4JYCA

Meab, a bacterial homolog of mmaa, in its apo form
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
322
structure length
311
Chain Sequence
PDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPKKGIFELADMIAVNKAGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 115
structure length 311
sequence length 322
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jycA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jycA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jycA02
1S8FA 2DBYA 4AC9A 1KI7A 4BLSA 2HLDD 1G16A 1KDTA 1H8EA 2C78A 4F92B 2L0XA 4OI0A 4BFSA 5IRCD 1JB1A 4AY2A 1W0JD 2BBWA 3WP0A 5AW4B 2P65A 3A1UA 3K0CA 1EFUA 3RRMA 4EUNA 1T2KD 3C8UA 1U90A 2X77A 2F1RA 3IHLA 4JVLA 4C0QC 2PMKA 4BFZA 1R10A 2WPQA 2A78A 2XNDA 3EAQA 1YZQA 3IEUA 4JLJA 4RZ3A 4U00A 5G3ZA 4QJ4A 4AG5A 4TT3A 3ZD7A 4PC6A 2CL7X 3TNFA 4EFNA 2OEPA 1DBSA 4E09A 3EPLA 3O8BA 2FEMA 4XIGS 2IBMA 3FKQA 4Z8YA 5JJIA 5B1NA 2PT7A 3L8ZA 1ZC4A 2VRSA 5EE0A 3CWZA 3ZS8A 1Q12A 2TMKA 3PUXA 1DAHA 2P6UA 3PUZA 2WJYA 3CNOA 4IRUB 3CRRA 3LWNA 3LXXA 5E7MA 1J8YF 1W36D 1JJ7A 3A1SA 3H2YA 1Z08A 3VQTA 1E9DA 4Q1DA 4DCNA 3FTQA 3ICEA 1M8PA 4D0LB 1KO4A 2WT7B 3EZFA 2GK6A 1SXJA 5AW1B 2AXPA 3HU2A 4JZKA 4RESB 2BKEA 2NZJA 5JJLA 4R2IA 3TGPA 1DOAA 3AKEA 4I81A 4LJYA 4BFXA 2P7JA 3RRZA 3UPUA 1Q20A 4MKFA 3IPXA 2WJGA 1Q1BA 2QRNA 5IHPA 1KHTA 3SBDA 1SHKA 1HH4A 4Q9JA 4F7WA 2PJRA 2YWEA 3NC1C 1HE8B 1F2UA 2RGNC 1NMZA 4NYMR 2Z4RA 3RVBA 1HT2E 5LD2B 1C1YA 1GL9B 1O3YA 3GEHA 4ZV4A 1MOZA 2UZ3A 2QM8A 1NKSA 2F43A 3WNDA 2O8CB 3PJRA 1TQ2A 3KFXA 1ZIOA 1KI1A 2VHQA 5JHHB 3TE6A 4A1FA 1G19A 1VCNA 4CEIA 4FMBB 3GJ6A 4LDJA 4IEIA 4TL8A 2QQ0A 1UFQA 3T5DA 5TARA 1IN6A 4EFLA 5KSZA 1U8YA 3CF0A 4M9QA 2AHOA 1SKQA 1W49A 3R8FA 2ZYTX 3MFYA 3D36A 2G77B 1F6BA 5BYKA 4D82A 2W6IA 4GFDA 3GD7A 4TMWA 1LW7A 5FBVB 1QG2A 3A0RA 2QAGA 5K8IA 2CDNA 3L8YA 3ETLA 1NMXA 1GKUB 3OIVA 4HSEA 1X8JA 1ZBDA 3EIEA 1W47A 4Q9KA 2W0MA 3RS2A 4IDOA 4MTXA 4QBIA 3IGFA 2XV5A 1S3GA 1XEWX 3SN6A 2ZRMA 2ZJ2A 4DIDA 4TQ9A 4DZZA 4M1TA 2CVHA 4Q7LA 2QPTA 3RS4A 4EFMA 1A82A 4EPVA 5KHOC 2QTVB 3KQKA 4F38A 3IR9A 2H5EA 4NL4H 4Q66C 4PAQA 4A6XA 4D0GA 3MGCA 3VYIA 5HKKD 2J7KA 4QPJA 2ZI5A 3LAWA 2JATA 3QOFA 4CW7A 1EXMA 4LJAA 1Z0JA 5CYOA 3TW8B 3ADCA 5EE5B 3ZH9B 4IJMA 1R8QA 4L4UA 1YZUA 1SULA 3O8DA 5EP4A 3WHKA 2I1QA 4DB2A 1XP8A 3K9NA 4OI1A 3B1VA 4W5WA 4QJ5A 1KAGA 1ZD9A 2Z6VA 4KXFB 2OT3B 4GBMA 1XCMA 5J4HA 3THXB 1VG9B 1DO0A 2D06A 2FWRA 2W2VA 2ZE8A 4DRZA 4M1YA 2ZIAA 3KJIA 1RIFA 3AVVA 4RCYA 1P61B 3OIWA 4KLNA 2YC4C 2FPKA 2IX3A 2ZPTX 1XPRA 2LFSA 1DAKA 5FBRB 3CLVA 1SKYE 2QMOA 3KTAB 5JRZA 1T91A 4BECA 3KB2A 2F7SA 8OHMA 4RD6A 1NF3A 5EXTA 1YVDA 3B9QA 2PX3A 2EQBA 5AW8B 3BS4A 2GXQA 3ZVLA 3OEED 3QG1A 4D0NA 1OYWA 2C9LY 1MKYA 3O8RA 3Q9LA 4C0AC 3AB3A 2I4IA 3GPLA 2VLIA 4C2TA 2GEVA 1S9KE 2NO7A 5ANRB 1GWNA 2ERXA 4IEEA 1EFRD 5GVRA 4RD3A 3VKWA 2QMHA 4C0SA 1RE0A 3TJZA 4Z1MD 2WSSD 4LJ9A 4JL6A 1UBFA 4M1OA 5TV2A 3BJIC 1QRAA 2R2AA 1YU9A 1NMYA 3MWYW 3U60B 1R6BX 1DAIA 3AKYA 4ACBA 1S9DA 3M6AA 4BLTA 2DWOA 1UADA 1ZYUA 4ITRC 3ND8A 2GETA 2GBLC 1SXJB 3GP8A 4G5QA 3QXCA 3X2SA 3W9YA 4P32A 1YZLA 4WZ6A 2HYDA 2IL1A 1VG8A 4HLUA 4LCBA 4UXHA 3S1AA 2BWJA 1PLLA 1II8A 1P7CA 1X8KA 4XWKA 4DC9A 2F9MA 3MWLA 2J87A 4NCIA 1NWQA 1F2UB 4RZUA 3FOZA 1E2MA 4KHZA 2HCJB 1ZUNB 4QRHA 4HAUA 3TSZA 4BRUA 4KJZA 3ADKA 2OUKA 1J2JA 2F43B 4MT8A 2NTYC 1HEIA 3P4XA 1G7SA 1GKIA 3AP1A 3Q85A 3WXMA 4ESHA 4KVAA 2OCAA 2FSGA 4DLZA 1H88A 3UIAA 3AUYA 2QNRA 1LF5A 1RJ9A 4CEIB 1RZ3A 2QGNA 1MV8A 1F48A 2CL6X 1CR1A 4RD1A 4TSFD 1IBRA 3JVVA 2C9OA 3T1QA 3VU9A 3ZZUA 1G21E 1ZNXA 2OCYC 3ASYA 4KSBA 4KI0A 4UXIA 1S3SA 1LF0A 2BVNA 1P62B 3OFNA 1XPUA 2J1LA 1OXVA 3IBGA 2OBLA 3AQ4A 4G1UC 2XOKA 1Q21A 5AJZA 1ZINA 2Z43A 2NO6A 5FPYA 2QAGB 5IK2D 4JSTA 1RW4A 4KYIB 1RRGA 1SVOA 4UQOA 2CNWD 3GJ8A 4HEJA 3U7EB 6Q21A 2XTNA 1FX0B 1X86B 1R5BA 5HCNA 1D9ZA 1JECA 2R9VA 3QKRA 4WXPA 4QKQA 3BRWD 1COWA 1N6PA 2ZRJA 3P4YA 4GZMA 2W6JA 1Z6GA 3FMPB 5FTJA 4DLVA 3AVXA 5JCPA 2E87A 1OFIA 1NP6A 3GFTA 2FJUA 1UF9A 2V1XA 3LBNA 1XXHE 4HDQB 4YDSA 4TWZA 2OESA 1CU1A 1GG2A 1OH7A 3ZLJA 1MV5A 3B6EA 3CRVA 1E9BA 1GVNB 2QPAA 3PEYA 4TYQA 4B86A 4XSHA 1IN7A 3H86A 3NDPA 2IWRA 1NLYA 3AF0A 3OIUA 3Q5DA 3IPYA 3TBKA 2XZLA 2C2AA 3T34A 2WWHA 2MMCA 3LQRA 2DPXA 3M1IA 3MAAC 1E9AA 2HCBA 5DYGA 3VR5A 3G82C 4HB2A 4EKDA 4FCWA 3FMIA 5JFGA 4Q7JB 4XVUA 1OIVA 1EFTA 2AK2A 4PO1A 2R44A 5FOSA 2H1LA 4MGKR 2A5FA 1W4RA 1YZTA 2P0EA 3GQBA 1E1RD 621PA 2O8EA 1XJQA 3C4JA 5DIFA 2XGJA 2LKDA 3HDTA 4ZDJA 1GM5A 4BE7B 1FAVA 3O8ZA 2QP9X 4XTRA 2NO1A 1GTVA 4NE2A 4GL2A 4PC1A 1Q1QA 3SFZA 4LHZA 4XD7D 4B44A 3A4NA 4Q19A 1ZM3A 2GZAA 2ZRPA 5FBWB 3ZRWA 2PMDA 2N9BA 4BZPA 4LZZA 3SDZA 1A1VA 1VCIA 3OIYA 3FMOB 4ASUA 3EIQA 3B13B 1N6KA 5F98A 4BFTA 3SC3A 4RD0A 1UJ2A 4OYHA 5EZ6B 1IO4A 2F1JA 2JIZA 5K8LA 2VSXA 2OSBA 3GLHE 3QKSA 3VX4A 2AL7A 2OO7A 3IKJA 5FFMA 2QROA 3PFIA 5CK5A 1AIPA 2GRJA 4RJLA 2JASA 1EFCA 2KSQA 5KNDA 1XMVA 3I72A 2IHYA 5JI3E 2Q6TA 1XU4A 2OE2A 1T8UA 1OKKA 1YZNA 3GJ0A 4LV8B 3M4YA 4IOMA 2YZ2A 3V4FA 1XEXA 3B60A 3M91A 5H70A 4DZOA 4FMCB 1UKZA 2BJWA 3KQHA 4V0LA 4LYHA 2IF0A 1DAEA 1T4GA 2V6JA 2XEXA 2GK7A 3OHMA 2GJ8A 1P4SA 3MUFA 4A4DA 4TQAA 1FL9A 1D6JA 1CTQA 1FP7A 1FUKA 2IYTA 3H1TA 1II8B 4TLDA 4IOKA 4LUCA 4BEJA 1AGRA 1FTNA 1XX6A 4P0TA 4X8MA 2GHIA 4TTQA 5JECA 5JHGB 4P4SB 3DKPA 2ODEA 4JLKA 1G8GA 4B6FA 1GTWA 5KPDA 2VYFA 1RC8A 1ZD1A 3CWQA 5APTA 2FV8A 3QVUA 4JLDA 3DDCA 3U3RA 4V0MA 5J40A 3UMRA 4AYXA 3TNUA 3HR8A 1J2JB 1IXZA 1GUAA 2VF8A 1UEJA 1XZPA 2LCFA 2ZJYA 4OJKA 3U5ZB 4QM6A 1KDOA 4Q4JA 1CJVC 3LVRE 4DSUA 1Z83A 3KL4A 5KTYA 4PZLA 2BASA 5L3QB 2FE4A 5L3SA 4I1SA 3ZGXA 3BB1A 2KI5A 4B2LA 2QU8A 4LBYA 3FYHA 1SGWA 3I73A 3M0DA 4PAOA 4EPYA 4QBHA 3VU9B 2A5GA 4XOIA 1IJEA 2NO9A 2J0UA 1VIYA 1AM4D 2E9SA 1E2JA 2PLFA 2RGBA 4I1UA 2V3CC 2GTPA 1JALA 2UZIR 1M6NA 5HPYB 1DADA 4XWAA 1ZAKA 3M9HA 1PLJA 3I1FA 1G291 3SZRA 4DJTA 3GMTA 1N6HA 3GLIE 1U81A 3B8EB 1E2GA 3NTNA 2WWIA 4QGAA 3W34A 4D80A 1G18A 1PUIA 1CRQA 2GZDA 2HUPA 1P2SA 4P4TA 3RC8A 3KZ1E 3QKRB 1P73A 4TYWA 3K8YA 2F1IA 2HT6A 4Z51A 3CF2A 1XTRA 5CITA 4MKGA 2WAXA 1T0HB 1XMJA 1W0KA 3GJ4A 4TLEA 4ARZA 2GCOA 3IILA 2AFHE 4DB4A 5TB5A 1E0AA 1Z6XA 3HJNA 4NP6A 2Z5FA 1E0JA 3EZ9A 4PAMA 2GVZC 3QXJA 2WOOA 1NN1A 2C03A 2C2HA 4HDCA 3QEOA 4DLWA 1KJWA 1XXHA 721PA 1M7GA 2OV2A 1GK6A 2RGGA 1EFHA 3NBZC 2ZJ5A 4A0HA 2ORIA 1KO1A 1HWTC 3Q8XB 4PQRA 2WKRA 1U2RA 4M4SA 3BAFA 2YV5A 2ZRBA 2WPDD 3AH8A 4I2LC 3ADBA 1KSFX 1XMIA 1SP4A 4HATA 2G1KA 4I99A 2WWYA 2LFRA 4GCZA 1P3JA 3K9HA 4CIDA 5AVSB 1Q22A 1OH6A 3C14C 2G6BA 2Q21A 1QHHA 1SVKA 3V4QA 3G0HA 4MRVA 2H57A 4ERNA 1N6IA 4LWZA 3HWSA 4B6EA 1OH5A 2FSIA 1TEXA 2YWGA 3VR6A 1L2TA 3CPEA 4KVGA 1KGDA 4X8OA 2O8EB 4PPFA 2LWIA 3RC3A 3NBFA 5KUTA 1I2DA 1NIJA 4II7A 4CRWB 2O0KA 2YNMA 4US0R 1BMFD 2JDIA 4W9MC 3NEYA 1TEVA 5JRJA 1A4RA 2OFOA 3AGQA 5AJYA 4AIIA 1UBEA 4F91B 2V54A 2WJJA 4NTZA 3UG6A 4P31A 1GK4A 5AVUB 1CJTC 3X1ZA 4BWYA 3VMZA 2R5DA 2WT7A 2W0SA 1KKLA 1CF4A 5TXGA 4FWTA 2RMKA 1R8SA 1GITA 1G5PA 3QI2A 2KBEA 4PSKA 1TU3A 1KO7A 2J3EA 3U7FB 4DUGD 4PSAA 2W83A 3QVVA 2ZJZA 5JMTA 221PA 3GLHA 5FH9A 4M1SA 2ZE6A 2QSYA 2Z0MA 3MCAA 4CF7A 1G3UA 4FW9A 1H8HD 1E2QA 1E1QD 4DLSA 2FPLA 3AVYA 1AQYA 4AKIA 1N0WA 4ZPXA 3KKNA 1CIPA 2KBFA 3L36A 3VNUA 1XEXB 4DT1A 3PITA 4DDVA 1NG9A 3FMFA 3W3ZB 1ZC3A 4EJSA 2XB2A 3TUZC 3KDSE 2XNSA 4N1AA 4LYAA 1YE8A 2G3YA 3U3KA 2IXEA 2CK3D 4Q9HA 4ILEA 4OKSA 1G3RA 5BN3A 2FSFA 2A5DA 4ESVA 3CUEF 2OCBA 5CLLA 4OHZA 3UWOA 2VPPA 1E2DA 1NBME 2QRZA 4PPGA 1II0A 1RRPA 3B9PA 4A0RA 2W00A 5FTNA 3VR3A 5FTMA 1VG0B 3LD9A 4DEXA 1UKEA 5DN6A 2ORWA 3NG1A 3PEUA 2ONJA 2VIIA 2CLSA 2OZEA 3TNUB 2WMOB 3P1JA 4EPWA 5EUMA 5B2ZA 3ZD6A 1GAJA 3KFVA 4JT2A 4U02A 5CIQA 1TX4B 5ELXA 2QMEA 4Z54A 1ZP6A 3Q5EA 2HJVA 4WA7A 3DL0A 2BBTA 3IDQA 2FEOA 2G0TA 2AWNA 1FOSE 4QGHA 2PZFA 4JS0A 3ZIAD 1E79A 3QEJA 1G3IA 4POAA 5L3SB 2J0SA 5A5GA 3VTKA 3CRMA 1TQ4A 2WM9B 3LA6A 4Q47A 2CHQA 5SZJA 1GDDA 2ZXEB 3ONWA 1KO8A 1A5TA 4MYUA 1KSGA 4H1VA 5AJWA 4DCSA 2D7DA 1CULC 3E5HA 4LYJA 4BUJA 2IK8A 3RRYA 4W5JA 4FCVA 1ZM9A 1T8TA 3EXAA 4HAWA 3EC1A 3BE4A 4ZCIA 3TK1A 3A3YB 4NYJQ 1KI8A 1E2NA 3I5YA 2WAYA 1GFIA 1NLFA 2Z5IA 3PEVA 3CW2A 3NXSA 2EFEB 3THWB 3QJYA 3T12A 1E4YA 2KB0A 4QBGB 1KTVA 2XSZA 2PZGA 2QMUA 3R9IA 5KSYA 5FL7D 2GF0A 3QF4A 5B30A 3LIDA 5B57C 1OXZA 2Q0HA 1OXSC 2ZJ8A 3NHAA 2IPPA 4DCTA 2GCOB 1E69A 2AX4A 4LPSA 1SVLA 5FTKA 1IY1A 3BFXA 3LX5A 2HF8A 1GZSA 2NG1A 3C16C 2FN4A 4ZCLA 3VTPC 2G83A 4WW0A 3T15A 2AKAB 4ZCMA 1P9RA 3EA5A 3SJBA 1XXHB 3K1JA 4XSGA 2XB4A 3KTAA 4WOPA 3I8SA 5GJVC 5JBQA 1DG1G 2ZSAA 1B23P 1Z6TA 3FWYA 2G1JA 1G5RA 4EPXA 4IXNA 1CJUC 3LQQA 3RANA 2ZVQX 4MDFA 1JR3D 1XTIA 1QHHB 3N2EA 3I5CA 3CX6A 4O25A 1NVVR 3B78A 1GNRA 3FFAA 3OAAA 3VAAA 4US2R 3W90A 3L0SA 4D26A 4FINA 1E2HA 2IYUA 4EPRA 1KKMA 1R4AA 3P8MC 3Q7QA 4M2LA 2QTFA 2JJ1A 4YC7A 2R65A 1D9XA 2PLRA 4Q00A 5J4LA 3QBTA 4RKFA 3M0AA 1N6NA 1HURA 2ZRKA 4JLNA 3TR5A 1WMSA 1P75A 4FI3C 5BN5A 1NN3A 5EXXA 1HBWA 2FG5A 1WB9A 2VP0A 1Z06A 5GJWC 1KO5A 4QHTA 3AEZA 2ZI7A 5LB4A 2JLRA 1NJFA 4AKEA 1MO4A 1P60A 4LHYA 4IDHA 4LC1A 3IIKA 3CB4A 3FFBA 2WBLC 2D74A 4DDWA 3K70C 1KMQA 2P6NA 4BLRA 1ZU4A 3WNCA 5FOTA 4V0NA 4OK3A 4ZKIA 2G0NA 2VHUA 3GLHB 1PVOA 4ZI3A 2CHGA 2C77A 2DWPA 3CNLA 2W2XA 4U7OA 5D3MA 2A7QA 1E3MA 2B7CA 3GEEA 4DCUA 2X2EA 2O8FA 5BN4A 1OPXA 4DT1B 4M1WA 1KI6A 2VSOA 1R0ZA 4JSYA 4EJSB 2ONKA 3ECCA 5CIWA 1MT0A 2BIFA 1PZNA 2EWWA 1D2EA 1S96A 4XWOA 1OT3A 4LPKA 4EQ6A 5F9HA 1IXMA 1E0SA 4JAVA 1UBCA 5FUYA 1WF3A 3K0EA 4BLOA 2R6FA 4RSGA 1IXSB 5GADl 3CR7A 3ZVRA 4CGZA 1NBMA 2B21A 4G3XA 1KYIA 1K8RA 4LRWA 3K0AA 2JJ8A 4U5XA 3SJCA 2WOJA 3AGPA 3QXHA 2O8DA 3ZZ0A 4TLCA 5FOUA 5FI0B 2P2LA 3A1WA 4MDEA 1BOFA 1UKVY 2VA8A 3B1WA 5AW2B 4R7ZA 1JQJC 5TDHA 1M7HA 2Z4SA 4B74A 4UNSA 2JJ2D 5J5CA 1FX0A 3IO5A 1FPMA 3TAUA 1KY2A 3SOPA 3ZQ6A 1E99A 3MMPA 3OE7D 1ZM2A 4L9SA 2QPOA 3K09A 2G9NA 4UKDA 3X1YA 1JJVA 1ZCAA 4WBSA 5C4GB 1D2MA 1L4YA 2JA1A 4KBFA 3PUVA 1P9WA 2WJIA 5TY0A 3KJGA 4AQRD 1WCV1 1CR4A 1JNMA 4OQXA 1G7CA 5EJEA 1Z0DA 3KX2A 5E4FA 4AUWA 5LBIA 4PTLA 1DG3A 3P27A 1HA3A 5DLQC 4UNPA 3DKVA 1FQKA 4MRSA 1NY6A 4Y0VA 3AP3A 2AR7A 4BQSA 2O5VA 2ODNA 3GLIB 2VHJA 1NSFA 1HUCA 4HAZA 3QF4B 5AW9B 1PLKA 3HP1A 3I62A 3UWKA 1PJRA 1R5NA 4WVFA 1KOFA 2XITA 1NVWQ 3MRSA 4PC7A 2OXCA 1E9FA 3FDIA 1TUIA 2C5LA 1Z63A 4CT4B 1XTJA 4HYYA 1D2NA 2IS6A 1S4QA 3ICQB 1Z6AA 4UNNA 4C30A 2Y8EA 2FGKA 2JGNA 1IJFA 4JYCA 1E96A 2RGAA 3W3AA 1J7KA 2AWOA 3L2OB 4TYPA 4A9AA 4MRRA 2F55A 4CEHA 2EVWX 2YHSA 3QPWA 3EPHA 4KCGA 2Q9CA 4QXAA 5DHFA 1U94A 1IN8A 1CRPA 3UG7A 4DSNA 2RHDA 2D4HA 5G40A 3EX7C 1LFDB 3L35A 1NIPA 4BIUA 4LBVA 2FTKA 2DR3A 1RKBA 2V6IA 4OI2A 4GP6A 3VR1A 2ZI6A 4Q03A 5G41A 1CKEA 1QG4A 2JAQA 1S1CA 3PV0A 1KJYA 5LD2C 1GL7A 4GNKA 4MYTA 3D6TB 3KDPB 1OFHA 1FTSA 1VYTA 4LHXA 4B32A 3TUIC 4NZYA 2KP8A 1Q3TA 3H0KA 4Q4AA 2P5TB 1WP9A 1GRNA 4JASA 1OIXA 1T5LA 2ZRHA 3K70D 3D31A 1GD2E 4A0FA 4NH0A 3RS3A 2C98A 3EWAA 5DHAA 1II9A 1A2KC 3QBVA 3SI7A 4TZ0A 2V7QD 4ON9A 2OFWA 5APYA 1KDRA 3WP1B 1XTQA 2QE7A 3CH4B 4B73A 1TADA 4AKHA 1HYQA 4XVRA 4YXWD 1UDWA 3T1OA 4FXPA 2ZSBA 5FBQB 1T3SA 3TQFA 1S9HA 3EA0A 4QGFA 2ZANA 5APXA 4NHOA 3SR0A 3P7KA 3CM0A 4AURA 2HLDA 1ONBA 5APVA 2MMGA 2PZEA 4YLGA 4NBSA 4MUBA 2B8TA 3QXXA 3LW7A 4P4SA 4M21A 3MD0A 1DPFA 3L0PA 3QKTA 1W0JA 5SZHB 4R71A 1G17A 3I3SR 1ZMXA 3CONA 4C3ZA 1IY2A 2EFGA 2QSZA 4MITA 4OJQA 2PEZA 3RABA 1W4BA 3LVQE 5D3MB 5AVVB 4BZXA 2O8FB 2XX3A 1T3HA 3K9LA 1KI6B 3PR1A 4Q20A 2ZFCA 1DO2A 2J46A 1QF9A 3THWA 1RPZA 1ZM4A 3NH9A 2VP2A 3ZS9A 2ZE7A 4J0QA 2ASEA 4EQ6B 1KK0A 5L3QA 2JLXA 1L8QA 1Z28A 3KXIA 3H4MA 4BEBA 4KP4A 3BIFA 4FMCF 2ANCA 5APWA 1QHXA 1E2EA 2K5UA 3E1SA 5AUPB 5L8VA 1EESA 1XD9A 4H9GA 1T3LA 4PFSA 1W5TA 1YRAA 4C0HA 1NN0A 4FN5A 1MUUA 3C5HA 2NGRA 1VCMA 5EE9A 3K0AB 3GJ3A 5C93A 1U9IC 4A8JA 4L15A 2O8DB 3TW4A 1G8YA 4UNQA 1OB5A 4QPKA 1QHNA 4YONB 1BYIA 3EARA 3RWMB 2QI9C 4RFSA 1Q3HA 1CXZA 1R2QA 4BFYA 3CPHA 3V5BA 5APQA 2ZYVX 5FOXA 4LSGA 2ZM5A 2IYSA 1XZQA 2ZRFA 1G1MA 2AD5A 2AXNA 4M53A 5E95A 4DLTA 3NFQA 5AVTB 5C1BA 2ZS9A 2P67A 4D2IA 5FTLA 3IBYA 3K0CC 1NL3A 2VL7A 4B34A 4QC2A 1M1YE 1SQ5A 3OEHD 4TL7A 5E3HA 1KSJA 4L5BA 4WIAA 4FMDF 2HJGA 2X19A 4L8GA 3O8CA 3VMFA 2WJVA 3V9PA 2NMVA 1KNQA 3IQWA 5LPNA 3FHTA 1KZ7B 1VYUA 2O52A 2ZQ5A 4NYIR 1M34E 4AG6A 5CB8A 1HTWA 3DVLA 2B6HA 2EFHB 2YOFA 1FW6A 1CP2A 2QP4A 2NO0A 1BH2A 4IVQA 4OK5A 1Z5ZA 4HB3A 3L0OA 2NPFA 1LB1B 2D2EA 4RVCA 1A2BA 4PC2A 2JLYA 2DFKB 4URVR 4N0EA 5KO2A 1O87A 3AF1A 2WICA 1NNEA 3Q72A 3HU3A 1U8ZA 2B7BA 1ZIPA 2C9CA 1W7AA 3GCGA 1HT1E 5KDOA 1T9HA 2IYYA 3DMDA 1ZRHA 4WXRA 3PUYA 2BBSA 2WMNB 3Q3JB 4YMWA 5DGXA 3QSYA 4Q02A 2FOLA 1Z2AA 4QG7A 1SXJC 4G0NA 1G3MA 2BV3A 2J5XA 4URYR 3BFKA 3FKSD 3L0IB 4Q9IA 4CEHB 4HYTB 1N3BA 2VBCA 1OH8A 1OE0A 3TMKA 3LX8A 4B47A 1ZCBA 4RD4A 2FH5B 2RAPA 3CBQA 2C9YA 3LDAA 4MUAA 4YQFA 1G6OA 1IN5A 3B85A 4JLVA 4A0GA 3WYFA 3L82B 1G9XA 2R6CA 2ZU0C 4GDFA 1OHHD 3WYAA 3T61A 3A36A 1AN0A 3NDBB 4GKGA 1JPNA 3WBJA 4ZDKA 5KDDA 2J7PD 2QEQA 4DLRA 5HKKA 5EE3A 1QHSA 4HUTA 4Q4AB 1YYCA 1AS2A 2B8WA 4Q1EA 5FR1A 3ZVNA 4URZR 1LNZA 5DNYB 4RKEA 1AA9A 3BXZA 3GLFE 4NYMQ 1T5IA 2F6RA 4MYCA 4PC3A 4XTCS 1FFHA 3K9GA 3ZVMA 3NH6A 2BMJA 2AK3A 1RYHA 2GJAA 3NBXX 1F2TA 3UATA 1HY3A 2W6AA 2IS1A 1ESNA 3UKDA 4BFUA 5CYPA 2GVDC 2MSCB 4CZ2A 4BFWA 4JLOA 3CIOA 3NHBA 2QAGC 1ESMA 4KAXA 4CT5A 3SNHA 3W6NA 3W6OA 5CK4A 1BO6A 5BXQC 1TQDA 3VR4A 5K8TA 2BEJA 2ZTSA 3WRYC 1QHYA 4QNMA 4X8HA 1E9CA 1XWIA 2WIBA 1Z47A 2QGZA 3MSXA 2HXYA 3NTUA 4Y0AA 4IVRA 4DKXA 3D8BA 3OEEA 2GCPA 1Z07A 5G53C 1OFUX 2GCNA 1OWAA 2CCKA 1V5WA 2CVFA 4LGMA 3IHWA 4M1MA 3TSOA 1LY1A 3AVOA 1D8TA 4AYCA 4JL5A 4B75A 1NY5A 2UVQA 1IY0A 4FMDB 2ZUCA 3OZXA 4TQUS 2WPSA 2N42A 1ZUHA 3DO6A 1EFRA 2CEAA 521PA 1JUNA 2H92A 1Z2CA 3C7KA 1H8ED 3X1DA 3GFOA 2ANBA 2I1VB 1X1RA 2WSSA 4Z1MA 1N5LA 3BH7A 2DWQA 1TAGA 3QXSA 2P5SA 1W36B 2GEDA 4A8JB 2GWHA 2BBOA 3KUCA 4R2HA 4QHYA 4BFVA 4E03A 3RRNA 2RGNA 4IKEA 1QHIA 4AYTA 5JWRA 3VNVA 3KJEA 4NCJA 2XNDD 5FL3A 1JXOA 3BWDD 4RFSB 4IDNA 4CVNA 2C95A 1KMHA 3I32A 1IN4A 4TT3D 5H68A 1AS0A 5JWOA 1T6NA 1ZVQA 3A58B 1EX6A 3NWJA 4TLBA 2NPIA 4TLAA 4DLYA 2ZJAA 3OAAD 1FZQA 1UM8A 4TMXA 5FPHA 4JLMA 4Q21A 3VHXA 4A6PA 4F93B 4A2WA 3TR0A 2A30A 2YC2C 3SQXA 1DS6A 4OQLA 4URWR 5CDFE 1KDPA 4FD2A 1NJGA 3WMEA 1CR0A 1Q0UA 4LJ6A 2VO1A 2R8RA 3V4WA 1DAFA 1L4UA 2ZI4A 5CM9C 2WWGA 4JL8A 3X1WA 2VTKA 1P6XA 5DE3A 5C46F 421PA 1SXJD 4ACAA 4HZIA 2EYQA 3U3JA 2IHBA 4TSFA 3W5JA 4XVQA 2YOHA 4RZ2A 3TLXA 4KU4A 2RGXA 4DCVA 2OLJA 4GMXA 2VQSA 5CMZA 3ZCCA 3KB1A 1MO3A 3W8NA 3QE0A 4Q4HA 2VEDA 1QHGA 1GRQA 3SYKA 5BW8A 1OJLA 3U4QA 1Z8FA 2B92A 1EWQA 2DB3A 2GJSA 2C8VA 2ECKA 2FX3A 5IK2A 2IS4A 2C96A 2FZ4A 2WHXA 5FI1B 3RS0A 2ZRAA 4TMKA 5EUQB 2OILA 2CNWA 4HLUC 4IVPA 5AUOB 3SE0A 1E2FA 1SKYB 3WRXC 4DIEA 4XE5B 3TUJC 2QTHA 3WHLA 4TL6A 1H65A 2R6DA 2ZRCA 3H84A 1FUUA 2IYRA 1YJ5A 2QORA 3QPUA 1CR2A 3MJRA 2Q9AA 4A2QA 2MSDB 3SWFA 1WQ1R 3VMYA 3ADDA 5JS8A 3VFDA 2J45A 3W5IA 3TAHA 5E7IA 4H1UA 2IXFA 1KQLA 2QENA 3ZYCA 2W6ID 3HU1A 1E4VA 2FFHA 3QF7A 3VKHA 3BH0A 3F8TA 3ZRXA 5JSZA 3K0FB 2O0JA 4MQBA 4L16A 3C41J 1VTKA 1VYVA 4HLDA 5APUA 1XDBA 2ZETA 1DAMA 1F2TB 1OXUA 2G88A 2HF9A 5AK0A 2Q3MA 1OW3B 2ZR7A 3M9BA 2NQ2C 4HB0A 4BZQA 5AJVB 5BQ5A 1S1MA 3P32A 1WDTA 1E1RA 1DELA 1DAGA 2QT0A 3B1YA 3IQXA 3ZDQA 3EPKA 4E07A 2REOA 4JLPA 3SHWA 1HJBA 1R0XA 2JLWA 3T35A 2QY9A 4NCNA 5AR1A 2JJLA 1CJKC 4XD7A 2JLQA 2A5YB 4K46A 4PHGA 2WKPA 5FUVA 2J41A 1AZSC 2BM0A 4JKIA 2RKOA 4DHEA 4JT4A 1R0WA 2QN6A 4NONA 1N6OA 4KLZA 1J8MF 2DCUA 4LBWA 4LK2A 2C99A 3DGEA 1KAOA 1GIAA 3GJ7A 3RS7A 2GBLA 3LLUA 5JI2E 2F9LA 2JLVA 5GJCA 2XTZA 3IIMA 2OM2A 3FE2A 3F5FA 4MYHA 4OHVA 5HE8A 2FPMA 3TQCA 3AVQA 4Z8XA 1XTKA 4G5SA 5JS7A 2W27A 1W46A 3GEIA 4L9WA 3SFVA 2RB4A 1LVGA 4PX9A 2PL3A 4ABYA 1LTQA 4OHYA 1OLOA 1QBKC 3FHOA 3TH5A 3GLIA 2IYZA 1KMHB 1GNPA 4QL3A 3LIEA 3CX8A 5KNBA 2V4ZA 4PPQA 3THYA 3U44A 2IT1A 4B3XA 4PZYA 2YO2A 2ZXUA 3WNBA 4FMTA 2ZITA 1ETUA 3DOFA 3FVQA 4IHQA 1AJEA 1MR3F 4C4PA 3TVTA 4NDZA 4TMTA 1C4OA 1XEFA 4QOSA 4ZDIA 3LY5A 1U0HC 1E32A 1WBBA 1XBTA 2KE5A 3GLGE 1NVXQ 3AUXA 4DBLC 1JI0A 1GKYA 4E22A 3GFPA 2YINC 3SYLA 1GU4A 4M1KA 4GZLA 2ODWA 2IW3A 3W8RA 2BCGY 4LBZA 1YKSA 1XJCA 1XJ0A 3SS8A 2A2ZA 5AW5B 4I4LA 4IOJA 4PQYA 4YMSA 2QBYA 1RVDA 4LJ4A 3I61A 1TL7C 5AW7B 1ZW6A 4KODA 3KXKA 1G8HA 5CJ2A 3LLMA 1Q44A 1NKTA 1EGAA 3EC2A 2Q7CA 2OFXA 4DLUA 2PCJA 2ZYUX 2RGCA 4GP7A 4C0BA 1VHTA 3UMFA 4K8OA 4CDGA 4Q4HB 4AWXA 5KU1A 3PG5A 5CB6A 3VKGA 3V00A 4BASA 2X1VA 3U4QB 5FPKA 3L43A 2ZSDA 2GXUA 2ZAOA 1X3SA 2H18A 5SZKB 2KJQA 4NKRA 4B3BA 4YMVA 4KFRA 2JCSA 1R0YA 4PHHA 1JQLB 2FU5C 2NOAA 4EIWA 3CZPA 4ZO4A 4AKGA 1CLUA 2WVJA 4OQFA 3PXGA 5SZIA 2BM1A 5IF9A 1G8FA 1KZGB 4P3YA 4C2UA 1U8AA 1US8A 1W2HA 2FA9A 4HZUB 4K81B 4OHXA 2UKDA 2BMEA 3QNUA 5DI9A 1E9RA 3HR7A 1G64A 2P6RA 3AVUA 1OXTA 4N0DA 2Z5HA 2ZU6A 3BBPA 1UBGA 4LJ8A 2BDTA 2XTMA 4D81A 2IS2A 1P2UA 3V4RA 2GZHA 2GXAA 3OFND 3VX3A 2R6GA 2XOKD 4C0KA 2PCLA 4B71A 4MA4A 3IO3A 5AW0B 3U3MA 3KQUA 4BRWA 1GILA 4UNRA 4PO8A 3U6BA 1IONA 2OBMA 3DMNA 2IA5A 1JBKA 2BCJQ 4NCHA 2WPDA 3BFVA 3RSLA 3VHLB 5B58C 2RH5A 4KBGA 5JSZB 5M04A 3GLFB 1JR3E 3IUYA 1A02J 1VECA 4C7OA 1X8YA 5P21A 5GJBA 3WBKA 1COWD 4Q1FA 2R3CA 3ZQJA 4B76A 5FUXA 5B64A 5BWMA 3K0SA 1XRJA 2V8OA 2W6JD 3CNNA 1R5OA 2CXXA 2V9PA 2JLSA 1Z0FA 1UAAA 5FPTA 4JAUA 4X8LA 2WWWA 2GXSA 5BYJA 4ZIRA 2FFBA 1P5ZB 5AWFC 3RHFA 1W1WA 2EYUA 5FOWA 4BGDA 2Q5UA 1BMFA 1KIMA 5J4VA 4QNRA 1S2MA 4R9UC 1XTSA 2YKGA 1F51A 4RD2A 4I1OA 2BEKA 4YMTA 3RWOA 1Q57A 2VP4A 1IXRC 3AP2A 3HYRA 5L3RA 1W48A 3EZ6A 4ZKDA 1GP2A 5AVYB 2LKCA 1AKYA 2BHRA 1DTSA 1W44A 1G20E 5FBLB 3RS5A 4TMVA 3WMFA 4AI6A 2OAQ1 4PR0A 2HEIA 3M0EA 4C46A 5EP2A 3SEAA 4DUGA 2W2TA 2HDNB 3A6PC 4HAXA 2IYQA 1XNJA 3RAPR 2IC5A 5EQTA 1JR6A 1NN5A 3DZ8A 5LDDC 3E70C 1J70A 1FOEB 1H8HA 4Q1BA 1E1QA 5HTKA 3SJAA 3VN0A 2EFCB 2A9KA 4N3NA 3U2QA 4I1VA 5DI3B 2SHKA 3MGNA 1JPJA 3DM5A 3THXA 3AM1A 4TTPA 3NC0C 2VF7A 3HYTA 2Q3HA 4MKHA 2QG6A 3R7WA 2DFNA 3AVWA 4RCZA 1SZPA 1X6VA 3QUSA 1BKDR 1P2TA 3WY9A 4LV5B 4ASUD 2CK3A 3TIFA 2ZJBA 4Q5IA 4D4JA 4LI0A 2N46A 1G6HA 3PENA 5IDJA 3JZAA 2FDCA 3THYB 4D4KA 1CI6A 3U44B 1Z29A 2JIZD 3RNLA 1G4UR 3KKOA 5HE9A 2Z83A 3EG5A 1GSIA 1DARA 3EZ7A 4F4CA 4U7DA 3EPJA 2VP6A 5IT5A 1X1SA 3REFA 1S9KD 3KUDA 3LFUA 4MGIR 4QJ3A 1WE2A 3F3YA 2AKYA 4LHVA 2ZYWX 4QFMA 3A7OA 1E9EA 2AN9A 3I4LA 1OKKD 1HQCA 1DEKA 4HUQA 4V0KA 3L37A 3B5JA 1FOSF 4M22A 2J9RA 4OK6A 4Q9LA 2CJWA 3M06A 3REGA 3GLGA 2F3RA 1LV7A 4JVNA 3ZZTA 4BLQA 3AF2A 4JIMA 4M9SA 4IFBA 2QBYB 4C7NA 2VH5R 2ZUBA 4NMMA 2PH1A 2QAJA 4C0JA 2RGEA 1NSTA 2ORVA 3ZIAA 1KNXA 2NIPA 4M9XA 5FUWA 4E5UA 2ZROA 1YR7A 4KFSA 3CPJB 1ANKA 2XU6A 1RRFA 2FNAA 1U98A 1VHLA 4A92A 4O3MA 1G7TA 3B7GA 3LV8A 3QQ5A 4TMZA 3BGWA 1JNYA 4EJSC 5HR5A 1EG7A 4B2IA 1PUJA 4UJ3A 4PQFA 5K8UA 4Q48A 2FZLA 4O2RA 2GAOA 5F3WB 5EP1A 1NLZA 2E42A 4BIZA 4MRNA 5FL7A 1US8B 1GNQA 5G3YA 4LJ5A 4JJKA 4KYUA 3AF3A 3U7GA 3I5XA 4F4IA 2CL0X 5FPSA 1FQJA 2CMKA 3BK7A 3TYYA 3DZDA 3ZJYA 3QENA 1QDEA 2DHRA 3SJZA 4EDHA 1K5DA 4CEJA 1N5KA 1ZNZA 4OBEA 4DSOA 4JJZA 3WYGA 2C9NY 3B8HA 5JLJA 3T1VA 1AQUA 2D7CA 1C9KA 2H8KA 3SQWA 2H7HA 3RYTC 1AKEA 2VHTA 3BH6A 1H89A 3WMGA 4CYMA 2J59A 2MSEB 4NCKA 3PIRA 3QIAA 1XCGB 2WPRA 1XD2A 3A8TA 4JVSB 3UIEA 4PXAA 2H7VA 1IM2A 1U0JA 3RSOA 1OIWA 1NG1A 4IDQA 1FNMA 2PBRA 4C7OB 2REXB 2O8BA 3G5UA 3AKDA 1UDXA 1CJMA 1EX7A 1OB2A 1JR3A 1Z3IX 1M74A 4G01B 4Q18A 1W0KD 2EW1A 5JCZA 1HQYE 2OHFA 2VP9A 5C2JB 5EP3A 4D25A 3BERA 4ZIRB 1KI4A 3QKUA 1TF7A 2DY1A 2I3BA 4A15A 2HYIC 2ZRNA 4M0LA 1TMKA 4RZXA 1ZNYA 4PANA 1MFZA 1ZU5A 3BORA 4GPTA 1LS6A 1N5JA 2A5JA 5DH9A 2XXAA 2ZI3A 1VG1A 2XZPA 4JKYA 1XFAA 3IIJA 4Q7KA 1YR9A 5H8WA 2J0QA 2CE2X 1GZLA 3DOEA 5C18A 1SLQA 4AYWA 3ND9A 5AVQB 4HAYA 3BOSA 3SBEA 3R8CA 3UK6A 4YDHB 5AVXB 3A5TA 4GMDA 1OFTA 1CSBA 2IYLD 3U6KA 3KKPA 1SHZA 1AK2A 3B1XA 4JLAA 2V1UA 2HV8A 3U7HB 1NVUQ 2ZRDA 4QM7A 2CE7A 2ZJOA 3TSWA 3A1TA 3A4LA 2EU8A 2CCJA 3ZRVA 2WV9A 1WRBA 1X8LA 1F60A 1XMSA 1XPOA 4KITB 2JDID 1E98A 5E7JA 3NMDA 3MJHA 3OESA 2OXRA 4BLPA 2YOGA 1I4LD 2WSMA 1VKJA 1VMAA 1RYFA 5KSOA 4US1R 1UPTA 1XCPA 3R7WB 4S35A 5DISB 2QZ4A 1BIFA 1Z6YA 1XF9A 3C15C 4URXR 2IUSA 4LOAA 1IAQA 4LY6A 3R9XA 5AW3B 2AD1A 5CJPA 3JVUA 5B1OA 4TTRA 4B3CA 1CI6B 3MWKA 4IXMA 2W58A 3NVAA 1E2IA 1S0UA 1NVVQ 1FMJA 5UKDA 1I4DD 2DFLA 4NYJR 4PPNA 1N6LA 4OQMA 1AZTA 1VDZA 2GDJA 1E9SA 3PCRB 4MGZR 3D7MA 2BMFA 3KKQA 1YQTA 1CZQA 4HUQB 4PHFA 1J90A 3FB4A 1ZM7A 2WJHA 2CJWB 3AVTA 2ZR0A 2X8AA 3GLGB 4TYYA 5GVSA 4Q1AA 1ODFA 2WZQA 2JJ2A 3HPRA 2CCGA 3AVPA 4KFUA 3W6PA 4QHSA 2FMXA 3OE7A 4P4UA 4C7NB 2YNYA 4XH9B 2R62A 5AUQA 2Q3FA 2HXSA 1H8AA 3KKMA 3VMXA 3THOA 1E2KA 1VIAA 2VRWA 3AKCA 3B1ZA 2CHVA 2GA8A 1TUEA 3B82A 3LBIA 4HLCA 2C04A 5HZHA 1SVWA 3CX7A 1YZGA 1N25A 4D6PA 1P2VA 2DFTA 4B2PA 4D4LA 1UEIA 4KFTA 2ZEJA 3A4MA 5DN6D 1JXMA 1MRSA 1OV4A 2YWFA 4HDOB 1F3OA 4Q01A 2E43A 1GRRA 1FP6A 2IUTA 3EASA 3I8XA 1KK3A 2OAP1 2PEYA 4YMUA 4B3FX 1CEEA 3T97A 3EWSA 3K0FA 3R9WA 1R7RA 4KHXA 2IEYA 1PV4A 3RDPA 1MRNA 2VP5A 5IDVA 5KYKA 1E79D 1FNNA 1TF2A 4ZKEA 4FIDA 4DWJA 5AUNB 3DPUA 2QL6A 2IYWA 3P20A 1NRJB 2ZRIA 3UANA 3UMSA 4OHWA 1TNDA 2GESA 2VHCA 4B33A 4CEJB 2YO3A 4M3LA 2WIAA 4I6MC 1HE1C 4PHTA 1IHUA 2IYVA 3DEFA 5JZVA 4MKIA 2IEZA 3TVDA 3CH5A 3I92A 5DSZA 1VCOA 2WKQA 1DH3A 3A1VA 4OI4A 3LW8A 2ZR9A 2FF7A 3NIBA 1M2OB 1Z0AA 3BB4A 4GOKA 1BYUA 4HB4A 2FSHA 5AVWB 2XAUA 1XD2B 1EK0A 1TPZA 2ZRLA 3K09C 2CBZA 4C9BA 4LX0A 4W5HA 4UXJA 3HE5A 2X2FA 2XSZD 1SVIA 4FCTA 2O8BB 1JEEA 1N0VC 4DLXA 4G5RA 4A82A 5HZKA 4TYNA 3DHWC 3MLEA 4V0OA 3U3OA 1F5NA 2EWVA 4TZ6A 1JEDA 4PSVA 3S1AB 1TTTA 2BKUA 3EW9A 1WA5A 3LXRA 3N2IA 5JWHA 3LO5A 4G5OA 1QVAA 3GJ5A 3SU8A 2ATVA 2ZVPX 2ZREA 2OLKA 2GJKA 2H17A 2XXAB 5JJKA 1ELOA 1XEWY 4B35A 1RFLA 3Q7PA 2GEUA 3NEJA 2FFAA 4JBWA 4LC0A 5EZ5A 1QZXA 4WAUA 3NBYC 4AK9A 4P33A 4EOTA 1YRBA 4IDPA 1KY3A 1OYYA 2V7QA 2ZUDA 3SHFA 4IFEA 2WWFA 4JVMA 3KQLA 2QM7A 1RJ9B 2BJVA 5KSPA 3O47A 1IOZA 3FPAA 3CKLA 4YXWA 4Q1CA 1W5SA 2WTUA 5EXPA 5APSA 1YHNA 2ZSEA 2YWHA 4A2PA 4Q4LA 1T0JB 1YR6A 3A37A 5CM8B 3QPVA 1WXQA 1A7JA 1E2PA 4A36A 4MRPA 2Q9BA 4LHWA 2R6AA 2JJ1D 4R98A 3CRQA 4D4MA 1G7RA 5HCIA 4B3GA 2OG2A 1MH1A 2IXGA 1MABA 3KQNA 5A0FA 5A4JA 2PJZA 3LBHA 1G2CB 1CS4C 3D3QA 3HPQA 5AJXA 2WWXA 2ODBA 1K6MA 4FPPA 3HE4A 4HAVA 5CLQA 2FGJA 5AW6B 4G5GA 821PA 5KPJA 3KQGA 2AFIE 2JLUA 1Q1ZA 4U7NA 1Z22A 1GOTA 1YZKA 3CO5A 4QBFA 3K53A 2QA5A 2BC9A 3HTKA 1E2LA 121PA 5JEDA 4S2EA 1MO6A 1SVSA 4NPHA 4XJXA 1I4TD 1NAFA 1U99A 4V0ME 5D3QA 1E0KA 2KWIA 2GKSA 1JAIA 4DVGA 5TVKA 5AVRB 2FFQA 3BB3A 4M9ZA 1KI9A 1OF1A 2YVUA 3NKVA 4F4JA 2NZ8A 2VSFA 1ZJ6A 4ZDWA 1BS1A 2QP3A 4DSTA 2D62A 2QUZA 4JBXA 4RFVA 3TKLA 1JOYA 1Z0IA 4EAQA 1GU5A 2P3SA 4QGGA 1EWRA 2ERYA 3JZMA 4IOLA 2JLZA 1RRCA 2O0HA 4HZUA 3U61B 4WZAE 1Q1EA 4UJ5A 1N5IA 1DVRA 1K5GA 4TN1A 4I5SA 4KO8A 3KJHA 1U0LA 2ATXA 2PX0A 4DDUA 1G5TA 5EE1A 3OEHA 3LH5A 3PUWA 1T2KC 2PT5A 4JBYA 2GNOA 4DEYA 1N6RA 2YJTD 4DDTA 2GF9A 1NBMD 3T06B 3QG5A 1V43A 5EXSA 4AD8A 1AS3A 1KJZA 2XZRA 4JYBA 3B2EA 1MO5A 2ZAMA 2P2UA 3N5CA 1Y3AA 4MH0R 2HT1A 2RHMA 1SXJE 1ZD8A 1W4AA 1B0UA 3ZRWB 5L3VA 2EFDB 3T5GA 3VR2A 4MGYR 4DXAA 3A2AA 2BMDA 3J81k 3GLFA 4LJ7A 2IWHA 3UXMA 2OCPA 3R20A 4OQNA 4W7SA 2D3WA 2J0VA 1TQ6A 1J99A 3X1XA 3IEVA 1G3QA 4GOJA 4PZZA 3QKSB 1CBUA 1W36C 1E94E 1TF5A 1Y63A 4WZBE 3MG9A 4A8JC 2V55B 1VPLA 2IYXA 3ASZA 3MWJA 1LS1A 4GSYA 3AV0B 3AF4A 1G8PA 2ZSFA 4KV9A 4IW3B 2JEOA 4OL0A 4Q7MB 3E2IA 3SYNA 1W4CA 4O0MA 1WBDA 3KXLA 3CF6R 3FKSA 5J4YA 4C0LA 1N2CE 2O8CA 5AVZB 2IUUA 3BC1A 3DM9B 4KSCA 1E6CA 3T1TA 3HE5B 4GRAA 4LV6A 2A3RA 2GILA 3N70A 4B48A 5C4MA 2ZS8A 1OXXK 1OHHA 2BOVA 1UKYA 1GL6A 1XD8A 3LRPA 4NU0A 2D2FA 1N0UA 1QVRA 4HI0E 3CR8A 2J7PA 2CLDX 4LYFA 4V03A 5J4KA 1TU4A 3TRFA 2WTYA 5JEEA 5KNCA 3CZQA 3RLFA 3PQCA 2XZOA 2QQEA 1FMLA 3FHCB 4B3DA 3K70B 5DI3A 3BD9A 2GAAA 3EIHA 1D5CA 4GOXA 1XB2A 1KI2A 1HUQA 1W2GA 2OBNA 1A02F 1YR8A 2REBA 3FGNA 5H1YA 4NYIQ 1HV8A 4Q4JB 3C5CA 1P9NA 2F3TA 2XJ4A 2IF2A 2ZI9A 5DYIA 2E1RA 1G41A 4ZI2A 1I2MA 4M8NE 1P72A 3P26A 4JLBA 1KK2A 5F9FA 2CLCX 2DYKA 5FOVA 1ZNWA 1ZUIA 2ZE5A 4EPTA 1OSNA 2J0UB 2F1HA 4HLQB 2H16A 2ZS7A 5LB2A 5DO9A 2R5BA 1AGPA 3CRW1 1SVMA 3GJXC 3LNCA 3OF5A 4URUR 5KDLA 4BPBA 1Z0KA 2QT1A 2XJ9A 3PVSA 1JAHA 1KK1A 3OAKA 3PEWA 4V02A 4O2LA 1MABB 4B43A 1IQPA 4GI7A 4TL9A 1KI3A 2YYZA 5J47A 5KOYA 2ZRGA 3QY0A 5F2EA 2GJ9A 4FWIB 5CDFA 4GT1A 2N1BA 3HE4B 3F0TA 4JMPA 4RY2A 2Q3IA 1L7VC 1KSHA 1DE0A 1U9IA 2RCNA 1M7BA 3EZ2A 4PO9A 2QE7D 5FR2A 5TMPA 2R32A 4ARZB 1G4AE 1NI3A 2RGDA
chains in the Genus database with same CATH superfamily
2HODA 1J6UA 1F6WA 1LDBA 3A1NA 1R4MB 3U48A 3E8BA 4CIBA 3K0KA 2IPMA 3RRMA 2PO7A 1R4NA 1S3JA 2ZDHA 2V4MA 1U8EA 4YRJA 2W2KB 2ADMA 5A9TA 4HDAA 2IBMA 2MINA 4H7JA 2C4VA 3BM5A 5U4XA 5BR7A 1CUWA 3CRRA 1RPOA 1MVOA 4JP2A 1TM4E 1Z08A 3VQTA 1E9DA 3E2MA 3FTQA 5AI9A 7MHTA 5AW1B 1YJBA 1D7OA 4R2IA 2DMXA 2P7JA 2Q8QA 1YQEA 3RRZA 4IHJA 2AGVA 1KHTA 2J3QA 1HH4A 4EFEA 2JAXA 3SEFA 1HR0O 3A0BH 3WKCA 3FI0A 3QI7A 3O8LA 4P6VF 1JVNA 5B6IA 3COZA 3SZGA 5DK6A 3AJEA 3FSRA 5AVXA 4ZC1A 4X71A 2I6XA 4LYDA 4QAJA 3ACDA 3PPVA 1WNTA 1EXDA 1RQGA 2WLIA 2Q5QA 3L7NA 4UVIA 1F6BA 2X0RA 2W6IA 1O5OA 5C7IO 3ETLA 3O31A 4F71A 3LDGA 4UAUA 3A4VA 1PZEA 2PF4E 1ZGGA 3EEFA 5GOZA 3S8MA 2QQ5A 2P6JA 2KG7B 1QU3A 1N33B 3KCNA 3MGCA 2J7KA 3MT7A 5BWOA 5LQRA 4LJAA 1DCFA 1BS2A 2O20A 1JJBA 4MR7A 1R73A 3KTDA 1RIFA 1CUFA 2YC4C 4IZ6A 4A10A 4M60A 3RK2B 1DAKA 3GV0A 1WVIA 3VR4D 5FQNA 4FR2A 2CB9A 1A7KA 2ISQA 3BS4A 4IY1A 2ECFA 1SQXK 2DT5A 1RHMA 2C9LY 4PPYA 5BUCA 1PL0A 1VKRA 2Q3EA 2QTOA 2OGTA 3VKWA 4C0SA 2GRAA 2FQ1A 1N5DA 3MWYW 1R6BX 2YV2A 3GG9A 1K8YB 5HA5A 1VJ1A 2EIKB 4L72A 4A6DA 3QXCA 1KGSA 3JQFC 3S1AA 1II8A 4IDGA 1V55C 3QFSA 1K4CC 4RA6A 4S12A 1NDQA 4WFHA 4DPLA 2JNWA 3EODA 3IAAA 3H6KA 4O2AF 1J2JA 4H7HA 1MPXA 2N3ZA 1H88A 2I1WA 2UZ1B 1MV8A 1XTUA 4ZI7F 3ASNC 4UTVA 2QRVB 4JUAA 4WK4B 4GGMX 4LOJA 4OWFA 3EUWA 5E6RB 1YQQA 3I1JA 1ZINA 2O7RA 2B0CA 2VAVA 4H13D 3A3NA 4LA4A 1QHTA 3RC7A 2PVCA 1U6JA 2PNFA 2PSDA 5SYNA 5K0LA 3OE7G 5DW3A 3HK2A 4REQA 1ZOPA 1PBTA 1RXUA 4CUZA 3I9JA 3B6EA 1DUSA 5CVVA 1U6KA 4TYQA 2IWRA 4QREA 5LMUO 2Y69B 1RS0A 2HBRA 4AQDA 3ABMB 4EKDA 5KWJA 3SSNA 4C76A 3TOCA 4IL5A 1UP4A 2O8EA 1T1SA 3C4JA 2E74B 1XQ6A 1GM5A 3NBKA 2QP9X 3HO1A 3H1PA 2PMDA 4LZZA 3DFIA 5HS4A 1GEEA 1DXHA 3EISA 5IW8A 5T8KC 1CY0A 4JJIA 3MUEA 5JI3E 4B7UA 3HLKA 1DEXA 2OYIB 1YOVA 4BU0A 3EY9A 3L73J 1DAEA 2GK7A 2R9RB 3QEMB 1UQRA 3WLJA 4HEHA 2DFVA 3EVFA 3ELBA 3NBQA 5KHIA 3CMEV 3GVIA 3UO3A 1DV2A 3U5ZB 3G6WA 1W9MA 1BXRA 2ZPUA 2XMCA 3PS9A 5DTMA 2FE4A 2CTPA 5JYBA 2JFOA 1RKXA 2ZXEA 4OBXA 3R0JA 3ENZA 2J0UA 3DXYA 4I1UA 4BXLA 5HPYB 1DADA 4RZHA 1YS2X 3B71A 1PLJA 1JMKC 1JJ2U 3A3YA 3A6JA 4DG5A 3LC7O 4UU1A 2C4WA 3CCMV 2WWIA 3B1KA 4MLPA 4HF7A 5TIIA 1NO4A 4P4TA 2Y0CA 3K8YA 4FYHA 1T0HB 3JARA 5T6MA 4GMFA 1GPDG 1E0AA 4NP6A 4AZ0B 4HDCA 3B09A 1KJWA 5FNZA 3VC2A 4H6XA 3G2OA 2WYIA 3AH8A 3KC2A 3HCCA 2CMFA 1B16A 3K0GA 1SQQJ 3B6ZA 5I7UA 3GFGA 4EHHA 1UK9A 3PJDA 5G4LA 1Y7IA 5KJ1A 4WASA 4EA9A 1DT5A 5DYNA 5IJWA 5BP7A 1HDXA 1X7YA 3X1ZA 4BNFA 3VMZA 3IA7A 1NTMK 3HH8A 2R85A 4JI5B 2ZJZA 5EYPA 1NJIW 1AQYA 1W30A 4ZPXA 3KKNA 5F4BA 4QTUB 3CCMP 1F9AA 3FMFA 4TKUA 4UDOA 2AG8A 5GM1A 3Q88A 4UTOA 1QIFA 1PWXA 2D1RA 1G3RA 5BN3A 1XYGA 1F23A 1XVIA 1Z18A 1UC5B 4O4JB 2X6BA 4KWCA 4LEIA 4HOYA 2ZUSA 1NRXA 1IBMO 2ONZA 3N0TA 3JATB 1FQWA 4WN9B 2XYGA 5JMWA 2Q5CA 1NWCA 4M83A 1DGQA 3C3EA 4CKBA 2GAJA 1OAOA 1Y7TA 5DBOA 4I3GA 4RTJA 2NW6A 3LQYA 1KSGA 1H8EG 1TVKA 1R8XA 5IANA 3WB9A 2P4EA 3CF4G 4DQXA 3CW2A 1QONA 2EFEB 4YR9A 4NZ9A 1VPWA 3SC4A 1L4AC 2XA1A 3TEMA 3FUTA 3GLTA 3T9CA 1PFWA 5ILQA 4I7EA 4IJWA 1XZDA 2IHUA 3EA5A 2HG5C 3B5NA 4B4OA 1V16A 2WLHA 1FYWA 3DZKA 1RWKA 1WPGA 4IXNA 2R1TA 5L45A 1YCDA 3BRQA 3UMVA 3N2EA 3W2GA 4RF3A 4LYGA 4US2R 5L7TA 1U31A 3P8MC 5CB4F 3ZHQA 4ENSA 1IBLB 1T1RA 1WETA 2I78A 4R4LA 1CHNA 1Z06A 4PAWA 5LB4A 1MX9A 3G0DA 3CUWA 1Y4MA 4GPBA 1NMEA 2ZG6A 4RULA 2Z5VA 2DWPA 2EKZA 1E3MA 2XUKA 4IUDS 4FLUA 2RK4A 3NDRA 4JSYA 1YJXA 5BMOA 3LDDA 2EBFX 1IXMA 1E0SA 2RKWA 4JVOA 2UUAB 1UIIA 4BXOA 3GFSA 1OXBB 5D86A 5AW2B 4DIBA 1YJNV 3K09A 2HGSA 3UT5B 3RK4A 1WCV1 1G7CA 4FDAA 2J5UA 2GYUA 5LBIA 4R4MA 2QQFA 4EVIA 2J3MA 2AR7A 2IIVA 2I76A 2O5VA 1RCTE 3UWKA 1PJRA 4EB6A 1GA1A 2VZLA 4LC9A 2R7NA 2JFWA 3ZN1A 1KILC 1D2NA 4JUFA 2IS6A 1MZFA 2FGKA 3U1VA 3OM3B 1DU4A 2EVWX 4M38A 4OSOA 2VZEA 5CYFA 4NNJA 1J5PA 4Q03A 2ONYA 3EF0A 1I0LA 3DTNA 2G5GX 3LBFA 1FTSA 1I2ZA 3TQOA 4PBSA 2ZT8A 1SHTX 4PEVA 1OIXA 4QUHA 4H59A 1PV1A 3ABIA 3IV7A 1KDRA 1VB5A 4PTZA 1OFCX 2QU7A 4LIPD 4BWGA 4QUGA 4C29A 2RCYA 3HCEA 4J1NA 2Z3YA 4X88A 1XE3A 5J58A 1QHXA 3ILXA 3QU2A 4D6TD 5EE9A 3O6QB 4QJFB 3DUFB 4BFYA 2FQXA 1FZCC 1MTOA 1NFQA 2X2PA 4R5MA 4YIHA 3IBYA 4QC2A 3PD1A 4KWEA 2BE7A 3GDHA 3TLAA 1NR1A 2YOFA 2CFTA 1Q11A 5JZBA 1Z5ZA 1VZ2A 4HPWA 1CUIA 2GT1A 4L9AA 4BMVA 2IYOA 4EHBA 2WICA 4W7HA 5KDOA 1T9HA 2WMNB 2QTCA 2BYTA 4UAVA 1X7ZB 4QDXA 3GNSA 4PZCA 4MUAA 4EB3A 1QAOA 3LOQA 5LBQA 4MB2A 1O6ZA 1ULZA 4Q1EA 1CUXA 1LNZA 2XBUA 4PQGA 2FZGA 3OIFA 3EBOA 3NBXX 3DVQX 1IHXA 3K8OE 1NKZB 4EM6A 1M1NA 5ESDA 3MUOA 5IY5C 2GM3A 4IJQA 1SOAA 1LDGA 2YMPA 3L4JA 1L1FA 3O65A 3C8HA 4UHCA 1G98A 5C51B 2HXYA 3SYOA 4BAYA 3A9RA 1VL0A 1OZGA 1OFUX 1V5WA 1SQFA 3GPBA 3AVOA 2ZUCA 1QS0A 1G0OA 1IFDA 4YAKA 3MWDA 4Z1MA 1CY6A 1VL1A 2DWQA 2BCCJ 2GEDA 1KC8W 3RRNA 4IWYA 2JIMA 4NCJA 3CU5A 1K3UB 3R2PA 2B1GA 2N1TC 3K8ZA 1DEAA 1C30B 5FPHA 1YTFD 4I36A 3UJBA 2YKPA 4B6JA 4M0MA 4CLOB 2W2QA 2ST1A 1NJGA 3X2FA 1Q0UA 3ZTWA 4EI8A 4LGVA 3HCWA 4B46A 2J48A 2VRCD 4DCVA 2AJ8A 2QX4A 4F4FA 1XMQO 4YNBA 3FA2A 3RUDA 4DV5B 2UZ0A 4ADSG 4HB1A 5IK2A 3N2GB 4DIEA 4NCAA 2O7NA 1FUUA 1ZA1A 4FM1A 2C1EA 3DLBA 1AZWA 2OZKA 1SXHA 1A9XA 3QWIA 2XVZA 4FFRA 3BH0A 3FGPA 2X22A 3V1MA 3IJPA 4J49A 1OWPA 1S1MA 3P32A 4BP3A 5L4SA 3IQXA 1JR4A 1BN6A 1E1DA 3PTLA 4ISCA 3ZWVA 4XD7A 1LWOA 2NVWA 3C8MA 4BNNA 2J41A 1SQPG 3ZCUA 5E9AA 3R3VA 5HUJA 1DQPA 3LLUA 3RK3C 3OOEA 3USZA 2OV3A 4IUYA 3HZHA 1DKPA 1LTKA 3X1MA 3RLIA 4NC9A 1N9KA 4KQ6A 1AF4A 4PR3A 2ZAIA 1URQB 1KMHB 4LY9A 2FP4A 2LCIA 5FUMA 1E3WB 4NBRA 3KLMX 4KGXA 1TE2A 1J21A 2VPYA 4FM2A 1MMMA 1TIKA 5KVVA 1C4OA 2AFHA 2B82A 4NMLA 1LBSA 3I2IA 1J22A 3W8RA 1XTTA 1E20A 3LLMA 3AFMA 1NKTA 4PA6A 3PXDA 3A05A 3F6EX 1R37A 3V00A 2I8CA 3JU3A 1NU1J 2GXUA 2H18A 4WFEA 5ALDA 4G97A 3CZPA 1ADFA 4R50A 2WUGA 2XQIA 1GGVA 1FYJA 1BGYH 1OXTA 2Z5HA 1I01A 3I09A 3D3KA 3IAM6 3SPHA 4M0KA 4B6SA 5K9ZA 1Y4ZA 2DQSA 5B1BC 2GLXA 3F5HA 4MA4A 1PPJG 3IQZA 1KILB 1J0AA 4MS1B 3VHLB 2WPDA 4ZU1X 3L4EA 4EG6A 3G0CA 2RG7A 3Q8KA 3SJQC 2V8OA 1BEZA 2WWWA 5BYJA 2XUGA 1SCUA 1U9ZA 2YKGA 3MJEA 1DZIA 3TDKA 4ZKDA 2LKCA 3VR5D 1UMDB 2GFQA 1V3TA 2PKQO 4EI7A 1R0LA 2XYRA 2HPAA 5FUBA 3RFCA 4HAXA 2YWCA 4D5GA 2Y2VA 4QU5A 4PYOA 4QWWA 2BFAA 1QFXA 4EO7A 2QG6A 1X7GA 2JF0A 2QRKA 2CMHA 2FDCA 3VOPA 2OG1A 4KQWA 1HGZA 2B4RO 4DV7B 5BNWA 3LFUA 1ULUA 1HQCA 1MIOA 1OKKD 3M06A 2I2XB 1UINA 1TYCA 1V8ZA 5EXDA 3T7EA 3KB8A 4MA0A 3IP8A 2PH1A 3CPJB 1RRFA 5KQRA 4MW2A 3FR7A 3HCNA 3AK2A 1V1RB 2P2NA 1LTJC 3UUWA 3EVDA 1NLZA 1OWMA 1A9ZA 3U4IA 4ZOEA 4KYUA 2WMDA 4OHOA 3GF3A 3SQWA 3RQSA 1L5SA 2VHTA 3H9JA 1SH7A 1WIWA 1XCGB 2Q07A 3GZJA 1GLGA 3VBCA 4G0VA 1OB2A 3SGIA 3U0ZA 1Z3IX 4Q18A 3T7KA 4DOJA 1SQBE 1SFCA 1Q1NA 4XYLA 2WTXA 2WLJA 1TF7A 4EKNB 3EXEB 2WFLA 1OR8A 3SDBA 1WJZA 1SQXG 5C18A 4HAYA 1Y3FE 4NQRA 1QRUA 1EYZA 2ZBFA 2ZYRA 4A8HA 4HDNA 3DC7A 3IQFA 4NU6A 1XAJA 5H9VA 3AERA 2NAFA 1AUVA 2WSMA 3L74H 5KSOA 3E5RA 5FPQA 4FKZA 1BIFA 1DFGA 1U5CA 1AXEA 4LOAA 1IAQA 5MGNA 3R9XA 4TTRA 3IBSA 4NYJR 2O2SA 1J0CA 2WG0A 1MA3A 1A8HA 4GI1A 4COOA 3S8YA 1ZM7A 3EW7A 4YWJA 3NAGA 4TYYA 3W6PA 4CM4A 1TA0A 4P4UA 2QSJA 2R62A 4CR6A 2QJOA 3LBIA 2WWRA 3AL0C 1TAUA 3RSSA 2DFTA 4D4LA 1YR1A 1QGKB 1QYVA 1T9DA 4IDCA 1A27A 3KHTA 2DETA 2UUCO 3T97A 3EMBA 4B81A 4EI9A 3WAJA 4DWJA 2IBZI 1D2GA 1UPCA 3P20A 3SJCC 1JB0J 4POOA 1G8AA 1JEQA 2OOKA 1JH8A 1MA1A 2ZR9A 3BB4A 1YONA 4ER0A 3LUTB 4DR5B 5AVWB 5T3UA 4AJ2A 4LX0A 4F4DA 1N0VC 3H11B 2JS3A 4FPXA 1CYEA 1C7ZA 4F2HA 2BKUA 3JS5A 4ZEOA 4LJSA 2OLKA 2X58A 2H17A 1SBIA 5AOBA 4OGQD 1PZFA 4ENQA 4LC0A 5H16A 1RP7A 5B5EZ 3EGXA 3ST7A 1ENPA 5EKSA 3ETDA 4QE7A 4IZOA 1EGHA 4Z0NA 1G20B 4IG4A 2HGZA 4LF9O 3FETA 3H9UA 5TJ9A 3DEJA 2XHBA 5KQSA 1XZIA 4P83A 4R98A 2JJ1D 1LT9C 3OF3A 1XCBA 3LBHA 1V54B 2FDXA 5K0NA 3A32A 4WGFA 3ZTTA 5KPJA 2JLUA 3NT5A 4U7NA 4NS1A 4J9UE 1VQ9V 2JVJA 3DFZA 4DA7A 1W2EA 1MZVA 4Y8VA 3GPDG 3TLMA 1DXYA 5TVKA 2FFQA 5CCDA 1F4MA 5F21A 1H9AA 2NU9B 2D62A 1JOYA 2JI8A 1Y1PA 2ZT9C 5B3KA 2P3SA 1GCOA 1Q7CA 1OCRC 4WFGA 4RC9A 1A50B 3U61B 3VVLA 1N5IA 1FMCA 1KQSU 3KJHA 2P4SA 1TUEB 5I47A 4YAJA 1E1RG 4DDTA 4UVDA 2IH2A 3UMGA 1QLNA 2NXEA 3WFVA 3B2EA 5JJNB 1Z7EA 1SUCA 3ORRA 4RESA 5DEOA 3QW2A 4HQRA 1DWUA 1E1CB 1G3QA 4PZZA 1YDFA 2L69A 3G8BA 1W4CA 3FYSA 1C4XA 4RJIA 5KYNA 3FX0A 2QE7H 4HRYA 1BCRA 4K5QA 3BEOA 3VDMA 4IGEA 1VQ9P 4K9RA 3D8RA 4NU0A 3JQ6A 4BAUA 3CR8A 3TRFA 1MD9A 2PFGA 1NHGA 4L1KA 3EIHA 4YASA 4WLVA 1NTMG 4I55F 2I1JA 1IZ0A 4RTQA 3M70A 4OGFA 1NPYA 4N4AA 1G41A 1FS0G 4DMLA 3MNFA 4WNYA 1VQLV 3A3KA 4UHBA 5FOVA 3BCCH 4QUEA 3CRW1 1UDCA 2XJ9A 4V02A 3Q3HA 1IQPA 4IV8A 5IVKA 4TL9A 1J1IA 3TZKA 4M7OA 2FPOA 1KSHA 4KK4A 1EUDB 2A0FA 2YXHA 5CAEA 3GGJA 1XRMA 1T34A 1GZ3A 4PXSA 4PZEA 4ZVOA 4BDSA 2PZKA 4GRDA 4AY2A 1D1PA 5CMUA 1ZFNA 4PD4H 3C8UA 4XX1A 4C0QC 3DZIA 1YZQA 2A9VA 1XNGA 1PS0A 5E2BA 4F86A 3OOHA 4OKIA 1DJPA 3BTUA 3D2LA 1XZGA 3CISA 4N9WA 1GGNA 1AZLA 4EUEA 2XE7A 3ZBTA 1F7UA 5G1PA 4D0LB 1RFGE 5D8DA 1SXJA 4JZKA 2FCAA 5H9WA 2C8JA 3AKEA 1XQWA 3IPAA 3AZOA 4GR5A 2IOYA 2QRNA 4RMHA 2HREA 3NFRA 5HP4A 1NMZA 2VTBA 1L5HB 5JPCA 3C3AA 2W2OA 1QR2A 2B98A 4JLUA 2WWVD 2WMMA 4X61A 4IEIA 2QQ0A 2PRIA 5TARA 3O8NA 1S5LH 2OHGA 2W6CX 4H4DA 2AHOA 2RCVA 3TIVA 3KDAA 4CH5A 2CY0A 4WNIA 1Z5VA 1QG2A 4BY9E 1QQ5A 1BSNA 3OPYB 1NMXA 2YN2A 2H0QA 1F4PA 4YTPC 4U3JA 5I7AA 4BMYA 2XV5A 1RAFA 1SIWA 1UQUA 2EZPA 4DZZA 4PAQA 3UT6A 5E6SB 3QOFA 1JQDA 3V4VB 3BF8A 1T5EA 1GYPA 1Y76A 3ZE2B 4DB2A 3K9NA 2LP7A 5KKCA 3N6RA 2EEPA 1BW9A 1GRVA 3THXB 2ZE8A 1Y5MA 3IODA 2JZCA 5JNTA 4J0HA 1P61B 5JQGF 1JCDA 4LVNA 2LFSA 2K7FA 1SKYE 2QRQA 4ALMA 3DFKA 2F7SA 4DBLE 3G0GA 1FC0A 1U2DA 2HRZA 4A3SA 4QODA 3B9QA 3DAGA 4DUYB 4J7ZA 4D0NA 3BAZA 3VUFA 4C0AC 1ODLA 3FXAA 5IWAO 2WI8A 3VR6H 4L0DA 4DCPA 3L7MA 2B20A 2QTMA 3X0DA 4K6GA 2ZYHA 4RPHA 1TKCA 1ZDMA 4YRBA 1S9DA 4QFDA 4JI4B 1AXGA 1WO8A 3C48A 5IJAA 2R70A 2GBLC 3FN4A 1H5NA 1ZIXA 5LMZA 3B77A 3BTSA 2B89A 4XWKA 5BMVA 5BV8A 3CRNA 4IJVA 2ZXWB 5HIKA 1HEIA 1TJ3A 1FA9A 1V9PA 4ESHA 3K30A 3AUYA 4JR2A 3K9CA 3ZZUA 1ZNXA 4KI0A 3NCTA 2GBOA 1NT2B 4LDZA 1K4MA 4P30A 3W1EA 4ZCQA 1T1GA 2DR0A 4UQOA 3I05A 3Q3EA 2R9VA 3BA8A 1COWA 4GZMA 1Z6GA 3AVXA 2V58A 1AMUA 3PR2B 1ZKDA 1RFYA 2ACKA 4CJXA 1YCFA 1KEZA 4XSHA 4DM3A 2XQVA 2WWHA 3RL0C 4HQNA 3M1IA 2HA0A 1E9AA 1H1DA 3SE7A 3FXEA 1WB6A 1KU0A 4P2BA 3T7AA 4ITVA 5ECYA 3TO5A 2C4HA 4K88A 3HDTA 1EXJA 4XTRA 3O8ZA 4S05A 9ABPA 3ZRWA 3RVJA 5GINE 3W78A 3D6UA 4MICA 4BFTA 2X9QA 3QU9A 2AL7A 4DYDA 2X8BA 4O2AB 3COYA 4RJLA 1LI7A 5EBWC 1GPNA 4YP7A 4BJ5A 4ZI7B 4B3JA 2H1RA 2Y05A 3ZW7A 2YIUB 4LH7A 3GGPA 1OUMA 1FUKA 2PUTA 2BUBA 4LQDA 5HQTA 2XADA 3DKPA 5K3OA 3RGUA 3X1JA 1ND5A 2JCBA 3UCSC 4RWEA 5K4AA 1E3DA 4PAOA 4EPYA 2RI6A 1IJEA 2X8LA 3LUKA 3PNOA 3LDCA 2O8VA 5LIRA 2NP6A 2XWBF 1Z8NA 4DJTA 1NDUA 1N6HA 1OZ0A 1E2GA 2WLTA 2YN0A 3FPSA 3CVUA 1P73A 1WSAA 5LQMA 3V5NA 2NSJA 2GAFA 1BFKA 3PKJA 4RELA 3OEHG 5EWLA 2KK7A 1BE3G 3AFOA 3ZV6A 1L3BA 1HWTC 2ZCVA 4X9QA 2ZRBA 3C1TA 4J0KA 4AZ3A 1EDBA 2ZBUA 2WWYA 2NU8B 2X9GA 3K9HA 1ORHA 2IZ6A 1IBLO 4BRYB 2Q21A 1W25A 4MV9A 3CN7A 1LXCA 2ZYIA 2NX2A 1DQSA 1M8OB 3GQBB 4YP6A 3NBFA 4R1TA 2O0KA 3I30X 2PBLA 1K86A 4FT4A 4JTAB 4OATA 2W0SA 2RMKA 1NVBA 2J3EA 4PSAA 5ERYA 2QN7A 4NRDA 2IFMA 2QSYA 1LSOA 1M1JA 1FJ2A 4FQ7A 5EHGA 2KQXA 2A59A 3QJGA 1BSHA 4JOSA 4LYAA 4EHNA 2CK3D 3BMNB 3P30A 1J23A 2NNWB 3ELYA 3STZC 5FTNA 4E94A 2ZBQA 4FIZA 3D0OA 3R40A 3MJ4A 1YFLA 1D0SA 3ESDA 5ELXA 5TEVA 4LGYA 1X7DA 4QGHA 4POAA 4M36A 3AI2A 4Q47A 2JHCA 5KYWA 4KXUA 5BO5A 2KYVA 1NTZH 5E1MA 4X93A 4J76A 1N2OA 3H1BA 2Z5IA 4BQIA 3NYRA 3QJYA 4OQDA 3BQ9A 4WUVA 2R00A 1LT1A 2R11A 3F6PA 2FKNA 2ZJ8A 4BLWA 3JWJA 3RUFA 5B4TA 5DBHX 3IC5A 3SQDA 3RAGA 1P17A 3R5SA 4N9QA 4KOEC 1DC5A 4J16A 2ZSAA 2ACWA 1O7JA 1H2SB 1G5RA 1L7MA 2FAXA 1I9CA 5L95A 1QHHB 2A3QA 4TV8A 4IIDA 2OPBA 4D26A 3A0HZ 2QTFA 1ZRSA 2SKEA 4GUAA 1XREA 5BN5A 1HBWA 1R12A 1WB9A 4OQQA 1GUZA 2NPOA 4QHTA 1EUYA 3FTCA 1NJ2A 1T1JA 1VCHA 3CB4A 2WBLC 2VC2B 3C85A 4BLRA 1NVMB 2G0NA 1KL7A 3DCNA 1PVOA 3AR4A 3DOCA 4R84A 2FQQA 4U7OA 1CY8A 4JX9A 4DCUA 3G0BA 4FYIA 1BMDA 1PI3A 7AT1A 3MJDA 4G65A 2CXUA 5AM1A 5HYVA 3UC5A 1SQSA 3OIGA 3IVXA 2JR8A 3L8MA 1AV6A 3IVCA 1GCIA 3ZZ0A 4TLCA 3AG4B 2BKVA 1JAXA 1VSBA 4V1CB 1KY2A 1E99A 3MMPA 2QPOA 3AEXA 1K7DA 1J4AA 5DNUA 3C70A 4WBSA 1NF8A 5IWCA 2XDWA 3SS9X 1VBKA 3JQQA 1QGAA 1FQKA 2VDRB 1UBKS 2J8ZA 3O26A 3T5MA 3GYGA 3C0KA 1RPRA 3K2EA 2J08A 4OQEA 2XITA 3DAOA 2PUHA 4BJ6A 1RHKA 5IU6A 3UAYA 5EJ2A 4BB9A 3FMGA 3EPHA 1T0IA 3VSCA 4JFRA 4RA9B 5GQSA 4LBVA 2PQMA 4GP6A 1CRZA 3VR1A 4Q37A 2FRVA 3D6TB 1SQBD 1SQ6A 4CE6A 1TFUA 3H0KA 3H5LA 3HL0A 3E27A 1A2KC 2JFNA 2P5YA 4S1NA 2OFWA 2JJMA 3CXHI 2QE7A 1NV8A 1KOLA 4LFBO 3N8IA 4QX6A 3KOYA 4MEAA 4NBSA 2B8TA 2ZR3A 4YJKA 5AIAA 3NEAA 1W0JA 4FEEA 3CONA 4N8DA 3RSHA 7ADHA 5BN4B 1B73A 3TLBA 3M89A 4Q20A 4CTJA 5GZ6A 4S1VA 2FQWA 2I4NA 5KYVA 4IBOA 2DJVA 5APWA 2XLCA 4PFSA 3MHHC 3ZGOA 1NBHA 4EF4A 3K0AB 1CCWA 1FFXB 2C59A 1QHNA 3EARA 4N78E 1WDWB 1OLXA 1WA8A 1Q3HA 3AIIA 2OQ2A 5DPMA 3RK2C 4LSGA 2CMGA 4F46A 4KXXA 4D2IA 4CKXA 1I33A 2RD2A 2PKEA 4WIAA 4ZEMA 1U65A 3UHPA 1U8CB 4FKBA 5LPNA 2P5UA 3VR2D 2OCXA 5CGQB 3LA8A 4NPAA 5KNBH 2AZ2A 1JJIA 4KQ2A 2DBZA 4PRZA 1DL5A 1NNEA 1ZL0A 5HRAA 2WB2A 4C20A 2GZ2A 3P4UA 1YR2A 2EIKC 2A1TR 4FOSA 1G3MA 4ZQFA 1P29A 4KIJA 5KKZC 2VBCA 1O5TA 3Q12A 2ZYAA 2QW8A 4ZQEA 1A77A 5DM0A 4F6RB 1VPVA 4O4HA 2QN8A 3DDNA 3T61A 5CDSA 1ODTC 4TTIA 4A0QA 2Q5OA 2J7PD 3ESRA 1U9CA 3DPIA 5T57A 3L75E 3C8ZA 3R24A 1XYYA 2WJWA 2PX5A 1S2IA 3CEAA 4R8LA 3REOA 2GJAA 1F2TA 3KAPA 4IVNA 2IS1A 3FAVA 2Q3JA 2FMKA 4CT5A 3I8OA 4BV3A 5CCGD 4G56A 1ZVMA 5F73A 4NSNA 1VL5A 3D8BA 3A6FA 2OZLB 2CCKA 2CVFA 2HV9A 4CKCB 3WGTA 4B75A 3P45A 1C80A 3LOUA 1ZUHA 4QLBA 2X41A 1FMFA 1TAGA 2GWHA 3LP8A 5DRTA 4J7JA 5JWRA 3L93A 3UWPA 2OQIA 5LN1A 4PF1A 4CMHA 4MWEA 1DIBA 4TLAA 5C1DA 3VHXA 5DASA 1XROA 5ALHA 3WOHA 5KTMA 2FI1A 3AWDA 1Z4MA 3R2JA 5G2OA 4D44A 3CS5A 2WC1A 4CFZA 5DNWA 5F76A 1QR8A 4OCZA 3DEAA 3ZWDA 3HJCA 1KH3A 2WHQA 2CUTA 3RGWS 2OYIC 4D9NA 4YO7A 2ECKA 2FX3A 4JSRA 3L0BA 1SU6A 2FZ4A 4CH4A 3FKSG 4TMKA 1F0YA 2HWKA 5L9AA 2CFIA 1SQPK 1QRTA 4HGYA 2Z2ZA 1O54A 3W67A 1TTHA 1VMEA 2A58A 3E7FA 3QNMA 3CCBA 3GRUA 2OKGA 4YJ3B 4OY3A 1FUYB 3B4SA 3HY6A 5DHRA 2F48A 2ZETA 1JHXA 4UDNA 2G9VA 2VS1A 1B1AA 7YASA 3H19A 1WDTA 5KVCA 3MHSC 3L70G 3SPIA 4Y30A 2JIRA 5F2OA 2BM0A 3NYIA 2IGTA 1XHLA 1EZJA 1WMAA 4LFAB 2DC1A 1JQKA 2XTZA 4G8CA 3JQAD 4XUDA 4BO5A 5FORA 8LDHA 3HKEB 1K04A 4MDHA 2VAPA 4N40A 2AOUB 1Z68A 1EZVG 4X85A 1WULS 1DRWA 1XOUA 2NO5A 1XEFA 5CR9A 5GIPE 1X7WA 1GKYA 5CD1A 3M6IA 4X94A 3MWEA 2JRCA 4QQKA 2Q0XA 4L57A 1QKIA 3FPGA 4YMSA 2W6JH 1XA0A 4LJ4A 3I61A 2BY4A 1CE8B 4DLUA 2PLNA 3BRVB 2PCJA 2HRDA 4K8OA 3G9ZA 4AQ7A 5CB6A 2Q1XA 4BASA 1C1XA 3VO2A 3HGQA 3L1HA 2G9UA 1HMPA 3I4CA 4AKGA 1GM7A 2RJZA 4QA9A 4C2UA 1W2HA 2M98A 3AILA 2R97A 4QBKA 1NF2A 1YZFA 2XTMA 3HDYA 1JOCA 4PDLA 1UT6A 2R6GA 4B71A 2FB9A 4KQFA 4PO8A 4JF7A 4ENVA 5BYAA 3L71D 4DV1O 5JSZB 1JR3E 5FRDA 3M0DC 2VDKB 3NOOA 2QJRA 4EBFA 1XRJA 5K4HA 5K6RA 1P5ZB 3SYPA 2WSBA 4II3A 4BO2A 2JJYA 4OP1A 5LYJA 1F51A 4J0FA 3RWOA 2CXSA 1IHOA 2PZLA 4X95A 3VSAA 2HFKA 3D2BA 5CG2A 2CZCA 3LFTA 1E1QA 5BNZA 1ZD2P 5ALOA 2GKOA 1L8DA 4G28B 2O23A 1RSOB 1WDKA 1RXSA 1I7NA 1FZFA 4LI0A 4KXLA 5IDJA 4IMIB 2I03A 4DZRA 4RIGA 1B2RA 3F9IA 1DWPA 2BFEA 4XM2A 4MGIR 2ZUTA 4M22A 3M7IA 2F3RA 3P52A 4JIMA 2AEEA 2ZUBA 4C0JA 1BD4A 3KQWA 1M76A 2WJZB 2BZSA 4G07A 2OBFA 4QDJA 4PZ0A 1NGMB 2FJPA 3PDIA 1Y7HA 2X8WA 4WCEV 3AZPA 3QUBA 5EP1A 3F97A 4IT5A 4DVJA 1JIJA 3FLAA 5FPSA 3NANA 2X3YA 3F5QA 4C7RA 1EFKA 2HWUA 4BR6A 3EDRA 1MAAA 2FOXA 4RY0A 4DR3O 2D7CA 3NWPA 3F3MA 3DTUB 3P9XA 3PIRA 4RPIA 3NP7A 3RI3A 3H25A 3QPCA 5KKZB 1L7NA 2QV7A 2C57A 3UAWA 5C3MA 5C2JB 2X8JB 5EZYB 1BKYA 2I3BA 2GFIA 1QYXA 5LDGA 1V7PC 3KZVA 1JU3A 1CDEA 4O4IA 3DV0B 1SOWA 1Q7RA 5AVQB 3BOSA 3NPAA 3KKPA 4EY6A 2X3UA 2V1UA 2WY2D 3E7PA 4AI8A 3MD9A 1U3DA 4BC0A 2W37A 4Y6OA 5DYTA 1DD3A 4P5EA 3SF8A 3PI7A 1E5WA 3HWWA 1Y37A 3VQYA 4IJ5A 3R7WB 5DISB 2IUSA 2I4MA 3VQXA 3JVUA 5B1OA 1T9GS 1TYZA 5JSKA 5SY9A 2PA0A 4JC4A 2FPGA 1WEKA 3T3PB 2ZR0A 1NBIA 2WZQA 2JJ2A 3UUFA 4KT0J 3GUHA 1PGNA 4C7NB 2FWIA 1H8AA 2ZJ6A 1XK6A 2CPBA 1OW7A 1BH6A 3IEIA 3RJZA 2CYAA 1JEYA 4E21A 1YE3A 3IPLA 4LMBA 4EFBA 3DHYA 1DF5A 5KJFA 2A92A 2WW8A 1UOQA 2IEYA 1PV4A 1RRMA 3DPUA 3A27A 2BSXA 4I6MC 3BA6A 4X7BA 4HN2A 2D2IA 4H1TA 2G82A 3MQ4A 1CY2A 3QOXA 1VRCA 2L35A 2XD4A 3TG2A 2BLNA 4DCCA 1S02A 3U3OA 2FXVA 2C3OA 7REQA 3EW9A 2Q8PA 5A9SA 5JWHA 3SU8A 3D6VA 1Q81W 5IC5A 4ZA2A 2DPHA 2VTVA 2FFAA 3VOAA 2JCYA 1Y8AA 1KZHA 1YRBA 2I4TA 4Z2AA 4IFEA 2VUSA 2YS7A 3H65A 3OD1A 4OOFA 4GOLD 2O2XA 2WTUA 1TAQA