3L70G

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
molecule tags Oxidoreductase
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l70G00
1BGYG 1L0LG 4U3FG 5KLVG 3H1LG 1KB9H 3L70G 1NTMG 2A06G 3TGUG 1P84H 3H1HG 3H1KG 1BCCG 1PP9G 3L74G 1NU1G 1SQXG 1SQPG 1EZVG 3L71G 1L0NG 4D6TG 2IBZG 1NTZG 3H1IG 1PPJG 3H1JG 1SQBG 3CWBG 1KYOH 2BCCG 1SQQG 3CXHH 3BCCG 1BE3G 1NTKG 4PD4H 3CX5H 1SQVG 2FYUG 3L72G 3L73G 3L75G
chains in the Genus database with same CATH superfamily
1N7LA 3V2NA 2B9BA 1N8RQ 1RF0C 2KLVA 2R32A 4UB6H 3HD7D 1T6AA 3L72J 1PZQA 2WSCJ 1MUUA 2IBZE 1PP9D 4ZKPA 1PPJD 3CCJP 2R5BA 3CCVP 2YMKA 3G71P 1LT9B 3WUUA 2FXPA 2M5AA 1YTZT 2ZJSE 1MFTA 4JYCA 4U3FE 1Q86Q 3KZIE 1NOHA 1GK6A 3M9BA 1G2CB 5M1BA 1NTMD 1SQXG 1PP9E 5AVUB 3P32A 1SQPE 1AVOA 3H1KD 2PRRA 4EOTA 1JY2O 3RK2C 4H13B 3TGUJ 2K9JB 1FZCC 2FYZA 3VTPC 1HF9A 4Y99B 1KILA 3H1KE 3CC7P 3O6QB 1JO5A 1VQLP 1FAVA 3M0AA 1WT6A 4KJMA 5CCGD 1PGOA 1RE3C 3H1JJ 3H1LG 2FFDA 5KAFH 2HFED 2HR3A 3CCQP 1EZVG 2CPSA 3MHVA 3RL0g 1YI2P 2K3RA 1L0LJ 4HKZH 1U7JA 1YBKA 2N1TA 1ZOYC 2GA1A 3IN6A 1SQQJ 3KDPB 1DEBA 3G6EP 3L73J 2W6BA 3CCEP 3CWBG 2BCCG 1DD3A 2KZJA 1L4AC 4EDFA 2ZT9D 3MZWB 1X22A 2AEJA 2AEFA 3NXSA 3JSVC 4C46A 3U1CA 4WY4D 4GKGA 3M9HA 2H43A 1JM0A 3A5TA 3PJSK 1KFNA 1CZQA 1N86A 4JPZB 1OIPA 1BCCJ 3JCUH 1Q7YQ 2Y0DA 2I1KA 1OMIA 1KFMA 3PP5A 3FWLA 3HD7B 1QEXA 3IFMA 2OQQA 1YYCA 2WQYC 3L37A 4MN4C 5KLIC 2YNYA 2YKPA 3WU2E 1AJYA 1S5LE 1KYOD 1IFNA 1SQVD 1IFPA 5APVA 2Q1KA 2WSFH 1ZRTD 1J1DC 4W7YA 1LWUA 4NPEA 1GW3A 1NWQA 4D6TG 1VQ9P 3HTKB 4PV1C 5KLVJ 5CCHC 5B66E 2E43A 3Q1MA 3V4QA 1KYOE 3MP7B 1SQVE 1URQA 2N9YB 2KP8A 2E76C 3KQGA 1ZRTE 2ZYAA 3HE4B 3AEAC 1LT1A 4UB6E 3RGUA 2K37A 1X8YA 3L4FA 1H89A 2OYHA 3Q5SA 2KIKA 3AE5C 4GOEA 1M7LA 1NU1J 1OZHA 1S5LX 1Q2NA 4DOJA 2QVAA 2OARA 2W27A 1KN7A 5CBNA 2QJPB 3M0DA 3B5NC 2IFMA 1RHZB 1DX7A 3L70J 2KLUA 3OA7A 3RK3C 1S72P 3L72G 4IFFA 3H32A 3VMYA 5AW9B 3E1RA 1ZXGA 2WTYA 1P84D 4Z1MH 4JQ0D 1GL2D 4I2LC 3HUSB 5TISE 3AEGC 3CXHI 4XE5B 2KNCA 1FU1A 3HRNA 3GW6A 3CMAP 4WVZA 1QL2A 1U7MA 4WY4B 1KV4A 1NTMJ 3C1LA 4IL6X 3CC2P 3G9RA 3A3YB 1X0TA 3N7NA 3SSUA 4YXWH 3M06A 2R3CA 1WRGA 1OW8A 1M1JA 4PD4H 1L4AD 5KAIH 3AE7C 1JY2N 1FE6A 3SWKA 3OW2O 1SQXJ 3RBZA 1H0TB 2RMZA 1DD4A 4DT0A 2P58A 1PGPA 3AEBC 1CI6B 1VQMP 2A06D 4ZMDA 5AW3B 2FY8A 3HD7C 2QJYB 3L74D 1FOSF 1LGHB 1BDCA 4GIFA 4DCKA 3JCUE 3SFEC 4DZOA 2A06E 2Q5UA 1NTZK 3C9IA 3EFGA 3L74E 3H1HD 1NTKK 3GLMA 5TJHA 3BATA 5APXA 3EWKA 1W5CE 5KKZC 1RF1A 1EDIA 1PL5A 4BRYA 2R44A 1FZGA 1BCCG 3H1HE 3SWYA 4PV1D 3RK2B 5CCHD 2WT7B 1QVGO 1KQFB 1FZCB 1SQBE 2P10A 2E76D 4UB8H 4L74A 3L75D 1SQPK 1UIIA 2BCCJ 3CWBJ 5CHXA 5CCGC 1H88A 1KB9D 3GF7A 1IZNB 4IFMA 1AQTA 2FYUK 2QE7H 3I56P 1A02F 3D71A 2KK7A 2K9YA 3U1AA 5GTHH 2M3EA 5AW1B 2IZ0A 2E74D 2KS1B 5KLVG 2WWWA 1VPCA 4C7RA 5DJUB 1VQ5P 3B5ND 1KB9E 1YITP 3AECC 1LT9A 2KSEA 3RK3D 1JY2P 1HJBA 2CK3H 1SP4A 1G2CA 2BEQD 3BCCD 3H25A 4IOIH 5AVTB 3LW5J 2XNXA 2ZT9C 2K9JA 2E5TA 5AW6B 3H1IG 3RK3E 5B5EH 2XZRA 3GHGB 3C8VA 1IK7A 2NPSC 1L4AB 4WY4C 3BCCE 1M57D 3O6QA 1W2EA 5BVZA 3AE8C 1L0NK 1YJ9P 4HH2A 4PJ0H 1T2KD 1KQLA 1ZMEC 3K5BA 2Y0CA 2I8DA 1RE4A 1YJWP 1NAYA 3AE2C 2W6AA 1NTKD 1GW4A 2J58A 1PP9G 3FGAD 1IFIA 5KLIB 1SFCD 1PPJG 1CW5A 3L71D 2IBZD 1JY3O 1NTKE 1MKMA 1J1DB 2QM8A 1NTMG 1BSNA 3H1KG 2H7HA 1JCCA 4U3FD 4PV1B 2IYPA 3L71E 1SQPD 1NJIQ 2E76B 3JC22 1AFOA 1QVFO 1QX8A 2FYUD 2FBWC 1USDA 1AVYA 1FDIA 1ZW0A 1EC5A 2LXBA 1OW7A 3BASA 1OVUA 2B88A 3S1KA 1SQVK 2WSEH 5AVQB 3HD7A 1EZVI 3BRVB 3W68A 4H44D 1K05A 2FYUE 3CX5D 2WVRA 2MJZA 2O01J 2KSJA 3B5NB 1VL2A 1YQ4C 1ZLLA 3RK3B 2WPRA 1X9VA 2AXCA 1YTZI 3CX5E 1FS0E 3HTKA 1GL2C 1XTCC 4UB8E 4C7NB 4K35A 1VQ8P 5AVXB 3RBXA 1MFZA 5BU5A 1EDKA 1JMMA 3HE4A 1L0ND 4GT1A 1EQ7A 2POHA 2YMYA 5GTHE 2OYIC 4IFDK 5KJ7A 3RL0D 1LJ2A 4L73A 1AQ5A 2C0XA 3AE4C 5CCGA 1VQPP 1L0NE 1N7SC 2IZ1A 5AVYB 2WSCH 4M3LA 3CCUP 3GHGC 2YO2A 3KYQA 1FBMA 4RKUJ 1GTWA 1ZR4A 2O01N 3GG2A 1EDJA 3L75J 2NPSD 2FYNB 5AVVB 2E75C 4AUWA 5APSA 5B5EE 4XA4A 1SQVG 5E79H 1VF5D 1NHLA 4BXLA 1AA0A 3H1LE 2O1JA 1HGZA 3HUSA 2O01H 2YXQB 3U59A 1FC2C 2RKLA 4Y28J 1VQKP 1W2BO 2OTLP 5AW2B 2UWJE 2XV5A 4WY4A 1LTBC 2LKMA 2Q7CA 3LIEA 2Q9IA 1HWTC 4OVNF 3A7OA 2OYOA 5KKZB 1P84I 5AVZB 3CXHH 2WPQA 2ZXXA 1PIXA 1VQ7P 3VP8A 4H44B 2HLOA 1BE3D 1NKZB 1N73C 2HPCB 3PHLA 3E1IA 4LC1A 1JTHB 1NAFA 2P1JA 1BSHA 3A0HH 2M8RA 1IK9A 2WSSH 1H0TA 4GOFA 4TLFA 1KMIZ 1BE3E 1CI6A 4EYYQ 1NTZJ 3H1IJ 4N6JA 2E74C 4L75A 1X79B 1SQBK 3MIWA 1RF0A 2D2CC 3TNUB 3CCRP 2V7QJ 1L0LK 3EFFK 1NYHA 5EFWB 2KI7B 3TYYA 3CD6P 3RL0B 4N3YB 3CCSP 1R5LA 1BGYD 2JP3A 2SPZA 2O3JA 3SWFA 4B86A 2FXOA 4D6TE 4U3FJ 3AEEC 1GDTA 5AW8B 2Z5IA 1HGVA 1PP9J 1SQPJ 1GMJA 2WT7A 1JY3N 2ZT9B 4AQRD 2OGUA 1BGYE 4AYCA 1FZCA 2KZIA 4NPFX 4N78D 1NKNA 2QIWA 5KAFE 3W67A 2NPSB 1FJKA 2JWAA 3IF4A 1T2KC 3H1KJ 1VF5B 3L35A 3AE3C 3L36A 3L72D 1VQ6P 4N78E 2A06G 1YJNP 3GMAA 3PTZA 3L74G 1RE3A 1N7SD 2KS1A 1OX3A 1GK4A 1LP1B 1JNMA 1SFCC 4WWIA 1FOSE 5AW5B 2FYNC 5AVWB 3A0BH 1S9KD 5GTIH 3L72E 3TF5A 2ZYDA 2YO3A 4R4LA 4NPDA 2NRGA 3H1HG 3TGUD 1KB9I 2E75D 2P67A 1KC8Q 2IDBA 1BDDA 2WZ7A 1S9KE 2WMMA 3FXEA 5E79E 3R4YA 4YPCA 3GHGA 2V7QH 5APWA 2GM4A 1L4AA 3TGUE 3CPWO 1S3JA 1YQ3C 4H0LD 2YIUC 3H1JD 1ZP0C 1SQBD 2PGDA 3L75G 1KILC 2XU6A 5CBOA 4H44C 4WBAA 2WPSA 1PGQA 1EDLA 3D70A 2JJLA 1L0LD 1TU3F 2WITA 1VQ4P 3F89A 1QLED 3H1JE 3D6ZA 2FFDC 3EQ2A 1Y8AA 1JY3P 1SQQD 2I1JA 1L0LE 3L73D 3QWOC 2ZFCA 1LTJB 3F5HA 1VQNP 1LTGC 2N1TC 1M8OB 4YTPC 1D7MA 3A0HE 1LTAC 3V4WA 3BCCG 4JYBA 1SQQE 4EI2A 1GL2B 5CCHA 3V5BA 3ITKA 3L73E 2W6JH 2AXTH 3II6A 3PRJA 2Q6QA 1KORA 1SQVJ 3RL0C 1N73A 1EXIA 2D2CD 4U7JA 3V2RA 4RO0A 2OYIB 2IBZI 2B89A 2ZVOB 2C0WA 3FWNA 2C9LY 2ZVNB 1BCCE 1N7SB 3A2AA 1NTZG 2YKOA 2JEEA 2PAJA 1LNQA 1NTKG 3B5NA 5C39A 1YIJP 3MD0A 1ZV8A 3V6IA 1E5WA 1NH4A 1VF5C 2OTKE 1J2JB 5KTBA 1NO4A 5KLVD 1IFJA 3BRTB 1OFCX 2E75B 3L71G 2IBZG 1KQGB 2C9NY 2E5YA 3S9OA 3WMM0 3AEFC 5APQA 4C7NA 1J1EC 2QM7A 3GF3A 4PD4D 4U3FG 3CX5I 5KLVE 1PV3A 4LLHA 1SQPG 3WUVA 1K04A 3WU2H 4H0LB 1S5LH 1NU1D 1URQC 3VMXA 2FYUG 1H8AA 2K1AA 3G4SP 4PD4E 5KAIE 1SS1A 3HE5B 4HYTB 4A7PA 3L70D 2OYHC 3QH9A 1NU1E 4R4MA 4OGQC 3USSA 1N73B 1OW6A 2KUBA 3Q3DA 2L91A 2XNDH 3M0DC 3L70E 1IFDA 4XFJA 2W83C 3OAKA 1S1CX 3LW5H 1S4XA 1Y47A 3P8CD 2BASA 4ZKUA 1KILD 1ZR2A 2E74B 3AE6C 3VP9A 1HTLC 4IL6H 2ITAA 2D2CB 1GZLA 3TDKA 1L0NG 1LTSC 4I1LA 3KXDA 1PPJE 2HYNA 3P8CE 1KILE 2PFXA 1LTJC 3AE9C 3L74J 3UIAA 2IFNA 1NTME 2JWDA 1T8ZA 1VDFA 2N1TD 1FZFA 5KJ7D 2KOGA 1SQXD 3CL3D 4I7ZC 2HPCA 2WSFJ 2FKWB 2JR8A 3H1HJ 5TISH 1GU5A 1JTHA 2A45I 2NZ2A 1KYOI 2B87B 5APYA 1SQBJ 5AVRB 3R2PA 1P84H 2GUVA 2AXTE 1A02J 3SFDC 1KTMA 3T97B 2HODB 1M1JC 1MZ9A 1SQXE 2Z5HA 1MV8A 4LGDE 2QG4A 5H2FH 1K8AQ 3VOPA 3B71A 1JEKA 3TNUA 3H1LD 1SFCB 2OTJP 1PFIA 2V4HA 2P7JA 3CC4P 2A45G 1EZVD 2Q3IA 1SVFA 4L76A 2J5UA 5APTA 2Z4EA 1FZEA 2QJKC 4DJGA 1XTGB 3FX0A 3PH0A 3VMZA 1HH0A 1IFMA 4KT0J 1RY3A 1RF1C 2M5AB 1EZVE 1BE3G 4PJ0E 4H0LC 3CWBD 2BCCD 1R5SA 5CJ4A 2NPSA 5L8RJ 3B4SA 3BCCJ 4GDOA 4JF7A 2YIUB 1URQD 1DIPA 3TSIA 3VYIA 1HJ0A 3P8MC 2LR2A 4O9BA 2Y0EA 1KILB 2BCCE 3CWBE 3AE1C 3PLNA 3Q5PA 1VQOP 1M1KQ 1LP1A 3H6PA 3CLQA 4GODA 4OGQD 2GUSA 2G3AA 1U57A 1PGJA 1JUNA 2FFDB 2JO1A 1FJPA 1NVOA 2LXCB 1L2PA 1OWAA 3I55P 2DW3A 3V2PA 2XDJA 1BGYG 1LT9C 3NMDA 1NTKJ 2N1TB 1E79H 1WMKA 5AW0B 1Q81Q 2IYOA 2Y9ZA 1JCDA 3O8ZA 4D6TD 2W90A 4H13C 2WPVB 3L71J 1KB9H 2N9BA 4ZNCA 2Y9YA 3KHUA 4HB1A 2W8ZA 3ZDMA 4IL6E 1HUCA 3RK2D 4Y99C 2Q3EA 1SQQK 3P7KA 3KPEA 3LIDA 1JMBA 1Z56A 3OJAB 5BU8B 1RH5B 3MUDC 1OVRA 3NFQA 3ABVC 4ASWA 3FXDA 1RQVA 1ZN5A 4K3AA 2FYUJ 1RE4C 4WB4A 2YKQA 2RH0A 1FZBA 2XKMA 1DH3A 1LTJA 4JBZA 1CSBA 4I6MC 1RQUA 3TGUG 2R3SA 2M3BA 1P84E 4W80A 1LTIC 1GL2A 3TK1A 1S2EA 3IAOA 1J1EB 1LWUB 1QL1A 5H2FE 2QEXP 4TT3H 5APUA 2OYIA 1G1JA 5DJTB 1URQB 1HVVA 1YHQP 3H1JG 1SQBG 5AW4B 2E42A 1QGKB 2L5GB 2H88C 4RJTA 1N7SA 5KLVK 1JB0J 1KQSO 1L0NJ 1L0LG 3E7KA 2OYHB 1Y9BA 3V2QA 4OGQB 1G1IA 2P2UA 1T3JA 2RN0A 2KXPB 2QSIA 1SQQG 2ZXEB 4YXDC 3B8EB 2IX7C 1R8EA 1M56D 3L73G 5K5GB 3CXHD 3KZIH 2ZYGA 3Q2YA 1NU1K 2KB7P 2AEMA 5AW7B 1UIXA 3WUTA 2VRSA 2G8YA 3H32B 3H1LJ 4CPGA 2HG5D 3CXHE 3BVHA 1KD1Q 1IJDB 1M90Q 2H8PD 3IR9A 2H89C 4W7ZA 1T3UA 1Q82Q 1NGMB 1K9MQ 2KNCB 3HE5A 3CX5H 3G3ZA 3CMEP 2CPBA 5KJ7C 1IO4A 4PD4I 5CMZA 2QRXA 3N4XA 4QMAA 3M9QA 3MGNA 1N2DC 4I7ZB 3M91A 2R5DA 1BCCD 3MTUE 2QJPC 2O1KA 4H13D 3CCLP 1NTMK 4KHXA 3L75E 1M1JB 1BE3J 4ASVA 4HJGH 1OXZA 1HBWA 1FZAA 2K88A 2QA4P 1GU4A 2FXMA 2PP6A 2BEZF 3D6YA 3HUSC 3I5CA 1SQXK 2WSEJ 1OVVA 2J59M 1DEEG 3NTNA 1NU1G 1FDOA 2JDIH 4OWFA 4OH8B 3CI9A 2IPPA 1FDMA 3VN0A 2QJKB 4D6TJ 5CJ0A 1LWUC 4EIJA 3L70G 3CCMP 3MUDA 1EXJA 2ZAEB 4BWNA 1RF1B 4RESB 4BRYB 2B87A 1Q90D 1BGYJ 1NTZD 3H1ID 3AEDC 2M0BA 3T97A 2HODA 5AVSB 1IC2A 3A0BE 5GTIE 2YXRB 1KZUB 1AV1A 1JOCA 3S4RA 1SLQA 5B66H 2KYVA 1GD2E 1NTZE 1K73Q 1LTTC 3Q5RA 2A45H 3H1IE 1KYOH 3VMAA 2MKVA 2QJYC 2JKVA 1USEA 1SFCA
chains in the Genus database with same CATH topology
1BGYG 1L0LG 4U3FG 5KLVG 3H1LG 1KB9H 3L70G 1NTMG 2A06G 3TGUG 1P84H 3H1HG 3H1KG 1BCCG 1PP9G 3L74G 1NU1G 1SQXG 1SQPG 1EZVG 3L71G 1L0NG 4D6TG 2IBZG 1NTZG 3H1IG 1PPJG 3H1JG 1SQBG 3CWBG 1KYOH 2BCCG 1SQQG 3CXHH 3BCCG 1BE3G 1NTKG 4PD4H 3CX5H 1SQVG 2FYUG 3L72G 3L73G 3L75G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BGY G;  1L0L G;  4U3F G;  5KLV G;  3H1L G;  1KB9 H;  3L70 G;  1NTM G;  2A06 G;  3TGU G;  1P84 H;  3H1H G;  3H1K G;  1BCC G;  1PP9 G;  3L74 G;  1NU1 G;  1SQX G;  1SQP G;  1EZV G;  3L71 G;  1L0N G;  4D6T G;  2IBZ G;  1NTZ G;  3H1I G;  1PPJ G;  3H1J G;  1SQB G;  3CWB G;  1KYO H;  2BCC G;  1SQQ G;  3CXH H;  3BCC G;  1BE3 G;  1NTK G;  4PD4 H;  3CX5 H;  1SQV G;  2FYU G;  3L72 G;  3L73 G;  3L75 G; 
#chains in the Genus database with same CATH topology
 1N7L A;  3V2N A;  2B9B A;  1N8R Q;  1RF0 C;  2KLV A;  2R32 A;  4UB6 H;  3HD7 D;  1T6A A;  3L72 J;  1PZQ A;  2WSC J;  1MUU A;  2IBZ E;  1PP9 D;  4ZKP A;  1PPJ D;  3CCJ P;  2R5B A;  3CCV P;  2YMK A;  3G71 P;  1LT9 B;  3WUU A;  2FXP A;  2M5A A;  1YTZ T;  2ZJS E;  1MFT A;  4JYC A;  4U3F E;  1Q86 Q;  3KZI E;  1NOH A;  1GK6 A;  3M9B A;  1G2C B;  5M1B A;  1NTM D;  1SQX G;  1PP9 E;  5AVU B;  3P32 A;  1SQP E;  1AVO A;  3H1K D;  2PRR A;  4EOT A;  1JY2 O;  3RK2 C;  4H13 B;  3TGU J;  2K9J B;  1FZC C;  2FYZ A;  3VTP C;  1HF9 A;  4Y99 B;  1KIL A;  3H1K E;  3CC7 P;  3O6Q B;  1JO5 A;  1VQL P;  1FAV A;  3M0A A;  1WT6 A;  4KJM A;  5CCG D;  1PGO A;  1RE3 C;  3H1J J;  3H1L G;  2FFD A;  5KAF H;  2HFE D;  2HR3 A;  3CCQ P;  1EZV G;  2CPS A;  3MHV A;  3RL0 g;  1YI2 P;  2K3R A;  1L0L J;  4HKZ H;  1U7J A;  1YBK A;  2N1T A;  1ZOY C;  2GA1 A;  3IN6 A;  1SQQ J;  3KDP B;  1DEB A;  3G6E P;  3L73 J;  2W6B A;  3CCE P;  3CWB G;  2BCC G;  1DD3 A;  2KZJ A;  1L4A C;  4EDF A;  2ZT9 D;  3MZW B;  1X22 A;  2AEJ A;  2AEF A;  3NXS A;  3JSV C;  4C46 A;  3U1C A;  4WY4 D;  4GKG A;  3M9H A;  2H43 A;  1JM0 A;  3A5T A;  3PJS K;  1KFN A;  1CZQ A;  1N86 A;  4JPZ B;  1OIP A;  1BCC J;  3JCU H;  1Q7Y Q;  2Y0D A;  2I1K A;  1OMI A;  1KFM A;  3PP5 A;  3FWL A;  3HD7 B;  1QEX A;  3IFM A;  2OQQ A;  1YYC A;  2WQY C;  3L37 A;  4MN4 C;  5KLI C;  2YNY A;  2YKP A;  3WU2 E;  1AJY A;  1S5L E;  1KYO D;  1IFN A;  1SQV D;  1IFP A;  5APV A;  2Q1K A;  2WSF H;  1ZRT D;  1J1D C;  4W7Y A;  1LWU A;  4NPE A;  1GW3 A;  1NWQ A;  4D6T G;  1VQ9 P;  3HTK B;  4PV1 C;  5KLV J;  5CCH C;  5B66 E;  2E43 A;  3Q1M A;  3V4Q A;  1KYO E;  3MP7 B;  1SQV E;  1URQ A;  2N9Y B;  2KP8 A;  2E76 C;  3KQG A;  1ZRT E;  2ZYA A;  3HE4 B;  3AEA C;  1LT1 A;  4UB6 E;  3RGU A;  2K37 A;  1X8Y A;  3L4F A;  1H89 A;  2OYH A;  3Q5S A;  2KIK A;  3AE5 C;  4GOE A;  1M7L A;  1NU1 J;  1OZH A;  1S5L X;  1Q2N A;  4DOJ A;  2QVA A;  2OAR A;  2W27 A;  1KN7 A;  5CBN A;  2QJP B;  3M0D A;  3B5N C;  2IFM A;  1RHZ B;  1DX7 A;  3L70 J;  2KLU A;  3OA7 A;  3RK3 C;  1S72 P;  3L72 G;  4IFF A;  3H32 A;  3VMY A;  5AW9 B;  3E1R A;  1ZXG A;  2WTY A;  1P84 D;  4Z1M H;  4JQ0 D;  1GL2 D;  4I2L C;  3HUS B;  5TIS E;  3AEG C;  3CXH I;  4XE5 B;  2KNC A;  1FU1 A;  3HRN A;  3GW6 A;  3CMA P;  4WVZ A;  1QL2 A;  1U7M A;  4WY4 B;  1KV4 A;  1NTM J;  3C1L A;  4IL6 X;  3CC2 P;  3G9R A;  3A3Y B;  1X0T A;  3N7N A;  3SSU A;  4YXW H;  3M06 A;  2R3C A;  1WRG A;  1OW8 A;  1M1J A;  4PD4 H;  1L4A D;  5KAI H;  3AE7 C;  1JY2 N;  1FE6 A;  3SWK A;  3OW2 O;  1SQX J;  3RBZ A;  1H0T B;  2RMZ A;  1DD4 A;  4DT0 A;  2P58 A;  1PGP A;  3AEB C;  1CI6 B;  1VQM P;  2A06 D;  4ZMD A;  5AW3 B;  2FY8 A;  3HD7 C;  2QJY B;  3L74 D;  1FOS F;  1LGH B;  1BDC A;  4GIF A;  4DCK A;  3JCU E;  3SFE C;  4DZO A;  2A06 E;  2Q5U A;  1NTZ K;  3C9I A;  3EFG A;  3L74 E;  3H1H D;  1NTK K;  3GLM A;  5TJH A;  3BAT A;  5APX A;  3EWK A;  1W5C E;  5KKZ C;  1RF1 A;  1EDI A;  1PL5 A;  4BRY A;  2R44 A;  1FZG A;  1BCC G;  3H1H E;  3SWY A;  4PV1 D;  3RK2 B;  5CCH D;  2WT7 B;  1QVG O;  1KQF B;  1FZC B;  1SQB E;  2P10 A;  2E76 D;  4UB8 H;  4L74 A;  3L75 D;  1SQP K;  1UII A;  2BCC J;  3CWB J;  5CHX A;  5CCG C;  1H88 A;  1KB9 D;  3GF7 A;  1IZN B;  4IFM A;  1AQT A;  2FYU K;  2QE7 H;  3I56 P;  1A02 F;  3D71 A;  2KK7 A;  2K9Y A;  3U1A A;  5GTH H;  2M3E A;  5AW1 B;  2IZ0 A;  2E74 D;  2KS1 B;  5KLV G;  2WWW A;  1VPC A;  4C7R A;  5DJU B;  1VQ5 P;  3B5N D;  1KB9 E;  1YIT P;  3AEC C;  1LT9 A;  2KSE A;  3RK3 D;  1JY2 P;  1HJB A;  2CK3 H;  1SP4 A;  1G2C A;  2BEQ D;  3BCC D;  3H25 A;  4IOI H;  5AVT B;  3LW5 J;  2XNX A;  2ZT9 C;  2K9J A;  2E5T A;  5AW6 B;  3H1I G;  3RK3 E;  5B5E H;  2XZR A;  3GHG B;  3C8V A;  1IK7 A;  2NPS C;  1L4A B;  4WY4 C;  3BCC E;  1M57 D;  3O6Q A;  1W2E A;  5BVZ A;  3AE8 C;  1L0N K;  1YJ9 P;  4HH2 A;  4PJ0 H;  1T2K D;  1KQL A;  1ZME C;  3K5B A;  2Y0C A;  2I8D A;  1RE4 A;  1YJW P;  1NAY A;  3AE2 C;  2W6A A;  1NTK D;  1GW4 A;  2J58 A;  1PP9 G;  3FGA D;  1IFI A;  5KLI B;  1SFC D;  1PPJ G;  1CW5 A;  3L71 D;  2IBZ D;  1JY3 O;  1NTK E;  1MKM A;  1J1D B;  2QM8 A;  1NTM G;  1BSN A;  3H1K G;  2H7H A;  1JCC A;  4U3F D;  4PV1 B;  2IYP A;  3L71 E;  1SQP D;  1NJI Q;  2E76 B;  3JC2 2;  1AFO A;  1QVF O;  1QX8 A;  2FYU D;  2FBW C;  1USD A;  1AVY A;  1FDI A;  1ZW0 A;  1EC5 A;  2LXB A;  1OW7 A;  3BAS A;  1OVU A;  2B88 A;  3S1K A;  1SQV K;  2WSE H;  5AVQ B;  3HD7 A;  1EZV I;  3BRV B;  3W68 A;  4H44 D;  1K05 A;  2FYU E;  3CX5 D;  2WVR A;  2MJZ A;  2O01 J;  2KSJ A;  3B5N B;  1VL2 A;  1YQ4 C;  1ZLL A;  3RK3 B;  2WPR A;  1X9V A;  2AXC A;  1YTZ I;  3CX5 E;  1FS0 E;  3HTK A;  1GL2 C;  1XTC C;  4UB8 E;  4C7N B;  4K35 A;  1VQ8 P;  5AVX B;  3RBX A;  1MFZ A;  5BU5 A;  1EDK A;  1JMM A;  3HE4 A;  1L0N D;  4GT1 A;  1EQ7 A;  2POH A;  2YMY A;  5GTH E;  2OYI C;  4IFD K;  5KJ7 A;  3RL0 D;  1LJ2 A;  4L73 A;  1AQ5 A;  2C0X A;  3AE4 C;  5CCG A;  1VQP P;  1L0N E;  1N7S C;  2IZ1 A;  5AVY B;  2WSC H;  4M3L A;  3CCU P;  3GHG C;  2YO2 A;  3KYQ A;  1FBM A;  4RKU J;  1GTW A;  1ZR4 A;  2O01 N;  3GG2 A;  1EDJ A;  3L75 J;  2NPS D;  2FYN B;  5AVV B;  2E75 C;  4AUW A;  5APS A;  5B5E E;  4XA4 A;  1SQV G;  5E79 H;  1VF5 D;  1NHL A;  4BXL A;  1AA0 A;  3H1L E;  2O1J A;  1HGZ A;  3HUS A;  2O01 H;  2YXQ B;  3U59 A;  1FC2 C;  2RKL A;  4Y28 J;  1VQK P;  1W2B O;  2OTL P;  5AW2 B;  2UWJ E;  2XV5 A;  4WY4 A;  1LTB C;  2LKM A;  2Q7C A;  3LIE A;  2Q9I A;  1HWT C;  4OVN F;  3A7O A;  2OYO A;  5KKZ B;  1P84 I;  5AVZ B;  3CXH H;  2WPQ A;  2ZXX A;  1PIX A;  1VQ7 P;  3VP8 A;  4H44 B;  2HLO A;  1BE3 D;  1NKZ B;  1N73 C;  2HPC B;  3PHL A;  3E1I A;  4LC1 A;  1JTH B;  1NAF A;  2P1J A;  1BSH A;  3A0H H;  2M8R A;  1IK9 A;  2WSS H;  1H0T A;  4GOF A;  4TLF A;  1KMI Z;  1BE3 E;  1CI6 A;  4EYY Q;  1NTZ J;  3H1I J;  4N6J A;  2E74 C;  4L75 A;  1X79 B;  1SQB K;  3MIW A;  1RF0 A;  2D2C C;  3TNU B;  3CCR P;  2V7Q J;  1L0L K;  3EFF K;  1NYH A;  5EFW B;  2KI7 B;  3TYY A;  3CD6 P;  3RL0 B;  4N3Y B;  3CCS P;  1R5L A;  1BGY D;  2JP3 A;  2SPZ A;  2O3J A;  3SWF A;  4B86 A;  2FXO A;  4D6T E;  4U3F J;  3AEE C;  1GDT A;  5AW8 B;  2Z5I A;  1HGV A;  1PP9 J;  1SQP J;  1GMJ A;  2WT7 A;  1JY3 N;  2ZT9 B;  4AQR D;  2OGU A;  1BGY E;  4AYC A;  1FZC A;  2KZI A;  4NPF X;  4N78 D;  1NKN A;  2QIW A;  5KAF E;  3W67 A;  2NPS B;  1FJK A;  2JWA A;  3IF4 A;  1T2K C;  3H1K J;  1VF5 B;  3L35 A;  3AE3 C;  3L36 A;  3L72 D;  1VQ6 P;  4N78 E;  2A06 G;  1YJN P;  3GMA A;  3PTZ A;  3L74 G;  1RE3 A;  1N7S D;  2KS1 A;  1OX3 A;  1GK4 A;  1LP1 B;  1JNM A;  1SFC C;  4WWI A;  1FOS E;  5AW5 B;  2FYN C;  5AVW B;  3A0B H;  1S9K D;  5GTI H;  3L72 E;  3TF5 A;  2ZYD A;  2YO3 A;  4R4L A;  4NPD A;  2NRG A;  3H1H G;  3TGU D;  1KB9 I;  2E75 D;  2P67 A;  1KC8 Q;  2IDB A;  1BDD A;  2WZ7 A;  1S9K E;  2WMM A;  3FXE A;  5E79 E;  3R4Y A;  4YPC A;  3GHG A;  2V7Q H;  5APW A;  2GM4 A;  1L4A A;  3TGU E;  3CPW O;  1S3J A;  1YQ3 C;  4H0L D;  2YIU C;  3H1J D;  1ZP0 C;  1SQB D;  2PGD A;  3L75 G;  1KIL C;  2XU6 A;  5CBO A;  4H44 C;  4WBA A;  2WPS A;  1PGQ A;  1EDL A;  3D70 A;  2JJL A;  1L0L D;  1TU3 F;  2WIT A;  1VQ4 P;  3F89 A;  1QLE D;  3H1J E;  3D6Z A;  2FFD C;  3EQ2 A;  1Y8A A;  1JY3 P;  1SQQ D;  2I1J A;  1L0L E;  3L73 D;  3QWO C;  2ZFC A;  1LTJ B;  3F5H A;  1VQN P;  1LTG C;  2N1T C;  1M8O B;  4YTP C;  1D7M A;  3A0H E;  1LTA C;  3V4W A;  3BCC G;  4JYB A;  1SQQ E;  4EI2 A;  1GL2 B;  5CCH A;  3V5B A;  3ITK A;  3L73 E;  2W6J H;  2AXT H;  3II6 A;  3PRJ A;  2Q6Q A;  1KOR A;  1SQV J;  3RL0 C;  1N73 A;  1EXI A;  2D2C D;  4U7J A;  3V2R A;  4RO0 A;  2OYI B;  2IBZ I;  2B89 A;  2ZVO B;  2C0W A;  3FWN A;  2C9L Y;  2ZVN B;  1BCC E;  1N7S B;  3A2A A;  1NTZ G;  2YKO A;  2JEE A;  2PAJ A;  1LNQ A;  1NTK G;  3B5N A;  5C39 A;  1YIJ P;  3MD0 A;  1ZV8 A;  3V6I A;  1E5W A;  1NH4 A;  1VF5 C;  2OTK E;  1J2J B;  5KTB A;  1NO4 A;  5KLV D;  1IFJ A;  3BRT B;  1OFC X;  2E75 B;  3L71 G;  2IBZ G;  1KQG B;  2C9N Y;  2E5Y A;  3S9O A;  3WMM 0;  3AEF C;  5APQ A;  4C7N A;  1J1E C;  2QM7 A;  3GF3 A;  4PD4 D;  4U3F G;  3CX5 I;  5KLV E;  1PV3 A;  4LLH A;  1SQP G;  3WUV A;  1K04 A;  3WU2 H;  4H0L B;  1S5L H;  1NU1 D;  1URQ C;  3VMX A;  2FYU G;  1H8A A;  2K1A A;  3G4S P;  4PD4 E;  5KAI E;  1SS1 A;  3HE5 B;  4HYT B;  4A7P A;  3L70 D;  2OYH C;  3QH9 A;  1NU1 E;  4R4M A;  4OGQ C;  3USS A;  1N73 B;  1OW6 A;  2KUB A;  3Q3D A;  2L91 A;  2XND H;  3M0D C;  3L70 E;  1IFD A;  4XFJ A;  2W83 C;  3OAK A;  1S1C X;  3LW5 H;  1S4X A;  1Y47 A;  3P8C D;  2BAS A;  4ZKU A;  1KIL D;  1ZR2 A;  2E74 B;  3AE6 C;  3VP9 A;  1HTL C;  4IL6 H;  2ITA A;  2D2C B;  1GZL A;  3TDK A;  1L0N G;  1LTS C;  4I1L A;  3KXD A;  1PPJ E;  2HYN A;  3P8C E;  1KIL E;  2PFX A;  1LTJ C;  3AE9 C;  3L74 J;  3UIA A;  2IFN A;  1NTM E;  2JWD A;  1T8Z A;  1VDF A;  2N1T D;  1FZF A;  5KJ7 D;  2KOG A;  1SQX D;  3CL3 D;  4I7Z C;  2HPC A;  2WSF J;  2FKW B;  2JR8 A;  3H1H J;  5TIS H;  1GU5 A;  1JTH A;  2A45 I;  2NZ2 A;  1KYO I;  2B87 B;  5APY A;  1SQB J;  5AVR B;  3R2P A;  1P84 H;  2GUV A;  2AXT E;  1A02 J;  3SFD C;  1KTM A;  3T97 B;  2HOD B;  1M1J C;  1MZ9 A;  1SQX E;  2Z5H A;  1MV8 A;  4LGD E;  2QG4 A;  5H2F H;  1K8A Q;  3VOP A;  3B71 A;  1JEK A;  3TNU A;  3H1L D;  1SFC B;  2OTJ P;  1PFI A;  2V4H A;  2P7J A;  3CC4 P;  2A45 G;  1EZV D;  2Q3I A;  1SVF A;  4L76 A;  2J5U A;  5APT A;  2Z4E A;  1FZE A;  2QJK C;  4DJG A;  1XTG B;  3FX0 A;  3PH0 A;  3VMZ A;  1HH0 A;  1IFM A;  4KT0 J;  1RY3 A;  1RF1 C;  2M5A B;  1EZV E;  1BE3 G;  4PJ0 E;  4H0L C;  3CWB D;  2BCC D;  1R5S A;  5CJ4 A;  2NPS A;  5L8R J;  3B4S A;  3BCC J;  4GDO A;  4JF7 A;  2YIU B;  1URQ D;  1DIP A;  3TSI A;  3VYI A;  1HJ0 A;  3P8M C;  2LR2 A;  4O9B A;  2Y0E A;  1KIL B;  2BCC E;  3CWB E;  3AE1 C;  3PLN A;  3Q5P A;  1VQO P;  1M1K Q;  1LP1 A;  3H6P A;  3CLQ A;  4GOD A;  4OGQ D;  2GUS A;  2G3A A;  1U57 A;  1PGJ A;  1JUN A;  2FFD B;  2JO1 A;  1FJP A;  1NVO A;  2LXC B;  1L2P A;  1OWA A;  3I55 P;  2DW3 A;  3V2P A;  2XDJ A;  1BGY G;  1LT9 C;  3NMD A;  1NTK J;  2N1T B;  1E79 H;  1WMK A;  5AW0 B;  1Q81 Q;  2IYO A;  2Y9Z A;  1JCD A;  3O8Z A;  4D6T D;  2W90 A;  4H13 C;  2WPV B;  3L71 J;  1KB9 H;  2N9B A;  4ZNC A;  2Y9Y A;  3KHU A;  4HB1 A;  2W8Z A;  3ZDM A;  4IL6 E;  1HUC A;  3RK2 D;  4Y99 C;  2Q3E A;  1SQQ K;  3P7K A;  3KPE A;  3LID A;  1JMB A;  1Z56 A;  3OJA B;  5BU8 B;  1RH5 B;  3MUD C;  1OVR A;  3NFQ A;  3ABV C;  4ASW A;  3FXD A;  1RQV A;  1ZN5 A;  4K3A A;  2FYU J;  1RE4 C;  4WB4 A;  2YKQ A;  2RH0 A;  1FZB A;  2XKM A;  1DH3 A;  1LTJ A;  4JBZ A;  1CSB A;  4I6M C;  1RQU A;  3TGU G;  2R3S A;  2M3B A;  1P84 E;  4W80 A;  1LTI C;  1GL2 A;  3TK1 A;  1S2E A;  3IAO A;  1J1E B;  1LWU B;  1QL1 A;  5H2F E;  2QEX P;  4TT3 H;  5APU A;  2OYI A;  1G1J A;  5DJT B;  1URQ B;  1HVV A;  1YHQ P;  3H1J G;  1SQB G;  5AW4 B;  2E42 A;  1QGK B;  2L5G B;  2H88 C;  4RJT A;  1N7S A;  5KLV K;  1JB0 J;  1KQS O;  1L0N J;  1L0L G;  3E7K A;  2OYH B;  1Y9B A;  3V2Q A;  4OGQ B;  1G1I A;  2P2U A;  1T3J A;  2RN0 A;  2KXP B;  2QSI A;  1SQQ G;  2ZXE B;  4YXD C;  3B8E B;  2IX7 C;  1R8E A;  1M56 D;  3L73 G;  5K5G B;  3CXH D;  3KZI H;  2ZYG A;  3Q2Y A;  1NU1 K;  2KB7 P;  2AEM A;  5AW7 B;  1UIX A;  3WUT A;  2VRS A;  2G8Y A;  3H32 B;  3H1L J;  4CPG A;  2HG5 D;  3CXH E;  3BVH A;  1KD1 Q;  1IJD B;  1M90 Q;  2H8P D;  3IR9 A;  2H89 C;  4W7Z A;  1T3U A;  1Q82 Q;  1NGM B;  1K9M Q;  2KNC B;  3HE5 A;  3CX5 H;  3G3Z A;  3CME P;  2CPB A;  5KJ7 C;  1IO4 A;  4PD4 I;  5CMZ A;  2QRX A;  3N4X A;  4QMA A;  3M9Q A;  3MGN A;  1N2D C;  4I7Z B;  3M91 A;  2R5D A;  1BCC D;  3MTU E;  2QJP C;  2O1K A;  4H13 D;  3CCL P;  1NTM K;  4KHX A;  3L75 E;  1M1J B;  1BE3 J;  4ASV A;  4HJG H;  1OXZ A;  1HBW A;  1FZA A;  2K88 A;  2QA4 P;  1GU4 A;  2FXM A;  2PP6 A;  2BEZ F;  3D6Y A;  3HUS C;  3I5C A;  1SQX K;  2WSE J;  1OVV A;  2J59 M;  1DEE G;  3NTN A;  1NU1 G;  1FDO A;  2JDI H;  4OWF A;  4OH8 B;  3CI9 A;  2IPP A;  1FDM A;  3VN0 A;  2QJK B;  4D6T J;  5CJ0 A;  1LWU C;  4EIJ A;  3L70 G;  3CCM P;  3MUD A;  1EXJ A;  2ZAE B;  4BWN A;  1RF1 B;  4RES B;  4BRY B;  2B87 A;  1Q90 D;  1BGY J;  1NTZ D;  3H1I D;  3AED C;  2M0B A;  3T97 A;  2HOD A;  5AVS B;  1IC2 A;  3A0B E;  5GTI E;  2YXR B;  1KZU B;  1AV1 A;  1JOC A;  3S4R A;  1SLQ A;  5B66 H;  2KYV A;  1GD2 E;  1NTZ E;  1K73 Q;  1LTT C;  3Q5R A;  2A45 H;  3H1I E;  1KYO H;  3VMA A;  2MKV A;  2QJY C;  2JKV A;  1USE A;  1SFC A; 
#chains in the Genus database with same CATH homology
 1BGY G;  1L0L G;  4U3F G;  5KLV G;  3H1L G;  1KB9 H;  3L70 G;  1NTM G;  2A06 G;  3TGU G;  1P84 H;  3H1H G;  3H1K G;  1BCC G;  1PP9 G;  3L74 G;  1NU1 G;  1SQX G;  1SQP G;  1EZV G;  3L71 G;  1L0N G;  4D6T G;  2IBZ G;  1NTZ G;  3H1I G;  1PPJ G;  3H1J G;  1SQB G;  3CWB G;  1KYO H;  2BCC G;  1SQQ G;  3CXH H;  3BCC G;  1BE3 G;  1NTK G;  4PD4 H;  3CX5 H;  1SQV G;  2FYU G;  3L72 G;  3L73 G;  3L75 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...