3L70G

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l70G00
2FYUG 1NTMG 3BCCG 1BE3G 1SQXG 3L75G 1EZVG 3H1HG 5KLVG 3H1KG 3L72G 1SQBG 1L0LG 4D6TG 3L73G 1NU1G 4U3FG 1SQPG 1BCCG 3L74G 1NTKG 2BCCG 4PD4H 3L70G 2IBZG 1KYOH 1BGYG 3CWBG 1P84H 3H1JG 1KB9H 3CXHH 1NTZG 1PPJG 3L71G 3CX5H 2A06G 1L0NG 3H1IG 1SQQG 1PP9G 3TGUG 3H1LG 1SQVG
chains in the Genus database with same CATH superfamily
3VYIA 3TYYA 1HJBA 1NTMG 2WQYC 3A5TA 2WSEH 4NPEA 5AW1B 1NTZJ 2W83C 1LTJA 1LTSC 2H88C 2QJYB 1SQBG 1GK6A 3SFDC 2Z4EA 1H88A 2BEQD 4C7NA 1QL1A 4PV1D 3I55P 3S1KA 4GDOA 5TISH 1FDMA 1ZW0A 1FDOA 2KK7A 1LTIC 2B9BA 2XNDH 5AVWB 5BU8B 2OYHB 1LTBC 1VF5D 3CL3D 1VQMP 4I7ZC 4R4LA 2A45H 3HD7D 3L70G 1HUCA 3G3ZA 1NTKK 5CHXA 3S4RA 2OYHA 1PV3A 3U1CA 2FYZA 4IFDK 2W6BA 3M91A 1QX8A 3TNUB 1T2KC 2ZXEB 3CX5D 1J1DC 2KNCA 3CX5I 3QH9A 4JYBA 1HJ0A 1LTGC 2I1JA 5AW0B 1DIPA 1BSHA 5B66H 4C46A 4CPGA 2IX7C 3L70E 1L4AC 1JTHA 4GT1A 1NGMB 1K9MQ 2NPSC 5E79H 2IBZI 1LWUA 2L91A 3PRJA 3A0HE 1J1DB 1NU1J 3HE5A 4HH2A 4WY4D 1QVFO 4N6JA 2QEXP 3P8CE 1DEBA 1JNMA 4H44D 1NTKJ 3A0HH 3VP8A 2LXCB 2JWDA 1FAVA 1FZBA 2Y0EA 5CCGC 4AQRD 1L4AB 4BRYB 4ZNCA 1FZCA 2CPBA 2E76B 2N9BA 3SWYA 1WRGA 1OVRA 1X0TA 3Q5PA 2H43A 3QWOC 3CWBG 1LT9A 1Q7YQ 3EQ2A 4R4MA 4D6TG 3PHLA 3CD6P 4WY4A 1H0TA 3L71D 1ZV8A 1N7SB 3AE5C 4IOIH 2WPVB 5AVYB 3VN0A 4BXLA 4MN4C 1PPJE 3I5CA 1EDJA 3A2AA 3FX0A 4EI2A 1BGYE 4L73A 3CCVP 1KD1Q 4L75A 3UIAA 3MUDC 1FJKA 1OWAA 3B5NB 3CWBE 5AW3B 2FY8A 4ZMDA 1T6AA 1EDIA 1JY2N 1SFCD 4YXDC 1BE3D 3TGUE 1NU1G 2P67A 1PP9E 4RKUJ 1ZRTD 1LP1B 1GW4A 3V2PA 4UB8E 3AEDC 3L74J 3CCSP 1KQGB 1MV8A 2ZVNB 2FFDC 1IK9A 2WMMA 2IBZD 5AW4B 5KAIH 2POHA 1KZUB 2QG4A 3GG2A 3H1HE 1KFMA 3KDPB 3P7KA 3WUVA 1AJYA 1JEKA 4TT3H 5CBNA 2Q1KA 2E76D 1NTKE 4Z1MH 4KHXA 1R8EA 5KLIB 1BCCE 1HVVA 1L0NG 2GM4A 1S9KE 1S3JA 1PP9G 1VL2A 2H89C 2FXOA 1PGQA 3KPEA 1OVUA 1OIPA 3PTZA 4GIFA 3W67A 3GHGB 2FKWB 1GTWA 3CC4P 1L0NK 1SFCC 1FZFA 1EZVE 3HD7C 3MTUE 1IC2A 1OVVA 1RY3A 5APSA 1VF5C 4AYCA 3B8EB 2OYHC 1LTTC 1X79B 3CXHI 1SQVD 4O9BA 3CPWO 1VQ9P 1ZRTE 2OARA 4H13D 2N1TC 1DD3A 5CBOA 1JO5A 3Q5RA 2QJPC 2WTYA 1QVGO 4K3AA 1M1JB 2PGDA 2WT7A 3D71A 2ITAA 4U3FE 5CCHD 5CCHC 1NTZK 2YMKA 3HD7B 3FXDA 3B71A 1SQQK 3ITKA 4D6TE 3AEBC 2Y9ZA 1ZOYC 2D2CB 3LIDA 2QJKB 3II6A 1CZQA 1MKMA 2E5YA 2KXPB 3L74D 4H13B 1JCDA 1L0LJ 2Q3EA 1UIXA 3AE8C 3BRTB 3L70D 4JYCA 3RBXA 1IFNA 5APUA 3H1IJ 1KILA 1KILD 1CW5A 2NPSB 1SQPE 2PFXA 1M1JA 2QJYC 3EFGA 4XFJA 2KS1B 2QIWA 1ZXGA 2FYNB 3GF7A 2A06E 3IAOA 2RMZA 1AVYA 1MFTA 2D2CC 4DZOA 5B5EE 1NTZE 2WZ7A 5AVZB 2A45I 1N73C 1FC2C 2Q3IA 1LWUB 3GMAA 3L75E 3MD0A 1BE3G 2R44A 2WSFH 1KQFB 1NU1D 4I7ZB 4BWNA 5APTA 2RKLA 4C7RA 1IFIA 5APQA 2QSIA 3H1JJ 2E75C 1GK4A 1EQ7A 2H8PD 2KZIA 3V5BA 3JCUH 1RE3C 2BASA 3KHUA 2V4HA 5APYA 1VQPP 3CMAP 5KKZB 2KB7P 3F89A 3OW2O 1N7SC 1FJPA 2IYPA 3OA7A 4YXWH 5AVQB 1K05A 4U3FD 1YBKA 1FU1A 4H44C 4JF7A 2CPSA 1FZEA 1OW6A 3PJSK 2ZT9C 2A06D 2K1AA 4HJGH 2H7HA 2RN0A 2YIUC 1HTLC 2Q7CA 2IFMA 3IR9A 5KKZC 1M90Q 1H0TB 4XE5B 1WMKA 1T8ZA 1KTMA 1LP1A 1HWTC 2KIKA 3AE7C 2J59M 4HKZH 2O3JA 1S5LX 1OXZA 3CC7P 3N4XA 1YIJP 5GTIE 5CJ4A 2E76C 2R5DA 3GF3A 4IFFA 3H1HG 2FXPA 1AQTA 2AEFA 5CCGA 1U7JA 3H1KD 4UB8H 1U7MA 3CCRP 1FZGA 3L75D 3O8ZA 4GKGA 1SQVJ 1NU1E 3TNUA 3HE5B 2HLOA 2OTKE 5APVA 3T97A 2WPSA 1GL2B 1RE3A 2AEJA 1Q81Q 2R3SA 2B89A 5C39A 3MIWA 1KFNA 4IL6E 1FDIA 3JCUE 3SWFA 2PAJA 1BGYG 3LIEA 1AFOA 4B86A 1QEXA 2FYUE 1N86A 3B5NC 4NPFX 4LGDE 5E79E 3PH0A 1CI6A 1NKZB 4YPCA 5CCHA 1VQ4P 2QJPB 3BRVB 1KYOE 3A7OA 3H1LG 3WUUA 2ZYDA 1JCCA 2FBWC 1H8AA 2LXBA 3NFQA 1GW3A 5AW8B 1SS1A 3Q1MA 3Q2YA 3VMYA 1JMMA 3G71P 3M9BA 5AVTB 1L0LG 2WSSH 1QGKB 5TISE 1PP9J 2I1KA 1FZCC 3M0AA 2JJLA 2M5AA 5CMZA 2HYNA 5AW2B 3D6ZA 1NWQA 3SFEC 4EDFA 4WY4B 3H32B 4U3FG 1LJ2A 1PGJA 1PIXA 1SQPG 5KLIC 3RK3E 1YQ4C 1S72P 2Y9YA 2JDIH 2YO2A 3L72E 1YQ3C 4H0LB 4JQ0D 3VOPA 2K9YA 3CCQP 3E1RA 1BCCD 3AEEC 3L35A 3RK3B 4DOJA 2NPSD 2YNYA 3LW5J 1L2PA 3AE2C 3P8CD 1FS0E 1GMJA 1RF0C 1VQNP 2JWAA 2E75B 2WWWA 4DJGA 1YITP 1PGPA 2OTLP 3U1AA 4IL6H 1YTZT 2BEZF 3H32A 5APWA 2NRGA 1IO4A 1RF1A 2E74B 3L4FA 5KAFE 1PGOA 2WSEJ 2Y0DA 3RK3D 4ZKUA 3TK1A 1QL2A 3C1LA 1JB0J 3L75G 4W80A 4ASVA 2WPQA 5KLVG 3CMEP 3L72G 4JBZA 2KOGA 1HGVA 3KQGA 3VTPC 1SQQJ 1E79H 2HFED 1K8AQ 2O1KA 2YIUB 2QA4P 2GA1A 2C9NY 2N9YB 1KV4A 1BGYD 4K35A 2V7QJ 4I2LC 4Y99B 2KZJA 5AW9B 1SQBE 2O1JA 1LTJC 1PPJD 1UIIA 1FOSF 1J1EC 2IFNA 2R3CA 2LR2A 3HRNA 4UB6E 5AVRB 3W68A 3AE1C 1URQD 3R2PA 5KTBA 3C8VA 3H1LE 1MZ9A 2A45G 2MKVA 2ZXXA 2FYUK 2P1JA 4C7NB 3M0DC 3TGUG 1NTMK 3C9IA 4OGQD 5GTIH 2V7QH 1LTJB 1YHQP 1RE4C 2FYUG 2N1TD 3CI9A 1M56D 1SQPK 3CLQA 4GODA 2O01N 2QVAA 5KJ7D 4N78D 2E74D 2HPCB 1KILE 1GD2E 1BE3J 2J58A 1HH0A 1X8YA 2KNCB 2M0BA 2P2UA 1JOCA 3CWBJ 2ZT9B 2OYIC 1GDTA 1FBMA 1K04A 1OW7A 2PP6A 4PV1C 2E42A 2OYIA 1BCCG 3U59A 1NTKG 1URQC 1SQXK 2BCCG 3HUSC 1BDDA 3MGNA 3OAKA 2NPSA 3E1IA 3AE6C 3VMAA 5M1BA 1DX7A 1ZR2A 3AEFC 1PFIA 3NMDA 1M57D 2G8YA 3JSVC 4N78E 3L71G 1NO4A 1SQVE 1L0NJ 1XTGB 3WU2E 1VQLP 2M5AB 2M8RA 1HBWA 2WVRA 1URQB 4U7JA 1NJIQ 3V4QA 3HE4B 1SP4A 1P84E 1KYOI 2IDBA 2PRRA 2G3AA 3H1LD 3L73J 3OJAB 1NTMJ 2RH0A 3H1KE 5KLVE 4GOEA 1S9KD 2FYUJ 1L4AD 2KLUA 2K88A 1J2JB 2W90A 3AECC 3L71J 4H0LC 1EZVG 3TDKA 1RE4A 1GU5A 2BCCE 1KORA 3RL0g 1ZMEC 1KB9D 3AE3C 1CI6B 1SQBD 5AVVB 3H1HD 1IJDB 3EWKA 2YXRB 5AVSB 3I56P 1N7SD 1S5LH 1JM0A 1BCCJ 2C0XA 2WITA 3BVHA 1JTHB 3M9HA 2C0WA 5BU5A 1RQUA 3NXSA 1IFDA 5DJTB 1SQBJ 3A0BH 3CCEP 1VF5B 1G1JA 1KB9H 3RBZA 1NTZG 3FXEA 2B87A 3K5BA 1N2DC 2XZRA 3L74E 1GL2A 1GL2D 1KB9E 1SQQG 3RK2C 1SQBK 1M1JC 1SQQE 3BCCD 1RQVA 3H6PA 1EZVI 2HR3A 1CSBA 3IF4A 3FWNA 3JC22 3O6QA 3WUTA 4Y28J 1M1KQ 2WSCJ 3CXHE 3CC2P 2P10A 2Y0CA 4GOFA 1S5LE 1R5LA 1SQXG 2AEMA 4LLHA 1VQ5P 2JP3A 5AW5B 4PD4I 5KLVD 3L72D 3AEAC 1EDKA 3MHVA 2Q5UA 3GHGA 1OX3A 3H1IE 3M0DA 1N73A 2YMYA 4KJMA 3SSUA 3HTKB 2FXMA 3BASA 3CCMP 3Q5SA 1NU1K 2WSCH 3B5NA 3TSIA 1E5WA 1SQPD 2E74C 4PD4H 3AEGC 2NZ2A 1VPCA 3CXHD 3RL0D 3H25A 1N73B 2OTJP 1D7MA 2W27A 5CJ0A 3BATA 3CWBD 3L75J 3O6QB 3CCUP 2XKMA 3FWLA 1VQKP 5B5EH 2Q9IA 1OFCX 3M9QA 2QM7A 1GZLA 1IFJA 1L0NE 4TLFA 2O01J 2Z5IA 1FE6A 5APXA 1M7LA 3NTNA 3WU2H 3S9OA 3L71E 3CCJP 3BCCJ 2OQQA 2BCCJ 2IYOA 3HUSB 4RJTA 1W2BO 2XU6A 4OVNF 4EIJA 1OMIA 2KS1A 2WSFJ 1IFPA 1N7LA 1Y47A 3A0BE 2B88A 2AXTE 1KILB 3L73G 1G2CB 2M3BA 1RHZB 2AXCA 4U3FJ 1BSNA 1XTCC 1S2EA 1RF0A 2ZAEB 3L37A 1NTKD 1LT9C 2R5BA 4N3YB 4PJ0H 2JEEA 2CK3H 2IBZG 3USSA 2JKVA 5KAFH 1R5SA 3HD7A 1SQQD 3BCCE 3PLNA 1FZAA 1LNQA 2QE7H 1NH4A 1NVOA 1PPJG 2HODA 3CXHH 3L70J 3FGAD 4XA4A 3VMXA 1Q86Q 1RF1C 1NAFA 3H1JD 5GTHE 2IZ1A 1EXIA 2QJKC 4KT0J 2KSEA 1NTMD 1M8OB 1Q90D 1Y9BA 1DD4A 1HGZA 2XV5A 4PV1B 4PD4D 5DJUB 1NOHA 3G9RA 2I8DA 3AE9C 3IFMA 1BE3E 1Y8AA 3TGUD 1X9VA 5TJHA 3F5HA 5BVZA 1Q82Q 2R32A 1A02J 1KMIZ 1S1CX 3H1KG 1EXJA 3HUSA 1EZVD 1S4XA 1JY3O 1DH3A 3CCLP 1KQLA 1OW8A 1TU3F 5H2FE 3TGUJ 3RK2B 3KXDA 1Q2NA 1BDCA 4HYTB 1P84D 5AVUB 2B87B 5H2FH 1WT6A 3V6IA 1YJNP 4ZKPA 3R4YA 3H1HJ 2K37A 5AW7B 4A7PA 4JPZB 5B66E 4AUWA 3H1ID 1ZP0C 1NTZD 2QM8A 4OH8B 3PP5A 1H89A 3RK2D 1ZLLA 2HODB 3P32A 4PJ0E 2KI7B 4BRYA 1FZCB 1KB9I 1USEA 2VRSA 4WY4C 3B5ND 1T3JA 4HB1A 3A3YB 1X22A 4H13C 2E43A 3MP7B 4EOTA 3G4SP 3MUDA 5EFWB 2L5GB 3L72J 1G1IA 2KP8A 2KUBA 1JY2O 1JY2P 1P84I 5GTHH 3RL0C 3RK3C 5KLVJ 5CCGD 3G6EP 1JMBA 1URQA 1KN7A 5AVXB 4D6TD 2FYNC 1HF9A 3HE4A 4QMAA 2JO1A 1JUNA 1T3UA 1USDA 1LWUC 1U57A 2KSJA 2YO3A 4LC1A 1L0LE 1LGHB 2WPRA 4IL6X 2C9LY 5L8RJ 3WMM0 1N8RQ 1YI2P 3P8MC 3H1JE 2ZYGA 1EDLA 4EYYQ 1KYOH 2AXTH 3H1JG 1P84H 4D6TJ 1NTME 3H1KJ 2FFDA 1NKNA 2M3EA 2YKPA 2A06G 4ASWA 1VQ7P 2YKOA 2YKQA 2K3RA 4W7ZA 3B4SA 1RH5B 1KQSO 1AQ5A 1YJ9P 2KYVA 1LTAC 1SQPJ 1BGYJ 3KYQA 3SWKA 1MUUA 1YYCA 1AVOA 3GW6A 3VMZA 1JY3P 2OGUA 1NYHA 1OZHA 3BCCG 3IN6A 4Y99C 4H0LD 2IBZE 4OWFA 4WWIA 1W2EA 2SPZA 1DEEG 4NPDA 3HTKA 1KC8Q 1J1EB 2IZ0A 3ABVC 4RO0A 2JR8A 3VP9A 2K9JA 1AV1A 5KJ7C 3D70A 1JY3N 1SQXD 2W6JH 1N7SA 1T2KD 4W7YA 1VDFA 1AA0A 2MJZA 2K9JB 2ZVOB 3H1LJ 1SVFA 2YXQB 2W6AA 4PD4E 3Q3DA 3E7KA 1YJWP 4WBAA 2UWJE 3GLMA 4RESB 1A02F 4H44B 4DCKA 3D6YA 2LKMA 2XNXA 2Z5HA 2HPCA 1L4AA 1L0ND 3V4WA 2GUVA 1PL5A 3V2RA 1VQ8P 1KYOD 2E5TA 1NAYA 2XDJA 4I6MC 1VQOP 2P58A 2ZFCA 2QRXA 3V2NA 3KZIE 1NHLA 2P7JA 4L74A 3ZDMA 1GL2C 1K73Q 3L73E 2OYIB 2Q6QA 3T97B 3V2QA 2FYUD 1IZNB 1KILC 1SQVG 2KLVA 3KZIH 3LW5H 2GUSA 3L36A 3M06A 5AW6B 1MFZA 5KLVK 2ZJSE 3CX5E 4I1LA 1SQXE 1W5CE 3AE4C 1SQVK 4DT0A 1IK7A 1SLQA 1LT9B 2D2CD 2ZT9D 4IFMA 1G2CA 1GU4A 1ZN5A 2FFDB 1SFCA 1LT1A 1L0LD 3N7NA 2ZYAA 3GHGC 5KAIE 1RF1B 1Z56A 1SFCB 2BCCD 3L74G 5KJ7A 2IPPA 4WVZA 2N1TA 3L73D 1YTZI 1ZR4A 4OGQB 1PZQA 3EFFK 2WT7B 2OYOA 2O01H 1EC5A 2N1TB 1FOSE 4YTPC 2W8ZA 1SQXJ 2DW3A 1IFMA 3CX5H 1PP9D 3RL0B 4M3LA 3RGUA 1VQ6P 3H1IG 5K5GB 1L0LK 3TF5A 4WB4A 3MZWB 4L76A 4OGQC 4UB6H 2J5UA 2E75D 2HG5D 1QLED
chains in the Genus database with same CATH topology
2FYUG 1NTMG 3BCCG 1BE3G 1SQXG 3L75G 1EZVG 3H1HG 5KLVG 3H1KG 3L72G 1SQBG 1L0LG 4D6TG 3L73G 1NU1G 4U3FG 1SQPG 1BCCG 3L74G 1NTKG 2BCCG 4PD4H 3L70G 2IBZG 1KYOH 1BGYG 3CWBG 1P84H 3H1JG 1KB9H 3CXHH 1NTZG 1PPJG 3L71G 3CX5H 2A06G 1L0NG 3H1IG 1SQQG 1PP9G 3TGUG 3H1LG 1SQVG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  1NTM G;  3BCC G;  1BE3 G;  1SQX G;  3L75 G;  1EZV G;  3H1H G;  5KLV G;  3H1K G;  3L72 G;  1SQB G;  1L0L G;  4D6T G;  3L73 G;  1NU1 G;  4U3F G;  1SQP G;  1BCC G;  3L74 G;  1NTK G;  2BCC G;  4PD4 H;  3L70 G;  2IBZ G;  1KYO H;  1BGY G;  3CWB G;  1P84 H;  3H1J G;  1KB9 H;  3CXH H;  1NTZ G;  1PPJ G;  3L71 G;  3CX5 H;  2A06 G;  1L0N G;  3H1I G;  1SQQ G;  1PP9 G;  3TGU G;  3H1L G;  1SQV G; 
#chains in the Genus database with same CATH topology
 3VYI A;  3TYY A;  1HJB A;  1NTM G;  2WQY C;  3A5T A;  2WSE H;  4NPE A;  5AW1 B;  1NTZ J;  2W83 C;  1LTJ A;  1LTS C;  2H88 C;  2QJY B;  1SQB G;  1GK6 A;  3SFD C;  2Z4E A;  1H88 A;  2BEQ D;  4C7N A;  1QL1 A;  4PV1 D;  3I55 P;  3S1K A;  4GDO A;  5TIS H;  1FDM A;  1ZW0 A;  1FDO A;  2KK7 A;  1LTI C;  2B9B A;  2XND H;  5AVW B;  5BU8 B;  2OYH B;  1LTB C;  1VF5 D;  3CL3 D;  1VQM P;  4I7Z C;  4R4L A;  2A45 H;  3HD7 D;  3L70 G;  1HUC A;  3G3Z A;  1NTK K;  5CHX A;  3S4R A;  2OYH A;  1PV3 A;  3U1C A;  2FYZ A;  4IFD K;  2W6B A;  3M91 A;  1QX8 A;  3TNU B;  1T2K C;  2ZXE B;  3CX5 D;  1J1D C;  2KNC A;  3CX5 I;  3QH9 A;  4JYB A;  1HJ0 A;  1LTG C;  2I1J A;  5AW0 B;  1DIP A;  1BSH A;  5B66 H;  4C46 A;  4CPG A;  2IX7 C;  3L70 E;  1L4A C;  1JTH A;  4GT1 A;  1NGM B;  1K9M Q;  2NPS C;  5E79 H;  2IBZ I;  1LWU A;  2L91 A;  3PRJ A;  3A0H E;  1J1D B;  1NU1 J;  3HE5 A;  4HH2 A;  4WY4 D;  1QVF O;  4N6J A;  2QEX P;  3P8C E;  1DEB A;  1JNM A;  4H44 D;  1NTK J;  3A0H H;  3VP8 A;  2LXC B;  2JWD A;  1FAV A;  1FZB A;  2Y0E A;  5CCG C;  4AQR D;  1L4A B;  4BRY B;  4ZNC A;  1FZC A;  2CPB A;  2E76 B;  2N9B A;  3SWY A;  1WRG A;  1OVR A;  1X0T A;  3Q5P A;  2H43 A;  3QWO C;  3CWB G;  1LT9 A;  1Q7Y Q;  3EQ2 A;  4R4M A;  4D6T G;  3PHL A;  3CD6 P;  4WY4 A;  1H0T A;  3L71 D;  1ZV8 A;  1N7S B;  3AE5 C;  4IOI H;  2WPV B;  5AVY B;  3VN0 A;  4BXL A;  4MN4 C;  1PPJ E;  3I5C A;  1EDJ A;  3A2A A;  3FX0 A;  4EI2 A;  1BGY E;  4L73 A;  3CCV P;  1KD1 Q;  4L75 A;  3UIA A;  3MUD C;  1FJK A;  1OWA A;  3B5N B;  3CWB E;  5AW3 B;  2FY8 A;  4ZMD A;  1T6A A;  1EDI A;  1JY2 N;  1SFC D;  4YXD C;  1BE3 D;  3TGU E;  1NU1 G;  2P67 A;  1PP9 E;  4RKU J;  1ZRT D;  1LP1 B;  1GW4 A;  3V2P A;  4UB8 E;  3AED C;  3L74 J;  3CCS P;  1KQG B;  1MV8 A;  2ZVN B;  2FFD C;  1IK9 A;  2WMM A;  2IBZ D;  5AW4 B;  5KAI H;  2POH A;  1KZU B;  2QG4 A;  3GG2 A;  3H1H E;  1KFM A;  3KDP B;  3P7K A;  3WUV A;  1AJY A;  1JEK A;  4TT3 H;  5CBN A;  2Q1K A;  2E76 D;  1NTK E;  4Z1M H;  4KHX A;  1R8E A;  5KLI B;  1BCC E;  1HVV A;  1L0N G;  2GM4 A;  1S9K E;  1S3J A;  1PP9 G;  1VL2 A;  2H89 C;  2FXO A;  1PGQ A;  3KPE A;  1OVU A;  1OIP A;  3PTZ A;  4GIF A;  3W67 A;  3GHG B;  2FKW B;  1GTW A;  3CC4 P;  1L0N K;  1SFC C;  1FZF A;  1EZV E;  3HD7 C;  3MTU E;  1IC2 A;  1OVV A;  1RY3 A;  5APS A;  1VF5 C;  4AYC A;  3B8E B;  2OYH C;  1LTT C;  1X79 B;  3CXH I;  1SQV D;  4O9B A;  3CPW O;  1VQ9 P;  1ZRT E;  2OAR A;  4H13 D;  2N1T C;  1DD3 A;  5CBO A;  1JO5 A;  3Q5R A;  2QJP C;  2WTY A;  1QVG O;  4K3A A;  1M1J B;  2PGD A;  2WT7 A;  3D71 A;  2ITA A;  4U3F E;  5CCH D;  5CCH C;  1NTZ K;  2YMK A;  3HD7 B;  3FXD A;  3B71 A;  1SQQ K;  3ITK A;  4D6T E;  3AEB C;  2Y9Z A;  1ZOY C;  2D2C B;  3LID A;  2QJK B;  3II6 A;  1CZQ A;  1MKM A;  2E5Y A;  2KXP B;  3L74 D;  4H13 B;  1JCD A;  1L0L J;  2Q3E A;  1UIX A;  3AE8 C;  3BRT B;  3L70 D;  4JYC A;  3RBX A;  1IFN A;  5APU A;  3H1I J;  1KIL A;  1KIL D;  1CW5 A;  2NPS B;  1SQP E;  2PFX A;  1M1J A;  2QJY C;  3EFG A;  4XFJ A;  2KS1 B;  2QIW A;  1ZXG A;  2FYN B;  3GF7 A;  2A06 E;  3IAO A;  2RMZ A;  1AVY A;  1MFT A;  2D2C C;  4DZO A;  5B5E E;  1NTZ E;  2WZ7 A;  5AVZ B;  2A45 I;  1N73 C;  1FC2 C;  2Q3I A;  1LWU B;  3GMA A;  3L75 E;  3MD0 A;  1BE3 G;  2R44 A;  2WSF H;  1KQF B;  1NU1 D;  4I7Z B;  4BWN A;  5APT A;  2RKL A;  4C7R A;  1IFI A;  5APQ A;  2QSI A;  3H1J J;  2E75 C;  1GK4 A;  1EQ7 A;  2H8P D;  2KZI A;  3V5B A;  3JCU H;  1RE3 C;  2BAS A;  3KHU A;  2V4H A;  5APY A;  1VQP P;  3CMA P;  5KKZ B;  2KB7 P;  3F89 A;  3OW2 O;  1N7S C;  1FJP A;  2IYP A;  3OA7 A;  4YXW H;  5AVQ B;  1K05 A;  4U3F D;  1YBK A;  1FU1 A;  4H44 C;  4JF7 A;  2CPS A;  1FZE A;  1OW6 A;  3PJS K;  2ZT9 C;  2A06 D;  2K1A A;  4HJG H;  2H7H A;  2RN0 A;  2YIU C;  1HTL C;  2Q7C A;  2IFM A;  3IR9 A;  5KKZ C;  1M90 Q;  1H0T B;  4XE5 B;  1WMK A;  1T8Z A;  1KTM A;  1LP1 A;  1HWT C;  2KIK A;  3AE7 C;  2J59 M;  4HKZ H;  2O3J A;  1S5L X;  1OXZ A;  3CC7 P;  3N4X A;  1YIJ P;  5GTI E;  5CJ4 A;  2E76 C;  2R5D A;  3GF3 A;  4IFF A;  3H1H G;  2FXP A;  1AQT A;  2AEF A;  5CCG A;  1U7J A;  3H1K D;  4UB8 H;  1U7M A;  3CCR P;  1FZG A;  3L75 D;  3O8Z A;  4GKG A;  1SQV J;  1NU1 E;  3TNU A;  3HE5 B;  2HLO A;  2OTK E;  5APV A;  3T97 A;  2WPS A;  1GL2 B;  1RE3 A;  2AEJ A;  1Q81 Q;  2R3S A;  2B89 A;  5C39 A;  3MIW A;  1KFN A;  4IL6 E;  1FDI A;  3JCU E;  3SWF A;  2PAJ A;  1BGY G;  3LIE A;  1AFO A;  4B86 A;  1QEX A;  2FYU E;  1N86 A;  3B5N C;  4NPF X;  4LGD E;  5E79 E;  3PH0 A;  1CI6 A;  1NKZ B;  4YPC A;  5CCH A;  1VQ4 P;  2QJP B;  3BRV B;  1KYO E;  3A7O A;  3H1L G;  3WUU A;  2ZYD A;  1JCC A;  2FBW C;  1H8A A;  2LXB A;  3NFQ A;  1GW3 A;  5AW8 B;  1SS1 A;  3Q1M A;  3Q2Y A;  3VMY A;  1JMM A;  3G71 P;  3M9B A;  5AVT B;  1L0L G;  2WSS H;  1QGK B;  5TIS E;  1PP9 J;  2I1K A;  1FZC C;  3M0A A;  2JJL A;  2M5A A;  5CMZ A;  2HYN A;  5AW2 B;  3D6Z A;  1NWQ A;  3SFE C;  4EDF A;  4WY4 B;  3H32 B;  4U3F G;  1LJ2 A;  1PGJ A;  1PIX A;  1SQP G;  5KLI C;  3RK3 E;  1YQ4 C;  1S72 P;  2Y9Y A;  2JDI H;  2YO2 A;  3L72 E;  1YQ3 C;  4H0L B;  4JQ0 D;  3VOP A;  2K9Y A;  3CCQ P;  3E1R A;  1BCC D;  3AEE C;  3L35 A;  3RK3 B;  4DOJ A;  2NPS D;  2YNY A;  3LW5 J;  1L2P A;  3AE2 C;  3P8C D;  1FS0 E;  1GMJ A;  1RF0 C;  1VQN P;  2JWA A;  2E75 B;  2WWW A;  4DJG A;  1YIT P;  1PGP A;  2OTL P;  3U1A A;  4IL6 H;  1YTZ T;  2BEZ F;  3H32 A;  5APW A;  2NRG A;  1IO4 A;  1RF1 A;  2E74 B;  3L4F A;  5KAF E;  1PGO A;  2WSE J;  2Y0D A;  3RK3 D;  4ZKU A;  3TK1 A;  1QL2 A;  3C1L A;  1JB0 J;  3L75 G;  4W80 A;  4ASV A;  2WPQ A;  5KLV G;  3CME P;  3L72 G;  4JBZ A;  2KOG A;  1HGV A;  3KQG A;  3VTP C;  1SQQ J;  1E79 H;  2HFE D;  1K8A Q;  2O1K A;  2YIU B;  2QA4 P;  2GA1 A;  2C9N Y;  2N9Y B;  1KV4 A;  1BGY D;  4K35 A;  2V7Q J;  4I2L C;  4Y99 B;  2KZJ A;  5AW9 B;  1SQB E;  2O1J A;  1LTJ C;  1PPJ D;  1UII A;  1FOS F;  1J1E C;  2IFN A;  2R3C A;  2LR2 A;  3HRN A;  4UB6 E;  5AVR B;  3W68 A;  3AE1 C;  1URQ D;  3R2P A;  5KTB A;  3C8V A;  3H1L E;  1MZ9 A;  2A45 G;  2MKV A;  2ZXX A;  2FYU K;  2P1J A;  4C7N B;  3M0D C;  3TGU G;  1NTM K;  3C9I A;  4OGQ D;  5GTI H;  2V7Q H;  1LTJ B;  1YHQ P;  1RE4 C;  2FYU G;  2N1T D;  3CI9 A;  1M56 D;  1SQP K;  3CLQ A;  4GOD A;  2O01 N;  2QVA A;  5KJ7 D;  4N78 D;  2E74 D;  2HPC B;  1KIL E;  1GD2 E;  1BE3 J;  2J58 A;  1HH0 A;  1X8Y A;  2KNC B;  2M0B A;  2P2U A;  1JOC A;  3CWB J;  2ZT9 B;  2OYI C;  1GDT A;  1FBM A;  1K04 A;  1OW7 A;  2PP6 A;  4PV1 C;  2E42 A;  2OYI A;  1BCC G;  3U59 A;  1NTK G;  1URQ C;  1SQX K;  2BCC G;  3HUS C;  1BDD A;  3MGN A;  3OAK A;  2NPS A;  3E1I A;  3AE6 C;  3VMA A;  5M1B A;  1DX7 A;  1ZR2 A;  3AEF C;  1PFI A;  3NMD A;  1M57 D;  2G8Y A;  3JSV C;  4N78 E;  3L71 G;  1NO4 A;  1SQV E;  1L0N J;  1XTG B;  3WU2 E;  1VQL P;  2M5A B;  2M8R A;  1HBW A;  2WVR A;  1URQ B;  4U7J A;  1NJI Q;  3V4Q A;  3HE4 B;  1SP4 A;  1P84 E;  1KYO I;  2IDB A;  2PRR A;  2G3A A;  3H1L D;  3L73 J;  3OJA B;  1NTM J;  2RH0 A;  3H1K E;  5KLV E;  4GOE A;  1S9K D;  2FYU J;  1L4A D;  2KLU A;  2K88 A;  1J2J B;  2W90 A;  3AEC C;  3L71 J;  4H0L C;  1EZV G;  3TDK A;  1RE4 A;  1GU5 A;  2BCC E;  1KOR A;  3RL0 g;  1ZME C;  1KB9 D;  3AE3 C;  1CI6 B;  1SQB D;  5AVV B;  3H1H D;  1IJD B;  3EWK A;  2YXR B;  5AVS B;  3I56 P;  1N7S D;  1S5L H;  1JM0 A;  1BCC J;  2C0X A;  2WIT A;  3BVH A;  1JTH B;  3M9H A;  2C0W A;  5BU5 A;  1RQU A;  3NXS A;  1IFD A;  5DJT B;  1SQB J;  3A0B H;  3CCE P;  1VF5 B;  1G1J A;  1KB9 H;  3RBZ A;  1NTZ G;  3FXE A;  2B87 A;  3K5B A;  1N2D C;  2XZR A;  3L74 E;  1GL2 A;  1GL2 D;  1KB9 E;  1SQQ G;  3RK2 C;  1SQB K;  1M1J C;  1SQQ E;  3BCC D;  1RQV A;  3H6P A;  1EZV I;  2HR3 A;  1CSB A;  3IF4 A;  3FWN A;  3JC2 2;  3O6Q A;  3WUT A;  4Y28 J;  1M1K Q;  2WSC J;  3CXH E;  3CC2 P;  2P10 A;  2Y0C A;  4GOF A;  1S5L E;  1R5L A;  1SQX G;  2AEM A;  4LLH A;  1VQ5 P;  2JP3 A;  5AW5 B;  4PD4 I;  5KLV D;  3L72 D;  3AEA C;  1EDK A;  3MHV A;  2Q5U A;  3GHG A;  1OX3 A;  3H1I E;  3M0D A;  1N73 A;  2YMY A;  4KJM A;  3SSU A;  3HTK B;  2FXM A;  3BAS A;  3CCM P;  3Q5S A;  1NU1 K;  2WSC H;  3B5N A;  3TSI A;  1E5W A;  1SQP D;  2E74 C;  4PD4 H;  3AEG C;  2NZ2 A;  1VPC A;  3CXH D;  3RL0 D;  3H25 A;  1N73 B;  2OTJ P;  1D7M A;  2W27 A;  5CJ0 A;  3BAT A;  3CWB D;  3L75 J;  3O6Q B;  3CCU P;  2XKM A;  3FWL A;  1VQK P;  5B5E H;  2Q9I A;  1OFC X;  3M9Q A;  2QM7 A;  1GZL A;  1IFJ A;  1L0N E;  4TLF A;  2O01 J;  2Z5I A;  1FE6 A;  5APX A;  1M7L A;  3NTN A;  3WU2 H;  3S9O A;  3L71 E;  3CCJ P;  3BCC J;  2OQQ A;  2BCC J;  2IYO A;  3HUS B;  4RJT A;  1W2B O;  2XU6 A;  4OVN F;  4EIJ A;  1OMI A;  2KS1 A;  2WSF J;  1IFP A;  1N7L A;  1Y47 A;  3A0B E;  2B88 A;  2AXT E;  1KIL B;  3L73 G;  1G2C B;  2M3B A;  1RHZ B;  2AXC A;  4U3F J;  1BSN A;  1XTC C;  1S2E A;  1RF0 A;  2ZAE B;  3L37 A;  1NTK D;  1LT9 C;  2R5B A;  4N3Y B;  4PJ0 H;  2JEE A;  2CK3 H;  2IBZ G;  3USS A;  2JKV A;  5KAF H;  1R5S A;  3HD7 A;  1SQQ D;  3BCC E;  3PLN A;  1FZA A;  1LNQ A;  2QE7 H;  1NH4 A;  1NVO A;  1PPJ G;  2HOD A;  3CXH H;  3L70 J;  3FGA D;  4XA4 A;  3VMX A;  1Q86 Q;  1RF1 C;  1NAF A;  3H1J D;  5GTH E;  2IZ1 A;  1EXI A;  2QJK C;  4KT0 J;  2KSE A;  1NTM D;  1M8O B;  1Q90 D;  1Y9B A;  1DD4 A;  1HGZ A;  2XV5 A;  4PV1 B;  4PD4 D;  5DJU B;  1NOH A;  3G9R A;  2I8D A;  3AE9 C;  3IFM A;  1BE3 E;  1Y8A A;  3TGU D;  1X9V A;  5TJH A;  3F5H A;  5BVZ A;  1Q82 Q;  2R32 A;  1A02 J;  1KMI Z;  1S1C X;  3H1K G;  1EXJ A;  3HUS A;  1EZV D;  1S4X A;  1JY3 O;  1DH3 A;  3CCL P;  1KQL A;  1OW8 A;  1TU3 F;  5H2F E;  3TGU J;  3RK2 B;  3KXD A;  1Q2N A;  1BDC A;  4HYT B;  1P84 D;  5AVU B;  2B87 B;  5H2F H;  1WT6 A;  3V6I A;  1YJN P;  4ZKP A;  3R4Y A;  3H1H J;  2K37 A;  5AW7 B;  4A7P A;  4JPZ B;  5B66 E;  4AUW A;  3H1I D;  1ZP0 C;  1NTZ D;  2QM8 A;  4OH8 B;  3PP5 A;  1H89 A;  3RK2 D;  1ZLL A;  2HOD B;  3P32 A;  4PJ0 E;  2KI7 B;  4BRY A;  1FZC B;  1KB9 I;  1USE A;  2VRS A;  4WY4 C;  3B5N D;  1T3J A;  4HB1 A;  3A3Y B;  1X22 A;  4H13 C;  2E43 A;  3MP7 B;  4EOT A;  3G4S P;  3MUD A;  5EFW B;  2L5G B;  3L72 J;  1G1I A;  2KP8 A;  2KUB A;  1JY2 O;  1JY2 P;  1P84 I;  5GTH H;  3RL0 C;  3RK3 C;  5KLV J;  5CCG D;  3G6E P;  1JMB A;  1URQ A;  1KN7 A;  5AVX B;  4D6T D;  2FYN C;  1HF9 A;  3HE4 A;  4QMA A;  2JO1 A;  1JUN A;  1T3U A;  1USD A;  1LWU C;  1U57 A;  2KSJ A;  2YO3 A;  4LC1 A;  1L0L E;  1LGH B;  2WPR A;  4IL6 X;  2C9L Y;  5L8R J;  3WMM 0;  1N8R Q;  1YI2 P;  3P8M C;  3H1J E;  2ZYG A;  1EDL A;  4EYY Q;  1KYO H;  2AXT H;  3H1J G;  1P84 H;  4D6T J;  1NTM E;  3H1K J;  2FFD A;  1NKN A;  2M3E A;  2YKP A;  2A06 G;  4ASW A;  1VQ7 P;  2YKO A;  2YKQ A;  2K3R A;  4W7Z A;  3B4S A;  1RH5 B;  1KQS O;  1AQ5 A;  1YJ9 P;  2KYV A;  1LTA C;  1SQP J;  1BGY J;  3KYQ A;  3SWK A;  1MUU A;  1YYC A;  1AVO A;  3GW6 A;  3VMZ A;  1JY3 P;  2OGU A;  1NYH A;  1OZH A;  3BCC G;  3IN6 A;  4Y99 C;  4H0L D;  2IBZ E;  4OWF A;  4WWI A;  1W2E A;  2SPZ A;  1DEE G;  4NPD A;  3HTK A;  1KC8 Q;  1J1E B;  2IZ0 A;  3ABV C;  4RO0 A;  2JR8 A;  3VP9 A;  2K9J A;  1AV1 A;  5KJ7 C;  3D70 A;  1JY3 N;  1SQX D;  2W6J H;  1N7S A;  1T2K D;  4W7Y A;  1VDF A;  1AA0 A;  2MJZ A;  2K9J B;  2ZVO B;  3H1L J;  1SVF A;  2YXQ B;  2W6A A;  4PD4 E;  3Q3D A;  3E7K A;  1YJW P;  4WBA A;  2UWJ E;  3GLM A;  4RES B;  1A02 F;  4H44 B;  4DCK A;  3D6Y A;  2LKM A;  2XNX A;  2Z5H A;  2HPC A;  1L4A A;  1L0N D;  3V4W A;  2GUV A;  1PL5 A;  3V2R A;  1VQ8 P;  1KYO D;  2E5T A;  1NAY A;  2XDJ A;  4I6M C;  1VQO P;  2P58 A;  2ZFC A;  2QRX A;  3V2N A;  3KZI E;  1NHL A;  2P7J A;  4L74 A;  3ZDM A;  1GL2 C;  1K73 Q;  3L73 E;  2OYI B;  2Q6Q A;  3T97 B;  3V2Q A;  2FYU D;  1IZN B;  1KIL C;  1SQV G;  2KLV A;  3KZI H;  3LW5 H;  2GUS A;  3L36 A;  3M06 A;  5AW6 B;  1MFZ A;  5KLV K;  2ZJS E;  3CX5 E;  4I1L A;  1SQX E;  1W5C E;  3AE4 C;  1SQV K;  4DT0 A;  1IK7 A;  1SLQ A;  1LT9 B;  2D2C D;  2ZT9 D;  4IFM A;  1G2C A;  1GU4 A;  1ZN5 A;  2FFD B;  1SFC A;  1LT1 A;  1L0L D;  3N7N A;  2ZYA A;  3GHG C;  5KAI E;  1RF1 B;  1Z56 A;  1SFC B;  2BCC D;  3L74 G;  5KJ7 A;  2IPP A;  4WVZ A;  2N1T A;  3L73 D;  1YTZ I;  1ZR4 A;  4OGQ B;  1PZQ A;  3EFF K;  2WT7 B;  2OYO A;  2O01 H;  1EC5 A;  2N1T B;  1FOS E;  4YTP C;  2W8Z A;  1SQX J;  2DW3 A;  1IFM A;  3CX5 H;  1PP9 D;  3RL0 B;  4M3L A;  3RGU A;  1VQ6 P;  3H1I G;  5K5G B;  1L0L K;  3TF5 A;  4WB4 A;  3MZW B;  4L76 A;  4OGQ C;  4UB6 H;  2J5U A;  2E75 D;  2HG5 D;  1QLE D; 
#chains in the Genus database with same CATH homology
 2FYU G;  1NTM G;  3BCC G;  1BE3 G;  1SQX G;  3L75 G;  1EZV G;  3H1H G;  5KLV G;  3H1K G;  3L72 G;  1SQB G;  1L0L G;  4D6T G;  3L73 G;  1NU1 G;  4U3F G;  1SQP G;  1BCC G;  3L74 G;  1NTK G;  2BCC G;  4PD4 H;  3L70 G;  2IBZ G;  1KYO H;  1BGY G;  3CWB G;  1P84 H;  3H1J G;  1KB9 H;  3CXH H;  1NTZ G;  1PPJ G;  3L71 G;  3CX5 H;  2A06 G;  1L0N G;  3H1I G;  1SQQ G;  1PP9 G;  3TGU G;  3H1L G;  1SQV G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...