3L70G

Cytochrome bc1 complex from chicken with trifloxystrobin bound
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
80
structure length
80
Chain Sequence
IHFGNLARVRHIITYSLSPFEQRAIPNIFSDALPNVWRRFSSQVFKVAPPFLGAYLLYSWGTQEFERLKRKNPADYENDQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Mitochondrial ubiquinol-cytochrome-c reductase complex core
publication title Famoxadone and related inhibitors bind like methoxy acrylate inhibitors in the Qo site of the BC1 compl and fix the rieske iron-sulfur protein in a positio close to but distinct from that seen with stigmatellin and other "distal" Qo inhibitors.
rcsb
total genus 19
structure length 80
sequence length 80
chains with identical sequence T
ec nomenclature
pdb deposition date 2009-12-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 3l70G00
4D6TG 1BCCG 3L75G 1SQPG 3H1JG 3L70G 1SQQG 3H1LG 1L0LG 4PD4H 1NTMG 3H1HG 1NU1G 3CXHH 1BE3G 1BGYG 3L73G 1EZVG 1SQVG 2IBZG 3L74G 3CWBG 3BCCG 1PPJG 1SQXG 2A06G 2FYUG 4U3FG 3TGUG 5KLVG 1NTKG 1NTZG 2BCCG 1P84H 1KB9H 3L72G 1SQBG 3CX5H 3L71G 1L0NG 1KYOH 3H1KG 1PP9G 3H1IG
chains in the Genus database with same CATH superfamily
3D71A 4H13B 4GIFA 3L74D 3EFGA 3CX5I 3CCLP 3CMEP 2KSEA 1NU1G 1JY2N 2YKQA 3H1JD 4PV1C 2QJPB 3RBZA 2BCCJ 3H1HE 1EXJA 2K9YA 3GF7A 2D2CD 3E7KA 3GLMA 2QJYC 2WSSH 1GL2A 2HODA 4JYCA 1KFNA 3PTZA 2Q1KA 1NU1J 1KILB 3VN0A 1FC2C 4A7PA 1SQVJ 2QIWA 1FAVA 1NTME 1HWTC 1BGYD 1EZVE 1SQPG 4N6JA 1XTGB 1IC2A 2KLVA 1QL2A 1FE6A 3CD6P 4JF7A 1BE3G 1R5LA 1Q7YQ 5AVRB 2CPSA 4IFFA 4W80A 3GW6A 1NU1K 5AW3B 1YI2P 4RKUJ 1AVOA 2WSEH 4XFJA 2V4HA 1N7SC 3RL0D 5GTHE 1SQPJ 3BCCE 4U3FE 2SPZA 1X79B 1Q86Q 1FDOA 1ZRTD 1IFJA 5L8RJ 3SWFA 2J58A 3L72D 1PIXA 2PP6A 3Q5RA 2DW3A 1VPCA 2W90A 3L35A 2A06G 2JR8A 3LIEA 5B66H 3M0DC 1IO4A 3RK2D 1J1DB 1L0LG 3TYYA 2N1TC 5GTIH 1FOSE 1SQPK 1ZW0A 4YXWH 1CW5A 5KJ7C 4OWFA 1NWQA 1JO5A 1BSNA 2QVAA 2LKMA 3FWLA 5APTA 1L0LJ 2E74C 3BASA 2OYHB 2FFDB 1ZN5A 2L5GB 3OA7A 2ZT9B 1FJPA 1Q90D 2O3JA 1KB9H 2KZJA 2H89C 2IYPA 3B5NC 3GHGC 1RF0A 1N73C 1GU4A 4C46A 4DJGA 3NFQA 3L36A 1LNQA 1L0LK 4XA4A 2WITA 5C39A 2RN0A 4L76A 3HD7D 4YPCA 1NU1D 1N86A 5B66E 3G3ZA 3PRJA 1HF9A 2E43A 3OAKA 1D7MA 1A02J 1OXZA 1KYOI 4H13C 3TNUB 1VF5D 1JY3N 2M8RA 2L91A 2C0XA 5GTIE 1J2JB 2IPPA 1W2BO 2JWAA 4LC1A 2KK7A 2IFMA 1M1JC 3SFDC 3EFFK 1H0TB 1VQMP 1SP4A 2WPSA 1LP1B 5AW7B 1PGQA 3UIAA 1SQBE 1YJNP 2OGUA 4PD4I 1SQPD 1OMIA 4NPDA 1NO4A 4GOFA 3TF5A 1T8ZA 5AW4B 1BE3D 1JM0A 1KILE 1KB9E 1LGHB 2FYUE 2Y0DA 2ZYDA 1HUCA 3PP5A 3O6QB 1FS0E 2YKPA 2HG5D 1VQ9P 1R8EA 1KORA 2OTJP 1QX8A 1USDA 1FZCA 4GODA 3GG2A 3NMDA 1OW7A 3AECC 4N78E 2A06D 2QJKB 2FXPA 1LTSC 1PP9E 2JO1A 1RHZB 1AA0A 2N9BA 3KQGA 3AE5C 1L0LD 1PZQA 3CCSP 5AVQB 2O1JA 3P32A 2RKLA 2AXCA 3A2AA 3MHVA 1LTJA 3AEGC 1GL2B 2HODB 2M3EA 3QWOC 3CWBE 3WUVA 1P84I 3MTUE 4YXDC 2PGDA 3Q3DA 3GMAA 4TT3H 1SFCC 2NPSB 3BATA 5APYA 2FFDC 2G3AA 1JMBA 1QVGO 1VQPP 2KUBA 3L71G 4GKGA 3H1KJ 3MGNA 2H7HA 3L75E 1LWUC 1Y47A 5TISH 3MD0A 3L71J 4Z1MH 3H1LG 3JC22 4LLHA 2N9YB 2P1JA 1OWAA 3WU2E 4OGQC 4GOEA 5EFWB 2LR2A 3AE9C 5CCHA 1UIXA 2Q3EA 4D6TE 3V2NA 2K88A 3AE1C 1NTZG 3CXHD 4K35A 5AW5B 5DJTB 1PGOA 4H0LD 2WVRA 1IZNB 2AXTH 3L70G 3FXDA 3H1LJ 3VMXA 2E74D 3ABVC 4WWIA 1SQXG 2HR3A 1KQGB 1NTZJ 2KI7B 1KTMA 1RE4A 2V7QJ 1PPJE 3L70J 3B5ND 3CX5D 3H1JJ 1Z56A 1HH0A 4I1LA 1K04A 4IL6E 2FKWB 4BRYA 1OVUA 3S9OA 2KYVA 2W6JH 1G2CA 5TISE 4KT0J 1BCCG 1NTZK 2O1KA 1L4AC 1IJDB 2R5DA 2K37A 1NGMB 1M90Q 1EZVI 2A45G 1KC8Q 1RE3C 4ZMDA 1VL2A 5AW8B 1JTHA 2ZXXA 3TGUG 1NTKG 2OARA 4L75A 4CPGA 1SQXK 1BCCJ 2KB7P 2XKMA 2Z4EA 1AQTA 2KSJA 2BCCE 2AXTE 1PGPA 4HH2A 3RK3B 1QVFO 3FXEA 3TGUJ 1MUUA 3V4WA 3EWKA 1AVYA 5CCGA 4JPZB 3L72J 1JEKA 4MN4C 3D6YA 3CCJP 1SQVE 1K05A 2YO3A 4DOJA 2BEQD 2YXQB 1DEBA 4YTPC 3L71D 2NRGA 4I6MC 2NPSC 3H32A 1KZUB 1HTLC 3CCEP 3AEDC 2BEZF 2ZYAA 2HLOA 3L73E 1NTKK 3AE4C 4DT0A 2HYNA 2K3RA 2K1AA 3LW5J 4EDFA 2JKVA 3CI9A 1IK7A 1FZCB 2KLUA 2JEEA 3H1LD 1DH3A 1KD1Q 2GM4A 3H1IG 1GK4A 1SQQG 1LTTC 1NHLA 2HPCA 1RY3A 1OZHA 1NTZD 2J5UA 1OIPA 3KZIH 1IFDA 4UB8H 3HD7A 3L70D 1RH5B 2C0WA 1MV8A 2XV5A 3FGAD 4I7ZC 1M8OB 1SQXD 1X8YA 3A0HH 1S4XA 2H8PD 1LTJB 4H44B 3F89A 3NXSA 2W27A 2ZJSE 1SFCD 2FBWC 2W6AA 3O8ZA 3HUSC 5CBNA 4RO0A 3Q5SA 1KYOD 3C8VA 1IFPA 2IZ1A 1SQQK 2E76C 1BCCD 1LT9A 1PFIA 1Q81Q 1GMJA 3F5HA 1G1IA 3CCRP 3AE7C 3B71A 3TGUD 1KB9I 5B5EH 1K8AQ 1NTKD 2K9JA 1JOCA 4WY4A 4AUWA 2WMMA 4PD4D 1BE3J 4OGQD 3KZIE 2AEMA 1YITP 4UB8E 3Q2YA 1YYCA 2W83C 4WVZA 1SVFA 5AVTB 5APXA 2IX7C 1S9KE 4Y28J 3Q1MA 3N7NA 5CCGD 3H1HG 5APSA 3ZDMA 2QRXA 1U7JA 1GDTA 2E75C 3A0HE 4C7NA 1ZOYC 4Y99B 2QE7H 2IDBA 3RK3E 1JY3P 1SLQA 1NTMG 1NVOA 3H1HJ 1L0NE 2D2CB 1EZVG 1MFTA 2KP8A 2WPRA 1HGVA 3FWNA 3VP8A 1FJKA 5TJHA 2WPQA 2Q7CA 1IFNA 2LXCB 4KHXA 4BRYB 1L4AD 1G2CB 2Q5UA 5B5EE 3H1ID 2WTYA 3BCCG 2P2UA 4U3FG 1SQQD 2R44A 4LGDE 1URQC 2XZRA 4EYYQ 1E5WA 1N7SA 2IZ0A 1EDLA 1P84D 5KLVE 2FY8A 3G4SP 1JTHB 3BRTB 2ZFCA 1NTMK 3RL0B 1JY2O 3MZWB 5K5GB 3G6EP 2OYIB 3BCCJ 4U3FJ 1IFIA 3M0DA 1GW4A 1JCDA 1T6AA 1ZP0C 2IBZE 2QJPC 2Y9ZA 5AVYB 1HGZA 2N1TA 3TSIA 1PV3A 3P8CD 3RK2B 1VDFA 2O01H 1T2KD 5APWA 5KJ7A 1PL5A 1LTGC 2QSIA 2FXOA 1KILC 2Y0EA 1TU3F 3HE4A 5DJUB 3AEEC 3M91A 3A0BH 2V7QH 1OFCX 1EXIA 1BDCA 3H1KE 3H32B 1BSHA 4IOIH 4WY4D 4M3LA 1VQOP 2PRRA 3B5NA 3GHGA 1EDIA 1L2PA 1N73A 5CBOA 3QH9A 4DCKA 1K9MQ 2ITAA 2WSEJ 3B8EB 5APVA 2HPCB 3H1HD 3RBXA 4PV1D 5H2FH 1H8AA 1N8RQ 3Q5PA 1JNMA 3SWYA 3HD7B 1J1EB 1A02F 2VRSA 1J1DC 2WSFH 3CC4P 5AW2B 1NTMD 1VF5B 1SQBG 1XTCC 1X22A 1M1JA 4Y99C 5CJ4A 1EZVD 3L74E 2KZIA 1VQNP 2P67A 4JQ0D 3W67A 3A0BE 3MUDC 3H1JE 2FYUG 1CZQA 2OYHC 3BRVB 2E76D 2D2CC 4GT1A 2YNYA 2WSCH 1MFZA 1SQBJ 2ZT9C 4OVNF 4GDOA 2M5AA 5AW0B 3BCCD 2ZAEB 4U3FD 1N7SD 4IFDK 1LT9B 2KS1A 3LW5H 3KPEA 4K3AA 1CSBA 2YKOA 4IFMA 2FYUJ 1ZV8A 1RF1A 1PP9G 2K9JB 1BGYE 1LTIC 4ZNCA 1YQ3C 1SQBK 5H2FE 1JY3O 3L4FA 1U57A 2N1TD 3S4RA 1HJ0A 1OX3A 2E75D 1S2EA 2E42A 2C9LY 3ITKA 3V2QA 3RL0C 2OYIC 5KJ7D 2FYUK 2W8ZA 1PP9J 2XU6A 4EOTA 2OTKE 2KXPB 1ZRTE 3L72E 5AW1B 1VQ4P 1EDJA 3CWBG 3I5CA 3TK1A 1IK9A 3RK2C 2QJYB 3SFEC 3TDKA 3D6ZA 1VQ8P 4XE5B 2OQQA 2W6BA 2GUVA 1SFCA 5BU5A 3JSVC 2I1JA 2B87A 5CJ0A 1YJ9P 2FFDA 3PHLA 3CWBJ 4HYTB 1SQXJ 3M9HA 1T3UA 1AFOA 1U7MA 4EI2A 2WPVB 3AEFC 1URQD 3L75G 3RGUA 2H43A 1X9VA 2IYOA 3E1RA 4N3YB 2FYZA 4AQRD 1S5LX 2Z5HA 4ZKUA 2QJKC 1LWUA 4H13D 1N7SB 3VYIA 4U7JA 5KAIH 2WT7A 4D6TG 1KN7A 2OYOA 1SQBD 3V4QA 3CLQA 1HBWA 1RQVA 3II6A 3MIWA 2JJLA 1NTKJ 2YMYA 3NTNA 1AJYA 1NU1E 2N1TB 4D6TJ 1KILD 2PAJA 1KB9D 4B86A 3A7OA 1JY2P 2FYUD 4H0LB 1GL2C 3U59A 1FZGA 3C1LA 3MP7B 1MKMA 2H88C 5AW9B 1PPJG 4BXLA 2P7JA 5AVXB 2R3CA 2E74B 4KJMA 1NKZB 4N78D 2GA1A 2JDIH 1N2DC 2POHA 4NPFX 1KV4A 1PP9D 3B5NB 1KQFB 1SQPE 3GHGB 2QEXP 3VTPC 1BE3E 3KHUA 1L4AA 3P8MC 5KAIE 2JWDA 1RE3A 4RESB 4R4MA 1AQ5A 1NH4A 4WBAA 3T97A 3H6PA 1FZEA 3CC2P 2BCCG 1QL1A 3H1IJ 2A06E 2M3BA 3CWBD 1SQQJ 2PFXA 1SQVG 1Y9BA 1M1JB 1L0LE 3AEAC 1S72P 3HE5A 1W2EA 1FU1A 3KXDA 2ZT9D 3USSA 2IBZI 1VQ7P 2FXMA 3EQ2A 3CXHH 3L73G 1YQ4C 5BVZA 3L75D 3WUUA 2R5BA 2NPSA 2M5AB 1YTZT 3JCUH 1RF0C 1ZMEC 2KS1B 1NYHA 3PJSK 1FZBA 2YMKA 2Y0CA 1FDMA 3L73J 4D6TD 1RF1B 1GTWA 4W7ZA 1M7LA 1E79H 1FZFA 1SQVK 3CX5H 1Q82Q 4DZOA 1VQLP 1OW8A 2C9NY 3BVHA 4I2LC 1EDKA 2YO2A 1WRGA 4L73A 1LT1A 1H88A 2GUSA 3PLNA 1N7LA 1DX7A 2XNXA 5KAFH 3RK3C 4UB6H 4EIJA 1USEA 2MJZA 5AVSB 1DIPA 2MKVA 1PPJD 3WMM0 4OH8B 3U1AA 4H0LC 3CXHE 1QGKB 4HJGH 1T3JA 2KIKA 2O01N 1FZAA 5KLIB 3HUSA 2B9BA 3L37A 3M0AA 1SFCB 3C9IA 2B87B 1NTMJ 2BASA 3VP9A 3JCUE 4ZKPA 1VQ5P 3CL3D 2XNDH 2Q9IA 2B89A 1VQKP 1M56D 5E79H 3WUTA 1FZCC 2E5YA 1YJWP 2NZ2A 5M1BA 3CX5E 2Z5IA 2ZVOB 1LWUB 1W5CE 2BCCD 1KQSO 3CPWO 2WT7B 3KDPB 5AVZB 3HRNA 2RMZA 4OGQB 2KNCA 5AVVB 5KKZB 1SQVD 3FX0A 5KAFE 3CCVP 4UB6E 3V2RA 2YIUB 2WZ7A 3IN6A 1GL2D 1YTZI 1KFMA 1LTJC 4H44C 1ZXGA 1NJIQ 2A45I 1L0NG 3CCMP 2NPSD 3L73D 3H25A 3AE6C 2KOGA 4RJTA 1R5SA 2QM7A 2FYNB 1LTBC 1CI6A 3G9RA 3HTKA 1OW6A 5CHXA 2RH0A 4ASVA 1QLED 1L0NJ 2JP3A 4WB4A 1LJ2A 1DEEG 5E79E 2AEJA 3L71E 1M57D 3SWKA 2ZVNB 5KLVG 1L4AB 3K5BA 1MZ9A 1URQA 1RF1C 3KYQA 1KYOH 4PJ0H 1G1JA 3T97B 1PGJA 1L0NK 2LXBA 1KMIZ 5CCHC 2A45H 1YBKA 2IBZG 2M0BA 2YXRB 1UIIA 3H1LE 3GF3A 5KLVJ 2B88A 5APQA 1VQ6P 2P10A 3S1KA 1IFMA 3WU2H 3I56P 4PD4H 3N4XA 2UWJE 1NTZE 1JMMA 1AV1A 2I8DA 3HE5B 3L70E 1ZR2A 1X0TA 1KILA 3H1KG 5KLVK 1FOSF 4AYCA 1NKNA 1RE4C 3AE2C 1SQXE 5KLIC 1S1CX 2QA4P 1GW3A 1GD2E 2QM8A 1Y8AA 1DD4A 3IAOA 1S9KD 3AE3C 4WY4B 1KYOE 1EC5A 4IL6H 1M1KQ 3IFMA 4PJ0E 3W68A 2Q3IA 3E1IA 4NPEA 1BCCE 1ZR4A 1S3JA 1YHQP 2E5TA 2QG4A 2G8YA 3P7KA 2I1KA 1WT6A 3VMYA 3M9BA 1JCCA 3RK3D 3TGUE 4C7NB 1NTKE 3CMAP 5KKZC 4PV1B 4PD4E 1L0ND 1HJBA 3R4YA 4L74A 3L74G 2YIUC 4I7ZB 3A5TA 1QEXA 5CMZA 3U1CA 1P84H 1S5LH 2P58A 4IL6X 5CCGC 3OJAB 1H89A 3M9QA 2IFNA 3H1JG 1NAFA 2O01J 2R32A 3AE8C 3MUDA 3HUSB 3L74J 2J59M 2OYHA 2FYNC 2HFED 2WWWA 2E76B 1GU5A 5KLVD 1FBMA 1BGYG 4BWNA 3B4SA 3CC7P 3OW2O 5APUA 4HKZH 1NAYA 3VOPA 4TLFA 4QMAA 1WMKA 1FDIA 3CCQP 2IBZD 3L75J 1BDDA 2WQYC 4JBZA 4R4LA 3V2PA 3H1IE 1BGYJ 1HVVA 1OVRA 3HD7C 1SQQE 2KNCB 3D70A 1J1EC 3TNUA 1OVVA 3L72G 2OYIA 2Q6QA 4H44D 3VMZA 1P84E 1S5LE 3R2PA 2E75B 2CPBA 1VF5C 4W7YA 3M06A 1JB0J 1JUNA 5KTBA 1Q2NA 2WSFJ 2ZXEB 1H0TA 3H1KD 3PH0A 3RL0g 2OTLP 3V6IA 1LP1A 3AEBC 3CCUP 3HE4B 4ASWA 3SSUA 1CI6B 3V5BA 5AVUB 1LTAC 3IF4A 1T2KC 3HTKB 5BU8B 1GK6A 5AVWB 3I55P 1GZLA 1KQLA 4JYBA 3P8CE 2Y9YA 2XDJA 2WSCJ 1RQUA 1LT9C 2ZYGA 3O6QA 3G71P 1N73B 3CXHI 1K73Q 5AW6B 3A3YB 3VMAA 1NOHA 4HB1A 1ZLLA 1YIJP 4O9BA 3LIDA 4C7RA 1DD3A 4WY4C 1SS1A 2AEFA 1EQ7A 1URQB 2R3SA 5CCHD 3IR9A 2CK3H 5GTHH
chains in the Genus database with same CATH topology
4D6TG 1BCCG 3L75G 1SQPG 3H1JG 3L70G 1SQQG 3H1LG 1L0LG 4PD4H 1NTMG 3H1HG 1NU1G 3CXHH 1BE3G 1BGYG 3L73G 1EZVG 1SQVG 2IBZG 3L74G 3CWBG 3BCCG 1PPJG 1SQXG 2A06G 2FYUG 4U3FG 3TGUG 5KLVG 1NTKG 1NTZG 2BCCG 1P84H 1KB9H 3L72G 1SQBG 3CX5H 3L71G 1L0NG 1KYOH 3H1KG 1PP9G 3H1IG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4D6T G;  1BCC G;  3L75 G;  1SQP G;  3H1J G;  3L70 G;  1SQQ G;  3H1L G;  1L0L G;  4PD4 H;  1NTM G;  3H1H G;  1NU1 G;  3CXH H;  1BE3 G;  1BGY G;  3L73 G;  1EZV G;  1SQV G;  2IBZ G;  3L74 G;  3CWB G;  3BCC G;  1PPJ G;  1SQX G;  2A06 G;  2FYU G;  4U3F G;  3TGU G;  5KLV G;  1NTK G;  1NTZ G;  2BCC G;  1P84 H;  1KB9 H;  3L72 G;  1SQB G;  3CX5 H;  3L71 G;  1L0N G;  1KYO H;  3H1K G;  1PP9 G;  3H1I G; 
#chains in the Genus database with same CATH topology
 3D71 A;  4H13 B;  4GIF A;  3L74 D;  3EFG A;  3CX5 I;  3CCL P;  3CME P;  2KSE A;  1NU1 G;  1JY2 N;  2YKQ A;  3H1J D;  4PV1 C;  2QJP B;  3RBZ A;  2BCC J;  3H1H E;  1EXJ A;  2K9Y A;  3GF7 A;  2D2C D;  3E7K A;  3GLM A;  2QJY C;  2WSS H;  1GL2 A;  2HOD A;  4JYC A;  1KFN A;  3PTZ A;  2Q1K A;  1NU1 J;  1KIL B;  3VN0 A;  1FC2 C;  4A7P A;  1SQV J;  2QIW A;  1FAV A;  1NTM E;  1HWT C;  1BGY D;  1EZV E;  1SQP G;  4N6J A;  1XTG B;  1IC2 A;  2KLV A;  1QL2 A;  1FE6 A;  3CD6 P;  4JF7 A;  1BE3 G;  1R5L A;  1Q7Y Q;  5AVR B;  2CPS A;  4IFF A;  4W80 A;  3GW6 A;  1NU1 K;  5AW3 B;  1YI2 P;  4RKU J;  1AVO A;  2WSE H;  4XFJ A;  2V4H A;  1N7S C;  3RL0 D;  5GTH E;  1SQP J;  3BCC E;  4U3F E;  2SPZ A;  1X79 B;  1Q86 Q;  1FDO A;  1ZRT D;  1IFJ A;  5L8R J;  3SWF A;  2J58 A;  3L72 D;  1PIX A;  2PP6 A;  3Q5R A;  2DW3 A;  1VPC A;  2W90 A;  3L35 A;  2A06 G;  2JR8 A;  3LIE A;  5B66 H;  3M0D C;  1IO4 A;  3RK2 D;  1J1D B;  1L0L G;  3TYY A;  2N1T C;  5GTI H;  1FOS E;  1SQP K;  1ZW0 A;  4YXW H;  1CW5 A;  5KJ7 C;  4OWF A;  1NWQ A;  1JO5 A;  1BSN A;  2QVA A;  2LKM A;  3FWL A;  5APT A;  1L0L J;  2E74 C;  3BAS A;  2OYH B;  2FFD B;  1ZN5 A;  2L5G B;  3OA7 A;  2ZT9 B;  1FJP A;  1Q90 D;  2O3J A;  1KB9 H;  2KZJ A;  2H89 C;  2IYP A;  3B5N C;  3GHG C;  1RF0 A;  1N73 C;  1GU4 A;  4C46 A;  4DJG A;  3NFQ A;  3L36 A;  1LNQ A;  1L0L K;  4XA4 A;  2WIT A;  5C39 A;  2RN0 A;  4L76 A;  3HD7 D;  4YPC A;  1NU1 D;  1N86 A;  5B66 E;  3G3Z A;  3PRJ A;  1HF9 A;  2E43 A;  3OAK A;  1D7M A;  1A02 J;  1OXZ A;  1KYO I;  4H13 C;  3TNU B;  1VF5 D;  1JY3 N;  2M8R A;  2L91 A;  2C0X A;  5GTI E;  1J2J B;  2IPP A;  1W2B O;  2JWA A;  4LC1 A;  2KK7 A;  2IFM A;  1M1J C;  3SFD C;  3EFF K;  1H0T B;  1VQM P;  1SP4 A;  2WPS A;  1LP1 B;  5AW7 B;  1PGQ A;  3UIA A;  1SQB E;  1YJN P;  2OGU A;  4PD4 I;  1SQP D;  1OMI A;  4NPD A;  1NO4 A;  4GOF A;  3TF5 A;  1T8Z A;  5AW4 B;  1BE3 D;  1JM0 A;  1KIL E;  1KB9 E;  1LGH B;  2FYU E;  2Y0D A;  2ZYD A;  1HUC A;  3PP5 A;  3O6Q B;  1FS0 E;  2YKP A;  2HG5 D;  1VQ9 P;  1R8E A;  1KOR A;  2OTJ P;  1QX8 A;  1USD A;  1FZC A;  4GOD A;  3GG2 A;  3NMD A;  1OW7 A;  3AEC C;  4N78 E;  2A06 D;  2QJK B;  2FXP A;  1LTS C;  1PP9 E;  2JO1 A;  1RHZ B;  1AA0 A;  2N9B A;  3KQG A;  3AE5 C;  1L0L D;  1PZQ A;  3CCS P;  5AVQ B;  2O1J A;  3P32 A;  2RKL A;  2AXC A;  3A2A A;  3MHV A;  1LTJ A;  3AEG C;  1GL2 B;  2HOD B;  2M3E A;  3QWO C;  3CWB E;  3WUV A;  1P84 I;  3MTU E;  4YXD C;  2PGD A;  3Q3D A;  3GMA A;  4TT3 H;  1SFC C;  2NPS B;  3BAT A;  5APY A;  2FFD C;  2G3A A;  1JMB A;  1QVG O;  1VQP P;  2KUB A;  3L71 G;  4GKG A;  3H1K J;  3MGN A;  2H7H A;  3L75 E;  1LWU C;  1Y47 A;  5TIS H;  3MD0 A;  3L71 J;  4Z1M H;  3H1L G;  3JC2 2;  4LLH A;  2N9Y B;  2P1J A;  1OWA A;  3WU2 E;  4OGQ C;  4GOE A;  5EFW B;  2LR2 A;  3AE9 C;  5CCH A;  1UIX A;  2Q3E A;  4D6T E;  3V2N A;  2K88 A;  3AE1 C;  1NTZ G;  3CXH D;  4K35 A;  5AW5 B;  5DJT B;  1PGO A;  4H0L D;  2WVR A;  1IZN B;  2AXT H;  3L70 G;  3FXD A;  3H1L J;  3VMX A;  2E74 D;  3ABV C;  4WWI A;  1SQX G;  2HR3 A;  1KQG B;  1NTZ J;  2KI7 B;  1KTM A;  1RE4 A;  2V7Q J;  1PPJ E;  3L70 J;  3B5N D;  3CX5 D;  3H1J J;  1Z56 A;  1HH0 A;  4I1L A;  1K04 A;  4IL6 E;  2FKW B;  4BRY A;  1OVU A;  3S9O A;  2KYV A;  2W6J H;  1G2C A;  5TIS E;  4KT0 J;  1BCC G;  1NTZ K;  2O1K A;  1L4A C;  1IJD B;  2R5D A;  2K37 A;  1NGM B;  1M90 Q;  1EZV I;  2A45 G;  1KC8 Q;  1RE3 C;  4ZMD A;  1VL2 A;  5AW8 B;  1JTH A;  2ZXX A;  3TGU G;  1NTK G;  2OAR A;  4L75 A;  4CPG A;  1SQX K;  1BCC J;  2KB7 P;  2XKM A;  2Z4E A;  1AQT A;  2KSJ A;  2BCC E;  2AXT E;  1PGP A;  4HH2 A;  3RK3 B;  1QVF O;  3FXE A;  3TGU J;  1MUU A;  3V4W A;  3EWK A;  1AVY A;  5CCG A;  4JPZ B;  3L72 J;  1JEK A;  4MN4 C;  3D6Y A;  3CCJ P;  1SQV E;  1K05 A;  2YO3 A;  4DOJ A;  2BEQ D;  2YXQ B;  1DEB A;  4YTP C;  3L71 D;  2NRG A;  4I6M C;  2NPS C;  3H32 A;  1KZU B;  1HTL C;  3CCE P;  3AED C;  2BEZ F;  2ZYA A;  2HLO A;  3L73 E;  1NTK K;  3AE4 C;  4DT0 A;  2HYN A;  2K3R A;  2K1A A;  3LW5 J;  4EDF A;  2JKV A;  3CI9 A;  1IK7 A;  1FZC B;  2KLU A;  2JEE A;  3H1L D;  1DH3 A;  1KD1 Q;  2GM4 A;  3H1I G;  1GK4 A;  1SQQ G;  1LTT C;  1NHL A;  2HPC A;  1RY3 A;  1OZH A;  1NTZ D;  2J5U A;  1OIP A;  3KZI H;  1IFD A;  4UB8 H;  3HD7 A;  3L70 D;  1RH5 B;  2C0W A;  1MV8 A;  2XV5 A;  3FGA D;  4I7Z C;  1M8O B;  1SQX D;  1X8Y A;  3A0H H;  1S4X A;  2H8P D;  1LTJ B;  4H44 B;  3F89 A;  3NXS A;  2W27 A;  2ZJS E;  1SFC D;  2FBW C;  2W6A A;  3O8Z A;  3HUS C;  5CBN A;  4RO0 A;  3Q5S A;  1KYO D;  3C8V A;  1IFP A;  2IZ1 A;  1SQQ K;  2E76 C;  1BCC D;  1LT9 A;  1PFI A;  1Q81 Q;  1GMJ A;  3F5H A;  1G1I A;  3CCR P;  3AE7 C;  3B71 A;  3TGU D;  1KB9 I;  5B5E H;  1K8A Q;  1NTK D;  2K9J A;  1JOC A;  4WY4 A;  4AUW A;  2WMM A;  4PD4 D;  1BE3 J;  4OGQ D;  3KZI E;  2AEM A;  1YIT P;  4UB8 E;  3Q2Y A;  1YYC A;  2W83 C;  4WVZ A;  1SVF A;  5AVT B;  5APX A;  2IX7 C;  1S9K E;  4Y28 J;  3Q1M A;  3N7N A;  5CCG D;  3H1H G;  5APS A;  3ZDM A;  2QRX A;  1U7J A;  1GDT A;  2E75 C;  3A0H E;  4C7N A;  1ZOY C;  4Y99 B;  2QE7 H;  2IDB A;  3RK3 E;  1JY3 P;  1SLQ A;  1NTM G;  1NVO A;  3H1H J;  1L0N E;  2D2C B;  1EZV G;  1MFT A;  2KP8 A;  2WPR A;  1HGV A;  3FWN A;  3VP8 A;  1FJK A;  5TJH A;  2WPQ A;  2Q7C A;  1IFN A;  2LXC B;  4KHX A;  4BRY B;  1L4A D;  1G2C B;  2Q5U A;  5B5E E;  3H1I D;  2WTY A;  3BCC G;  2P2U A;  4U3F G;  1SQQ D;  2R44 A;  4LGD E;  1URQ C;  2XZR A;  4EYY Q;  1E5W A;  1N7S A;  2IZ0 A;  1EDL A;  1P84 D;  5KLV E;  2FY8 A;  3G4S P;  1JTH B;  3BRT B;  2ZFC A;  1NTM K;  3RL0 B;  1JY2 O;  3MZW B;  5K5G B;  3G6E P;  2OYI B;  3BCC J;  4U3F J;  1IFI A;  3M0D A;  1GW4 A;  1JCD A;  1T6A A;  1ZP0 C;  2IBZ E;  2QJP C;  2Y9Z A;  5AVY B;  1HGZ A;  2N1T A;  3TSI A;  1PV3 A;  3P8C D;  3RK2 B;  1VDF A;  2O01 H;  1T2K D;  5APW A;  5KJ7 A;  1PL5 A;  1LTG C;  2QSI A;  2FXO A;  1KIL C;  2Y0E A;  1TU3 F;  3HE4 A;  5DJU B;  3AEE C;  3M91 A;  3A0B H;  2V7Q H;  1OFC X;  1EXI A;  1BDC A;  3H1K E;  3H32 B;  1BSH A;  4IOI H;  4WY4 D;  4M3L A;  1VQO P;  2PRR A;  3B5N A;  3GHG A;  1EDI A;  1L2P A;  1N73 A;  5CBO A;  3QH9 A;  4DCK A;  1K9M Q;  2ITA A;  2WSE J;  3B8E B;  5APV A;  2HPC B;  3H1H D;  3RBX A;  4PV1 D;  5H2F H;  1H8A A;  1N8R Q;  3Q5P A;  1JNM A;  3SWY A;  3HD7 B;  1J1E B;  1A02 F;  2VRS A;  1J1D C;  2WSF H;  3CC4 P;  5AW2 B;  1NTM D;  1VF5 B;  1SQB G;  1XTC C;  1X22 A;  1M1J A;  4Y99 C;  5CJ4 A;  1EZV D;  3L74 E;  2KZI A;  1VQN P;  2P67 A;  4JQ0 D;  3W67 A;  3A0B E;  3MUD C;  3H1J E;  2FYU G;  1CZQ A;  2OYH C;  3BRV B;  2E76 D;  2D2C C;  4GT1 A;  2YNY A;  2WSC H;  1MFZ A;  1SQB J;  2ZT9 C;  4OVN F;  4GDO A;  2M5A A;  5AW0 B;  3BCC D;  2ZAE B;  4U3F D;  1N7S D;  4IFD K;  1LT9 B;  2KS1 A;  3LW5 H;  3KPE A;  4K3A A;  1CSB A;  2YKO A;  4IFM A;  2FYU J;  1ZV8 A;  1RF1 A;  1PP9 G;  2K9J B;  1BGY E;  1LTI C;  4ZNC A;  1YQ3 C;  1SQB K;  5H2F E;  1JY3 O;  3L4F A;  1U57 A;  2N1T D;  3S4R A;  1HJ0 A;  1OX3 A;  2E75 D;  1S2E A;  2E42 A;  2C9L Y;  3ITK A;  3V2Q A;  3RL0 C;  2OYI C;  5KJ7 D;  2FYU K;  2W8Z A;  1PP9 J;  2XU6 A;  4EOT A;  2OTK E;  2KXP B;  1ZRT E;  3L72 E;  5AW1 B;  1VQ4 P;  1EDJ A;  3CWB G;  3I5C A;  3TK1 A;  1IK9 A;  3RK2 C;  2QJY B;  3SFE C;  3TDK A;  3D6Z A;  1VQ8 P;  4XE5 B;  2OQQ A;  2W6B A;  2GUV A;  1SFC A;  5BU5 A;  3JSV C;  2I1J A;  2B87 A;  5CJ0 A;  1YJ9 P;  2FFD A;  3PHL A;  3CWB J;  4HYT B;  1SQX J;  3M9H A;  1T3U A;  1AFO A;  1U7M A;  4EI2 A;  2WPV B;  3AEF C;  1URQ D;  3L75 G;  3RGU A;  2H43 A;  1X9V A;  2IYO A;  3E1R A;  4N3Y B;  2FYZ A;  4AQR D;  1S5L X;  2Z5H A;  4ZKU A;  2QJK C;  1LWU A;  4H13 D;  1N7S B;  3VYI A;  4U7J A;  5KAI H;  2WT7 A;  4D6T G;  1KN7 A;  2OYO A;  1SQB D;  3V4Q A;  3CLQ A;  1HBW A;  1RQV A;  3II6 A;  3MIW A;  2JJL A;  1NTK J;  2YMY A;  3NTN A;  1AJY A;  1NU1 E;  2N1T B;  4D6T J;  1KIL D;  2PAJ A;  1KB9 D;  4B86 A;  3A7O A;  1JY2 P;  2FYU D;  4H0L B;  1GL2 C;  3U59 A;  1FZG A;  3C1L A;  3MP7 B;  1MKM A;  2H88 C;  5AW9 B;  1PPJ G;  4BXL A;  2P7J A;  5AVX B;  2R3C A;  2E74 B;  4KJM A;  1NKZ B;  4N78 D;  2GA1 A;  2JDI H;  1N2D C;  2POH A;  4NPF X;  1KV4 A;  1PP9 D;  3B5N B;  1KQF B;  1SQP E;  3GHG B;  2QEX P;  3VTP C;  1BE3 E;  3KHU A;  1L4A A;  3P8M C;  5KAI E;  2JWD A;  1RE3 A;  4RES B;  4R4M A;  1AQ5 A;  1NH4 A;  4WBA A;  3T97 A;  3H6P A;  1FZE A;  3CC2 P;  2BCC G;  1QL1 A;  3H1I J;  2A06 E;  2M3B A;  3CWB D;  1SQQ J;  2PFX A;  1SQV G;  1Y9B A;  1M1J B;  1L0L E;  3AEA C;  1S72 P;  3HE5 A;  1W2E A;  1FU1 A;  3KXD A;  2ZT9 D;  3USS A;  2IBZ I;  1VQ7 P;  2FXM A;  3EQ2 A;  3CXH H;  3L73 G;  1YQ4 C;  5BVZ A;  3L75 D;  3WUU A;  2R5B A;  2NPS A;  2M5A B;  1YTZ T;  3JCU H;  1RF0 C;  1ZME C;  2KS1 B;  1NYH A;  3PJS K;  1FZB A;  2YMK A;  2Y0C A;  1FDM A;  3L73 J;  4D6T D;  1RF1 B;  1GTW A;  4W7Z A;  1M7L A;  1E79 H;  1FZF A;  1SQV K;  3CX5 H;  1Q82 Q;  4DZO A;  1VQL P;  1OW8 A;  2C9N Y;  3BVH A;  4I2L C;  1EDK A;  2YO2 A;  1WRG A;  4L73 A;  1LT1 A;  1H88 A;  2GUS A;  3PLN A;  1N7L A;  1DX7 A;  2XNX A;  5KAF H;  3RK3 C;  4UB6 H;  4EIJ A;  1USE A;  2MJZ A;  5AVS B;  1DIP A;  2MKV A;  1PPJ D;  3WMM 0;  4OH8 B;  3U1A A;  4H0L C;  3CXH E;  1QGK B;  4HJG H;  1T3J A;  2KIK A;  2O01 N;  1FZA A;  5KLI B;  3HUS A;  2B9B A;  3L37 A;  3M0A A;  1SFC B;  3C9I A;  2B87 B;  1NTM J;  2BAS A;  3VP9 A;  3JCU E;  4ZKP A;  1VQ5 P;  3CL3 D;  2XND H;  2Q9I A;  2B89 A;  1VQK P;  1M56 D;  5E79 H;  3WUT A;  1FZC C;  2E5Y A;  1YJW P;  2NZ2 A;  5M1B A;  3CX5 E;  2Z5I A;  2ZVO B;  1LWU B;  1W5C E;  2BCC D;  1KQS O;  3CPW O;  2WT7 B;  3KDP B;  5AVZ B;  3HRN A;  2RMZ A;  4OGQ B;  2KNC A;  5AVV B;  5KKZ B;  1SQV D;  3FX0 A;  5KAF E;  3CCV P;  4UB6 E;  3V2R A;  2YIU B;  2WZ7 A;  3IN6 A;  1GL2 D;  1YTZ I;  1KFM A;  1LTJ C;  4H44 C;  1ZXG A;  1NJI Q;  2A45 I;  1L0N G;  3CCM P;  2NPS D;  3L73 D;  3H25 A;  3AE6 C;  2KOG A;  4RJT A;  1R5S A;  2QM7 A;  2FYN B;  1LTB C;  1CI6 A;  3G9R A;  3HTK A;  1OW6 A;  5CHX A;  2RH0 A;  4ASV A;  1QLE D;  1L0N J;  2JP3 A;  4WB4 A;  1LJ2 A;  1DEE G;  5E79 E;  2AEJ A;  3L71 E;  1M57 D;  3SWK A;  2ZVN B;  5KLV G;  1L4A B;  3K5B A;  1MZ9 A;  1URQ A;  1RF1 C;  3KYQ A;  1KYO H;  4PJ0 H;  1G1J A;  3T97 B;  1PGJ A;  1L0N K;  2LXB A;  1KMI Z;  5CCH C;  2A45 H;  1YBK A;  2IBZ G;  2M0B A;  2YXR B;  1UII A;  3H1L E;  3GF3 A;  5KLV J;  2B88 A;  5APQ A;  1VQ6 P;  2P10 A;  3S1K A;  1IFM A;  3WU2 H;  3I56 P;  4PD4 H;  3N4X A;  2UWJ E;  1NTZ E;  1JMM A;  1AV1 A;  2I8D A;  3HE5 B;  3L70 E;  1ZR2 A;  1X0T A;  1KIL A;  3H1K G;  5KLV K;  1FOS F;  4AYC A;  1NKN A;  1RE4 C;  3AE2 C;  1SQX E;  5KLI C;  1S1C X;  2QA4 P;  1GW3 A;  1GD2 E;  2QM8 A;  1Y8A A;  1DD4 A;  3IAO A;  1S9K D;  3AE3 C;  4WY4 B;  1KYO E;  1EC5 A;  4IL6 H;  1M1K Q;  3IFM A;  4PJ0 E;  3W68 A;  2Q3I A;  3E1I A;  4NPE A;  1BCC E;  1ZR4 A;  1S3J A;  1YHQ P;  2E5T A;  2QG4 A;  2G8Y A;  3P7K A;  2I1K A;  1WT6 A;  3VMY A;  3M9B A;  1JCC A;  3RK3 D;  3TGU E;  4C7N B;  1NTK E;  3CMA P;  5KKZ C;  4PV1 B;  4PD4 E;  1L0N D;  1HJB A;  3R4Y A;  4L74 A;  3L74 G;  2YIU C;  4I7Z B;  3A5T A;  1QEX A;  5CMZ A;  3U1C A;  1P84 H;  1S5L H;  2P58 A;  4IL6 X;  5CCG C;  3OJA B;  1H89 A;  3M9Q A;  2IFN A;  3H1J G;  1NAF A;  2O01 J;  2R32 A;  3AE8 C;  3MUD A;  3HUS B;  3L74 J;  2J59 M;  2OYH A;  2FYN C;  2HFE D;  2WWW A;  2E76 B;  1GU5 A;  5KLV D;  1FBM A;  1BGY G;  4BWN A;  3B4S A;  3CC7 P;  3OW2 O;  5APU A;  4HKZ H;  1NAY A;  3VOP A;  4TLF A;  4QMA A;  1WMK A;  1FDI A;  3CCQ P;  2IBZ D;  3L75 J;  1BDD A;  2WQY C;  4JBZ A;  4R4L A;  3V2P A;  3H1I E;  1BGY J;  1HVV A;  1OVR A;  3HD7 C;  1SQQ E;  2KNC B;  3D70 A;  1J1E C;  3TNU A;  1OVV A;  3L72 G;  2OYI A;  2Q6Q A;  4H44 D;  3VMZ A;  1P84 E;  1S5L E;  3R2P A;  2E75 B;  2CPB A;  1VF5 C;  4W7Y A;  3M06 A;  1JB0 J;  1JUN A;  5KTB A;  1Q2N A;  2WSF J;  2ZXE B;  1H0T A;  3H1K D;  3PH0 A;  3RL0 g;  2OTL P;  3V6I A;  1LP1 A;  3AEB C;  3CCU P;  3HE4 B;  4ASW A;  3SSU A;  1CI6 B;  3V5B A;  5AVU B;  1LTA C;  3IF4 A;  1T2K C;  3HTK B;  5BU8 B;  1GK6 A;  5AVW B;  3I55 P;  1GZL A;  1KQL A;  4JYB A;  3P8C E;  2Y9Y A;  2XDJ A;  2WSC J;  1RQU A;  1LT9 C;  2ZYG A;  3O6Q A;  3G71 P;  1N73 B;  3CXH I;  1K73 Q;  5AW6 B;  3A3Y B;  3VMA A;  1NOH A;  4HB1 A;  1ZLL A;  1YIJ P;  4O9B A;  3LID A;  4C7R A;  1DD3 A;  4WY4 C;  1SS1 A;  2AEF A;  1EQ7 A;  1URQ B;  2R3S A;  5CCH D;  3IR9 A;  2CK3 H;  5GTH H; 
#chains in the Genus database with same CATH homology
 4D6T G;  1BCC G;  3L75 G;  1SQP G;  3H1J G;  3L70 G;  1SQQ G;  3H1L G;  1L0L G;  4PD4 H;  1NTM G;  3H1H G;  1NU1 G;  3CXH H;  1BE3 G;  1BGY G;  3L73 G;  1EZV G;  1SQV G;  2IBZ G;  3L74 G;  3CWB G;  3BCC G;  1PPJ G;  1SQX G;  2A06 G;  2FYU G;  4U3F G;  3TGU G;  5KLV G;  1NTK G;  1NTZ G;  2BCC G;  1P84 H;  1KB9 H;  3L72 G;  1SQB G;  3CX5 H;  3L71 G;  1L0N G;  1KYO H;  3H1K G;  1PP9 G;  3H1I G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...