4JYCA

Meab, a bacterial homolog of mmaa, in its apo form
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
322
structure length
311
Chain Sequence
PDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPKKGIFELADMIAVNKAGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
molecule keywords Methylmalonyl-CoA mutase accessory protein
total genus 115
structure length 311
sequence length 322
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jycA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jycA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jycA02
3ICEA 2GXSA 3FFBA 4QG7A 1EFCA 3IQWA 4ZCLA 3OEEA 4LYJA 5BW8A 1KDPA 3KKOA 5CIQA 1Z07A 821PA 4G5RA 1ZD9A 3RRMA 1M8PA 2HXSA 4QM7A 5AK0A 3AEZA 3QKSA 3NTNA 1IBRA 3RLFA 2VTKA 2ZJ5A 4LYAA 4BFXA 2RAPA 3BWDD 3A3YB 4M9XA 3EARA 2GILA 2PZGA 5EP2A 1LW7A 5FL7A 1G9XA 3QSYA 2BMJA 2ORWA 3HPRA 4TT3D 4LV6A 2ZJOA 4URUR 4DIDA 5CITA 3TE6A 3KQUA 5SZJA 3KKMA 1GAJA 1VKJA 1HT1E 4TN1A 1KO5A 1IN5A 5E4FA 1P3JA 4DEXA 2EFGA 5TXGA 1S1CA 5H68A 4IDPA 4DCTA 3FVQA 1LF5A 1CULC 1MV5A 5HKKA 2WKQA 2F43B 2V7QA 4MT8A 3GEHA 4LRWA 5KNBA 3T15A 5J5CA 2YWFA 3OF5A 4QHSA 1Z29A 1T4GA 3LLUA 5JECA 1PVOA 4N1AA 4TYYA 2QBYB 1ZC3A 2MMGA 3LQQA 4BLSA 2VQSA 3K0FB 4TLCA 1WXQA 1NG1A 1HURA 4U7NA 1ZW6A 2CLCX 2VO1A 3AV0B 4TSFA 3SHFA 5IHPA 2PJZA 5CB6A 4DUGA 2ATXA 3BS4A 4Q1CA 3AQ4A 1OWAA 1FP6A 4DCVA 4QBHA 1TEVA 5FBQB 1M34E 2L0XA 3RRNA 3TNUB 2QAGB 3G82C 4MRNA 4TMXA 2CVFA 1P2SA 1SKYB 1UPTA 1XDBA 1U0JA 5AVTB 4IOLA 4P32A 3UWOA 2G6BA 5LDDC 1NJFA 2GAAA 1N5JA 4H9GA 3PUYA 1GU4A 4XD7A 4BZPA 2HJGA 2R6FA 2VHTA 2WICA 1HH4A 5JEEA 1F6BA 1XD9A 4AYCA 4TYWA 1LFDB 2CCKA 3AF2A 1ZYUA 3L0IB 3DMNA 1VTKA 3GLGB 1E1RD 1GTVA 1BOFA 4DIEA 2JATA 4TWZA 4AQRD 3L43A 4JSTA 1BIFA 1SKQA 1YVDA 5CM9C 4ARZA 4V02A 2DFTA 3ZRXA 4B3FX 2PJRA 4EKDA 2GNOA 4PZZA 1AZTA 4BECA 3CR8A 2P0EA 3NC0C 2ZXUA 3CWZA 3I92A 4C30A 3MWJA 4ESVA 1KSJA 2PL3A 1L2TA 2ZI3A 3TIFA 5KDOA 2ZQ5A 4HAXA 3TUZC 3TH5A 1XMSA 3SEAA 3WMEA 3D31A 5IF9A 2ZYWX 1F2TA 1Q57A 1HUQA 3TSZA 3KQNA 2B8TA 4RY2A 4LJ9A 1Z6AA 2Q9BA 1D9ZA 2KSQA 2YYZA 4LK2A 4Q1DA 4I6MC 5GVSA 2V7QD 2IX3A 2WJVA 3EZ2A 3MD0A 1E98A 2VSOA 1S9HA 4IFEA 2N46A 1KK3A 4M4SA 3F0TA 4OHZA 4QFMA 4Q1FA 4QL3A 1B0UA 1JPJA 2JLSA 3KUDA 2CE7A 4FI3C 1IJEA 3ADBA 3VMXA 1WBBA 1NIPA 5JSZA 1G64A 1DBSA 1SVSA 1VHLA 3A7OA 3MFYA 4DXAA 4EIWA 3L8ZA 4HZUA 2W83A 4NHOA 2QORA 3IO3A 1JR3A 1U9IA 3K9GA 1IY0A 4DLZA 1TQ6A 3QXCA 1D9XA 3SU8A 1K6MA 3B82A 3L0OA 1MO6A 1O87A 1II8B 2X77A 2YINC 3GLHE 1KQLA 3D6TB 1I2DA 5AW7B 4BFZA 2WM9B 1ZU4A 4F4IA 2NTYC 4DCSA 2AX4A 2ZTSA 3EX7C 2IBMA 1X1SA 2ZAOA 5HR5A 2IEYA 5B1OA 1TL7C 5AUPB 1N6OA 2WWIA 1OE0A 3QVVA 3BB1A 3QXJA 5CIWA 1JEDA 2WT7B 5FPHA 2N9BA 3MGCA 4HDOB 3HU2A 3DOFA 5HE8A 1Z2AA 3C14C 4B35A 2W00A 2RGNC 5KSOA 3CRQA 4KCGA 4KFRA 2LWIA 4GMDA 3U7EB 1OKKD 1UBCA 4CT5A 3WBKA 1P2VA 1XXHA 2D2EA 2BIFA 4D4KA 5L3SB 5CK5A 1T5IA 1XXHB 4B3DA 1DH3A 1GRQA 4CEIB 4RFSA 1OPXA 1UM8A 1P4SA 3CNNA 1XEFA 4GP6A 1VCIA 5HZHA 2YOGA 2IS1A 2VHCA 3TAHA 4BFTA 4TLDA 1E2LA 1RFLA 2F3TA 2Q21A 2F7SA 3NBZC 5FOVA 3TUJC 5IK2A 1H8EA 3Q3JB 4IXMA 4KLZA 3WP0A 4ILEA 4MUAA 3OEHD 1RE0A 1Z0JA 3AKYA 3THOA 4B6EA 5GVRA 4NL4H 4GL2A 4E09A 5CK4A 4EPVA 1D5CA 4V0NA 1XWIA 2A3RA 3EIQA 3U61B 2NG1A 1KGDA 1ODFA 1ZM2A 2D62A 3L0SA 4R9UC 3M0DA 1U94A 1KJWA 4NH0A 3KB1A 5J40A 1JQLB 3EZ9A 1NVUQ 3W6OA 2GCPA 1KMHA 4URWR 4X8HA 2C77A 2ZVPX 1G3RA 4MRVA 2OZEA 2BCJQ 2BASA 2ODEA 2JLWA 2QBYA 2NO0A 2EQBA 3EXAA 2H16A 3KDSE 3QI2A 5AVZB 3AVPA 2E9SA 1YZTA 1UF9A 2Z43A 1YR6A 2GF9A 3DMDA 1T9HA 4MGYR 2FZ4A 5G53C 3TR0A 3TR5A 5FTLA 1WB9A 1OFTA 3CM0A 3PENA 2HEIA 3U3JA 4Q9IA 4DC9A 2E42A 1IXRC 1F2UA 3B5JA 2C2HA 1U2RA 1QRAA 5EUQB 4DLVA 1CEEA 2EW1A 3UK6A 3UXMA 3LLMA 3LWNA 1M1YE 1RRFA 1XEWY 2FGKA 5AW6B 1H8ED 2HCJB 5DYGA 1DG3A 3FMOB 5C4GB 1W36D 4QKQA 1SXJE 2F1RA 1P9NA 3K70C 4NDZA 4GRAA 1X8KA 2CLSA 1T0HB 3EZ6A 4R2HA 1ZUNB 4XSGA 3MGNA 2CBZA 4HAVA 4X8LA 3ZS8A 2YKGA 4JS0A 1NG9A 1KO7A 5JS8A 2WJJA 4C7NA 4BIZA 5LPNA 1EFRA 5L3VA 4JLNA 3GD7A 3U3OA 2FFAA 4E22A 1YU9A 4TMKA 3IIJA 4NONA 4R2IA 1E2HA 2ZRCA 3B2EA 2J1LA 1E96A 2GESA 1NLFA 1AM4D 1S9KD 1Z28A 2HDNB 2FPMA 1W0JA 2ZRFA 3C16C 3ETLA 1II9A 4B6FA 1NL3A 4NCJA 2DY1A 4BPBA 2JAQA 2ZRBA 2F43A 1HEIA 5B2ZA 4PC7A 2CVHA 5DIFA 3SI7A 1MT0A 1EWQA 1HV8A 2C5LA 3EC1A 2BBSA 5DLQC 2J59A 4JAUA 2LKDA 3W8NA 2RB4A 3AGQA 2P6UA 3THYA 1LY1A 3E2IA 3QF4A 4AYTA 3AVYA 1E94E 1XX6A 1R8QA 1QHXA 4BUJA 4P33A 1D2NA 1EG7A 4M21A 3ZD7A 2Q3IA 4LBZA 1U81A 2ZJ8A 2QEQA 1JQJC 4ITRC 1Z06A 3HJNA 2O8FB 2BMEA 4D82A 2A5YB 4IEEA 4Q9JA 1E1QA 3U44A 3GQBA 5D3QA 3MCAA 2VP4A 1G3MA 5GJCA 4XSHA 3IDQA 5JLJA 3IEVA 3U44B 1KO4A 4BASA 4FMCB 2OCAA 1NKSA 2VP5A 2PLFA 5J4VA 4DLUA 1W4CA 3GJ0A 3SN6A 2WHXA 2Q3FA 1DEKA 3NH9A 5EQTA 2XZLA 1KMQA 3CZPA 4A2PA 5C2JB 5CJ2A 5KNDA 2K5UA 1Q1QA 2QA5A 1WQ1R 1G6HA 4DRZA 1U8YA 3N5CA 1P75A 2C2AA 4RESB 3PG5A 1OXXK 1RJ9A 3ZQJA 2YO2A 1P2TA 4KHZA 4Q7JB 2HYDA 4EPRA 1E4YA 1EFUA 3GCGA 1AGPA 2OG2A 1TADA 1DPFA 3U6KA 1N25A 1AJEA 2ZROA 5JCZA 3X1WA 2EFDB 1TF7A 2QPTA 1X8LA 1E9DA 1Q1EA 2J0UB 3R7WB 1CTQA 1G8PA 3A1TA 4ABYA 5SZHB 1Z0AA 2XJ9A 1RW4A 1XZQA 2YVUA 2PBRA 5AW2B 2ZS8A 5DGXA 1E9CA 4WXRA 2XTNA 4MRRA 1NLYA 4A82A 1KSFX 2GCOA 4JT4A 1F48A 2H18A 2TMKA 3SQXA 2Q7CA 4Q9KA 2IF0A 1IJFA 3VKWA 2QROA 2CJWB 3DHWC 1WCV1 4XWOA 4V0MA 3HR7A 3OESA 5K8IA 1E1RA 3EIEA 2VHJA 4M8NE 2ZRMA 1HJBA 3VHLB 3CIOA 4ARZB 1F51A 4RVCA 2MSDB 5KU1A 4KITB 1G7SA 1ESNA 2WJYA 3THWA 2FJUA 2H8KA 4A0FA 4US0R 5DH9A 1G4AE 2FWRA 2ZAMA 5KYKA 4CVNA 2O8CA 1YQTA 3TW8B 5AWFC 3SC3A 4XD7D 3UMRA 1P72A 3NH6A 4CYMA 1OYWA 5HCIA 1NJGA 4B44A 2WJHA 4E07A 4FMTA 5JWHA 3TVTA 3O8CA 2QN6A 4D80A 4AD8A 1DAIA 3QPVA 4A0HA 4PO9A 2ZRAA 1KI8A 1HA3A 2BM1A 2QG6A 4DSTA 5B30A 2QP4A 4I1SA 5GJVC 3WNBA 1KIMA 1RIFA 2H1LA 4A15A 2RCNA 3A1VA 4L5BA 2QMUA 1G16A 3BAFA 2CLDX 4DLRA 1S3GA 1W36C 4M9QA 1Z63A 1BYIA 2IWRA 4LOAA 1NI3A 5TDHA 3SJBA 2OO7A 4OYHA 1CRPA 3T1VA 2CMKA 3KTAB 1AQYA 4M1YA 4ZKIA 5B58C 1NAFA 2QMOA 1Q22A 2VP0A 4OK6A 2X2EA 3N2EA 1OFIA 1LTQA 4I1UA 2QNRA 3FKQA 2P65A 2ZREA 4XIGS 3IUYA 4ERNA 1J8YF 4DDVA 2EFEB 5C1BA 3FTQA 4QJ4A 3TKLA 2Z4RA 1XTRA 2ZJZA 1QVRA 4TT3A 5AUNB 2DR3A 3QKRA 4U00A 4DB4A 2J3EA 3AKCA 2QT0A 3BERA 3K0AA 5FPYA 5BN4A 4YMUA 4LYHA 1Z6TA 5DO9A 2XOKA 2SHKA 3B8EB 1E0SA 2RGDA 1C9KA 2VP9A 3SR0A 1R0ZA 1HQYE 5JFGA 2D4HA 3W34A 1DAFA 3AP1A 4UNPA 5C4MA 4WIAA 1H8HA 2GTPA 4DZZA 3VX3A 2Z5IA 1FTSA 1Q1BA 1XBTA 4YXWD 4QXAA 5EXTA 4GZMA 3PUWA 2BDTA 4FINA 3SFVA 2ZYVX 4MQBA 3IIMA 2Z5FA 4LC1A 2QAJA 3PXGA 4MH0R 2IS2A 3LIDA 2D2FA 4M53A 3SYNA 1ZAKA 1T2KC 3EIHA 4OQXA 4C46A 5BN3A 1KYIA 5FTJA 1W7AA 2ZSBA 4LJ6A 1MO3A 1OT3A 3T5DA 2KBEA 2QE7A 2CNWD 2IA5A 4EFLA 2JLXA 3P32A 3I72A 5DI3B 4JYBA 1AGRA 1J90A 4QRHA 1CR1A 4ZI2A 1P60A 1KI4A 3DDCA 2KB0A 2P6NA 2ZE5A 4JVLA 1WP9A 2WAYA 3E1SA 4JKYA 3LX5A 2ODWA 2HT1A 2AHOA 1BH2A 2ZRLA 1E32A 1E9EA 2ZEJA 3WYGA 3AF3A 3U7HB 3QE0A 1JEEA 4UXHA 1G19A 1DS6A 2IXFA 3VNUA 4QHYA 2JJ1D 1FUKA 1W46A 4P0TA 4Q1BA 5TMPA 4JBYA 4Z54A 5AW4B 2IYWA 4GPTA 3L0PA 4AY2A 4PSAA 2WZQA 5EXSA 2ZRIA 2RHDA 4JVNA 2GXQA 3T5GA 1CJUC 4C4PA 1KNQA 4PPGA 3NEJA 3OZXA 4DLXA 1CI6B 2O52A 4AK9A 4WW0A 5TARA 2JIZA 4B3BA 2EVWX 5JWRA 3A6PC 4TLBA 1G5TA 3HE5B 1W4RA 4IFBA 2AN9A 1AS2A 2BOVA 3TSWA 4P31A 1R0WA 2IF2A 5AW0B 1G5RA 3G5UA 3QJYA 4G5SA 1W44A 3LNCA 5EP1A 3ZH9B 4PC1A 4PAMA 2JJ8A 2VLIA 1MRSA 2AK3A 2CXXA 521PA 3FDIA 3FHTA 3ZCCA 4A92A 3R8FA 4TMTA 1OIWA 1FX0A 2GDJA 1AQUA 1E69A 3K9NA 1ZRHA 4L4UA 4HZIA 3I32A 5EE5B 3ZLJA 4A0GA 1FNMA 5LD2B 3HWSA 2XZRA 1LS1A 1FX0B 2BCGY 2O0JA 1TPZA 3PCRB 4FMBB 4PHFA 2FOLA 2OFWA 1N6LA 3KB2A 2C9OA 3W90A 1YRAA 421PA 4ZIRA 2BV3A 5AJWA 5K8UA 1IN7A 3K8YA 2O8FA 4A36A 4G5GA 1KDTA 3CRW1 3U3KA 2V55B 3WNCA 5JWOA 3UKDA 5AVYB 2JDID 2JCSA 5J4YA 1FW6A 4IHQA 2ZRGA 1UEIA 3BH0A 3MAAC 1W47A 1C4OA 3UMFA 1OHHA 2B6HA 2RGBA 2HXYA 1YZNA 5FFMA 4OBEA 1F2TB 1NVWQ 1VDZA 1M74A 3JVVA 2IYZA 1JUNA 1XXHE 1UKZA 4OK3A 2YC2C 3RS7A 2IXEA 1GSIA 2JA1A 4PQYA 4QJ3A 4LJYA 2AFHE 5H70A 4DSNA 1B23P 4NP6A 4WOPA 4ACBA 4BLTA 1YKSA 2ZSDA 5JJKA 1CR4A 5JRZA 3CRVA 1DG1G 3LAWA 5IDVA 3ZS9A 2CE2X 5FOXA 4HUQB 1SGWA 4II7A 3DO6A 2FFQA 3IEUA 4Z8YA 1N5IA 1E2EA 1R5OA 1E79D 4NBSA 5JS7A 1Q0UA 5C93A 2HUPA 2W0SA 2XITA 1EWRA 1ZM3A 3BGWA 4KI0A 4TQAA 1R8SA 1X3SA 3AM1A 3CKLA 3U60B 1N5LA 2GEVA 3TBKA 1OB5A 3PR1A 4UNSA 1A7JA 4NE2A 4JL8A 4HAUA 1OXTA 1BMFA 2QENA 4Z8XA 121PA 2CHGA 3I5YA 3WHKA 3K1JA 4N0DA 3X1DA 2BBOA 2J9RA 1GM5A 3W9YA 1JOYA 2OSBA 2XX3A 3PFIA 4B75A 3TW4A 3GLIA 1XTQA 2IYQA 4LPSA 4P4SB 2GJKA 1N0UA 2ZJBA 3DGEA 4PC2A 3UG6A 4HYTB 4CGZA 4P4TA 1KK0A 1KZGB 2PX0A 3FWYA 1IHUA 1QF9A 2W58A 3PEVA 5E95A 5CM8B 1GRRA 4TTPA 4U5XA 1IN6A 3VMZA 4PPQA 4RD6A 2O8CB 3NXSA 3DM9B 2QM7A 3AVUA 3NVAA 1IOZA 4AUWA 3R8CA 2V1XA 5JBQA 4LUCA 2EFCB 5APWA 2YWGA 3CLVA 1NLZA 4M1SA 3SYLA 4B32A 4TL6A 4Q1AA 1M7HA 4NPHA 2B8WA 2OCPA 2WAXA 4JSYA 4D25A 3X2SA 1Z6GA 3QVUA 1AKYA 3THXA 2P6RA 2QY9A 2J0VA 2W6JD 1SVLA 2KJQA 4C7OA 2ATVA 4HAZA 1EGAA 5FTMA 1N0VC 1NVVR 1P6XA 2VRWA 5AVSB 5AJYA 4B34A 3G0HA 1CRQA 4LC0A 4JVMA 2RMKA 5JI2E 3BE4A 3D7MA 1OIXA 2FA9A 2GJ8A 4OJKA 2O8EA 1OYYA 2QAGC 3DVLA 1ZJ6A 3SS8A 4MDFA 3A4MA 4Q1EA 3P20A 3OIWA 3EWSA 4W5JA 4CEJB 1KI6A 3ZVLA 4Q4JA 3PJRA 4Q47A 4B3GA 2Q5UA 3LX8A 3B8HA 4KV9A 2OT3B 2W6JA 3I73A 2WWXA 4Y0AA 2JIZD 3CX7A 3RWMB 1WBDA 5FBLB 2P67A 1E9SA 1UKYA 3QKTA 4Q7KA 3QKRB 3ZGXA 4F93B 2OBNA 3ECCA 4RCZA 3EZ7A 5AVXB 1QHHB 1JJVA 4TQ9A 3IIKA 2YV5A 4EDHA 1VCMA 1COWA 1SVOA 4CRWB 1EFTA 2C9NY 4ESHA 3OFNA 2PT5A 3QG5A 1T91A 4G0NA 3AKEA 1WRBA 3EW9A 4PPFA 3VR5A 2H92A 2JLRA 1GL6A 4RKFA 3L37A 2G0TA 2ZRNA 4G5OA 4MRSA 4TMZA 1AN0A 2FPLA 2ZYUX 3UANA 4MA4A 2DCUA 2OXRA 4IRUB 3GLIE 3IHLA 2R6AA 3ZVRA 2WOJA 4IXNA 1E2NA 2O8BB 2J87A 3P26A 3ZQ6A 4IOMA 3KTAA 1RZ3A 2EFHB 3NFQA 2PX3A 3GJ3A 4HUTA 5DN6A 2OESA 1AK2A 4NYJR 2OM2A 4B33A 4F4JA 3AVVA 1HWTC 2BVNA 1LF0A 3VFDA 4FCVA 3AVWA 2B92A 4RD2A 1IN4A 1G8GA 3X1XA 1X8YA 4M1OA 3WRXC 5SZKB 1CJTC 1Q12A 1GVNB 3B1WA 3GJ8A 4C0KA 4D4JA 3T06B 4IVQA 4KP4A 2ERYA 2NOAA 2F1HA 2XEXA 2EYUA 5GJWC 2AK2A 4HYYA 5HZKA 4XWAA 5E7IA 5EE0A 4QGFA 3M6AA 1IAQA 2O8DB 1NN3A 4BIUA 2J45A 1UKVY 4LBYA 4PHHA 1KKMA 2GCNA 4HLUC 1Q3TA 1H8HD 2GAOA 2VSXA 4PPNA 3CX8A 2GVZC 4LYFA 3U4QB 1EX6A 1EFHA 1JAHA 2ZE8A 2LCFA 1CJVC 1CJMA 3EA0A 1OHHD 1YE8A 4Q4HA 1CS4C 2XOKD 3A4LA 2ZM5A 3VAAA 1V43A 3CBQA 2X1VA 1JNYA 1CI6A 2HF9A 3MLEA 4NTZA 2R6DA 4JBXA 3X1ZA 1Z47A 2Q3HA 1OJLA 2F1JA 5FUVA 3MJHA 3THYB 2XU6A 5FR1A 1U8ZA 2JJ2A 4FWIB 3HE5A 2XB4A 3L82B 4RZ2A 5ANRB 4LJ8A 1GK4A 4B48A 4LJAA 1OSNA 2JLZA 2QGNA 1DVRA 1ZC4A 1N6NA 2ZR7A 1DAGA 2HCBA 3QENA 2FH5B 4LJ4A 3K0EA 3Q85A 3W3ZB 2H5EA 2VHQA 3FKSA 3RS3A 1ZINA 1N6KA 3AGPA 4LDJA 1KJZA 4KU4A 2E87A 2J7KA 4LI0A 4Q18A 5JZVA 2OLKA 2WJGA 3LW7A 1J2JA 2OILA 1G5PA 5D3MB 2FFHA 5JJIA 2REXB 4ZIRB 2IYSA 2ZE7A 4UXIA 4OQFA 3ZRWB 4H1UA 1N6PA 2GETA 3ND9A 4KYIB 4DHEA 4UNRA 3UPUA 4OI4A 3WMFA 3ZRVA 2W2XA 4O2RA 3C41J 3UG7A 4HB3A 4QPKA 5G40A 1E9AA 2NPIA 2ZETA 3LFUA 3VTKA 2J0SA 4WZBE 5B1NA 3P27A 1G7CA 1XTJA 4LX0A 2OXCA 1XCPA 4LHZA 4QNRA 3IPXA 1NVXQ 1AKEA 1FP7A 3P4XA 4GMXA 4R98A 3SE0A 1TAGA 3AF4A 3RHFA 4M1MA 1EX7A 3ICQB 1DAHA 4TLEA 4YMTA 2JJ1A 4LV8B 3PEWA 1OXUA 1U99A 3LQRA 1VIYA 2A5GA 4URVR 1ZM7A 2QZ4A 4MYCA 4AC9A 3I5XA 4YONB 1OB2A 1NVVQ 2WVJA 3DL0A 1U0HC 4HUQA 2BWJA 3HR8A 2D74A 2AFIE 1FAVA 3LW8A 4HDQB 3TAUA 4BGDA 2V8OA 4YLGA 1SKYE 1MH1A 3AKDA 4EFMA 1KZ7B 2R6CA 2WMOB 3GFPA 4MYTA 4DJTA 1IY1A 2VEDA 3T61A 1JPNA 3R20A 2AL7A 3PUVA 3PVSA 1OV4A 1UBFA 2QTFA 2RH5A 4LBWA 4ZDKA 3MMPA 5JHGB 4QJ5A 1IXMA 2YZ2A 3CW2A 1KI6B 3OAAA 5FL3A 1KI7A 3KDPB 2A7QA 4JIMA 1G4UR 3TMKA 4URZR 2ZITA 4ZI3A 3NG1A 3FOZA 2QP3A 1SVIA 1RRCA 3UWKA 3WYFA 3NBXX 4P4UA 1NNEA 5TV2A 1KAOA 1JBKA 2ZUBA 4YXWA 1N6HA 4P4SA 2IYTA 3RS0A 5EP3A 1ZM4A 3FE2A 1H65A 4B3CA 1G21E 2C9YA 5KDLA 2OFXA 4YDHB 1KKLA 4BE7B 2QTVB 1E2FA 5EE3A 3A36A 1FUUA 4B73A 1SP4A 2DFKB 2FPKA 1KSGA 1TF2A 2WMNB 1SXJC 3KZ1E 4DLYA 4F7WA 2IYYA 4RZ3A 3HYRA 4WBSA 5HTKA 4JAVA 5JRJA 4CEHA 2DFNA 3EA5A 4PO1A 4F91B 3CF6R 2PEZA 4KYUA 4DLSA 3GFOA 3K0CA 3THXB 1KO8A 3SBDA 3KXKA 2J5XA 2R32A 2IYVA 1GWNA 2VBCA 3SHWA 1RYHA 4AYXA 2BM0A 4LZZA 5FI0B 3KJIA 2NO7A 4D2IA 2F9MA 1ESMA 1N5KA 4MGKR 4PHGA 5KSPA 2FZLA 2WWYA 1G7TA 4PC3A 1GP2A 5IRCD 4MKFA 4Z1MA 1T6NA 4YMWA 4ZKEA 4IDQA 2NIPA 4NCKA 1JR3E 2QQ0A 4CEIA 1XPUA 4RKEA 4FD2A 2QP9X 2GJ9A 4CEJA 1TU3A 1UFQA 1ZCAA 1OH6A 1W0JD 2PZFA 2E1RA 2GEUA 5C46F 1MABB 1PUIA 1YR8A 3PUXA 4QPJA 4MRPA 1EESA 3H86A 4M1TA 3GLFB 1DELA 1GKUB 5FI1B 1D2EA 4W5WA 1Z22A 3KFXA 4EFNA 5JJLA 1ZCBA 5HCNA 2G1JA 2GJSA 4Z51A 4EPWA 1FNNA 4MTXA 2C03A 4D4MA 4A0RA 3QEJA 1G3QA 4KJZA 2RKOA 2QMHA 2CL6X 2GK6A 3WXMA 5JI3E 1Z2CA 4PSKA 1G18A 4UNQA 3HU3A 1SZPA 3RS2A 1NBMA 1KI2A 1KY2A 1I4LD 3AP3A 4TL9A 1GD2E 1T8UA 4Q7MB 5FOSA 1G3UA 3H1TA 1TU4A 3W6PA 3MWLA 1R2QA 3BIFA 4BFVA 1XB2A 1I2MA 4IW3B 3K0CC 1JB1A 4OJQA 4AI6A 2VRSA 2D7CA 1UDXA 2I1QA 3B78A 1KJYA 2C99A 1SVKA 1KDOA 2P2LA 4LJ7A 4JASA 4O3MA 1W2GA 2CDNA 3TVDA 2XZOA 3K09C 4BFSA 4BRUA 3LXRA 1P7CA 4UJ5A 2BMFA 4S35A 4C0LA 4LPKA 1AZSC 1LVGA 4XTRA 3ZVMA 2IHYA 2RGEA 2XGJA 2QAGA 2QPAA 3P4YA 3AUYA 5EE1A 5H1YA 3C4JA 4BZXA 1FFHA 5EE9A 3IKJA 3M9BA 3CPHA 4CF7A 5E7JA 1ZU5A 2IPPA 3GJ7A 2IK8A 4NZYA 2IYXA 3NBFA 1E2KA 5AUQA 1CSBA 4FN5A 5J4LA 4C0SA 3LY5A 3QIAA 2NZJA 5UKDA 1HBWA 2R65A 4M22A 5TB5A 3A4NA 1VIAA 3AH8A 3ZRWA 4G1UC 1N6RA 4GOJA 3SFZA 2O8DA 3R9XA 1Z6XA 2E43A 3F5FA 2ANCA 3LVQE 4PAOA 2QRZA 5G3YA 3CNLA 1ZP6A 2EWVA 2WBLC 2VHUA 3OHMA 4FWTA 5TVKA 5EP4A 2VYFA 2I3BA 4TMVA 3VX4A 4OHVA 2GZHA 1M2OB 2BBWA 1NN0A 3WP1B 2GBLC 2A5FA 1X6VA 1Q21A 1KK1A 3WBJA 1FOEB 4ZDWA 2ORIA 3CUEF 4I4LA 1X8JA 1NN1A 5FTKA 3TRFA 1RVDA 4Q4AA 2FFBA 4KO8A 5E7MA 4KBFA 1G7RA 4A1FA 1NBME 3EG5A 4W5HA 4TQUS 1OXSC 5DYIA 4E03A 3QY0A 2PMDA 3UATA 3GJXC 4KAXA 1E9FA 3BC1A 2ODBA 2BEKA 1SXJA 5IDJA 1DOAA 2XAUA 2NO9A 5DE3A 3IR9A 3UIEA 1GTWA 3B1ZA 2NQ2C 5D3MA 2FN4A 2MSCB 3AB3A 2XZPA 1XP8A 3KJHA 3U4QA 1RRPA 4QGHA 4A6PA 2ZIAA 5DSZA 1YZGA 5FOUA 3BD9A 3ZDQA 2FX3A 1MV8A 4FIDA 1E0AA 1W2HA 3F8TA 1F60A 1EFRD 2NGRA 1JR3D 4OL0A 4LHXA 2B7CA 3F3YA 1FOSE 5FTNA 4YMVA 3IPYA 4KHXA 4Q00A 5CLQA 3B13B 3B85A 3MUFA 1XJCA 4DSUA 4I5SA 1E2GA 1NP6A 2AR7A 3FMPB 4LWZA 2UKDA 4MKGA 4ACAA 3TNUA 1G20E 2Z6VA 4BFYA 4PAQA 2DWQA 4WVFA 1U8AA 4L9WA 4R7ZA 1FQKA 4PZLA 5FOWA 1S9KE 2IUUA 2DWOA 1E99A 2C9LY 3C7KA 4NYIQ 5FBVB 4G5QA 1TF5A 5EXPA 2FGJA 3QKUA 1J2JB 3PEYA 4NMMA 3M0EA 4GBMA 2XNDD 3NWJA 4AKEA 2QT1A 1U90A 5LB2A 1GFIA 4OHWA 4J0QA 2GCOB 2YWEA 1GNRA 5EZ5A 4RFSB 2JLUA 4MYUA 1UKEA 1G2CB 3CNOA 3I4LA 2J41A 621PA 3GLIB 5JCPA 1LV7A 4U7OA 4TLAA 4AWXA 2WWGA 1EK0A 3THWB 5DHFA 5CMZA 3KUCA 3B6EA 3SZRA 2JLYA 2P7JA 2Q3MA 3H4MA 3U6BA 2NMVA 3KFVA 3M06A 5KTYA 2IS4A 5FR2A 1M7BA 4QOSA 1E2QA 3KJGA 2FG5A 4RD0A 5GJBA 3QG1A 3DZDA 1MFZA 3B7GA 1W36B 4C2TA 1R6BX 2AD1A 2ASEA 1SVWA 1P5ZB 2RGGA 2VF8A 1CZQA 6Q21A 2EU8A 5K8TA 2PMKA 5SZIA 5FPKA 1A2KC 3B9PA 1G41A 3LH5A 2HV8A 4KSBA 4PQRA 4ZV4A 2WIBA 4Q5IA 1Z8FA 2XSZA 5KO2A 5APXA 5AW9B 4N3NA 4OI1A 1MOZA 1XD2A 3BH7A 4A8JB 4GP7A 1E0KA 1RKBA 1IXSB 2G1KA 4HZUB 5F3WB 1T3SA 3VR3A 1G8YA 4NU0A 3ONWA 3ADCA 4HAYA 4A8JA 1GUAA 4BLPA 1RYFA 1XMVA 3O8RA 2ZRKA 3ZVNA 2YC4C 2OEPA 2PCJA 1XFAA 4K8OA 3MSXA 2ZS7A 3BB4A 2GBLA 4OKSA 1QVAA 2V54A 1A02F 1Z0DA 1XMJA 2WPDD 1TEXA 2QRNA 3NDPA 3O8DA 1MABA 1C1YA 3T35A 1PLKA 4DB2A 4CDGA 5BXQC 2A5DA 4HEJA 1ETUA 1QHGA 1QHYA 2IS6A 1NN5A 1GZSA 3CONA 2C96A 1DTSA 3I1FA 3NBYC 4CEHB 3W8RA 2FSGA 2GZDA 2VIIA 3DOEA 4IDNA 3RABA 1CU1A 4BFUA 2BJVA 1A02J 4BEJA 2HLDA 2IYRA 4DEYA 3NHAA 2R8RA 2NZ8A 1P61B 1Z3IX 2PLRA 3L2OB 4RD1A 3D8BA 2HLDD 2A78A 3REGA 4TTQA 3UIAA 2AXPA 3PUZA 3RAPR 1NSTA 3O47A 1Z08A 5CB8A 5L3SA 3BH6A 2LFRA 2O0KA 3V4WA 4LHWA 3U3RA 1CLUA 3AVQA 2V4ZA 2OCYC 4C9BA 4YMSA 1UEJA 1H89A 3VR2A 1TTTA 2FMXA 1ZD8A 1I4TD 3U7FB 4L8GA 4GNKA 4KVAA 5DI3A 3B9QA 2JEOA 1MRNA 4A8JC 2WPDA 4JT2A 3OAAD 1RRGA 4UQOA 5KHOC 5KOYA 4HI0E 1Q20A 3W3AA 2DWPA 3Q9LA 4ZCMA 3QF7A 3ZZTA 4JLDA 3V4FA 2P3SA 4PSVA 2AKAB 2V9PA 2XTMA 4OHXA 4B2PA 1J7KA 2AWOA 4YC7A 1AIPA 4C0QC 3TNFA 4QBIA 1XF9A 2KI5A 2RGXA 3VTPC 3VU9B 4K81B 4X8OA 1YR9A 2DYKA 4LCBA 3L8YA 4F92B 2P5TB 1Y3AA 1G6OA 2XSZD 4TZ6A 4TYPA 1II0A 1NKTA 3K0FA 4KSCA 5KUTA 4ASUA 2W2VA 5FH9A 4H1VA 4Q4LA 2QSZA 1R5NA 3O8ZA 3RWOA 4B2LA 5L3QB 5AW5B 3KL4A 3NMDA 4OK5A 4BLOA 1BYUA 4URYR 1ANKA 4JYCA 2ZYTX 2H57A 1IONA 1FPMA 1Z6YA 4O25A 1L7VC 4WXPA 4OI2A 2ZI9A 2WPSA 3B60A 2ANBA 2NO6A 3TQCA 5CDFE 4LHVA 3RC8A 1CJKC 4KFTA 1ZIPA 1EXMA 2OV2A 4BFWA 3KKNA 4KXFB 4Q4AB 4UJ3A 1Z0KA 4NYMR 3R7WA 4CZ2A 2Z5HA 2IL1A 4GZLA 1A2BA 1IY2A 1CBUA 2RGAA 4MKIA 3M4YA 4IKEA 3EPKA 2FF7A 2ZFCA 2V3CC 1HY3A 4DUGD 1QG4A 3DM5A 3DEFA 3MRSA 2BMDA 5AR1A 4B76A 3H84A 4TSFD 2G9NA 1CR2A 2VSFA 4FCWA 1P2UA 2EYQA 5KDDA 3K70B 1W4BA 4F38A 1KK2A 4URXR 3TYYA 4PANA 3RANA 4RZXA 2V1UA 4C7NB 4NYMQ 3FKSD 4EPTA 2CEAA 2CHQA 1D8TA 2OHFA 5FUYA 5HPYB 2FU5C 4RD3A 3M1IA 4EUNA 3K9HA 3LVRE 2CL7X 4S2EA 1I4DD 2OFOA 3KQLA 4DDWA 2XNDA 2KE5A 1KI9A 5DHAA 4C2UA 5HKKD 1L4YA 1T3LA 4HB2A 2FEMA 4M9ZA 2G77B 2GKSA 1HE1C 2LKCA 2IC5A 2ORVA 2JJ2D 4X8MA 4XH9B 1DAMA 5TY0A 1CR0A 4DVGA 3B1VA 5G41A 2JGNA 1IQPA 3QF4B 5M04A 4QGGA 3AP2A 2ECKA 2ZI6A 5FL7D 4ZO4A 3ZIAD 1VPLA 3V00A 1K8RA 2QMEA 4RCYA 1J99A 2DHRA 4IEIA 1XPRA 4IOKA 1S8FA 3WY9A 5LB4A 3RSOA 5DISB 1W5TA 3GLFE 4ZPXA 2Z83A 3OE7A 1XZPA 2AKYA 3W5IA 4US2R 4GDFA 4JLJA 4LJ5A 3C8UA 3VYIA 1DO0A 2BJWA 1E9RA 2IYLD 1YZUA 2W6ID 3QOFA 4QC2A 2CL0X 4Q20A 4GCZA 3OEED 3GP8A 4IDOA 4Q7LA 1P73A 3IO5A 1MR3F 4P3YA 1S0UA 2BHRA 3GJ4A 1S3SA 1GL9B 4TMWA 4EJSB 2QUZA 5H8WA 1G1MA 1MKYA 1II8A 1Z0IA 1SXJD 3MG9A 1ZM9A 2A2ZA 5JMTA 1ZBDA 3P8MC 3BBPA 3EC2A 1VCNA 5CJPA 3ZZUA 3D3QA 3KJEA 3FGNA 1P9WA 1JALA 2QPOA 5DN6D 3QBVA 2ZANA 1XTSA 4DSOA 1H88A 2G83A 4KFUA 3BOSA 1A1VA 2QSYA 1L8QA 4DCNA 4KFSA 4FPPA 2OUKA 3AVXA 3HYTA 4D26A 2GZAA 3R9IA 3P1JA 4I1VA 3BJIC 3AUXA 2YOFA 4OQLA 3VR4A 5FBWB 2R62A 4RD4A 3K70D 4M1WA 5FBRB 721PA 2EWWA 3LRPA 4NYIR 1WMSA 4FW9A 2P5SA 2PH1A 2AXNA 2R3CA 1COWD 4V0OA 3OIVA 2BEJA 2FSHA 4LGMA 3RYTC 2O0HA 3V9PA 2IUSA 3B1YA 1OIVA 5AJZA 2FE4A 2HT6A 1FOSF 4PTLA 2CJWA 1KDRA 2GRJA 1X86B 2UZ3A 3S1AA 4E5UA 1QDEA 2ZSFA 4BEBA 4MDEA 1UBEA 4JL5A 3FHOA 1WF3A 3HU1A 1SLQA 5AVUB 4DDUA 4Q02A 5IT5A 4MITA 3CRRA 4U02A 1FMLA 3SBEA 1Z5ZA 1OF1A 2PZEA 2X2FA 2BKEA 1D2MA 2F55A 1HUCA 2WTYA 1PJRA 4ON9A 3K9LA 3NEYA 2REOA 4JL6A 2FTKA 2CK3A 1R7RA 4AURA 2QM8A 3N70A 5CLLA 1SQ5A 3IQXA 1W1WA 4XJXA 1GG2A 1R4AA 3VNVA 1VYTA 3FMFA 3KKQA 2DBYA 3QXXA 4KODA 5ELXA 2B7BA 4BRWA 4BWYA 4R71A 3GJ6A 3V4QA 3DZ8A 1S4QA 3A2AA 4RSGA 1QHSA 3NKVA 3QXHA 4LBVA 3VU9A 3ZZ0A 2I1VB 4D6PA 3CB4A 2H17A 4A2QA 3PEUA 4AYWA 4Q21A 5F9FA 2KWIA 2FSIA 2ZU0C 3SOPA 2A30A 1N2CE 4HAWA 3OAKA 4KLNA 2ZU6A 4GKGA 3CR7A 2ZI7A 3T34A 3RS4A 3Q7PA 5APVA 1A4RA 1GILA 2QU8A 2R5DA 1XD2B 5FOTA 1NBMD 3QPUA 5F2EA 4CW7A 1F2UB 2HF8A 3LO5A 1WDTA 3IBGA 4FXPA 4QBGB 5BYJA 8OHMA 4L9SA 1E2PA 3IILA 4DKXA 2Q9CA 3QNUA 3NHBA 1X1RA 1G8HA 2J46A 3GJ5A 1L4UA 4OQNA 2BC9A 4XVRA 3T1TA 1M6NA 1GNPA 3CRMA 1W0KA 2YHSA 1Y63A 3T1QA 1MO4A 2ZJ2A 3C15C 4EPYA 3A1WA 3KX2A 1ZIOA 3EASA 5AVVB 3KQKA 3Q5DA 2NO1A 2H7VA 2Q9AA 3JVUA 4QNMA 2I4IA 4A2WA 3K0SA 1LB1B 3EPLA 1HT2E 1E9BA 3QUSA 4Z1MD 2VPPA 2GWHA 1VG9B 1E79A 2O5VA 2Z0MA 4EAQA 1IM2A 1YHNA 1US8B 4I99A 2DFLA 4U7DA 2VH5R 1DAEA 2DB3A 4MKHA 1OXVA 3Q5EA 2R5BA 3K09A 5APTA 1KOFA 1SHKA 3RDPA 1US8A 1HTWA 2JLQA 1J8MF 4IJMA 2VP2A 3LBNA 4Q4HB 4Q03A 3KQGA 3HTKA 3QXSA 4JJKA 1Q3HA 4GSYA 3I5CA 4US1R 4TTRA 1NY6A 3Q7QA 5L3QA 3I61A 1G291 1TX4B 2FNAA 3JZAA 5P21A 3TSOA 3DKVA 1A5TA 3H2YA 4BQSA 2PT7A 3OIYA 4M9SA 1JI0A 1CF4A 2V6JA 5A0FA 3PQCA 3BB3A 1DARA 3HE4B 2WWFA 1KO1A 1DE0A 1GITA 2WSMA 1QG2A 1ZNWA 4JMPA 2ZRJA 1G17A 3HE4A 5BN5A 4Q9HA 3ZD6A 1OFUX 4HLDA 1TQ4A 4DCUA 4HLQB 5CYOA 2JLVA 3RNLA 3K53A 2IT1A 5KSZA 1YR7A 1DADA 1AS0A 1TUEA 1XEXB 3A1UA 3A8TA 1S2MA 3ASYA 3IBYA 4G3XA 2ZJYA 2P2UA 1XPOA 2YNMA 4LY6A 2WTUA 1XEXA 1JNMA 2ZUDA 5EUMA 5AUOB 2QGZA 2GXUA 5AW1B 1Q1ZA 3AF0A 3GMTA 3C5CA 2HJVA 5EZ6B 3ZYCA 4G01B 4JVSB 3BFKA 3U7GA 3NDBB 4JLKA 2WV9A 2QL6A 1IO4A 1XCGB 5AJVB 2GA8A 2ONJA 2WSSD 1E0JA 4KBGA 4PFSA 1PZNA 4HLUA 1XJ0A 5LD2C 1XJQA 4W7SA 2W27A 3SDZA 4KVGA 1VHTA 2RGCA 4JLOA 3SJCA 4B3XA 4PX9A 4D0NA 2J7PD 2F6RA 5FUXA 3RS5A 3RVBA 3V5BA 2XB2A 4C7OB 3FPAA 2GF0A 1CP2A 4GOKA 1GL7A 3MWYW 2WJIA 5BYKA 4M2LA 1TQ2A 2MSEB 2J7PA 3ND8A 5HE9A 4OHYA 2VL7A 2MMCA 4HB4A 4DT1A 3LXXA 4I81A 2GHIA 2G0NA 3TJZA 2YNYA 1TNDA 2LFSA 3TQFA 4I2LC 1YZQA 2C04A 4JLAA 1ZMXA 2N42A 2WSSA 5EJEA 1RC8A 2F9LA 2GK7A 1QBKC 5J4KA 1T0JB 1A82A 2JASA 4RFVA 4DWJA 5AW8B 1N6IA 4QHTA 2ZXEB 4EQ6B 4IVRA 4V0ME 1WA5A 3C5HA 4RJLA 2XXAA 1TQDA 3ZJYA 1JAIA 5KPDA 1GIAA 3R9WA 2PEYA 5J47A 3M91A 3QBTA 4B2IA 2C8VA 2XXAB 2CNWA 1S96A 3CPEA 1XNJA 4QM6A 5F9HA 4JKIA 3LBHA 1QHHA 3PV0A 3WMGA 1QHIA 4Q66C 4F4CA 4IOJA 1XTIA 2UVQA 2W2TA 2QTHA 3BXZA 2YJTD 1G3IA 4D4LA 1V5WA 4MGZR 1BO6A 3U2QA 5KPJA 2W0MA 4C0JA 1R5BA 3TLXA 2XV5A 3EAQA 2ZRPA 4LV5B 1CXZA 2IW3A 3CWQA 4RZUA 3J81k 2OAQ1 1FZQA 1W4AA 3CZQA 3SJAA 3FYHA 3P7KA 3WRYC 2ZUCA 2OBMA 2VF7A 1XEWX 221PA 4AKGA 3N2IA 4DDTA 5JHHB 2WWWA 4XWKA 2O8BA 2R6GA 4NCIA 1PV4A 4Q9LA 2IWHA 2UZIR 2A9KA 3LA6A 4Q01A 4WZAE 3PITA 4O2LA 3LDAA 2JJLA 3RRZA 3VR6A 1OLOA 2IUTA 3K0AB 4JLVA 1UADA 1E6CA 2VP6A 3Q8XB 2ZE6A 4ZCIA 1LS6A 1OXZA 1N0WA 4L16A 2XNSA 4HDCA 1HQCA 1R10A 4C3ZA 1ONBA 1DO2A 2F1IA 3I3SR 3WYAA 3GPLA 4YDSA 1VECA 3Q72A 5DNYB 4NYJQ 4WAUA 5APYA 5AVQB 4IVPA 3LV8A 3BFVA 4BLQA 2C95A 3EPHA 1E2DA 3FMIA 3RC3A 3ASZA 3GLFA 1UAAA 2ZS9A 2FDCA 2Y8EA 2YWHA 1VYUA 3QPWA 1NMXA 2ZR0A 2WKRA 4D0GA 1JR6A 1W48A 2GXAA 3BFXA 5APUA 1Q44A 3HDTA 4DZOA 2RGNA 1E2JA 1GOTA 1K5DA 1XMIA 2WWHA 1VG8A 4FMDB 4WZ6A 1FQJA 2REBA 4PO8A 1OH8A 3M9HA 2CCGA 1OH5A 1MUUA 3SYKA 3GLHA 4AG6A 2IEZA 2CHVA 1GRNA 1VG0B 5J4HA 2V6IA 3CO5A 5EXXA 1KMHB 4HSEA 5F98A 4JLMA 3NIBA 3GLGE 1O3YA 4UKDA 1F3OA 2O8EB 3E5HA 3GLHB 1NF3A 4JLBA 1J70A 4NKRA 3KKPA 1W5SA 1NSFA 2ZJAA 4ZDJA 3OFND 3TUIC 1T5LA 1U98A 3KXIA 4C0AC 1FMJA 1E4VA 1VG1A 3WNDA 2WKPA 4B47A 1CKEA 2KBFA 4PC6A 2FEOA 3VQTA 1NMZA 2WPQA 3L35A 4QBFA 4A9AA 2Q6TA 3SJZA 1PLLA 1U0LA 1VCOA 1YZKA 3IHWA 3CX6A 4O0MA 3T12A 5BWMA 4EOTA 3I8SA 4TL7A 4V0KA 4TYNA 1SHZA 4D81A 2IXGA 4JZKA 1XTKA 2R2AA 1RPZA 2NPFA 3T1OA 3GFTA 4XOIA 3UMSA 2D3WA 1IN8A 4B74A 3U3MA 2CK3D 4W9MC 4LSGA 4TYQA 3TGPA 1E3MA 2GJAA 2WIAA 1G8FA 1GDDA 2R9VA 2FSFA 4HB0A 4DBLC 3DKPA 1UDWA 1JXOA 3FB4A 5E3HA 3H0KA 4MGIR 1ZUIA 3E70C 4OQMA 3BORA 4Y0VA 2ZPTX 3L36A 1ZVQA 3PIRA 1QHNA 1ZUHA 1CIPA 1K5GA 2ODNA 4AG5A 2PCLA 1YJ5A 3QKSB 1NMYA 2Q0HA 5KNCA 1KY3A 3MJRA 5KSYA 1HE8B 1R0XA 3HPQA 4OI0A 1OW3B 3LD9A 1M7GA 4B71A 4POAA 3AVTA 1ELOA 4N0EA 3SWFA 3RSLA 4GT1A 1R0YA 5A4JA 2XJ4A 3X1YA 4A4DA 1KHTA 3GLGA 1ZD1A 1VYVA 1UBGA 3GEEA 2C78A 3CF2A 2R44A 4AKIA 5APSA 1PLJA 1ZNYA 1T2KD 5JSZB 4AKHA 1Z0FA 1E1QD 2BBTA 1SXJB 4YQFA 3ADDA 2OBLA 1XU4A 3IGFA 1BMFD 4HLCA 4M0LA 4TL8A 5CDFA 2H7HA 4EJSA 4BZQA 4EPXA 1IXZA 2XTZA 5B64A 3VMYA 3A1SA 4K46A 4GI7A 4UXJA 3B1XA 2AWNA 2IHBA 5GADl 3SNHA 1KAGA 3VKHA 2C9CA 1W49A 2ZRDA 3CPJB 1JXMA 5FPTA 3D36A 1RJ9B 3VKGA 1YYCA 4ZDIA 3O8BA 1QZXA 2W6IA 2N1BA 1AS3A 4GOXA 4Q48A 4V03A 1S1MA 4PZYA 2WT7A 1E2MA 2WOOA 5AW3B 1W0KD 3BK7A 4JBWA 3QQ5A 5LBIA 2D7DA 5G3ZA 3OE7D 1NIJA 2IYUA 1GNQA 2OLJA 3HP1A 1TMKA 4A6XA 3TK1A 1KTVA 3JZMA 3LBIA 4V0LA 4B43A 2J0UA 2ZI5A 5C18A 1D6JA 1PUJA 2ZVQX 1KNXA 1WE2A 2FV8A 2VA8A 2GEDA 3ZIAA 3U5ZB 1KSHA 3BRWD 3GEIA 3VHXA 1GK6A 4GFDA 2ERXA 2F3RA 3CH5A 2JDIA 2Z4SA 1FTNA 5AJXA 1NWQA 2J0QA 5DI9A 3W6NA 2ZI4A 3QEOA 1T8TA 2ONKA 4PHTA 2ZRHA 5AVWB 4EJSC 4M3LA 2X19A 3ADKA 4NCNA 2A5JA 2WPRA 1N3BA 1XCMA 2G88A 3NTUA 5AVRB 4JJZA 1Z83A 1BKDR 1MO5A 1XD8A 1HYQA 5FUWA 4JLPA 3RRYA 1ZNXA 5APQA 2OCBA 1OH7A 4PR0A 3CF0A 5CYPA 1XRJA 2D06A 3A58B 1P9RA 2QI9C 3NC1C 3A0RA 1KI3A 1GKYA 1U9IC 2OE2A 5FPSA 1JECA 4FMDF 1BS1A 4MUBA 3WHLA 2YOHA 3DPUA 3EZFA 2W6AA 4Q19A 1ZNZA 2ZR9A 3CH4B 1KI1A 4XE5B 2BKUA 3A5TA 1AA9A 5K8LA 4L15A 4XVQA 4DT1B 3MWKA 3S1AB 4BLRA 4B86A 4CIDA 3KXLA 1FL9A 1YRBA 2ZSAA 2CCJA 3AVOA 3OEHA 4PQFA 4Q4JB 3REFA 2DPXA 1YZLA 4IDHA 1T3HA 1GZLA 3FHCB 3T97A 3AF1A 4LHYA 4UNNA 5IK2D 5A5GA 1P62B 1JJ7A 4ZKDA 2HYIC 1VMAA 4M1KA 1SULA 1E2IA 2X8AA 4EQ6A 1TUIA 4ASUD 1SVMA 1GU5A 2RHMA 4QGAA 3A37A 2YO3A 1NRJB 2KP8A 5L3RA 3LIEA 3VR1A 1S9DA 2QQEA 5BQ5A 4HATA 5JEDA 3M0AA 2C98A 4C0BA 1OFHA 3W5JA 3FFAA 5L8VA 4MYHA 4DLWA 3VMFA 3KQHA 4I1OA 1H8AA 1OKKA 4NCHA 3EPJA 4XTCS 3I62A 1UJ2A 3I8XA 4XVUA 3V4RA 2OAP1 4AIIA 3VN0A 4TZ0A 1F5NA 2QE7D 1NY5A 4WA7A 4C0HA 4CT4B 2GVDC 2ZSEA 4D0LB 1DAKA 2G3YA 1LNZA 2AD5A 3OIUA 2B21A 3EWAA 4FCTA 4DLTA 5B57C 3SQWA 4FMCF 4PXAA 1GKIA
chains in the Genus database with same CATH superfamily
3ZMTA 1UWVA 1FCJA 1WY5A 3G6BA 1UFVA 3E9EA 3GJZA 3H5TA 3HC7A 5AKEA 5EIAA 2QZSA 2XE6A 2QVCA 1EVEA 3IQWA 4OM7A 1LC0A 3D70A 2WTBA 5L3CA 3KKOA 1IUPA 821PA 4OA5A 5I3ZA 2DPGA 3VMAA 1AKUA 1MT3A 1ZD9A 1IVNA 2OQRA 3DBOB 3L4SO 4UV8A 3HUFA 1LUVA 3AFMA 3OJFA 5EWLA 3RJ9A 4X3PA 5AK0A 3RD5A 1GG5A 4IFDK 3C5WP 6YASA 4JV5B 4FHGA 3USZA 5U4QA 3TGUG 2RAFA 3UGJA 3SXUB 4HH3C 4OMDA 4AHCA 2XUFA 4CV1A 1ZW0A 3COJA 1JTFA 2WKWA 2BD0A 4H7IA 3A3YB 4M9XA 2PL9A 5T3UA 4BWVA 2N1TC 2LW7A 5F3DA 4AZ0A 3E0XA 3L8EA 3LYUA 5DTQA 3CCSP 1EUCA 1Y6XA 3HPRA 3KQYA 4TT3D 4CG1A 4ESOA 4ZI7F 4URUR 4DIDA 3GN2A 4HWSA 3LK7A 1VI5A 4QOIA 4W9NA 1UIMA 1VKJA 2PX5A 1KO5A 2ADFA 1PYOA 2UXXA 4DEXA 3IMCA 3T54A 4ARCA 4HN2A 4OHKA 1DJMA 1I0LA 3QBDA 2NNUA 2JPDA 3JQ7A 4J42A 2G0AA 4IDPA 3TWOA 3FVQA 3ZW8A 4ZAZA 1CULC 1MV5A 3HJGA 5HKKA 3MQFA 5JO9A 2CVPA 4YO7A 5I9NA 1HDYA 4ALIA 4MVQA 1PKEA 1TTPB 2FR8C 5NLLA 2IELA 3OF5A 4QHSA 5IE9A 3LLUA 1U1FA 4K9MA 4TYYA 2GUWA 4EIJA 4AECA 1KKDA 1T2CA 1DB3A 3LY7A 1GM7A 2OG1A 3G59A 1EM8B 4PNEA 3FF1A 2WTAA 3HD7C 1F0YA 3H5RA 4RZQA 1NC3A 2EQ5A 3L0BA 5CB4F 1NR5A 1EJ2A 1HURA 3I04M 3CC4P 1ZW6A 2CLCX 1KYZA 3AV0B 4DJFC 4DQUA 3SZUA 2ATXA 3GDGA 4U7FA 1OWAA 1FP6A 1M6EX 4YP7A 3EH1A 2ZBFA 4UBOA 3CLSD 2PMCA 3Q12A 5EK0A 1T36A 4MRNA 2ODTX 3C3JA 1SQPG 3C8MA 4ZT6A 1XDBA 3ABZA 1UPTA 4BX8A 4ZODA 5IYZF 2G6BA 3GR6A 2QR4A 2GAJA 1N5JA 1CYEA 3PUYA 2NWQA 2HKOA 1OI2A 2HJGA 2PN1A 1XRSB 4QRIA 4ZOEA 3QVLA 4L95C 5A9SB 1YONA 2WICA 5ER6A 1TC1A 4E2XA 5JV5A 4EHKA 5I9MA 1O96A 2K9PA 3SVLA 4KXQA 1X1AA 1NLUA 1XD9A 1KEWA 1Z0UA 3T5CA 2CCKA 4TYWA 4UMEA 4NMWA 1QRUA 4ZP1A 3DE4X 1ZYUA 5BSWA 4N0QA 1E1RD 4DIEA 2JATA 5CN0A 1VQ5V 1OXMA 3SQOA 1RM5A 4UCUA 2O2IA 4A27A 2CFCA 3B5NC 1BIFA 3MPUA 1J49A 4JSTA 4UU1A 5CM9C 5I9TA 3ER8A 3FBGA 2DFTA 4CHGA 3CEIA 3H01A 3QYJA 4B3FX 5JPDA 2PJRA 1JTVA 2OP1A 4Z5XA 2RAVA 3DCJA 1PP9G 2XYRA 3CR8A 4QUIA 1D1TA 2ZXUA 2Z98A 4QOEA 3VZPA 1AMOA 1XZNA 1VMDA 3OU7A 2PL3A 2XNHA 4F3CA 1LI4A 1L2TA 2ZUUA 4ESVA 1B73A 2IHNA 2H00A 2ZQ5A 2P6OA 3Q3HA 1XMSA 3SEAA 3UA3A 3D31A 3TUZC 1FS4A 2BFWA 4I5IA 4LMAA 2CTQA 2B8TA 3DMPA 4ZRMA 3VU0A 3A6DA 3MB5A 4JAAA 4N82A 3GVMA 3SJ7A 1D9ZA 3AG4C 1C3VA 1NULA 3K0DA 2BHLA 4NWIA 4WASA 1AXRA 5DNUA 5KJCA 2IX3A 1R6AA 2WJVA 3R5KA 2A9VA 3UJBA 3OCYA 4E6PA 1SPXA 1CYDA 1WD5A 2N46A 3OT5A 4GPBA 1CXZB 1S89A 4MA0A 3BJRA 3F0TA 3O3MB 3VNRA 5J2UA 2ZUFA 3ZQUA 4QL3A 1HDXA 2DGDA 1IHXA 1FU8A 4ZOBA 2C7OA 3GWOA 3KUDA 2CE7A 4IVNA 2IXBA 5FWXB 3UAYA 3HGMA 3AE9C 3FW1A 3U40A 4D46A 1WBBA 2H1OA 1G64A 3GWGA 3MFYA 4KW7A 3A7OA 4EIWA 3VSCA 4QLOA 1JXAA 5BVGA 4HZUA 1GZ6A 2AVNA 3M81A 1EXDA 1AUVA 2COKA 1SQFA 4FGSA 5BUSA 2PTHA 4PO3X 1V9SA 1P7GA 4PTZA 1B43A 3K59A 3FAKA 5CLJA 3NBUA 1TZ2A 2WW8A 4DLZA 5CDYA 1EK6A 2WIDA 4KAAA 2RDMA 1TQ6A 4DAEA 1WJZA 4R8RA 3VPCA 1A71A 4WXMA 1N7JA 2GERA 1RHMA 5EJ8A 1K6MA 1Q82Q 3AHGA 4KXRA 3HEBA 2Y0DA 3HNRA 4JI8O 2GN9A 1HG1A 2YINC 4QTYA 1KQLA 4ZYLA 3D6TB 1ORIA 4DFDA 3KZNA 5E4YA 4LQLA 4KLAA 1NU1G 5FPQA 2WM9B 1ZU4A 2CLFB 2XW6A 4GIBA 4G1BA 4JI0O 5KHJA 4MSUA 3REQB 3SLRA 4CM3A 5CBKA 1I7NA 2IBMA 2ZAOA 3K7EA 3CLTD 3HM2A 2JH8A 2CYCA 5B1OA 3JTMA 5CP8A 4JZ2A 2IKSA 2WWIA 3G67A 2QUHA 5CIWA 3FCXA 3B38A 3MOGA 2AFHB 4P7FA 4RZSA 5A06A 2HU8A 3JWHA 2Z9DA 4D9HA 3B40A 3JARA 2GK3A 3DOFA 4KL1A 3PD1A 1QX8A 3EXG2 3A3OA 1Q92A 4DR1B 1HTBA 3CCUV 3I09A 3KLPX 3OTFA 2LWIA 4S1OA 3OZ7A 1UBCA 4CT5A 1M2NA 3L74E 3DMRA 1EA5A 16PKA 3PHHA 2BIFA 4KN6A 4F3TA 1AB3A 3RU9A 3WZ2A 5JNWA 1JQ5A 4Y98A 1VRCA 4PDRA 1T5IA 3GZTB 1DH3A 1EG2A 4B3DA 5JAOA 3GEPA 1OPXA 5HDBB 1I80A 2LIPA 4MUMA 3U9TA 3PR2B 1G2CA 2Q4BA 5HZHA 3E8HA 2YOGA 2BSKA 2M0BA 4DNPA 4KACA 3QELA 1YTUA 2NSLA 3KQMA 2Q21A 3PJSK 1QH1A 3D7RA 3NBZC 4X7MA 5IK2A 1ST2A 1H8EA 2X4IA 1XEAA 1PGNA 3Q3JB 1GKFA 3GZ4A 5IT5A 1SY7A 1ZMTA 1AV7A 2I8LA 5CCHC 1SG9A 3WP0A 3IR5A 5AVRA 1WXFA 2QOEA 2PQMA 4MUAA 4N6GA 2WUGA 5HUQA 3MWGA 4CQMA 2VUHB 2I4RA 1EUCB 5K9ZA 3NAZA 1Q74A 3V8EA 4GL2A 2AG5A 1NJIW 4GPAA 5HKLA 3PGVA 1C8BA 4QT4A 1X7DA 2FZCA 3KVVA 3Q7TA 3FVVA 1ZM2A 3PC8C 4I46A 1XVLA 1J9EA 1ZJYA 3QBJA 3QVSA 4R9UC 2YL2A 5KX5B 3K15A 3WQHA 5HVNA 1GL3A 1T2EA 3T99A 3ZJ5A 3EZ9A 1NVUQ 2D2XA 3KT3A 3OBBA 1KMHA 2C77A 1G3RA 1IFXA 4BKOA 4CKEA 1T9ZA 1ULZA 3RODA 3VDRA 1GLGA 2Y4OA 4UTOA 1AMNA 2QBYA 4V3BA 3PKIA 1KDVA 2H16A 2HX1A 1EM8A 1NUPA 5CXUA 5AVZB 2DFVA 1IFJA 2JAWA 3AVPA 3O2QB 4NG5A 5AICA 2HBRA 2FP4B 4CMEA 4LGDE 1U0TA 2EZOA 2QE7H 1B0ZA 2VYNA 3N7TA 4G5YA 1P44A 1ARZA 3NT5A 5G53C 2CWDA 4GYCB 5FTLA 4KXXA 4PYQA 5CW1A 4QA9A 4KV7A 1OFTA 2YR0A 2QWRB 3I01A 3U3JA 3VNSA 2E42A 1R64A 1IXRC 1YMUA 2HD4A 3G1TA 4YAOA 2WVGA 2WZBA 3PE6A 1BVHA 3PTLA 2AYZA 4J1TA 1NRXA 2AG6A 1EQ2A 3PQ3A 4HD8A 5A6SB 5K2OA 3UN1A 5FAXA 5LOVA 1UZNA 3V4PB 1WABA 3BA9A 2PVSA 5K8UA 3FNGA 4HBZA 4PFJA 2IPNA 1KPHA 3CPWO 2FGKA 1JR2A 5DYGA 1DG3A 1MJNA 1ENVA 3DLTA 1E1NA 5FKJA 1HGZA 1V55B 1T0UA 1P9NA 3GUHA 3RV4A 3OW2O 3BL5A 2BGIA 3DP7A 4GRAA 1X8KA 5JU6A 2PSEA 1AN9A 1L7BA 1QX3A 1RPTA 1E3SA 3LKBA 4MW4A 3ABKC 3D3IA 1DTWB 3M8AA 3IUPA 3OZVA 4Q24A 2PV0A 4JS0A 2WHRA 5EHZA 1NG9A 1KO7A 5JS8A 2K88A 3QNMA 1U7DA 4XASA 4BIZA 2CNKA 1EFRA 2XUQA 4US2R 4H2DA 3T3NA 3U3OA 4B08A 3RVYA 1CUJA 2FFAA 3GD7A 1SC1A 3LDFA 4J43A 4XW2A 1OTHA 4E33A 4R2IA 5L8RJ 3B2EA 2QWOB 2X9LA 2ZRCA 4DYLA 1WCIA 3ETLA 1S9KD 4WH0A 2HDNB 3QE4A 4C9BA 1M8FA 4D25A 2GTSA 1A9SA 1II9A 4R6WA 4B6FA 3WB1A 4LW8A 2QN2A 2F43A 5B2ZA 3G2NA 5JZMA 5JZ9A 3U5TA 2NNWB 3E22A 1YZBA 3PXAA 4XSVA 3HH8A 5CVCA 3SI7A 2GN2A 5JNSA 4GO1A 2C5LA 4PBSA 4K05A 4UBIA 4U3FE 3E22B 3APQA 3AGQA 3PDJA 1DIAA 1JDBB 2P6UA 3E2IA 3FDFA 3GGJA 1DG9A 4H7PA 4ZC8A 3UOGA 4FB5A 3UENA 1D6MA 5H82A 3JYNA 4GYYA 3VM6A 3HBFA 4P33A 4BW5A 4M21A 2C4UA 1SKVA 3GGPA 2QEQA 5EY5B 1K4YA 2OSVA 1JQJC 4IYHA 2ZUWA 1Z06A 1NQOA 4RXUA 4L87A 1XBLA 3R6GA 3VOSA 3CT4A 4IEEA 4I50A 1E1QA 3UY4A 4I9UA 4E7PA 3CCEP 2BI7A 3MCAA 4ETNA 3N3BC 2H48A 5ALHA 5GJCA 2VPYA 1E3LA 4XSHA 5JLJA 1LTBC 4KOAA 1RKXA 4HP8A 1DC4A 1G59A 1NT2B 2Z2IA 1FDRA 4LIPD 5DLDA 2FZGA 3TLZA 1N78A 4GHWA 4CE6A 2Y0IA 4YV0A 2VP5A 1NKSA 2NR5A 3VP9A 3ZWAA 1SG0A 2CUKA 2ARHA 1WAMA 2R8ZA 2ZIZA 5D5QA 3LC1O 4RLFA 3SN6A 3VJMA 4C29A 2BRUA 2WHXA 4CV3A 3TL6A 3V8NA 5MF6A 2QVAA 1HSZA 2NAPA 3KAPA 3NH9A 1N73A 3I2JA 4WLEA 2QDOA 4F6LA 2QM0A 1EN5A 3GRCA 2WTXA 3RUDA 4TTVA 1QYIA 5CJ2A 5KNDA 3C3YA 1Q1QA 2DVMA 1J8VA 3DAYA 2HMAA 4LDZA 3LDDA 1E63A 1X42A 1P75A 4RESB 1H4VB 4ACBA 4DY6A 1V54C 4Q7JB 3K4QA 3I53A 3M99B 4K9DA 4V24A 5FOQA 5THQA 4H13C 4FPXA 1YRWA 4P83A 4F21A 1TADA 1DPFA 3KOWA 4DR5O 4GVLA 1L7NA 5AI5A 4TT8A 1LD3A 2FN8A 2E3JA 4GM1A 5JY1A 4BNTA 4CXMA 2QPTA 2P06A 2O2CA 3A1NA 3FB1A 4G41A 1XOIA 4R0MA 5AFSA 3BGDA 1ZLZA 1G8PA 1Y8QB 2G9QA 3K3PA 4ABYA 3F3MA 3H8VA 2XJ9A 2IYFA 2ZS8A 5F78A 1EDZA 2H0QA 3FI0A 4NVPA 4UVDA 3H1EA 1H3FA 4GXQA 3EFFK 3I9OA 2XODA 3NRCA 5CT5A 1NLYA 2FZEA 3MLBA 1WBJB 2XKKA 2TMKA 2H18A 2Q7CA 3SSAA 3W7BA 2IJGX 2YIAA 3R3HA 3DZCA 2JGDA 2HRRA 2QPLA 4YXDC 4IS3A 2CSXA 4XWOA 4YGYA 1JKJB 2B2XA 4FFRA 3GHHA 5M04A 3BY6A 2LXBA 1E1RA 2Q3CA 3EIEA 4FYJA 4YCNA 4C4AA 1U28C 2J5QA 3JVIA 5K01A 1FS0E 2A84A 4UD6A 2OZKA 4ASVA 3S7ZA 5E6RA 1G7SA 1ESNA 2DPLA 2WJYA 3F6RA 4FKMA 4Z99A 5B36A 1M2GA 3DKRA 2OKCA 5DH9A 3STWA 5KYKA 3L40A 3LF2A 3JQRA 3R6LA 4YWHA 1M0EA 3X2QB 1CB7A 2Z2ZA 3BE6A 2AZ4A 3BSSA 5AWFC 5TS3A 3SC3A 4ZZ2A 3VHRA 4BGVA 4D5GA 2A86A 2PR7A 5TMDA 1F4PA 3GGGA 3V7UA 4AO8A 1NJGA 4LE1A 5CYFA 2RCYA 4E07A 1OW7A 3DBVO 4I08A 3MAQA 4FMTA 3CH7A 2YFHA 3TVTA 4D80A 3NGXA 4AD8A 2DPMA 3ZWCA 2ZRAA 1KI8A 1HA3A 2BM1A 2P27A 4XZ3A 4TXMA 5GJVC 4YTPC 3WNBA 4DJDC 5JATA 2HQ1A 4LS3A 3OQMA 1N7SC 1YJCA 4YHHO 1QFYA 1W36C 4M9QA 2RGRA 3E9NA 3CCQV 4OLHA 4OX9O 4RL4A 1O03A 1ULTA 2ZT7A 4Z0HO 3NASA 1ACMA 1BCCG 2JDIG 1CRPA 4Q4CA 3JQCA 1HL3A 1DXHA 5I7OA 1KQGB 1ADBA 2QLJA 4ZKIA 4HFJA 5KWSA 3FHJA 3BPZA 3JYPA 2X2EA 3N2EA 3ZBHA 1GYQA 1FFCA 1OFIA 1MEJA 1OI7A 3M6FA 1XA4A 1T35A 4I1UA 3OICA 3WKDA 3FKQA 2ZYAA 2P65A 2ZREA 3IUYA 4XIGS 3H0EA 4ERNA 4ZK6A 5LC1A 1SQBK 4DDVA 3JD3A 3K06A 4JC0A 3IOBA 4HBGA 1AXEA 2OZLA 4N5MA 1N36O 2Z6QA 3AUFA 2PDAA 4MP3A 3DAHA 2QRVA 1XTRA 4GVPA 1UWCA 4QJ4A 4TT3A 2DR3A 3QKRA 4XM2A 5AUNB 1L0NJ 1QNLA 2JIDA 2QT0A 2DPYA 1ISFA 5LOVB 2X7RB 1N1EA 3AY6A 1JSCA 3BERA 1YRHA 4HEQA 4LYHA 4B4OA 1ORTA 2V7VA 4HQ0A 1QIMA 3WWZA 2B25A 2BCEA 5IG2A 1GSAA 1X14A 1P4JA 3CCMV 1C9KA 4FMBB 4J03A 2VP9A 4FC6A 4J0GA 4Y2GA 2JHFA 5HG0A 3SR0A 3DBRA 2GRUA 3AP1A 3N86A 4S1TA 3QFRA 3OTGA 3Q9SA 5CLIA 1E5LA 1RQVA 1OFUA 1H8HA 1QQTA 4DUZO 2M1ZA 1JR9A 4C5CA 4ZEVA 1FTSA 1T2AA 1ISRA 2PRSA 2AZ0A 1SBCA 3P5BA 4M0UA 4ND6A 5AVQA 1DBQA 3V9AA 4F4LA 1GM9A 1VQ8P 2J3HA 2IY9A 3PUWA 3SFVA 2Q8VA 3EXG1 3H9QA 3IA2A 1D5NA 2OMEA 3PDCA 3R3XA 4I2VA 3TZLA 4PWZA 3EXIB 5GPBA 2Z5FA 1NBOA 3PXGA 2ZBRA 3LIDA 3DGEC 4M53A 3Q5SA 5DFAA 4FDTA 2QI9F 2IIQA 4P3NA 4OQXA 3CUUA 3TS1A 5BN3A 2WLMA 2PY5A 3AFIA 3GCDA 5JADA 5FTJA 1EBOA 2KBEA 1Z2NX 2Z30A 1XF1A 2D0PB 3BCCG 1PJLA 2JFGA 5DI3B 4CR6A 4CKXA 3HCWA 5KJ7D 2CVQA 1DRUA 1CR1A 1C4KA 3AXTA 4JVLA 5JJ5A 3ASOC 1ZWIC 4M3NA 4HADA 5D84A 5E6UA 5C52B 1PX0A 2QLBA 1BH2A 2QV0A 4G0VA 1E9EA 4E13A 2ZEJA 3HO8A 3RGGA 3QE0A 3U1VA 1JEEA 3C3AA 4UXHA 4GE0A 5FV4A 2YXLA 2OQQA 4H0LD 3ROTA 5KLVK 1TDJA 2JJ1D 1FUKA 2VBIA 4KRYA 5BU8B 4P0TA 4CQLA 1PDVA 5LIPA 4MTFA 3ZCXA 3PE4A 5ITVA 1WB4A 5TMPA 1SA0B 4Z54A 5A3SA 5K2MA 5C1IA 4HPWA 1H05A 4AY2A 3VYWA 1BX0A 1VQOP 1PEAA 2I9PA 4ZVVA 4PGHA 3TDNA 1M90Q 3GEMA 2RN0A 1QCZA 3W9BA 4AMBA 5LP1A 2GXQA 1CJUC 3N6RA 5L45A 2WSCH 1IX9A 3GNQA 4PPGA 3OFNG 4AK9A 5ALEA 4PA7A 2YXBA 3AEFC 2XOXA 1VIMA 3OC0A 2JIZA 4RUKA 2JNWA 4UZSA 5T4BA 3KSZO 3F98A 4BWAA 5JWRA 3A6PC 3LWZA 1E1DA 3UM7A 2AN9A 4W1RA 1AS2A 2BOVA 5LBUA 3W6ZA 2R5FA 4FONA 4P31A 1ZOLA 4LECA 4DQ0A 3FSRA 3KLBA 4Y2QA 5KQSA 2V7QH 5AM3A 5LLDA 2LR2A 1TZBA 1BSHA 2I65A 1GGEA 1W44A 3LNCA 3LXMA 4ZVTA 3RVQA 2F62A 2VLIA 2RC6A 3QOWA 521PA 2CDYA 5GTHH 3L0YA 4Y2RA 3ZCCA 3C5VA 3NRJA 3W1WA 5CVUA 5EC8A 2GDJA 4ZT4A 1AQUA 2IP4A 3U9SA 1ZRHA 3ZBTA 4L4UA 2FXVA 3FJYA 3I32A 2G1PA 1GQFA 4A0GA 2A9QA 1FNMA 2HSEA 4HPXB 4IM7A 1BMDA 4OQQA 2RGYA 3HWSA 3HY6A 5F21A 2XZRA 5A0VA 4FDLA 3ZZUA 1N9KA 2ODMA 1OVMA 5T5QA 1QGDA 1XCOA 5HFMA 5G1OA 4ZIRA 3RKSA 1M2VA 3DSQA 3AEEC 1BHBA 1MAWA 4HJGH 4K6FA 3RUEA 3BMQA 4NBWA 5AOCA 2HPAA 3ZCTA 4IY1A 3GB9A 2V55B 3GMAA 1ESCA 4OSEA 4JKOA 1EUDA 4L50A 5JT1A 3U16A 3CLRD 2JDID 1H1LA 1LLQA 2FCAA 2JCSA 2UYYA 5HF9A 3WIDA 3TXXA 1VQKV 3F6CA 5J4YA 1FW6A 3WB0A 1U6IA 2ZRGA 4IHQA 4MV9A 5MFPA 1YVPA 3WFZA 4K9NA 5LYJB 4X65O 2Z1NA 1PG0A 2V6FA 1C4OA 3UMFA 5ABPA 5CM2Z 1KOLA 4J29A 3K03A 1NX6A 2HXYA 2VRCD 3RI3A 3D43A 2HU5A 1DBPA 3IPCA 1G8AA 1NVWQ 1M6HA 1M74A 1VDZA 2DQ4A 4GR5A 3FFXA 4M7PA 3RWBA 1BXGB 3MUDC 1W0CA 2A4KA 2IYZA 1XZHA 3LFHA 3QX9A 4R7TA 2YC2C 3PNLA 4PQYA 3WLJA 2E4VA 3IFSA 4UM9D 3T1YO 1PJ4A 4DSNA 4GRIA 5IZ4A 3BMXA 1FXWF 4YQZA 1XAHA 5DRTA 1GH6A 1DIRA 4IUYA 2CHFA 2O2EA 2X9NA 2YW9A 4D0RA 4GSKA 4DGSA 1JEYB 1A5SB 1RF1B 1YHQP 1B8UA 2MSWA 4HUQB 4BOYA 1WDLA 2FFQA 2KPOA 3V48A 1EH5A 2EINB 1EU1A 2KS1B 4NBSA 1VC2A 1K7FB 4FS8A 4QULA 3F3KA 5C93A 1J5EB 2HUPA 2XITA 3N87A 1PFVA 4TQAA 2VBFA 1QU3A 3JCUE 3D7NA 3AM1A 2R6HA 1QQ5A 2GEVA 3LGAA 1U6KA 1SCQA 3K5WA 4UNSA 5E1OA 3JQBA 3RHZA 1BRTA 4GI5A 4L3OA 3PQ5A 2WLNA 3DKKA 1BMFA 3RIYA 2QENA 3V4OA 3E8XA 1V8FA 2VZEA 4Y6LA 5DM70 3R0IA 4N0DA 1NVFA 4MPJA 3X1DA 1YIJV 2LTAA 1GM5A 4QJBA 4U3JB 1FBMA 3TTUA 2C7BA 2OSBA 4IRXA 2IYOA 4PELA 1QAOA 3UC5A 2NVBA 4RQAA 5JARA 1G38A 2YMLA 3DLHA 4QXRA 3OAAG 4LF7B 1FFEA 2WB2A 1QE3A 4KWCA 4P4SB 4WY5A 2GJKA 3CIFA 2BRUC 3DC6A 3OLYA 1R3DA 1KK0A 1KZGB 3LECA 2DWDC 4OGKA 3ZIDA 2CYAA 1GL2D 1IDN1 1IHUA 1NTKJ 1P7VA 5CFNA 2B5UA 4HGZA 1IN6A 4NHEA 3KJXA 2QM7A 4O2BF 5KAIZ 1QP8A 3WFVA 4QD3A 2W9XA 1YZFA 1UXOA 3H5IA 3L6DA 4FYVA 5EJMA 2ZWAA 3TKYA 2WF6A 3SYLA 4EW2A 1KECA 1NLZA 1YS6A 1WXGA 2QDXA 3JS5A 3EBOA 3JZFA 1M7HA 1O9HA 3DOUA 2B8WA 4JSYA 2EZUA 4Q1AA 4PZDA 5TS2A 4F4DA 4PSCA 3RFUA 5FADA 4C06A 2J0VA 4ZI7B 2KJQA 2IXTA 4C7OA 3F8WA 2WUWE 3EY4A 1TFRA 4R2WA 1P2DA 3DMHA 2C1EA 3PE3A 3ZDFA 1NFRA 3ZE6A 2VT2A 1MVLA 4D98A 1VQLP 4P38A 4J1QA 1VA5A 2Q8QA 3Q3IA 4R31A 1P84H 3DE0X 1RXSA 3T95A 4LCUC 4MK4A 3BE4A 4TLMB 2WSEH 1EPUA 4AJ1A 2FDRA 2GJ8A 3A9UA 4UVEA 1M1YA 1QANA 4W1PA 1CS0B 1JXQA 4R16A 1IFNA 2OV3A 3RF6A 3S2ZA 1U97A 4MDFA 2RMKB 1NO4A 4WI1A 4UEOA 1PP9D 2P4EA 4G85A 4W5JA 3D02A 3ZVLA 3NHZA 2Q5HA 3PJRA 4I4NA 4KQHA 2ST1A 4P1ZA 3WWPA 3QVJA 2L6LA 4UCVA 1JW9B 2VP3A 4WY4A 2Z9BA 3GRYA 4RZIA 4E88A 4ZYUA 3WLNA 1WHSB 1JZSA 1GAWA 2OT3B 2DR0A 3CX7A 3R2JA 5JDCC 4BO3A 3AYZB 2FJ0A 2RARA 2PV7A 3T3OA 3B52X 3TOSA 3ZD9A 1T2VA 2R7NA 2WFLB 1K06A 1NTKK 1PG2A 1YHYA 1YVRA 2GKOA 3F6PA 4LFCO 3PRHA 4UD2A 1QLHA 4ZEWA 3T1NA 1KIAA 1VE1A 3LUJA 2P30A 3GHGB 1EE9A 1Z5OA 4DILA 4BFLA 2M3EA 1JJVA 4KYVA 3BPSA 4TQ9A 2YJNA 1OCOB 2YV5A 4INPA 1QYCA 1COWA 1VCMA 1Z3CA 3L73H 1TJPB 3QPDA 2AQIA 1YJ9V 2OENG 1TLTA 5JXJA 4F5YA 3MGAA 4E5MA 4IJ6A 5CGZA 3CCRP 1OZGA 3AKEA 4PRKA 1FFWA 3K1TA 2H92A 3E8GA 3L4KA 4MI9A 1SD2A 1T2FA 2G0TA 3TRDA 2C59A 4BRWA 1AN0A 4DQLA 1EWVA 4TV8A 2OXRA 2NU8A 4BBZA 3GLIE 1QO0A 4X45A 3RVOA 1K05A 3P3PA 2R6AA 2VDRB 4Z86A 5E9WA 2DUWA 4FM0A 3PUHA 3QFCA 1NPDA 3CNHA 4J7UA 4JJ6A 4L78A 5PNTA 3KTAA 3ZQ6A 2AV6A 3LSQA 3NFQA 4FM1A 4L73A 5DN6A 1RM3A 3CJHA 4ROSA 2V4HA 1DKNA 2OZPA 4NYJR 1HWTC 2XT6A 2BVNA 3SYCA 4WLOA 3CKYA 4TQGA 2B92A 3FTPA 3QLVA 3QX8A 5B1SA 4I0XB 1X8YA 1Y81A 2CDCA 5DHUA 2GMWA 5FNVF 1HDEA 1MVNA 2XKMA 1CJTC 2GQ0A 3T3GA 2XHBA 1GVNB 1VARA 3FR7A 3RF7A 4D4JA 2Q49A 4N8SA 1QM5A 2Q50A 2X5NA 5E4JA 4KP4A 2NOAA 1VPDA 3T06B 4FKBA 1NUAA 3G5LA 1J1DB 4JUFA 4IUDS 5HZKA 3M6LA 1U1EA 1OOEA 3MINB 4M60A 3ZHZA 3H32A 2CB9A 3OF3A 1GZDA 2O8DB 4AAYA 3RT3C 1Q6YA 2J45A 1QE5A 2ZVDA 3ED1A 3EGOA 3QHPA 3TTWA 3UPDA 4AZ0B 1WXIA 4HLUC 2L18A 2BW0A 1H8HD 2XGMA 4QDOA 5DP2A 2GVZC 4IR7A 4LYFA 4PW0A 4BVGA 3FTFA 2ZE8A 1MXFA 1H1LB 4IJUA 1I6KA 4RK5A 5JYDA 4UHHA 1NU8A 2YJ6A 5HF8A 1YE8A 1QL2A 1XHEA 3VO8A 2HPHA 3M9QA 2XOKD 4IAOA 1MEOA 2D59A 5AI0A 3F5MA 5CXQA 3DE3X 4FGLA 4U2BA 3WFIA 4TROA 2VJBA 3SYOA 1CI6A 1DJNA 1GW3A 1MPXA 3BCSA 1R0CA 3FG9A 1RVV1 2R6DA 3JSAA 3X1ZA 1Z47A 2Q3HA 4M87A 1G8KA 4QECA 2C8KA 3ZX4A 4BC1A 3GRAA 4P36A 2JJ2A 4E5YA 3BVOA 1SQQD 3HE5A 2PS1A 3N5KA 4RZ2A 4WQMA 2AOTA 4GI3A 4Q6BA 1H4SA 2B82A 1GK4A 4EHIA 4EG4A 1WXEA 4XA4A 5KNCH 2QHXA 1H2NA 2I4LA 1RYNA 2R87A 1BKYA 1DVRA 4MV0A 4TPKA 4YYZA 1Y8ZA 2BGGA 3W7VA 5KOHB 1YTFB 1FVXA 4L8LA 5KC8A 1DAOA 2FY8A 2DWUA 4FE7A 4YRBA 1LBIA 4W6ZA 1KBZA 3NPMA 1JU9A 2M7WA 3Q85A 4NV0A 5TJ9A 4JI1O 5DJUB 1LRJA 1ZINA 4R8MA 5IASA 4KU4A 1LBHA 4LXUA 4Q18A 5EQDA 3DR5A 2B4QA 3LW7A 3PFWO 2M1XA 4P3XA 4EHAA 3PFFA 2OILA 4YRIA 4LWSA 2FFHA 2ZBVA 3SPIA 2M6LA 3FNRA 4FK8A 4BTVA 5FIUA 5BNZA 4EARA 5DN9A 5KTPA 4NTXA 2IHVA 4AULA 2BP7A 2I62A 3ZRWB 2XTAA 4H1UA 1RM4A 2IEAA 5CLGA 4DV7B 3I1JA 3Q2IA 2TS1A 3R9XB 3S2FA 5B5SA 1UFRA 4HX2A 2ZATA 3O2NA 1V7ZA 3QYAA 3WL5A 3AEXA 3ZRVA 3GGCA 4N18A 4RY9A 3WWOA 3PGA1 4TWRA 4Z3DA 1PK7A 3HXTA 2V5VA 4X66O 1OLSA 5LIRA 4XWYA 4NFLA 2UYGA 3BQNB 1Q5PA 3KJNA 4RHEA 2JEZA 2J0SA 4TSFG 1HBJA 2WPNA 4WZBE 2VCHA 3HJRA 1G7CA 2E75C 5D8DA 2CXQA 2V6BA 3DNMA 3QVWA 1BFDA 2OXCA 1XCPA 4LHZA 4LX0A 1NVXQ 1FP7A 4HDMA 4GMXA 2A45I 2YIBA 3ETNA 4G1MB 4XGIA 2H94A 1TAGA 5K1XA 3AF4A 3BFRA 3GQVA 1A3CA 3RHFA 4REOA 1JB0J 3UBTA 3ICQB 1USWA 4LV8B 5BWLA 3PEWA 4WBNA 4B3SB 1U99A 2YHAA 1ZONA 2JD0A 3F7VC 1YJ9P 3LQRA 3M6UA 2FB9A 3LXUX 3RK3D 1J7JA 2VS1A 4EYQA 3H3FA 4C6TA 1ZLYA 3WFJA 4MIOA 7ADHA 1IVYA 1JEOA 3HABA 4KLCA 2R5WA 2XNKA 5M3BA 3UJHA 1JEYA 4NVRA 1ZUWA 3DL0A 1NJ6A 2R8OA 2NSDA 2FKAA 3HR8A 3O73A 4LYYA 2JGIA 1FAVA 4PYKA 5E1MA 2OP0A 4QAJA 2F3UA 3HN2A 3HCOA 1MH1A 2X6BA 1LT9A 1X7YA 2A0YA 3AKDA 3O21A 3PPYA 4W9RA 1FYEA 1KFKB 2GN4A 3GFPA 4OUDB 1IPHA 1IZYA 4NENA 4XGRA 2Y1KA 1EZVG 1QJ4A 4FFNA 4JHLA 3T61A 5JS6A 1J5EO 3SPGA 1JPNA 1Z2OX 2AL7A 4KR9A 4QUEA 1Q5OA 4D9NA 1OV4A 4OMUA 2QTFA 4LBWA 1LC3A 3TZ6A 4EY6A 3ZMVA 4QJ5A 4RBNA 2JC3A 1EUQA 4FFWA 2XUZA 2C4MA 4FX5A 1QVGU 1NF2A 1LP1B 3V80A 1IMJA 1E61A 3CX5H 3W2EA 4BN5A 4BNKA 4ZTUB 2K9JA 4G56A 1SF9A 2E4YA 4HHEA 2MR5A 3CNQS 2B9EA 4XJVA 5FBZA 3RC1A 3C3MA 3AEYA 4P4UA 1XTTA 4CR7A 4MUHA 2IZ1A 1B2LA 4I55B 1XKLA 1PWXA 1SN7A 1WTCA 2HSDA 2ZUBA 3GP5A 4QVGA 4FZ1A 2IYTA 3N8NA 3JWIA 3OUFA 5EP3A 5F5LA 1O1YA 5BUQA 1N4AA 4QTXA 3LNMB 1YA4A 2E76D 1NQTA 1D4OA 2EC5A 1QKIA 1G21E 3LX4A 4H3HB 1PD0A 3R2PA 1MLDA 1U5CA 3DBHB 3G88A 2C4HA 3R3SA 5KDLA 5JCJD 1E2FA 1UZLA 3A36A 4R5HA 1A9XA 2FPKA 4ENVA 3WL7A 5LP6A 1O6ZA 3R8XA 2IYYA 2VLBA 4BP3A 4RZ3A 3INNA 2YRWA 2DFNA 4HBNA 1P2GA 3ZDYB 4PO1A 2WUVA 4BKUA 2XWJI 3J81N 2NUAB 2VWQA 4F91B 2HODB 2X76A 4MCAA 2BUAA 4DLSA 3M4XA 5C7IO 2DUUA 2WDPA 2J5XA 2R32A 2IYVA 2QK4A 5CB0A 5FA5A