4JYCA

Meab, a bacterial homolog of mmaa, in its apo form
Total Genus 115
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
115
sequence length
322
structure length
311
Chain Sequence
PDMDTLRERLLAGDRAALARAITLAESRRADHRAAVRDLIDAVLPQTGRAIRVGITGVPGVGKSTTIDALGSLLTAAGHKVAVLAVDPSSTRTGGSILGDKTRMARLAIDRNAFIRPSPSSGTLGGVAAKTRETMLLCEAAGFDVILVETVGVGQSETAVADLTDFFLVLMLPKKGIFELADMIAVNKAGDGERRASAAASEYRAALHILTPPSATWTPPVVTISGLHGKGLDSLWSRIEDHRSKLTATGEIAGKRREQDVKWMWALVHERLHQRLVGSAEVRQATAEAERAVAGGEHSPAAGADAIATLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Methylmalonyl-CoA mutase accessory protein
publication title A switch III motif relays signaling between a B12 enzyme and its G-protein chaperone.
pubmed doi rcsb
source organism Methylobacterium extorquens
molecule tags Chaperone
total genus 115
structure length 311
sequence length 322
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2013-03-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03308 MeaB Methylmalonyl Co-A mutase-associated GTPase MeaB
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.287.130 Mainly Alpha Orthogonal Bundle Helix Hairpins Helix Hairpins 4jycA03
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4jycA01
3.40.50.300 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold P-loop containing nucleotide triphosphate hydrolases 4jycA02
5EXSA 3HU2A 5JEEA 2N9BA 4KU4A 1TUEA 3IR9A 2VRWA 1KI8A 1JQJC 1U99A 3MAAC 1Z83A 3CR7A 2BJWA 2H16A 1YZQA 1G21E 3AF1A 3ZRVA 4UNNA 2DB3A 3NIBA 4PZZA 4GKGA 5J40A 4TYNA 2AD5A 3CZPA 4FMTA 4RCYA 1QHHA 1W4BA 1XD9A 2CL7X 2V4ZA 1GSIA 3EWSA 1XEWY 4JLBA 1W47A 1NMXA 1M6NA 1W48A 3SU8A 3R9WA 2CLCX 3TUZC 1BIFA 3FGNA 2GZHA 4PC1A 1FNMA 5JS7A 1GFIA 2A3RA 4EKDA 2WWWA 2ZANA 4G5QA 3M9HA 4PPQA 5LDDC 5AJWA 1AN0A 1ESMA 1NVUQ 4ZIRB 1G9XA 1L4UA 2Z5HA 1VCIA 2Q3HA 4P4UA 3RS2A 5FPYA 1BMFD 4B86A 4BFTA 4B35A 3EZFA 3AVYA 1G7RA 2J0VA 2Q3FA 4MKHA 3K0AB 2BVNA 3VR5A 2YOFA 5AJZA 3BH6A 5AJYA 4Q5IA 2R32A 2DFTA 4BFSA 4N0EA 3AVTA 3ND8A 4TQAA 4BASA 3KZ1E 5GADl 3GMTA 3NKVA 2ZI3A 5G40A 2VHUA 3QY0A 3Q9LA 2QTVB 5HE9A 5APUA 1FNNA 5DI9A 2J87A 4QNRA 1G2CB 4DCNA 1Z22A 3LH5A 1TF2A 1C9KA 2IYTA 3F3YA 1J2JA 2H5EA 4LJ6A 4MRRA 4Q4AA 3AUYA 1N6OA 2ZUDA 1U98A 3GLIB 1Z0AA 4U00A 2G0TA 2NO9A 1G3RA 3WNDA 1JUNA 4Q1BA 1XTIA 3L36A 1KK2A 1KI6A 1QRAA 1U90A 4IDQA 4QBFA 4B3BA 4LBYA 4V0OA 1R0ZA 1T5IA 3BOSA 4NKRA 2NO0A 2OCPA 2VO1A 4OI4A 3ASZA 4D0LB 1ZUIA 1E0JA 4Q03A 1QG4A 3DL0A 1C4OA 4GP7A 2GVZC 2VPPA 1U8ZA 4DDUA 2SHKA 3MFYA 1ZIOA 4TL7A 4Z51A 1V5WA 4BZXA 1CZQA 1QHGA 3LXXA 2Q9BA 3QKRA 4M8NE 3H1TA 4HATA 2PEYA 4UNPA 5AUPB 1R5BA 4RKEA 5IDVA 4JVMA 2JLSA 5D3QA 4KLNA 5AJXA 1COWA 2O0HA 3IIJA 3VQTA 1Q3TA 3D31A 2P2UA 5DIFA 2FG5A 2QRNA 2J0UB 3VTKA 3RRMA 5CB6A 5AVYB 1E32A 4MITA 2ZI9A 2ZU6A 1OPXA 1S3SA 3L2OB 5H68A 4JAUA 3DPUA 1E94E 3CWZA 1RRPA 1IXRC 1SULA 2BKEA 2BKUA 3AQ4A 3CM0A 1S2MA 4Y0VA 1OJLA 1P9WA 3OE7A 1Z0KA 4Q4JB 2KI5A 2A2ZA 3UXMA 4L9WA 3FKSD 1OKKA 3NMDA 1A4RA 1N6HA 3R7WA 1CBUA 2FMXA 2OBLA 1E2NA 1XJ0A 3VR6A 1IN6A 1Q1EA 2WAXA 3KXKA 3ICEA 2P7JA 2IYUA 2FSHA 2A78A 2VP6A 4TLAA 4OI1A 1Z06A 3RS5A 2O5VA 3NBYC 5CDFE 3D7MA 2ZROA 2Z43A 3ONWA 4RESB 2FF7A 3U4QA 3NDPA 1J7KA 1N5JA 1VCMA 3T06B 1D9XA 1H8ED 4AC9A 1WBDA 2Z6VA 3SHFA 3MCAA 1RYHA 3PEUA 5J5CA 2JLUA 2KP8A 1DVRA 4BFWA 3SI7A 2OBNA 2IXGA 1Q22A 1ZINA 3LQQA 2ORIA 5FL7A 3ZZUA 5AVRB 1KSFX 1Q1ZA 1J90A 3LRPA 2PCJA 4YC7A 5HR5A 1HYQA 4DB2A 1S9KE 4POAA 2EQBA 3CNOA 2GEVA 1LNZA 2I1QA 2C9NY 1KO7A 2X2EA 1XJQA 3A36A 2ZYWX 3FTQA 1DPFA 4A0GA 4JJZA 3B6EA 2NO7A 3BWDD 1T3SA 2ZITA 5EUMA 3ZVLA 2C03A 4AYXA 1TL7C 1GG2A 5APWA 1OHHA 1VYUA 2YWGA 1NL3A 1FW6A 3Q85A 2E87A 3OIWA 4XH9B 1P3JA 2JJ1A 5AJVB 5KNDA 1JR3A 1XX6A 1PZNA 3BJIC 2J7PD 2DPXA 2E1RA 1F60A 4DT1B 3M0EA 3K0CC 4Q01A 1XEWX 3TAHA 3H86A 1AK2A 4PAMA 5KDLA 1IN4A 4ZIRA 3A3YB 1KNQA 4F93B 4JLMA 3U7FB 3N70A 4L16A 1TEXA 3X1XA 4MUBA 2XJ4A 3RNLA 2JLXA 3AV0B 1TUIA 2DWQA 3QF7A 1YQTA 1SQ5A 3K0AA 3K70D 2GJAA 3C16C 3P20A 1Q44A 1Z08A 1KDRA 1OE0A 2XNDA 4HAUA 5CIQA 4CZ2A 4EQ6B 4ZKDA 4Q66C 4UXHA 1OH7A 1PJRA 5AVUB 1FX0B 4TTRA 4F4JA 3CBQA 2W2VA 3CH4B 1P9RA 3CX7A 1OXSC 1RZ3A 3CW2A 1NKTA 4Y0AA 4WOPA 4RZ2A 3IHLA 1N6IA 1R0YA 2CHVA 2QPOA 3EASA 4M1TA 4A82A 2WJJA 2AHOA 1JAHA 2IC5A 2MSCB 5CLQA 5FPTA 4WVFA 3CRRA 3GLIA 3LBHA 1U0HC 3CNNA 5BN5A 3UATA 1NBMD 2ZXEB 4L15A 1CRPA 5BYKA 3LIEA 3KXIA 1F3OA 3L35A 4I1UA 4LYAA 1CS4C 5DHFA 5LB2A 4ASUD 2P6RA 1FZQA 1RFLA 1RKBA 1YR6A 5K8UA 4YXWD 4CRWB 1Y3AA 1W2GA 1GVNB 2W58A 1GNRA 1U9IC 4PO9A 1JXMA 3QXJA 4UJ3A 3RYTC 3TUIC 3ZD6A 1CR4A 1KDOA 1X3SA 2QZ4A 1JR3E 2IYLD 3PG5A 4QM7A 1G7TA 4JZKA 3G5UA 1S9DA 5SZIA 3VR4A 2VSOA 3ZS9A 5AW3B 2IYZA 1OIVA 3WXMA 2RH5A 2YZ2A 3KKMA 3PEVA 2YC2C 2J0UA 3ZVNA 2F1IA 2V7QD 5D3MB 4EPRA 3CPHA 1CULC 1A2KC 1U0LA 2EW1A 2OFWA 2YOHA 3TAUA 5J47A 5KOYA 2ONJA 3H84A 2DWOA 4ACBA 1T2KD 1OF1A 2X1VA 2C9YA 1DE0A 1XMVA 2OV2A 3DKVA 3L37A 3PIRA 4XIGS 2R44A 1SVKA 1ZNYA 1Q21A 4UJ5A 5JJLA 4Q4JA 3WYGA 1HE1C 2MMGA 2ZSAA 1HURA 3SQXA 5GJVC 2RGEA 1EXMA 1UDWA 2V54A 1QHXA 3K9LA 2E43A 3OE7D 4KODA 2EWVA 4X8LA 1H88A 5IK2D 1XB2A 5J4LA 4BE7B 5A4JA 4IDOA 1OKKD 2V6JA 1E9DA 4TL8A 3T5DA 3EPHA 3OEEA 3GLIE 1OH8A 2HT6A 2XITA 4LJ5A 3WYFA 2BBSA 1ZM4A 4YMTA 1XD8A 2D3WA 3KUDA 3ZLJA 3NC1C 4M1MA 5F9HA 2YWHA 1JEDA 2GWHA 2OESA 2QAJA 2FWRA 1SLQA 4O3MA 1EESA 2PEZA 1P2UA 4QGHA 1WXQA 4Q1AA 1YRBA 1RW4A 2PLFA 3D8BA 3K9HA 1IBRA 4G3XA 4HI0E 4PPGA 5FOSA 1NAFA 2C78A 2PT7A 4F4CA 2XV5A 4AKHA 2XOKD 3BORA 5JZVA 1X1SA 1E4VA 3RWMB 1M2OB 1NIPA 1E2PA 4HAVA 1LB1B 5KDDA 1G8HA 3NHBA 3JVUA 3ZS8A 1FTSA 1ODFA 4LHWA 3KKQA 4E22A 3QBTA 3QSYA 3IGFA 4G1UC 2WSSA 3V4QA 3SR0A 2W27A 2ZRKA 4GNKA 1G41A 1WF3A 3NWJA 3FVQA 4RD0A 3A4NA 3UANA 2W2TA 4C0QC 4URWR 4A6PA 1E1RD 1W4AA 4C0JA 3QG5A 2QSZA 1GKUB 4GP6A 4ZV4A 1E98A 1GOTA 1UBGA 2RHMA 4LHZA 4DT1A 1DO0A 2IYRA 1T3LA 4CGZA 3T34A 1AGRA 1XTRA 3RRNA 2P5SA 1SVWA 2BDTA 3I62A 4E03A 2GCOB 4LJ9A 2ZU0C 1KZ7B 2PBRA 3LVRE 2BM0A 3DM5A 1YRAA 1I4LD 3ZQJA 1KKLA 2WKRA 3U7HB 1JB1A 2LWIA 4EQ6A 3RANA 1OXZA 3MGNA 1E9EA 1BS1A 2IA5A 1GNQA 3T97A 1FX0A 1P62B 3AGQA 621PA 3AF4A 3BXZA 4BEJA 2C9CA 3SN6A 3PR1A 4EFLA 1AKYA 2XNDD 3GJ3A 1G1MA 1G17A 4JVLA 1AQUA 2OT3B 1XCMA 4NBSA 4DIDA 1XMIA 1RYFA 3CRW1 4JYBA 3EC1A 4NHOA 4L4UA 3TK1A 2J1LA 4BZPA 3IO3A 3NXSA 3LXRA 5JECA 1TNDA 5C4GB 2F1JA 4CEJB 1Z0FA 1A5TA 1PLLA 3HYTA 3LO5A 1N2CE 4Z1MA 4BLSA 1GUAA 2NPIA 4YLGA 2IS1A 4ZPXA 3U61B 3EPLA 4PANA 1XNJA 2RGNC 4BWYA 1F48A 4HLUA 4QJ5A 3KQKA 1HUQA 1S9HA 3GJ7A 3B78A 1WDTA 5H1YA 1W1WA 1DAEA 2ZYUX 4LC1A 1E2MA 3F0TA 1UEJA 3F5FA 3KUCA 4PHGA 4KI0A 5JWRA 1M7GA 2R6AA 4NYMR 4HYYA 3VR2A 4LJ7A 2YO3A 3U60B 1GP2A 3BB3A 4B44A 4BEBA 4JKYA 2WWGA 1GITA 2F1HA 1Z6YA 4EPTA 3FDIA 3ADDA 4KFUA 2WZQA 1W36D 2RGCA 1KK1A 5GJCA 1X6VA 2WAYA 3TR0A 4F91B 5D3MA 3AVVA 4A8JC 4MYUA 4TL9A 1G8YA 2FDCA 2AWOA 4V0NA 1JAIA 3UKDA 1IO4A 2IL1A 4NZYA 4TYWA 1JOYA 3EIQA 5L3SB 4DDWA 2OCAA 2CLSA 4DBLC 1KMQA 3M0AA 3R8CA 5AW7B 3U7EB 4NL4H 3HE4B 4GOXA 1NLFA 5DE3A 2QMOA 2W6JD 2CLDX 1HT1E 3ND9A 3A58B 3BC1A 1SXJC 3K0FA 2VP2A 3AKEA 3QF4B 3THOA 2FFHA 2RGGA 2R6DA 4U7OA 5HZKA 3BGWA 1TU3A 2GZDA 4QHSA 1KO4A 2GEUA 4G0NA 4DKXA 3A5TA 1VHLA 1IM2A 4JMPA 1ZW6A 1G18A 4QL3A 3EWAA 4QKQA 2D74A 4G5SA 4US2R 1RVDA 1EWRA 5KO2A 1AS2A 1HJBA 1ESNA 4EAQA 2ANBA 4OHYA 1DAGA 1U8YA 2FSGA 4PSVA 2GAOA 3U3MA 4N3NA 1ZC3A 4MA4A 3SJAA 2VEDA 5L3RA 4ESHA 3LIDA 4GT1A 2LKCA 1K6MA 4Q20A 5FBRB 4PZLA 4HUTA 4K8OA 3GP8A 3HP1A 3VX4A 3CLVA 3LD9A 3LX8A 4BLRA 5L3VA 3K0SA 4B73A 1KTVA 1F2TB 5C46F 3R9IA 4B2LA 4AQRD 1G6OA 3GJ8A 1VIYA 1W0KD 4GCZA 4DLSA 3KB2A 1YZUA 4V0MA 5EE1A 3REFA 5L8VA 4PFSA 1UBFA 3SYLA 4CW7A 1NIJA 5LD2B 4AD8A 3ECCA 4XVUA 2ZSEA 1FUUA 1QVAA 3VKHA 1BMFA 1KO5A 1PUIA 1D2NA 1E0KA 1CJVC 1XMSA 2G83A 3T1QA 3K70B 1JQLB 1QHSA 2W6ID 1OLOA 3DKPA 2C96A 3EZ6A 4GI7A 3TH5A 3VAAA 4A2WA 1KI7A 4JT4A 1KSGA 2IYSA 1K5GA 5KHOC 1SVIA 2HYIC 2DR3A 1CLUA 1W0JD 2HCJB 4IRUB 2QE7D 3CF0A 2D7DA 2GCOA 5FBQB 4D26A 2HUPA 3CR8A 2JJLA 3TLXA 1FFHA 4GZLA 3CONA 2ZFCA 1H8AA 2C04A 2NQ2C 2VP0A 2ZRAA 3DVLA 2QM7A 1AS0A 2NMVA 2WWIA 4G5GA 2C8VA 4MUAA 2WWFA 3CX8A 5JFGA 4Q4LA 3EX7C 1RJ9B 1TF5A 1YHNA 2WBLC 4XWAA 3U3JA 1UKYA 1EX6A 4FMCF 3RHFA 3TGPA 3EZ7A 2O8BB 4W7SA 2G3YA 3V4WA 2WICA 3B1VA 1EWQA 1KAOA 2IXEA 2QT1A 1DADA 3V4RA 1CEEA 2IYWA 3UMRA 3MSXA 1E2KA 3W90A 4FMDF 4Q7JB 4E07A 2BEJA 2AKAB 1TADA 1UM8A 1ZC4A 4AIIA 2ZRFA 4UQOA 3OIUA 4CEJA 2ZJ5A 3WMFA 4D4KA 1NVVR 4GPTA 2XB2A 5IRCD 1TQ2A 2LCFA 1DH3A 1ZNWA 4XTCS 4O2LA 2X19A 3FHOA 4NCIA 2NTYC 5TDHA 4EPVA 3PVSA 2XNSA 3KKNA 3N2EA 1X8KA 1ZCAA 3QXHA 4V0ME 4PSKA 4KHXA 4ABYA 4JAVA 4RSGA 3BB1A 1SZPA 4DIEA 1VHTA 4FMCB 1OFUX 2OAP1 2PH1A 4OJQA 2VP4A 2ZAOA 4WIAA 4ZCLA 4D4JA 5E7MA 4XD7D 3LBNA 4FCTA 3T61A 1E9RA 4FMDB 3NHAA 4GZMA 4NMMA 2XSZD 4OHWA 4US1R 5FOTA 1OYWA 2O8CB 3TQFA 4CVNA 4M1SA 4M1OA 5FI0B 3FKSA 2B7BA 2ZVPX 1UKEA 2FU5C 4TTPA 4QHTA 2FPLA 3VMXA 1N5KA 1OXVA 1VMAA 3ZIAA 5HTKA 2PT5A 3KB1A 2XZPA 4EOTA 2YWEA 3MWLA 1JEEA 3LW8A 2O52A 2WJGA 4OI0A 2BEKA 4GMDA 2JIZD 3O8ZA 1RRFA 2HXSA 4D25A 3EPKA 4OQXA 1M7BA 2ZJAA 1KO8A 5L3SA 1GZLA 1RRGA 4V0LA 3EC2A 1GWNA 1VYTA 5TY0A 2CVHA 3BRWD 1L7VC 4NYIR 2WJYA 3WHKA 3IBGA 4M3LA 3HE4A 2GBLC 2QRZA 4HZIA 2ZJ2A 5KUTA 1X1RA 3KQGA 1XF9A 2QPTA 4B71A 4JL5A 1X8JA 5LB4A 3B5JA 4QC2A 3QF4A 3GLHB 1NJFA 2ZI5A 1F6BA 5KSPA 3TKLA 4B6FA 1B0UA 1SGWA 3HR8A 4QFMA 2JATA 3IIMA 3WMEA 5AW1B 2KJQA 2JLWA 4YDHB 5J4VA 4GOJA 4BRWA 2A9KA 3L0PA 1SVSA 1OW3B 1NVWQ 1G20E 1YR9A 4DB4A 2WV9A 1FOSE 4JLOA 2Q5UA 3NG1A 1ONBA 2EVWX 5G41A 3GJ0A 3V00A 5CJPA 4M1KA 1Z2AA 3OAAD 2ZVQX 5DYGA 1OSNA 5J4YA 1E2FA 2G6BA 3DMDA 1F2TA 3U2QA 4EFNA 4PC7A 3VN0A 5JHGB 2J7PA 3GEEA 2NZJA 4QGAA 1P60A 1NY5A 3C5HA 2WIAA 4DLWA 3SEAA 3FMIA 1E79D 2QBYA 4LYHA 2E42A 4NP6A 3OF5A 3KQHA 3VTPC 4XE5B 4Q9JA 3SDZA 2VHJA 1YVDA 5JWOA 2C2HA 2NO1A 3LW7A 3B82A 3N2IA 4A1FA 2NGRA 4UNSA 2RKOA 1M1YE 1S96A 4BFVA 3NDBB 3CIOA 1NG9A 2R5DA 4QG7A 4S35A 1Z07A 2HF8A 2VHCA 5AWFC 3M0DA 5BXQC 1G4AE 3IBYA 5ELXA 1NMZA 1BYUA 4JLAA 4D81A 1G3UA 2KE5A 1UF9A 4CEHB 1GAJA 4HYTB 2O8DB 4M53A 3UIEA 1T0HB 2ZI7A 1R8SA 4IW3B 5KPJA 5E7IA 1SVMA 1GL6A 4RD6A 5FR2A 1RPZA 5EE5B 2WT7B 5B58C 4HLDA 1RE0A 1RJ9A 1NBMA 4IDHA 2O8BA 2H7VA 5J4HA 4P0TA 4LK2A 3I92A 5EE3A 5HZHA 1E6CA 2QY9A 1N6PA 4JJKA 1A7JA 3TVTA 2ONKA 4HLCA 5FI1B 221PA 3DMNA 4ASUA 1JPJA 2OFOA 2VA8A 3AF2A 2DYKA 2QPAA 2EFHB 3X1YA 5LPNA 4YXWA 3EZ9A 4L8GA 2XX3A 5KDOA 1WP9A 2ODEA 1E2IA 2F1RA 1XPRA 1XRJA 1LS1A 1U81A 2AXPA 2ORWA 2R6GA 4DXAA 2J0SA 4KFSA 4YMWA 4IXNA 3BAFA 1AM4D 4AI6A 1H8HD 4DRZA 3CO5A 1W36B 3LWNA 4A2PA 2D06A 1X8LA 2B8WA 3E5HA 4LX0A 2FPMA 3LVQE 3MWKA 4M0LA 4BECA 4BGDA 3KFVA 2V7QA 4Q9LA 3TNUB 4KCGA 4AYTA 3H4MA 1A02F 1E2QA 3AUXA 2GRJA 3K09C 2BC9A 1Z29A 3I72A 5AR1A 4Q1FA 4IJMA 4Z8XA 1CR0A 1YE8A 4E5UA 4Q9IA 4W5JA 2O8CA 3DM9B 4HAWA 4M1YA 4H9GA 2RGAA 1M74A 3CRQA 4MKGA 2A5FA 1I2MA 1T8TA 1XFAA 1D2EA 2FFQA 1VG9B 1ZBDA 1JECA 2A7QA 1DO2A 5SZJA 2FFBA 5IK2A 3GQBA 1QHYA 2BBWA 3TQCA 1MKYA 3B1YA 4NH0A 2FSFA 3RLFA 2RCNA 5HCNA 4CEIB 3ZIAD 5GVRA 3A2AA 1NMYA 1X8YA 1VYVA 2VSFA 1NBME 1P2VA 3FE2A 1II0A 3E2IA 1QG2A 3QG1A 4HDCA 2AR7A 2C9LY 2FTKA 5AW2B 1S8FA 2CCKA 4MYTA 2WKPA 4YONB 4KVGA 1OFIA 1OWAA 2GTPA 3SE0A 3GLHA 1KY2A 2D4HA 5CM8B 4OK3A 4MTXA 4LC0A 2XOKA 4FINA 1G5RA 4C0AC 2PL3A 2ZI6A 4R2HA 2AD1A 4TLDA 3P4YA 4ZDJA 2GCPA 1BOFA 1D9ZA 3WNCA 3AF0A 1M8PA 5FOWA 4O0MA 2QQ0A 3EXAA 2A30A 2UKDA 5JJKA 3EIEA 1E2LA 3TRFA 4B76A 3AVWA 3I5CA 3SFZA 1DAHA 5CMZA 1E1RA 5JHHB 2D7CA 2HEIA 2VF7A 4R9UC 1CI6B 4LI0A 4S2EA 3R9XA 1SKQA 1R0XA 4N0DA 1P4SA 3N5CA 2ZTSA 2YKGA 4C7OB 3Q72A 5F9FA 1T5LA 4NYIQ 5SZHB 4JSTA 3G0HA 1BH2A 1JPNA 3W5IA 1N5LA 1KMHB 3VMZA 1GKYA 1ZD9A 2FV8A 4KFRA 1NSTA 1ZAKA 2GDJA 2YWFA 1HV8A 3CB4A 2BASA 4MRPA 4OL0A 5FPHA 3IPYA 1F51A 2NPFA 2CCJA 2X2FA 4QBIA 4NONA 5H70A 2CHQA 2XEXA 3RABA 1GTVA 4OQLA 4EJSB 3IEVA 3TW4A 1FMJA 5F3WB 1PVOA 4HSEA 3K9NA 1O3YA 3W5JA 4B2IA 4I1OA 2NO6A 2IEZA 4DSOA 1CXZA 2FNAA 5TVKA 2OILA 5AW6B 2JGNA 4F92B 3FFBA 2F3RA 4ZI2A 3W3AA 5JCZA 4LJYA 2JASA 4CEHA 2HV8A 4XSGA 1R5OA 1YZGA 3NTUA 4IFBA 4LV5B 4Q48A 3HWSA 1SP4A 2ZE7A 1FQKA 4AKEA 3I8XA 4MRVA 3ZQ6A 1Q57A 2O8DA 1HEIA 1WQ1R 3Q5EA 5FBWB 2WT7A 2IYQA 5SZKB 4JT2A 4OJKA 3GLFA 4TSFD 4MRNA 5L3QB 1A1VA 3X1DA 1NF3A 1IHUA 2BMDA 3A37A 4WXPA 2GILA 1MRSA 3QPUA 1NN3A 4OI2A 3KQNA 3VKGA 1HE8B 2ZAMA 2C98A 5IDJA 3L8ZA 5JI2E 2Z4RA 2QGZA 3IIKA 1S3GA 2WJIA 4KAXA 1FOEB 2CMKA 4JLNA 2PZGA 3QVUA 3E1SA 4IEEA 2VTKA 4OHXA 4LOAA 3RSLA 4A0HA 5H8WA 1MO3A 2RGDA 2OUKA 4C0LA 2ZS9A 2QAGB 3V5BA 3NFQA 1KK3A 1P9NA 4TMZA 3T35A 2C77A 1DS6A 2GAAA 2CL6X 3I3SR 2R9VA 1MFZA 4XJXA 5FTMA 4ZO4A 4BLQA 4OHVA 3NH9A 3FKQA 1UAAA 2H8KA 5CIWA 4TQUS 3REGA 1MO5A 4OK5A 1ZP6A 3TNUA 2VP5A 2XJ9A 2ZSDA 3V9PA 4RCZA 1W7AA 3IQWA 4IOJA 4B33A 1XXHA 1P75A 3A4MA 5EXTA 4QM6A 1G6HA 3SHWA 2FE4A 4F4IA 1CR1A 4D82A 4MKFA 3ZVRA 3KTAB 2ZR7A 1Y63A 3EW9A 3KXLA 3LLUA 1VG8A 4OK6A 2H17A 4ZDWA 4EPYA 4B32A 2JJ2D 2VIIA 1E69A 2N46A 2ZRMA 2W6JA 3B8HA 2BV3A 4FCWA 2QTFA 3Q3JB 2MSDB 4QGFA 1DG1G 3RDPA 1E9CA 3FMFA 2ATVA 3DHWC 3DZ8A 3W6OA 4CEIA 2HXYA 2F7SA 2AWNA 3K0FB 4BIZA 1S9KD 2VYFA 4US0R 4F38A 3U6KA 5GJBA 3MD0A 2IS2A 1MH1A 1LF5A 5JSZB 4TTQA 1U0JA 5BQ5A 4MQBA 2DFKB 1KNXA 2EYQA 2X8AA 2ZREA 5M04A 3Q5DA 4PHHA 2ERXA 1NJGA 4DCTA 2IBMA 2XGJA 3KJHA 3OEHD 1NNEA 3NH6A 5E95A 1RC8A 3M6AA 4RFSB 1G64A 2ZYTX 1P2TA 2KBFA 2O0JA 4DWJA 3BERA 3B85A 3RC8A 1DAKA 1AZTA 1W0KA 1Z3IX 2I4IA 1LV7A 3AVXA 4M21A 1XZQA 2DFNA 4KVAA 1XP8A 4URVR 2R6FA 1K8RA 2QI9C 5C93A 3AGPA 4ON9A 2JEOA 3SBEA 5JJIA 5G3YA 1G291 4QBHA 4HEJA 3B7GA 3VKWA 3ICQB 3DZDA 1CI6A 2VSXA 2W6IA 3CNLA 4QPJA 1KJZA 2Q9CA 5CJ2A 4HB4A 3G82C 2IUSA 3ZD7A 3NC0C 4IDPA 2FX3A 2VLIA 1OH6A 3GPLA 4C7OA 5DLQC 3PITA 1XPOA 1W0JA 4DEYA 4KJZA 2QE7A 4D0GA 4XWKA 3ADKA 3L43A 4LV6A 4TMWA 4BUJA 4PC6A 1KMHA 1YZTA 2Q9AA 3A6PC 3WP1B 1G4UR 1FP7A 2F9MA 4DEXA 1SVOA 2WMOB 5EP2A 2GA8A 5DSZA 2R6CA 4G5OA 4EJSA 2HLDA 3PUYA 2ZUCA 2C9OA 2ZRDA 5AUOB 1J70A 2P0EA 2OFXA 2AK2A 3MWJA 2ASEA 1OIXA 5FOVA 4C0HA 5B57C 2JLYA 3P4XA 1UBCA 2ZETA 4URYR 3X1WA 3R20A 2JCSA 3QKSB 4URZR 2FGKA 2IPPA 1G8GA 3NEJA 4NDZA 4Q4HB 4IKEA 3GLGB 1Z5ZA 4I6MC 2QGNA 3A1TA 4PAQA 3RWOA 1G5TA 1P61B 3QJYA 4DUGA 5FPKA 1ETUA 1Z8FA 2R62A 3SOPA 1GILA 3W3ZB 5TB5A 1AIPA 1GKIA 1HQCA 2EWWA 4TYQA 3UMFA 1YZLA 1YZKA 3HTKA 5APXA 5L3QA 1DAFA 3CH5A 5HPYB 2H1LA 4M2LA 2IUUA 5CK4A 1US8B 3TMKA 5AVZB 2Z83A 2ZJ8A 4UNQA 2CHGA 2Q7CA 3ZRXA 3AP1A 1KDTA 1DEKA 3GJXC 5FL3A 2ZEJA 2WIBA 2IS4A 3W6NA 4D4MA 1NRJB 4YMVA 1UKVY 4XD7A 2QAGA 4KBGA 1JNMA 4MGIR 1XTSA 1F2UB 2XSZA 2ZS8A 5FTKA 3GCGA 1OXTA 3ZGXA 1MRNA 2QROA 3U3OA 3BFKA 2F55A 3UIAA 4U7DA 4QRHA 1AA9A 1DOAA 2BM1A 5JMTA 4FN5A 1NWQA 2QSYA 4PC2A 3QNUA 3H2YA 1PLKA 3QOFA 3SQWA 2AN9A 4LPKA 1VECA 3EA0A 4B3CA 2JIZA 3NEYA 3TSOA 2B92A 2GXUA 2OO7A 4DLZA 3WY9A 2RGBA 5A0FA 5DI3B 1JXOA 3AVUA 1U94A 2ODWA 3A0RA 1P6XA 3JZAA 3KTAA 1IJEA 1T6NA 2CK3A 2JDIA 1HT2E 2QQEA 4BPBA 2JLVA 1E96A 3O8CA 2GJ9A 1WMSA 3OFND 4NCHA 4YMUA 1DBSA 3FOZA 4LHYA 2VL7A 1T91A 3ETLA 3L82B 1MUUA 2BIFA 3ZZTA 1JI0A 3THXB 1J8MF 3THWB 1EX7A 3F8TA 2ZM5A 1MOZA 2FSIA 2GBLA 1XCPA 5APSA 2EFCB 2WPQA 1ZRHA 2GK7A 5HCIA 2PZFA 4Q1CA 5JSZA 1ZM3A 1N5IA 3LBIA 1CSBA 1W44A 2ZJYA 3VNUA 1R6BX 1F5NA 3AVOA 5FUYA 4A2QA 4O25A 1I4DD 3TSZA 4HAZA 1SXJD 4R7ZA 4H1VA 521PA 2IXFA 4UNRA 5FTLA 3LLMA 4JASA 1TAGA 3TYYA 3B9QA 1KI4A 3OAAA 3CF6R 4IDNA 1IQPA 4LYJA 3SZRA 5APQA 4HLQB 4RD4A 4RFSA 3V4FA 4C4PA 1KYIA 4KBFA 4NYJR 2ZRBA 2ZRLA 3BH7A 3P26A 4MGYR 2CNWD 4A92A 4HB2A 4PQFA 3QVVA 5FTNA 3K8YA 1E79A 1DELA 1CJKC 5FUVA 3DO6A 4GOKA 2ZRJA 2ZRPA 4K81B 1G3MA 1R5NA 2I1VB 2IEYA 3IEUA 5KPDA 1AQYA 3OIYA 3OIVA 5FOXA 3O8BA 4CF7A 4MKIA 3CRMA 1CJUC 2GVDC 2PX3A 2WOOA 1KJWA 2IUTA 4WZAE 3UK6A 2QBYB 2RGXA 4IEIA 4LBVA 3WRYC 2OAQ1 2FEMA 3QXXA 2V1XA 2H92A 1OT3A 2XXAB 2GETA 1EG7A 3QEJA 3TW8B 1OB5A 2OEPA 4LJ4A 3IO5A 3UWOA 1ANKA 1XEFA 1GM5A 4Q7MB 4ZKEA 5UKDA 3QKUA 1LY1A 3LNCA 5EQTA 4ZCIA 3ZH9B 4PR0A 1CU1A 3PUXA 721PA 2WJHA 5C18A 1MO6A 3K53A 4HDOB 2WTUA 2B6HA 2UZIR 1S0UA 3TUJC 4JKIA 4IVQA 4NPHA 1X86B 2YNYA 3LX5A 1YKSA 5DHAA 5GVSA 1FPMA 3L0IB 2XAUA 3OAKA 5APTA 2VQSA 3QEOA 2TMKA 2HLDD 4WZ6A 2C5LA 1K5DA 1TMKA 3QKSA 4PXAA 5EZ6B 1GK6A 4Q4HA 2XU6A 3GLGA 3O8DA 1KK0A 4E09A 1KHTA 1RIFA 1CJMA 5B64A 1U8AA 4DDTA 1T4GA 3RS0A 1FAVA 2OCBA 3ZJYA 3THYB 2CEAA 1VTKA 1KI2A 2HCBA 2ORVA 2PJRA 2BHRA 1SHKA 1ZMXA 1E0AA 4LCBA 2Q3MA 4DUGD 1H8HA 2J46A 3AVQA 4WA7A 1CF4A 1KOFA 1US8A 2OXCA 5KNBA 2FA9A 2Q6TA 4RFVA 2JLZA 3Q7PA 1VCNA 4BFYA 1N0VC 4MYCA 1H89A 2YV5A 2FZLA 4G01B 3X2SA 4LUCA 1BKDR 3PJRA 4LY6A 1F2UA 1GU5A 2F43A 3NVAA 1Z6GA 4LJAA 2GXQA 3AKDA 3K09A 4HZUA 5HKKA 4DLYA 1E9BA 5GJWC 2AFHE 3C5CA 3LAWA 1ZNXA 1E2HA 4MGKR 4TT3A 4LWZA 4HLUC 3HU1A 4M9XA 3LY5A 4RD2A 5C2JB 3AVPA 4FMBB 1Q0UA 5DI3A 4C0KA 1QHNA 2KSQA 1ZVQA 1IJFA 2IT1A 1HTWA 3C8UA 5APVA 4RD3A 5CYPA 2VHQA 4OQFA 4KITB 2Y8EA 1G7CA 1GRRA 1CR2A 3KKOA 1R7RA 3VMFA 4XVRA 2JDID 2CK3D 4QPKA 2GZAA 2QG6A 1Z2CA 1LS6A 4ITRC 3THXA 2VP9A 2A5YB 3THWA 4JBYA 3DOEA 4QNMA 2W2XA 1J8YF 1GU4A 1G5PA 3BBPA 2WJVA 5CB8A 4M9ZA 4C30A 3QQ5A 1EFTA 2XZLA 3P27A 3PENA 2PZEA 4LJ8A 3U3RA 3BS4A 1NN5A 1IY2A 1DTSA 4NYMQ 4V0KA 5E7JA 5EJEA 2O8FB 3RAPR 1ZNZA 1N0WA 1ZM7A 2REBA 5KNCA 3CKLA 3P8MC 3A8TA 4YMSA 1OIWA 2DCUA 2ZE8A 4LYFA 2JAQA 3KJIA 3MWYW 5DGXA 5JCPA 2ZPTX 1JJVA 3U6BA 5B1NA 2MMCA 1IN7A 2YYZA 1TTTA 1KKMA 1EGAA 2D2EA 5E3HA 2QU8A 4P4TA 2Z5FA 2K5UA 5FFMA 3VX3A 5JS8A 5KSOA 4QJ3A 2QTHA 3AEZA 2WM9B 4I99A 5IF9A 5DNYB 1NP6A 3WRXC 3AF3A 4UKDA 2J41A 2GHIA 5APYA 2IF0A 5KU1A 4FWTA 1EFCA 4QGGA 1E1QD 4KYUA 4L5BA 4Q00A 5IHPA 2XXAA 3AKYA 2XZOA 3K0CA 5BYJA 4A0FA 1E3MA 4IHQA 4YDSA 1UFQA 3BB4A 1AZSC 3W9YA 2ZE5A 4OKSA 1RRCA 4M1WA 3HE5B 4W9MC 4OBEA 4TMTA 2P2LA 1GIAA 2YOGA 3WMGA 3K9GA 4DSUA 1XU4A 4EIWA 1E0SA 3QXCA 2IS6A 1MV8A 4P33A 4TSFA 2UZ3A 2R5BA 4NYJQ 5FBLB 1DAMA 1KDPA 3ZRWB 1R4AA 1Z0DA 4JLKA 4ERNA 2Z5IA 1GNPA 1R10A 1N6RA 3GLFB 2WPRA 1Z47A 1TPZA 4RJLA 1TQDA 3TR5A 5AUQA 1Q1QA 4KSBA 1S4QA 3A1UA 1XDBA 1E4YA 5AW5B 3NBXX 5EUQB 3THYA 2EU8A 4IOLA 5IT5A 4DDVA 3B2EA 2DWPA 1E9AA 4Q7KA 2O0KA 1BO6A 5A5GA 1KAGA 2RHDA 4B43A 1NN0A 2LFSA 1IAQA 4PZYA 1WRBA 1S1MA 5LBIA 1NKSA 2V55B 1NI3A 4MYHA 4PPFA 3VMYA 2HJVA 3FYHA 4X8MA 1UEIA 1GRQA 1FMLA 4D80A 2EFGA 1LFDB 5CDFA 3PFIA 2V6IA 1UADA 4KFTA 1U9IA 3GFOA 4B6EA 2ZRIA 5BW8A 4RKFA 4RY2A 1Z0IA 2KWIA 3L8YA 5KYKA 2W83A 4PPNA 1P73A 1JALA 2XTMA 3T1VA 3ADBA 1AJEA 1W4RA 1PUJA 1XXHB 2B7CA 2QP4A 2H18A 2J7KA 2V8OA 5FR1A 2JJ2A 4JBXA 1GD2E 5EXXA 4PO1A 4RVCA 1L2TA 2E9SA 4IOKA 2V9PA 4A8JB 2OCYC 1NSFA 2ZR0A 3C15C 1XEXB 1VG0B 3B13B 2OM2A 3A1WA 4LPSA 5HKKD 1E2DA 4C7NA 1PLJA 1W4CA 5AK0A 3QPVA 2ODBA 3FHTA 1UDXA 2QL6A 1GDDA 4TT3D 5G53C 1ZM2A 2WMNB 1GZSA 2YHSA 4TLCA 4ESVA 1IY1A 1FP6A 1QHIA 3CUEF 5DN6D 4GBMA 4HDQB 4DLVA 1FTNA 5CITA 5JI3E 4HUQB 2ZSBA 2WVJA 4EUNA 5BN3A 4WZBE 2WWYA 5F98A 5TARA 5DH9A 2WSMA 3RS7A 4DSNA 2IW3A 1NVVQ 1KQLA 3RC3A 2AKYA 1SXJB 1JBKA 1VDZA 3BFVA 1Z6TA 1XMJA 3OEHA 4P4SA 4D0NA 5KSYA 3PUVA 4AUWA 4KP4A 1VG1A 4EDHA 2J59A 3CPJB 1G3IA 1Q12A 2R2AA 3I1FA 3VR1A 4J0QA 4TQ9A 5HE8A 1C1YA 2GK6A 3GFTA 4B3DA 3RRYA 4B2PA 1HQYE 4TWZA 2HDNB 2OG2A 4KXFB 4LHXA 3SJCA 4BLTA 2O8FA 3EAQA 2W00A 4BFUA 5C4MA 1XTJA 5AVTB 2WOJA 4LDJA 5CYOA 2Q0HA 4LGMA 2WPDD 1G16A 3UWKA 2Q21A 2PX0A 4Q19A 4FD2A 2GCNA 2DFLA 2G77B 3B1XA 2N1BA 1UJ2A 3W8NA 2GJ8A 5DYIA 1OV4A 4TLEA 4A6XA 3W34A 3VHLB 2JLQA 3ZVMA 1G19A 5EP4A 3RVBA 1FQJA 4AWXA 1SKYB 1D8TA 4Q9HA 1NVXQ 5JWHA 4BLPA 3P7KA 3I5XA 4DCUA 1IOZA 1EFRD 2F6RA 3Q7QA 4RZ3A 2IX3A 4AYWA 5DISB 1IN8A 1ZU4A 4Q21A 3FB4A 4D6PA 4FIDA 1NN1A 4JLVA 4P32A 4AK9A 2HJGA 2AFIE 4XWOA 4GL2A 2GJSA 1R2QA 2WTYA 2GXAA 2BMEA 3C14C 2G1KA 3QE0A 3VFDA 2ZI4A 5K8IA 3J81k 5E4FA 2NG1A 2FJUA 2RB4A 3JZMA 3HE5A 4C2UA 1M7HA 4OHZA 8OHMA 3VU9B 3KDPB 4JSYA 3UPUA 5LD2C 3DGEA 2DHRA 2YO2A 3A4LA 4URXR 4AY2A 4C0SA 4QXAA 2V1UA 4XTRA 2EFDB 1AGPA 3ZYCA 3GLHE 3B60A 1G7SA 5K8LA 3K70C 1QF9A 1WA5A 3HU3A 4R2IA 2CCGA 1H65A 4M4SA 4ARZB 2YNMA 3ZRWA 1KY3A 1P7CA 4MH0R 2J9RA 2X77A 2RAPA 1ZUNB 2FH5B 1HA3A 2CE7A 4IOMA 3SS8A 3U3KA 3CPEA 4JVNA 4A0RA 3SC3A 1EFHA 4M9QA 5AVQB 4UXIA 5K8TA 4AURA 1WE2A 5CLLA 3FPAA 2CDNA 4B3GA 1Q3HA 3PCRB 1VCOA 1D2MA 5AVXB 3IUYA 4O2RA 3P32A 1KSHA 1JR6A 4C3ZA 1BYIA 4IVRA 2IYVA 2GF0A 4IVPA 4DHEA 4OQMA 1OH5A 5TMPA 2PJZA 2RGNA 2J0QA 4WAUA 1XTQA 3TIFA 1ZUHA 4KSCA 1XBTA 1GL7A 4DVGA 3UG7A 2AX4A 2FZ4A 4JLPA 1T3HA 4DCVA 3BH0A 4TL6A 1ZM9A 3KJGA 4TMXA 3S1AB 4CDGA 3Q8XB 121PA 2QM8A 1T0JB 5FH9A 2B8TA 2BCJQ 1LVGA 1MABB 3PEWA 2AL7A 4CIDA 4CT4B 4MDEA 3OFNA 4GFDA 2PLRA 2XB4A 4ZDKA 2XZRA 1Q20A 3W8RA 4A8JA 4C0BA 3EPJA 1XEXA 4M22A 1E9FA 4RD1A 1MO4A 5AUNB 1CKEA 4QJ4A 3EA5A 2ZJZA 1YZNA 1T2KC 4X8OA 4TZ6A 2REXB 1Z0JA 3QKTA 3GD7A 4II7A 1EK0A 3X1ZA 1NLZA 3D36A 1KIMA 3HPRA 5BWMA 4PQYA 2IK8A 4HUQA 421PA 3RS4A 4D4LA 5AW8B 2CJWB 2IYXA 3HJNA 4LBZA 3GLFE 2W6AA 3IILA 1MT0A 1COWD 1SXJA 4FXPA 1ZIPA 4JLDA 4JLJA 3B1ZA 3QENA 4PC3A 1L4YA 4TYPA 3QBVA 4U02A 1XZPA 4B3XA 3U7GA 3CZQA 2WPSA 3AP2A 4PHTA 2CNWA 3A7OA 1T9HA 2F3TA 3GJ5A 3MJRA 5EE0A 3VHXA 3AM1A 3U44B 1E2JA 1DAIA 3QXSA 2A5JA 1UBEA 3BK7A 2QUZA 4ACAA 3WBKA 4PAOA 5B1OA 1P72A 1B23P 3U5ZB 3IHWA 2P67A 1Z28A 3ADCA 1EFUA 1P2SA 2BWJA 3NTNA 1KI9A 4F7WA 4PX9A 3ZCCA 2IHYA 1E99A 3KKPA 4N1AA 3BIFA 2AK3A 1VPLA 5F2EA 1OFHA 4EFMA 4NCNA 4DJTA 2MSEB 1Z6AA 1DG3A 3FFAA 1XXHE 1Z6XA 2O8EB 1J99A 3MG9A 4C9BA 4U7NA 3RS3A 2ZJOA 1OYYA 4LV8B 3TNFA 5AW9B 2XTZA 3P1JA 1NG1A 3FHCB 2JLRA 2JJ8A 4W5WA 4R71A 2GJKA 2P65A 4Q7LA 1IXMA 1T8UA 5FPSA 5FBVB 2KB0A 3T1TA 1CRQA 1NY6A 1N0UA 2QNRA 3L0OA 3LV8A 2ZJBA 4C46A 4TMVA 1XD2B 5EP1A 3DOFA 3SYNA 1N25A 1XCGB 2CBZA 3R8FA 1ZD1A 5FL7D 3VR3A 5FTJA 2KBEA 4BQSA 3CF2A 3E70C 4JL8A 2GXSA 2P3SA 5TV2A 1II8B 2FN4A 5B30A 4TYYA 2REOA 3C7KA 1SXJE 4KYIB 3VU9A 4QHYA 3EIHA 4BFZA 1HWTC 2YVUA 4XSHA 1IXSB 1KJYA 2CE2X 4LRWA 5CM9C 4DLRA 4P3YA 4V03A 1CTQA 4Q9KA 1OHHD 1Q1BA 1W49A 1TQ6A 2VHTA 4JIMA 5EZ5A 3KFXA 2D2FA 4ARZA 2ZQ5A 2R3CA 4ILEA 1W2HA 2JJ1D 2QMEA 4UXJA 1E2GA 1JR3D 1TF7A 2J3EA 2OSBA 2ZIAA 2QT0A 1S1CA 3RSOA 3O8RA 3B1WA 4HAYA 1GL9B 1FUKA 4GRAA 4OQNA 4Q18A 4AG6A 4AKIA 2YC4C 5C1BA 2C2AA 4OYHA 3TJZA 1G3QA 4RZXA 1CP2A 2AXNA 2YINC 4DLTA 1CIPA 1VIAA 1FOSF 2QEQA 5KTYA 2G88A 3VYIA 2W0SA 2QORA 3A1SA 3AH8A 4M9SA 4NCJA 3KQUA 2BBTA 4A4DA 1IONA 3KL4A 2ZXUA 2FFAA 3TE6A 2LFRA 1P5ZB 1A82A 3I32A 4A9AA 3T5GA 821PA 3MGCA 2F43B 3T1OA 3UMSA 3EARA 1HBWA 2QMUA 2ZRHA 1GK4A 1R8QA 4LSGA 4YQFA 2WWHA 1I2DA 4HZUB 1SKYE 2G1JA 1LTQA 2R8RA 5AW4B 2GNOA 3EZ2A 3K0EA 1II9A 3KQLA 1NLYA 2BOVA 2VBCA 3GFPA 4TN1A 3S1AA 1MR3F 1XWIA 3VNVA 1PV4A 5BN4A 1O87A 1OFTA 4I1VA 1MABA 3M06A 3O47A 3PQCA 1Z63A 2XTNA 3BD9A 2L0XA 4WBSA 4XOIA 2PCLA 1XPUA 4MRSA 1W36C 2H57A 1QBKC 3CRVA 2ERYA 2ZUBA 5FUXA 3LA6A 3MMPA 4JBWA 4R98A 1G8PA 2VF8A 4GMXA 4Z8YA 4NE2A 3TSWA 1D6JA 2ECKA 4PQRA 1SHZA 1A2BA 3GJ6A 5JLJA 4BIUA 4NU0A 4IXMA 1AKEA 5AW0B 3I73A 5EXPA 1AS3A 3SJZA 2GF9A 2H7HA 2HT1A 4URUR 2CJWA 5KSZA 4P31A 2GKSA 3CX6A 2B21A 3QUSA 4BRUA 3QPWA 4EPXA 4TMKA 1GRNA 4FPPA 3HDTA 1TQ4A 2P5TB 1N6LA 1KI3A 2R65A 4EPWA 2LKDA 5JBQA 1ZD8A 3W6PA 1CJTC 1YYCA 4A15A 3FMPB 1YU9A 4C2TA 2QMHA 5FUWA 3L0SA 3TBKA 4Q47A 2G9NA 2A5GA 3U44A 1N3BA 2WKQA 4JYCA 2ZS7A 2OLKA 1KO1A 1QZXA 2EYUA 5AVWB 3I8SA 3HR7A 1HY3A 1L8QA 1QVRA 2QP3A 3WP0A 3C4JA 3NBFA 1JNYA 1ELOA 3BFXA 2ZRGA 2BMFA 3MUFA 4I1SA 3KJEA 3PV0A 2PMDA 4PSAA 4MGZR 4DZOA 4NTZA 4JL6A 4Q1EA 3HYRA 1KSJA 4Z54A 2WWXA 2W0MA 3WBJA 4DLXA 3PUWA 4HB0A 1E1QA 5JRJA 3OEED 2O8EA 1W46A 2ZE6A 1ZJ6A 4PTLA 2ZRCA 5P21A 3PUZA 3DDCA 3M91A 3D3QA 3WYAA 2A5DA 4G5RA 3C41J 3EG5A 2ATXA 2C99A 3AKCA 1XTKA 2J45A 4PHFA 4ZDIA 3IPXA 3WHLA 1YR7A 4CYMA 5ANRB 4ZI3A 1QHHB 1R0WA 1YR8A 2ZRNA 3MJHA 1G8FA 1XD2A 2OE2A 4DCSA 2QA5A 4CT5A 3OZXA 2YJTD 1TEVA 4QOSA 2Z0MA 3RRZA 5FOUA 4MDFA 3A1VA 3HPQA 4FWIB 3SFVA 1UKZA 4B75A 1GTWA 4I5SA 1D5CA 1SVLA 1II8A 3K1JA 4TLBA 3SBDA 1WB9A 4L9SA 1TX4B 2Q3IA 2NIPA 4ZCMA 3IKJA 4K46A 4JS0A 1IY0A 3I61A 4LBWA 1I4TD 2WSSD 4AG5A 2IWRA 5B2ZA 3CWQA 3M1IA 5TXGA 4FCVA 2C95A 1OXXK 1KI1A 3M4YA 3GEHA 1HUCA 4EJSC 2FPKA 1LF0A 3OHMA 4Q02A 4Q1DA 4GSYA 2QP9X 3WNBA 2BBOA 1A02J 2ODNA 4H1UA 3MLEA 3B8EB 2JA1A 4DLUA 3OESA 4DSTA 4B47A 3D6TB 2QN6A 4LHVA 2UVQA 4NCKA 4B48A 1WCV1 2OLJA 2BJVA 1W5SA 2NZ8A 3T15A 4Q4AB 2WHXA 1J2JB 4KHZA 4KLZA 5CK5A 3NBZC 6Q21A 1HH4A 4I81A 1WBBA 1JJ7A 1N6KA 3GJ4A 2N42A 4B3FX 1OB2A 1IXZA 3KDSE 1KI6B 4XVQA 4WXRA 2P6NA 4LZZA 2ANCA 5EE9A 5J4KA 3M9BA 1W5TA 4B34A 3PXGA 3SYKA 3DEFA 2OZEA 3ZDQA 3KX2A 2CXXA 5JRZA 2G0NA 1IN5A 3QIAA 2QAGC 2ZR9A 4X8HA 2GEDA 5DN6A 4C7NB 4FI3C 4I2LC 3QKRB 5JEDA 4MT8A 4ZKIA 4Z1MD 3IQXA 4JVSB 2CL0X 3AP3A 2DBYA 2VH5R 4U5XA 1VKJA 3H0KA 2J5XA 2EFEB 3AB3A 2PMKA 4KV9A 1TU4A 1YJ5A 1LW7A 1ZYUA 2IF2A 4AYCA 2FGJA 4WW0A 4FW9A 2BMJA 4I4LA 3GLGE 2NOAA 4IFEA 1M34E 2GESA 3BE4A 4P4SB 1U2RA 3SJBA 4BFXA 3UG6A 3SNHA 2DY1A 3LFUA 3JVVA 1E2EA 4V02A 3TVDA 4HB3A 1KGDA 3R7WB 2HYDA 3IDQA 1E9SA 4KO8A 2IWHA 2P6UA 1V43A 2ZYVX 4B74A 1OXUA 4GDFA 4HAXA 2Z4SA 5G3ZA 5AVSB 4QBGB 3MRSA 3PEYA 3T12A 2WPDA 3ZZ0A 2V3CC 5AVVB 2VRSA 2FEOA 2FOLA 2IHBA 4BLOA 3I5YA 4AKGA 1ZU5A 1H8EA 3FWYA 4PO8A 5EP3A 3GEIA 1QDEA 3FMOB 3LQRA 1UPTA 4BZQA 2QENA 2D62A 3U4QB 3QI2A 2RMKA 1MV5A 2ZSFA 3LDAA 4W5HA 4DC9A 2HF9A 4RZUA 2F9LA 1XJCA 5DO9A 4TZ0A 2OXRA 1N6NA 3SWFA 2IYYA 1DARA 3B9PA 1EFRA 2OHFA 2I3BA 2BCGY 1ZCBA 1FL9A 2CVFA 3ASYA 4D2IA 3I4LA 4A36A 1KZGB 4DZZA 2OBMA
chains in the Genus database with same CATH superfamily
4BNWA 3MAAC 3OWHA 1G21E 1GYPA 2WG0A 1H93A 4GKGA 4KQWA 3CS5A 4DV5O 1Z26A 2IHNA 1EFVA 3TFWA 4D3FA 2BKXA 1WZCA 1I36A 3VC7A 2VYNA 3L1KA 4EKDA 1NVKA 4CM3A 1SQPH 1SQXE 4ZIRB 1MQ9A 3CPWO 1L4UA 3WUVA 1VCIA 5LMNO 3O3OB 1J1UA 1NASA 4FZ0A 3C43A 1ORDA 5EUCA 2BVNA 3BH6A 1QRUA 2DFTA 3ER9A 3QY0A 3VPSA 1NTZE 4Q3NA 4GKKB 1U98A 4LCJA 3CCLV 3ESDA 4L51A 3KAPA 4YUAA 1O9GA 1HDZA 4OJNA 1GEGA 4D0LB 1ZUIA 4IHJB 3PDJA 3TDMA 1V5WA 1CZQA 1RWQA 2AH5A 2QL5A 5EZQA 4E2ZA 1Q3TA 2J0UB 1SULA 1E5XA 1KD1W 1FYFA 2KI5A 1BAPA 3R7WA 2V1DA 1Q1EA 1E8MA 1U8EA 1OWMA 5JOQA 4JENA 2PVPA 2WTAA 3LSSA 3HVRA 2Z43A 2FF7A 3HJGA 3I53A 4P8RA 1D9XA 1H8ED 2Z6VA 2OCDA 2XZDA 3AV3A 1WHSB 4C78A 1GLVA 5FV4A 3GRPA 4HEA1 1RDFA 1ZINA 4GWLA 1RNLA 3CZ9A 2R7KA 1SETA 1Q77A 3ABQB 1H42A 4BVFA 1KO7A 1XJQA 3ZQKA 2KG7B 4DJGA 3STLC 4Q3AA 2PD6A 1QL1A 1B43A 5GGYA 5LP6C 2PZMA 1V0JA 3C3XA 2CFRA 1G9TA 3BRQA 3ZGLA 3A31A 5T64A 1DHTA 1AX9A 3K0CC 4A8HA 1XEWX 3FUVA 1Q1GA 5KAIE 2XJ4A 5F73A 1M2VB 3OC6A 2VRCA 3K0AA 2DOKA 2KLBA 3K70D 2HSDA 3CKMA 4G0UA 4DR7B 4EQ6B 4PZ9A 3ZEAA 1CUAA 1QH9A 3T97B 5AVUB 3PGMA 3HC7A 1KPIA 4WOPA 2H6EA 2WTNA 3EASA 2VWJA 4C5AA 4IRMA 4WVFA 1N8KA 2IYNA 3QU9A 3WLAA 4H4DA 5BYKA 3LIEA 3CB2A 1RE1A 4X64O 1G4HA 3RYHB 4O2AA 2GV9A 4YAUA 2W58A 1GNRA 1JXMA 2AYXA 2WFAA 4CDNA 2PMCA 5HIKA 3V34A 3LJKA 4WB4A 5TISZ 1PQWA 2CMGA 1R3KC 3TB4A 4NVRA 2YOHA 3PIRA 3V8EA 4MPPA 1N2HA 2E43A 3DNMA 4PN7A 4F2GA 5C52B 3DLHA 3AE5C 4FEGA 3T5DA 3EPHA 3OEEA 1P4JA 2G0AA 2FWRA 3BVOA 1G42A 2C78A 1Y5IA 3EMVA 3GUVA 4C7KA 5L3EA 2V7TA 1GEEA 4LS3A 4HAVA 4DJ5X 3HGMA 1JHRA 4WWHA 3V4QA 4EVSA 2YEVB 2DC1A 3JSXA 2JKVA 4JI6O 1ESDA 1W2BO 3GA0A 3EQ7A 4NJMA 4CGZA 2EX0A 2PX4A 3K0GA 1USVA 2PBRA 1L5GB 1K63A 1E7SA 5JNTA 3L8FA 1LT9C 1H2NA 4MDYA 2XDWA 3ZHOA 1KETA 3GJ3A 1XMIA 5ALOA 1SURA 1S76D 5THQA 2JAUA 3DKRA 1X3LA 4R51A 1GAEO 4ZPXA 3ZEIA 5AJHA 4EVQA 4GLFA 1CQJB 4HYYA 3ABKC 2FN7A 2HI0A 1EDEA 2JIBA 4KB5A 2I62A 2VJOA 2QEXV 1GPH1 3M3DA 2AWOA 2WU3A 3QFFA 3R5SA 3Q87B 4OQ4A 4PYKA 4UHHA 3H1LG 1DOHA 5KTBA 3HH8A 3A58B 3BC1A 4EECA 1D09A 1UANA 1FS0E 1QVFO 1ZW6A 4QL3A 2HBQA 3NJ4A 5DYWA 2GAOA 3S28A 2EKQA 3LIDA 2H51A 2VQEO 3Q4HA 3F8SA 1K1EA 1EDLA 4LP8A 4OGQB 3AFGA 2X6QA 1MX3A 3QU5A 1P7YA 1H2MA 1YZHA 1L0NE 4W1RA 4X65O 5IN5A 3TFQA 2H8PC 5JNLA 5K3OA 1N73C 2XTAA 2DR3A 4HGYA 2X0JA 1OGYA 3ESCA 2QWPB 1XRMA 3SMQA 5REQB 1ZUWA 2H3HA 3IEPA 2ZBFA 3LL7A 4IZHA 3B3GA 5KJCA 1DKNA 1TF5A 3B40A 4GYCB 1EX6A 5DK4A 2F1KA 1J95A 1NULA 1ODJA 1UPFA 1DADA 3I2JA 2IYWA 1WUJS 2AFVA 1YOVA 1FNDA 4AIIA 1XVIA 3B3QA 2FPIA 5H9VA 5KKZC 1V1RB 3LPLA 3LW5J 5J9FA 3MFQA 4IVNA 2DHCA 4V0ME 1IUKA 5KTPA 5TQJA 3DZKA 4E0BA 1T6AA 3BCHA 4KUEA 5E7MA 3T61A 2R79A 4JZGA 4LXGA 4M1SA 4TTPA 1WV0A 2FPLA 2WE7A 1OXVA 3BWBA 3ZDBA 2PT5A 3BAAA 4H7JA 3L49A 2IXDA 1K33A 3HN6A 3CW9A 5HGXA 2B9BA 2DHEA 3SXUA 4CU5A 5M5BA 3HXPA 4BLUA 4ALMA 3KSUA 2QPTA 4ER7A 3P5BA 4PXSA 1PWXA 3GLHB 4NZ9A 1T9ZA 3HDGA 5IN4A 3U4CA 1NXOA 4CTMA 3L0PA 4JP3A 4LJSA 1EG2A 2F3UA 3K5NA 1R1DA 1WXWA 4H15A 1E2FA 2FK7A 2W2OA 1JEJA 1QLJA 4RTPA 5ITZB 5GIOE 1DTWB 3MJCA 1GMGA 4NP6A 5J2TA 4HNAB 2CXUA 4QGSA 1AKVA 4OU5A 1I6KA 1NW6A 4UNSA 1E8DA 2QWOB 4A5UB 4IJUA 4PJ0Z 1U7HA 3FSGD 4A1OA 4QG7A 1L0LK 4GRIA 1SQ6A 3ZI0A 4XRGA 3N39C 3M9WA 1DX7A 1GAJA 2EP8A 3K2QA 1UPAA 2Q4EA 5KPJA 2W6ZA 5B58C 1NBMA 3O4JA 4BQNA 1XMPA 2PGNA 2EDAA 4AJKA 3GGDA 2V6MA 4JJKA 1N6PA 1A7JA 3LP5A 5EA2A 4OXKA 4ASUA 1LJLA 1SMKA 3L7OA 4HYEA 1TVKA 1ZOYC 2O1KA 3SJUA 4A2PA 2D06A 2B8WA 1RLJA 1BX3A 2CUTA 2AQHA 5FB3A 1A02F 4MW7A 1PNMA 1NM5A 2HHAA 3PDIA 4Q9IA 2O8CA 4H9GA 8ADHA 4K9LA 5BSRA 1O89A 3VQYA 1XFAA 3EC7A 1G5QA 2C1EA 3IQDB 3UH1A 1KYZA 4ROSA 3RM3A 4MR7A 3K6RA 3ZIDA 2D2VA 3ZI4A 1DMRA 3V8RA 1KVRA 1SUAA 3LQ1A 4MYTA 2FLWA 3SE0A 3HL0A 3L9DA 4L6IA 5CN0A 3I9V1 4H31A 1M4UA 3GW6A 2OC4A 2WWTA 2Y69B 1JHVA 1M7LA 3MJSA 1M8PA 3I0MA 1P0PA 4O0MA 3HFGA 3BULA 5KNCD 1CI6B 1P4SA 3RREA 3Q72A 4X0EA 1YGPA 3A0HE 1DQPA 1GKYA 3UJ9A 3E05A 2ZT7A 1F51A 1RM4A 4OQLA 4FHCA 2IEZA 5HGJA 5CBPB 3CX4A 1PX2A 3L0DA 1R5OA 3N2KB 4AZSA 2I4TA 5IKMA 4PWZA 4MB2A 4W9NC 4WXPA 4FE3A 2Z4RA 3QKIA 2GNPA 4MI9A 1RPOA 2W4MA 1KK3A 3MYRA 4J6FA 3OTWA 3T35A 2MDTA 4B3IA 4X66O 2FFDC 1QFZA 3UAXA 2FEKA 4QO8A 4CTJA 1XXHA 4E13A 4BMZA 3CC2V 1CR1A 2K1AA 3KTAB 3EBOA 3KXLA 1NH4A 4DR2O 2ZRMA 4XX0B 3SZUA 1M54A 4XGRA 3DZ8A 1M1JA 3IVCA 5LJIA 1SQVH 3CPSA 1JCDA 1VZ3A 1IWPB 4E5YA 5KYWB 2ERXA 2WLIA 3DVRX 4TXJA 3VPXA 2D5BA 5E95A 3Q6NA 1OWPA 3NUGA 4AL4A 4C7BA 1K3UB 3AVXA 1LV7A 1ZFNA 1JTHB 5EJ9A 1V7QA 3AERA 2BEVA 1X1CA 4F97A 4I6EA 4LF6B 2V65A 2GWRA 2W6IA 3AG4C 4XWKA 3KSBC 1BXGA 2Q9AA 4FDVA 1USEA 2Y4UA 2WMOB 2YYAA 2W8BB 4DNPA 3ZBTA 2OFXA 2ASEA 3SM9A 1AUOA 3T3EA 1UBCA 2P40A 4URZR 2FGKA 3CWBG 1IWBB 4BUCA 1YHQP 4DV7O 4I9NA 1EFLA 4AJEA 4JSRA 3E8XA 4KAJA 5ENZA 3W2IA 4KX3A 3HTKA 1DAFA 3MAGA 4Y6GB 3H1HH 4LMPA 4NDAA 2RJZA 1NJ2A 1COZA 5AI0A 3U7RA 2M8RA 1PFKA 3H1JH 3EEIA 3C6ZA 5BR4A 1SU6A 1SQFA 1RHKA 3ZGXA 4G8DA 5G1PA 1LTHR 5IH3A 1S2EA 1XDGA 3KQQA 3GGCA 2GSWA 5A0FA 3MF4A 4YJKA 2PV0A 4GGPA 3TM5A 1WMSA 2HJ9A 4GS5A 3X44A 5DLYA 1TECE 2QVGA 2WHPA 3SYTA 3OECA 1ZD2P 3RROA 2FPXA 5K3CA 2D0OB 5JW6A 2XAAA 3U9SA 2GBLA 3BKWA 1L4AC 3K8QA 3HN7A 4Q1CA 3GWZA 1GK9A 3AVOA 4WJZA 1I4DD 4ZOCA 4HAZA 2IXFA 3BA8A 4C4PA 3ZE8A 1HNWO 3VAZA 3JQDA 2GFHA 3HRNA 2FEPA 5H2FZ 2DTXA 2WLTA 3FETA 2RHJA 4NZNA 2NSLA 5IAGA 2GVDC 4CHGA 1R8JA 4LRQA 2GK4A 4RTSA 1I0IA 2IEGA 1DBRA 4DV0B 1OB5A 1RM1C 3OT1B 3TR6A 3AEDC 1O58A 2WTUA 2OVFA 3N2GB 4EQZA 1FPMA 5JZMA 3OPYA 1BQ3A 1XLTC 1TMKA 2YFYA 4MQEA 1GK6A 5FOQA 2IX9A 5L7TA 1O94D 1E1QG 3CCSP 3THYB 2OCBA 4R16A 1VTKA 2FF5A 2BFWA 4ZV7A 1Y37A 2W2PA 3M5WA 1N1MA 1C3OB 2GBCA 2OGWA 2FZLA 3ZWYA 4LY6A 1YDWA 2ZXXA 4H13C 4ALJA 1M33A 4FHZA 1E3EA 5E2IA 2FYNC 2A1UB 3LAWA 3MT0A 4TT3A 5K0EA 4ZI5A 7ABPA 2VPYA 4ZCRA 1BHSA 4NV3A 1GRRA 3AG3B 2PIDA 3FYUC 2C4WA 2VXCA 3U80A 3JQEA 2YUIA 1N7IA 2NTEA 4I19A 1S72V 4KFCA 2ZWAA 4F3KA 3ONFA 4IT5A 1NN5A 2FUG6 4OPMA 2O8FB 2REBA 5DCLA 3TQSA 4P3PA 4CR7A 5JD5A 4JYZA 3WHIA 3C39A 3MWYW 3L8HA 5TPWB 1QCDA 5B1NA 4X1KA 1IHYA 4ZOEA 4I2VA 4JBGA 4QLOA 5IF9A 2HZ7A 5LP6A 4DKJA 1DINA 2AXEA 1NXWA 3K0CA 1PVDA 3MLAA 3G7UA 3BB4A 1TLFA 1L5YA 2P2LA 3TIXB 2ID4A 4B82A 1F7YA 5C35A 1DAMA 3CZRA 2GEFA 4KR7A 4L95C 3GLSA 4RJJA 4ZVNA 1L4KA 2GN8A 3NBXX 3R0JA 5ALGA 4Q12A 2WYVA 3PLAE 2OAEA 4KLCA 5HRUA 4F9TA 1KAGA 3CLKA 3DV9A 2Q9IA 2V55B 3TO5A 2FVXA 3A06A 1GRQA 3RV4A 3CT4A 2KXPB 3GN2A 1Q6IA 3TTTA 1ZLXA 1YO6A 1A7KA 2AF4C 4MQ6A 5EXXA 4JR2A 2VZ8A 2E9SA 5AIBA 1IQUA 4BWGA 1RQNA 3ZZMA 4NBRA 2W6CX 1H4TA 2XUKA 4FGWA 5KVCA 3MEQA 5TARA 1SN7A 4PYOA 4CT0A 1SB8A 4PHCA 3NAZA 1VQPP 3KUKA 3RRYA 1GYQA 1OU0A 3IDOA 1A8HA 1YMUA 1DK1A 5AVVA 5C4MA 4YMHA 2FZEA 4LDJA 3NNSA 2ZT9D 5LHIA 3OQ6A 3TIGA 1SQVD 1K8QA 2QE6A 5IM5A 3EIUA 1NR5A 2LDBA 5KWIA 1BE0A 3A3PA 2ATIA 1EFRD 4RZ3A 3EVNA 2XF2A 2VP3A 1WB7A 3S2ZA 2H1VA 3DFZA 5KX5F 3EVFA 3ABLC 2ZI4A 1T2AA 4N5IX 2G4VA 1YK0A 2WUFA 3VU9B 4LJLA 2RAVA 2WIDA 1KU6A 2ZT5A 5FWDA 4PTYA 4FFWA 2ZM6B 2YIBA 3GLHE 3LFTA 3B60A 1ECGA 2NU8A 1LT9A 1L8AA 3CC7V 2FH5B 1UFRA 2HMVA 5C8ZA 1MVOA 3C70A 3GJQA 5L3GA 5AVQB 3I56V 1ZN8A 5JS6A 4K8XA 2HK9A 5KNBH 3CD6V 2EW2A 1GL2B 3DULA 4IVPA 4WAUA 1XRPA 4JQOA 4B4VA 3TIFA 4NULA 1XBTA 4DVGA 3OC0A 2LVBA 1ZGJA 2NUPA 1W5CE 1JFVA 4X62O 3ICVA 3HRIA 4MVYA 5D7BA 3WVNA 4IHJA 1E1NA 3DTVD 3H1JD 4NTXA 1ZHFA 4NMLA 3CXHH 4TZ6A 1IFJA 2OZKA 1A77A 3QKTA 4K8RB 1NLZA 1UQTA 3D5EA 2OP1A 1ZHOA 4XUCA 4LBZA 2RKBA 4E15A 4K05A 1IHOA 3O4HA 1L4GA 4NXNO 3JXEA 1ZONA 3TPZA 3U44B 2YIJA 3QXSA 3DS8A 3IS3A 5BV1A 3SVTA 4NX2A 3A7DA 5GM1A 3IHWA 3FXDA 1EFUA 3PTZA 2IH2A 2M0BA 2QN3A 4C9BA 4U7NA 3RS3A 1SZTA 3FHCB 1E3WB 2JJ8A 4I5DA 1IXMA 3EDQA 1YUMA 1OZFA 2XT0A 1N0UA 2W0XA 4TMVA 1ZD1A 1N73A 2NLOA 3K0KA 2GXSA 3RKUA 4LXYA 1C80A 5CM9C 1KJYA 2F4VB 5E9QA 1PZMA 1C81A 4HSGA 3RK3C 4RDXA 2QT0A 3FYTA 2O2SA 5C1BA 4BXOB 1M2VA 2X14A 4HAIA 2H59A 3H3JA 3KZIZ 5MDHA 3H1IH 1Q0PA 2ZRHA 1ZNQO 1V47A 3DC2A 3I9FA 2R8RA 3UM7A 1II9A 1LI7A 3TCNA 4TRNA 1Z4KA 2P58A 5DKFA 4W1SA 7REQB 4NFLA 2B5VA 4PCAA 1S4MA 2WZCA 4NE2A 4D96A 3W7UA 2ECKA 4PQRA 2XCRB 4Z7QB 3IOYA 1NBHA 3C0KA 3ZKWA 2V9ZA 3PXXA 4YIKA 4LOHA 3CSSA 2C20A 4BRUA 4CE6A 2P5TB 5CNKA 3BMNB 3A2MA 5FUWA 2P9EA 2OLKA 3KAKA 2PL5A 4UQLA 1PDVA 2CLEB 5IULC 4M8IA 4EJ0A 1UT6A 2CNNA 2P5UA 4B7AA 3SWYA 5FAKA 3LC0A 4JL6A 3H7AA 3E81A 4DIFA 5COAA 3GBSA 1PZHA 3M7MX 2ZE6A 4DF3A 2B37A 3U09A 3EHEA 3D71A 3EXG2 4YNBA 4UCFA 5EIHA 4ZDIA 1J2YA 4MA5A 5A5FA 1EFVB 1YQWA 3PFHA 3DXRA 5JARA 5GGXA 1PFWA 3ZY3A 4I5SA 4L9SA 2Q3IA 4K46A 4CS2A 1CETA 4NNOA 1GPYA 2HDOA 2IWRA 4Q02A 3U49A 5FNVF 5F23A 1R5JA 2OCIA 3D64A 1U4SA 2AMFA 2W0FC 2IY9A 4WRRA 2NZ8A 5LKRA 5L3BA 5BMVB 1SXIA 4UCQA 2X22A 3T9EA 5HRCA 3JQ9C 2FDXA 3DZCA 5J4KA 3DE5X 4HN2A 1W5TA 1RAGA 5AW4A 3IJRA 1Q11A 2XHZA 3UJ3X 1YACA 4YT5A 2PKRA 4BP3A 1VKJA 3H0KA 4DEVA 1I3LA 5CRIA 2DW3A 2WUDA 1UFIA 4UB6Z 3JWIA 2RN0A 5FD8A 4RA9A 1XT6A 5E1OA 4F85A 4WUTA 3R7WB 3SQOA 5JRDS 4MUEA 3B51X 1G60A 3D3IA 2HRCA 4P4GA 1TO2E 2A86A 1QDEA 5CPFA 4XWGA 2N47A 2X6RA 4W5HA 1LJUA 4RY0A 5LU9A 4JOSA 4GUNA 4RVHA 5EIAA 1FAFA 1LKZA 3WIVA 4W5OA 4BVLA 4CC6A 4U7PB 2E4UA 4XGNA 1I2ZA 1TUEA 2Y0PA 1TIKA 4BWAA 3EFFK 1YZQA 1ZHHA 2XBLA 2DB3A 4ZREA 3UB2A 1Z7YA 2UUPA 2XF8A 4TYNA 5LQDA 3AR5A 2QUJA 4QFDA 2WYIA 3KQVA 1B2RA 2Y9MB 1URQB 4PC1A 3AOGA 1YC2A 1OZ0A 3H9UA 4RHFA 1VPDA 1SQVE 1JJAA 4AZTA 3K0AB 5IMSA 1KB9H 2XUIA 1T29A 4W9NA 1UIRA 3PB3A 3HDJA 2GJ4A 4O2AF 4DW1A 2UYYA 2M3BA 5BNFA 1G1XB 3H9JA 2FX5A 3F4BA 3CEMA 4LJ6A 1EDDA 3KZMA 2G0TA 3JYCA 2C2ZA 4Z53A 2FFDA 1QRAA 2C07A 1CUZA 2MJLA 3DC7A 3MQ2A 4O2AB 1W96A 2ZSUA 3SZGA 4CCWA 4GP7A 2VPPA 3HV0A 2JD0A 2E6KA 3NDIA 5MFZA 3TDKA 3LXXA 5EN4A 3M4NA 1EX9A 2JDIH 1YIJV 1H2RS 2Z2IA 2OFFA 3CWZA 3UC5A 2A2ZA 3V55A 1A4RA 1DC3A 3G59A 1PJLA 2BCEA 1C50A 1IQRA 2DW4A 3CXHD 1RI2A 1V9SA 1ZOSA 5SICE 1FJGO 3H1JE 5DXFA 2H1WA 3OCYA 2R1VA 4IAOA 1M6VA 3SPGA 4ZOBA 5BUQA 1YZVA 4YCAA 4UUJC 1ZTEA 4G97A 1ZMEC 3VZQA 4MOWA 5ITZA 2YWGA 2WG1A 1FW6A 1NVDA 4TTIA 2VRZA 2E1RA 2CW5A 4NJMB 1JWAB 1AC5A 4F04A 4AECA 1HJ0A 2HF2A 2XOKG 2VYND 3N70A 3U7FB 1KAEA 5D8DA 2WU1A 2LNDA 1FVFA 2NYVA 4HWSA 4D7TA 5CIQA 1LQ2A 5DT9A 1YQDA 1TPYA 5AFSA 1P9RA 1NU6A 2YY7A 1R0YA 3MTAA 3U4MA 4U6QA 3F78A 4RC9A 4PY2A 4CLDA 2HN9A 3G2MA 3B2QA 1R6DA 1HT0A 4PDMA 3IHTA 1QIJA 4PELA 2SCUA 3WGYA 2VWHA 4KPEC 3T3GA 2Y4NA 3H1ID 4HP8A 1Y42X 3RT1A 2GM9A 4JKOA 3RSSA 1KGSA 1F7UA 1T2KD 1L4AA 1RFYA 1AQLA 1LX6A 1JKXA 1XRSB 2RGEA 3FWLA 1H5NA 5GW7A 1E3DA 3D4BA 2X4IA 4R8KA 3IDAA 4RXMA 1X9GA 2PWYA 3COVA 4FGUA 1SAYA 1OH8A 2ACVA 4DS3A 2C7QA 4H0NA 5DX1A 5JNVA 2VKTA 4KQMA 5HFJA 4IJ6A 5D5HA 3CCVV 4J9VA 4BBAA 1N2CA 2KKWA 3W7XA 2EIKB 3BCCJ 2RCVA 1BEZA 3ZS8A 1X74A 3IP5A 3F7VC 1CK4A 4BGVA 2BHSA 1E89A 4QQFA 4ZJYA 3A4NA 5ILQA 2WMMA 1XZKA 1XLTA 2JFUA 5A62A 1P2DA 1PYGA 3W1WA 3EVBA 2FYUE 1QF7A 2Q1UA 2Y0BA 4G4SP 1KKLA 3G6WA 3U7HB 3RANA 2LGWA 4FNGA 2GN2A 3AGQA 3OX3A 3URKA 2XYHA 1RYFA 2OO5C 5A71A 3OTOO 3DBOB 4BZPA 1YOVB 2GVNA 2FPIB 1VLJA 3LO5A 3F6EX 4YLGA 1V3QE 2IS1A 4JI8O 3G0OA 2G40A 4CU2A 1SC3A 3P3NA 3SZOA 4JKYA 3FYUA 4FLWA 3LYLA 1EB9A 3KPWA 1X6VA 2JFWA 3Q41A 5D3MA 4CM4A 4A8JC 3KEMA 4EDFA 4QTYA 4BTLA 3F74A 1C2TA 4DN6A 2LXBA 1EXIA 3SXUB 1NC1A 2CLSA 1R5LA 4A8TA 3WUTA 1SK8A 3WAJA 5KAIH 3FMGA 4FYPA 3THOA 1U3CA 4J0FA 4DV6O 5L8RJ 2P2DA 5J2TF 1H2GA 4WLVA 1P5FA 3GP8A 1PP9H 4B73A 2FYUK 1G6OA 5LCXA 2XOEA 1TE2A 1YZUA 3ZE6A 2WSEH 2X5XA 5J2TB 2BYTA 4XVUA 1G2OA 2OCCC 3TB6A 3CRCA 1WU8A 3M4XA 2ONYA 2G83A 3Q7IA 1FSPA 1QHSA 2A0LA 1SVIA 1W0JD 3TTSA 2YBDA 3II6X 3CZCA 2W8BA 2X9LA 1AJQA 3SHVA 3CY6A 4MIOA 2C4NA 3JSVC 1DCFA 4GZLA 3JZDA 3AIKA 2DHDA 4ALKA 3EZ7A 4W7SA 3GRAA 2HXGA 3GRZA 1CEEA 4DMGA 4XDKA 2BEJA 1H94A 1TVKB 1I08A 1EM6A 2HV9A 2UXXA 2NPSC 2FPPB 4PRYA 1G20A 4GZ5A 2OMEA 4I55F 3BB1A 1T25A 3O2QB 3QLVC 2ID7A 3ORFA 2X15A 1PR3A 4FCTA 3PDIB 4F9FA 2O8CB 2XSZD 1KB9I 2GD1O 3E1KA 4N5DA 2E76C 1N5KA 1VMAA 3ISVA 2OK7A 2N74A 3ICXA 1PK7A 2H4XA 4D6TG 3PC3A 1GWNA 3D8SA 3BRWD 2Y1OA 1P9OA 4GM4A 3HCAA 1WCWA 3DAFA 3CF4A 3B2NA 3B3JA 1B0UA 1BRMA 2GRAA 1JA8A 5J4VA 3KKYA 1FDSA 1XU7A 1WUIS 4HNQA 5JH7A 3WQBA 3SLGA 2UZAA 3N7UA 5G41A 1JFLA 4PFKA 5JHGB 4EFNA 2J7PA 4NY1A 3MPOA 1PL0A 4M0EA 4PYQA 1US6A 4V0SA 4BV9A 3OF5A 4A5OA 1VQLP 3TZEA 4FTWA 3B82A 3CXHE 1EDJA 2RKOA 1FMFA 3MGGA 3R3YA 1G4AE 4MPJA 5ELXA 4FSXA 1BHO1 1ZXLA 1WOMA 4K9KA 2EZ4A 1RE0A 1RJ9A 2R72A 1SESA 1NYRA 1E6CA 5JNSA 1A7UA 2I2XB 3AF2A 4AUKA 2VSNA 5LQMA 1GGFA 3IJ5A 3EGCA 2F1RA 1XPRA 5IYBO 4JMLA 2R6GA 3K9CA 4L4SA 4EI2A 1X8LA 4O5AA 2EJBA 3LT2A 3T5AA 3I34X 5ETJA 2P7TC 1LW6E 1Z29A 1ILEA 4X60A 7ADHA 4Q1FA 3O21A 3T7AA 3OE5A 1N5DA 2YRFA 1DO2A 4EG7A 3F47A 3TQCA 1M1JB 1NMYA 1JQ3A 4LA4A 1QNLA 4E5KA 2Q62A 2ZBVA 2Y9ZA 2JL1A 4KVGA 1BRTA 4UBIA 2WLIB 1VOTA 3PGJA 2ZATA 3C6BA 3H1IE 1GSAA 5DNUA 1PZXA 1QV7A 3H42B 1EP3B 1L0LH 1HORA 3AERB 3NJ8A 4Z2YA 2BEVB 3EIEA 3N75A 4F8YA 5CMZA 2HHHB 3R9XA 1R0XA 2DF8A 4P7KA 3UAZA 5F9FA 2ZZKA 1BXGB 4XE5A 1VZ2A 4OL0A 1CB0A 5CCHD 3MP7B 1R0BA 2CVQA 5CW2A 3OT4A 5ALNA 2QLFA 3WWZA 4WCDA 3UHOA 1YZGA 5B1DA 3V48A 3A2KA 2G1PA 1X38A 3HTKB 3ONVA 5AKYA 1ZLYA 2H0RA 2ZT8A 2GILA 2Y0CA 2HIHA 2OC9A 2B0CA 3TKAA 3HWRA 1ZEMA 2B9EA 1QHFA 1YJ8A 2VJCA 1I0HA 4OP3A 5KJ6A 5AOAA 3IPAA 2GZMA 2VP5A 4HQRA 3NDJA 1Q83A 1GLNA 1SWVA 2EAUA 2IDBA 3O0TA 2V7XA 2ATCA 2IHJA 2A9QA 2WHPB 2YV3A 3LLCA 3CINA 3QKWA 4BQFA 3IUPA 3FVVA 4DYDA 1NUAA 2ATVA 3LKBA 1QGZA 3QU4A 4ASWA 2IS2A 1LF5A 3LECA 1U0JA 1IHXA 1JQ0A 5IE9A 1KZUB 1FFTB 5EMHA 1IUPA 3DBVO 3LDUA 1NNEA 1TYEB 1RC8A 2ZYTX 3ABZA 4UM5A 5K3BA 4BNJA 4YHBA 4H37A 2VJPA 1Z3IX 3RC2A 4BMYA 3WDSA 4F8EA 1GD1O 1RMYA 3KVYA 3N6VA 3SBEA 1HEYA 2IDJA 2G8YA 2Q9CA 3P9RA 1GGNA 3NC0C 2BHNA 1L5LA 2V7VA 2OIEA 5HUHA 3GMDA 4PC6A 1PP9D 1T1IA 4CG3A 4PZCA 2AW9A 4JCOA 2DGDA 3OPYB 5B1AC 1Z2NX 2XYPA 4XPIA 2YNMC 1KFBB 2J3HA 3LUPA 3DGFC 2ARKA 3L77A 3ROTA 1QYXA 1IB0A 3JQ9A 5ECGC 4MW5A 5KHAA 1AR5A 3ASVA 3T1YO 5ILGA 1W34A 5JNRA 5K1PA 5DF1A 3W6NA 4OGGA 3OPXA 3VU3A 2A45I 4MGIR 3AG5A 5BV7A 2A59A 1XVLA 3GY0A 4GX2A 1MRNA 4TS9A 3DDSA 1FBTA 4ARUA 4Y2QA 2OO7A 1ONNA 1SBNE 3DW3X 1XAJA 4NQRA 5TMBA 3O8CA 3A0HH 3DOHA 3NOVA 3ZQUA 1DT3A 2IJGX 2FSIA 1E59A 5J59A 5APSA 2O3QA 2GK7A 4EYEA 3FB8C 2GUVA 1FS6A 5LP6F 2R8PA 1Y1LA 3TSZA 4LH7A 3LLMA 1THTA 3B9QA 3OAAA 3NHUA 3T54A 5LMCA 3V8MA 4LSZA 4KWCA 2GZ3A 4O5OA 3KNZA 4B87A 4X1KB 2ZRJA 4LRYA 4NSNA 5MF6A 1W35A 1ZESA 3HKCB 1KJWA 5LP6B 4IQFA 1VKHA 2UUCO 2GETA 2RQ6A 1N32B 4UBKA 2QRMA 3OE4A 3UWOA 1DQRA 1JQAA 1W88A 1E62A 1KH2A 3D6HA 4L4ZA 3LX5A 5IVDA 5KOIA 5J5VA 2VPTA 2X23A 2K1EA 4WZBB 2W2NA 4K6HA 2YZGA 3EIXA 5IUJC 1X94A 2HW8A 1LDEA 3OWXA 4FEEA 1KI2A 3WIBA 2BHRA 3QRWA 2NZYA 1HNXB 1RM0A 2YWDA 1WKVA 2ADOA 1JR2A 2CDAA 2A79B 3DEHA 2FDRA 2HPZA 1MB4A 1D2GA 4G01B 4G84A 2BCCJ 4Y99C 2HNKA 3AKDA 5DTEA 1LU9A 5L3FA 5ALHA 3PX7A 3HP4A 4M9XA 1J20A 5C2JB 1H3NA 3M8KA 1C5KA 1U4OA 2F3QA 1PKEA 5APVA 1EAMA 2PHZA 1XDUA 1JFFA 1L5KA 4D97A 3KSMA 2A5YB 1PBTA 4JBYA 1KY4A 3CCCA 2QZ9A 2CHEA 1JA0A 3I6QA 4DT0A 5EJEA 1BXKA 3U37A 2X4GA 4MKRA 1WVGA 4DV2O 1FY2A 1YXMA 4LYFA 5H59A 4QJIA 5TE9A 4S2UA 5L45A 2MSLA 4BW5A 5TPZD 4IH1A 3E7DA 4RGYA 2DVMA 3AF3A 3NBUA 4YAGA 1CUIA 2Q5QA 2XXAA 5KI6A 1YU6A 2Z58A 4A0FA 4KLRA 1L0LD 2WLLA 4H60A 2H29A 4O1HA 1PAUA 3OOYA 4YBZA 5ALUA 1YB5A 2NU8B 4D44A 1LT9B 4JLKA 4ERNA 4ES6A 1N6RA 1ADFA 2VSYA 4KPYA 2F2TA 1F20A 3FKJA 5L40A 4IOLA 1WR8A 4IHJF 4DDVA 4W7ZA 5C53B 2DTEA 3O75A 1IVSA 1YTFD 1Q81Q 2HNAA 1DB3A 3Q7SA 4X8MA 2Q46A 5BMVA 2Q3LA 4FYWA 3LCRA 4OPHA 4R7TA 3CNBA 5CVJA 2NUPB 3ABKB 2J7KA 3KJQA 4JBXA 2PRJA 2GPWA 4EG8A 2V9PA 5CLGA 3WGHA 2XHBA 1W4CA 3LPMA 2FZCA 4TT3D 4UU7A 1BVYF 3OZAA 4ZRDA 4AT1A 3BFVA 3QWOC 1XMJA 5KSYA 1L2PA 2E89A 3MRVA 4ADSG 5JATA 1N4AA 1O0CA 5DLDA 3IQHX 4L3WA 4BLTA 1G0NA 1PFVA 1D07A 1QM5A 2PGOA 4Z7JA 4EI8A 4MVZA 2WIJA 3VHLB 4UUOA 4ITVA 3D54D 5I9IA 1Z6QA 3DE1X 3RODA 4YJDA 3II6A 2YUTA 4D99A 1KYTA 1NN1A 1N73B 5DEOA 2WTYA 1WP7A 5FTWA 1L6IA 2RB4A 4WY4D 3JZMA 1URQA 3NVMB 1TKRA 5BNZA 4CLXA 3NCHA 3ZYCA 4DW8A 4JUBA 3DQPA 3MIIA 1V9PA 3U3KA 1VFPA 4ZWNA 4QXMA 3RL0D 2OO5A 3AFOA 1WE2A 5KKZB 5CLLA 4J7ZA 1IATA 1XE3A 1T6XA 2FSPA 4IVRA 3P9CA 1GZVA 1C2YA 2WSYB 4NNJA 4KKXB 2JJ1G 1PP9E 4DCVA 2FP3A 1F51E 2AL7A 1BKYA 4GIFA 4A8JA 1CNFA 3H75A 3E53A 1RP1A 5DNDA 4ABMA 3UGTA 3ZKWB 1EI9A 1Z4MA 2GD2A 2IK8A 3S1KA 3I55P 1GZ7A 3DE2X 4QATA 3HVUA 2W4QA 1K88A 5BUCA 5SYNA 1SXPA 3V1NA 4UMFA 4CDMA 1MEJA 1QZ3A 4HBNA 5KNCH 2PZ8A 4RGQA 4ED9A 2E4VA 3K05A 4KNYA 4LH6A 1ISRA 1DG3A 4BNFA 1XXHE 2Q3JA 3TNDA 1QQAA 3RTBA 4B31A 1XNRO 3B5EA 3OOWA 5FLXN 2V7QJ 2C4TA 5EP1A 1HYEA 2P27A 3DXRB 5CH8A 3R8FA 5FL7D 1L8OA 1C41A