1NH4A

Structure of the coat protein in fd filamentous bacteriophage particles
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
44
structure length
44
Chain Sequence
PAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Major coat protein
publication title Structure of the coat protein in fd filamentous bacteriophage particles determined by solid-state NMR spectroscopy
pubmed doi rcsb
molecule tags Virus
total genus 18
structure length 44
sequence length 44
ec nomenclature
pdb deposition date 2002-12-18

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1nh4A00
1HGVA 2C0XA 2C0WA 2CPSA 1IFIA 1IFDA 1HGZA 1HH0A 2MJZA 1IFJA 1FDMA 2CPBA 1NH4A
chains in the Genus database with same CATH superfamily
3B5NB 1AFOA 1FBMA 3WUTA 1Q81Q 1NKZB 2HYNA 5KAIH 3AE5C 2BCCG 3SWKA 3B5NA 3QH9A 4N6JA 1GW3A 4RESB 2K88A 4D6TE 2W6AA 4XA4A 1N7SB 2E42A 1TU3F 3E1RA 3OW2O 2JR8A 1N7SA 2YIUC 1Y47A 3LIDA 3A7OA 1Y9BA 5GTIH 3P8CE 4B86A 1EZVI 2O01N 2FXPA 3C1LA 1S2EA 4K35A 1PGPA 4RO0A 3L4FA 3EWKA 2FFDB 4AQRD 1JY2N 3WU2E 1S9KD 2O1KA 3W68A 1OX3A 4BWNA 5AVUB 5TISE 1KD1Q 3GF3A 2FFDA 1T2KC 4OVNF 4H0LD 1EDLA 2WZ7A 3Q5PA 3G9RA 2QRXA 3A0BH 3HD7B 2JDIH 2NRGA 4TT3H 2YXRB 3GW6A 1RQUA 2P1JA 1HF9A 4L73A 5KLVE 2IBZD 2XNDH 2FYUJ 3HD7A 1MFTA 4U7JA 3RK2C 4L75A 1RE3A 1X22A 3I56P 1ZRTE 1LTGC 2WSEH 1NTKK 3MHVA 3II6A 3S4RA 3G4SP 3GHGB 1PPJD 4BRYB 2C9LY 2A06E 1QGKB 3Q5RA 3BATA 4PD4E 2BASA 1AJYA 1FZBA 2A06G 3V2QA 1NTKE 2RKLA 3GHGA 2ZVNB 1FZAA 3U1AA 4BRYA 1JB0J 4IL6X 1W2BO 3KZIH 5KJ7C 1BDDA 1QLED 1FAVA 1HJBA 1LT9B 3L75D 5CBOA 1FS0E 5KTBA 1SQBK 1XTCC 2W90A 1M8OB 3AE8C 2VRSA 1VQ8P 1JM0A 5APTA 1K04A 1LT9A 2WPSA 3B5NC 3BCCG 4RKUJ 1YTZI 1SQBE 3MIWA 1SQPK 1FDMA 2CPBA 1X79B 2QJKB 1SQBG 2FKWB 1PV3A 1NU1J 1N7SC 2WSFH 3TF5A 3ITKA 2AXTE 2KUBA 1OW7A 1IK9A 1JMMA 1NTZD 1SQPG 2K9JB 1KN7A 2QE7H 1OVUA 1OVRA 3CCSP 3LW5J 4OGQB 1VQ5P 5AVZB 1BGYE 2D2CD 4PD4I 2V7QH 4JPZB 1VQ9P 1RF1B 3T97B 5AW2B 4ZNCA 3CWBJ 3L70G 2PP6A 2FFDC 3C9IA 3CCQP 4L74A 2GA1A 2KB7P 1RF1A 1BCCJ 3T97A 1VQLP 3M0DA 3CC2P 2Q5UA 1CW5A 1PFIA 2B9BA 2XZRA 1NTMJ 3H1KD 3V4WA 1MKMA 2KK7A 1NU1D 3M9BA 3HE5B 2XU6A 3HD7C 3TGUD 1SQQD 4N78E 1RE3C 1KQLA 2E74B 1RE4A 2ITAA 3FX0A 3HE5A 1SQVJ 5APYA 3R4YA 1SQXJ 2O1JA 1FOSF 2C0XA 5TISH 3H1JD 2FYNB 1P84E 1KYOD 3CWBD 3GHGC 1JY2O 3KPEA 3SFDC 4C46A 1EC5A 1NTZE 2JKVA 1K05A 1HVVA 3P7KA 1PGJA 3IN6A 2OGUA 1FZFA 1LT9C 1NTMD 2ZVOB 2OYOA 5CCGD 3VTPC 4WY4D 4WWIA 5B5EE 2FY8A 2B89A 1FZGA 3MZWB 1FZEA 2QJPB 3L74J 1WT6A 2R5DA 5AVVB 1OIPA 5EFWB 2K9YA 1SQVD 3H1IE 2QJKC 3Q2YA 1SQXD 3MP7B 4ASWA 1NH4A 1L0LD 2WQYC 1UIXA 1X8YA 2PRRA 1DX7A 4PV1D 3H1KE 4R4LA 3BVHA 1NO4A 1S1CX 1SFCD 1JUNA 3TGUE 3U59A 1KB9D 1P84I 4K3AA 1SQQE 3IR9A 1EQ7A 3VMZA 5BU5A 1WMKA 4OGQC 1CI6B 3KYQA 4Z1MH 2R5BA 3N4XA 1G1IA 2Y0CA 3H1HE 2IFNA 2OTJP 1GU5A 1VF5B 1CI6A 2QM8A 3M0DC 3PH0A 2R3CA 1PIXA 2G3AA 4XFJA 1M1JB 2H89C 3ZDMA 1KQFB 4U3FD 1FZCA 3EFGA 1T3JA 1YJWP 3L72E 3V6IA 1IK7A 1M1JA 1U57A 1J1DB 2E76D 1OVVA 3L72G 1H89A 1RE4C 1UIIA 2N1TD 1BE3G 1MZ9A 2BCCJ 3U1CA 2E74C 2QJYB 2KZIA 2UWJE 2L5GB 2IPPA 3OJAB 5CCHD 1L4AD 4Y28J 1N73C 1VL2A 1YQ3C 4EI2A 1VQ6P 3H1LG 1L0LE 1OZHA 2LKMA 2QG4A 1URQD 1NJIQ 4AUWA 5E79E 1PL5A 1M56D 2RMZA 2SPZA 1AVYA 1GDTA 1A02F 4WVZA 1ZLLA 1KYOI 2NPSD 1BSHA 2ZAEB 4TLFA 4GDOA 1P84H 5AVSB 1GD2E 1SLQA 1GTWA 2M8RA 1KZUB 1JCDA 4H0LB 2QJPC 3G71P 2GUVA 1FJKA 1RH5B 1ZN5A 2WSCH 4U3FE 3KZIE 2M3EA 3R2PA 1GZLA 3L71G 2WPVB 2Y0DA 1S5LE 1HGVA 2I1JA 5B5EH 2PFXA 3ABVC 1BSNA 3AE1C 1H88A 5AW9B 1K8AQ 3RL0D 3P32A 1EZVG 3A5TA 3L73D 3V4QA 1Z56A 1VF5C 1FZCC 2Z4EA 1JY2P 1M1JC 2IX7C 1MV8A 3SWYA 4I7ZB 4OWFA 2H43A 2HG5D 3MD0A 3Q3DA 4EDFA 2ZT9D 1J1DC 5AW4B 2KI7B 3BCCJ 4IFMA 2R32A 3LW5H 2E5TA 2PAJA 4RJTA 1SQBJ 2QJYC 1JMBA 4IOIH 1AV1A 1KYOH 1NGMB 4D6TG 3AEEC 1OWAA 1PP9D 1S4XA 1SQPJ 1L0NK 2YXQB 1R5LA 1Q7YQ 2YKQA 2YKOA 2D2CB 1IO4A 2CK3H 2QA4P 1L0NE 3CCUP 3AEAC 1M57D 2IYPA 2WPQA 1KTMA 3L70J 1GK6A 5APXA 1AQ5A 1GL2D 2WWWA 3I5CA 5AW1B 4H13D 1IZNB 3AEFC 5KLVK 4N3YB 3V2RA 2P67A 3HUSB 3V2PA 1VQ7P 4H0LC 4HH2A 1NHLA 2WTYA 1T8ZA 2J59M 3AECC 3MUDA 4H44D 5E79H 3HUSA 2K1AA 1Q90D 4MN4C 1KB9H 2R44A 3CCRP 3A2AA 5KLVG 1VQNP 1VDFA 4GOFA 3TSIA 3TYYA 1KFMA 4R4MA 2JO1A 5CJ0A 3FXEA 2QM7A 3TK1A 2G8YA 1W2EA 3HE4B 2XKMA 2KLVA 1GMJA 5TJHA 2QSIA 2E75D 3WMM0 3SFEC 1VQPP 2KLUA 3SWFA 3HE4A 1PP9E 3WUVA 1NTKG 1YITP 2I8DA 3RK3D 3PTZA 1S5LH 5AVXB 1E79H 4I7ZC 3D71A 3IFMA 1Q2NA 2WMMA 3AE2C 4WY4B 3LIEA 3SSUA 2MJZA 5APWA 1J1EC 2FYUD 1S9KE 1LGHB 5CCGA 4WY4A 2AXCA 2IZ0A 3CXHD 4AYCA 1HH0A 4HYTB 4M3LA 1W5CE 5CHXA 2Z5IA 3Q5SA 5AVWB 4PV1B 2KYVA 5APQA 1GW4A 1GU4A 1ZOYC 1SFCB 3NFQA 1KV4A 3FXDA 1X0TA 2IBZE 3OA7A 2M3BA 1GK4A 1SFCA 2ZYAA 1BGYG 3VP9A 2D2CC 2OYHB 2FYZA 3AE7C 1OMIA 1E5WA 3CI9A 1PPJE 3JCUE 3EFFK 4UB6E 3S1KA 2OYHA 2A45I 2H8PD 1PGQA 3MUDC 1DEEG 2OQQA 3QWOC 3HUSC 2E76B 4LC1A 3L72J 2NZ2A 1JNMA 3L75E 2JJLA 4DT0A 3TNUB 2N1TB 1BE3J 3K5BA 3L75G 4ASVA 3USSA 2ZYGA 1HJ0A 4O9BA 1N73B 4WBAA 2YNYA 2WVRA 1L4AB 3TNUA 2N1TA 3AEDC 2FYUE 1USDA 2P58A 4KT0J 4I6MC 1N73A 1NTZK 4YTPC 5CCHA 1L4AA 3H1LJ 2IBZI 3KXDA 1Q86Q 1Y8AA 1H0TB 1BCCD 1EXIA 2AEFA 3BASA 5L8RJ 1URQB 2WPRA 1KFNA 1NTZG 5APSA 2XV5A 1ZR4A 1H0TA 1URQA 1CZQA 2NPSB 5KLIB 5CCGC 4GOEA 4WY4C 2FXOA 2N9BA 4DZOA 1G1JA 4C7RA 2NPSA 2WSEJ 1JEKA 3O8ZA 1ZXGA 3H1IG 1JCCA 1SQQK 3D6YA 5KAFH 1QX8A 3AE4C 1NU1E 4PV1C 2A45H 3H1KG 3L71J 4ZKPA 3HTKB 3L36A 2KS1B 2ZFCA 1SFCC 4W7ZA 1K9MQ 3PRJA 3TGUG 2O01H 1SQQG 3IF4A 3HTKA 5AW6B 1NAFA 2KP8A 2KS1A 2M5AB 3RL0B 1MFZA 1LTSC 1ZV8A 2OYHC 2KSJA 3H1JE 1KQGB 3H1HG 1IC2A 1FZCB 3Q1MA 1G2CB 3P8MC 2W8ZA 2M5AA 1KYOE 3CWBE 3L74D 2YO2A 1M7LA 1LTJB 3CX5D 3CPWO 1NTMK 1G2CA 2WSFJ 4HKZH 3D70A 1BCCE 2IFMA 1HBWA 1NKNA 3NTNA 1U7MA 1LTJA 3PLNA 2FBWC 2E76C 1L2PA 3M9HA 2ZJSE 3BRTB 1NTME 1S3JA 3M0AA 2KSEA 2JP3A 1LTTC 2N1TC 1SQVK 2V4HA 1OW6A 4NPEA 5AVRB 1SQXK 2V7QJ 3H6PA 1L0LK 3JCUH 4UB6H 5CCHC 4D6TJ 1L4AC 2OYIB 1YHQP 4HJGH 1SQVE 2H88C 2FXMA 1LTAC 4I1LA 4PJ0H 1SQXE 3CCVP 3A3YB 1KILD 1EZVD 3BRVB 2OYIA 2I1KA 1VQ4P 1L0LG 3AEGC 5AW3B 2WITA 2LXBA 1OW8A 1FU1A 2W27A 1LNQA 1URQC 3VP8A 1KB9E 4C7NB 3M9QA 2Y9YA 3VMAA 3S9OA 2HPCB 4BXLA 4IFFA 2NPSC 1GL2B 5B66E 2Q9IA 1VQMP 1KQSO 2Q7CA 5KLIC 4C7NA 3MGNA 2BCCD 2HODB 4H13B 3NXSA 1AQTA 2HPCA 1DD3A 1GL2A 4GODA 2QIWA 1KMIZ 3L35A 3CCEP 2OARA 5AW0B 2HODA 2K3RA 3CX5E 4H44B 2L91A 3B8EB 2XNXA 1EXJA 4U3FG 5DJTB 1IFJA 5H2FE 5KLVJ 2WT7A 3CMAP 2AEJA 1KC8Q 2XDJA 3P8CD 1JOCA 2IDBA 4JYBA 2B87B 1DEBA 1BDCA 1IJDB 5AW7B 3RL0C 2POHA 1MUUA 2W6BA 5GTHE 2E75B 1LJ2A 2B87A 1KB9I 1YQ4C 4NPFX 2Q3IA 1VQOP 4LLHA 1NTKJ 3EQ2A 1LTJC 1SVFA 5AVTB 2ZXEB 3G3ZA 2HLOA 3VYIA 2P10A 3A0HH 1J1EB 2E43A 1ZP0C 1N86A 2Y9ZA 2ZT9C 3GLMA 1RF0A 2J5UA 2HR3A 3D6ZA 1D7MA 2O3JA 1NVOA 3CX5I 1LWUB 1R5SA 2BCCE 1YBKA 2LXCB 1S5LX 1ZRTD 1LWUA 2OYIC 1AVOA 1R8EA 4HB1A 4EOTA 1KORA 2A06D 1YIJP 4PD4D 1RHZB 1NTKD 1JY3N 1BGYJ 1L0NG 2GM4A 4YXWH 5BU8B 2AEMA 3BCCD 3H32B 4I2LC 1GL2C 1X9VA 3PHLA 4IL6E 4OH8B 1CSBA 3L73E 1YJ9P 4H13C 3IAOA 1SQBD 3L73G 3H32A 3VOPA 2Z5HA 1QVFO 2C0WA 1T2KD 1K73Q 3JSVC 4H44C 1SQPD 1VPCA 3L75J 2OTLP 1J2JB 1NYHA 1DH3A 3E1IA 3GG2A 3PP5A 5B66H 4DJGA 1OFCX 1ZW0A 1YTZT 2P2UA 1DIPA 1BGYD 3RK2D 3JC22 3L70D 2ZXXA 1IFPA 3AEBC 3CX5H 2E75C 2HFED 1U7JA 2YO3A 1JTHB 1N2DC 5KAFE 1EDKA 1PP9G 3F89A 1NTZJ 2WSCJ 2YKPA 5H2FH 3V2NA 3RK3C 1JTHA 5KJ7D 1N8RQ 1RF0C 2A45G 1IFMA 3GF7A 4L76A 1QL2A 3RBZA 1HWTC 4N78D 5AVYB 3H25A 5GTHH 3BCCE 3B5ND 1VQKP 4KJMA 1LWUC 1WRGA 2LR2A 4GKGA 3H1IJ 4UB8H 1FJPA 5K5GB 2YMYA 1FOSE 1P84D 3B71A 1NOHA 3H1KJ 1IFDA 1N7SD 3B4SA 1EDIA 4W7YA 3FGAD 3TGUJ 1SQPE 1SQQJ 4QMAA 2IBZG 1A02J 2K37A 1JO5A 4EIJA 2M0BA 3H1HJ 3KHUA 2K9JA 3H1JJ 1USEA 2BEQD 2KNCB 1PPJG 3L70E 5BVZA 2KOGA 4PJ0E 3PJSK 4NPDA 1LTIC 4YXDC 5AVQB 2J58A 3CCLP 2Q3EA 2KNCA 2B88A 3H1ID 1S72P 3RK3E 4IFDK 1YYCA 2FYUK 3KDPB 2Q6QA 2RN0A 4JQ0D 3CCJP 3HD7D 4JF7A 4YPCA 1JY3O 1FC2C 4IL6H 2FYUG 3FWLA 3CXHE 3WU2H 3UIAA 3CD6P 1KILB 5M1BA 3E7KA 3H1HD 1LTBC 3RGUA 3V5BA 1L0LJ 2R3SA 1KILA 2JWAA 2CPSA 2P7JA 2JEEA 5CMZA 3C8VA 2ZYDA 3KQGA 3L72D 3O6QB 3CL3D 2WSSH 1BE3D 3CC7P 3O6QA 1FE6A 2IYOA 1NU1K 4XE5B 3I55P 3CCMP 3AE6C 1M90Q 2RH0A 1QL1A 1PGOA 1SP4A 4U3FJ 3H1LD 2QVAA 4PD4H 3VMXA 1QEXA 1LP1B 1M1KQ 4DOJA 1NU1G 5CJ4A 3A0HE 3CC4P 1IFIA 3CXHI 4JBZA 1LP1A 3NMDA 2W83C 4A7PA 5KKZB 2W6JH 2JWDA 2YMKA 4KHXA 4OGQD 4Y99B 3HRNA 3M91A 3H1JG 1N7LA 3OAKA 3VMYA 5KAIE 3CWBG 3L37A 1AA0A 1RF1C 4ZMDA 1IFNA 2ZT9B 1BCCG 4JYCA 2AXTH 3TDKA 1QVGO 1EDJA 1HGZA 1YJNP 1FDOA 5AW5B 4DCKA 5APVA 2Y0EA 1SS1A 1NTMG 3L71D 3FWNA 2E5YA 5GTIE 1BE3E 2IZ1A 1PZQA 3RL0g 2E74D 1HTLC 1ZR2A 2KXPB 1SQVG 3AE3C 1XTGB 1SQXG 1KILC 3GMAA 2OTKE 2Q1KA 4GIFA 3H1LE 4CPGA 2YIUB 2FYNC 1OXZA 3RBXA 2QEXP 1L0NJ 5APUA 3A0BE 3WUUA 3M06A 4WB4A 3CXHH 1HUCA 1DD4A 3L73J 5AW8B 3L74E 4LGDE 2N9YB 2H7HA 4D6TD 2KIKA 2WT7B 1FDIA 1NAYA 3L74G 3W67A 2C9NY 5C39A 1RQVA 2BEZF 3N7NA 3L71E 2DW3A 4ZKUA 3RK2B 1JY3P 1L0ND 5KKZC 3CMEP 3VN0A 1NWQA 3AE9C 4GT1A 4Y99C 1T3UA 1H8AA 4UB8E 1RY3A 2PGDA 1KILE 2GUSA 3MTUE 1EZVE 1ZMEC 5CBNA 3CLQA 1PP9J 3RK3B 1VF5D 3F5HA 4W80A 1Q82Q 2KZJA 4EYYQ 1T6AA 3G6EP 1YI2P 2MKVA 5KLVD 5KJ7A 2O01J 5DJUB 1LT1A
chains in the Genus database with same CATH topology
3OJAB 5CCHD 1JTHA 1L4AD 1N73C 3B5NB 5KJ7D 1RF0C 1AFOA 1FBMA 2A45G 1IFMA 3BASA 1URQB 1NKZB 2WPRA 2HYNA 1KFNA 1QL2A 5APSA 1HWTC 2XV5A 3B5NA 1ZR4A 4N6JA 4N78D 5AVYB 1GW3A 4RESB 2W6AA 4XA4A 1URQA 1CZQA 1N7SB 2LKMA 2NPSB 3B5ND 2E42A 1LWUC 1WRGA 5CCGC 4GKGA 4WY4C 1URQD 2N9BA 4DZOA 4AUWA 1G1JA 1FJPA 4C7RA 2YMYA 1N7SA 2NPSA 1FOSE 1GDTA 3LIDA 1A02F 3A7OA 1NOHA 1ZLLA 1IFDA 1N7SD 2NPSD 3O8ZA 3P8CE 4B86A 4W7YA 1JCCA 1SQQK 5AVSB 1GD2E 1SLQA 1GTWA 2M8RA 3L4FA 1A02J 1KZUB 1JCDA 2GUVA 2FFDB 2A45H 1JO5A 4AQRD 1FJKA 1JY2N 4EIJA 4ZKPA 1S9KD 1ZN5A 3HTKB 3L36A 2O1KA 2ZFCA 1SFCC 4W7ZA 2WSCH 5AVUB 2O01H 3R2PA 1T2KC 2FFDA 3HTKA 5AW6B 1NAFA 5BVZA 2KP8A 2KOGA 3RL0B 1MFZA 2WZ7A 1GZLA 1LTSC 1LTIC 1ZV8A 1HGVA 2OYHC 5AVQB 2KSJA 2J58A 2I1JA 3HD7B 1IC2A 1FZCB 1G2CB 3P8MC 1H88A 2P1JA 4IFDK 1YYCA 5AW9B 2FYUK 2YO2A 1M7LA 1LTJB 3KDPB 3RL0D 3HD7A 1NTMK 1G2CA 3P32A 3RK2C 2IFMA 1RE3A 3A5TA 1HBWA 3HD7D 1NKNA 3NTNA 3V4QA 1Z56A 1LTJA 4JF7A 1FZCC 2Z4EA 1LTGC 2WSEH 3M9HA 1JY3O 1NTKK 3II6A 1JY2P 3BRTB 1M1JC 2IX7C 3GHGB 1MV8A 3M0AA 3SWYA 2C9LY 1LTTC 2H43A 2HG5D 2N1TC 1SQVK 3MD0A 3UIAA 3BATA 2BASA 1KILB 5AVRB 1SQXK 3H6PA 1FZBA 1LTBC 3V2QA 1L0LK 3GHGA 1J1DC 1FZAA 3U1AA 3V5BA 5AW4B 5CCHC 1L4AC 5KJ7C 2OYIB 1KILA 1FAVA 1HJBA 4IFMA 1LT9B 2FXMA 2R32A 1LTAC 4I1LA 2CPSA 3LW5H 2PAJA 5KTBA 1SQBK 1XTCC 2P7JA 3A3YB 1KILD 2VRSA 2JEEA 3BRVB 2OYIA 5CMZA 5APTA 3KQGA 2I1KA 1LT9A 5AW3B 2WITA 2WPSA 3B5NC 3CL3D 1FU1A 2W27A 1YTZI 1OWAA 1URQC 3MIWA 3VP8A 1SQPK 1FDMA 2CPBA 4C7NB 1X79B 3M9QA 1L0NK 1NU1K 2FKWB 2HPCB 4XE5B 4IFFA 1N7SC 2NPSC 1GL2B 2YKQA 2YKOA 2WSFH 2Q9IA 2Q7CA 4C7NA 1QL1A 1IO4A 1IK9A 1JMMA 1SP4A 3MGNA 2HODB 3NXSA 2HPCA 3VMXA 1GL2A 2WPQA 4DOJA 1GK6A 5APXA 1AQ5A 3L35A 5CJ4A 2OARA 5AW0B 1GL2D 2HODA 5AVZB 2WWWA 1IFIA 3B8EB 2XNXA 3I5CA 5AW1B 3NMDA 1RF1B 5KLVK 5AW2B 4N3YB 1IFJA 3V2RA 2P67A 2PP6A 3HUSB 3V2PA 4HH2A 2FFDC 3C9IA 2WT7A 1NHLA 4KHXA 2WTYA 1T8ZA 2J59M 4Y99B 3HRNA 2KB7P 3MUDA 1RF1A 3M91A 3T97A 2XDJA 1N7LA 3OAKA 3M0DA 3P8CD 3HUSA 1JOCA 4JYBA 3VMYA 2Q5UA 1CW5A 1DEBA 1PFIA 3L37A 3A2AA 1RF1C 1IJDB 5AW7B 2XZRA 1VDFA 3RL0C 3V4WA 2POHA 1MUUA 2W6BA 3TSIA 3TYYA 1KFMA 3M9BA 1IFNA 3HE5B 2XU6A 3HD7C 4JYCA 5CJ0A 2QM7A 2Q3IA 1HGZA 4N78E 4LLHA 1RE3C 3TK1A 5AW5B 1W2EA 1KQLA 5APVA 3EQ2A 3HE4B 2XKMA 1RE4A 2KLVA 1LTJC 1SVFA 3HE5A 5AVTB 2ZXEB 3G3ZA 2HLOA 5APYA 3VYIA 3WMM0 1J1EB 2O1JA 2E43A 3SWFA 1FOSF 2C0XA 3HE4A 1N86A 1HTLC 1RF0A 3RK3D 1ZR2A 3GHGC 5AVXB 1JY2O 3KPEA 4C46A 3IFMA 1LWUB 1XTGB 4WY4B 1KILC 3LIEA 2MJZA 5APWA 1J1EC 4GIFA 1HVVA 3P7KA 1OXZA 1LWUA 1S9KE 1LGHB 2OYIC 5CCGA 4WY4A 1FZFA 1LT9C 4EOTA 5CCGD 3VTPC 4WY4D 5APUA 4AYCA 1HH0A 4HYTB 4M3LA 1FZGA 5CHXA 2Z5IA 1FZEA 1JY3N 3M06A 5AVWB 1WT6A 2R5DA 4WB4A 5AVVB 2KYVA 5APQA 1GW4A 1GU4A 1HUCA 1SFCB 2GM4A 3NFQA 5AW8B 1NH4A 5BU8B 4LGDE 2H7HA 1X8YA 2WT7B 3H32B 4I2LC 3OA7A 1GL2C 1DX7A 1X9VA 2M3BA 1GK4A 1SFCA 4OH8B 1CSBA 3VP9A 3BVHA 2OYHB 1NO4A 2C9NY 2FYZA 1SFCD 1JUNA 1E5WA 3H32A 3U59A 3VOPA 2Z5HA 3CI9A 2C0WA 1T2KD 3IR9A 1EQ7A 3VMZA 5BU5A 2OYHA 1CI6B 3KYQA 2R5BA 3N7NA 2A45I 2H8PD 3N4XA 4ZKUA 1G1IA 3RK2B 1VPCA 2IFNA 1J2JB 1GU5A 1JY3P 1CI6A 2QM8A 3M0DC 1DH3A 3E1IA 3HUSC 4LC1A 2R3CA 3PP5A 3VN0A 1NWQA 1M1JB 1JNMA 4GT1A 4Y99C 1T3UA 1H8AA 2JJLA 1RY3A 1YTZT 2GUSA 3MTUE 3TNUB 2N1TB 2P2UA 3RK2D 3CLQA 3RK3B 1FZCA 3EFGA 1T3JA 4O9BA 1N73B 1M1JA 4WBAA 2YNYA 1J1DB 4W80A 1L4AB 1H89A 3TNUA 2N1TA 1RE4C 2HFED 2YO3A 1JTHB 1N2DC 4I6MC 2N1TD 1N73A 1NTZK 1MZ9A 2YKPA 5CCHA 3U1CA 3V2NA 1L4AA 5KJ7A 3RK3C 2L5GB 2IPPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGV A;  2C0X A;  2C0W A;  2CPS A;  1IFI A;  1IFD A;  1HGZ A;  1HH0 A;  2MJZ A;  1IFJ A;  1FDM A;  2CPB A;  1NH4 A; 
#chains in the Genus database with same CATH topology
 3B5N B;  1AFO A;  1FBM A;  3WUT A;  1Q81 Q;  1NKZ B;  2HYN A;  5KAI H;  3AE5 C;  2BCC G;  3SWK A;  3B5N A;  3QH9 A;  4N6J A;  1GW3 A;  4RES B;  2K88 A;  4D6T E;  2W6A A;  4XA4 A;  1N7S B;  2E42 A;  1TU3 F;  3E1R A;  3OW2 O;  2JR8 A;  1N7S A;  2YIU C;  1Y47 A;  3LID A;  3A7O A;  1Y9B A;  5GTI H;  3P8C E;  4B86 A;  1EZV I;  2O01 N;  2FXP A;  3C1L A;  1S2E A;  4K35 A;  1PGP A;  4RO0 A;  3L4F A;  3EWK A;  2FFD B;  4AQR D;  1JY2 N;  3WU2 E;  1S9K D;  2O1K A;  3W68 A;  1OX3 A;  4BWN A;  5AVU B;  5TIS E;  1KD1 Q;  3GF3 A;  2FFD A;  1T2K C;  4OVN F;  4H0L D;  1EDL A;  2WZ7 A;  3Q5P A;  3G9R A;  2QRX A;  3A0B H;  3HD7 B;  2JDI H;  2NRG A;  4TT3 H;  2YXR B;  3GW6 A;  1RQU A;  2P1J A;  1HF9 A;  4L73 A;  5KLV E;  2IBZ D;  2XND H;  2FYU J;  3HD7 A;  1MFT A;  4U7J A;  3RK2 C;  4L75 A;  1RE3 A;  1X22 A;  3I56 P;  1ZRT E;  1LTG C;  2WSE H;  1NTK K;  3MHV A;  3II6 A;  3S4R A;  3G4S P;  3GHG B;  1PPJ D;  4BRY B;  2C9L Y;  2A06 E;  1QGK B;  3Q5R A;  3BAT A;  4PD4 E;  2BAS A;  1AJY A;  1FZB A;  2A06 G;  3V2Q A;  1NTK E;  2RKL A;  3GHG A;  2ZVN B;  1FZA A;  3U1A A;  4BRY A;  1JB0 J;  4IL6 X;  1W2B O;  3KZI H;  5KJ7 C;  1BDD A;  1QLE D;  1FAV A;  1HJB A;  1LT9 B;  3L75 D;  5CBO A;  1FS0 E;  5KTB A;  1SQB K;  1XTC C;  2W90 A;  1M8O B;  3AE8 C;  2VRS A;  1VQ8 P;  1JM0 A;  5APT A;  1K04 A;  1LT9 A;  2WPS A;  3B5N C;  3BCC G;  4RKU J;  1YTZ I;  1SQB E;  3MIW A;  1SQP K;  1FDM A;  2CPB A;  1X79 B;  2QJK B;  1SQB G;  2FKW B;  1PV3 A;  1NU1 J;  1N7S C;  2WSF H;  3TF5 A;  3ITK A;  2AXT E;  2KUB A;  1OW7 A;  1IK9 A;  1JMM A;  1NTZ D;  1SQP G;  2K9J B;  1KN7 A;  2QE7 H;  1OVU A;  1OVR A;  3CCS P;  3LW5 J;  4OGQ B;  1VQ5 P;  5AVZ B;  1BGY E;  2D2C D;  4PD4 I;  2V7Q H;  4JPZ B;  1VQ9 P;  1RF1 B;  3T97 B;  5AW2 B;  4ZNC A;  3CWB J;  3L70 G;  2PP6 A;  2FFD C;  3C9I A;  3CCQ P;  4L74 A;  2GA1 A;  2KB7 P;  1RF1 A;  1BCC J;  3T97 A;  1VQL P;  3M0D A;  3CC2 P;  2Q5U A;  1CW5 A;  1PFI A;  2B9B A;  2XZR A;  1NTM J;  3H1K D;  3V4W A;  1MKM A;  2KK7 A;  1NU1 D;  3M9B A;  3HE5 B;  2XU6 A;  3HD7 C;  3TGU D;  1SQQ D;  4N78 E;  1RE3 C;  1KQL A;  2E74 B;  1RE4 A;  2ITA A;  3FX0 A;  3HE5 A;  1SQV J;  5APY A;  3R4Y A;  1SQX J;  2O1J A;  1FOS F;  2C0X A;  5TIS H;  3H1J D;  2FYN B;  1P84 E;  1KYO D;  3CWB D;  3GHG C;  1JY2 O;  3KPE A;  3SFD C;  4C46 A;  1EC5 A;  1NTZ E;  2JKV A;  1K05 A;  1HVV A;  3P7K A;  1PGJ A;  3IN6 A;  2OGU A;  1FZF A;  1LT9 C;  1NTM D;  2ZVO B;  2OYO A;  5CCG D;  3VTP C;  4WY4 D;  4WWI A;  5B5E E;  2FY8 A;  2B89 A;  1FZG A;  3MZW B;  1FZE A;  2QJP B;  3L74 J;  1WT6 A;  2R5D A;  5AVV B;  1OIP A;  5EFW B;  2K9Y A;  1SQV D;  3H1I E;  2QJK C;  3Q2Y A;  1SQX D;  3MP7 B;  4ASW A;  1NH4 A;  1L0L D;  2WQY C;  1UIX A;  1X8Y A;  2PRR A;  1DX7 A;  4PV1 D;  3H1K E;  4R4L A;  3BVH A;  1NO4 A;  1S1C X;  1SFC D;  1JUN A;  3TGU E;  3U59 A;  1KB9 D;  1P84 I;  4K3A A;  1SQQ E;  3IR9 A;  1EQ7 A;  3VMZ A;  5BU5 A;  1WMK A;  4OGQ C;  1CI6 B;  3KYQ A;  4Z1M H;  2R5B A;  3N4X A;  1G1I A;  2Y0C A;  3H1H E;  2IFN A;  2OTJ P;  1GU5 A;  1VF5 B;  1CI6 A;  2QM8 A;  3M0D C;  3PH0 A;  2R3C A;  1PIX A;  2G3A A;  4XFJ A;  1M1J B;  2H89 C;  3ZDM A;  1KQF B;  4U3F D;  1FZC A;  3EFG A;  1T3J A;  1YJW P;  3L72 E;  3V6I A;  1IK7 A;  1M1J A;  1U57 A;  1J1D B;  2E76 D;  1OVV A;  3L72 G;  1H89 A;  1RE4 C;  1UII A;  2N1T D;  1BE3 G;  1MZ9 A;  2BCC J;  3U1C A;  2E74 C;  2QJY B;  2KZI A;  2UWJ E;  2L5G B;  2IPP A;  3OJA B;  5CCH D;  1L4A D;  4Y28 J;  1N73 C;  1VL2 A;  1YQ3 C;  4EI2 A;  1VQ6 P;  3H1L G;  1L0L E;  1OZH A;  2LKM A;  2QG4 A;  1URQ D;  1NJI Q;  4AUW A;  5E79 E;  1PL5 A;  1M56 D;  2RMZ A;  2SPZ A;  1AVY A;  1GDT A;  1A02 F;  4WVZ A;  1ZLL A;  1KYO I;  2NPS D;  1BSH A;  2ZAE B;  4TLF A;  4GDO A;  1P84 H;  5AVS B;  1GD2 E;  1SLQ A;  1GTW A;  2M8R A;  1KZU B;  1JCD A;  4H0L B;  2QJP C;  3G71 P;  2GUV A;  1FJK A;  1RH5 B;  1ZN5 A;  2WSC H;  4U3F E;  3KZI E;  2M3E A;  3R2P A;  1GZL A;  3L71 G;  2WPV B;  2Y0D A;  1S5L E;  1HGV A;  2I1J A;  5B5E H;  2PFX A;  3ABV C;  1BSN A;  3AE1 C;  1H88 A;  5AW9 B;  1K8A Q;  3RL0 D;  3P32 A;  1EZV G;  3A5T A;  3L73 D;  3V4Q A;  1Z56 A;  1VF5 C;  1FZC C;  2Z4E A;  1JY2 P;  1M1J C;  2IX7 C;  1MV8 A;  3SWY A;  4I7Z B;  4OWF A;  2H43 A;  2HG5 D;  3MD0 A;  3Q3D A;  4EDF A;  2ZT9 D;  1J1D C;  5AW4 B;  2KI7 B;  3BCC J;  4IFM A;  2R32 A;  3LW5 H;  2E5T A;  2PAJ A;  4RJT A;  1SQB J;  2QJY C;  1JMB A;  4IOI H;  1AV1 A;  1KYO H;  1NGM B;  4D6T G;  3AEE C;  1OWA A;  1PP9 D;  1S4X A;  1SQP J;  1L0N K;  2YXQ B;  1R5L A;  1Q7Y Q;  2YKQ A;  2YKO A;  2D2C B;  1IO4 A;  2CK3 H;  2QA4 P;  1L0N E;  3CCU P;  3AEA C;  1M57 D;  2IYP A;  2WPQ A;  1KTM A;  3L70 J;  1GK6 A;  5APX A;  1AQ5 A;  1GL2 D;  2WWW A;  3I5C A;  5AW1 B;  4H13 D;  1IZN B;  3AEF C;  5KLV K;  4N3Y B;  3V2R A;  2P67 A;  3HUS B;  3V2P A;  1VQ7 P;  4H0L C;  4HH2 A;  1NHL A;  2WTY A;  1T8Z A;  2J59 M;  3AEC C;  3MUD A;  4H44 D;  5E79 H;  3HUS A;  2K1A A;  1Q90 D;  4MN4 C;  1KB9 H;  2R44 A;  3CCR P;  3A2A A;  5KLV G;  1VQN P;  1VDF A;  4GOF A;  3TSI A;  3TYY A;  1KFM A;  4R4M A;  2JO1 A;  5CJ0 A;  3FXE A;  2QM7 A;  3TK1 A;  2G8Y A;  1W2E A;  3HE4 B;  2XKM A;  2KLV A;  1GMJ A;  5TJH A;  2QSI A;  2E75 D;  3WMM 0;  3SFE C;  1VQP P;  2KLU A;  3SWF A;  3HE4 A;  1PP9 E;  3WUV A;  1NTK G;  1YIT P;  2I8D A;  3RK3 D;  3PTZ A;  1S5L H;  5AVX B;  1E79 H;  4I7Z C;  3D71 A;  3IFM A;  1Q2N A;  2WMM A;  3AE2 C;  4WY4 B;  3LIE A;  3SSU A;  2MJZ A;  5APW A;  1J1E C;  2FYU D;  1S9K E;  1LGH B;  5CCG A;  4WY4 A;  2AXC A;  2IZ0 A;  3CXH D;  4AYC A;  1HH0 A;  4HYT B;  4M3L A;  1W5C E;  5CHX A;  2Z5I A;  3Q5S A;  5AVW B;  4PV1 B;  2KYV A;  5APQ A;  1GW4 A;  1GU4 A;  1ZOY C;  1SFC B;  3NFQ A;  1KV4 A;  3FXD A;  1X0T A;  2IBZ E;  3OA7 A;  2M3B A;  1GK4 A;  1SFC A;  2ZYA A;  1BGY G;  3VP9 A;  2D2C C;  2OYH B;  2FYZ A;  3AE7 C;  1OMI A;  1E5W A;  3CI9 A;  1PPJ E;  3JCU E;  3EFF K;  4UB6 E;  3S1K A;  2OYH A;  2A45 I;  2H8P D;  1PGQ A;  3MUD C;  1DEE G;  2OQQ A;  3QWO C;  3HUS C;  2E76 B;  4LC1 A;  3L72 J;  2NZ2 A;  1JNM A;  3L75 E;  2JJL A;  4DT0 A;  3TNU B;  2N1T B;  1BE3 J;  3K5B A;  3L75 G;  4ASV A;  3USS A;  2ZYG A;  1HJ0 A;  4O9B A;  1N73 B;  4WBA A;  2YNY A;  2WVR A;  1L4A B;  3TNU A;  2N1T A;  3AED C;  2FYU E;  1USD A;  2P58 A;  4KT0 J;  4I6M C;  1N73 A;  1NTZ K;  4YTP C;  5CCH A;  1L4A A;  3H1L J;  2IBZ I;  3KXD A;  1Q86 Q;  1Y8A A;  1H0T B;  1BCC D;  1EXI A;  2AEF A;  3BAS A;  5L8R J;  1URQ B;  2WPR A;  1KFN A;  1NTZ G;  5APS A;  2XV5 A;  1ZR4 A;  1H0T A;  1URQ A;  1CZQ A;  2NPS B;  5KLI B;  5CCG C;  4GOE A;  4WY4 C;  2FXO A;  2N9B A;  4DZO A;  1G1J A;  4C7R A;  2NPS A;  2WSE J;  1JEK A;  3O8Z A;  1ZXG A;  3H1I G;  1JCC A;  1SQQ K;  3D6Y A;  5KAF H;  1QX8 A;  3AE4 C;  1NU1 E;  4PV1 C;  2A45 H;  3H1K G;  3L71 J;  4ZKP A;  3HTK B;  3L36 A;  2KS1 B;  2ZFC A;  1SFC C;  4W7Z A;  1K9M Q;  3PRJ A;  3TGU G;  2O01 H;  1SQQ G;  3IF4 A;  3HTK A;  5AW6 B;  1NAF A;  2KP8 A;  2KS1 A;  2M5A B;  3RL0 B;  1MFZ A;  1LTS C;  1ZV8 A;  2OYH C;  2KSJ A;  3H1J E;  1KQG B;  3H1H G;  1IC2 A;  1FZC B;  3Q1M A;  1G2C B;  3P8M C;  2W8Z A;  2M5A A;  1KYO E;  3CWB E;  3L74 D;  2YO2 A;  1M7L A;  1LTJ B;  3CX5 D;  3CPW O;  1NTM K;  1G2C A;  2WSF J;  4HKZ H;  3D70 A;  1BCC E;  2IFM A;  1HBW A;  1NKN A;  3NTN A;  1U7M A;  1LTJ A;  3PLN A;  2FBW C;  2E76 C;  1L2P A;  3M9H A;  2ZJS E;  3BRT B;  1NTM E;  1S3J A;  3M0A A;  2KSE A;  2JP3 A;  1LTT C;  2N1T C;  1SQV K;  2V4H A;  1OW6 A;  4NPE A;  5AVR B;  1SQX K;  2V7Q J;  3H6P A;  1L0L K;  3JCU H;  4UB6 H;  5CCH C;  4D6T J;  1L4A C;  2OYI B;  1YHQ P;  4HJG H;  1SQV E;  2H88 C;  2FXM A;  1LTA C;  4I1L A;  4PJ0 H;  1SQX E;  3CCV P;  3A3Y B;  1KIL D;  1EZV D;  3BRV B;  2OYI A;  2I1K A;  1VQ4 P;  1L0L G;  3AEG C;  5AW3 B;  2WIT A;  2LXB A;  1OW8 A;  1FU1 A;  2W27 A;  1LNQ A;  1URQ C;  3VP8 A;  1KB9 E;  4C7N B;  3M9Q A;  2Y9Y A;  3VMA A;  3S9O A;  2HPC B;  4BXL A;  4IFF A;  2NPS C;  1GL2 B;  5B66 E;  2Q9I A;  1VQM P;  1KQS O;  2Q7C A;  5KLI C;  4C7N A;  3MGN A;  2BCC D;  2HOD B;  4H13 B;  3NXS A;  1AQT A;  2HPC A;  1DD3 A;  1GL2 A;  4GOD A;  2QIW A;  1KMI Z;  3L35 A;  3CCE P;  2OAR A;  5AW0 B;  2HOD A;  2K3R A;  3CX5 E;  4H44 B;  2L91 A;  3B8E B;  2XNX A;  1EXJ A;  4U3F G;  5DJT B;  1IFJ A;  5H2F E;  5KLV J;  2WT7 A;  3CMA P;  2AEJ A;  1KC8 Q;  2XDJ A;  3P8C D;  1JOC A;  2IDB A;  4JYB A;  2B87 B;  1DEB A;  1BDC A;  1IJD B;  5AW7 B;  3RL0 C;  2POH A;  1MUU A;  2W6B A;  5GTH E;  2E75 B;  1LJ2 A;  2B87 A;  1KB9 I;  1YQ4 C;  4NPF X;  2Q3I A;  1VQO P;  4LLH A;  1NTK J;  3EQ2 A;  1LTJ C;  1SVF A;  5AVT B;  2ZXE B;  3G3Z A;  2HLO A;  3VYI A;  2P10 A;  3A0H H;  1J1E B;  2E43 A;  1ZP0 C;  1N86 A;  2Y9Z A;  2ZT9 C;  3GLM A;  1RF0 A;  2J5U A;  2HR3 A;  3D6Z A;  1D7M A;  2O3J A;  1NVO A;  3CX5 I;  1LWU B;  1R5S A;  2BCC E;  1YBK A;  2LXC B;  1S5L X;  1ZRT D;  1LWU A;  2OYI C;  1AVO A;  1R8E A;  4HB1 A;  4EOT A;  1KOR A;  2A06 D;  1YIJ P;  4PD4 D;  1RHZ B;  1NTK D;  1JY3 N;  1BGY J;  1L0N G;  2GM4 A;  4YXW H;  5BU8 B;  2AEM A;  3BCC D;  3H32 B;  4I2L C;  1GL2 C;  1X9V A;  3PHL A;  4IL6 E;  4OH8 B;  1CSB A;  3L73 E;  1YJ9 P;  4H13 C;  3IAO A;  1SQB D;  3L73 G;  3H32 A;  3VOP A;  2Z5H A;  1QVF O;  2C0W A;  1T2K D;  1K73 Q;  3JSV C;  4H44 C;  1SQP D;  1VPC A;  3L75 J;  2OTL P;  1J2J B;  1NYH A;  1DH3 A;  3E1I A;  3GG2 A;  3PP5 A;  5B66 H;  4DJG A;  1OFC X;  1ZW0 A;  1YTZ T;  2P2U A;  1DIP A;  1BGY D;  3RK2 D;  3JC2 2;  3L70 D;  2ZXX A;  1IFP A;  3AEB C;  3CX5 H;  2E75 C;  2HFE D;  1U7J A;  2YO3 A;  1JTH B;  1N2D C;  5KAF E;  1EDK A;  1PP9 G;  3F89 A;  1NTZ J;  2WSC J;  2YKP A;  5H2F H;  3V2N A;  3RK3 C;  1JTH A;  5KJ7 D;  1N8R Q;  1RF0 C;  2A45 G;  1IFM A;  3GF7 A;  4L76 A;  1QL2 A;  3RBZ A;  1HWT C;  4N78 D;  5AVY B;  3H25 A;  5GTH H;  3BCC E;  3B5N D;  1VQK P;  4KJM A;  1LWU C;  1WRG A;  2LR2 A;  4GKG A;  3H1I J;  4UB8 H;  1FJP A;  5K5G B;  2YMY A;  1FOS E;  1P84 D;  3B71 A;  1NOH A;  3H1K J;  1IFD A;  1N7S D;  3B4S A;  1EDI A;  4W7Y A;  3FGA D;  3TGU J;  1SQP E;  1SQQ J;  4QMA A;  2IBZ G;  1A02 J;  2K37 A;  1JO5 A;  4EIJ A;  2M0B A;  3H1H J;  3KHU A;  2K9J A;  3H1J J;  1USE A;  2BEQ D;  2KNC B;  1PPJ G;  3L70 E;  5BVZ A;  2KOG A;  4PJ0 E;  3PJS K;  4NPD A;  1LTI C;  4YXD C;  5AVQ B;  2J58 A;  3CCL P;  2Q3E A;  2KNC A;  2B88 A;  3H1I D;  1S72 P;  3RK3 E;  4IFD K;  1YYC A;  2FYU K;  3KDP B;  2Q6Q A;  2RN0 A;  4JQ0 D;  3CCJ P;  3HD7 D;  4JF7 A;  4YPC A;  1JY3 O;  1FC2 C;  4IL6 H;  2FYU G;  3FWL A;  3CXH E;  3WU2 H;  3UIA A;  3CD6 P;  1KIL B;  5M1B A;  3E7K A;  3H1H D;  1LTB C;  3RGU A;  3V5B A;  1L0L J;  2R3S A;  1KIL A;  2JWA A;  2CPS A;  2P7J A;  2JEE A;  5CMZ A;  3C8V A;  2ZYD A;  3KQG A;  3L72 D;  3O6Q B;  3CL3 D;  2WSS H;  1BE3 D;  3CC7 P;  3O6Q A;  1FE6 A;  2IYO A;  1NU1 K;  4XE5 B;  3I55 P;  3CCM P;  3AE6 C;  1M90 Q;  2RH0 A;  1QL1 A;  1PGO A;  1SP4 A;  4U3F J;  3H1L D;  2QVA A;  4PD4 H;  3VMX A;  1QEX A;  1LP1 B;  1M1K Q;  4DOJ A;  1NU1 G;  5CJ4 A;  3A0H E;  3CC4 P;  1IFI A;  3CXH I;  4JBZ A;  1LP1 A;  3NMD A;  2W83 C;  4A7P A;  5KKZ B;  2W6J H;  2JWD A;  2YMK A;  4KHX A;  4OGQ D;  4Y99 B;  3HRN A;  3M91 A;  3H1J G;  1N7L A;  3OAK A;  3VMY A;  5KAI E;  3CWB G;  3L37 A;  1AA0 A;  1RF1 C;  4ZMD A;  1IFN A;  2ZT9 B;  1BCC G;  4JYC A;  2AXT H;  3TDK A;  1QVG O;  1EDJ A;  1HGZ A;  1YJN P;  1FDO A;  5AW5 B;  4DCK A;  5APV A;  2Y0E A;  1SS1 A;  1NTM G;  3L71 D;  3FWN A;  2E5Y A;  5GTI E;  1BE3 E;  2IZ1 A;  1PZQ A;  3RL0 g;  2E74 D;  1HTL C;  1ZR2 A;  2KXP B;  1SQV G;  3AE3 C;  1XTG B;  1SQX G;  1KIL C;  3GMA A;  2OTK E;  2Q1K A;  4GIF A;  3H1L E;  4CPG A;  2YIU B;  2FYN C;  1OXZ A;  3RBX A;  2QEX P;  1L0N J;  5APU A;  3A0B E;  3WUU A;  3M06 A;  4WB4 A;  3CXH H;  1HUC A;  1DD4 A;  3L73 J;  5AW8 B;  3L74 E;  4LGD E;  2N9Y B;  2H7H A;  4D6T D;  2KIK A;  2WT7 B;  1FDI A;  1NAY A;  3L74 G;  3W67 A;  2C9N Y;  5C39 A;  1RQV A;  2BEZ F;  3N7N A;  3L71 E;  2DW3 A;  4ZKU A;  3RK2 B;  1JY3 P;  1L0N D;  5KKZ C;  3CME P;  3VN0 A;  1NWQ A;  3AE9 C;  4GT1 A;  4Y99 C;  1T3U A;  1H8A A;  4UB8 E;  1RY3 A;  2PGD A;  1KIL E;  2GUS A;  3MTU E;  1EZV E;  1ZME C;  5CBN A;  3CLQ A;  1PP9 J;  3RK3 B;  1VF5 D;  3F5H A;  4W80 A;  1Q82 Q;  2KZJ A;  4EYY Q;  1T6A A;  3G6E P;  1YI2 P;  2MKV A;  5KLV D;  5KJ7 A;  2O01 J;  5DJU B;  1LT1 A; 
#chains in the Genus database with same CATH homology
 3OJA B;  5CCH D;  1JTH A;  1L4A D;  1N73 C;  3B5N B;  5KJ7 D;  1RF0 C;  1AFO A;  1FBM A;  2A45 G;  1IFM A;  3BAS A;  1URQ B;  1NKZ B;  2WPR A;  2HYN A;  1KFN A;  1QL2 A;  5APS A;  1HWT C;  2XV5 A;  3B5N A;  1ZR4 A;  4N6J A;  4N78 D;  5AVY B;  1GW3 A;  4RES B;  2W6A A;  4XA4 A;  1URQ A;  1CZQ A;  1N7S B;  2LKM A;  2NPS B;  3B5N D;  2E42 A;  1LWU C;  1WRG A;  5CCG C;  4GKG A;  4WY4 C;  1URQ D;  2N9B A;  4DZO A;  4AUW A;  1G1J A;  1FJP A;  4C7R A;  2YMY A;  1N7S A;  2NPS A;  1FOS E;  1GDT A;  3LID A;  1A02 F;  3A7O A;  1NOH A;  1ZLL A;  1IFD A;  1N7S D;  2NPS D;  3O8Z A;  3P8C E;  4B86 A;  4W7Y A;  1JCC A;  1SQQ K;  5AVS B;  1GD2 E;  1SLQ A;  1GTW A;  2M8R A;  3L4F A;  1A02 J;  1KZU B;  1JCD A;  2GUV A;  2FFD B;  2A45 H;  1JO5 A;  4AQR D;  1FJK A;  1JY2 N;  4EIJ A;  4ZKP A;  1S9K D;  1ZN5 A;  3HTK B;  3L36 A;  2O1K A;  2ZFC A;  1SFC C;  4W7Z A;  2WSC H;  5AVU B;  2O01 H;  3R2P A;  1T2K C;  2FFD A;  3HTK A;  5AW6 B;  1NAF A;  5BVZ A;  2KP8 A;  2KOG A;  3RL0 B;  1MFZ A;  2WZ7 A;  1GZL A;  1LTS C;  1LTI C;  1ZV8 A;  1HGV A;  2OYH C;  5AVQ B;  2KSJ A;  2J58 A;  2I1J A;  3HD7 B;  1IC2 A;  1FZC B;  1G2C B;  3P8M C;  1H88 A;  2P1J A;  4IFD K;  1YYC A;  5AW9 B;  2FYU K;  2YO2 A;  1M7L A;  1LTJ B;  3KDP B;  3RL0 D;  3HD7 A;  1NTM K;  1G2C A;  3P32 A;  3RK2 C;  2IFM A;  1RE3 A;  3A5T A;  1HBW A;  3HD7 D;  1NKN A;  3NTN A;  3V4Q A;  1Z56 A;  1LTJ A;  4JF7 A;  1FZC C;  2Z4E A;  1LTG C;  2WSE H;  3M9H A;  1JY3 O;  1NTK K;  3II6 A;  1JY2 P;  3BRT B;  1M1J C;  2IX7 C;  3GHG B;  1MV8 A;  3M0A A;  3SWY A;  2C9L Y;  1LTT C;  2H43 A;  2HG5 D;  2N1T C;  1SQV K;  3MD0 A;  3UIA A;  3BAT A;  2BAS A;  1KIL B;  5AVR B;  1SQX K;  3H6P A;  1FZB A;  1LTB C;  3V2Q A;  1L0L K;  3GHG A;  1J1D C;  1FZA A;  3U1A A;  3V5B A;  5AW4 B;  5CCH C;  1L4A C;  5KJ7 C;  2OYI B;  1KIL A;  1FAV A;  1HJB A;  4IFM A;  1LT9 B;  2FXM A;  2R32 A;  1LTA C;  4I1L A;  2CPS A;  3LW5 H;  2PAJ A;  5KTB A;  1SQB K;  1XTC C;  2P7J A;  3A3Y B;  1KIL D;  2VRS A;  2JEE A;  3BRV B;  2OYI A;  5CMZ A;  5APT A;  3KQG A;  2I1K A;  1LT9 A;  5AW3 B;  2WIT A;  2WPS A;  3B5N C;  3CL3 D;  1FU1 A;  2W27 A;  1YTZ I;  1OWA A;  1URQ C;  3MIW A;  3VP8 A;  1SQP K;  1FDM A;  2CPB A;  4C7N B;  1X79 B;  3M9Q A;  1L0N K;  1NU1 K;  2FKW B;  2HPC B;  4XE5 B;  4IFF A;  1N7S C;  2NPS C;  1GL2 B;  2YKQ A;  2YKO A;  2WSF H;  2Q9I A;  2Q7C A;  4C7N A;  1QL1 A;  1IO4 A;  1IK9 A;  1JMM A;  1SP4 A;  3MGN A;  2HOD B;  3NXS A;  2HPC A;  3VMX A;  1GL2 A;  2WPQ A;  4DOJ A;  1GK6 A;  5APX A;  1AQ5 A;  3L35 A;  5CJ4 A;  2OAR A;  5AW0 B;  1GL2 D;  2HOD A;  5AVZ B;  2WWW A;  1IFI A;  3B8E B;  2XNX A;  3I5C A;  5AW1 B;  3NMD A;  1RF1 B;  5KLV K;  5AW2 B;  4N3Y B;  1IFJ A;  3V2R A;  2P67 A;  2PP6 A;  3HUS B;  3V2P A;  4HH2 A;  2FFD C;  3C9I A;  2WT7 A;  1NHL A;  4KHX A;  2WTY A;  1T8Z A;  2J59 M;  4Y99 B;  3HRN A;  2KB7 P;  3MUD A;  1RF1 A;  3M91 A;  3T97 A;  2XDJ A;  1N7L A;  3OAK A;  3M0D A;  3P8C D;  3HUS A;  1JOC A;  4JYB A;  3VMY A;  2Q5U A;  1CW5 A;  1DEB A;  1PFI A;  3L37 A;  3A2A A;  1RF1 C;  1IJD B;  5AW7 B;  2XZR A;  1VDF A;  3RL0 C;  3V4W A;  2POH A;  1MUU A;  2W6B A;  3TSI A;  3TYY A;  1KFM A;  3M9B A;  1IFN A;  3HE5 B;  2XU6 A;  3HD7 C;  4JYC A;  5CJ0 A;  2QM7 A;  2Q3I A;  1HGZ A;  4N78 E;  4LLH A;  1RE3 C;  3TK1 A;  5AW5 B;  1W2E A;  1KQL A;  5APV A;  3EQ2 A;  3HE4 B;  2XKM A;  1RE4 A;  2KLV A;  1LTJ C;  1SVF A;  3HE5 A;  5AVT B;  2ZXE B;  3G3Z A;  2HLO A;  5APY A;  3VYI A;  3WMM 0;  1J1E B;  2O1J A;  2E43 A;  3SWF A;  1FOS F;  2C0X A;  3HE4 A;  1N86 A;  1HTL C;  1RF0 A;  3RK3 D;  1ZR2 A;  3GHG C;  5AVX B;  1JY2 O;  3KPE A;  4C46 A;  3IFM A;  1LWU B;  1XTG B;  4WY4 B;  1KIL C;  3LIE A;  2MJZ A;  5APW A;  1J1E C;  4GIF A;  1HVV A;  3P7K A;  1OXZ A;  1LWU A;  1S9K E;  1LGH B;  2OYI C;  5CCG A;  4WY4 A;  1FZF A;  1LT9 C;  4EOT A;  5CCG D;  3VTP C;  4WY4 D;  5APU A;  4AYC A;  1HH0 A;  4HYT B;  4M3L A;  1FZG A;  5CHX A;  2Z5I A;  1FZE A;  1JY3 N;  3M06 A;  5AVW B;  1WT6 A;  2R5D A;  4WB4 A;  5AVV B;  2KYV A;  5APQ A;  1GW4 A;  1GU4 A;  1HUC A;  1SFC B;  2GM4 A;  3NFQ A;  5AW8 B;  1NH4 A;  5BU8 B;  4LGD E;  2H7H A;  1X8Y A;  2WT7 B;  3H32 B;  4I2L C;  3OA7 A;  1GL2 C;  1DX7 A;  1X9V A;  2M3B A;  1GK4 A;  1SFC A;  4OH8 B;  1CSB A;  3VP9 A;  3BVH A;  2OYH B;  1NO4 A;  2C9N Y;  2FYZ A;  1SFC D;  1JUN A;  1E5W A;  3H32 A;  3U59 A;  3VOP A;  2Z5H A;  3CI9 A;  2C0W A;  1T2K D;  3IR9 A;  1EQ7 A;  3VMZ A;  5BU5 A;  2OYH A;  1CI6 B;  3KYQ A;  2R5B A;  3N7N A;  2A45 I;  2H8P D;  3N4X A;  4ZKU A;  1G1I A;  3RK2 B;  1VPC A;  2IFN A;  1J2J B;  1GU5 A;  1JY3 P;  1CI6 A;  2QM8 A;  3M0D C;  1DH3 A;  3E1I A;  3HUS C;  4LC1 A;  2R3C A;  3PP5 A;  3VN0 A;  1NWQ A;  1M1J B;  1JNM A;  4GT1 A;  4Y99 C;  1T3U A;  1H8A A;  2JJL A;  1RY3 A;  1YTZ T;  2GUS A;  3MTU E;  3TNU B;  2N1T B;  2P2U A;  3RK2 D;  3CLQ A;  3RK3 B;  1FZC A;  3EFG A;  1T3J A;  4O9B A;  1N73 B;  1M1J A;  4WBA A;  2YNY A;  1J1D B;  4W80 A;  1L4A B;  1H89 A;  3TNU A;  2N1T A;  1RE4 C;  2HFE D;  2YO3 A;  1JTH B;  1N2D C;  4I6M C;  2N1T D;  1N73 A;  1NTZ K;  1MZ9 A;  2YKP A;  5CCH A;  3U1C A;  3V2N A;  1L4A A;  5KJ7 A;  3RK3 C;  2L5G B;  2IPP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...