3L70G

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l70G00
4PD4H 1KYOH 1NTKG 3H1JG 1BE3G 5KLVG 1NTMG 1SQVG 3TGUG 3CX5H 1BCCG 3H1IG 1NU1G 3L74G 1L0LG 1KB9H 1BGYG 4D6TG 3H1KG 1PP9G 1P84H 3H1LG 3L71G 3L72G 2FYUG 3L73G 1EZVG 4U3FG 2BCCG 3CWBG 1NTZG 2A06G 1SQQG 3L70G 1L0NG 3BCCG 2IBZG 1SQXG 3H1HG 3L75G 3CXHH 1PPJG 1SQBG 1SQPG
chains in the Genus database with same CATH superfamily
2YMYA 3H1IJ 3L70D 5APXA 2FYUK 4PV1B 2N9YB 1H88A 3KHUA 1RF1A 1NTZK 3CCEP 3M91A 1FS0E 1N7SD 3L72D 1IFMA 1LTJB 2FXPA 2HG5D 2RH0A 3EWKA 3TGUG 3H1LJ 1SQPD 2OTKE 3V5BA 3PHLA 5AVQB 1P84H 3L72G 1JY2P 3I5CA 2XZRA 4IFMA 3FWNA 4RJTA 4L73A 5CJ4A 1W5CE 2WPQA 2WSFH 1JCCA 1L0NJ 1NTMJ 1N86A 2FBWC 4N78D 3SFDC 1YIJP 1M1KQ 1GW3A 3H1ID 2PP6A 1SQXG 2Q7CA 2I1KA 1SQVJ 2K9JA 3GHGB 1SQPE 2R3CA 1IK7A 2KXPB 1PV3A 3P8CD 3V2QA 1NTKK 4Z1MH 1VQ5P 1GZLA 1FZAA 1L0LK 2FYZA 1XTGB 3PRJA 4N3YB 2LKMA 1KYOE 2E74D 2OQQA 1SQBJ 1ZN5A 4GOEA 3W68A 4C7NA 1FZGA 2ZAEB 4PD4E 1IJDB 1SQQJ 3RK3B 3D71A 1IFJA 5KLIB 2R44A 3CCVP 2A45G 2FYUD 1JMBA 1KB9I 2BCCE 2ZVNB 3LIDA 3CC2P 2L5GB 1PP9J 3FX0A 3P8CE 3I55P 1T2KC 5APVA 3H1KG 2RMZA 4RO0A 1USDA 2WSEJ 4W80A 3AE5C 2OYIB 2E75C 2IYPA 3VOPA 1K9MQ 4JQ0D 1ZV8A 1RY3A 2K9YA 3WMM0 5CMZA 3PH0A 1GD2E 3MHVA 1OWAA 1Y9BA 1NU1D 1W2EA 2UWJE 2W27A 3C8VA 1KILA 3H1HG 3CCSP 4DOJA 5KTBA 3ABVC 2Z4EA 1KQLA 1U7MA 1FC2C 2Z5IA 1YQ4C 2QA4P 1JMMA 1PPJG 2ITAA 3OA7A 1Y47A 2IBZD 1VF5C 2KP8A 1LTJC 4H44B 4AQRD 1LWUB 5APUA 4ZKPA 1HH0A 3E1RA 3CI9A 2XKMA 2YXRB 1DEEG 3H6PA 4R4MA 1VDFA 1HGZA 1SQXJ 2Z5HA 1CI6A 1QX8A 5KLVG 1QVFO 4AYCA 1X79B 2ZVOB 3MIWA 1NAFA 2Y0CA 1N73A 4UB8E 3BVHA 1GL2C 1KTMA 5B66H 1PP9G 2Q9IA 3VYIA 3GMAA 1LTBC 2E76D 3Q2YA 1DEBA 1RHZB 1K73Q 1G2CA 2M8RA 4R4LA 4LGDE 1NYHA 5AVYB 1EQ7A 3KXDA 3BATA 1USEA 1IFPA 3HE4B 2JJLA 3V2NA 4U3FD 2FFDA 1PPJE 2WPSA 3H1IG 3TGUD 3N7NA 5KLIC 1GU4A 1S1CX 3PJSK 4PD4H 2QJKC 2GUSA 3RL0D 1N8RQ 2WPVB 3CCQP 2P10A 1YJNP 3C1LA 1RF1B 1OZHA 2QJYC 1FZCB 1VQ9P 1JY3O 3QWOC 1T2KD 2HYNA 3P8MC 2WSSH 4H44C 2KLUA 1LTGC 5KJ7A 1M90Q 2KOGA 2YKOA 3BASA 1LNQA 2B89A 2Y0EA 2P2UA 4D6TG 2FFDB 1KB9D 1LTAC 2FY8A 3H1LG 3KQGA 1YJWP 2LXCB 2FYUG 3CC4P 3TK1A 1R8EA 1X8YA 2LXBA 2XU6A 5CCGA 4K3AA 3CD6P 4KJMA 1J1EB 1OW8A 3R4YA 3HE5B 4Y28J 5AW9B 2M5AA 2ZJSE 3TSIA 1ZR2A 3G9RA 1YHQP 1JOCA 1AVYA 2WPRA 1VF5D 5BU5A 3CX5E 2YXQB 2AEFA 1OVUA 4H13D 2OYOA 1NTZD 1T8ZA 2B88A 2W8ZA 1KB9E 1FZEA 4D6TJ 1FZCA 2ZYDA 2YNYA 2E76B 1J1DC 1T3JA 1SQXE 4GKGA 2IYOA 1YBKA 2QRXA 1VQ8P 1W2BO 4JYBA 1BDDA 5CHXA 3VMAA 1JY2O 1YI2P 1EXIA 1N7SB 1NU1J 4NPEA 1EDIA 2YO3A 3CX5D 1R5SA 5M1BA 4I1LA 4YXWH 1BCCJ 3L72E 5APSA 3AE7C 5L8RJ 5APYA 3G6EP 3H1HD 5AW3B 5KAIE 2KZJA 2RKLA 2QM7A 1AVOA 3AE9C 3TYYA 3PP5A 4WY4B 1FOSE 1FOSF 2FYNB 2XDJA 3FXDA 1FBMA 1JY2N 3L70G 4EOTA 3Q1MA 1XTCC 1KQFB 1GDTA 2ZXXA 3M0DA 4OVNF 1NWQA 2OYHA 1EXJA 3V4WA 2JWAA 1MZ9A 3M0AA 1URQA 5C39A 3H1IE 4GODA 1LT9A 4DJGA 4NPFX 1EDKA 1X22A 4PV1C 2R5DA 1FZFA 1BGYJ 3CCLP 1NO4A 2KI7B 2GM4A 2YMKA 4L76A 1KN7A 1S5LE 4XE5B 5B5EH 4HB1A 1N7SA 1NTKG 3L71D 2E5TA 5AW4B 1OIPA 1KYOD 1HJ0A 3USSA 1IK9A 3W67A 2W90A 2ZYAA 2D2CD 1L4AA 4BRYA 1LTTC 2KNCB 1SQVG 1RE4A 1G1JA 1VQOP 2C9NY 3NFQA 1H0TA 4LC1A 3WUUA 5KAFH 2GA1A 3AEAC 3KYQA 1H8AA 3AE4C 2OARA 1SFCC 2V7QJ 2O01N 4WVZA 5B5EE 3TF5A 1OX3A 1KFMA 3KDPB 4HJGH 1KMIZ 2R5BA 3BRVB 1ZOYC 4Y99B 1BGYD 1SQQG 1GW4A 2NPSA 3C9IA 2IDBA 2AXCA 2KUBA 3OJAB 4IFFA 5H2FE 1NGMB 3LW5H 1K05A 4JPZB 4WY4C 3Q5PA 1OMIA 1VQMP 1M1JC 2IZ1A 3P7KA 4WWIA 3E7KA 3OW2O 1H89A 1J1DB 1ZXGA 2OTJP 1LT1A 4CPGA 3H1KJ 1YTZI 3QH9A 3L36A 2WT7A 1K8AQ 5BVZA 1JTHA 1SQXD 1HWTC 3KZIH 3S1KA 3G3ZA 1JNMA 1GL2A 4WY4D 3B5NC 1NTMG 1PZQA 1BGYE 2Y0DA 2QVAA 3V6IA 1E79H 5GTHE 1AFOA 1KQGB 1SFCA 2NZ2A 2O3JA 4N78E 1SFCD 2E75B 1L0NK 4QMAA 2K9JB 3GHGA 2QSIA 3RL0C 1NKZB 2NPSC 3CC7P 1NTKD 3L71G 3VP8A 3U59A 3L73G 2DW3A 1BSHA 2BASA 2IZ0A 2YKPA 2BCCG 3SSUA 1NTZG 2G3AA 1P84I 3IF4A 1L4AD 3Q3DA 5GTHH 2IX7C 1CW5A 1JB0J 1L0NG 3BCCG 2H43A 2FFDC 3CL3D 4W7YA 1S2EA 1L0NE 2J5UA 1HVVA 3GHGC 5BU8B 4GIFA 1SQPG 3U1CA 2E5YA 4U3FE 5TJHA 3RL0g 1FZBA 5APQA 4AUWA 2HFED 3L4FA 5CBOA 4I2LC 2JR8A 1VQ4P 3AECC 2YKQA 2KS1A 3L71E 2E76C 2BEZF 4OWFA 2Q3EA 3PLNA 1JCDA 1URQC 1KYOI 3RK3C 3WU2E 4BWNA 1KB9H 2ZT9C 3M0DC 1RF0A 4I7ZB 4PD4I 3EFFK 1IO4A 1VQ6P 2YIUB 4H44D 5CCGD 1AQTA 4DZOA 1CSBA 1LWUA 2OYIC 1WMKA 3O6QA 1SQPJ 1M1JB 1BE3E 1M8OB 3EQ2A 2PFXA 4C7RA 1M56D 1HBWA 1J2JB 2WSEH 1GTWA 2WWWA 5AW2B 4C7NB 5CJ0A 5AW6B 1HGVA 3V4QA 1SQQE 2HPCA 3CXHI 1S5LX 1EDLA 1Y8AA 5AW8B 3VMXA 1SVFA 2KS1B 1NTZJ 3OAKA 4YXDC 2AXTH 4DCKA 3AEEC 1AA0A 3L73J 2ZYGA 3AE8C 1A02F 5K5GB 2KZIA 1Q90D 4BRYB 1EZVD 1LWUC 1HJBA 4TT3H 4EI2A 5GTIH 4HKZH 2JKVA 1S5LH 2JWDA 5KLVJ 3CX5H 3HRNA 2N1TA 2PGDA 1NAYA 4LLHA 3D6YA 1KD1Q 3S4RA 1DIPA 1JUNA 1NTKE 4JYCA 3L74E 1YYCA 3TDKA 2B87A 1FAVA 3ZDMA 1NVOA 1T3UA 3M9QA 3R2PA 3V2PA 2OGUA 1SQVK 3H1HJ 1UIIA 3H32A 2FXOA 4XFJA 5TISE 1MV8A 3D70A 2HPCB 1ZW0A 2WSFJ 3HUSC 1KILB 3WU2H 1LP1B 3B8EB 2CPSA 3G4SP 2G8YA 4ASVA 3GG2A 1MKMA 1SS1A 2AEMA 3GLMA 2KSJA 1G1IA 2H89C 4ZMDA 1S9KD 1PIXA 2QE7H 4WB4A 4ASWA 1YQ3C 3A0BH 1N7LA 1NKNA 1KYOH 1GL2B 1OFCX 2KLVA 2R3SA 2Q5UA 2ZT9B 3M9BA 3HE5A 1KORA 2N1TB 5H2FH 3WUTA 4A7PA 3G71P 3L75J 4H0LB 3RK2D 3CWBE 2ZFCA 3P32A 2QJYB 1CZQA 4WBAA 1FZCC 3GF3A 5CCGC 1LT9B 3AEFC 2KK7A 3F5HA 3CMAP 3F89A 1RF1C 1VQNP 1N73C 4H13B 1FDMA 3B5ND 1DD4A 1L0LE 2C0XA 3H1JJ 3H32B 1FU1A 4U3FG 2K3RA 1U57A 5AW7B 2KSEA 2K1AA 1PL5A 3AEDC 4PV1D 5KAIH 1GK6A 2ZXEB 3MP7B 1L4AB 1PGPA 1SLQA 2K88A 2E74C 1SQBD 3A0HH 5CBNA 2QEXP 2KYVA 1R5LA 3CWBD 4B86A 1OVRA 4OGQD 1J1EC 2NRGA 1PGQA 1JEKA 3B4SA 1ZRTE 4UB6H 5AVUB 1OW7A 1SQQD 1SQVD 4WY4A 3L37A 1SQBG 5KAFE 3RK3E 3HUSB 3T97B 1BCCD 2HR3A 2HODA 1KV4A 3U1AA 3CXHD 2SPZA 3IN6A 1HF9A 3VTPC 3HD7B 3TGUJ 4U3FJ 2E43A 4IL6X 3RGUA 1DX7A 4KT0J 1NTKJ 1Q2NA 2A06E 1QGKB 4UB8H 2OYHB 3O8ZA 5AVXB 4IL6E 1NU1G 1SQBK 1BGYG 1JM0A 1NTME 1URQB 2Q1KA 2D2CC 2QJPB 1P84E 3AE3C 1OW6A 2W6JH 3M06A 5AVSB 3V2RA 5AVRB 3CWBJ 5B66E 1BCCE 2P67A 3HTKA 3L72J 4IL6H 3O6QB 2Y9YA 2KNCA 2A06G 3CXHE 4MN4C 2I1JA 2J58A 5TISH 3HUSA 3L70J 1YTZT 1YJ9P 2M5AB 3H1JE 3CLQA 2N1TD 3SWYA 4IFDK 1RQUA 2M0BA 5KLVD 1HUCA 2WQYC 4K35A 1LTJA 3JC22 1NU1K 1Q7YQ 3MGNA 1PGJA 4UB6E 2XNXA 3L75E 4H0LC 1ZMEC 3B5NB 2N1TC 2Y9ZA 4L75A 3D6ZA 3M9HA 2BCCJ 3CCMP 3A0HE 3MTUE 1PP9E 3VP9A 1VL2A 2Q3IA 3A3YB 1L0LJ 1VQLP 3GF7A 3CMEP 1N73B 1X0TA 1L0LG 3N4XA 1VQPP 5KLVE 3NTNA 1JTHB 1MUUA 2PRRA 4PJ0H 2E42A 1RE3C 2E74B 1EZVG 2KIKA 2L91A 2P7JA 3L75D 2MJZA 2WT7B 4OH8B 3CWBG 1KQSO 2K37A 5AW0B 1UIXA 2WTYA 1PP9D 3HD7D 3HE4A 3IAOA 1VF5B 2PAJA 3I56P 5EFWB 1L2PA 1BE3D 2JP3A 1NHLA 2FYUJ 2CPBA 3B5NA 1FJKA 3L70E 4YPCA 5DJTB 1ZRTD 3ITKA 4DT0A 1GK4A 3L71J 3MZWB 2WSCH 4RKUJ 1M57D 5APWA 3BCCD 2IBZI 2QG4A 1QEXA 4N6JA 1ZP0C 2FXMA 2OYHC 1GL2D 1BDCA 2JEEA 5KKZB 3CCUP 1H0TB 2D2CB 2QJPC 4RESB 1EZVE 2H88C 1YITP 1FJPA 4ZNCA 3CPWO 1NTMK 1NTMD 1KFNA 2WZ7A 3WUVA 1EC5A 1P84D 2O1JA 3JCUH 2WMMA 3SWFA 1L0ND 2AXTE 1BE3J 5AVWB 2NPSB 3IFMA 1IFDA 4U7JA 3RK2C 3RL0B 1IZNB 1AQ5A 2VRSA 3L74D 2RN0A 1KZUB 1CI6B 3BRTB 1LTSC 4D6TD 3AE6C 1PGOA 1SP4A 1E5WA 5DJUB 3S9OA 1DH3A 1L4AC 3L75G 1QLED 2JDIH 1LGHB 2M3BA 3RBZA 1SQQK 2WITA 4BXLA 1S3JA 1VQ7P 3TNUB 3E1IA 2FYUE 3H1JG 2KB7P 3HD7A 4O9BA 1BE3G 2ZT9D 3H1KD 2AEJA 3H1LE 1JY3N 1WT6A 2W6AA 4D6TE 1PPJD 1GU5A 2YO2A 1LTIC 2H8PD 3K5BA 1BCCG 2FKWB 1D7MA 2V7QH 3A2AA 5AVZB 3TGUE 1DD3A 4XA4A 1Q86Q 1LJ2A 1TU3F 1X9VA 2V4HA 3CCRP 3A7OA 1URQD 4I6MC 2XNDH 4GDOA 1NU1E 4W7ZA 4GT1A 2A45I 2MKVA 1KILC 4I7ZC 2YIUC 4M3LA 5CCHD 5KJ7C 1VQKP 2WSCJ 1RH5B 5E79E 2C9LY 1ZR4A 1T6AA 1KILE 1ZLLA 2IBZE 3L73D 2FYNC 2N9BA 4OGQB 3RBXA 3TNUA 1SQBE 1Q82Q 2GUVA 3SFEC 1FDOA 1FDIA 3II6A 3LW5J 4YTPC 4GOFA 5AVVB 5KLVK 1SQXK 3CXHH 2W6BA 1VPCA 2IFNA 3KZIE 5KKZC 1EZVI 3A5TA 3B71A 3MUDA 4HH2A 3FGAD 3BCCE 3LIEA 3PTZA 1U7JA 2NPSD 2HLOA 1M7LA 2OTLP 2XV5A 1NH4A 2QJKB 4HYTB 1RE3A 3AE2C 4L74A 1NTZE 3Q5RA 1K04A 1A02J 1RF0C 3SWKA 2QIWA 5KJ7D 2O01J 1KILD 1LP1A 3L73E 2JO1A 3NMDA 5CCHC 3JCUE 1QL2A 1MFTA 1Q81Q 2OYIA 3CX5I 1JO5A 3UIAA 3FWLA 2P1JA 2W83C 3H25A 1WRGA 5GTIE 1S9KE 1M1JA 1RQVA 4KHXA 4PJ0E 1QL1A 2IPPA 1N2DC 2H7HA 1NOHA 3H1HE 1AV1A 2QM8A 1IFIA 1HTLC 3FXEA 3L35A 3MUDC 3H1JD 3NXSA 1MFZA 3CCJP 3AEBC 1JY3P 1OXZA 3AEGC 2J59M 5CCHA 3EFGA 2BEQD 3HTKB 3HD7C 1GMJA 3A0BE 4PD4D 5APTA 4ZKUA 1AJYA 3Q5SA 1S4XA 1L0LD 4JBZA 1EDJA 1RE4C 3H1KE 3H1LD 3MD0A 3GW6A 1SFCB 2BCCD 2E75D 2WVRA 3L74J 2CK3H 2LR2A 2O1KA 3JSVC 3KPEA 5AW1B 1QVGO 3L74G 1S72P 2HODB 1PFIA 1NJIQ 2B87B 2R32A 1N7SC 2C0WA 3T97A 3VN0A 1OVVA 4IOIH 1IC2A 4EDFA 3IR9A 2A45H 4Y99C 1IFNA 1SQVE 1G2CB 1LT9C 4H13C 1Z56A 4OGQC 5E79H 3RK3D 5AW5B 1FE6A 4H0LD 3RK2B 2I8DA 4TLFA 2POHA 4JF7A 2IBZG 5AVTB 1SQPK 4C46A 3VMZA 3AE1C 4NPDA 3VMYA 1KC8Q 3BCCJ 2B9BA 1BSNA 2IFMA 4EIJA 4EYYQ 2A06D 2P58A 2Q6QA 2M3EA 2O01H
chains in the Genus database with same CATH topology
4PD4H 1KYOH 1NTKG 3H1JG 1BE3G 5KLVG 1NTMG 1SQVG 3TGUG 3CX5H 1BCCG 3H1IG 1NU1G 3L74G 1L0LG 1KB9H 1BGYG 4D6TG 3H1KG 1PP9G 1P84H 3H1LG 3L71G 3L72G 2FYUG 3L73G 1EZVG 4U3FG 2BCCG 3CWBG 1NTZG 2A06G 1SQQG 3L70G 1L0NG 3BCCG 2IBZG 1SQXG 3H1HG 3L75G 3CXHH 1PPJG 1SQBG 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4PD4 H;  1KYO H;  1NTK G;  3H1J G;  1BE3 G;  5KLV G;  1NTM G;  1SQV G;  3TGU G;  3CX5 H;  1BCC G;  3H1I G;  1NU1 G;  3L74 G;  1L0L G;  1KB9 H;  1BGY G;  4D6T G;  3H1K G;  1PP9 G;  1P84 H;  3H1L G;  3L71 G;  3L72 G;  2FYU G;  3L73 G;  1EZV G;  4U3F G;  2BCC G;  3CWB G;  1NTZ G;  2A06 G;  1SQQ G;  3L70 G;  1L0N G;  3BCC G;  2IBZ G;  1SQX G;  3H1H G;  3L75 G;  3CXH H;  1PPJ G;  1SQB G;  1SQP G; 
#chains in the Genus database with same CATH topology
 2YMY A;  3H1I J;  3L70 D;  5APX A;  2FYU K;  4PV1 B;  2N9Y B;  1H88 A;  3KHU A;  1RF1 A;  1NTZ K;  3CCE P;  3M91 A;  1FS0 E;  1N7S D;  3L72 D;  1IFM A;  1LTJ B;  2FXP A;  2HG5 D;  2RH0 A;  3EWK A;  3TGU G;  3H1L J;  1SQP D;  2OTK E;  3V5B A;  3PHL A;  5AVQ B;  1P84 H;  3L72 G;  1JY2 P;  3I5C A;  2XZR A;  4IFM A;  3FWN A;  4RJT A;  4L73 A;  5CJ4 A;  1W5C E;  2WPQ A;  2WSF H;  1JCC A;  1L0N J;  1NTM J;  1N86 A;  2FBW C;  4N78 D;  3SFD C;  1YIJ P;  1M1K Q;  1GW3 A;  3H1I D;  2PP6 A;  1SQX G;  2Q7C A;  2I1K A;  1SQV J;  2K9J A;  3GHG B;  1SQP E;  2R3C A;  1IK7 A;  2KXP B;  1PV3 A;  3P8C D;  3V2Q A;  1NTK K;  4Z1M H;  1VQ5 P;  1GZL A;  1FZA A;  1L0L K;  2FYZ A;  1XTG B;  3PRJ A;  4N3Y B;  2LKM A;  1KYO E;  2E74 D;  2OQQ A;  1SQB J;  1ZN5 A;  4GOE A;  3W68 A;  4C7N A;  1FZG A;  2ZAE B;  4PD4 E;  1IJD B;  1SQQ J;  3RK3 B;  3D71 A;  1IFJ A;  5KLI B;  2R44 A;  3CCV P;  2A45 G;  2FYU D;  1JMB A;  1KB9 I;  2BCC E;  2ZVN B;  3LID A;  3CC2 P;  2L5G B;  1PP9 J;  3FX0 A;  3P8C E;  3I55 P;  1T2K C;  5APV A;  3H1K G;  2RMZ A;  4RO0 A;  1USD A;  2WSE J;  4W80 A;  3AE5 C;  2OYI B;  2E75 C;  2IYP A;  3VOP A;  1K9M Q;  4JQ0 D;  1ZV8 A;  1RY3 A;  2K9Y A;  3WMM 0;  5CMZ A;  3PH0 A;  1GD2 E;  3MHV A;  1OWA A;  1Y9B A;  1NU1 D;  1W2E A;  2UWJ E;  2W27 A;  3C8V A;  1KIL A;  3H1H G;  3CCS P;  4DOJ A;  5KTB A;  3ABV C;  2Z4E A;  1KQL A;  1U7M A;  1FC2 C;  2Z5I A;  1YQ4 C;  2QA4 P;  1JMM A;  1PPJ G;  2ITA A;  3OA7 A;  1Y47 A;  2IBZ D;  1VF5 C;  2KP8 A;  1LTJ C;  4H44 B;  4AQR D;  1LWU B;  5APU A;  4ZKP A;  1HH0 A;  3E1R A;  3CI9 A;  2XKM A;  2YXR B;  1DEE G;  3H6P A;  4R4M A;  1VDF A;  1HGZ A;  1SQX J;  2Z5H A;  1CI6 A;  1QX8 A;  5KLV G;  1QVF O;  4AYC A;  1X79 B;  2ZVO B;  3MIW A;  1NAF A;  2Y0C A;  1N73 A;  4UB8 E;  3BVH A;  1GL2 C;  1KTM A;  5B66 H;  1PP9 G;  2Q9I A;  3VYI A;  3GMA A;  1LTB C;  2E76 D;  3Q2Y A;  1DEB A;  1RHZ B;  1K73 Q;  1G2C A;  2M8R A;  4R4L A;  4LGD E;  1NYH A;  5AVY B;  1EQ7 A;  3KXD A;  3BAT A;  1USE A;  1IFP A;  3HE4 B;  2JJL A;  3V2N A;  4U3F D;  2FFD A;  1PPJ E;  2WPS A;  3H1I G;  3TGU D;  3N7N A;  5KLI C;  1GU4 A;  1S1C X;  3PJS K;  4PD4 H;  2QJK C;  2GUS A;  3RL0 D;  1N8R Q;  2WPV B;  3CCQ P;  2P10 A;  1YJN P;  3C1L A;  1RF1 B;  1OZH A;  2QJY C;  1FZC B;  1VQ9 P;  1JY3 O;  3QWO C;  1T2K D;  2HYN A;  3P8M C;  2WSS H;  4H44 C;  2KLU A;  1LTG C;  5KJ7 A;  1M90 Q;  2KOG A;  2YKO A;  3BAS A;  1LNQ A;  2B89 A;  2Y0E A;  2P2U A;  4D6T G;  2FFD B;  1KB9 D;  1LTA C;  2FY8 A;  3H1L G;  3KQG A;  1YJW P;  2LXC B;  2FYU G;  3CC4 P;  3TK1 A;  1R8E A;  1X8Y A;  2LXB A;  2XU6 A;  5CCG A;  4K3A A;  3CD6 P;  4KJM A;  1J1E B;  1OW8 A;  3R4Y A;  3HE5 B;  4Y28 J;  5AW9 B;  2M5A A;  2ZJS E;  3TSI A;  1ZR2 A;  3G9R A;  1YHQ P;  1JOC A;  1AVY A;  2WPR A;  1VF5 D;  5BU5 A;  3CX5 E;  2YXQ B;  2AEF A;  1OVU A;  4H13 D;  2OYO A;  1NTZ D;  1T8Z A;  2B88 A;  2W8Z A;  1KB9 E;  1FZE A;  4D6T J;  1FZC A;  2ZYD A;  2YNY A;  2E76 B;  1J1D C;  1T3J A;  1SQX E;  4GKG A;  2IYO A;  1YBK A;  2QRX A;  1VQ8 P;  1W2B O;  4JYB A;  1BDD A;  5CHX A;  3VMA A;  1JY2 O;  1YI2 P;  1EXI A;  1N7S B;  1NU1 J;  4NPE A;  1EDI A;  2YO3 A;  3CX5 D;  1R5S A;  5M1B A;  4I1L A;  4YXW H;  1BCC J;  3L72 E;  5APS A;  3AE7 C;  5L8R J;  5APY A;  3G6E P;  3H1H D;  5AW3 B;  5KAI E;  2KZJ A;  2RKL A;  2QM7 A;  1AVO A;  3AE9 C;  3TYY A;  3PP5 A;  4WY4 B;  1FOS E;  1FOS F;  2FYN B;  2XDJ A;  3FXD A;  1FBM A;  1JY2 N;  3L70 G;  4EOT A;  3Q1M A;  1XTC C;  1KQF B;  1GDT A;  2ZXX A;  3M0D A;  4OVN F;  1NWQ A;  2OYH A;  1EXJ A;  3V4W A;  2JWA A;  1MZ9 A;  3M0A A;  1URQ A;  5C39 A;  3H1I E;  4GOD A;  1LT9 A;  4DJG A;  4NPF X;  1EDK A;  1X22 A;  4PV1 C;  2R5D A;  1FZF A;  1BGY J;  3CCL P;  1NO4 A;  2KI7 B;  2GM4 A;  2YMK A;  4L76 A;  1KN7 A;  1S5L E;  4XE5 B;  5B5E H;  4HB1 A;  1N7S A;  1NTK G;  3L71 D;  2E5T A;  5AW4 B;  1OIP A;  1KYO D;  1HJ0 A;  3USS A;  1IK9 A;  3W67 A;  2W90 A;  2ZYA A;  2D2C D;  1L4A A;  4BRY A;  1LTT C;  2KNC B;  1SQV G;  1RE4 A;  1G1J A;  1VQO P;  2C9N Y;  3NFQ A;  1H0T A;  4LC1 A;  3WUU A;  5KAF H;  2GA1 A;  3AEA C;  3KYQ A;  1H8A A;  3AE4 C;  2OAR A;  1SFC C;  2V7Q J;  2O01 N;  4WVZ A;  5B5E E;  3TF5 A;  1OX3 A;  1KFM A;  3KDP B;  4HJG H;  1KMI Z;  2R5B A;  3BRV B;  1ZOY C;  4Y99 B;  1BGY D;  1SQQ G;  1GW4 A;  2NPS A;  3C9I A;  2IDB A;  2AXC A;  2KUB A;  3OJA B;  4IFF A;  5H2F E;  1NGM B;  3LW5 H;  1K05 A;  4JPZ B;  4WY4 C;  3Q5P A;  1OMI A;  1VQM P;  1M1J C;  2IZ1 A;  3P7K A;  4WWI A;  3E7K A;  3OW2 O;  1H89 A;  1J1D B;  1ZXG A;  2OTJ P;  1LT1 A;  4CPG A;  3H1K J;  1YTZ I;  3QH9 A;  3L36 A;  2WT7 A;  1K8A Q;  5BVZ A;  1JTH A;  1SQX D;  1HWT C;  3KZI H;  3S1K A;  3G3Z A;  1JNM A;  1GL2 A;  4WY4 D;  3B5N C;  1NTM G;  1PZQ A;  1BGY E;  2Y0D A;  2QVA A;  3V6I A;  1E79 H;  5GTH E;  1AFO A;  1KQG B;  1SFC A;  2NZ2 A;  2O3J A;  4N78 E;  1SFC D;  2E75 B;  1L0N K;  4QMA A;  2K9J B;  3GHG A;  2QSI A;  3RL0 C;  1NKZ B;  2NPS C;  3CC7 P;  1NTK D;  3L71 G;  3VP8 A;  3U59 A;  3L73 G;  2DW3 A;  1BSH A;  2BAS A;  2IZ0 A;  2YKP A;  2BCC G;  3SSU A;  1NTZ G;  2G3A A;  1P84 I;  3IF4 A;  1L4A D;  3Q3D A;  5GTH H;  2IX7 C;  1CW5 A;  1JB0 J;  1L0N G;  3BCC G;  2H43 A;  2FFD C;  3CL3 D;  4W7Y A;  1S2E A;  1L0N E;  2J5U A;  1HVV A;  3GHG C;  5BU8 B;  4GIF A;  1SQP G;  3U1C A;  2E5Y A;  4U3F E;  5TJH A;  3RL0 g;  1FZB A;  5APQ A;  4AUW A;  2HFE D;  3L4F A;  5CBO A;  4I2L C;  2JR8 A;  1VQ4 P;  3AEC C;  2YKQ A;  2KS1 A;  3L71 E;  2E76 C;  2BEZ F;  4OWF A;  2Q3E A;  3PLN A;  1JCD A;  1URQ C;  1KYO I;  3RK3 C;  3WU2 E;  4BWN A;  1KB9 H;  2ZT9 C;  3M0D C;  1RF0 A;  4I7Z B;  4PD4 I;  3EFF K;  1IO4 A;  1VQ6 P;  2YIU B;  4H44 D;  5CCG D;  1AQT A;  4DZO A;  1CSB A;  1LWU A;  2OYI C;  1WMK A;  3O6Q A;  1SQP J;  1M1J B;  1BE3 E;  1M8O B;  3EQ2 A;  2PFX A;  4C7R A;  1M56 D;  1HBW A;  1J2J B;  2WSE H;  1GTW A;  2WWW A;  5AW2 B;  4C7N B;  5CJ0 A;  5AW6 B;  1HGV A;  3V4Q A;  1SQQ E;  2HPC A;  3CXH I;  1S5L X;  1EDL A;  1Y8A A;  5AW8 B;  3VMX A;  1SVF A;  2KS1 B;  1NTZ J;  3OAK A;  4YXD C;  2AXT H;  4DCK A;  3AEE C;  1AA0 A;  3L73 J;  2ZYG A;  3AE8 C;  1A02 F;  5K5G B;  2KZI A;  1Q90 D;  4BRY B;  1EZV D;  1LWU C;  1HJB A;  4TT3 H;  4EI2 A;  5GTI H;  4HKZ H;  2JKV A;  1S5L H;  2JWD A;  5KLV J;  3CX5 H;  3HRN A;  2N1T A;  2PGD A;  1NAY A;  4LLH A;  3D6Y A;  1KD1 Q;  3S4R A;  1DIP A;  1JUN A;  1NTK E;  4JYC A;  3L74 E;  1YYC A;  3TDK A;  2B87 A;  1FAV A;  3ZDM A;  1NVO A;  1T3U A;  3M9Q A;  3R2P A;  3V2P A;  2OGU A;  1SQV K;  3H1H J;  1UII A;  3H32 A;  2FXO A;  4XFJ A;  5TIS E;  1MV8 A;  3D70 A;  2HPC B;  1ZW0 A;  2WSF J;  3HUS C;  1KIL B;  3WU2 H;  1LP1 B;  3B8E B;  2CPS A;  3G4S P;  2G8Y A;  4ASV A;  3GG2 A;  1MKM A;  1SS1 A;  2AEM A;  3GLM A;  2KSJ A;  1G1I A;  2H89 C;  4ZMD A;  1S9K D;  1PIX A;  2QE7 H;  4WB4 A;  4ASW A;  1YQ3 C;  3A0B H;  1N7L A;  1NKN A;  1KYO H;  1GL2 B;  1OFC X;  2KLV A;  2R3S A;  2Q5U A;  2ZT9 B;  3M9B A;  3HE5 A;  1KOR A;  2N1T B;  5H2F H;  3WUT A;  4A7P A;  3G71 P;  3L75 J;  4H0L B;  3RK2 D;  3CWB E;  2ZFC A;  3P32 A;  2QJY B;  1CZQ A;  4WBA A;  1FZC C;  3GF3 A;  5CCG C;  1LT9 B;  3AEF C;  2KK7 A;  3F5H A;  3CMA P;  3F89 A;  1RF1 C;  1VQN P;  1N73 C;  4H13 B;  1FDM A;  3B5N D;  1DD4 A;  1L0L E;  2C0X A;  3H1J J;  3H32 B;  1FU1 A;  4U3F G;  2K3R A;  1U57 A;  5AW7 B;  2KSE A;  2K1A A;  1PL5 A;  3AED C;  4PV1 D;  5KAI H;  1GK6 A;  2ZXE B;  3MP7 B;  1L4A B;  1PGP A;  1SLQ A;  2K88 A;  2E74 C;  1SQB D;  3A0H H;  5CBN A;  2QEX P;  2KYV A;  1R5L A;  3CWB D;  4B86 A;  1OVR A;  4OGQ D;  1J1E C;  2NRG A;  1PGQ A;  1JEK A;  3B4S A;  1ZRT E;  4UB6 H;  5AVU B;  1OW7 A;  1SQQ D;  1SQV D;  4WY4 A;  3L37 A;  1SQB G;  5KAF E;  3RK3 E;  3HUS B;  3T97 B;  1BCC D;  2HR3 A;  2HOD A;  1KV4 A;  3U1A A;  3CXH D;  2SPZ A;  3IN6 A;  1HF9 A;  3VTP C;  3HD7 B;  3TGU J;  4U3F J;  2E43 A;  4IL6 X;  3RGU A;  1DX7 A;  4KT0 J;  1NTK J;  1Q2N A;  2A06 E;  1QGK B;  4UB8 H;  2OYH B;  3O8Z A;  5AVX B;  4IL6 E;  1NU1 G;  1SQB K;  1BGY G;  1JM0 A;  1NTM E;  1URQ B;  2Q1K A;  2D2C C;  2QJP B;  1P84 E;  3AE3 C;  1OW6 A;  2W6J H;  3M06 A;  5AVS B;  3V2R A;  5AVR B;  3CWB J;  5B66 E;  1BCC E;  2P67 A;  3HTK A;  3L72 J;  4IL6 H;  3O6Q B;  2Y9Y A;  2KNC A;  2A06 G;  3CXH E;  4MN4 C;  2I1J A;  2J58 A;  5TIS H;  3HUS A;  3L70 J;  1YTZ T;  1YJ9 P;  2M5A B;  3H1J E;  3CLQ A;  2N1T D;  3SWY A;  4IFD K;  1RQU A;  2M0B A;  5KLV D;  1HUC A;  2WQY C;  4K35 A;  1LTJ A;  3JC2 2;  1NU1 K;  1Q7Y Q;  3MGN A;  1PGJ A;  4UB6 E;  2XNX A;  3L75 E;  4H0L C;  1ZME C;  3B5N B;  2N1T C;  2Y9Z A;  4L75 A;  3D6Z A;  3M9H A;  2BCC J;  3CCM P;  3A0H E;  3MTU E;  1PP9 E;  3VP9 A;  1VL2 A;  2Q3I A;  3A3Y B;  1L0L J;  1VQL P;  3GF7 A;  3CME P;  1N73 B;  1X0T A;  1L0L G;  3N4X A;  1VQP P;  5KLV E;  3NTN A;  1JTH B;  1MUU A;  2PRR A;  4PJ0 H;  2E42 A;  1RE3 C;  2E74 B;  1EZV G;  2KIK A;  2L91 A;  2P7J A;  3L75 D;  2MJZ A;  2WT7 B;  4OH8 B;  3CWB G;  1KQS O;  2K37 A;  5AW0 B;  1UIX A;  2WTY A;  1PP9 D;  3HD7 D;  3HE4 A;  3IAO A;  1VF5 B;  2PAJ A;  3I56 P;  5EFW B;  1L2P A;  1BE3 D;  2JP3 A;  1NHL A;  2FYU J;  2CPB A;  3B5N A;  1FJK A;  3L70 E;  4YPC A;  5DJT B;  1ZRT D;  3ITK A;  4DT0 A;  1GK4 A;  3L71 J;  3MZW B;  2WSC H;  4RKU J;  1M57 D;  5APW A;  3BCC D;  2IBZ I;  2QG4 A;  1QEX A;  4N6J A;  1ZP0 C;  2FXM A;  2OYH C;  1GL2 D;  1BDC A;  2JEE A;  5KKZ B;  3CCU P;  1H0T B;  2D2C B;  2QJP C;  4RES B;  1EZV E;  2H88 C;  1YIT P;  1FJP A;  4ZNC A;  3CPW O;  1NTM K;  1NTM D;  1KFN A;  2WZ7 A;  3WUV A;  1EC5 A;  1P84 D;  2O1J A;  3JCU H;  2WMM A;  3SWF A;  1L0N D;  2AXT E;  1BE3 J;  5AVW B;  2NPS B;  3IFM A;  1IFD A;  4U7J A;  3RK2 C;  3RL0 B;  1IZN B;  1AQ5 A;  2VRS A;  3L74 D;  2RN0 A;  1KZU B;  1CI6 B;  3BRT B;  1LTS C;  4D6T D;  3AE6 C;  1PGO A;  1SP4 A;  1E5W A;  5DJU B;  3S9O A;  1DH3 A;  1L4A C;  3L75 G;  1QLE D;  2JDI H;  1LGH B;  2M3B A;  3RBZ A;  1SQQ K;  2WIT A;  4BXL A;  1S3J A;  1VQ7 P;  3TNU B;  3E1I A;  2FYU E;  3H1J G;  2KB7 P;  3HD7 A;  4O9B A;  1BE3 G;  2ZT9 D;  3H1K D;  2AEJ A;  3H1L E;  1JY3 N;  1WT6 A;  2W6A A;  4D6T E;  1PPJ D;  1GU5 A;  2YO2 A;  1LTI C;  2H8P D;  3K5B A;  1BCC G;  2FKW B;  1D7M A;  2V7Q H;  3A2A A;  5AVZ B;  3TGU E;  1DD3 A;  4XA4 A;  1Q86 Q;  1LJ2 A;  1TU3 F;  1X9V A;  2V4H A;  3CCR P;  3A7O A;  1URQ D;  4I6M C;  2XND H;  4GDO A;  1NU1 E;  4W7Z A;  4GT1 A;  2A45 I;  2MKV A;  1KIL C;  4I7Z C;  2YIU C;  4M3L A;  5CCH D;  5KJ7 C;  1VQK P;  2WSC J;  1RH5 B;  5E79 E;  2C9L Y;  1ZR4 A;  1T6A A;  1KIL E;  1ZLL A;  2IBZ E;  3L73 D;  2FYN C;  2N9B A;  4OGQ B;  3RBX A;  3TNU A;  1SQB E;  1Q82 Q;  2GUV A;  3SFE C;  1FDO A;  1FDI A;  3II6 A;  3LW5 J;  4YTP C;  4GOF A;  5AVV B;  5KLV K;  1SQX K;  3CXH H;  2W6B A;  1VPC A;  2IFN A;  3KZI E;  5KKZ C;  1EZV I;  3A5T A;  3B71 A;  3MUD A;  4HH2 A;  3FGA D;  3BCC E;  3LIE A;  3PTZ A;  1U7J A;  2NPS D;  2HLO A;  1M7L A;  2OTL P;  2XV5 A;  1NH4 A;  2QJK B;  4HYT B;  1RE3 A;  3AE2 C;  4L74 A;  1NTZ E;  3Q5R A;  1K04 A;  1A02 J;  1RF0 C;  3SWK A;  2QIW A;  5KJ7 D;  2O01 J;  1KIL D;  1LP1 A;  3L73 E;  2JO1 A;  3NMD A;  5CCH C;  3JCU E;  1QL2 A;  1MFT A;  1Q81 Q;  2OYI A;  3CX5 I;  1JO5 A;  3UIA A;  3FWL A;  2P1J A;  2W83 C;  3H25 A;  1WRG A;  5GTI E;  1S9K E;  1M1J A;  1RQV A;  4KHX A;  4PJ0 E;  1QL1 A;  2IPP A;  1N2D C;  2H7H A;  1NOH A;  3H1H E;  1AV1 A;  2QM8 A;  1IFI A;  1HTL C;  3FXE A;  3L35 A;  3MUD C;  3H1J D;  3NXS A;  1MFZ A;  3CCJ P;  3AEB C;  1JY3 P;  1OXZ A;  3AEG C;  2J59 M;  5CCH A;  3EFG A;  2BEQ D;  3HTK B;  3HD7 C;  1GMJ A;  3A0B E;  4PD4 D;  5APT A;  4ZKU A;  1AJY A;  3Q5S A;  1S4X A;  1L0L D;  4JBZ A;  1EDJ A;  1RE4 C;  3H1K E;  3H1L D;  3MD0 A;  3GW6 A;  1SFC B;  2BCC D;  2E75 D;  2WVR A;  3L74 J;  2CK3 H;  2LR2 A;  2O1K A;  3JSV C;  3KPE A;  5AW1 B;  1QVG O;  3L74 G;  1S72 P;  2HOD B;  1PFI A;  1NJI Q;  2B87 B;  2R32 A;  1N7S C;  2C0W A;  3T97 A;  3VN0 A;  1OVV A;  4IOI H;  1IC2 A;  4EDF A;  3IR9 A;  2A45 H;  4Y99 C;  1IFN A;  1SQV E;  1G2C B;  1LT9 C;  4H13 C;  1Z56 A;  4OGQ C;  5E79 H;  3RK3 D;  5AW5 B;  1FE6 A;  4H0L D;  3RK2 B;  2I8D A;  4TLF A;  2POH A;  4JF7 A;  2IBZ G;  5AVT B;  1SQP K;  4C46 A;  3VMZ A;  3AE1 C;  4NPD A;  3VMY A;  1KC8 Q;  3BCC J;  2B9B A;  1BSN A;  2IFM A;  4EIJ A;  4EYY Q;  2A06 D;  2P58 A;  2Q6Q A;  2M3E A;  2O01 H; 
#chains in the Genus database with same CATH homology
 4PD4 H;  1KYO H;  1NTK G;  3H1J G;  1BE3 G;  5KLV G;  1NTM G;  1SQV G;  3TGU G;  3CX5 H;  1BCC G;  3H1I G;  1NU1 G;  3L74 G;  1L0L G;  1KB9 H;  1BGY G;  4D6T G;  3H1K G;  1PP9 G;  1P84 H;  3H1L G;  3L71 G;  3L72 G;  2FYU G;  3L73 G;  1EZV G;  4U3F G;  2BCC G;  3CWB G;  1NTZ G;  2A06 G;  1SQQ G;  3L70 G;  1L0N G;  3BCC G;  2IBZ G;  1SQX G;  3H1H G;  3L75 G;  3CXH H;  1PPJ G;  1SQB G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...