ I;  1FOS F;  2K3R A;  2E75 C;  1K73 Q;  3CC4 P;  1MUU A;  3MHV A;  2OTK E;  4DT0 A;  1OX3 A;  3FXD A;  1EDL A;  4HJG H;  4PV1 B;  2PP6 A;  2QG4 A;  1SQV G;  1A02 J;  2OYO A;  5CHX A;  5APX A;  1KIL E;  3N4X A;  2P10 A;  4TT3 H;  1J1D B;  2Y0E A;  2L91 A;  2FYU K;  1OFC X;  1P84 E;  1JUN A;  1AA0 A;  1LTJ C;  3M06 A;  3BCC E;  1P84 H;  2K9J A;  1KB9 E;  3P8C D;  1KYO H;  2AXC A;  1NAF A;  2IPP A;  1SLQ A;  2OYH C;  2WPV B;  3I55 P;  1KB9 H;  5KLV J;  1H8A A;  2KXP B;  4NPF X;  1NO4 A;  5M1B A;  1MKM A;  2N1T D;  5APU A;  3V4W A;  1OW8 A;  1YIT P;  1CI6 B;  3HRN A;  5GTI E;  3G71 P;  1NH4 A;  1SFC D;  5KLV D;  2ZVN B;  3L72 E;  5GTI H;  1JMM A;  2FXO A;  4DCK A;  1BCC J;  2FYN C;  2FYU E;  3VMY A;  5EFW B;  1KYO D;  1HWT C;  4RKU J;  3CME P;  1PPJ G;  2POH A;  1LTA C;  4UB8 E;  3H32 B;  1JEK A;  1S1C X;  2H88 C;  3BVH A;  1KQL A;  1Y9B A;  3G6E P;  3FGA D;  1DEE G;  4WY4 B;  1BCC D;  3AED C;  1H88 A;  1EQ7 A;  3LIE A;  1YJ9 P;  1M1J A;  1BE3 J;  1N86 A;  4NPE A;  2Y0D A;  4N78 D;  3GW6 A;  4WWI A;  3L72 J;  3OW2 O;  1H89 A;  3Q5S A;  1T3U A;  2PFX A;  3F89 A;  3L74 G;  3PRJ A;  4OWF A;  1NU1 E;  4WB4 A;  1BE3 D;  1T2K D;  2KOG A;  1EXJ A;  1NTZ E;  3CXH H;  3Q1M A;  4PV1 C;  5E79 H;  1Q2N A;  3VMX A;  3A3Y B;  1GU5 A;  1N7S B;  1RQU A;  1VQK P;  3P32 A;  3NMD A;  1OIP A;  1DD3 A;  2ZT9 D;  3V6I A;  1SQB E;  3D6Y A;  3A0H E;  5B5E H;  4A7P A;  1NOH A;  3IR9 A;  1PP9 E;  2KS1 B;  3NXS A;  1YIJ P;  2D2C D;  1YBK A;  1VQP P;  4C46 A;  3A0H H;  3S9O A;  4RES B;  5TJH A;  1DH3 A;  2IBZ D;  1L4A B;  4I1L A;  3KQG A;  1IC2 A;  4UB6 E;  1N8R Q;  1HUC A;  2C0W A;  3CXH D;  1LGH B;  3IF4 A;  4WBA A;  2YNY A;  1VQN P;  1NTM J;  2UWJ E;  3TYY A;  4BRY B;  4HYT B;  3TDK A;  1OVV A;  1LTS C;  1SQB J;  1J1E C;  3B5N D;  4R4M A;  3H1I G;  3RL0 D;  4U3F E;  1FU1 A;  1T2K C;  2CK3 H;  3PH0 A;  4M3L A;  1NTM D;  3L70 J;  1SQX K;  2QM8 A;  4ZKP A;  2NPS B;  1RHZ B;  1EDJ A;  5AVU B;  1IFJ A;  1EXI A;  5AW6 B;  2B9B A;  1X79 B;  2E74 B;  1QGK B;  1JO5 A;  1EZV D;  3CC2 P;  5DJU B;  5H2F H;  1IO4 A;  3L70 D;  2KB7 P;  3H1L E;  3KZI E;  4XE5 B;  1CI6 A;  3Q5R A;  1AQ5 A;  3B8E B;  3TSI A;  2WSE H;  2A06 G;  1LWU C;  3RK3 E;  2KK7 A;  3MP7 B;  3SWK A;  2OTL P;  1NTK J;  2WZ7 A;  2ZFC A;  1K8A Q;  3OA7 A;  1DX7 A;  1VQ4 P;  1RE3 C;  3RL0 C;  1SQX E;  4WY4 A;  1GW4 A;  2N9B A;  1NTK D;  2WSE J;  3CX5 H;  1KV4 A;  1PV3 A;  3HD7 B;  1GL2 A;  1BGY J;  1N7S C;  1BDD A;  2O01 H;  3L75 E;  4L73 A;  1BSH A;  2WIT A;  3O8Z A;  1FZC C;  3AE8 C;  1USE A;  2O1K A;  3HUS B;  3QWO C;  1BGY D;  3H1J G;  3TGU J;  2XDJ A;  1XTC C;  1PFI A;  3O6Q A;  1PGO A;  4AUW A;  1L4A C;  1FS0 E;  3F5H A;  1VQ9 P;  2O01 J;  2E42 A;  2ZXE B;  1SQV K;  2LXC B;  4ASW A;  3CX5 D;  4OGQ D;  3TGU D;  5AW5 B;  2BCC J;  5AVW B;  2E75 B;  2LKM A;  1LNQ A;  5AW7 B;  1LT1 A;  2C9N Y;  2R5D A;  2BEQ D;  3SWF A;  2KS1 A;  3L73 G;  4IFM A;  2W27 A;  5CCG A;  4HB1 A;  1L0N D;  1L0L D;  2Y0C A;  3SFD C;  5KJ7 A;  3H1K E;  1FZE A;  1LT9 C;  1W2B O;  2BCC D;  3EFF K;  3JCU E;  3V4Q A;  1J2J B;  3G3Z A;  3CCR P;  1KYO I;  3Q3D A;  3AE4 C;  2A45 H;  1ZP0 C;  1WMK A;  4BRY A;  1S5L E;  2WSS H;  2KUB A;  3D71 A;  1KN7 A;  3OAK A;  1Q82 Q;  2KYV A;  3CC7 P;  4D6T J;  1FDO A;  1LTJ B;  4DJG A;  3K5B A;  3WUU A;  1MFT A;  2XNX A;  2GUV A;  1LTI C;  2NPS A;  3AE1 C;  3A2A A;  3IN6 A;  1FZF A;  2QRX A;  1K9M Q;  2OYH B;  4H0L B;  3FX0 A;  2QJK B;  4LLH A;  5APQ A;  2NZ2 A;  4OGQ C;  4D6T D;  2ZXX A;  1U7J A;  1L0N G;  1L0L G;  2E76 D;  1M56 D;  1SQQ E;  1VQ5 P;  3USS A;  1Q86 Q;  1FBM A;  2KLU A;  2MJZ A;  3G4S P;  3CWB E;  1X22 A;  3M0D C;  1SQP D;  3WUT A;  3HD7 C;  3T97 A;  4PD4 E;  2ZAE B;  2E5Y A;  2JO1 A;  2V7Q J;  1HF9 A;  2FYN B;  5AVZ B;  3U1A A;  3A0B E;  3JC2 2;  5AVT B;  5AW8 B;  4ZNC A;  1FDM A;  3OJA B;  3A0B H;  3HUS C;  1JM0 A;  2IBZ I;  1KD1 Q;  1SQQ J;  3GHG C;  3VOP A;  3CXH I;  3RL0 g;  5KLV K;  3CWB J;  5BU5 A;  3H1H G;  2Q6Q A;  4PJ0 E;  3TNU B;  1PPJ E;  2XKM A;  1GMJ A;  2I1J A;  3KDP B;  2WTY A;  3B71 A;  4CPG A;  2E76 C;  3VYI A;  2N1T B;  2M5A B;  5KAI H;  4H13 D;  2P58 A;  5L8R J;  1SQP G;  3VMA A;  1SFC B;  2OQQ A;  4KT0 J;  3P8M C;  3AE6 C;  3HE4 A;  3NTN A;  3MUD C;  1M57 D;  3IFM A;  1H0T B;  1RE4 A;  1EZV I;  2AEM A;  4JYC A;  5AW9 B;  1NJI Q;  2IX7 C;  2ZVO B;  2YO3 A;  3L74 E;  3CCL P;  2DW3 A;  3S1K A;  1JY3 P;  4RJT A;  5CJ4 A;  2KLV A;  3GLM A;  3CCE P;  3Q5P A;  1NVO A;  4H0L C;  2QJK C;  2GA1 A;  1TU3 F;  1WT6 A;  4NPD A;  1N73 C;  2QEX P;  1J1E B;  3S4R A;  3HTK A;  2Y9Y A;  3A5T A;  2GM4 A;  4H13 C;  1FJP A;  1LTJ A;  1KIL D;  2FYZ A;  2YKO A;  2HOD B;  3H6P A;  1HJB A;  2P2U A;  1FZB A;  1Y8A A;  2OYH A;  3BCC J;  2P7J A;  4IFF A;  2YO2 A;  4R4L A;  2R3C A;  2ZT9 B;  4AYC A;  5KAF E;  3CPW O;  1P84 D;  1KOR A;  2B89 A;  5B66 E;  1FZA A;  2RMZ A;  4OH8 B;  5KAF H;  1JY3 N;  3H1I E;  3BCC D;  2D2C B;  1KB9 D;  1RH5 B;  4K3A A;  3CI9 A;  2R3S A;  3HE5 B;  4UB8 H;  3MD0 A;  4U7J A;  1NTM K;  2QA4 P;  1LWU B;  2JR8 A;  2E5T A;  2FFD C;  2KNC B;  3CL3 D;  2J5U A;  1R5L A;  2FYU J;  2B87 A;  4L75 A;  1FJK A;  3B5N B;  2N1T C;  3RL0 B;  5CBO A;  2AXT E;  3L72 D;  1KIL C;  5KLV G;  2QJY C;  2JEE A;  1U7M A;  1KFM A;  1SFC C;  1QVG O;  1NHL A;  3L71 E;  2FYU D;  2A06 E;  1MZ9 A;  1JTH A;  2HYN A;  1S4X A;  2W90 A;  3C9I A;  3TNU A;  1PGQ A;  1FZC B;  1S2E A;  4YTP C;  1BCC G;  1VF5 D;  4GOE A;  1NU1 J;  2WPR A;  3CLQ A;  3AEC C;  5APY A;  3AEE C;  1NTZ J;  4N3Y B;  1GDT A;  4TLF A;  1NTK K;  2OYI B;  5AW3 B;  3VP9 A;  1KFN A;  2W8Z A;  2WPS A;  3L71 J;  1D7M A;  1E79 H;  5K5G B;  2ZYA A;  2W83 C;  2G8Y A;  1NU1 D;  5AW0 B;  1NTZ D;  4UB6 H;  1BE3 G;  2I8D A;  5TIS E;  1K05 A;  3L72 G;  3H1J E;  4IL6 X;  4W7Z A;  3BRT B;  1PP9 J;  1SS1 A;  3CCM P;  4MN4 C;  1LT9 B;  1URQ D;  1T3J A;  5TIS H;  3D70 A;  1NYH A;  1AV1 A;  1JOC A;  1SQB D;  4DZO A;  2BAS A;  3JSV C;  2R5B A;  3B4S A;  4DOJ A;  2ZT9 C;  1JCD A;  1PP9 D;  1SVF A;  3KHU A;  3AEA C;  2IFN A;  2Z4E A;  5CCH D;  3L73 E;  2D2C C;  1JMB A;  1VF5 C;  1L0N K;  1EC5 A;  1L0L K;  2IBZ G;  2YIU B;  4U3F J;  3KZI H;  1L2P A;  2G3A A;  2H8P D;  2KI7 B;  2Q1K A;  3RGU A;  4HKZ H;  2PAJ A;  3GG2 A;  5CCG D;  4OGQ B;  3A7O A;  2PRR A;  1T6A A;  4U3F D;  1IFI A;  1VQ7 P;  3H32 A;  3M0A A;  5AVV B;  4JBZ A;  3CD6 P;  3B5N C;  1NTM G;  3H1L J;  2CPB A;  3AEG C;  1U57 A;  2FXP A;  1Y47 A;  1K04 A;  1SQB G;  1URQ C;  2WSC H;  1N7L A;  1LWU A;  5KLI B;  5CJ0 A;  2LXB A;  1RF1 B;  1FE6 A;  2J58 A;  3ZDM A;  1EZV G;  3H1L D;  4H44 D;  3L70 G;  4GDO A;  3BAT A;  2Q9I A;  1BSN A;  1HVV A;  3AEB C;  3LW5 H;  1L0L E;  5CCH C;  1DIP A;  1RE3 A;  1PIX A;  3RBZ A;  1JB0 J;  3GHG B;  3KPE A;  4EOT A;  5APT A;  4C7N B;  1BDC A;  3RK3 D;  3AEF C;  1SQX J;  1X8Y A;  2HFE D;  2OYI C;  5APV A;  3RK2 D;  1N7S A;  1SQP K;  2FBW C;  3N7N A;  2HPC B;  4OVN F;  3LW5 J;  1FZC A;  1RQV A;  1SQX D;  3L75 J;  4RO0 A;  3V5B A;  1NWQ A;  2E76 B;  2YXQ B; 
#chains in the Genus database with same CATH homology
 1ZR4 A;  1HWT C;  5KLV K;  2POH A;  5KTB A;  1LTA C;  5BU5 A;  3H32 B;  3M9H A;  2WT7 B;  1L4A A;  3BVH A;  1KQL A;  1SP4 A;  1N7S D;  3TNU B;  2XKM A;  4WY4 B;  2I1J A;  3KDP B;  2WTY A;  2HG5 D;  4B86 A;  2C9L Y;  3RK3 B;  1H88 A;  1EQ7 A;  3VYI A;  3LIE A;  2N1T B;  1JY3 O;  2HOD A;  1W2E A;  1M1J A;  2J59 M;  4W7Y A;  1N86 A;  3M9B A;  1GW3 A;  3RK2 B;  1A02 F;  1RF0 C;  4ZKU A;  4N78 D;  1SFC B;  1HBW A;  5APW A;  3P8M C;  1H89 A;  1ZV8 A;  3HE4 A;  1T3U A;  3NTN A;  5KJ7 D;  4WY4 C;  2FXM A;  3IFM A;  1LT9 A;  1RE4 A;  1M7L A;  3BRV B;  3L37 A;  4WB4 A;  3RK3 C;  1L4A D;  3U1C A;  1T2K D;  2KOG A;  1X9V A;  4JYC A;  1GL2 C;  5AW9 B;  3EFG A;  1G2C B;  3RK2 C;  1FAV A;  2IX7 C;  2YO3 A;  1G1I A;  5AW2 B;  3HE5 A;  3VMX A;  3A3Y B;  5AW1 B;  3MIW A;  1JY3 P;  3II6 A;  1GU5 A;  5CJ4 A;  2KLV A;  1N7S B;  1N73 B;  4HH2 A;  3P32 A;  3L4F A;  3NMD A;  4N6J A;  4GKG A;  1YYC A;  2KSJ A;  3I5C A;  1IJD B;  1AFO A;  1JY2 O;  2Z5I A;  3E1I A;  1NOH A;  3IR9 A;  3NXS A;  2NPS D;  1WT6 A;  3B5N A;  3TK1 A;  4C46 A;  1NKN A;  1N73 C;  4RES B;  1RF1 C;  1DH3 A;  1J1E B;  1URQ A;  1N2D C;  1L4A B;  3HTK A;  3A5T A;  2GM4 A;  4I1L A;  3KQG A;  1HGV A;  3KYQ A;  1IC2 A;  3WMM 0;  1FJP A;  1HUC A;  1LTJ A;  1KIL D;  1LTT C;  2C0W A;  1LGH B;  1Z56 A;  2WSF H;  3M9Q A;  4WBA A;  3VP8 A;  2XU6 A;  2YNY A;  2FYZ A;  2W6B A;  2YKO A;  3TYY A;  4LC1 A;  3L35 A;  4HYT B;  1OWA A;  2HOD B;  3H6P A;  1M1J B;  1HJB A;  2P2U A;  5CCG C;  1FZB A;  2OYH A;  1JY2 P;  5KJ7 C;  2P7J A;  1LTS C;  1ZN5 A;  1DEB A;  3M91 A;  4IFF A;  2YO2 A;  1LTB C;  4GT1 A;  5CCH A;  1S9K D;  1J1E C;  2R3C A;  3M0D A;  2I1K A;  3B5N D;  1IFN A;  4AYC A;  3HD7 A;  3RL0 D;  2XV5 A;  1GZL A;  1FU1 A;  2YMY A;  1T2K C;  1RF1 A;  3HE4 B;  4M3L A;  2FFD B;  4KHX A;  1FZA A;  1WRG A;  3V2N A;  2OYI A;  1SQX K;  4OH8 B;  2QM8 A;  1JY3 N;  4ZKP A;  2NPS B;  1CSB A;  3LID A;  1QL1 A;  4XA4 A;  5AVU B;  3CI9 A;  2O1J A;  2C0X A;  1IFJ A;  3U59 A;  3HE5 B;  5AW6 B;  1GTW A;  3HUS A;  3MD0 A;  4I6M C;  1IFM A;  1MV8 A;  1NTM K;  1X79 B;  1JO5 A;  1LWU B;  3GHG A;  2L5G B;  1VDF A;  1SQQ K;  2YKQ A;  1KIL B;  2OAR A;  1IO4 A;  2KB7 P;  2FFD C;  1GD2 E;  3P8C E;  2H7H A;  3HD7 D;  4XE5 B;  2M3B A;  1CI6 A;  2W6A A;  3CL3 D;  2NPS C;  3VN0 A;  1AQ5 A;  4Y99 B;  3B8E B;  2HLO A;  1FJK A;  3TSI A;  2WSE H;  3MTU E;  1YTZ T;  2YKP A;  1G1J A;  2N1T C;  3B5N B;  2HPC A;  3RL0 B;  1LWU C;  2P67 A;  4GIF A;  5BU8 B;  4LGD E;  3BAS A;  1KIL C;  2Q3I A;  2JEE A;  2XZR A;  1KFM A;  1SFC C;  3HTK B;  1NHL A;  1VPC A;  2WZ7 A;  4IFD K;  2ZFC A;  2VRS A;  1JY2 N;  2JJL A;  1RF0 A;  2Q7C A;  1CZQ A;  4EIJ A;  2WT7 A;  1MZ9 A;  3PP5 A;  1HH0 A;  1OXZ A;  3OA7 A;  1DX7 A;  1JTH A;  2HYN A;  3C9I A;  1RE3 C;  3RL0 C;  5APS A;  3TNU A;  4WY4 A;  2H43 A;  1RY3 A;  3MUD A;  1GW4 A;  1S9K E;  1FZC B;  2N9B A;  5BVZ A;  1CW5 A;  1IK9 A;  5AW4 B;  3HD7 B;  4I2L C;  1GL2 A;  4W80 A;  2Z5H A;  1HGZ A;  1N7S C;  2WPR A;  3CLQ A;  5APY A;  3UIA A;  4N3Y B;  1ZR2 A;  1GDT A;  2O01 H;  1NTK K;  2OYI B;  5AW3 B;  3VP9 A;  3MGN A;  3VTP C;  2WIT A;  1KFN A;  3P7K A;  3O8Z A;  1FZC C;  2WPS A;  5AVY B;  3V2P A;  2O1K A;  3HUS B;  1FZG A;  4JF7 A;  5AW0 B;  1G2C A;  4N78 E;  2XDJ A;  1XTC C;  1PFI A;  4AUW A;  4C7R A;  1MFZ A;  2WPQ A;  2R32 A;  1GK4 A;  1L4A C;  1LTG C;  3VMZ A;  5AVQ B;  1N73 A;  1NU1 K;  4W7Z A;  3BRT B;  2E42 A;  2GUS A;  2ZXE B;  1SQV K;  1LT9 B;  1NTZ K;  1URQ D;  1T3J A;  5AW5 B;  1M1J C;  3SWY A;  1JOC A;  5AVW B;  1XTG B;  2LKM A;  1JCC A;  5AW7 B;  4DZO A;  2C9N Y;  2R5D A;  2BAS A;  2A45 G;  3SWF A;  2R5B A;  4DOJ A;  4IFM A;  2W27 A;  1FOS E;  5CCG A;  1JCD A;  1IFD A;  2QM7 A;  3V2Q A;  1SVF A;  5KJ7 A;  2FKW B;  4C7N A;  2IFN A;  1FZE A;  2Z4E A;  1LT9 C;  1RE4 C;  1SQB K;  5CCH D;  1JTH B;  2IFM A;  1YTZ I;  1FOS F;  3V4Q A;  1J2J B;  2M8R A;  2E43 A;  3G3Z A;  1L0N K;  1L0L K;  2A45 H;  1MUU A;  2H8P D;  1GL2 B;  2PP6 A;  2KP8 A;  4O9B A;  3OAK A;  1HTL C;  3R2P A;  2KYV A;  1GK6 A;  2PAJ A;  1URQ B;  1A02 J;  5CCG D;  5CHX A;  5APX A;  3A7O A;  3N4X A;  2FFD A;  4Y99 C;  1LTJ B;  1IFI A;  4JYB A;  3H32 A;  3M0A A;  5AVV B;  2XNX A;  1J1D B;  2GUV A;  1LTI C;  2NPS A;  3A2A A;  1FZF A;  3B5N C;  2CPB A;  2OYH B;  1ZLL A;  1QL2 A;  2FYU K;  4LLH A;  5APQ A;  4AQR D;  1GU4 A;  2N1T A;  1URQ C;  2WSC H;  1N7L A;  2WWW A;  1LWU A;  1JUN A;  5CJ0 A;  1RF1 B;  1KIL A;  2J58 A;  1LTJ C;  3M06 A;  1SFC A;  3NFQ A;  1J1D C;  3P8C D;  1NAF A;  2IPP A;  1SLQ A;  5AVR B;  1FBM A;  3BAT A;  5AVX B;  2OYH C;  2Q9I A;  1HVV A;  2MJZ A;  3LW5 H;  5CCH C;  1RE3 A;  3M0D C;  1JNM A;  2P1J A;  3HD7 C;  3T97 A;  4WY4 D;  1KZU B;  1H8A A;  3GHG B;  3KPE A;  2A45 I;  4EOT A;  5APT A;  4C7N B;  3RK3 D;  1NO4 A;  2N1T D;  5AVZ B;  5APU A;  1X8Y A;  3U1A A;  3V4W A;  2HFE D;  1E5W A;  5CMZ A;  2OYI C;  1GL2 D;  1T8Z A;  1CI6 B;  5APV A;  5AVT B;  3RK2 D;  1N7S A;  1NKZ B;  3HRN A;  5AW8 B;  1SQP K;  1FDM A;  3OJA B;  1NH4 A;  1SFC D;  3L36 A;  2CPS A;  3HUS C;  3EQ2 A;  3N7N A;  2HPC B;  1JMM A;  1FZC A;  3GHG C;  3V2R A;  5AVS B;  2Q5U A;  3VOP A;  3V5B A;  1NWQ A;  3VMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...