4JYCA

Meab, a bacterial homolog of mmaa, in its apo form
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
322
structure length
311
Chain Sequence
PDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPKKGIFELADMIAVNKAGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
molecule keywords Methylmalonyl-CoA mutase accessory protein
total genus 115
structure length 311
sequence length 322
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jycA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jycA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jycA02
4Q4HA 3HE5B 3ND9A 3QXHA 2VL7A 3MJHA 3HP1A 2JLXA 4Q66C 3S1AA 1XZPA 2AWNA 2JCSA 1AKEA 3AVYA 1XJ0A 3P1JA 5DE3A 2GXAA 3MAAC 4TMWA 4LGMA 1Z6GA 1QBKC 1S1MA 2C5LA 2GVZC 2WSSA 4ON9A 2BJVA 3K0SA 2FSGA 2O0HA 4L16A 5TB5A 1G5TA 2N9BA 1I4DD 1LTQA 3FKSA 1Z08A 1F48A 2D2FA 2BCJQ 3WNCA 1CXZA 4MYHA 4PQFA 1E32A 3UATA 3QE0A 4M3LA 1OV4A 5JJLA 2QORA 3HYRA 3SWFA 2ZI5A 3PIRA 4JLVA 2QNRA 5EP3A 1NI3A 2ZYUX 1FFHA 1XD9A 4KBGA 4P4UA 4XVRA 4JAVA 1E9CA 3M0DA 1FOSF 2YWEA 3BBPA 1OWAA 3L0SA 1OKKA 4JS0A 3AKYA 2C2AA 1N6KA 1IY2A 4LPSA 2WM9B 3U7GA 4PC2A 5JLJA 4JLJA 2IYTA 4B3FX 5DO9A 3KTAA 2VHJA 4P4TA 3O8RA 2QY9A 2F55A 3V4WA 2ZAMA 3VTKA 3BXZA 1R4AA 4HLUA 5KO2A 2DWQA 4OK5A 4C2UA 3BWDD 3FKSD 5FPYA 3OZXA 1KMQA 2XZOA 2KBEA 2PZGA 1OFIA 5LB4A 3TW8B 4CEIB 2FEMA 1Z6AA 2WWFA 4Q9LA 4A82A 4Q1AA 3VKHA 1MT0A 4JLNA 1M7HA 1ZUNB 3GLIB 4IDHA 2XV5A 2BBOA 2EVWX 3THYB 3B1WA 3TUIC 2W6JD 2J7PA 3FE2A 3QOFA 1W2GA 1YZLA 3ZRWA 2HUPA 1JB1A 5EE5B 4TZ6A 2VTKA 4JL8A 1Q3TA 2XZLA 3TNFA 1Z47A 4LYHA 4DIEA 1G21E 4MKIA 5CM9C 3C41J 2B8WA 2Z83A 5AR1A 1W4CA 2R6FA 4OBEA 1CJUC 1IOZA 2V9PA 1KO4A 2IBMA 1GSIA 2P3SA 4W9MC 2FZLA 1F2TB 5DI3B 2ZE5A 4HAVA 4ACBA 2JJ1A 3RVBA 3QEJA 3KDSE 2H8KA 1W0JA 1VPLA 3RS3A 1KZGB 4TTQA 4X8MA 2R65A 2B6HA 1KGDA 4D26A 2FPKA 2GK7A 2CDNA 1PLKA 1V5WA 1EFRA 3BD9A 3FFAA 4CRWB 1P2VA 2EQBA 4Q9JA 4DB2A 3VHLB 3C8UA 3QXJA 1RYHA 1CR1A 4D25A 1F2TA 4GOKA 4MRRA 4G5OA 1SVIA 521PA 1KI3A 1E2HA 1R10A 4N3NA 1W7AA 4BLOA 4I5SA 3KL4A 1TU3A 3FHTA 1A7JA 3WP1B 1NN1A 1ZNXA 1NN5A 1KK0A 1Q21A 4CVNA 1HEIA 3ZRWB 1N6LA 1U0HC 3OE7D 4JSTA 3UIEA 2ZSAA 1NG1A 3KKOA 1E1QD 3VHXA 1W5TA 2B92A 2ZU0C 4BLQA 1T0JB 3TLXA 2IS6A 4P3YA 4X8LA 4BFZA 5JSZA 3K9LA 3VMXA 2WOOA 1DS6A 1SVWA 4IXMA 1NY6A 4QFMA 1E1RA 1RC8A 3IBGA 2CLDX 3SJAA 5K8IA 1KI8A 1XP8A 4FXPA 4YDSA 5BW8A 3K09C 3EZ6A 1P72A 2YOGA 4IDPA 4OYHA 3FYHA 3DGEA 3CX6A 1H89A 3W6OA 2Q3IA 1II8B 3FMFA 4HLUC 5FPKA 2ZRGA 2GXQA 1DOAA 4DT1B 4MQBA 4PQRA 1TQ4A 3QXXA 3PFIA 1WA5A 2D74A 4MYTA 1VG9B 3AUXA 3NMDA 2LWIA 2QP4A 2WKQA 4YC7A 1A1VA 2A5JA 3U3JA 3THXB 4O0MA 3A1SA 2GCOB 3VMFA 1G9XA 2VF8A 3M4YA 4HUQB 1YR8A 2R32A 2XZPA 2IYWA 3C15C 3CF2A 1NMZA 1W4AA 5AW9B 4U7OA 2OFOA 1TNDA 4V03A 2ZI4A 3NHAA 4B6EA 5AVVB 3VR5A 5SZHB 2ZANA 3E2IA 1NF3A 1HBWA 3HJNA 1S3GA 3LA6A 4TYQA 5AJWA 5HR5A 3NDBB 1IO4A 4BPBA 3CUEF 3Q9LA 3QNUA 3CPHA 4BFYA 4E07A 1XMVA 2CL7X 1GNRA 2KJQA 3F3YA 3GLFB 4O2LA 2FMXA 3RC3A 5ELXA 1UDWA 1RFLA 1GVNB 3WMFA 4E22A 4Q21A 4DDUA 4Q47A 4QM7A 1J90A 1SKQA 2EFHB 1P75A 1W49A 4LJ9A 1F2UB 2C04A 1S8FA 1F51A 3HU3A 3NH6A 4Q4HB 4WAUA 5G3YA 2LKCA 4D82A 1T91A 1VCMA 3PEUA 4IOMA 1E2IA 5J4LA 2WPDA 3ZVMA 5AVSB 3ETLA 1P9RA 1W1WA 4RZUA 4ZKEA 4B35A 5HCIA 5AJVB 2IYQA 4WZ6A 4LJYA 4DCSA 1MRNA 3PEWA 3K70C 4MGIR 3GJ4A 4YXWD 1P2SA 1G4UR 1XTKA 1HY3A 1N6OA 1HE1C 1W0KA 2G0NA 1KQLA 5IK2D 4Z1MA 3U4QB 4BLPA 4F92B 2C96A 1J8MF 4G0NA 3EW9A 3ZS8A 1N6IA 1ZP6A 2XNDD 4JLOA 3KQUA 3PUWA 5H70A 1IN4A 1VCIA 2YHSA 4TZ0A 1ZD9A 4RD6A 4AKIA 2EWWA 3NIBA 2O0KA 2PZEA 3LDAA 4H1UA 3K8YA 1C9KA 3A0RA 4OQLA 2WZQA 2ZEJA 5IHPA 4LCBA 2R5BA 2P5SA 4W5WA 2ZSBA 2PT7A 5FTJA 3UKDA 2J59A 4HZUB 1JUNA 1RRPA 2EYQA 3TNUA 2ZPTX 3B82A 3Q7QA 1EGAA 3P20A 4M21A 4QGAA 4V02A 4W5HA 1KNQA 4DSNA 4Z51A 2IHBA 3U7FB 1MO4A 1KO1A 4QXAA 5HE8A 2IYLD 1D2MA 5SZJA 3AV0B 1E0SA 5EP1A 2C2HA 2XNSA 1ESMA 4OQFA 4TL9A 3LIDA 3MD0A 2JGNA 1E4VA 2E87A 3CRQA 3TR0A 3VR1A 5CLLA 2FA9A 3BERA 4C7NB 4KITB 3LD9A 2QP9X 4EPVA 3SC3A 2JJ2A 3VNUA 1HQYE 1ANKA 2J87A 3GJXC 4GPTA 1E2KA 2V8OA 1CJKC 3SJZA 5KPDA 5KYKA 3DVLA 3GLHA 1AZTA 2GEDA 1GL6A 2CNWA 2IXFA 3FOZA 4P31A 4DRZA 1XB2A 1NLZA 2QG6A 1R8QA 4TT3A 3AVXA 2JIZD 4JT2A 4TL7A 3LY5A 2HLDA 4MYCA 2FDCA 1WQ1R 4Q4JA 5APSA 2RAPA 1MABB 4FW9A 1NN0A 4U02A 4FWTA 4B76A 2UZIR 4CIDA 3LVRE 4RFVA 3VKGA 4Q01A 2RB4A 1LVGA 2C9CA 2MSCB 3BB1A 1QVRA 2DBYA 2KP8A 2REBA 1EFTA 2BKUA 4QC2A 4LOAA 2RGDA 1IY0A 5E4FA 2IA5A 5J4YA 2VO1A 2IYYA 5AW2B 3U44B 4B2PA 1UKYA 1E3MA 1N0WA 2GVDC 1J8YF 4PX9A 5LD2C 5P21A 5F9FA 3ASYA 5AVTB 5B64A 1HUCA 3HU1A 1PV4A 1P9NA 3T12A 5JWHA 5AUPB 1KO8A 2OLKA 4EFMA 1VYVA 3R20A 3I8SA 2J0VA 1DEKA 1ONBA 2JIZA 3LLMA 3A4LA 1KO7A 3LH5A 1XX6A 2ZRLA 2IXEA 4U5XA 5GJWC 1BOFA 2PX0A 2GEUA 2QTVB 5EZ6B 4QRHA 2IYUA 4NHOA 1AM4D 4P33A 5HZKA 2Q3FA 3L2OB 4IDQA 4KAXA 5AW7B 3ZGXA 1R7RA 2MSDB 3LVQE 4YMTA 1HUQA 2QRNA 2EFGA 4A2WA 3BORA 1S1CA 4LV6A 1H8ED 1YZGA 2VSXA 1RPZA 2BMEA 3QG1A 1QHGA 2BASA 5CYPA 2QBYB 3CB4A 4AIIA 1G6HA 4M1SA 3MWYW 4LJ5A 3OEHD 1DAKA 5HCNA 1DARA 1SHKA 3QSYA 1OT3A 5D3MB 5FTKA 1KI4A 4KO8A 4YMSA 3NG1A 2R6AA 2FPMA 1Z8FA 1TX4B 2LCFA 2IUTA 3BJIC 4IXNA 4RZ2A 4TYWA 2NTYC 1CRQA 3W6PA 2P67A 3SYKA 5G53C 3KUCA 4EDHA 5AVZB 2QEQA 1QG4A 3IDQA 3IIMA 4IVPA 1TEVA 3MG9A 4ZCMA 3EPJA 2EFDB 1W0JD 2B8TA 3EC2A 2K5UA 5AUQA 3I92A 1KNXA 2IC5A 2KI5A 1RRFA 2G83A 3HWSA 4DDVA 4B48A 1Z0IA 3CR8A 4DDWA 1S9KD 5L8VA 2B7CA 2ECKA 4Y0AA 5CK5A 5A5GA 1NP6A 2ZI7A 5KDOA 2CCGA 2NPFA 5EE9A 2JJLA 1L4UA 4MYUA 3R9XA 2WSSD 2IW3A 5L3QA 2GRJA 2QAJA 4LC0A 2HDNB 821PA 3LXRA 4B2LA 1COWA 2C98A 4QBFA 3GFPA 5CIWA 1X86B 1SKYE 1GG2A 1XJCA 4EJSB 2GBLA 4XD7A 1M8PA 5CLQA 4CZ2A 3EPHA 4TN1A 1R0YA 1YVDA 4JKYA 1MOZA 4POAA 5C4GB 2CHVA 2QE7D 3SI7A 1D9ZA 1KYIA 2BV3A 1P9WA 3H2YA 4WZAE 3V4FA 2HT1A 1GITA 4HLDA 3WHKA 4LHZA 4D80A 4ZDKA 2QI9C 2P7JA 1CULC 2H92A 3MUFA 5J47A 1HJBA 3I3SR 1LB1B 4CF7A 3QVVA 5FL7D 3T1VA 4Q7JB 3KQLA 1MR3F 1YU9A 2OO7A 4FMDB 4AKHA 1GKYA 2YWHA 3WNBA 4HLCA 5KNBA 2ZITA 1MUUA 1WE2A 3DM9B 4LDJA 4NCKA 2FFBA 1NG9A 1G8HA 4MT8A 4PC6A 2V54A 4KXFB 2BEKA 3W3AA 5JWRA 3EXAA 3DOFA 4YMUA 4XD7D 4B44A 1AJEA 5KSPA 1W4RA 3OAAD 2X19A 3X1XA 2WIAA 4A92A 2VIIA 2CBZA 3PXGA 1S9HA 2XAUA 1QHXA 2XJ4A 1KDRA 2OHFA 1X8YA 2IHYA 2QMHA 2R2AA 2ZJBA 3B2EA 1YRBA 4D4MA 3GLIE 1ZCAA 1LW7A 1W47A 4EJSA 1T3HA 4XVQA 2V55B 2YJTD 2VP5A 4N0EA 3W5JA 1U98A 2HYDA 2REOA 2F6RA 4GRAA 2R62A 2D06A 3ZD7A 1NAFA 3AGPA 1KK1A 3GLIA 3A2AA 2WOJA 2WICA 1GK6A 2CJWB 1KJYA 3ZIAA 3WYFA 4E09A 2XSZD 2GNOA 4HAYA 2IYZA 3GJ8A 2AR7A 5L3RA 3TAHA 2ZRIA 4ZCIA 2XOKD 5C1BA 1CBUA 4PO1A 5BYKA 2FGKA 3IIKA 2ZYVX 3P27A 1N5KA 5DSZA 4ABYA 2YWGA 4LBWA 1EFHA 1QVAA 2D7DA 5DNYB 5SZIA 3E5HA 2R5DA 1JPJA 3FVQA 4F38A 4F4CA 1NVVR 1JJVA 2DCUA 1XTIA 2KBFA 1P5ZB 2YZ2A 3GLGB 1E9SA 2ZVQX 5AJXA 5FOXA 3DHWC 1C1YA 1HA3A 5JEEA 1IBRA 4KYIB 1AIPA 1Z29A 2V1UA 3T1QA 5D3MA 4BFTA 1LS6A 4M1OA 1WCV1 4FMDF 3DEFA 3A4MA 3PENA 3W90A 2OCBA 4BFXA 1TPZA 2NZ8A 3PITA 1SVLA 3W5IA 2F9MA 1DAIA 4M9QA 4X8HA 1VCOA 2YNMA 2FEOA 4Q1FA 5LB2A 2QZ4A 1A4RA 3B1YA 2XOKA 5BQ5A 1LF5A 3VYIA 1M34E 221PA 2GESA 2FU5C 2ZRJA 4PHTA 1JAHA 1GU5A 2Z5FA 3ZVRA 1XF9A 4LRWA 2JLZA 1GWNA 2I1QA 2MSEB 1QHHA 4Q00A 1GNPA 1ETUA 5FBRB 1NJGA 3KQHA 3Q72A 1ZCBA 3QF7A 4OK6A 2NOAA 1PJRA 2CNWD 1XD2B 3TUZC 4TSFA 3IHWA 2NO1A 3DPUA 1UM8A 3GJ7A 1KI7A 1GRNA 2OCAA 1UKEA 3LQRA 2J0UA 3LRPA 2VHUA 3FMIA 2AHOA 2PZFA 5J40A 1MV8A 4C0JA 2QPTA 4DEYA 3RDPA 2O8BB 2AN9A 1XNJA 1AS3A 3BOSA 2J0QA 1D5CA 1K5DA 1G3RA 2CLCX 2E1RA 1XTJA 2PT5A 2WAXA 3HPQA 1DAFA 3LAWA 5FUWA 5BYJA 2H18A 2FFHA 4KVGA 1IN5A 4AI6A 2ZETA 1FL9A 1IXSB 4MUBA 3WMEA 421PA 2CHGA 4URZR 2OXCA 4NYJR 4EJSC 3O8BA 4KLZA 2HF9A 5JCZA 4U00A 3I5CA 2BWJA 4AYCA 2WT7A 2OFWA 4M8NE 3SQWA 2HXYA 4JJKA 3K09A 4RZXA 1SXJB 2OBMA 2AX4A 4OJKA 3UMSA 1N6PA 3IPYA 1O87A 1A5TA 1MO5A 1QDEA 1G7TA 2RH5A 5TXGA 2C9OA 1RVDA 4BZPA 3ZRVA 2NG1A 2FOLA 1E98A 4JJZA 3RS0A 3O8CA 3I5YA 2VHTA 1P7CA 1P2TA 3TH5A 2UVQA 1G7RA 5APYA 1Z0JA 1ZIPA 2VRWA 2PJRA 1Y3AA 1OIXA 4H1VA 1W46A 3EX7C 2QSZA 4LC1A 3O8ZA 1RW4A 3B1ZA 1N6NA 4IFBA 2P6UA 2WWHA 1W36C 5APWA 1W2HA 2F1HA 3MWLA 1NWQA 4M1TA 4C0LA 3K0FB 2JDID 5EQTA 1F3OA 4A8JA 2NMVA 1SZPA 1GKIA 3TR5A 2DHRA 1ODFA 2GAOA 4MKGA 4US1R 1KSGA 4ARZA 1Q1QA 2CL0X 4BUJA 5B1OA 1Q22A 3MGNA 2W00A 1KJZA 5EXSA 3REGA 4A4DA 5HZHA 4JASA 3T35A 3UG6A 3AVTA 1GFIA 2QSYA 2NQ2C 4DLTA 2O8DA 3QIAA 2Y8EA 4Q19A 2AFHE 4MRPA 2A3RA 1GRRA 2XNDA 1T2KD 2Q9CA 1UAAA 4W5JA 5CDFE 2GJ8A 3B5JA 1IY1A 1GILA 2BIFA 2HXSA 2J45A 5B57C 2GEVA 3KFXA 3EIHA 3KJIA 3LWNA 3RLFA 4I2LC 3WBJA 3TK1A 3AF1A 1G5PA 1AN0A 1R6BX 3MGCA 1H88A 4KBFA 4QJ4A 4RZ3A 2F9LA 3NWJA 3DZ8A 3M9BA 3PJRA 1A2BA 4PAOA 1NMXA 2WWYA 3KTAB 2ZE8A 4UKDA 3A4NA 3CWQA 2A2ZA 2WKPA 2P2LA 8OHMA 2OT3B 1E79A 1OXXK 4DLSA 5KSZA 3N2EA 1KAGA 4WVFA 2NIPA 4ACAA 5GJCA 1MKYA 1NBMA 1VYTA 2PLFA 4FINA 4JL6A 4DLVA 2GF9A 4B3DA 3ADCA 4BASA 1LNZA 1M2OB 1ZNYA 1A02J 2RHDA 1GDDA 2G0TA 3A58B 1KK2A 4NDZA 1E2GA 1E99A 1NBME 2W2TA 1TL7C 5AW1B 4Q4AA 2XTNA 1XD2A 4NYMR 2ZRFA 4GOXA 2LFRA 1N2CE 2F3RA 3W3ZB 1ZIOA 3VQTA 3UIAA 1XEFA 2VF7A 2Q9BA 1ZC3A 5FL3A 1U81A 3AH8A 3QPWA 5FTMA 2Q3MA 5EJEA 4WXRA 2PJZA 2ZXEB 1VIAA 2P5TB 2RMKA 1U9IC 4GZMA 1MRSA 3A1WA 4OK3A 1CLUA 1KDPA 2ZXUA 4GBMA 2X1VA 1OLOA 3HE5A 1H8EA 3NKVA 4LSGA 4PHGA 3LIEA 2J5XA 5B58C 3D3QA 2PEZA 1ZU5A 1KI6B 1OJLA 4OJQA 2ZRHA 1RIFA 4MKHA 4MUAA 1KI6A 4CEHB 2ZI9A 4ZCLA 2WV9A 1XPUA 1RRCA 1NKSA 3ECCA 1OFUX 4OHYA 4A2QA 4A0GA 2QMOA 1IHUA 2IEZA 1YQTA 1KY2A 1KMHA 3LO5A 3NVAA 2C95A 1RJ9B 4GMXA 5CITA 5JBQA 3BH6A 4A2PA 4LJ4A 2JATA 4DT1A 4RESB 4MGKR 4AC9A 5JHHB 3WP0A 1TF2A 4G01B 2YNYA 2ONKA 3BH0A 3L0IB 4Q4AB 5FI0B 2WWXA 3RC8A 3S1AB 3TVDA 5JI3E 1G8YA 2DWOA 1BO6A 4ZKIA 3PUZA 3V5BA 1BIFA 3P4YA 2LKDA 2ZAOA 4PC3A 4UNPA 1KSHA 4I6MC 2FFQA 2ZM5A 3SHFA 2R6DA 4P0TA 3ZVNA 2HYIC 1E2NA 1S2MA 3GFTA 3G82C 3MFYA 3T1OA 5APTA 3LW7A 4HDQB 1OF1A 3B13B 2QAGB 3CX7A 3GJ6A 4QBHA 1F60A 4IJMA 4PPGA 3DMNA 4JVSB 4V0ME 1KSFX 2BEJA 2DYKA 1ZAKA 3OAKA 2DFNA 3AVOA 1G41A 3TAUA 2ERXA 2FSIA 3SNHA 5IRCD 5GVRA 1ESNA 4HSEA 1ZINA 1E2FA 2BC9A 2HF8A 4V0MA 1KI2A 4DCUA 4JLBA 2JLQA 1OFTA 5KUTA 1NMYA 3TE6A 2P6RA 5FI1B 2QL6A 3CNLA 4URWR 2B21A 4M9ZA 5IT5A 1AQYA 3A6PC 3SBEA 2DFKB 5DLQC 1GTWA 2ZRDA 1KK3A 1OH7A 2X8AA 3QKTA 4UQOA 2FE4A 4LX0A 2O8CA 4PHHA 3H86A 4Q03A 1T8UA 1GM5A 4LUCA 1AK2A 4K81B 3L0PA 3WBKA 3I62A 3VTPC 4LJ6A 2WJIA 4Q02A 3OIWA 2C78A 4JKIA 3ZH9B 3U7HB 5DI3A 4DEXA 3QXCA 4K46A 1T6NA 4H9GA 3AF0A 4ZKDA 2KWIA 4RSGA 4EUNA 3AQ4A 3KKQA 1G4AE 1GRQA 2WJVA 4KI0A 1YKSA 4G3XA 5FTNA 3KQNA 4DHEA 2VLIA 5HTKA 5HKKD 3B6EA 4KJZA 1GTVA 1UEIA 3P8MC 5AVQB 3U60B 3A5TA 1CIPA 2XEXA 2AD5A 4RD0A 2QGZA 4D4LA 2RGBA 1Z0KA 3K0CC 3KKMA 4RKEA 5IK2A 3BIFA 2O52A 3E1SA 1TQ2A 3H4MA 2R6GA 1KHTA 3KKPA 2AD1A 2QBYA 1KI1A 5DYGA 3JVUA 3SHWA 3GD7A 1E9RA 5FR2A 3RSOA 3TRFA 3T5DA 1T5LA 4BRUA 2HCJB 3UMRA 3VN0A 3AM1A 4EQ6B 1G6OA 3AP2A 2ZJZA 2IF0A 4R71A 2IK8A 4RD3A 2WJJA 4EOTA 3Q5DA 2PLRA 5AVYB 4M53A 1E2EA 5E95A 3LBNA 1Z6XA 3QKRB 2QP3A 4Q18A 3KJEA 3PVSA 3QENA 1DAGA 1FP6A 1XPRA 3W8RA 5JJIA 1XBTA 2ORWA 4EPRA 4KYUA 3QBTA 5K8LA 4OHWA 3RS4A 2FF7A 1UBFA 3LV8A 3G5UA 2ZRNA 4S35A 4Q9HA 4GSYA 4LK2A 2ZUBA 1YZTA 3A36A 4A1FA 1GNQA 2RGXA 1JALA 3K53A 4RKFA 1DO0A 2RHMA 2VH5R 3THXA 1OH8A 1DAHA 1XMSA 4L5BA 4C46A 1DH3A 1JBKA 4BECA 2PH1A 1ZM3A 3D7MA 5FOVA 3EASA 1R5NA 5EUQB 4KU4A 2FJUA 2I1VB 3F5FA 4QHYA 1DELA 1MABA 3RS5A 1CF4A 1RKBA 4JAUA 1VG0B 2XB4A 1E2JA 3GLHE 1E9EA 4X8OA 1SQ5A 2D4HA 1CSBA 3CRMA 4LBZA 1EX7A 3GCGA 5CJ2A 1XD8A 2QENA 3I4LA 5JSZB 1HH4A 4C0KA 2IF2A 1SXJD 4WIAA 2CMKA 1E0JA 3CX8A 5C18A 4LHYA 2FPLA 2BBTA 2JLWA 1COWD 4IEIA 2J7KA 4QGFA 1RZ3A 2AKYA 5AVUB 1VCNA 2IL1A 2WIBA 5JS7A 2ZI6A 4II7A 2OE2A 1Z28A 4V0OA 4QKQA 2ANCA 4LPKA 3ZLJA 4NTZA 3GJ5A 4LJAA 3GJ0A 1CZQA 4QPJA 4WBSA 5TV2A 4D4KA 4FMTA 2J0SA 1SXJC 4JT4A 4PC7A 3ADBA 2GJAA 4FI3C 5KTYA 1FNMA 3Q3JB 4KHXA 1Z07A 3SEAA 4DWJA 4OKSA 5L3SA 4B75A 5APVA 1MFZA 3AVQA 1S4QA 4LBYA 1AS2A 1G17A 4M4SA 4HYTB 3M0AA 1AZSC 5EP2A 4US0R 3OAAA 1SVSA 3UWOA 2QPOA 3KQKA 5EUMA 2CHQA 1SXJA 1QHNA 2CL6X 3NFQA 2R8RA 2C99A 3ZZ0A 3FGNA 3THWA 4C0BA 5B30A 5APXA 4IKEA 1AGRA 4HEJA 3TSZA 1WBBA 1GD2E 1ZBDA 1N0VC 2R9VA 4FCWA 1E2LA 1VHTA 4PO8A 2IYRA 3TIFA 4HAWA 1IM2A 2WJGA 4BFVA 2RGCA 1J2JA 5DN6A 5CM8B 1DG3A 4M1MA 3OESA 2WMNB 2YVUA 4HB4A 3KXLA 5AJZA 3M91A 2RKOA 4B3BA 4MKFA 1U0JA 4LY6A 2W58A 4I4LA 4CGZA 5J4KA 4CEIA 2VYFA 1GZLA 2C9LY 1JI0A 4FMBB 3CF0A 1OE0A 2ODBA 2RGNC 1Q0UA 4G5GA 4CYMA 1XWIA 4TYYA 1SVKA 1UADA 3VU9B 3M1IA 4XIGS 2IS2A 1GOTA 3TSOA 3OIVA 1YZUA 4IOKA 1NSTA 1Z2CA 2R44A 2J3EA 5HE9A 4AYWA 3BB4A 4DUGD 4TYNA 1QG2A 4KFTA 3E70C 4Z8XA 1XCMA 1EFUA 2AWOA 2ZYWX 4KHZA 5JRZA 3WNDA 3BGWA 2BHRA 2GDJA 3QXSA 1H8HA 2NGRA 2A5FA 4KFSA 1VDZA 3A1TA 3IPXA 2VQSA 4HDCA 4W7SA 1FZQA 4B73A 3CO5A 2C9YA 2C9NY 4MTXA 3AKDA 3CNOA 2I4IA 1S0UA 3CRRA 3QF4B 1W36D 2O8EA 1VMAA 1AQUA 4DB4A 1VIYA 2QE7A 4YXWA 3IEUA 4LYJA 2WPSA 4BE7B 3WRXC 5CYOA 5EXXA 3BB3A 3AF2A 4RFSA 3VR4A 4F4JA 4CW7A 4B43A 5E7JA 3TUJC 3A37A 4TT3D 3GLFA 4OI4A 1EX6A 1DG1G 3FMPB 3TKLA 3BFKA 3GLGA 1XEWX 3OIYA 2IUUA 4B47A 2WKRA 4Z54A 5EZ5A 2C03A 4PZLA 4P4SB 5FBLB 3W6NA 3CM0A 1UBEA 5FPHA 4M9XA 4TSFD 4MGYR 1E9FA 3RRYA 2G6BA 3EG5A 4Q7LA 4YMVA 1NIPA 3ZRXA 3RAPR 1W44A 4B3GA 1V43A 3M6AA 3MCAA 4WZBE 5KSYA 4PAMA 2DWPA 4D81A 5C93A 1YZQA 3QJYA 3K0CA 4N0DA 2VP4A 2VPPA 2ZRPA 3QUSA 3TQFA 2QGNA 5JWOA 3I5XA 4LI0A 2FZ4A 4Q9IA 1J2JB 5SZKB 1JPNA 1G5RA 3C4JA 3OEHA 4B3XA 5AW8B 5DGXA 1NRJB 4ARZB 2R6CA 1HQCA 2H7HA 4AG6A 1ZM2A 3EZ9A 4DLZA 2GAAA 3MLEA 5L3QB 4ESVA 3U7EB 2XSZA 1R5BA 2ZS7A 3TBKA 4A8JB 2IYSA 3GQBA 1Z0AA 2IPPA 4TLDA 3O8DA 4TL8A 1NNEA 2A7QA 4YQFA 4TMKA 2ZSFA 3LFUA 4J0QA 4CEJB 1IN8A 1SP4A 3DO6A 4PZZA 3AVVA 2FGJA 4Q5IA 4BRWA 4IW3B 4LJ7A 1IAQA 3K0EA 3RRMA 4A0HA 2HLDD 2UKDA 3NEYA 3CRW1 3KKNA 3P4XA 4UNQA 4C7OA 5AW0B 4C4PA 2O0JA 4DC9A 3O47A 3X1YA 1JR6A 2QM8A 4A6PA 2IS4A 4C7NA 3MJRA 5KSOA 2V3CC 2FH5B 1TMKA 4ASUD 3V4QA 2CVHA 3NHBA 1DO2A 1P62B 3CW2A 3DKPA 1OIWA 3T34A 1FTSA 2WHXA 3R7WA 3A3YB 1NIJA 5AUNB 2W6JA 2WT7B 2VA8A 3BRWD 1A82A 2X77A 1G8FA 1OHHD 3UANA 4E5UA 3GLFE 1E96A 3EA0A 4M1KA 2WTUA 5AVWB 2J46A 5FPSA 1G19A 4RD1A 3X2SA 2O8FA 1U9IA 3UPUA 1RE0A 3K0FA 4MRVA 3R9WA 2XZRA 5AW4B 2OCPA 3RYTC 1ZU4A 3Q5EA 1XXHA 2IYXA 5L3SB 4A0RA 3D8BA 3UWKA 1WBDA 5FUXA 3DL0A 1R0XA 3EZFA 4AUWA 1O3YA 5D3QA 5AUOB 5AW5B 3JVVA 4XSGA 5GJVC 3B9QA 4CT5A 4XVUA 3QI2A 4BLSA 1UBCA 4HZIA 3RNLA 2ZJAA 4KSBA 2ZVPX 1QHHB 1P60A 4JBXA 2CLSA 4NCJA 2VP2A 1Z3IX 2FTKA 1E79D 1US8A 5F2EA 2GXUA 4NH0A 3FB4A 4OI2A 4GL2A 2H1LA 3B7GA 3OEED 4QL3A 3WYAA 2VBCA 1LFDB 4NCHA 2VP9A 4URUR 1KKMA 1CKEA 1JEEA 2JLSA 3LX5A 2ZI3A 3SR0A 2O8BA 1DVRA 2HCBA 1L8QA 2Z5HA 3WY9A 1KKLA 5F98A 3ICEA 4Q1BA 3QKSA 2ZFCA 3L37A 3RRNA 4P4SA 2GZDA 2G9NA 4HUTA 5KOYA 3KQGA 5J5CA 2QQEA 2FG5A 1IN6A 4IVRA 3ZQJA 3LQQA 2AXNA 5AK0A 1CS4C 4HAUA 4PQYA 1E1RD 3KB1A 1QHSA 1P3JA 4HDOB 1JR3D 1OXTA 2V7QA 4DLRA 1T8TA 1XJQA 2F43B 4OQNA 5JCPA 5KDDA 1OH6A 3QKSB 4Z8YA 4G5RA 2EFCB 1WRBA 3JZMA 4NYJQ 5FBQB 4LV5B 4DSOA 1EWRA 1FUKA 2N42A 1DBSA 3PCRB 2QU8A 4QHTA 4ILEA 3EZ7A 3RANA 4MITA 2A78A 1WXQA 4JYBA 4G5QA 3LX8A 1Z6TA 3L8ZA 3QF4A 5FOWA 3BH7A 1OXSC 4F4IA 1UBGA 2GJKA 4AKEA 1ZM7A 1KZ7B 2GHIA 2V4ZA 3LNCA 3X1WA 5JI2E 1LV7A 2KE5A 4M2LA 1TQDA 5BXQC 4DZOA 4D4JA 1S96A 3CR7A 2KSQA 3K70D 2AFIE 1TU4A 4KFUA 3Q85A 4AYTA 3ZVLA 1HURA 3GEHA 3EZ2A 5LPNA 2GETA 1XTQA 5E7MA 3H0KA 1FTNA 1P73A 4BEJA 2YO2A 3PUVA 3QBVA 2QM7A 4M1YA 3HPRA 3KJHA 1AA9A 1FPMA 2ZE7A 2FX3A 4LHVA 3C16C 3OF5A 2V7QD 4EPTA 3VR2A 4Y0VA 2E43A 4LBVA 3SE0A 3U6KA 1OH5A 3ICQB 1E0KA 3PUYA 4DCTA 5H1YA 5CK4A 3VKWA 3L82B 4HUQA 2W6ID 3SYLA 1FAVA 1TEXA 3LLUA 1YZNA 1FQJA 3MWJA 5H8WA 3I73A 3QPVA 3T06B 4MDEA 1Q12A 2BKEA 2JA1A 2JDIA 3AVUA 1GIAA 4PSVA 2BM0A 2GZHA 5KNCA 2IS1A 1NBMD 1M1YE 1KO5A 2F1IA 5FR1A 2QA5A 3ZZUA 3KB2A 4QJ5A 4DBLC 4EIWA 5KNDA 3B60A 4TWZA 4I1VA 2XU6A 1GUAA 1NVVQ 2MMGA 3T15A 3GFOA 4Q1CA 1ZW6A 5E3HA 4XWKA 3T61A 3U6BA 2VP0A 3PR1A 2KB0A 4LHWA 4EPYA 4Q9KA 1BMFA 4JL5A 5DHAA 4HZUA 2IWRA 2E42A 2CE2X 3I1FA 2ANBA 3EAQA 4PPFA 4QBGB 5DI9A 1XXHB 3VAAA 4S2EA 2WVJA 2FNAA 4NU0A 4KV9A 2GZAA 4US2R 1S3SA 4WA7A 2Q6TA 4QJ3A 1UPTA 3K9GA 1SVOA 2V6JA 4KLNA 4PAQA 5APQA 4PANA 5J4HA 5DISB 4RCYA 4D6PA 4JYCA 1Z06A 2WTYA 2ZJ5A 2ZR7A 1FNNA 3HE4B 1JNYA 1T3LA 3C7KA 2P0EA 1ZC4A 1I2DA 4BIZA 3ZJYA 3ZYCA 1KIMA 4EPXA 3AB3A 4C0QC 4EKDA 2W6IA 4FD2A 5B2ZA 1DADA 3R7WB 4YLGA 4BQSA 1CR0A 3K0AA 2V1XA 4XTRA 5G41A 1P2UA 3IUYA 2E9SA 2AK2A 4L9WA 1TF5A 1LY1A 3OFNA 1B23P 3JZAA 5JEDA 4JVNA 4A0FA 1NLYA 1T0HB 2FWRA 2OV2A 2GWHA 1FOEB 2UZ3A 1BKDR 2I3BA 2P2UA 2DFLA 2N46A 5LBIA 4WOPA 2XITA 1OW3B 3GEEA 121PA 2VEDA 4F91B 5DH9A 5EE3A 2VHQA 3GEIA 4LYAA 4BIUA 4FN5A 4GP6A 3EWSA 3SZRA 4BFUA 3J81k 4O25A 1CI6B 4IDNA 4PPQA 2BMFA 4JBWA 1P6XA 2L0XA 4I99A 2NZJA 4NMMA 4V0LA 3NBYC 2BOVA 2ZREA 3HR8A 2WMOB 3RABA 1N3BA 3RHFA 1E2MA 3C14C 2C77A 4JZKA 2G77B 3LXXA 1G3IA 1HYQA 2NO9A 1JAIA 4D0GA 4URVR 2J41A 4NYIR 5JFGA 2RGEA 3IKJA 1QRAA 5ANRB 5G40A 4NPHA 1YR6A 2WJYA 3R8FA 1CI6A 4KSCA 5GJBA 3GMTA 1Z22A 4NE2A 5JRJA 1YRAA 4DJTA 2O8EB 1G2CB 2O5VA 5JZVA 3VNVA 2CK3D 1FOSE 3CKLA 4QOSA 4B74A 4V0KA 4R2HA 1X1SA 2IWHA 2Q21A 2RCNA 3P32A 5BN5A 3K70B 3X1ZA 3AEZA 5JMTA 1YR7A 2YKGA 2RGGA 4TYPA 1UF9A 4QGHA 4UNRA 1M6NA 4NZYA 1IXMA 1JXMA 2H7VA 4ZPXA 2A30A 2QUZA 4BEBA 1AGPA 1FP7A 4EQ6A 4R2IA 3REFA 3G0HA 3KUDA 3K0AB 1E4YA 1H65A 5CB6A 3MSXA 4AK9A 2EWVA 1R0ZA 4BFWA 5BN4A 4B32A 2JEOA 2OEPA 3NC1C 4B2IA 3MRSA 5APUA 2BVNA 3NC0C 4TMXA 2YOFA 3FTQA 2Q5UA 1CR4A 1Z2AA 1G7CA 1XEXA 1VECA 2ODNA 2QTFA 3BE4A 4TLBA 4XTCS 3M06A 5FPTA 5TARA 3K1JA 3NBZC 1GU4A 5FFMA 4C9BA 4DUGA 2WPRA 1U2RA 1Z6YA 3RS2A 1WB9A 4P32A 5EP4A 3M9HA 3SN6A 2J1LA 3U44A 4DLYA 1EESA 2OZEA 4NCNA 3EA5A 4OHZA 2YYZA 5J4VA 1EG7A 1WMSA 2A9KA 2Z4RA 5FOTA 4D0NA 4JVMA 1GAJA 3RWOA 3A7OA 5C2JB 1G64A 1A2KC 4LZZA 2O8FB 1J7KA 1K8RA 1Z0DA 4JLKA 3IEVA 1YJ5A 3EPKA 3EARA 2YC2C 3I61A 3V00A 1XXHE 5EE1A 4ITRC 2OBNA 2OCYC 4BFSA 5KHOC 3U2QA 3IR9A 3HTKA 2QROA 2V6IA 2BM1A 1NL3A 3B1XA 6Q21A 3ONWA 1G3MA 4G1UC 2DY1A 2G1KA 3AKEA 2ONJA 2O8CB 3AKCA 1DPFA 1ZUIA 1R2QA 2HJGA 2X2EA 5TMPA 4C7OB 1PUJA 4Q1DA 4RJLA 1ZUHA 2VRSA 2QRZA 2GF0A 4FIDA 4C3ZA 1HWTC 1L2TA 3QY0A 1JECA 1KJWA 3P26A 5GADl 3AGQA 1QHIA 4GDFA 1W36B 2W2XA 1OB2A 2D62A 4UXJA 1R5OA 4AURA 1SKYB 2ZSDA 4D2IA 4PTLA 3CNNA 2X2FA 3WRYC 4I1SA 1ZD8A 3SQXA 3UG7A 4FPPA 2JLYA 2NO6A 3VFDA 3SJCA 4UXIA 4GFDA 1ZRHA 3FWYA 4HYYA 1OFHA 3VX4A 2EU8A 1XMIA 3W8NA 5IDJA 3IO3A 2XXAB 1NJFA 4RY2A 1KMHB 3VX3A 1D6JA 1XEWY 2OXRA 2ZRKA 2OUKA 4JLDA 1CU1A 1GP2A 2GBLC 4DXAA 3F8TA 4GKGA 2QAGC 1XTSA 3NTUA 2BJWA 4BGDA 4RD2A 1VYUA 4ZDWA 3AF3A 4A6XA 3ND8A 1JR3A 2QN6A 2W2VA 2OBLA 4G5SA 1M7GA 4FCVA 1ZM9A 4LHXA 4L9SA 3SU8A 4NP6A 2BBWA 2IX3A 1VTKA 1XCPA 2CCJA 3GP8A 2C8VA 4OI1A 4L4UA 2PL3A 3DOEA 1I2MA 2G88A 3B9PA 3PV0A 3PEYA 1XZQA 4OQXA 5IF9A 1Y63A 5C4MA 1Q1BA 2Q0HA 3L8YA 3U3MA 4MA4A 1G8GA 2ZJ2A 2HEIA 3TW4A 1AS0A 4MRNA 1C4OA 2F1JA 1IQPA 1TAGA 1UEJA 1F6BA 3AVPA 1DAMA 5DIFA 2IUSA 2Q3HA 3H1TA 2EFEB 2WPQA 1DTSA 2OAP1 1Z63A 3L36A 2ZR9A 3QKRA 4ZI3A 4OI0A 2GCOA 1OSNA 1F2UA 2ZJYA 2VSFA 4M9SA 1Q3HA 1JQJC 4TMTA 2OG2A 5L3VA 1US8B 1W5SA 2F43A 1I4TD 1VG8A 4OQMA 4C30A 4Q7KA 3WYGA 4AWXA 3VMYA 3B78A 2R3CA 1XMJA 1ZM4A 3NTNA 3B85A 1I4LD 1EFCA 4PZYA 2OSBA 2ZYTX 4RFSB 4WW0A 5DYIA 1U8AA 5FUVA 3IHLA 3TMKA 4KFRA 5LD2B 3D36A 5AVRB 2FSHA 3EWAA 5JHGB 2ZRAA 4B34A 1E2PA 1G16A 1FW6A 4DDTA 1HV8A 1D2NA 2REXB 3LBHA 2Z4SA 4JLAA 5FTLA 1G3QA 2J7PD 4LWZA 4GCZA 5AVXB 1SHZA 2O8DB 1X8KA 1NN3A 4NBSA 1W48A 3SBDA 1EXMA 1BYIA 2QMEA 3IGFA 1G291 4JLPA 4JMPA 3KDPB 1QHYA 3H84A 1OPXA 3OIUA 3SOPA 1SXJE 5FUYA 3ASZA 1EK0A 2AK3A 3C5CA 1QZXA 4ZDJA 3ZZTA 4ZV4A 5CIQA 4UXHA 2CE7A 4N1AA 2CEAA 2HJVA 1E9DA 1SLQA 3DMDA 2GK6A 2PEYA 4OL0A 3THWB 2PCJA 1Q1ZA 3UK6A 1D2EA 4LV8B 4YDHB 4DKXA 721PA 1IONA 4NL4H 3A1VA 2VP6A 4C0AC 5EXPA 5A0FA 2RGAA 1N5IA 3W34A 4RD4A 5A4JA 4I1UA 4HB0A 1JEDA 4KVAA 1G1MA 4ZO4A 4DZZA 1IJFA 2XXAA 1EFRD 2JLRA 1L7VC 4TLEA 3V9PA 3Q8XB 3RS7A 3U61B 3V4RA 4XE5B 2Z6VA 2WPDD 1XDBA 3EPLA 2BDTA 3QKUA 1GK4A 4L8GA 3AVWA 3X1DA 2IYVA 4URYR 5C46F 1KI9A 4B86A 1AKYA 1MO6A 5HKKA 2CK3A 1E9BA 2CXXA 3FFBA 4HI0E 4TQUS 5AW3B 1ZNZA 1TQ6A 2NO0A 2QPAA 2FV8A 2GCPA 4Q4JB 2AXPA 5CDFA 4IVQA 3VR3A 1KSJA 3BC1A 2G3YA 1TUEA 3U3OA 1G8PA 1SGWA 3AP3A 4MH0R 2QAGA 4MDFA 4QG7A 1KDOA 1WP9A 1BYUA 3UXMA 1BS1A 2YWFA 4B71A 2ZUDA 5UKDA 3D31A 3EIEA 2WAYA 4MGZR 4Q48A 3K9NA 1CRPA 4IDOA 4CEJA 3PG5A 2A5YB 1JQLB 2H16A 4A36A 1ZD1A 3L0OA 4IRUB 4B33A 4C0SA 3GLGE 2WWGA 4DSUA 2ATVA 2PMDA 4JSYA 1G3UA 2ZRCA 3SS8A 1OXVA 1Z0FA 2F7SA 4BZQA 5AJYA 4LYFA 3GPLA 2DR3A 2JLUA 4I81A 1H8HD 2DPXA 2OFXA 2XJ9A 4I1OA 2ZS8A 4NKRA 3OFND 4NYIQ 3TQCA 3FPAA 3LBIA 3OEEA 4JVLA 4OHVA 2EYUA 1UKVY 2W6AA 1XRJA 4UJ5A 1HT1E 3BFXA 1U90A 3I72A 1U8YA 2FSFA 2IXGA 1NVWQ 3WXMA 1JJ7A 4F93B 4KODA 5FBVB 4AY2A 4DLWA 2ZQ5A 4IOJA 2GJSA 1N6RA 3CZPA 5FOSA 3W9YA 3ZCCA 3I32A 1OXUA 1H8AA 3DDCA 1RYFA 5F3WB 5KU1A 4U7NA 3HR7A 1HE8B 2JASA 1KAOA 4HATA 4NYMQ 1T2KC 4QHSA 1PVOA 4GT1A 4M1WA 3U4QA 4TMVA 3HU2A 2WJHA 2YINC 4CT4B 5FL7A 3RWMB 1E2DA 1IJEA 4B6FA 5JJKA 4URXR 1VG1A 2BBSA 2XX3A 5AWFC 4WXPA 2HT6A 4HAXA 3TYYA 4KCGA 4ZIRB 1YYCA 4RVCA 4BZXA 2CJWA 2XGJA 1U8ZA 4L15A 4EFNA 1OXZA 1UFQA 2ZIAA 3SJBA 2VHCA 1M74A 1N0UA 4UNNA 1MH1A 3CIOA 3T97A 1D8TA 1TUIA 1W0KD 2ZRMA 4U7DA 2AL7A 1U99A 3IBYA 4BLRA 2PCLA 3P7KA 1X6VA 3U3KA 5KPJA 1E1QA 4TLCA 621PA 2DFTA 1S9KE 3KXKA 3KX2A 2XB2A 4IOLA 3KXIA 2OM2A 1VHLA 5FH9A 4C2TA 1CP2A 4IFEA 5EXTA 2IEYA 1PLLA 4XSHA 4Q1EA 3AF4A 1EWQA 2W27A 5IDVA 1II9A 2GXSA 1CR2A 2RGNA 4OHXA 1ELOA 1UDXA 2GTPA 4O2RA 1X8LA 4A15A 5LDDC 1CJVC 1DAEA 4Q7MB 5TVKA 4NONA 4ZI2A 3VMZA 1JOYA 1R8SA 5CMZA 2FN4A 4GMDA 3QPUA 3UMFA 4EFLA 3M0EA 1KTVA 2ZR0A 1TADA 3BS4A 3DKVA 1Q57A 1VKJA 3FHCB 3NBXX 4V0NA 1BH2A 5EE0A 1ZYUA 1X8JA 3FMOB 3N70A 4A9AA 3B1VA 3HYTA 1T5IA 1OYWA 4Q4LA 2MMCA 4QNMA 2YO3A 2ORIA 1F5NA 1M7BA 3KFVA 4TQAA 3WHLA 2H57A 5KDLA 5DN6D 3HE4A 2JJ2D 5CJPA 5AW6B 1TF7A 1CJMA 4FWIB 4BLTA 1QF9A 3ZQ6A 4NCIA 4DCVA 2JJ8A 1JR3E 5H68A 1X3SA 1SULA 2ZUCA 1ZMXA 2GA8A 4JLMA 1HTWA 3C5HA 5FBWB 2YC4C 2BMJA 3DM5A 3BFVA 3SFZA 2CVFA 4AKGA 3KJGA 3ZS9A 2J9RA 3EIQA 1YE8A 3R9IA 1OIVA 2QT1A 3RSLA 3T5GA 2H17A 2ZS9A 1GL9B 1XEXB 4HAZA 1R0WA 1Z5ZA 2ATXA 3QQ5A 1W4BA 2OESA 1ZJ6A 2ZTSA 1LS1A 1JXOA 2ZJOA 1E2QA 4UNSA 5B1NA 5DHFA 2YV5A 4A8JC 1XCGB 3CWZA 3TSWA 1NVXQ 3A1UA 4QGGA 2VSOA 4PC1A 1RJ9A 3TJZA 4YMWA 2ASEA 1FUUA 4DIDA 3EC1A 1RRGA 2F3TA 2OILA 1J99A 4FMCF 5CB8A 1NLFA 4TMZA 2P6NA 3CZQA 2ZRBA 2QT0A 1N5LA 1Q20A 3THYA 1Z83A 1OHHA 3HDTA 3U3RA 4QM6A 1GKUB 2GCNA 3NH9A 2OAQ1 4ZIRA 1OKKD 1PLJA 3FHOA 1S9DA 2J0UB 4R9UC 3ZD6A 2OLJA 1FQKA 1XFAA 1E94E 4QBIA 1E69A 3PEVA 4M22A 2D2EA 4TQ9A 3NDPA 3WMGA 5E7IA 2FFAA 4DSTA 4R7ZA 3DZDA 2JLVA 1CTQA 5JS8A 2ZSEA 2XTZA 1II0A 2GILA 1UJ2A 2W0SA 2QMUA 4HLQB 4PSAA 1KDTA 1U94A 4GOJA 4EPWA 3LW8A 2WWWA 2Z5IA 2TMKA 4HB3A 4IHQA 4BWYA 2DB3A 1FX0A 4CEHA 3A8TA 1X1RA 1FX0B 2HV8A 3FDIA 3AUYA 2A5GA 4E03A 1B0UA 4UJ3A 4B3CA 2GKSA 2PBRA 3T1TA 5TY0A 2WBLC 3TVTA 4TL6A 3QG5A 1NY5A 4AG5A 2IT1A 1ZVQA 4M0LA 3QEOA 1YZKA 4MRSA 2SHKA 1K5GA 4PO9A 4GP7A 1XPOA 1Q1EA 4ERNA 1T4GA 4DLUA 4DVGA 1BMFD 3ZIAD 2XTMA 4JIMA 4K8OA 3SYNA 1NSFA 4GI7A 3IO5A 2Z0MA 3BAFA 1T9HA 3L35A 3F0TA 1IXZA 4PHFA 1II8A 2GJ9A 2JJ1D 1P61B 3ADKA 3CH4B 4AD8A 3CRVA 2Q7CA 1UKZA 3VR6A 2EW1A 2ORVA 4C0HA 3OHMA 1TTTA 2F1RA 1CJTC 4FMCB 3NXSA 2NO7A 2A5DA 5K8UA 4R98A 5TDHA 1Q44A 3IQXA 5K8TA 2ZJ8A 1G20E 4DLXA 4EAQA 5BWMA 3B8HA 2LFSA 1NKTA 1WDTA 4TTRA 2D3WA 3GLHB 1CEEA 2ODEA 1FMJA 3IIJA 1N5JA 3ZDQA 4ASUA 4XWOA 2BCGY 3CPEA 3TGPA 1PUIA 4XH9B 4PSKA 3SFVA 1PZNA 3CONA 3N2IA 5GVSA 3ADDA 3D6TB 2AKAB 4F7WA 1KOFA 3IILA 2ZROA 3Q7PA 4CDGA 2ERYA 3CF6R 4YONB 1G7SA 3VU9A 1L4YA 2YOHA 4Q20A 1SVMA 5F9HA 1YHNA 3OE7A 4FCTA 4RCZA 3I8XA 2BMDA 1IXRC 2QQ0A 1MV5A 3CBQA 2W83A 5G3ZA 3B8EB 1YR9A 2QTHA 3MWKA 1IN7A 1G18A 3AP1A 4LJ8A 3NBFA 4GNKA 3N5CA 4Z1MD 3TNUB 1E6CA 4AYXA 3CLVA 3QVUA 5M04A 1A02F 1GZSA 3SDZA 4DCNA 1K6MA 4QNRA 2CCKA 1FMLA 3MMPA 4IEEA 1MO3A 2ZU6A 4XJXA 2P65A 1OB5A 4AQRD 1U0LA 4QPKA 1JNMA 1N25A 1P4SA 4PXAA 4HB2A 3KZ1E 4D0LB 3U5ZB 2H5EA 1OYYA 2NPIA 3IQWA 4GZLA 4TTPA 4ESHA 5BN3A 1HT2E 2B7BA 2PMKA 1D9XA 2G1JA 1J70A 4PPNA 3NEJA 2PX3A 3PQCA 4PFSA 1XTRA 1XU4A 3FKQA 1GL7A 1E9AA 4JBYA 2JAQA 3PUXA 3CPJB 1T3SA 4KP4A 1WF3A 2D7CA 1ZNWA 3CH5A 3RRZA 1N6HA 4ZDIA 4O3MA 2ZE6A 1DE0A 1NVUQ 2Z43A 4XOIA 2WWIA 3R8CA 3K9HA 4PR0A 4TLAA 1E0AA 2W0MA 3THOA 2ODWA 3GJ3A 5JECA 2Q9AA 1KY3A 3BK7A 5HPYB 2N1BA 4XWAA 1LF0A 2WSMA 3L43A 5FOUA
chains in the Genus database with same CATH superfamily
2BEQD 1Y80A 1TGOA 2IY9A 4V39A 3HE5B 2A94A 2FE1A 2V6BA 2HOQA 3QXHA 2QIOA 2C1ZA 2OA0A 2YS8A 1P5JA 1JIVA 4E5NA 5KCZA 2AWNA 2JCSA 5LMNB 3KPVA 4TV9F 2RHOA 3Q10A 1V55B 1OW7A 3TGUD 3B77A 4PSUA 5DE3A 3V8RA 4JEUA 1H38A 2PZ8A 4Y28J 5KHKA 1RCUA 2O0LA 3MT7A 3PEEA 3ROGA 2GF2A 3OETA 4ON9A 3GT4A 3I83A 2WSLA 5JZBA 3FKSA 2N9BA 1I4DD 3BCHA 3ZDYB 2OV1A 2HSZA 1BL8A 5U1PA 3RIHA 3KQVA 4B6RA 1F48A 1FZAA 1ABBA 4B3HA 3R0JA 1TQHA 1U6JA 4FJ0A 4MYHA 5K51A 4QDKA 4D8VA 2QTTA 3NASA 5MN4A 5J2TB 1EIZA 3WU2E 3A7DA 2HB6A 1RPRA 1YR3A 3E82A 3MCVA 4ZVTA 4LVCA 3IE2A 1OZ0A 2QORA 3SSOA 3SWFA 2ZI5A 3TQHA 4JNCA 1KOGA 1OAOC 3OZ7A 5KTPA 4B6JA 3HKBA 4D6TH 2POQX 1XD9A 3QO8A 5L7YA 4BMXA 2O05A 4E46A 2BGNA 1VQ4V 1DGQA 4FFKA 1U9JA 4N40A 5TLSA 2XNJA 2Q5EA 4IDBA 2C2WA 4PZUA 3BBPA 3HBAA 1E4OA 1PG5A 3R44A 1O03A 3W7XA 1OKKA 1XREA 2Z2IA 2Z2KA 2ZIXA 2IPXA 2JO1A 3K1AB 3AKYA 4JS0A 4N5MA 5I6DA 1IY2A 2YWJA 2OZLA 3SR3A 5KTNA 2I54A 4N3AA 4EHHA 4NQRA 2BFNA 4RU1A 1GN6A 1A1SA 1B14A 4B3SB 1IEXA 4R1LA 4B3FX 1I4OA 3DZJA 3KTAA 2VHJA 5DO9A 5EWLB 4MVQA 2QY9A 1QFZA 3U1TA 1DRVA 2IZOA 2QN3A 3H8WA 3IHKA 2IU3A 5CGZA 3BXZA 1N2ZA 1R4AA 2XCOA 1LTAC 2I8DA 3G5MA 5AKIA 5HM8A 4C2UA 3SX0A 3OZXA 1KMQA 4LY9A 3OQIB 2LBPA 1ZLZA 1JYFA 4NI5A 1ADJA 1V1RA 5F5LA 2B4YA 3O90A 2GBFA 1KYXA 2BI4A 4B7AA 5AM3A 4CEIB 2FEMA 2WA2A 3D3KA 1Z6AA 1AU9A 2J8ZA 2QM3A 4JQOA 1Y3FE 2NTJA 4LZOA 1MT0A 4JF3A 1M7HA 2PANA 3WZMA 4IDHA 2XV5A 2EVWX 2J9YB 2NXCA 4KXNA 4JI6B 3TUIC 6ADHA 4EYYQ 1J49A 1J23A 1MORA 2J7PA 2LXNA 1BAPA 2PZJA 3LFTA 3QOFA 3WFZA 1URQC 2HU8A 2ZIWB 1E5WA 3SICE 4BEVA 2SCUB 2YUTA 1JB1A 3PFGA 4ETMA 1DO8A 3VHLB 2HSEA 3EF0A 4DCGA 1LSJA 4YAKA 1YS7A 4WCVA 5CM9C 1Q95A 2NZWA 4I8DA 2WLKA 2C84A 3R3HA 5ALGA 4K3VA 1XVUA 3ZY5A 4UCOA 1AQ5A 1OIPA 1W4CA 2R6FA 3KZCA 4EG8A 4LOLA 5C1OA 4RAIA 3IUMA 2IBMA 5D1HA 1AHIA 5IKXA 3Q15C 4FHEA 2OTLP 2FZLA 1MAWA 2XV1A 4BRYB 3HI4A 3IE0A 3FR7A 3PNBA 2JJ1A 2W6IG 2QNBA 1PL5A 1KFEB 1VXOA 3KDSE 1W0JA 3CZMA 2NAPA 1RZRA 1G5FA 3K6RA 4TTQA 4X8MA 1X87A 2X9NA 1B8PA 1RRKA 5DSTA 4DLPA 4C05A 4B3JA 3RBXA 1ID1A 4P80A 1Q6ZA 1X0TA 3BD9A 2H7YA 4CRWB 4Q9JA 5K5EA 1PQWA 1W0KG 4UUQA 4A7PA 3QXJA 5CW2A 4TUYF 3FNHA 4G5YA 1B16A 3ITDA 1CR1A 5BVGA 1AKUA 1NOHA 4FR0A 1F2TA 2B83A 2GEBA 2IKQA 4FLXA 4G5OA 2JR8A 4GOKA 4E31A 2EZOA 4YN3A 521PA 1B0AA 1KI3A 2ZJ6A 1ZXGA 3I12A 1ISSA 1J0EA 1PS8A 3K5OA 3O1IC 3AERA 3OZRA 3PKZA 4WNCA 3ZDAA 3WLEA 1E79H 4Q3DA 4E94A 4NJMB 4KMOA 4H13D 2CFRA 2QA4V 4NPEA 2HJFC 1KPGA 3FTDA 1IK6A 1NN5A 5DIZA 5K6AA 2QLJA 3BSFA 3G02A 2A9VA 5IJ9A 2NU9A 1N6LA 1A97A 3GYGA 4OG2A 1B4DA 3RGBA 2JCBA 4FT4A 4PFQA 4PYQA 4MTGA 1NG1A 3JD3A 5LXTB 3KKOA 1E1QD 4N54A 4P34A 1U1IA 4I4TF 3VHXA 1WY5A 4LNAA 5BR8O 1UIXA 1FEZA 1XKLA 2ZU0C 1T0JB 1SB8A 3RVDA 3LQFA 3T7KA 5FQNA 4BLQA 1IHYA 3IYLW 4CTNA 3ONNA 1N9ZA 3K9LA 5JSZA 2WW8A 5JS1A 1KILC 1DS6A 1SVWA 5A6SB 2P22C 1LRKA 3WBBA 1RAIA 1RC8A 3IBGA 2G25A 3SJAA 5K8IA 4FE3A 4L9AA 3ZE9A 4ZNCA 1CQJB 2VUIB 1GAXA 1TCAA 4DDMA 2R8ZA 3K09C 1H93A 4X1KB 1M10A 3OCWA 5ALYA 1P72A 4CV3A 5L40A 4IDPA 2OGZA 2ZWOA 3DGEA 2B94A 3R7DA 3W6OA 3FFQA 3PTLA 2GB4A 2WZ7A 1MMMA 2ABWA 5H6RA 2GXQA 4PW0A 1MJHA 2KPOA 3RFUA 4MQBA 1TQ4A 4MYTA 5FFNA 5D84A 3G2NA 2LWIA 4QA9A 5CMLA 1YH3A 4HWKA 3GB7C 1C2YA 1NW4A 2A5JA 4ETIA 1FDWA 2ZSUA 3THXB 3U3DA 3A1SA 1G9XA 1K05A 4O6VA 3M4YA 4OYYA 1EWKA 4OHRA 4YA6A 1MX9A 4DWOA 4QE9A 2VI5A 3CN7A 1HDRA 3L49A 4JUCA 4KL8S 4WBXC 1W4AA 1Z0ZA 3I9V1 1ZN8A 1M1JC 2PI4A 3FCAA 2KB7P 5AVVB 1DK1A 1ZL2A 3IT3A 4LRUA 4MCHA 4B6EA 2BTQA 4HH4A 3NDBB 4YK7A 4L76A 2Q8QA 2ZVDA 4EMTA 4CS3A 2EBWA 4BPBA 2Y9ZA 3QVTA 3OY2A 2RMKB 1VI2A 4KUGA 2BFPA 5DXJA 4E07A 2BYTA 3H1KJ 4GPEA 2KJQA 3F3YA 1K5QA 3LYUA 2W4MA 1QBZA 1P5RA 3N07A 1ENYA 2FMLA 3AI7A 2NUPB 4O2LA 4Q93A 1VPTA 2FMXA 5JQGB 2CJPA 2ZUTA 4MQMA 4QOHA 4HAOA 3WXBA 5CFZA 3W7WA 3CVXA 3AEUA 4KWEA 4Q47A 1O95A 1J90A 3D3JA 2XCLA 4JHXA 3BQMB 4B79A 4Y7CA 5BMVB 5D01A 2XGOA 3CZ9A 1RNLA 2FQQA 4JK3A 3WLRA 4AJIA 4GQAA 3QYAA 1L5SA 3H13A 5FORA 3TQOA 2X13A 3KELA 1ODCA 2LKCA 4M7RA 4RA6A 1E2IA 4QFBA 4PTYA 4Y6GB 3R65A 4X1YA 4TSKA 3BCCD 1W1WA 2CGNA 3UWSA 1JW9B 4ZKEA 4OAQA 3CMEV 1V1MA 4W5OA 2PAFA 4XJVA 1MRNA 3I42A 1JVBA 4R68A 4DR4B 3OQHA 3GJ4A 3I0ZA 4P08A 3H05A 5LMUB 3E8HA 5CBOA 1BA3A 1G4UR 1LPAB 3H0CA 4NENB 4RF3A 4XQGA 4HYQA 4EF4A 1FZGA 1HE1C 4Y1GA 4G84A 2XNDG 4JKOA 1KQFB 1O9GA 2H94A 1O94C 2YJ4A 2R68A 5LZ9A 1B1CA 1I7QB 3U4QB 3HEMA 4UCQA 1KZYC 3EW9A 4ZOCA 2GV9A 1XEQA 1W8IA 1FJGB 1W87A 1ZP6A 2OECA 2ZYDA 2WHPB 2XNDD 3BICA 1VCIA 3GCXA 4MRMA 2JS5A 3UJ7A 3WDKA 4FU0A 4WFBV 1H8EG 1ZD9A 3HEBA 3N0RA 2GFQA 3AUAA 4TKZA 4LF4B 2EWWA 2H2IA 2PYLA 3KUUA 3TIVA 4EELA 2I8AA 2UUBO 3KTOA 5DTIA 1KOJA 3ABMB 1C9KA 3A0RA 4DG8A 4Y2PA 2DKOA 2WZQA 5AW9A 5IHPA 4C3OB 4JYZA 2H54A 2P5SA 3MJTA 2ZSBA 4B85A 2Q7OE 4GC5A 2J59A 4NJOA 1COZA 2HBRA 4KRXA 4X6XA 1VBMA 2R8BA 2ZPTX 3PFNA 5E9WA 2VXBA 2F64A 3COZA 4HK4A 5BW4A 1T4BA 3P20A 5JSUA 2PUGA 4Z51A 2IHBA 2IIVA 4AX4A 4IX1A 2BGWA 1ZICA 4BNVA 4O4JA 3S28A 4EW2A 1CUHA 2XQKA 2C92A 2XHBA 3DKRA 5EP1A 1LDYA 3DEKA 4FOOA 4ERXA 2K88A 1JIKA 4LE0A 1Y6RA 4C3UA 4NULA 2CMDA 3N8NA 4OQFA 3TOXA 3LIDA 3MD0A 1P8JA 3ZEDA 3CRQA 1V7ZA 2E87A 2OB1A 4FYMA 1OQAA 3TR0A 4XGIA 3BERA 2WHYA 3EGOA 1X7XA 4LQCA 4UUBA 3LD9A 5IC4A 3GPCA 2XVXA 4UW9A 1KQGA 4EPVA 3D6VA 5ERGB 2VPIA 2C9MA 1SELA 3G0BA 4CL8A 4KXWA 1RM3A 4PLFA 1M1UA 2J87A 3GJXC 4GPD1 1E2KA 2EOAA 3SJZA 5KYKA 3ZUGA 3GLHA 5DX1A 1VCHA 4JX8A 1R3DA 1OC2A 5I7VA 2CNWA 1X74A 4G8JA 3AINA 1E58A 4K9LA 1NYHA 4DRZA 1A9XA 2V45A 1DJQA 1NLZA 1X7WB 1DC4A 1QS0A 1R8QA 1PZXA 1TVEA 2I6UA 4O5AA 5HVNA 3IKTA 4JT2A 4JTAB 1FYEA 3LY5A 3OAAG 4Q4JA 3KXPA 4WKGA 3ZHCA 4ECEA 4OGQD 5BRAA 4Z4FA 1O77A 3CSSA 2G28A 2VEOA 4FW9A 4NJMA 2Z5GA 4NZPA 5GTIE 1XNQB 1LJUA 4HGQA 4OLFA 4CIDA 4IL6E 5CD1A 4ETNA 3R3UA 3L71H 1Y7PA 2OTCA 3HD7A 3CVJA 4RKYA 4RFVA 1CY1A 3VRHA 3H1PA 1WVIA 2Q1KA 1Y1TA 2RB4A 2WIFA 1EZ1A 2P4KA 1E3EA 1KC3A 1T6AA 2MSCB 2ZXFA 3BB1A 4LIPD 5L4NA 1GU0A 4LMBA 2KP8A 2I1KA 2V0CA 3USES 2A06H 2DTEA 4CF6A 3MCTA 3HM2A 1WJZA 1PV1A 2R2GA 1QORA 3U44B 1UKYA 2AE2A 1LD3A 4Z0TA 3S4YA 1E3MA 3UFXB 4K3AA 1ULUA 3LPMA 3OQVA 2M6SA 1MB9A 1BX0A 2RH4A 2W6OA 4PX9A 4IUDS 5F2NA 5KX5F 4EY8A 3ASYA 5CB4B 4XQEA 1Y48E 1HUCA 3HU1A 3H01A 1D09A 1P9NA 1LPOA 3T12A 5JWHA 3MQ2A 5EY5B 4UOZA 1SFCC 3D4BA 1AMNA 5HCUA 1VYVA 3ROQA 1EGQA 3I34X 3R20A 1NPTO 1A9YA 4Y6QA 2AN4A 2NAFA 4UPDA 1E3SA 1ONBA 3OLCX 3LLMA 4ZOLF 5D6OA 3S55A 5L53A 3A4LA 2HWUA 2WLIB 1XX6A 2ZRLA 4D96A 3T9EA 1CUZA 1FXWA 2CL5A 2ECOA 4IH1A 4Q37A 4B6QA 4GPZA 2ZQMA 2GEUA 2PX0A 1RAHA 1W5AA 2QTVB 3ABQB 4KNWA 3PN1A 1BDDA 5EZ6B 4P33A 1AM4D 2Y0BA 3ZWWA 5CEEA 4CIWA 2Q3FA 3L2OB 4KAXA 4EM6A 2BMWA 5AW7B 2R8OA 2MSDB 4IAOA 2Q5OA 4CPGA 2QRNA 3KZKA 3AE2C 2GM3A 3BORA 5AI0A 5H6QA 1SQVE 4LV6A 3AW9A 3UW3A 4OOFA 5ICGA 4P4NA 1NONA 3RU9A 2TMGA 2BMEA 1LWOA 4L8YA 5CYPA 5AM4A 5JMPA 2QBYB 1Y5MA 2HA6A 4AIIA 1A69A 1G6HA 5TC4A 3MWYW 3LQ4A 4LJ5A 5KREA 3SC2A 5HOQA 2IVZA 1LLQA 2I0FA 3SQMA 2CFOA 4BVLA 1MNGA 5J2TA 3QZUA 4U7TB 3QSYA 5A7FA 4DR1O 3KB8A 4MPJA 1QL1A 1IATA 5FTKA 1KI4A 5LMZA 1USUA 3PK0A 3HB1A 1YMQA 2R6AA 2IUTA 3IPCA 2PGDA 5FO1A 3GK3A 2XZTA 1S4MA 3ZHRA 1LTJB 1QZTA 1VQLP 2W6PA 3NBAA 1J33A 1Q1AA 2P6PA 4RVSA 5G53C 3W6PA 1SPBS 3Q1LA 3VPAA 2JFVA 4RQAA 1HX7A 1QG4A 3EIOA 3O91A 3L72J 4MJXA 4CKWA 4Y67A 1Q0TA 1GARA 4J1TA 1P6UA 3IAS6 2EFDB 4DM3A 1MJ5A 4K8RB 4FZ0A 3CNQS 3ADDA 3FJOA 1KNXA 2Z6UA 2OAGA 2KI5A 3HWSA 3FXEA 1RRFA 2G83A 3B51X 4R2XA 3WLAA 4E12A 4UMVA 5L8VA 3ACCA 4DDWA 4UQLA 4CH3A 2POCA 3BMQA 3S70A 2WNIA 1LNSA 1XRNA 3EEYA 3L93A 2GUGA 3OZWA 1D07A 5EHIA 4MUNA 2IDKA 4GLFA 4A8PA 2YS6A 1FVXA 2J3QA 4FFPA 2NPFA 3UGKA 5IJZA 5J58A 2D6FA 2JBHA 4TTIA 1A9QA 2O5CA 4FFSA 5YASA 4X62O 1L0LJ 2MJZA 2A0WA 3LUBA 4YDRA 5KYNA 4LC0A 3HYSA 1P1RA 3BRSA 1IBMB 2XCIA 3T5PA 4FDLA 4Q6GA 2QL5A 5THQA 3THRA 1XJCA 1BDIA 1ODTC 4M6WB 4MEJA 5MHTA 4XD7A 1N4AA 1O5IA 2AR9A 2YJ5A 1K3EA 1LQ2A 4BNNA 2NV2B 3I0NA 4CZ2A 5E38A 4INAA 1R0YA 3D8RA 3O21A 4NATA 2QD4A 4NZ9A 5EWMA 1Y8RB 4WXYB 3BT7A 1MOZA 1NTME 5HFMA 4NRDA 3ILSA 2Q6IA 3RPEA 3SI7A 1LR1A 1XL6A 1D9ZA 2R70A 1NW9B 1AI5A 1P2GA 3KCQA 1CP3A 3H2YA 3DMRA 1S2DA 2P4QA 3MQ4A 4ZTBA 3UQ8A 4EECA 2CV1A 2XPCA 4X7RA 4TYYA 4HLDA 1GZ7A 5EK0A 1JHUA 4J90A 2W2PA 2DQYA 4GI2A 1J8QA 4D80A 4KPEC 1LW6E 3CY6A 2OYHB 2EGUA 3TM5A 4WOJA 3MRXA 1HE4A 3I3SR 1LB1B 3C7DB 1D4OA 3UO2A 3ID6C 3TIXB 5HJ5A 5B1AC 2MYPA 2B2XA 3PQFA 1SMKA 3EVNA 2I5PO 1MAVA 1FPQA 4GHWA 4XFDA 5FO0A 2NU8A 2P6JA 4FEAA 4DV2B 1GT91 2OO7A 4HXEB 4XKJA 3ROZA 3TO5A 4IMRA 2RD2A 4IHKA 4HT3B 5K45A 2ZITA 1WE2A 3CVYA 3B8EA 3ORQA 3OWXA 4QPZA 4RTLA 1HNXO 4J16A 1NG9A 2R7LA 2WAMA 3FAVA 2JGKA 4MB0A 1NXQA 1LT9A 4U9HS 2IHUA 4Z4IA 2EKPA 4ZU1X 4GSKA 3FPHA 5DRYA 3OAAD 4ALMA 2X19A 2GDSA 3X1XA 5HKLA 2GN8A 4NG4A 4XARA 2DECA 4I9UA 4KKVA 1JIQA 2HUNA 5HF8A 3L4JA 1SH7A 2XJ4A 3M83A 4CMCA 2OHFA 2ZJBA 2QMHA 3ZWCA 3P8CD 5G3ZA 4DIBA 1YIDA 5BOSB 2QMYA 3PWTA 3VPBA 1BVYF 1E3JA 2ODAA 3GLIE 1O94D 3TBHA 5K5GB 2V55B 1ZZEA 2I2WA 2VJPA 4N0EA 1VQ9V 4FUTA 4Y2TA 3SM3A 3W5JA 3ZWYA 3V8EA 4KL1A 1JFFB 1K66A 1SUCA 2A1UB 1A9ZA 2D06A 1OA1A 1WB5A 1YE5A 2OENG 1K5PA 5MF6A 2DXIA 1E5QA 4YGYA 2GUVA 3ZMVA 1TKBA 5CLJA 3B1FA 2CJWB 3HWWA 4BGUA 3CG4A 2VOJA 3ZIAA 2XSZD 1NHGA 3NV7A 3GJ8A 2AR7A 1RAAA 4AY4A 4O2BA 4CKBB 1YBVA 4UTOA 1MNQA 3FWPA 4ZCIA 2NU6A 4GRIA 1EZVE 1VLQA 2FGKA 3NYQA 4YXDC 3V3KA 2CXQA 2V03A 3E5HA 3C1OA 3GA5A 2BTOA 2JIBA 2WYIA 4F4CA 1NVVR 5B37A 3AETB 1RLIA 1TK9A 1XTIA 3G2JA 1Q91A 1P5ZB 4J03A 4LOKA 4BQQA 1E7MA 1CDZA 1EX1A 4UDXX 5CA1F 1E3DA 3KZIE 3WIEA 4C76A 2ZNIA 2P8SA 2VN8A 5CT5A 4KYIB 1AIPA 5F51A 1QIGA 1RF0A 4MKXA 4TYMA 1JMYA 3T1QA 1R66A 2DPYA 3TLGA 4HSGA 3OKAA 2VJKA 1TECE 3IIEA 4J7UA 5KWEA 1O7JA 4FMDF 4ND8B 3VPFA 3DEFA 3A4MA 1Q6YA 4RK0A 1M9NA 5EGNA 1WP8A 1GGJA 1CG6A 1V16B 2OGTA 2NZ8A 1EUDA 3RT7A 1M5TA 1G6Q1 1VIVA 4F4FA 2F8TA 2R8EA 3CCLP 1LNQA 4X8HA 1VCOA 3I2IA 3OQIA 2NPSC 5DHRA 2HJRA 3HY4A 2UV8A 2JK1A 3LYHA 1U3CA 1UDCA 2A0XA 1YHZA 1NVEA 2Q4DA 2W71A 4Q1FA 1A4RA 1N32B 3D1VA 1NX9A 1VSBA 1M34E 3DCJA 4A03A 1QYIA 2YV4A 3UO8B 4YT8A 4DR7O 1XF9A 3G2HA 3UK2A 4E08A 3H75A 1PKXA 1Y7IA 4BIOA 3ENZA 4DUZB 3JQ6A 2Y1EA 1NJGA 3DW1X 4MKZA 3BZWA 3OOYA 3R6LA 4OK6A 1JG6A 2CNWD 4OQDA 5BW5A 1Y76B 1FLAA 1L4MA 4LP8A 2WRZA 4ZVUA 1UM8A 1JDNA 4JEMA 1V8DA 2OCAA 1UKEA 4IF6A 5JE8A 1UKCA 1HDYA 1QIJA 2VHUA 1C1XB 3BJEA 5JROA 2WC1A 4XDKA 3GT3A 4QU0A 1QQCA 1XNJA 3BOSA 3X44A 2WA3A 4P30A 1FNDA 4XWGA 2PZSA 4QVIA 4Y2QA 2UXDB 1YIAA 2SECE 2E1RA 1XTJA 2WAXA 3AM3A 1DAFA 1K2WA 4N8EA 3HFGA 2QUKA 3Q2OA 3ZWNA 3A2KA 1I2AA 1ORRA 2AMFA 1WKCA 4YY3O 2FFHA 1Y67A 2H18A 2GZ3A 2R87A 3CUWA 3E8GA 1K68A 1CZOA 4UCWA 4YHBA 4HQRA 2PWAA 4FDTA 2CHGA 3LP8A 4URZR 4EEXA 2P40A 5LZ5A 5CA3A 3O8BA 3S2GA 3F2VA 1CDEA 4GQIA 3ZXIA 5JCZA 4U00A 2BCCJ 3I5CA 4AYCA 5KUMA 2BWJA 2OFWA 3NI2A 4G1CA 4HCJA 4M8NE 4WY2A 3UAXA 1WN7A 3SQWA 1IL0A 5CA1A 5LWQA 2AX4A 4MAAA 4OJKA 4NBKA 3UMSA 5JAIA 4M49A 3V4LA 2RH5A 3EWIA 5TXGA 5B7QA 1RVDA 1SOAA 1TA4A 1XJWA 2H31A 2NG1A 3OCYA 4JJZA 3RS0A 1V6SA 4NOKA 3Q4GA 2VHTA 1WXDA 1P7CA 4OXNA 4N6JA 4S24A 3RIYA 3RRJA 3PNVA 5IN5A 4AAYA 3AG3B 1P2FA 5JH7A 2O7RA 2B2NA 4MWTA 4BV9A 2VRWA 5TF4A 1ZMBA 5DB4A 3EX7C 2Y1CA 3O8ZA 1RW4A 3NIFB 3OZBA 4RL4A 3WADA 3L1HA 5FPPA 2ZTHA 3P96A 4E4YA 1R27A 5J9PC 2O6HA 2WWHA 3KJNA 1FYDA 5BMOA 3H3JA 4LF9O 1NWQA 3C0KA 4DIFA 1QF6A 3M9WA 2V7UA 5KTRA 2IY7A 2C82A 4XWTA 1F4PA 1SZPA 1BCRB 3FETA 1I6WA 3FSGD 3DEHA 3L71J 4M55A 4XX0B 4NTXA 3B8NA 3C45A 2E0IA 3DDWA 1ODFA 4RMNA 4U6QA 5DSXA 4QPCA 1P3Y1 4HDNB 4ZI7F 3B38A 4ARZA 2CL0X 5KNDD 2JIMA 4RMJA 1VA4A 1WABA 1GADO 5FB3A 4IHJB 1KJZA 5KAFE 4KGDA 5GINE 3OGIB 2O3TA 3JQFC 5CCHC 2EZ4A 3O3OB 4KK4A 3UG6A 1GQRA 1GFIA 3IF4A 2OQVA 4B4OA 3VR6H 5KLIC 2AYXA 2O8DA 4FB5A 2ZIOA 2BM9A 2Y8EA 4Q19A 2A3RA 4HNRA 2QRGA 1JYSA 1L4FA 2P3LA 3LT4A 4FVTA 4QDTA 4W5JA 3ZE8A 3SPIA 1UAAA 3B5JA 1IY1A 3BCRA 3AK1A 2N75A 2XAFA 1UJWB 1YASA 2A0UA 2VK2A 4Q3OA 1BX3A 1V7QA 1X1QA 2C94A 3EIHA 4BX9A 1QIFA 1SBTA 1QKJA 4INJA 5J1TB 1KYOH 2EBHX 2MT9A 1M1JA 4KBFA 4KE9A 3IRVA 4QYIA 4RZ3A 2F9LA 4WECA 3DZ8A 1JU4A 3PJRA 4PAOA 4PRZA 2YJNA 1YXMA 2G63A 5C7IO 3F5TA 2RIPA 3CCFA 2VNIA 3IEPA 3A05A 4MQUA 5AW8A 4OXXA 3WK5A 1BD4A 3ASVA 2X6AA 1VF5D 1FJPA 2P06A 4GPIB 3T54A 4B1FA 4CNQA 3D5EA 3O6QB 1EUYA 2JFPA 1ISHA 1UFRA 5KLVE 1JSRA 1OXXK 4DLSA 1DKQA 4RACA 5KSZA 1KAGA 1R18A 2H1FA 3EFOB 4FC7A 3TNYA 3NOQA 3HDJA 3CWBD 4PRKA 1MKYA 4QOFA 1BA2A 5GJCA 4JCOA 3H9CA 4ZVQA 2UUAO 3ADCA 2Z4EA 4AHCA 4BASA 1JDJA 2OYQA 1JSCA 1LNZA 2JS7A 2R1TB 3FMGA 1FSFA 2CZCA 3K0HA 3FDXA 3ODGA 1WKBA 1V25A 1JB9A 4MIYA 3Q87B 4CMEA 5IKPA 4LZLA 2B5WA 2EJRA 4RJIA 1L5VA 4G5HA 1K3FA 1OU0A 4YVFA 5DM4A 1EBOA 4RJ2A 2XTNA 3A25A 1KB9H 3BN3A 3UEOA 5FUQA 1T3UA 1YBMA 5KHAA 2LFRA 1OZFA 4OJMX 4D8TA 2F3RA 3NP9A 1ZIOA 3PPYA 3ABRB 2YIUB 3J7TA 1NI4B 1ZC3A 3F78A 4ZYTA 3MJEA 5EJEA 4NENA 4JBGA 2BPOA 2EJUA 1J07A 1ZGGA 2FPSA 3Q8MA 4TTSA 1TE2A 2EHDA 3NGMA 3UBTA 1OLOA 1OFCX 3UWDA 1RXWA 1R9GA 3HCAA 3NKVA 1T8SA 4LSGA 4PHGA 3LIEA 1LBEA 2G8NA 3E9YA 1ACJA 3CCVP 2J3LA 3HFJA 4N3YB 3I9KA 4LWSA 3CVUA 3SGIA 2Z5UA 5I51A 4UUNA 4MUAA 4CEHB 2B4AA 2DJVA 1NYRA 1ZXLA 1X9IA 3F98A 4ZP1A 3NTOA 4UCTA 4XPIA 4QTXA 2RHWA 1ZN7A 4A0GA 3R5XA 5K0BA 1YONA 3HJGA 2C7PA 1OTYA 1U7MA 1YZ3A 1GPWB 3HNPA 1N2XA 3IP1A 1JQBA 1F0KA 3JYNA 2E4VA 3IP7A 4HC4A 2Q73A 4RMGA 1ND5A 2RGUA 4ZXFA 3A31A 3LT5A 5CITA 4EEZA 4QPPA 3VO9A 1GYRA 1QHTA 1XMQB 1KU0A 3N2KB 1T36B 2GSDA 2DUJA 4FNAA 5TRTA 5AOBA 5U9CA 3WA7A 4UM5A 4UULA 1OVMA 2C5SA 3H0EA 1MVNA 2BEVA 5THXA 3IJ4A 1ZOPA 1TU0A 4CDMA 3AFHA 4CM9D 2CH7A 2CFIA 2ONKA 5IP5A 4ZMSA 1E5LA 3S1AB 1T3TA 1MJGA 1CK4A 4AULA 1JEYB 3V5BA 3P4YA 4PC3A 2LKDA 2ZAOA 3FNGA 3LL7A 2CDBA 3URMA 3EG9A 2R6DA 4LJRA 3ZGZA 1I7DA 2HYIC 1N36B 5FNVA 3ORRA 1S2MA 2CXPA 4DPMA 3T1OA 3AJ8A 1OPRA 1OF1A 3GJ6A 4EHLA 3M5PA 5EHQA 4PPGA 3HKEA 4H44D 4IHJA 3DMNA 1LDBA 4V0ME 4LOIA 3ZW9A 2WG1A 3BBLA 1M2FA 2NSJA 4CLOA 4M0CA 3DLBA 2R6R1 3VVLA 1ZAKA 2CKDA 2HLDG 3OAKA 4MKRA 4J4HA 2DFNA 1G41A 3EHEA 2ERXA 2RI0A 2DT5A 4J0DA 4TKVA 4CC6A 4R83A 1BKYA 2QVBA 1QZUA 3E1IA 1ESNA 2O5EA 4HQ0A 1E2FA 4H35A 1VRCA 1H0SA 1NXXA 3GRFA 1H22A 1NMYA 2X4GA 3L01A 1Z56C 4HRYA 4L02A 5FI1B 3TE6A 3ZK9A 4JJGA 1G6UA 3K2BA 4AW9A 4B17A 5LPNA 3N4XA 1G21A 4URWR 4FKZA 4R7GA 1ZIYA 3T0FA 1X39A 3A6PC 3DH0A 3EMVA 1GSAA 4K9MA 2DFKB 5DLQC 1QBGA 4K9KA 3QLEA 4ZAWA 4PR3A 4CN8A 2WWTA 2NNUA 2X8AA 3UYLA 2JCGA 3TPCA 2PQ2A 1TJPB 2IEIA 4LX0A 3E22B 4LUCA 1CZKA 3WBKA 3L0PA 3WIBA 2NU8B 4JQCA 4QVKA 4GMKA 1F8FA 2HSDA 3RYFA 2I6TA 4Q02A 3FH0A 4MCAA 4BB9A 3U7HB 2W70A 4BRYA 4I46A 3UJCA 4K46A 4R8RA 4K8XA 1FYJA 2PS9A 3FVVA 3SSNA 1BH6A 2EIHA 1BG6A 4C08A 2OV3A 5KHIA 5G02A 3L73G 3AF0A 3CX5I 1T25A 1UT5A 3HCPA 4ROTA 1QO7A 3LG2A 1ZLLA 3AQ4A 1YA8A 4AY5A 4EUNA 2PRIA 1ZAUA 4UVAA 1FP2A 2IE0A 3ZR4B 3WKAA 4UBKA 4EVIA 5ELMA 2WJVA 4F2HA 4AZWA 1URQA 4O63O 3CT6A 4G3XA 4YP5A 5HIMA 5KYGA 4DLLA 3KQNA 2UYQA 2VDUE 5HKKD 1GR0A 1JDVA 1UMCA 3A9WA 3B6EA 3PNLA 2XOXA 1NPDA 2FPWA 3EBOA 3U60B 2DE0X 3V55A 2AV6A 5KYYA 4CMKA 1MEJA 2C31A 2ISSD 1DTOA 3DOOA 3O4FA 4X88A 2BKVA 3P9RA 4IILA 4RD0A 4WCFB 3WGKA 2QGZA 3IQGX 2RGBA 4D4LA 3SFDC 1N7IA 1FRVA 1NSYA 4D3FA 4QU5A 1TK3A 2XAGA 4L0MA 5KX5A 3E3LA 1SXQA 4J0KA 3MTBA 3P94A 5ES3A 2J5UA 3JSNA 3H1HH 1DUSA 1PWHA 5CG2A 1FTGA 3PL5A 5DYGA 3UT6A 3JVUA 2JKVA 3GD7A 1KH1A 3DAGA 2WVGA 4MIOA 2O4CA 3H2HA 4IIFA 3T5DA 4BRUA 1F7YA 3S2EA 2HCJB 3K32A 1MQ9A 3AFMA 1KB9D 1G6OA 3UCEA 1R5LA 3JW8A 4GE3A 3V1YA 3PL1A 4B5LA 4MLPA 2JJYA 2WPNA 4I6GA 4QATA 4OYLA 4PNZA 4J0IA 3F97A 4RD3A 5FLYA 4YCMA 4L28A 3V2NA 5JAOA 2Y71A 1SZJG 5AXDA 3O9OA 1V3VA 1E2EA 5LVAA 4MWGA 2FUG6 5ILQA 3K79A 4IH4A 1JLKA 1H05A 3F9IA 3QO5A 3I5AA 3QKRB 4Q18A 3LWDA 2BFOA 4J9VA 4YGXB 5FUMA 3T7RA 3ZW7A 5AO9A 1DAGA 1FP6A 4DQUA 3EOZA 3W8RA 1ECBA 5JJIA 3EXHA 1DBWA 4EPRA 4TVBA 3I9OA 3WLJA 3E3MA 4E4TA 4ZN6A 4OLBA 3RS4A 1SQVG 4GVLA 3OHPA 1KBOA 2FF7A 3M6VA 3K9FC 3G5UA 4MW7A 4Q9HA 3BTVA 3RK2D 2HM7A 3JQAB 4LK2A 4UMDA 1BE1A 1CQZA 1FP4B 3ETNA 4Z9AA 5DM0A 3WIDA 3HC7A 5CVTA 5KJFA 5CCGC 3H9QA 1D1SA 4BP9A 2QMQA 2RGXA 3KR2A 3QELA 1DO0A 1A2OA 1ZMOA 2WM3A 3RK3B 4BAZA 3LCRA 3T5BA 4JTDB 5ER6A 1HZZC 3WWOA 4PU0A 1AQIA 1N78A 3EVEA 2PGLA 4M46A 4E5YA 1I94O 1ZM3A 4I0WB 4YBRA 1R6AA 1R5NA 1ECGA 5IWAB 1DJLA 4JJ7A 5LJLA 3W8DA 4JAUA 4D57A 1CQJA 1VG0B 2XB4A 2R7KA 2CJFA 2C3UA 3Q98A 4JXKA 4L5JA 1SCAA 2KB1A 1EX7A 2A79B 3GCGA 5CJ2A 1CD5A 3LUKA 2ZJ7A 2FMIA 2ONZA 5FA5A 4KQ2A 3E7KA 1SXJD 1A8PA 3L0BA 1GTL1 3RADC 3CO0S 3GJTA 1A50B 1E7RA 3QUAA 2DBZA 1RYMA 2FPLA 3KZOA 4CFSA 5C18A 1TUEB 1COWD 3E61A 4UD2A 1P7PA 4RTRA 2D0PB 3WWZA 1RZ3A 4DFDA 1KVSA 4N8DA 1J21A 3D4PA