4JYCA

Meab, a bacterial homolog of mmaa, in its apo form
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
322
structure length
311
Chain Sequence
PDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPKKGIFELADMIAVNKAGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
total genus 115
structure length 311
sequence length 322
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jycA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jycA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jycA02
2Q9CA 2A5FA 4TWZA 2WOJA 2RGGA 1Z6GA 2F55A 4MRSA 4QBIA 2FG5A 3NBZC 2DWPA 4X8HA 2W83A 1X1RA 1YVDA 5CDFE 1AM4D 5G3ZA 2NO1A 2QE7A 4GOJA 1I2MA 5JI3E 1AS2A 3U5ZB 1L7VC 4MKFA 4C0HA 1KNQA 2DYKA 2EQBA 3H84A 4OHYA 1NN0A 1XRJA 3CX8A 4CEHB 3BH7A 4Q20A 3ZRXA 1ZP6A 1IY1A 2QN6A 3AF0A 4GSYA 3VFDA 5GVSA 1QHXA 1NKTA 1NSTA 2CJWB 2V4ZA 2JA1A 2Q6TA 3N2IA 1RZ3A 2IEZA 4FWIB 1R6BX 2KI5A 5DHFA 3I8SA 1IM2A 3KUCA 3A5TA 1PLJA 3AKCA 5FI1B 4F93B 5TY0A 3A8TA 3GLHB 1KTVA 5GJCA 1IN8A 1D6JA 3UIEA 1M2OB 1CF4A 4TMXA 1A02F 4JLAA 5AVQB 4B2LA 1FTSA 1PUIA 4ZDJA 3AH8A 4I1VA 4TYNA 3AV0B 5FUXA 3NWJA 3KDSE 1G3QA 3RRMA 1IY0A 5TARA 2CMKA 3PXGA 2GXSA 5SZHB 3UMRA 2H5EA 2RHMA 3TSWA 4BIZA 3GPLA 4YMSA 1YKSA 1JECA 3QIAA 1P2TA 4A8JA 4L16A 5BN3A 1ZVQA 2GCPA 3KQHA 4QOSA 4Z8YA 3C15C 1HYQA 4D4KA 4P0TA 3KFXA 5AR1A 4LJ7A 4PPFA 2PLRA 3RC3A 3GLIA 2O8BA 1E69A 2DCUA 2ZI7A 3VR5A 1EESA 5JI2E 1E9AA 4C9BA 2JLQA 1MABA 5KTYA 3SHFA 2WM9B 2JJ1D 4A0RA 2IA5A 4YMUA 2VSXA 3IGFA 3NEYA 4WAUA 3EXAA 1E79D 4R2IA 2VSFA 3V4RA 2V7QD 2P6NA 2UKDA 3HJNA 4Q7KA 4D0GA 4RKFA 4ZIRA 4AI6A 4PZLA 4RFSA 1CI6B 1F60A 3TNUB 4ITRC 3NBXX 4RD6A 1JR6A 2ZJ2A 1XFAA 2FZ4A 4GCZA 1OH8A 3KXLA 3TYYA 2CVHA 2UVQA 3EX7C 1X6VA 2D4HA 5BQ5A 4HAZA 3SS8A 3MGNA 3JZAA 4MDEA 3C5CA 4Q1BA 5C1BA 1G16A 1HQCA 3GMTA 1E2LA 4HUQB 1IXRC 3HU1A 3Q8XB 3QXSA 2QY9A 5HTKA 3S1AB 2V54A 4PAOA 4D81A 4Q9LA 4TYQA 4BFVA 1NP6A 3ZZUA 3W8NA 3X1ZA 2H7VA 2Q3IA 2QP4A 4JBXA 1Z6AA 3OHMA 4KBFA 4V0ME 3REGA 4KHXA 3W5JA 2JLXA 2GILA 4MRPA 1S9DA 2QENA 5AW6B 1IHUA 1Z6TA 1D2MA 1GNPA 5B1NA 1ZM7A 2RGNC 3PEYA 2ONKA 4TZ6A 3QKSA 1CEEA 3CW2A 3AKYA 4P4SB 1OW3B 3MD0A 4DUGA 3A36A 1II8A 4AC9A 2HUPA 3ADCA 1ZNZA 4TMKA 3IBGA 4EJSA 5AUNB 5AJWA 3E5HA 3L0PA 3O8CA 1CRPA 4DKXA 3QKUA 2XGJA 1CZQA 1TU4A 2FPMA 2P6RA 821PA 1ZNXA 1G7TA 4U7DA 1FUUA 4ACBA 5KU1A 2WV9A 3UATA 3PUXA 4XD7A 1OH6A 3BERA 1RJ9B 1LF5A 5JWHA 4QJ4A 3VX3A 1C4OA 3MWJA 4TSFA 3NKVA 1OKKA 1RFLA 5JMTA 1P9WA 4JLDA 1I4DD 4PPNA 2HDNB 1OHHA 3IQXA 3DZDA 5JEEA 2XX3A 2CDNA 3CX6A 4JVSB 4C7OB 5JBQA 4V0NA 4F4IA 3HP1A 5BWMA 3VR3A 4IEEA 5C18A 1KQLA 2ZJAA 3KL4A 5KDDA 3VMXA 4LV6A 3ZD7A 2Q0HA 1OXSC 1IXSB 4M21A 1EWRA 4XVQA 3K9GA 2BKUA 2C9LY 2BMFA 4D2IA 4PTLA 5K8UA 3UG7A 4PHHA 3RC8A 3CBQA 3LVRE 5FTNA 4A82A 2HXSA 5KSYA 2GZAA 1VCMA 2QP3A 5KSZA 2IF2A 4HB0A 1JEDA 3SDZA 2FU5C 4NYMQ 1Z3IX 3T1TA 1FP6A 4M1KA 1UADA 4OK3A 4KSCA 1Q57A 2P7JA 3MG9A 1S3GA 1GU5A 1W5SA 4MGZR 4KITB 1KZ7B 1XXHE 1E9SA 2B7CA 1XTKA 2BOVA 2QQ0A 5JJIA 1JJVA 4RD2A 5JS8A 2IS2A 3MGCA 1VIYA 2RH5A 4BLSA 3IEVA 2B8TA 2W00A 3QG5A 1X1SA 4TT3A 4UNQA 5EP1A 4CEJA 3GJ4A 4U02A 1Z06A 1RE0A 4WOPA 4M22A 2AR7A 4D0NA 2FMXA 3EZ6A 2HXYA 3V5BA 4HB4A 1FZQA 4DEYA 1HT1E 2J9RA 4D4MA 3P1JA 5J47A 2R5BA 2QT0A 4XIGS 4EPWA 1HA3A 2X8AA 1ZNYA 3HWSA 4OYHA 5JSZB 2ZSEA 2ECKA 2XSZD 1FPMA 5EXTA 3X1YA 4XWAA 1U8YA 1CIPA 3GLFA 1MOZA 4BGDA 2GAOA 2C8VA 1BS1A 5C93A 5EXSA 1QHHB 4I2LC 2ZI6A 2XU6A 3CRMA 4JIMA 2VRWA 4JAUA 1KI1A 2VHTA 5EP4A 3OAKA 2NPIA 4PC7A 3U44A 2NQ2C 2QTHA 1GITA 2QBYB 2R6DA 5HR5A 4JL6A 4IXNA 1PUJA 3AUXA 4DZOA 1A5TA 2IYVA 3DKPA 3I72A 5FBLB 2ZU0C 221PA 2I1QA 2XNDD 5CK5A 4LRWA 1GNQA 1CXZA 3SOPA 4BPBA 2ZJBA 4B3FX 2WPSA 2X2FA 4J0QA 1DOAA 2IWRA 3VKWA 2G1KA 4B73A 4AIIA 4WVFA 3TMKA 1A02J 2O52A 3CNOA 1SULA 2IC5A 2OESA 1IONA 4LJ6A 4LHYA 3O8ZA 1JPJA 3ZZTA 5JCPA 3AB3A 1IN7A 2ANCA 2BIFA 4QGGA 1DBSA 1GL7A 1U9IA 3WYAA 2E9SA 4TLEA 2ZAOA 4WXRA 4HYYA 4YQFA 3AF2A 3TAHA 1WMSA 1GWNA 4S35A 2CHQA 5AVZB 2XTMA 2LCFA 3V9PA 1LW7A 1ZD1A 4AD8A 1WQ1R 2C9CA 1AS0A 3T1QA 5GJVC 1NVUQ 2EFDB 1MO3A 2R5DA 1YZTA 1UDXA 4AKGA 3A1UA 4P33A 5G40A 1NI3A 3MWLA 3TQCA 4M0LA 1KI8A 1ZM3A 4GZMA 2PH1A 2Q5UA 1VCNA 2WICA 4HSEA 5BN4A 4HZUB 1P75A 3KKNA 2VP0A 1HUQA 2ZJYA 5FUVA 3KKMA 1NNEA 5E95A 3B5JA 3GEIA 1R8SA 3I61A 2B8WA 5G41A 4XVUA 3GLHE 2OV2A 3TLXA 2GHIA 1HEIA 1LNZA 2F1IA 2NZ8A 2VHQA 4C7NB 2XOKA 4WA7A 4QKQA 4XWKA 1E1QD 5JRZA 3VR2A 1QHGA 4LBVA 2QNRA 1DO2A 2CVFA 4A0FA 1E9EA 4DCNA 2PLFA 2BASA 3UWKA 2GESA 1KIMA 1E2GA 4MYHA 3NBYC 2NMVA 2XAUA 1E9DA 2ONJA 1GKUB 1M7BA 3BFKA 2OFXA 3ZS9A 2WPDA 1E0JA 1MH1A 4KYIB 1JJ7A 4JS0A 4QJ3A 3IHWA 4HEJA 1A7JA 2O0KA 3KUDA 5FTJA 3SBEA 4UXJA 1SLQA 4KLNA 2ZRHA 4AG6A 3QPWA 5JWRA 4QGFA 5FL3A 1XD9A 2FF7A 5IK2A 1NN3A 2ZFCA 3KTAB 2YOHA 4NYIQ 4B34A 3TUJC 3JZMA 1Q3HA 3NH9A 3NFQA 2UZIR 5DE3A 4OHWA 1E2IA 5BXQC 4B32A 5DGXA 1E2QA 4FI3C 4B3CA 5K8TA 3U6KA 1SHKA 5BYJA 2GXAA 3HDTA 2C5LA 2QSZA 3WMFA 5APYA 2IYZA 5L3RA 1YQTA 4JLPA 2V9PA 4B74A 2XZLA 2IEYA 1F2TB 1N6OA 5FPKA 3WNCA 3OEEA 4B3DA 5C46F 3M1IA 1KI6A 2GETA 2QT1A 2ZAMA 5APQA 4XH9B 4URUR 4R7ZA 2ZYVX 4KU4A 4GL2A 3GJXC 2RGBA 1DAMA 1SKYB 1S9KD 1GRRA 4Q1CA 3E70C 3I3SR 2WMNB 4NPHA 4WW0A 4TTRA 4D82A 1KAGA 3CUEF 3SU8A 3HE5B 1J70A 4IOMA 4OQFA 3VX4A 1IOZA 1ZUHA 5EE1A 2CEAA 2WJYA 1HURA 3TJZA 2B92A 4Q4HB 3ZRWB 3THWB 4BFYA 3ADDA 1OV4A 3QQ5A 3QSYA 2FH5B 1IXMA 2KBEA 4MKHA 2FA9A 3LNCA 4EUNA 4XWOA 2CNWD 3FYHA 4JJKA 4RESB 3LQRA 4FCTA 4KCGA 4HUTA 2GJAA 3CKLA 4JVNA 1H8HA 1NG1A 2WKPA 3X1DA 4TLCA 5AW5B 3ND8A 1CJUC 3FGNA 1SHZA 1F6BA 3FTQA 3K0FB 2ZRFA 2JJ2A 4OKSA 1GILA 2AWOA 3OIYA 3DMNA 3U7HB 2IYTA 3IBYA 3TR0A 2J46A 1SVOA 1M8PA 3KXIA 1UKEA 2W6JA 1YR8A 4PXAA 4NU0A 5FFMA 3HR8A 1SXJA 4EPVA 3LIEA 3UWOA 1QHYA 1JXMA 4ZO4A 1CP2A 3IO3A 2JLZA 3R9WA 3BWDD 4JAVA 2IPPA 1EFTA 1J99A 1H8EA 3OFND 5DYIA 3R20A 2YZ2A 4A15A 4L9WA 4G5SA 3U61B 2E87A 3PCRB 1UBGA 5AJYA 4DSTA 2YKGA 2BV3A 3EC2A 1EXMA 1R10A 2R65A 3VYIA 2XJ4A 3EPKA 1G8PA 1QG2A 1JUNA 3FWYA 1UBCA 4LCBA 1N0WA 1ZM9A 3K0CC 4B43A 3RS3A 5JFGA 2ORIA 3W3AA 1AQUA 2BM1A 3PUWA 2MSDB 4A92A 1R0YA 2ZUDA 4A36A 1N6KA 5FBQB 4W7SA 1JNMA 1HH4A 1T3SA 3TIFA 1JQJC 2QMEA 1QG4A 2F6RA 4E03A 3VU9A 2ZVQX 2Z4RA 4GZLA 5HKKD 5SZJA 4M53A 4Q18A 4LYAA 5J5CA 5TB5A 1CJMA 2HF8A 5A0FA 3WP1B 5B64A 1I2DA 1EG7A 2C03A 4MITA 2ZS7A 4MUBA 2BMJA 3RNLA 1G3IA 3QXJA 4QNRA 4JLNA 1NLFA 5EQTA 5JZVA 1HT2E 1XDBA 2BCJQ 4FMCB 4YXWD 2O8FA 2XZOA 3A3YB 5FBWB 5AVUB 3AP1A 1KSJA 5JS7A 2ZJ5A 2NO7A 2ZSFA 4IOJA 1MO6A 1Z47A 1ZC4A 1T2KC 2DFNA 2GVZC 4OBEA 3BJIC 3R9IA 3U3OA 1Z6XA 1S4QA 1N6HA 3NXSA 3MLEA 4ON9A 2PX0A 4LHZA 2NTYC 1CULC 1DARA 4CIDA 1P4SA 3P8MC 4LSGA 2REBA 4MYTA 2ZS9A 2YJTD 4DIEA 2VHUA 3AF4A 1FX0B 2BC9A 3UANA 4PC6A 4C3ZA 1G9XA 5CDFA 5G3YA 3WYFA 1W49A 3AVQA 4S2EA 1Q44A 2ZI9A 2C9NY 4IDPA 4X8OA 2Q3HA 4FMBB 4AURA 5FR1A 4Z54A 1IN5A 2ZR0A 3EZFA 2C99A 1BKDR 1DELA 3AF3A 4QPJA 3KB2A 4NBSA 4OHXA 2FFAA 4UJ5A 1DS6A 3EIHA 2IS6A 4DZZA 2QG6A 3KDPB 4JJZA 1YZLA 2ZRIA 4URWR 5HZHA 2ZM5A 5CLQA 2VL7A 2GJSA 2HCJB 2REXB 3U3RA 4B2IA 5EE3A 4OL0A 4QBGB 1Z0AA 4C0SA 1JOYA 3M06A 4LI0A 4Y0AA 4WZBE 3TRFA 2SHKA 1N25A 4A2PA 5KYKA 1EWQA 1EFRD 1Z22A 4U7OA 2IS1A 1KK1A 1NMZA 2V1UA 3P7KA 2OLKA 2VP4A 1EX7A 5B57C 2QPOA 4ESHA 3VAAA 1XMJA 2VP2A 1R7RA 3IHLA 4AUWA 2GJKA 4AKIA 2B21A 2IXEA 4GMXA 4DJTA 4M9ZA 2ERXA 2WAXA 4A4DA 1VDZA 5FOWA 3TW4A 3UMFA 2J7PD 1WDTA 1KJYA 3B1XA 1ZRHA 3NH6A 4EPYA 2ZYWX 1W0JA 2F43B 2ZR9A 4QG7A 1HE8B 2ODNA 2VBCA 2R44A 4TLDA 4M9SA 2WWWA 2HV8A 4FWTA 4GI7A 2BEJA 1ZU4A 2FGKA 1OB5A 1DADA 4Q1AA 2QPTA 2FDCA 4PC3A 4YDSA 3QEOA 2J0QA 1E96A 2GCOB 3UK6A 4TQAA 4JLOA 4Q47A 3PIRA 4GBMA 3H1TA 3SYNA 2WPQA 1N5JA 5FOXA 4D26A 1U94A 1ZC3A 3Q85A 2YO2A 1GD2E 3CH5A 2GRJA 3DM5A 1KMHA 4KVAA 2WIBA 2BJWA 1OT3A 4ZDKA 4L8GA 4NCKA 2ZPTX 3BS4A 1NRJB 1II9A 2R3CA 3LRPA 4DDTA 2WSMA 1S9KE 1LVGA 1VCIA 4GKGA 2RGNA 2J0UA 3ZLJA 3TSZA 4DHEA 1BMFA 3CM0A 1TF2A 1D2EA 4L4UA 3FMPB 4F38A 1VYTA 1E1RD 4NYIR 1KI4A 4ZDWA 3ZIAD 3W8RA 3ZD6A 4V0MA 2GBLC 1Z07A 5J4HA 2XZRA 3W3ZB 3CZQA 4LJ5A 1AN0A 1E4YA 4GRAA 1N5IA 4LHVA 2JEOA 4F7WA 1F2UA 4RSGA 2BKEA 1U99A 2IYWA 4RD1A 3HE4A 5HE8A 3W6NA 1JI0A 3CPEA 4HLUC 4PAQA 4Z8XA 4A8JB 3FMIA 1WE2A 4C0JA 3BD9A 2ZANA 2DPXA 4AKHA 3EA0A 2CLCX 1E2KA 2QE7D 5DI3A 3O47A 4WIAA 3GLIB 3SFVA 1KAOA 2O8BB 1TMKA 2IUUA 2WWFA 3B9PA 5APVA 1OXZA 1I4TD 1P2VA 2PJRA 4PO8A 5HE9A 5DLQC 1MABB 2ZIAA 3ADBA 2HF9A 2JDIA 1Q22A 5FR2A 3UKDA 1E3MA 4OI0A 1JAIA 1VG1A 4KFTA 3AGQA 5JJLA 5KHOC 5AW8B 1S3SA 2MMGA 4TL7A 2GKSA 4RFSB 4TMZA 4IVPA 4Q4JB 3SZRA 2ZETA 3LWNA 3VKGA 2IX3A 2NO0A 4B48A 2YO3A 2C9OA 2GXQA 4IOLA 1DTSA 3QPVA 1Z0KA 2KB0A 1S96A 2F3TA 3P4YA 4RZ2A 4TYYA 3BFVA 1E9BA 1J8MF 5FUWA 1KMQA 3MJHA 3VKHA 3LV8A 3ZZ0A 4E07A 5AUOB 2W0SA 4NCIA 5G53C 1S1CA 2D62A 2OILA 1XXHA 1CU1A 1DAFA 2KBFA 4UNNA 1KSFX 4LWZA 2WKQA 1E2EA 3K0AA 3SHWA 3NHBA 1G20E 2DFLA 3QKSB 4FMCF 2H18A 3KFVA 1U81A 3C16C 2KP8A 1XTQA 1MKYA 1YYCA 2E1RA 4PZZA 1FL9A 5AVRB 3C8UA 1AKYA 5AUQA 4EJSB 4QRHA 4DWJA 2ODEA 3KQUA 3CRRA 1Q12A 4DT1A 4TQUS 2VRSA 3SNHA 1Q21A 2GVDC 2BMDA 2AXNA 2C9YA 1GL9B 4URZR 3BK7A 4A2QA 4I81A 4LBYA 4KFSA 4WBSA 4G5GA 1YZNA 2EU8A 2W6IA 5L8VA 1VG8A 1CS4C 2EYQA 2XTZA 3F0TA 3RS5A 1EFUA 2FTKA 1XZPA 1AA9A 2C77A 2Z0MA 3WP0A 2FOLA 4W5WA 3ZQJA 2A30A 4YLGA 3PJRA 1YRBA 4UNSA 5FPTA 2A78A 4ZCLA 3BIFA 2A7QA 1NBME 3MCAA 5KSOA 2WWYA 3Q7QA 1T9HA 1J2JA 5AW2B 1OWAA 1DG1G 1NMYA 2EFGA 3FDIA 1IAQA 2JATA 2A5DA 3NC0C 3QBTA 4BFXA 4EPXA 4NKRA 5JCZA 3E2IA 4H1VA 3A4LA 2FGJA 1C9KA 3CRW1 1GOTA 5FL7A 1CLUA 4JZKA 1Z6YA 1EX6A 2IYLD 2ATVA 3NTNA 2FSFA 1KO8A 1Z5ZA 3EWSA 1ANKA 3L8ZA 4R9UC 4Y0VA 4DDUA 4LC1A 4DUGD 3KQKA 2JLWA 1ZIOA 2RGEA 1N6PA 5CM9C 4FMTA 1G6OA 1NVVQ 4QHTA 3RANA 1N6NA 5FH9A 5DO9A 4A0HA 1Z2AA 1UM8A 1KNXA 1XEXA 2VTKA 1VMAA 2ZRCA 4BASA 4B71A 4CEJB 2CBZA 1XCGB 1Z29A 3EAQA 4XD7D 3GJ6A 5KUTA 4OHVA 4M1OA 1PLLA 3AQ4A 4D0LB 4B6EA 2XB2A 2JAQA 4HDCA 2CLSA 4TSFD 5F2EA 2WJVA 3KQLA 2O8CA 4PFSA 1L2TA 1SVWA 4CDGA 1JNYA 1OHHD 2GTPA 1F48A 5CB8A 5F98A 1FP7A 3AP3A 4TTQA 1L4YA 3EW9A 1KSGA 3TNFA 3ZJYA 4II7A 1R4AA 1FMJA 2WHXA 4MYCA 5FBVB 3GLFB 2OBLA 1GAJA 4LBZA 1P60A 1X86B 3B60A 4URVR 2N9BA 3ZVNA 1X8LA 1ZD9A 2JJ1A 3AP2A 1FTNA 1Z0IA 1NIPA 3LBNA 1ZD8A 1JR3E 3OIWA 1AIPA 1T6NA 2VP6A 1NN1A 5L3QA 1SQ5A 2FWRA 3MSXA 3GLHA 1RKBA 2QRZA 3U44B 2RB4A 1KI3A 1T91A 3GJ5A 4JLBA 3GFPA 3VHXA 3RWOA 3BXZA 3KJGA 2ZE7A 2HT6A 3QY0A 2B7BA 4IJMA 1W7AA 2WT7A 5ANRB 3RS2A 4BZQA 2CL0X 5AVTB 1KDPA 4TT3D 2QORA 1G6HA 3BBPA 1LTQA 3DOFA 1SKQA 3OESA 1GK6A 2FZLA 2PX3A 2WWHA 4V03A 4DSUA 1GRQA 3LY5A 3B1ZA 2D7CA 5EZ5A 1W48A 2O0HA 4TL6A 3MUFA 2D3WA 1W47A 3X2SA 3MJRA 2IYYA 5FOSA 3SJZA 5APSA 1A82A 2ZJZA 1E0SA 5CJPA 3RWMB 2D74A 1G64A 3B82A 1QF9A 3EA5A 1OH7A 2YWGA 1SVKA 3CO5A 2IT1A 3QJYA 1TQ6A 3X1WA 1W46A 4Q7LA 3HYRA 5KNCA 3D7MA 1G41A 3GFOA 2R9VA 1LY1A 5CB6A 1FAVA 1P2SA 1VHTA 1AGPA 2XEXA 2NPFA 1CI6A 2R62A 4CF7A 2Q3FA 3LVQE 2Q3MA 4G3XA 4H1UA 3WNDA 4C2UA 3ZVMA 1P7CA 2NO6A 4C30A 3WRYC 2V6IA 1TPZA 2IYQA 1R0XA 2OEPA 1N0UA 3BH0A 5D3MA 3K0SA 3TVDA 4HUQA 5H8WA 4W5HA 4UNPA 5DH9A 4A1FA 2C96A 3LFUA 1PV4A 1RYHA 3ASZA 4AYWA 1R5OA 3VMZA 1GFIA 3ONWA 4BZPA 1P5ZB 2QMOA 1BYIA 3NG1A 4KVGA 1UBEA 2A5JA 3Q72A 1G3MA 2BBOA 3UXMA 4I5SA 1QZXA 3GLGE 4IDHA 1NN5A 2C04A 1W0KA 4ZCMA 3THOA 1WBBA 4KI0A 1UKVY 4QJ5A 4JT4A 2QUZA 4D4LA 5A5GA 4B3GA 1OFUX 1YZQA 2OXCA 4QHSA 2ZRJA 4GFDA 3G0HA 3T12A 2QROA 2ZYUX 1XEFA 3ZVRA 4D25A 4UKDA 2VP9A 4JYBA 4PR0A 4FCWA 4O0MA 4PC1A 5AUPB 4TL9A 3N2EA 4LYJA 3BB3A 3QEJA 4GDFA 1MRNA 4I1OA 2O8EA 5SZIA 4M4SA 3OE7A 4TN1A 2QAJA 2Z5HA 3TVTA 4ZPXA 4A8JC 2XXAA 2ZUBA 1RJ9A 5E7JA 2OBNA 4Z1MA 1G17A 2Q9BA 2JLUA 3SI7A 3THYA 3T35A 4B76A 3P32A 3G5UA 1RYFA 1XPOA 1KI6B 1GG2A 2BHRA 3DGEA 2ZU6A 3C5HA 2GK7A 5F9FA 1RW4A 3MRSA 3M9BA 3VNUA 5BYKA 1NLYA 2XOKD 3BB4A 3PG5A 2OFOA 1NMXA 1GVNB 1I4LD 1KY3A 3K09C 3N70A 1CRQA 2XNSA 5AVVB 2YYZA 4BFWA 4NONA 3K0EA 3QXHA 3CRVA 3MAAC 4LJAA 4W5JA 1VTKA 1QHIA 2PZEA 3SJBA 4PQRA 1XU4A 3V4WA 1KDRA 2XTNA 2ZRBA 3FKSA 2WPDD 4ARZA 1NJGA 5IHPA 2HCBA 2YC4C 1U90A 1XMSA 2HJVA 4JSYA 4NZYA 2BBTA 3T97A 3HTKA 1TF7A 3RRYA 4RY2A 2FEMA 4M1TA 1Z8FA 5IK2D 4JL8A 1XCMA 3CH4B 4LUCA 4DLRA 4EQ6B 1S9HA 1KJZA 2OLJA 1OFTA 4BWYA 3B85A 1QVRA 2OO7A 4DDWA 1XTJA 1G8HA 2CCGA 3NDPA 3GP8A 3SJCA 1MO4A 4AYCA 2MMCA 1ZBDA 1G7RA 2FFHA 4G5OA 1GIAA 1SXJB 1DAGA 4DCSA 3QENA 3QKRB 2VH5R 4HB2A 3DOEA 4MRRA 2VYFA 2H7HA 3THXA 2I4IA 3CF2A 4MDFA 4EDHA 4FXPA 4IDNA 3KQNA 4EFMA 2XZPA 3W90A 3VN0A 3MMPA 3RYTC 2W6AA 1ZUIA 4EPRA 5F3WB 4KJZA 3VR4A 1JAHA 2WOOA 2QI9C 5H1YA 4DLTA 3K8YA 2WIAA 4Q7JB 4O2RA 4D4JA 1XWIA 1WP9A 1TX4B 4FIDA 1E6CA 4HLQB 4YMTA 5AVWB 1QHHA 5H70A 2PEZA 3Q5EA 4A0GA 3ICEA 4K46A 3B8EB 4I4LA 1NL3A 3K9HA 1RRGA 3IO5A 3SE0A 3IDQA 3MWYW 4AK9A 2IYXA 2BJVA 3TUZC 3I1FA 4U5XA 2IW3A 2ZE8A 3WHKA 4Q9IA 4DCUA 2BM0A 2F9MA 1CR1A 1DPFA 1U0JA 3PQCA 4B33A 3NIBA 2QBYA 4TTPA 1GRNA 2BBWA 3IIKA 1H8HD 5JWOA 2C2AA 4LJ9A 4M1SA 3WRXC 3ZGXA 4Q1DA 5KSPA 4BFUA 4QM7A 2A9KA 4A6XA 2PMKA 2JJ2D 2ZQ5A 3VMFA 2P3SA 1OIXA 2W6JD 3F3YA 1G3UA 3J81k 4HYTB 1SXJD 2QAGA 5FPSA 2GWHA 4GP6A 2AL7A 4LZZA 1ZJ6A 5JLJA 1H8ED 2O8FB 3L0IB 1LV7A 1CJTC 4A9AA 1WCV1 3ZDQA 1M1YE 1E2HA 1M34E 4ZV4A 4V0LA 3REFA 5JJKA 5EE0A 4IW3B 2NZJA 3VTKA 1D9ZA 1HY3A 2N1BA 2O0JA 1E2JA 1W36D 4AG5A 4NCHA 1DH3A 1LB1B 2RGDA 4Q4AA 1GTVA 2W58A 1K5DA 5J4YA 3DM9B 1YR7A 2A5YB 2VPPA 1CR0A 3JVUA 4M3LA 2IHYA 3GJ3A 1II0A 3BAFA 1CTQA 1K6MA 3LXRA 3NTUA 2FX3A 5DISB 4LHXA 1M6NA 2GAAA 4Q1EA 4XE5B 4C0AC 4DC9A 2F9LA 3OEHA 4PHTA 2QMUA 4GOXA 1QBKC 1RVDA 4HZUA 4UNRA 1FOEB 4KHZA 1A2KC 1GDDA 3ND9A 1BOFA 4JKYA 2H17A 4ABYA 4GT1A 2OT3B 2J1LA 2GBLA 1X8YA 1CJKC 5CIQA 2OCAA 4ZCIA 2J7KA 3L43A 2CL6X 2WTYA 4C7NA 2EFHB 4WZ6A 5EP3A 2R8RA 2V55B 5AJVB 3A4NA 2PCLA 4HLUA 5APTA 2CK3D 4U7NA 5CJ2A 1G5TA 1TQ2A 4NHOA 5FOTA 1KI2A 1U0LA 4NYMR 3U3MA 2Z6VA 3B2EA 4TMVA 4RCYA 1N0VC 4KBGA 5GVRA 2G6BA 2VP5A 4DSOA 2VO1A 5FTKA 3U4QA 3EIEA 1LF0A 2YWEA 2ZSDA 1LS6A 4V0KA 1U8AA 3AKEA 1L8QA 4POAA 621PA 2R6CA 2ZJ8A 1CJVC 1XPRA 1S2MA 4CGZA 5DN6A 5B1OA 3AVVA 2ATXA 5GJWC 4QXAA 3PUVA 1R5NA 1S8FA 1YRAA 2GF0A 3RLFA 4QGAA 1Z0JA 2WBLC 4BLQA 2JLRA 3T1VA 2F1JA 4KFRA 4OI2A 2VA8A 6Q21A 2VHCA 4QBHA 3IIJA 5HZKA 4MT8A 4KXFB 4RZUA 1CBUA 1OXXK 2GDJA 1IN4A 2WZQA 4IVRA 2G0TA 1XJ0A 1XD8A 3FHTA 1M74A 5AWFC 1C1YA 3B9QA 4RD0A 3IQWA 2AWNA 3H86A 1Y63A 2R6GA 5KDLA 2HT1A 3C7KA 1WBDA 1KI9A 2P2LA 1X8KA 1P2UA 2MSEB 4PO9A 4BEJA 2ZRMA 1F5NA 1YU9A 4LC0A 2JASA 5LDDC 2FPKA 1UAAA 4MYUA 4LOAA 3C14C 1HE1C 3KJIA 5KO2A 4PSVA 5JEDA 1N6IA 3QF4A 2OSBA 3IPXA 1FFHA 3T06B 3WNBA 1KO1A 1W0JD 3HE4B 4DEXA 3I32A 2DR3A 4QBFA 4QGHA 1G2CB 3BC1A 1ESMA 5CYOA 3NBFA 4HAWA 1XJCA 1G5PA 1UJ2A 4CT4B 1G8FA 3NEJA 2FJUA 4XVRA 3W6OA 1JQLB 4EAQA 4B86A 3U60B 1GNRA 1YR6A 2NOAA 4KYUA 2LFRA 1UEJA 2N42A 4XSHA 1TQ4A 4MGKR 4M1MA 4D6PA 2P2UA 3OIUA 1M7HA 2FSIA 1G4UR 1UKYA 5CLLA 1RPZA 1GM5A 3ZH9B 5AJZA 3RS7A 1HWTC 2RAPA 4RD3A 1SVSA 1XTIA 1BMFD 2W0MA 3D3QA 3EZ7A 2D06A 3K1JA 3K9NA 1PLKA 1QVAA 2ZREA 1NBMA 2AFHE 4TL8A 3ICQB 1TTTA 4KSBA 1GSIA 4FINA 1DAEA 2CHVA 3BORA 1T5LA 4I1SA 1DO0A 2XB4A 1R0ZA 1FUKA 1NVXQ 2Q9AA 4IKEA 4JLMA 1E0AA 2ZXUA 3UIAA 1DAIA 2KWIA 1UFQA 4BRWA 4QM6A 2RGAA 3EPHA 4DSNA 1Q20A 4A2WA 3D36A 2PT5A 4CZ2A 1F51A 1YJ5A 3P27A 4ZKDA 2AKAB 2EFEB 2IHBA 1XXHB 4D80A 1WA5A 3K0AB 4LGMA 1F3OA 1NY5A 1PJRA 1JPNA 3M9HA 1Z08A 4GP7A 2RCNA 1UF9A 4DCTA 1WF3A 5APWA 1ZCAA 2ZRAA 1D5CA 4FMDB 3PEWA 3A7OA 1FMLA 2ZSBA 1MV8A 5TV2A 1JEEA 2WWGA 2JDID 4XTRA 4Q9HA 2JGNA 3PUYA 1KOFA 2V1XA 4PC2A 5CYPA 4LV5B 2ZI3A 3LXXA 1XD2A 1Z0FA 4JT2A 2WSSA 3PV0A 4PPQA 1XP8A 3LH5A 4DIDA 2HLDA 2VHJA 2GCNA 3V4FA 2R6FA 3HPRA 3FPAA 4KLZA 5HPYB 1P73A 2ORWA 721PA 1YR9A 2D2EA 3DDCA 3LX5A 3TH5A 1ONBA 1G7SA 1L4UA 1OLOA 4JYCA 1GK4A 3B1WA 1COWA 1VIAA 1H65A 1ZNWA 1JR3A 4M9XA 1G18A 4OI4A 4E5UA 1J2JB 4NP6A 1BH2A 4K8OA 1KO4A 2YHSA 3RAPR 4GNKA 4TLAA 5AW9B 1DAHA 1SKYE 3QPUA 3IR9A 5E4FA 2VQSA 2F1HA 5LB4A 1TUEA 1HUCA 2AD1A 4JVLA 4MGIR 2JLSA 4ZIRB 5AK0A 4ACAA 5C4GB 3N5CA 4Q9KA 2X1VA 1BIFA 3SQWA 3I8XA 1D9XA 3A2AA 1DEKA 2ZRDA 3CLVA 3RRZA 5L3SA 3WMGA 3DPUA 2R6AA 4RCZA 2QGZA 2FFQA 2E42A 1AZSC 2QPAA 1E32A 4HAVA 5JRJA 3HU2A 3HU3A 1QHNA 4BLOA 4M8NE 1MFZA 2VF8A 3OAAA 1NWQA 4HAXA 1XEXB 4JASA 3EARA 3EC1A 3R8CA 3I62A 1NVWQ 4Q21A 4V02A 2ZRPA 3OZXA 4P4UA 3A1SA 1AK2A 2W6ID 3FVQA 3GD7A 4BUJA 2IXGA 2DFKB 2NIPA 2WJGA 2OBMA 1B0UA 4JLVA 3ZS8A 2YOGA 2OE2A 1IJEA 2QL6A 4OQXA 2O8CB 5B30A 1Z0DA 4G0NA 4R2HA 2GCOA 1FW6A 4UXHA 2ZI5A 2GF9A 2C95A 2ZRGA 1GZLA 1II8B 4N3NA 3VHLB 3VNVA 4Q7MB 2AK3A 3M91A 3GFTA 2Z83A 4LV8B 4DLXA 2NGRA 2XV5A 3AM1A 1EK0A 5FPHA 4NMMA 2WWXA 3D31A 1US8A 4Q48A 2JIZA 3SBDA 2CLDX 4HI0E 5GADl 3K70B 3CR7A 5AJXA 5FL7D 2HYDA 3EZ9A 2I1VB 2YWHA 3KKQA 4LJ8A 4P4TA 3DMDA 5FTLA 3WY9A 1E9CA 4ASUA 1YHNA 5L3QB 2O8DA 5JECA 2YC2C 3EPLA 2PMDA 4AYTA 2BMEA 1OYWA 1MUUA 2Z5FA 4UJ3A 5FBRB 5TDHA 1GKYA 2GJ9A 3U6BA 3Q3JB 2P65A 4DLVA 1HV8A 5EZ6B 2ANBA 4BFSA 2WT7B 1TEVA 3GLGA 3A6PC 4US0R 3A1TA 1VG9B 2OM2A 2XJ9A 4HLDA 2IL1A 1OF1A 1GKIA 5APXA 2P67A 3PEVA 3M6AA 1OYYA 4JLKA 3UPUA 3FE2A 4Q9JA 2CHGA 3R7WA 3RS0A 1U0HC 4MH0R 3UG6A 2CCJA 2IYSA 3BB1A 3C41J 4BECA 3KX2A 4P31A 1XB2A 2VSOA 1W44A 1NY6A 2PZGA 1GUAA 1ZM2A 2FEOA 2G1JA 2P5TB 4TLBA 4LPKA 2OUKA 2REOA 4LYHA 2N46A 4P3YA 1YZKA 5P21A 4BEBA 5KPJA 1O3YA 4CEIA 5AVXB 5AW3B 4AYXA 1KKLA 2HJGA 3LLUA 3AVUA 2VLIA 3RHFA 1G8YA 5KPDA 1IN6A 1JALA 3K09A 3LBHA 4YDHB 1R0WA 2Z5IA 2GXUA 3G82C 3K70D 3AVYA 4Q66C 1KO5A 2PCJA 4KO8A 3L0OA 4O3MA 3GJ8A 2J0SA 1QRAA 4PPGA 3EZ2A 3LIDA 4XOIA 2IYRA 3CX7A 4Q4JA 4MQBA 3QNUA 2JJLA 4EOTA 1OKKD 3K53A 3RSLA 3SFZA 3U3KA 5CIWA 3NHAA 2ZEJA 5JHHB 1KO7A 1ZCBA 3VTPC 1XEWY 2WMOB 2Z43A 2W2TA 1BYUA 5D3MB 3DO6A 2RKOA 3WXMA 3O8BA 2C98A 3FFAA 1NLZA 1OH5A 5LB2A 4N0EA 4CEHA 2RGXA 2IBMA 4MRVA 4NH0A 4WZAE 4YMVA 1DE0A 5K8LA 4DXAA 4QC2A 5LD2B 3LAWA 4O25A 2CJWA 5APUA 4PAMA 3AVOA 4RFVA 4U00A 5FUYA 4IDOA 3I92A 2EFCB 1E79A 2OCYC 5HCNA 2ODBA 3AGPA 2IF0A 2V7QA 4KAXA 4RJLA 3QVVA 2F7SA 1G4AE 2EYUA 1XNJA 3BE4A 4TMTA 1KI7A 3SN6A 4YONB 1UKZA 2JCSA 1SP4A 4OQLA 4GOKA 4NE2A 2VF7A 1M7GA 2VEDA 4K81B 4FN5A 4LJYA 1E2NA 4MUAA 3K9LA 1G8GA 4BLRA 2PL3A 1MO5A 4FMDF 4DDVA 4H9GA 3CPJB 1GL6A 3NVAA 2O8EB 1ETUA 1MR3F 1KK2A 1ZAKA 2G77B 4CRWB 4DB2A 3F5FA 4TYWA 2XXAB 4Q00A 3TK1A 3LO5A 1U98A 2EWWA 3KZ1E 2Y8EA 3THYB 2H8KA 1IQPA 2BVNA 3R8FA 4B35A 2QTFA 3LW7A 2ZROA 3U7EB 4C0QC 2MSCB 3JVVA 4KV9A 1HBWA 4LPSA 3CNLA 4W9MC 4HDOB 1K5GA 3Q9LA 3EASA 4TMWA 3QG1A 1XJQA 4ESVA 1NIJA 1GU4A 1SVMA 2GZDA 5CM8B 1OXVA 1V43A 1SGWA 2AKYA 3B78A 3E1SA 3ZYCA 4B47A 3WBKA 3I5CA 1W0KD 1Q1ZA 4R71A 5DI9A 5B2ZA 1W5TA 3TNUA 1U8ZA 4ARZB 5UKDA 2H57A 4M1WA 4IFEA 2FV8A 4B6FA 1D8TA 3TW8B 3Q5DA 3WBJA 4OJKA 4OQNA 3QXCA 1Z83A 2JLYA 2KSQA 2IUTA 5B58C 2GEUA 2V3CC 2AXPA 3ADKA 3FB4A 3S1AA 4FPPA 4PSKA 1H8AA 4DLZA 4IRUB 1BO6A 3SEAA 1RRPA 4LBWA 2G3YA 3QXXA 3OE7D 2IYUA 3L36A 4DBLC 5HCIA 2QU8A 2G83A 4Z1MD 2ZUCA 1KGDA 2AD5A 4HATA 1TU3A 5BW8A 4GMDA 3KQGA 5AW0B 1P9NA 3THXB 2P0EA 5TVKA 4P4SA 3IPYA 1NG9A 1OFHA 1HQYE 1N3BA 4IFBA 1O87A 2OXRA 2FPLA 3GQBA 1G19A 4NYJQ 3FMFA 5CITA 2DB3A 2BDTA 3RABA 4URXR 2DFTA 2FNAA 2CCKA 1W2HA 1XX6A 1WB9A 1Z28A 1T8TA 2EW1A 1HJBA 1OSNA 2JJ8A 3T5GA 3K0CA 3KJEA 3EWAA 3CB4A 1R8QA 2ZSAA 3C4JA 1TADA 3I4LA 1NAFA 4US1R 5LPNA 3GLIE 2AK2A 1KHTA 121PA 1VG0B 3B13B 1RIFA 2GNOA 3PITA 1E98A 4HDQB 3FKSD 2ERYA 3TAUA 3FHCB 4C0BA 1EGAA 1G3RA 1T2KD 1Z63A 1UPTA 4TQ9A 1KKMA 3L35A 5EUQB 1FNNA 1MT0A 2OHFA 4R98A 4HZIA 3BGWA 2R32A 1XEWX 1AJEA 3QOFA 2G9NA 4C7OA 2X19A 4B3BA 1X3SA 2XSZA 2R2AA 2WVJA 3W9YA 2QM7A 3I73A 4C2TA 1AS3A 2X77A 3KKOA 3HPQA 3LW8A 1TUIA 1SVLA 3D8BA 3RRNA 4MRNA 1AZTA 2O5VA 1E2FA 3HR7A 1P72A 4YC7A 1Q1QA 2QAGB 2JLVA 4DLWA 4FD2A 4RKEA 4XSGA 2DHRA 3CNNA 1RRCA 3QF7A 3SQXA 1V5WA 3LD9A 4QL3A 3IILA 1CR2A 2PZFA 3TKLA 5C4MA 5DYGA 1ELOA 4Q1FA 4EKDA 3DKVA 1T3HA 4N1AA 2YINC 3IEUA 3QKTA 1E94E 4JLJA 4L5BA 4LX0A 3SYKA 4MGYR 1G21E 3FOZA 4G5RA 4IVQA 4PSAA 5SZKB 2BBSA 1T5IA 4Q4AB 3OF5A 4M1YA 4F4JA 3DHWC 3SR0A 2XNDA 2QGNA 1OE0A 1XZQA 5H68A 4BQSA 2FN4A 1KSHA 4JBYA 2IWHA 3NMDA 4F4CA 4G01B 4HB3A 4RZ3A 3NDBB 2EVWX 3OEED 1RC8A 1E99A 1EFCA 3PVSA 3EG5A 4UXIA 5J40A 2F1RA 4LY6A 5JSZA 5AW7B 1H88A 3ZVLA 2CL7X 4EJSC 1E0KA 1XPUA 3T61A 1FNMA 3PEUA 2GJ8A 4CVNA 4C0LA 1W36B 1VHLA 3SJAA 2PJZA 5K8IA 3K70C 5EUMA 2H1LA 1HTWA 1PZNA 2ZE5A 3P26A 3CF6R 2QA5A 3LQQA 3A37A 2QZ4A 1T0JB 4OJQA 4ZDIA 1IBRA 2BEKA 1OJLA 3OIVA 5ELXA 1W2GA 1NVVR 3U3JA 1WXQA 2P5SA 1Q0UA 3P20A 3VU9B 3U4QB 1W4RA 3FMOB 3H2YA 4OQMA 2Q7CA 4XJXA 3B1YA 5EE9A 2ZJOA 3GJ0A 3SWFA 2ODWA 1P61B 2ZRKA 1FQKA 1DG3A 2GEVA 3BOSA 1U2RA 2FE4A 1G1MA 1E1QA 4KFUA 4IHQA 1FQJA 4IOKA 1XBTA 3OEHD 4ZI2A 1ZM4A 4EIWA 1OXUA 2WJHA 2ASEA 4KODA 1Q1EA 1VYUA 3DVLA 2W27A 1OIVA 3GEEA 4A6PA 2A3RA 5AVSB 4XTCS 1JBKA 1KDOA 3CWQA 5DIFA 3L2OB 3O8RA 2GK6A 1ESNA 4NCJA 421PA 4B2PA 1NJFA 2RGCA 4I1UA 3M0AA 4MA4A 3BH6A 2DWQA 3FHOA 4EFLA 5CK4A 4L9SA 5E7IA 1ZW6A 4Q5IA 4ZI3A 1N6RA 4QHYA 4PZYA 1W1WA 3IIMA 1CKEA 4CYMA 1WRBA 4WXPA 4M2LA 3MFYA 2J45A 2LKDA 3H0KA 3GLFE 1A1VA 4IEIA 2IK8A 2Z4SA 2J59A 3WHLA 3X1XA 1T8UA 1QHSA 3LBIA 3W6PA 4B44A 3PFIA 2ZXEB 3GEHA 4BLPA 1IXZA 3ETLA 4OI1A 3M0EA 4ZKIA 1A4RA 1KYIA 1XF9A 5D3QA 4JBWA 4JKIA 3H4MA 4HAYA 3TBKA 1GZSA 1P6XA 5A4JA 2EWVA 2ZS8A 4EQ6A 3VQTA 5KOYA 1KJWA 4FCVA 1E2PA 1Y3AA 2UZ3A 3V00A 4PHFA 2I3BA 3Q7PA 3EPJA 4LJ4A 4JMPA 4ERNA 5DN6D 3QF4B 8OHMA 5LD2C 1J8YF 1R2QA 3HYTA 2BCGY 2NO9A 4F92B 3QKRA 2OAQ1 3WYGA 4OK5A 1PVOA 3ASYA 2YNYA 2ZI4A 1XMIA 2Q21A 3AKDA 1H89A 3B7GA 3DZ8A 4I99A 3A1WA 1T4GA 2F3RA 2ORVA 5KNDA 2V8OA 1KK3A 1TF5A 1UDWA 2CNWA 2G0NA 2P6UA 4V0OA 1JXOA 2OZEA 5E7MA 5FTMA 5F9HA 1XCPA 4YMWA 3KXKA 2AN9A 4RVCA 1TL7C 3KTAA 3ECCA 1SVIA 2ZRNA 4PANA 1GTWA 1VYVA 3LX8A 4M9QA 1B23P 2ZVPX 2TMKA 1AQYA 5AVYB 1OB2A 4PHGA 1KY2A 1T0HB 4LK2A 5FOUA 2YOFA 4HLCA 1N2CE 1EFHA 1VKJA 4MKGA 2X2EA 1F2TA 1KK0A 3I5XA 3L37A 1XTSA 3OFNA 2OCPA 1P9RA 4DVGA 3B1VA 4URYR 3LLMA 5JHGB 3QI2A 5GJBA 3M4YA 1IO4A 1NKSA 5EJEA 3GJ7A 4L15A 1U9IC 2XITA 3L8YA 3AVXA 4CW7A 521PA 4BIUA 3VR1A 4BZXA 4DCVA 1YE8A 4BRUA 1P62B 3MWKA 1KZGB 1UEIA 2C78A 4C4PA 4DLYA 3HE5A 3NC1C 4FW9A 3AEZA 3U2QA 2WTUA 3ZQ6A 1KMHB 2LKCA 2CK3A 2AFIE 4Q01A 4US2R 2CE2X 4Q4HA 3ZRWA 3THWA 1TAGA 1YZUA 3DEFA 2QRNA 1Q1BA 2J3EA 3P4XA 1E2DA 4E09A 4AWXA 1MV5A 2J41A 4NYJR 3SC3A 2J0UB 5AW1B 4HAUA 1ZMXA 5L3VA 2OG2A 4RZXA 4X8LA 4CT5A 1XTRA 1SZPA 2J5XA 3VR6A 1ZIPA 2G88A 3B8HA 5HKKA 1ZINA 3A4MA 4B75A 3K0FA 2C2HA 3ZRVA 3A58B 5KDOA 4LDJA 3TE6A 4BE7B 2B6HA 3AF1A 3RS4A 4C46A 5C2JB 3ZCCA 2YWFA 1Q3TA 5EE5B 3F8TA 2ZR7A 2OAP1 1E9RA 1F2UB 1OXTA 4IXMA 5EXXA 1XD2B 1QDEA 4NCNA 4NDZA 2WWIA 5AW4B 4JVMA 4RD4A 4YXWA 1NBMD 1IJFA 4P32A 2J87A 1OIWA 2HEIA 5J4KA 3O8DA 2KJQA 1VPLA 1GP2A 1N5LA 2FFBA 3FKQA 3AVWA 1JB1A 4EFNA 4IDQA 4PQYA 5DI3B 2WJIA 1LFDB 2WPRA 3RSOA 2GEDA 4X8MA 2ZYTX 2QEQA 2ZE6A 2QSYA 3CR8A 3FFBA 2RMKA 5FPYA 1ZYUA 4DLUA 1DAKA 1S1MA 3QE0A 4Q03A 5J4LA 1OPXA 1K8RA 3L0SA 4QNMA 5IRCD 3T34A 1E9FA 5DNYB 1CR4A 2DWOA 4BLTA 5M04A 5EP2A 4AQRD 1J90A 2ZITA 2PT7A 1E4VA 1UBFA 4TYPA 4UQOA 4F91B 4N0DA 1S0UA 4PQFA 3TGPA 4Z51A 3D6TB 2CE7A 3BRWD 1XMVA 2ZRLA 5L3SB 2H92A 3L82B 1W4CA 3B6EA 3PENA 4G5QA 1FOSF 1OFIA 3CWZA 3TR5A 2L0XA 2QMHA 5LBIA 1D2NA 3PR1A 2IUSA 3LDAA 5EXPA 5KNBA 2K5UA 5J4VA 2WSSD 3T5DA 4DLSA 1NF3A 3VMYA 2IXFA 2HLDD 2QAGC 3WMEA 2PEYA 1E2MA 4E22A 3CIOA 3CRQA 1DVRA 4NL4H 1MRSA 5BN5A 3IUYA 1KDTA 1NSFA 4Q02A 1ODFA 1W4BA 1EFRA 2H16A 3W5IA 4Q4LA 3M0DA 4LYFA 4QPKA 3V4QA 1SXJE 3AVTA 1COWD 2VIIA 4BFZA 3KKPA 1JR3D 2ZTSA 3CONA 4OHZA 4ZKEA 2A5GA 1RRFA 2WAYA 2V6JA 1VCOA 4PX9A 3PUZA 3T15A 1ZUNB 2BWJA 2HYIC 3TQFA 4DRZA 2KE5A 1TNDA 1TQDA 1VECA 2DY1A 1FX0A 2W2XA 3DL0A 1AGRA 4DT1B 4EPTA 1LS1A 1US8B 2D2FA 2A2ZA 3I5YA 5FI0B 2J7PA 1SXJC 4LHWA 2WKRA 2LWIA 2W2VA 4ILEA 1T3LA 2O8DB 3T1OA 1A2BA 3R9XA 2QM8A 2YVUA 3AUYA 3QBVA 4DB4A 1J7KA 3AVPA 3RDPA 1N6LA 3RVBA 2LFSA 1G5RA 1ZU5A 2AHOA 2QP9X 3IKJA 3UMSA 5IF9A 1IY2A 4AY2A 1FOSE 3GLGB 2AX4A 1W36C 2OFWA 3OAAD 3U7GA 3KB1A 1G291 3QVUA 2WJJA 2IS4A 5CMZA 2NG1A 5DSZA 3A1VA 5IDVA 1CSBA 5IDJA 3LA6A 1R5BA 1Z2CA 3CF0A 3KJHA 4O2LA 1G7CA 3R7WB 1YZGA 1W4AA 3TUIC 5IT5A 2CXXA 3BFXA 1AKEA 2D7DA 4B3XA 2J0VA 3U7FB 2FSGA 2OCBA 3SYLA 4BFTA 2FSHA 3TSOA 4OK6A 4AKEA 4QFMA 4JSTA 4PO1A 4G1UC 2GZHA 5E3HA 4I6MC 1E1RA 3A0RA 3CPHA 4CEIB 2GA8A 2YNMA 3ZIAA 5TXGA 2YV5A 5DHAA 3EIQA 3QUSA 2DBYA 4KP4A 1P3JA 3GCGA 4Q19A 5FOVA 4TZ0A 4GPTA 2JIZD 4NTZA 2RHDA 4C0KA 4JL5A 2QQEA 4MTXA 3CZPA 2E43A 1TEXA 4MKIA 1X8JA 2PBRA 2QTVB 2F43A 3W34A 1N5KA 5TMPA 4ASUD
chains in the Genus database with same CATH superfamily
4PYKA 4G0MA 1Z6GA 3L70E 2AOTB 4QBIA 4X8HA 3RT1A 4IINA 5IYZF 3E7DA 2AOVA 1RPAA 3S40A 4IL5A 3C7DB 3OFNG 1JDTA 3SDLA 3QUCA 1FBTA 3G80A 2O2GA 1KB9F 3UICA 3AW8A 4AY4A 4Y9UA 2QMZA 2F67A 2OTLV 5KQMA 4S24A 4HGYA 1BVUA 1TQ8A 2XGMA 3ABKC 1IY0A 5TARA 3UMRA 2G1UA 5CT5A 3AECC 3I42A 1E3IA 5HQJA 3ZY2A 3IAOA 1A71A 1RHZB 4YPVA 1SCJA 5EKDA 2ID4A 1MABA 3OQIA 2WM9B 4TS3A 2IA5A 4YMUA 2GM5A 3W77A 3EXAA 1E79D 1N1MA 4R2IA 3V4RA 1L5GB 4BFCA 1KOJA 3TNUB 4W6QA 4HQNA 4V1CA 1P1CA 1NRWA 5BQ5A 2XA1A 1G16A 4J94A 3QXSA 2BI8A 4PAOA 1WVIA 3WQSB 4MUYA 1GUFA 2QP4A 1QLJA 3DSQA 3B3AA 2I6SA 2Q1XA 1G21A 3LBFA 4Y28J 2DYRC 4PA4A 5D1HA 2JI9A 3NATA 1XNQO 3CYOA 4HB1A 3JQCA 3B8MA 4TMKA 3UGQA 2Z8YM 3KYIB 4HFNA 4U7DA 5B7QA 1K9SA 2I2DA 1YVEI 3TZCA 5E6SA 4QJ4A 1GA6A 4JLDA 2HH9A 5JEEA 3WE7A 2JFQA 4U3JB 4XCVA 1R9JA 2M9MA 4Q34A 1UFRA 4N5NA 4D2IA 4KQ6A 1IPEA 2C2YA 1SFCD 4MUGA 1WWKA 1VCMA 4KAAA 3FPEA 3H1JG 1S2DA 2FU5C 4OK3A 2P7JA 1GU5A 4MGZR 1ONPA 2P1JA 5EMKA 3AFMA 4JI8O 3PRJA 1SZXA 1TTQB 3CCUV 1X1SA 4NU6A 4B0OA 4PFQA 3U9LA 4CKWA 1OZFA 2Y93A 3GRKA 4INAA 5AVJA 2HU5A 2V7TA 3GF4A 2XBMA 4Q4DA 4U3FD 2BRUC 2XYVA 1FTYA 1BVYF 3IKTA 3TOCA 5F73A 2IDBA 4JAUA 4I8DA 2VYVD 3LBYA 3OQ6A 3ZW8A 5IXSA 3B70A 3U44A 3DF7A 1GFWA 3I9MA 2X42A 4JB3A 4CV1A 3DKPA 3KRTA 4ASUG 3VR0A 3GRAA 1DB3A 2H88C 1NWHA 4O5OA 2DVMA 2DEUA 4NENA 2O52A 4LJ6A 3WLNA 1P7BA 3C3DA 4FI3F 1E1MA 5JCPA 2MOKA 2AN5A 1DBSA 1JG1A 3HBMA 2NTNA 1E1NA 2NU7B 1XKQA 3AETA 1MO3A 4ZXFA 2OECA 1V8DA 2QVZX 3HEMA 4RVSA 5L3GA 3TQCA 3H11A 1IM8A 5FI5A 3AG2C 1QDLB 2Q5IA 1Q92A 3C3PA 4TYMA 5CVUA 1SA0B 2BR3A 2C20A 2GHIA 2AV6A 1NT4A 4KPEC 1L0LD 4D92A 5JSYA 2NMVA 3K06A 1GKUB 2AZ2A 4LQCA 1C3JA 5K0GA 5E9WA 4JS0A 1A7JA 1GN4A 3IXQA 5CX1B 1YR1A 3OWOA 3R4YA 3RS9A 3NFQA 3LPCA 5JNWA 3KPYA 1JIXA 2JGLA 4OVKA 1VQ8P 1F2TB 3ZJTA 3GHGB 3LW5H 1N2SA 2CDBA 5LYJA 3DZCA 2VJKA 3TLAA 3HSYA 3E70C 4NPHA 4RWZA 4I2NA 5BVGA 2X2PA 4OQFA 1ZUHA 4O4JA 2B94A 2GZSA 2WT9A 3WGNA 1ZK1A 4PYOA 1JHQA 1U0OC 4X90A 4MN4C 3LQRA 4PN3A 3CKLA 4J9YB 5NLLA 2XODA 3ND8A 2AHZA 2ZBUA 1CJBA 2X23A 1LNSA 3QNMA 4ILKA 2P1DA 2FOIA 2D8AA 4BV9A 1CRWG 2BHLA 2BCCD 4ARSA 3EPKA 2HW8A 2R8EA 3FWYA 1F38A 1UBCA 4KI7A 3KOUA 2WSBA 3EJ6A 1LJ2A 2C4HA 3MTBA 2F6RA 2E75C 3WFZA 1JSLA 2V6FA 4Y99C 4M6WA 4WINA 3CMCO 2D2IA 1XDBA 2GUWA 3ULKA 2VZ0A 4G09A 2O8FA 1IFJA 2O01N 2O1EA 3HUTA 4YFVA 4AQ7A 5DGCA 2PX0A 2HBQA 3OMLA 4G9BA 4LZAA 4MYTA 3E8GA 2SECE 3AF4A 1KECA 5BSRA 2W42A 2YKOA 2M1XA 3GPDG 1NPYA 3M49A 1GGFA 2YI9A 3GDWA 3PQEA 2C9BA 5A9RA 2YL2A 2VLBA 1BKDR 3LDDA 1H9BA 4KQIA 4URWR 4B09A 2VQDA 3DE2X 4QBGB 4ZK2A 2H11A 3ZZMA 2SHKA 2PWBA 3H0CA 4BNDB 2YMPA 4NMWA 1BZKA 4CIBA 2FRXA 2B1IA 5F5XA 1RBYA 1AT1A 2F3PA 2NN3C 4BO6A 4XBFA 3WZ2A 4ZI7A 2VP3A 2VK4A 4TQAA 4MIYA 4HS9A 4ZDKA 3K9WA 1GDHA 4JQ0D 1XU9A 3NPMA 4L4SA 3C7TA 1I5RA 2P4VA 3NO4A 4NZ9A 4NYIR 4RZHA 2YNMD 1U7WA 1Z5UA 4I2VA 2X6TA 2XZRA 4ZIBA 4X41A 1NTMG 4FIZA 5HHTA 2VDOB 3RUCA 1GTL1 2VFAA 2XF8A 1TYBE 2WLKA 5L7WA 4QBKA 1WE2A 3UC9A 2ABWA 1Q7TA 3DDZX 1MZ9A 5I6DA 1KAOA 2G36A 3B9PA 2H4YA 3W06A 2O06A 1Q22A 4YAGA 2A0FA 4F5EA 3M9XA 3FLMA 1Q5OA 3ICXA 4DJEC 1VQ5P 4NZMA 2EW8A 1U0NA 4D5EA 2YO3A 1M7LA 4YRBA 2KB0A 5TJHA 1YE5A 5FUWA 3KXDA 5G53C 1VQNV 3IGAC 1RAFA 3HO1A 2ZCEA 4FMCF 4EYOA 1QG6A 4QTUB 3RBVA 1VMEA 3OJFA 1KXJA 4JI5B 4QRHA 1J5XA 1R4MA 3LCVB 4OQZA 2OXFA 4LZOA 2ZWIA 2VDWB 3AY0A 2IVFA 1Y1RA 2EU8A 3PJEA 5JYCA 4PRLA 3D43A 5IJXA 4B7KA 5JW6A 4YRCA 4B6GA 1JYSA 1NBME 3PPIA 3ON5A 2EFGA 3NC0C 3ABUA 4JHLA 4MQ6A 3O7MA 2R87A 4U6NA 5JV5A 2PS1A 2FSFA 3L8ZA 4G07A 1XDSA 1HXHA 1N6PA 2NV2B 3WIEA 1CYEA 1VMDA 1XEXA 2DWDC 2CTWA 1CUSA 2PX8A 3DBOB 2FRDA 5A6VA 3LT2A 1OHHD 2ZYAA 4IM7A 2ODTX 3ZJ4A 1NI4A 5B66H 3V1MA 4EO7A 1CUAA 2AZMA 3EHDA 4W99A 2J67A 5JD6A 3RRJA 3UKOA 2P4QA 2B7BA 3LWDA 9GPBA 2JA2A 4HWKA 3WAJA 3OT1B 3WK4A 4B84A 5HKBA 3FMVA 4YJ2B 1SKQA 2ZDIA 3OESA 1XA4A 3BXPA 1I13A 4G4SO 4C7JA 4HXFB 3G7SA 3LT5A 2R8OA 5B1BC 2B37A 5EWMB 4ZQFA 2JCGA 2FJ0A 3D7MA 1NU1E 2QM3A 5TPZA 3DBRB 1CUUA 1RHJA 3MMXA 5GOZA 4F4UA 3ZVMA 3NANA 2AR9A 4QUGA 3GZTB 4HG2A 5D3MA 3N4XA 4DG8A 3LFUA 5CG1A 1R5OA 4QX6A 1ZWIC 4R2LA 1UBEA 3IT1A 2XUKA 2C04A 1WSDA 4ZC1A 4ZVPA 2OXCA 4WECA 2I7XA 4PNEA 4WOBA 4GDFA 1SY7A 1YBMA 1NVMB 3I6MA 1L7BA 5TEWA 2IBZD 4BX2A 3BB4A 2GCEA 1IHYA 2V4HA 3CRVA 10MHA 3SJBA 5IXJA 4OKIA 2K88A 1NJGA 1SQXH 4TLFA 3PGMA 3A6JA 3CH4B 4LUCA 1EU1A 1FZCA 5EWLA 4Z7OB 4G26A 4BO1A 2VYFA 2WYIA 3RVPA 3H2KA 2QQGA 5JAMA 3VN0A 3MMPA 4P5DA 1IRIA 4KXWA 2WOOA 5M5BA 5ED4A 1FSSA 2RK3A 4TXNA 4H18A 1Z82A 4BMOB 2EIJB 4NBNA 3Q5EA 4J90A 1WW3A 3H1IE 2LRHA 3DDHA 3IDQA 1QG0A 2H4HA 2C2AA 2OHVA 5TIIA 2D5LA 3D71A 3FJYA 2EBUA 5JY6A 1XHFA 2I2CA 4AP5A 1J9EA 1KMIY 2RGYA 2XWSA 3R23A 2PXHA 2AUNA 3G88A 3D8CA 1RWBA 4RHYA 1YR7A 3RK2B 1ITZA 1GZ6A 2R5NA 3ELYA 4FSDA 2V6GA 1M6NA 4Q1EA 2Y3IA 5HRCA 1U9YA 4UNRA 2WNIA 2G7ZA 1K0UA 1UBTS 2WF5A 3H1KG 5AM3A 1PE0A 4RK1A 4WZ6A 2NPSC 4LNUB 4DMHA 2AW5A 3WGLA 2H94A 1UOEA 2KG7A 2HMSA 3MTDA 2GA1A 2J33A 1TT5B 4MDYA 1Z4OA 4QWMA 5B1OA 6LDHA 2WFLB 4D4IA 2X0JA 3T4ZA 1YRAA 2EJRA 3FYCA 1VIVA 3GNTA 1Z8HA 4LMBA 3PQDA 3JAWB 3IIJA 1Y5RA 3AX6A 2H1HA 2ID8A 3VTZA 3L9DA 1VBKA 1R5JA 3CWBE 3W7XA 1Q7CA 4IH1A 1CZHA 1P7YA 4BEJA 1Z68A 4MYUA 2YIBA 3FDXA 1RDFA 1UL1X 1JEYA 3ZDRA 3DHYA 1GPH1 3DZGA 3P9YA 1ZEMA 1IWPB 5HQTA 3U60B 4F6CA 3O4IA 4D6PA 2A7XA 1L7MA 2C88A 4FS8A 2ACEA 1W85B 1GM5A 1KD1W 1QVAA 4RK6A 1NBMA 1H6AA 5E79H 1EGHA 4WKPA 1TE2A 3FTFA 1DAIA 4G5HA 3AESB 5U9CA 3SQOA 4IGFA 4BO0A 4OYRA 1J0BA 2MYPA 2EL7A 2PGGA 1ZCAA 2QYOA 3AUSA 5BMOA 4EUSA 4NV0A 2JGNA 3I56V 4XA4A 4UXNA 721PA 3J7TA 1D7OA 1ONBA 2QY6A 1UOQA 4A5SA 1GK4A 1G18A 1VPEA 2PO5A 5LXTA 3HCDA 2JC3A 2XXBA 3KQYA 3UMBA 1SKYE 4UM9D 2VTBA 2F1HA 1V5EA 2C97A 3ECSA 2RI6A 4DV3O 4N8EA 2ZRDA 3OLWA 5L3SA 4ZO9A 2LW7A 3FFTA 3R6TA 1BWQA 2Q0SA 1QH1B 1QHNA 1NTKD 2W4IA 1W2EA 4HFJA 4RPLA 3IIEA 5D1NA 5C35A 4YI5A 2M6YA 1OREA 1SQPH 1E6EA 4G0NA 4FZVA 3EEQA 4Y30A 1ZUNA 3AEUA 2IH1C 3SBDA 4XI9A 1X7HA 3LSSA 3DMDA 1Y8QB 1ZMBA 1AN9A 1A7UA 2B30A 1YQXA 2BEZF 3NZEA 1KYZA 1TVEA 3A1TA 1REQB 5HFJA 1FP4B 2IIQA 3FE2A 3R7WA 2PGAA 1W44A 3VBEA 2G1JA 4A5UB 4C0XA 2F8MA 4O0LA 2B99A 1MA0A 5BURA 4E12A 1T2NA 4HNQA 1JALA 5TISH 3AR6A 1RZRD 1DRWA 3ANMA 2J0SA 3O73A 3SPJA 4PZ0A 4XOIA 3TGWA 4LEIA 1TK2A 5IT9N 2MR6A 5A04A 3I04M 1LQUA 2X1MA 5IWCA 5B1EA 4WZAE 2GZMA 2GFQA 1U0RA 5FUYA 1EJ6A 4O2BB 2ODBA 1GDTA 4FGJA 4M55A 1CHDA 2CLHB 4IJKA 1UMCB 3SN6A 1XU7A 3PXDA 1UC4B 4NE2A 3L8EA 3DMYA 4YWHA 3NHMA 5DTJA 4H9GA 3ZLTA 3MWEA 3SX4A 3WL8A 4PGGA 4A26A 1T36B 1BGYG 4IDFA 1XDZA 3U7EB 4HDOB 2GHQA 3OD5A 4XRRA 3T3HA 4ESVA 2FI1A 5CM8B 2B4YA 4NI5A 2ZFUA 2FVXA 5B2ZA 2AOUB 2H57A 5H6RA 4IFEA 5FA8A 2FV8A 2JD0A 3IUPA 3Q5DA 3WBJA 4U0KA 3MN1A 5JCJD 2EZUA 5KAIH 3ZUGA 1X9HA 4RGVA 2J48A 5E4JA 1OV9A 5AW6A 1VQ1A 2VDPB 4GMDA 2CFIA 4S1OA 1MDBA 4QYIA 5ALHA 2DHCA 2GRUA 3I0ZA 1XX6A 1QO7A 2JJ8A 1ORHA 1KJ8A 1R8QA 5U4XA 2PMBA 2LNDA 4D44A 2AK2A 3BWXA 2A1UA 3Q1KA 4C0BA 1KKMA 3ASOB 1HI9A 1ZMTA 1AUXA 2X77A 4G4GA 3OPVA 3D8BA 3AF5A 3FOBA 3HR7A 3PJFA 3T4XA 1Q1QA 4ZICA 1UAYA 4XSGA 1XA3A 4LRQA 4UHCA 4RKQA 1L4AB 4FYIA 2PA3A 1M1JB 3AY7A 2GSWA 3OO1A 3SYKA 4R5HA 3NOVA 1TUBB 1YQEA 5FADA 1MSWD 1YF2A 1XZQA 1YKFA 3KWLA 4RMNA 1BE0A 2IWHA 2EVWX 2ODPA 2HVJC 1KE1A 4H44C 2PYLA 3A9WA 1JJAA 1FNMA 2XMGA 1S3IA 1VHLA 5B66Z 2Y0IA 2Z6AA 1HTWA 1QOZA 2PU7A 3R4CA 3CF6R 3OIVA 5ELXA 1EDBA 3FMOB 1XCBA 2I55A 2X3UA 3F5DA 1RYEA 1PJCA 2QLBA 1FQKA 4BN5A 2RJ3A 5IANA 2H08A 2AS0A 4BNLA 2UZ1B 3L7IA 4OP2A 3GEEA 3IQGX 3PFKA 5F12A 4XTCS 1P5RA 3JPWA 1YMUA 3FY4A 5I7FA 3IVXA 1WRBA 4XYBA 4CKCB 3CLSD 2GZ3A 1W94A 2J59A 1RU3A 1QIHA 4E2XA 2O2YA 4AN0A 1C8KA 1V2GA 1TI7A 3V6IA 5JY1A 3BKXA 1GZSA 3DC7A 1Z25A 4EQ6A 1ECJA 3CLKA 1T5TA 1MMFB 1TCAA 1ZH6A 1JY2N 3B7GA 3EMKA 3M1LA 3AL3A 3LP8A 1QPZA 3D54D 3R3HA 3A1NA 4OX9B 1VYVA 4M9QA 1SPBS 3OI7A 4O29A 1HW7A 1BCCJ 4IUCS 2HHAA 1BE3E 1K0FA 1MVLA 1U9ZA 4NH4A 4BZXA 1SO8A 1MP0A 3NVDA 3G68A 2WTUA 2AFIE 2I6GA 3V4PB 4UBNA 2J3EA 2GERA 1MV5A 2J0UB 4F72A 2BL4A 1HG1A 1QYDA 2SKEA 2ZTHA 4KQ9A 1QRDA 4HZGA 2QIOA 5WRFA 2XYGA 4FLVA 4CLEA 2CHFA 3C90A 1Z74A 3UJ8A 3SLGA 2O3RA 4LG1A 4KKXB 1PIWA 4D8XA 1OIWA 3AI1A 4FFLA 5DI3B 2E4VA 1Q2UA 3BDVA 1PV3A 4J03A 3W4KA 4KIGA 4QNMA 3UXYA 2R25B 1S72V 2PX4A 3WKDA 2PH5A 4PQFA 2R1VB 1EDEA 4HNUA 3EZLA 2H7YA 3T3DA 2CFTA 3CWZA 3TR5A 4ZO7A 3L71G 2PVCA 2IUSA 1L0NE 3K71B 3JQ6A 1HO3A 4EA7A 4LWSA 1UBLS 3H9EO 2PANA 4NL4H 2XNXA 1NSFA 4Z9AA 4H16A 3GUZA 2VIIA 3EGXB 4BWAA 1RRFA 4PX9A 1E20A 2UVDA 3F5MA 3FNGA 3HA5A 1Y33E 1LSOA 3NAMA 3P71T 3K0DA 3AUYA 2A57A 4WZAA 3MQ2A 3X43A 3O65A 1RRMA 3IDAA 2IJGX 3A6ZA 3FAVB 3OD1A 3KB1A 1RABA 4F3YA 5CMZA 4QFBA 2QDXA 3EIFA 1LT1A 4QGPA 5IT5A 3KT3A 1KYOI 2R5FA 2J0VA 2E5FA 3G49A 3VA7A 5YASA 2PZ8A 4NB5A 3NWEA 3JQBC 2FRVA 1VOTA 3ND7A 3H16A 3IAM1 1NASA 2QM4A 2O20A 2CLLB 2D0PB 2FMKA 2X76A 2WOJA 4N49A 1QIJA 2DWPA 3WRYA 2DBQA 1AS2A 3IOEA 1U0BB 1XHLA 3NT2A 4R1QA 3VFDA 1RZ3A 2PGNA 3KUCA 3CVVA 1XK7A 4G97A 4ZA2A 4ZDJA 3BL8A 3AH8A 3EA4A 5THXA 3DEJA 1NH4A 4TS9A 4LAFA 2JF0A 3MELA 3RRMA 2RK6A 3SG0A 1NNLA 1FRQA 3KQHA 3C15C 3B6ZA 2XNJA 3DWIA 4U9HS 5EY5B 1I32A 1P7PA 3VH3A 4MI3A 5H9WA 3A27A 1JQEA 3UOGA 3D8TA 2I67A 3VPGA 5KHLB 2Q1YA 2QN8A 3GXBA 2HQBA 3D7KA 3KXLA 2ZXWB 2FFRA 3HVHA 1AJEA 3HU1A 5E79Z 1C81A 3LUBA 4FDTA 3IQFA 2N9UA 1NJ2A 5CYGA 3GLSA 3E89A 1VP3A 3KWMA 4CH3A 3S8MA 5JVDB 1CEEA 3WIOA 3AKYA 4P4SB 1X2EA 1C7JA 5BXZA 3GQBB 4W7YA 4GOEA 1WVMA 1R6UA 1VF5C 4JKOA 4EIJA 1E5DA 1UBNA 2Q62A 3R0JA 4GF5A 2DLDA 2F4VB 2EHJA 3IAUA 2DXIA 2J3KA 3CX6A 4KEAA 1R50A 3OPQA 1W29A 4LF7O 2PRSA 2AOXA 2G9QA 3LVRE 4L2IB 4NZPA 2IF2A 5LHGA 3DFIA 4Z4CA 3I30X 4YAOA 4EG7A 2V7VA 3PX2A 5HGXA 2QQ0A 3MGCA 4G1VA 3ENQA 2YXNA 2YXYA 1YI2V 4U02A 1I2ZA 2Y6VA 4M22A 3I52A 2HXYA 1SZDA 4AJKA 3NHFA 4K9KA 2E74B 4DEYA 1N36O 4JFRA 3KQTA 4LF5B 3PYMA 5BQXA 3JASA 2VC2B 5FWDA 4HNAB 3RYHB 1KXZA 4ZJPA 5KYWA 3LZDA 4ND4A 4UUAA 2DTDA 4MUXA 3K9FC 1PZMA 5BVHB 1X2BA 5IVHA 2NQ2C 5CIYA 3RE1A 1WXFA 3OMAB 1XAGA 2QTZA 2QZPA 5I5GA 3SOPA 4C2BA 1AZLA 2VHZA 3NRJA 3L8GA 1TM1E 2VSYA 2WW8A 4WKOA 1ZOSA 1GWNA 5IC4A 5KYYB 1ZD1A 1WQ1R 1USDA 2LGQA 4RL6A 5GV7A 1Z12A 2EFDB 1JDUA 4O1HA 5TISZ 1QKIA 2ZJ3A 3MWLA 1P75A 3QQPA 2AFIA 2CT8A 2C7GA 1HEIA 2XOKA 1LTTC 3HBJA 2CNNA 1QHGA 1L5HB 5I8WA 1IFMA 2CVFA 4UVAA 4B81A 5LZ7A 2P91A 2NT4A 3SR4A 3HQ4O 1Q7YQ 3VC7A 4E2YA 2PX2A 2V7QG 1NN3A 3VNQA 4NYIQ 3F5WC 1JX6A 4PCLA 4ZQIA 4CUJA 2BUAA 3HDTA 2IYZA 4OEHA 4K3UA 3LCJA 5DASA 5APQA 4RV9A 4RHFA 3WI7A 1ECGA 4D82A 3U4HA 1IZYA 1DL5A 2XLCA 2CEAA 5JXHA 4F6EA 3P97A 2DJIA 4ESOA 4KCGA 1F9AA 4JVNA 3X1DA 4MS4B 1F6BA 4ZGWA 4OM7A 5B7PA 5JZMA 5KAIZ 3GIDA 3N2NA 2VZ9A 3WG7B 2O0LA 5BRNA 3QNWA 1SU7A 1RM0A 2OHIA 1UIXA 1CF9A 1N0WA 1ZM9A 3K0CC 1EQ2A 3AJ8A 1AQUA 1A9XA 1M1KW 1YZBA 1K1EA 1I4EB 3TIFA 4MQLA 1DJPA 4LYYA 2XUOA 4AJ4A 4MV0A 1DKPA 1N2HA 1X19A 3UK7A 1RJEA 2BMJA 5EQTA 3CCQP 2W6OA 3AEEC 3LM8A 1PP9H 4K7JA 3R9IA 1BSNA 3I9V1 3AE3C 4WLUA 4RA9A 3NASA 3DC5A 1FX0B 3LY9A 5BUSA 2C4VA 3A0BZ 3GJQA 3K1ZA 4QQKA 1WVGA 1IN5A 1TOAA 4N7BA 4OHXA 2VWPA 1A5ZA 3FD8A 2WUWE 5KNBD 5E1DA 2JLCA 1ICEA 4LI0A 4D9MA 5AXCA 3F6BX 1JT2A 1NYHA 2HLHA 4FHGA 3IHLA 3A0RB 5F21A 2QF7A 1YMQA 4KV7A 3CI9A 4MR7A 3RSCA 2CXQA 3TW4A 4BZWA 4TV8A 1QL2A 3AXSA 1YB4A 1YDFA 4WCEV 1BGVA 1ZPDA 3A2NA 2A33A 2GCOB 4AY5A 3PK0A 1YB7A 2ALJA 5H9CA 4H0NA 1YB1A 1BXZA 3H1TA 3SYNA 4DCCA 3TZLA 2WIBA 2BJWA 3MWGA 3PJGA 2WSMA 4FX5A 4KR2A 1NVPD 5DTIA 4B6JA 3RROA 5KOIA 1D1SA 1UBHS 3DBLB 4G8BA 4J9VA 4C22A 5JH7A 3FWNA 1F2UA 3W5HA 1LT9C 2GKGA 4LOHA 1ST3A 2AYXA 3RN4A 5FEMA 2CLCX 2J9FB 1ZL2A 5F77A 4YIOA 3CTPA 4OI0A 3VXKA 2C2XA 4PHZA 1WPQA 4MUKA 2GKSA 4TL7A 1MOPA 1ZL8B 4IVPA 4IOLA 1EWVA 2HBYA 4A10A 1SXIA 4R50A 3PEFA 4RZ2A 4XARA 2GM4A 5IE9A 2W0SA 5E9AA 1EK1A 4PYJA 1UZAA 4F1KA 3QKSB 2XMQA 1L3CA 4BRYA 4DWJA 3OCYA 3NPAA 3JWIA 1WZ2A 1J2RA 5EMHA 1NQOA 2GVDC 4F4HA 3UCFA 4V0SA 1WW8A 1N7LA 4G5GA 4N12A 2PNFA 3ZQJA 4XYEA 4ZHQF 4NQRA 4J6FA 3K8ZA 1J2JA 4TKVB 3TZQA 4MARA 4RORA 4R3WA 5JCZA 1IPFA 3T5CA 5B3SC 5AT1A 2QT9A 4CKZA 4R9UC 3K58A 3HC7A 3BT7A 4QTXA 4K9SA 2A5LA 4IIXA 1S0VA 3ZK7A 1YDMA 4C7KA 5DULA 3ROTA 4FNMA 1PLLA 3ZWWA 4X92A 3W1WA 2BHTA 2DHQA 1B41A 3TNFA 4II7A 1Z0UA 4LBZA 4FZ0A 4REQA 4S2UA 3MCZA 1XAJA 1YGYA 4WFGA 4A8TA 3JD3A 5A0VA 3HBNA 3W1VA 4UEWA 4PJ0E 2HJRA 2MWMA 3C6XA 3RASA 2FZLA 2PX3A 1XVTA 3KT0A 2EATA 1YI8A 2XUJA 1W47A 2Z9CA 1AXEA 1EJ2A 4QDJA 5CB6A 3NYRA 1D5WA 4FGSA 1EBOA 4CF7A 4KMSA 5JYEA 2DETA 3WNDA 1GM7A 2NO6A 1XDCA 3PTLA 2OEPA 2JHFA 3SHTA 3BUSA 3BH0A 4H37A 2VQFB 1MJGM 1RYHA 1K92A 1H0TB 5LDGA 2VWKA 3Q72A 5HP4A 2V1DA 1LU9A 3WQRA 5EJ5A 3UH0A 1DQPA 1LA2A 3RRXA 3DZKA 2H7XA 4MPDA 5BWNA 4HMPA 2OGZA 1TW3A 2VP9A 2C94A 1ZK0A 2HFKA 3BB3A 2IYAA 3JY6A 1RJ9A 1SIWA 3DGEA 2M0BA 2FETA 2GD0A 5CFZA 1K06A 1NLYA 3HUDA 4UTVA 3SZLA 1I5YA 4DDHA 4LJAA 1M2EA 1JLLB 1XROA 1SG6A 5ALUA 3RW0A 5EFWB 3T97A 4OSEA 4H27A 2B7LA 3EUFA 1PGJA 4FLEA 1X9GA 1KYOE 1XCMA 3ZU3A 5CGZA 2ZJFA 1OFTA 3OG9A 4IKPA 1RKQA 2Z6QA 4AZ0A 1YC5A 4HB2A 3ONEA 2AZ0A 2LPMA 5I7VA 4RUEA 1O6CA 4Z9YA 1ADGA 4XWYA 2I5PO 4HPWA 1CX9B 4RPIA 2VUSA 1JHPA 5CAEA 4KO2S 3B8EB 1EEHA 3AWIA 1IXBA 1Q0QA 5EFZA 3H3FA 5BW5A 1ACLA 3OZEA 2XT9A 5JDIA 1PJ8A 3R5KA 3MYRA 1OIXA 1UWLA 2DF8A 2OCLA 4QAQA 3ZXXA 1VB5A 4A9AA 1L5LA 1JHRA 4V0LA 2OCGA 1LC0A 4IW3B 2NUAA 3CSXA 3TAXA 3HXTA 2RGDA 5MF6A 3CVJA 1WMDA 3K6JA 3OBBA 2WU3A 3RVSA 2PKQO 2E3CA 3UK2A 3M8KA 1BOFA 1NW3A 3V4VB 3GEBA 2EFHB 2IDKA 2R8RA 3WLKX 5ICFA 5AJVB 5APTA 4QT4A 1KI2A 1Y6JA 1N2JA 2J9GA 5HVNA 1SZCA 3KQPA 2DULA 5KLVD 1N7SA 3NLLA 2XQGA 4HVTA 3IJPA 1XPRA 5A3RA 4XD2A 2Q5OA 2VDUE 3CD6V 2I0FA 2UUPA 5LL6Y 2G7MC 4PLVA 3D6HA 1Z0JA 1U7ZA 3MUEA 1B4DA 2M3EA 2ADPA 5HXAA 5FYQA 1N3LA 2GDJA 1T5BA 3RFCA 2G0TA 3QPCA 2CUNA 4RWEA 3S3TA 5HQ3A 3AI7A 3HH8A 5EIOA 2OOSA 4MUHA 1UAAA 1U3VA 4BV3A 5JEDA 1SN7A 1FFHA 1EZVG 1RJGA 1W0JD 1QCYA 1I10A 3KVVA 3HE4B 2IV7A 1V1JA 3FR8A 3DLBA 2HODB 4O5AA 1ZJWA 2IOYA 3WLJA 2COUA 5DT9A 4B86A 3HXKA 2PN1A 2GRAA 2P2UA 2FYUK 3VH2A 3LKVA 3RU7A 2FWAA 3ZH9B 2WF9A 3HUSB 4YJGB 3EYWA 5IJAA 1VLQA 2CGOA 2D06A 3MXTA 2CDYA 1TTTA 4DM7A 2YZMA 3L75D 4I1SA 1DO0A 3ZGVA 1KJIA 1SUPA 4RSMA 5LQUA 3P2YA 1ISJA 3PDJA 4Y1FA 5AM1A 1J49A 2EFEB 5L7TA 4D80A 3ODGA 4GSKA 4DJAA 3K0AB 2G76A 5FWYA 5JAHA 1N0HA 2ZRAA 2ZBDA 1JEEA 2ZUTA 2ZI3A 4FEEA 4DGQA 2GKOA 2HLDA 5REQA 4JJAA 2GB4A 2QKCA 3DDCA 1WPXA 1G7SA 2W6JG 3W5SA 4JYCA 3OOWA 1QCZA 3K2BA 2FFDC 2RE8A 4IL6H 4EG4A 4AJNA 4BKUA 2YXDA 3KZXA 4ACAA 4Z86A 4LDQA 1C9NA 3LTEA 4ND1A 5K0EA 4ZEWA 1VP7A 1O97D 1E32A 3E82A 4QUEA 5FP0A 2AIRA 2HSDA 1XLTC 4R4LA 3BN3A 2W6ID 1C30A 3PXUA 4A8PA 2DFKB 4YUZA 1WBJB 4DQVA 1DZ3A 2B8JA 5TQJA 3B52X 3MUDC 3L84A 3TS1A 1IN1A 1BDMA 2ZI5A 1JDBB 2WTXA 4DLXA 5FCDA 4LFAO 2JIZA 3K70B 3CR7A 2YWHA 1M6EX 4P4TA 1NXWA 4QU5A 1C9YA 4PS0A 5JQGA 2K3RA 3Q3JB 3MT0A 2NM0A 2JIBA 4B45A 3RL0g 2XGGA 4IWNA 3BPZA 3EGEA 4XJSA 2IZOA 5E38A 5APXA 2YXLA 1RWQA 2VT3A 3UG6A 5IVPA 4HDRB 4P3YA 5P21A 5TQVA 1O08A 1KQ3A 3OEWA 3EXHA 3CC7V 3Q1MA 1EUCB 1WB4A 2PG3A 1L3BA 4KDFA 1FNBA 4E3WA 2PCJA 3L0OA 3GJ8A 3IVAA 3PT9A 4EG1A 1M5RA 4Q4JA 4IQ0A 3U7JA 3NHAA 1M72A 1BYUA 2FYUJ 3K16A 1MIOB 3E2MA 4CCYB 2AN4A 2JARA 2JCYA 2IDZA 3UAYA 3D6VA 1V3UA 2MSNA 2EFCB 4QQNA 2W37A 1XTCC 3IODA 1EE2A 2R68A 2EGHA 3NJ4A 1Z33A 1PKXA 1KV4A 2JCSA 1I24A 1SQVH 1I3KA 3BMXA 3CT6A 3E48A 2GK4A 1VSVA 3LX6A 3A11A 4MRAA 4JUAA 3RL0B 2AMVA 3U16A 4CTMA 4B35A 3RIXA 4X1YA 3LG2A 4ZVVA 3WGUA 1XC7A 2IXDA 4KP7A 3EASA 3A1FA 4R69A 1X7WA 2B83A 3WU2Z 1T2UA 1VQKP 1NQ5A 1V7PC 4M1WA 1D2HA 2W83C 1JY2P 4OQDA 3UMYA 2JLYA 4KQXA 3S1LA 3GUCA 3ADKA 3FB4A 3CCEP 4PSKA 4DR3O 3G8CA 2Y77A 1ORTA 4TMYA 3HB9A 2YKQA 3MILA 1OFHA 3UY4A 4ZYXA 4EB6A 1OY1A 5C7OO 4IIVA 3BSSA 5EJIA 2VYQA 4GZ3A 3U9SA 3RFVA 4DUZO 1K7CA 4HEA6 4OLAA 4YP1A 1UDRA 1MB2A 5AIAA 2BE3A 1O96B 3KSRA 3II6X 4MB0A 1AZTA 2AVDA 3VP9A 2QAGB 3CNNA 2B9ZA 1XQXA 3IEPA 1F0PA 1HYEA 1L4HA 3ZY4A 4N1AA 2Q8NA 3IEUA 1JQKA 1W59A 2QYHA 1KGSA 1I9CA 2R6R1 3GB7C 4WESA 1R8XA 2OARA 1SUCA 2H85A 3HM2A 1I5OA 2XHBA 2JAHA 1TMYA 3COPA 1TYCA 2YC0A 4KQCA 3EB9A 3OURA 4X60A 4TWJA 1RC1A 1YL6A 5TQ2B 3ML1A 3WK5A 1P61B 2VRCA 3BSWA 4UTZA 4EI7A 3M6UA 3EVEA 2QX8A 1YQQA 1N2GA 1Y1PA 3KALA 3R4VA 1MLDA 4CM1A 4OXNA 5ALPA 1HDGO 1HOTA 2Y6UA 3F73A 3ZD9A 5A4AA 1CB0A 5ITSA 3H2IA 5K5GB 2JRIA 2IY7A 1T8UA 3I5UA 2R66A 2MINA 3WQHA 5J63A 3QFFA 3E7FA 4WK2B 3HYTA 1K9MQ 2JANA 4R1MA 3A1DA 2KLUA 4RH0A 2IP2A 3FTDA 4EYEA 1XCJA 5E7MA 2YBDA 5BSKA 1PS8A 1T4BA 4L5YA 4BB9A 5K2OA 3CNQS 2VN8A 4CMBA 2CW5A 5ESWA 3W9BA 1QORA 1N2CE 2P30A 3H65A 1JHOA 2LR0A 1PFGA 4D4GA 2XITA 4AQDA 1D4ZA 2RKWA 2HKOA 1YE8A 3MWKA