5AVRB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avrB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avrB02
2YO3A 3KQGA 1FOSE 3P32A 3P8MC 5APTA 5AW8B 3TK1A 3SWFA 4RETB 5APVA 4M3LA 2W6AA 2XV5A 1H8AA 2WT7A 1SP4A 5CMZA 1GD2E 3T97A 4KHXA 3A5TA 5AVRB 1FOSF 4AQRD 1MFZA 1SLQA 1A02F 3VMYA 4HYTB 3V4QA 4RESB 4I6MC 1DH3A 4GKGA 2E43A 1FAVA 3I5CA 5AW7B 1GTWA 1CZQA 5APWA 3V4WA 3MGNA 3V5BA 3M9HA 2N9BA 2WTYA 3L37A 1S9KE 1T2KD 3HE5B 5AVWB 2KP8A 5APSA 5AW1B 1GK4A 1H88A 3M0DA 5AW2B 5AW4B 2P67A 3HE4B 5AW5B 3MD0A 1J2JB 4JYBA 2R5DA 1HUCA 2Z5IA 1NAFA 2WPRA 2QM7A 2VRSA 3A7OA 2Z5HA 1OWAA 2P7JA 2BASA 1H89A 1IO4A 2YO2A 2R3CA 2WWWA 1GZLA 2QM8A 2ZXEB 3M9BA 3P7KA 1CSBA 1KQLA 2Q5UA 5AVTB 5AVXB 1GK6A 5AW9B 2W27A 1X8YA 3A2AA 2R5BA 5AVQB 2WPQA 3HE5A 3OAKA 2JJLA 4EOTA 2C9LY 5AW3B 3A3YB 2P2UA 3TNUB 3M06A 1JNMA 4LC1A 3HE4A 4I2LC 4AYCA 3VTPC 4C7NB 4GT1A 1YYCA 4B86A 5AW6B 3TYYA 4DZOA 5APXA 1MUUA 3UIAA 3NTNA 3WGVB 1A02J 1CI6A 5APUA 5AVYB 1JUNA 3TNUA 2YNYA 5AVSB 1CI6B 3VN0A 1NWQA 2H7HA 2XU6A 3WGUB 3L36A 1G2CB 1T2KC 2ZFCA 1GU4A 3L35A 3VYIA 2Q7CA 2E42A 2WPSA 4XE5B 4C7NA 3M0AA 3O8ZA 5APQA 5AVZB 1HWTC 2WT7B 3IR9A 3LIEA 2Q3IA 4AUWA 5APYA 3NXSA 1HBWA 3VMZA 3M91A 1GU5A 1S9KD 3HTKA 3KDPB 2C9NY 4C46A 2XZRA 3LIDA 5AW0B 5AVVB 3NFQA 4JYCA 1MV8A 3VMXA 3B8EB 3NMDA 5AVUB 1OXZA 2IPPA 2R32A 1HJBA
chains in the Genus database with same CATH superfamily
2KK7A 1FOSE 1KGIA 4QOKB 4R26H 4ZMXA 2E7LA 1EVTC 3CZNA 3OX8B 4U1JA 2WINA 4XP9H 1P2CB 4GODA 1C12B 4JDEA 4AM0A 3LNHA 3IAGC 3BD5A 2VDNB 3EG9B 3N1FC 1X79B 1OLZA 4M8QB 5JMRA 2J55A 2VKWA 1SQXK 1AZCA 5CGYC 5JXAL 1Y18A 2JH2A 3NSFA 1OCWH 4NWTL 4CU7A 12E8H 3ARDB 4RX4A 3RDTC 2IH9A 4W93A 3S3SA 4A2EA 5APWA 1JZ4A 2NY3D 3D5OF 2NYYC 5ANMB 5I23A 4FXKB 2WO4A 3CK0H 3P2DA 4J3OF 1ZS8A 5DHVB 2H6PA 3QNFA 4MJJA 1DBKH 4NEHB 2O5YH 1TSRA 2YC1A 4LSQH 2GJZB 2VLLB 5IHLB 3QUHA 5D7JC 1LO3L 1MCDA 2GBVA 3DBXB 4JM2F 3AEAC 3PWNA 1GGYA 1XD0A 3FW6A 1RVFH 3H53A 3AQZA 4PJ8C 3NCEB 5DC2A 2X87A 3B2XA 4HZLB 5GRWA 4FI7A 2WSEJ 3FCSB 4RJTA 2X4UB 2YLHA 3T0EE 4MAUL 3WE6B 4RZCA 3IGLA 1AHMA 1R19A 1J5IA 2FBJL 1PKQB 3RK3C 2NRDA 5K1NA 4WU5A 3LQAL 4XOAA 3MBEB 4NKQB 2ZONA 2AW2A 4MKTA 3QJTB 4HPYL 1F2XK 2DLFL 5JR1L 1MFEH 4J8RA 3DYPA 1SF3A 3PIQA 3AE9C 2ICEC 3HB3C 2ZP8A 3HS0C 4XXDA 2VKXA 4JZJC 5EIVA 1JFHA 1RUQH 2W9LA 3LNDA 4OLYL 3U6RA 4E41B 1PZ2A 1YYML 3L5IA 5I9QB 3S97C 2X4NB 3KDMB 4NFBA 4X99B 5JZ7D 1MIML 3E1IA 1UOLA 4BSVB 4YHLL 3D12B 5IJBC 1NCDH 1W16A 4GIPD 4Z7WB 3RGBA 3COOA 4GMSL 4PRHD 5KEZA 4PJGE 5E5MA 3BQVA 4YBQD 4KROC 1BBDH 4JFVA 4XO3A 1ZV2A 5ID0A 3BAEL 4XNXL 4K9EL 4P8QA 1PVHA 1JDAA 5D1XE 5IB2A 1JM0A 2YD4A 1FZCB 2CIKA 1BQLH 2V5TA 4JM4H 4QRSB 3MUJA 2LFEA 4KDTC 2Q3EA 3L3JB 1KB9K 4ZXBD 5IQOA 1DJHA 4HMCA 4KUZH 4WY4D 3IR9A 4KDWA 2C7UA 4KX9A 3ARFC 1NKGA 1H8NA 1O5PA 1BFOA 1D5MA 2O30A 3MYZA 1QL1A 1OT1A 5TK2A 4Y19A 2FWLB 1S72P 2UXTA 3JVFC 1EO5A 5B22A 2SEBB 5F44A 2QEJA 3PV6B 3W38A 1ICTA 2XN2A 3KM2A 1TVBA 3PGCA 1N8OE 1K8IA 3ARSA 3D69B 5I1EL 1G2CA 2ZXAA 1C5CL 4PI0A 1QBLH 3REVB 3QFJE 3UTZB 4L4TD 3OBAA 5HYQB 1PD0A 2J8HA 1ZPLA 2KB7P 3MZGB 5KG9A 1Z9MA 5IVXA 2L04A 2FD6L 3MRFB 1X9RA 2WT7A 2B9BA 3GBNH 5EC2B 3V0GA 2D0GA 4XVJH 2DYPD 2F7PA 4RQQA 2MH4A 3MV7A 3UBGA 3JYCA 5A1AA 1BVZA 1QWUA 4I0PB 4XP4L 3CFIC 3PUUA 2E74B 1BPVA 4HEMA 3QH9A 4A37A 1ITCA 5FV1L 4YDLC 4RAVA 1KDIA 2OMYA 3FSOA 4MJ4A 4QEGA 3GLZA 4L3EA 2GITA 3TWYA 4O9HH 5T5FA 3E7JA 1VESA 3OHXB 4O4YH 2AF2A 1T66D 1RHHB 4PRPE 3P73B 3WS3A 2PW1B 1MQKH 2BXYA 1SJXA 2P4AB 1XAUA 2Z4QB 3V5HB 5JPMA 3CZEA 1AHKA 3JSSA 2QR0A 3LZPA 3QZWG 3UADA 1KWGA 5BV7L 1MCEA 1E50A 3E1F1 1FGVH 1NCDL 5AUMB 3CCHB 3WJJC 3V4PH 5BS0B 1USDA 3CFEA 3OKOA 2VDQH 1BBDL 5LBSH 5LGHH 1GOGA 5CU5A 2N1TD 2AEQH 5KSVB 3HLAB 2V2TB 2WLZA 2AJUH 2BJMH 5DS8A 4HUUA 1DDHB 5D71H 4Z7NE 4FXKC 2B0SH 5E51A 4Q89A 3MRBB 4XCCH 5EOTB 2RB8A 3WEBA 4ACTA 2J43A 2Y7LA 3P0YH 4X5LA 3O45A 3NPSB 4NN6B 4LLHA 4PJ7E 4WWNA 1L0PA 2PR4L 4F2ME 4XXCA 1JP5A 5I71B 3O2WH 4HFWA 3TS8A 4NOBA 2JCCB 2ALAA 5ACZA 5AAMC 1SQPJ 2EACA 4FGMA 1THCA 2P8LA 4FNUA 2QKIA 4HHGA 5BVZA 4PJFF 4DO5A 4OI7A 5EZJB 3EDEA 4PMFA 4PB9H 3IDGB 4ODVH 4FP8L 5EOCH 5TJWK 2DWYA 2NNCA 5AVSB 2DQFA 3MBEC 3T4YB 4YFLF 5HYFA 2QVMA 4F58H 4NYLA 1ZR4A 2WM0A 3PNWB 3LSOB 3EFFB 4MCNA 4QTIH 2XBDA 1GU4A 2ITCA 3L5WA 3SZ6A 4JQ0D 2WZAA 2XWTA 3IKCA 2OYPA 5APQA 1GXEA 2L7EA 4C55A 4AEIL 1VDFA 1YDPB 2HPTA 4G6KH 4AV4A 4DO6A 1DANT 3E6HB 4LKCA 5E94A 1A7OH 1PPJG 1M71A 1W5CE 1H3GA 3EOTL 5K5YA 2FEDD 4PW9A 1EZVG 5BU8B 1M2VA 2WLIA 3UPRB 4HJIA 5KSUA 2WIMA 4I9WD 4MNGA 5C0DA 3RX8A 1FO0L 3DJZA 1QASA 4KRPB 3L73G 4QRTB 1U8KB 3B7UX 1CICA 1FZCC 1B90A 2NY4D 4LFHD 4O5LL 1KDJA 3O4OB 1YC8A 5I1GL 3H55A 5IBLC 3WFBL 3QE5A 3SE4C 3T97A 4BGDA 3D85D 2YXMA 5JOFB 2WXQA 3KXFB 5EA0H 2BJML 2QSIA 1RH8A 3RL1A 4WHYG 3PHQB 5CLZA 5IF0B 2HVJB 3WELA 1NCWL 4GO9A 1OAZL 4FQHA 3OPZH 1CGTA 4URKA 1QVOB 1IK7A 4QNPF 2BCCE 5IEHA 5IHBA 4WFFD 4NZTL 3GK8L 2ICES 3T6XA 1INDH 1TZOA 1KV4A 2CM6A 1HQRB 4UM9D 3CFCH 4XMPH 2NPSA 4LSPH 1FNHA 1XHHA 1JV2A 3QYCA 4NQEB 5F93C 3HNTH 4OJCA 5JHBA 4Z6AT 1JYWA 3WEXB 4H2AA 1FAIL 2VXUH 2BK8A 3JTTA 3TPUB 5SV3A 1KTJA 3VH8B 1XF4A 2VAAA 3MJ6A 4APXA 1MF2H 4I0PC 2HWZH 2KLSA 3CFNA 3IFNH 4H5SB 4DF9A 2E74C 5DZJA 2QQLH 2P5WE 3BZ4A 4J8QA 2BDNH 4F58L 4PTTB 3EGSB 3WDJA 4LCWD 2H1LM 3KPPA 4HMDA 4Y4HB 3EJPA 2WUCL 2G9KA 2IO5A 3FO0L 3OHXC 4CU8A 4ZX6A 4X9GA 1QWHA 2X2JA 4C58B 5KW9L 4L8CB 4JZNB 4Q9RL 1HGZA 4XWGH 4MXWL 4OQTA 3WUZA 1OTTC 4M4RA 4O58H 4YXLH 5I76B 1MLBA 3DC0A 1NO4A 1CR9L 3MGOB 1EZSA 1F11A 4N20A 4B9YA 1F1DA 1JJUA 1QA9A 5LAPA 2JF1A 3KZIH 1Q1JL 3W56A 2BFVH 3CC4P 1N8RQ 1JNJA 5IESL 5DZPA 1DQKA 3II6A 5CWSA 3TN0B 3FQTA 3TVMD 2H3XC 1GHFL 3HC0B 4PS4H 5F7MC 1A8ZA 1DSFL 4M4PA 3E2HB 3NEXA 5HGAA 3RTQB 3WY2A 4JNXA 3KPSA 3Q9PA 4M61A 4TQ8A 4X6CE 3TIEB 4MCYA 3TP4A 2ZICA 5GRZA 3R7QA 4EO5A 2E9IA 3GG2A 2X0WA 2G3XA 3BQUB 4N9GA 1NIEA 2N7BA 3CJJA 1USEA 3HRNA 2ZUQB 3T65B 1T21A 4DP1X 5JORB 1FV1B 1KXQA 3RVWD 5B7FA 4JPKH 4MZIA 3NPSC 1SYSA 4NN6C 1WPCA 1M1JB 2BO0A 1GGTA 1T0MA 2R39A 4PS8A 3TX4A 5H2FE 5EULV 2QSVA 3CFJA 4KPHH 3SQOL 3ZZQA 5I71C 2VW7A 2DWXA 4GUOA 3D0LB 2BM3A 5EEZA 3K6DA 3UTPE 4ZQKA 5K9QI 1FFRA 2V3EA 1YITP 2YKLH 3TYGL 1QBBA 3EOYG 5DT1H 5ESVA 3ERXA 4MQXC 1S5LE 2CBOA 3NFQA 2ZYIA 5MEOA 1KB9H 4BHUA 4UTBH 3DXAB 1JZGA 1GY1A 3FT2A 3NCJH 5GGSA 5KSAC 1BLNA 4C83B 2NXYD 4OVVA 1X5GA 5IM7B 4XNZB 4J3OH 1RURH 2W59A 1S78D 1VQ9P 1X5HA 2GHWB 2KMWA 1SP4A 1L0NG 4ALAC 3RNKB 1FNSL 1MIEL 1MRDL 3FUMA 3T0ED 1QZNA 4MB4A 3N0PB 3QXDB 5D7SL 3KL5A 5IEKB 1ZOYC 1MCNA 2JKSA 3Q1EA 3BPOB 2HTLC 3V52H 1I3VA 1PD1A 1KJ2L 3C60B 3K2MC 1DEBA 3FGAD 1CGXA 4NRZB 4F9LC 1R3IH 3EO9H 4K3HA 4BK5A 2ENYA 1XGYH 4FD0A 3O6MH 4QHNA 5DRNA 2YWYA 3CHQA 1JGLH 1AMXA 2Z34A 3Q6FB 3B6SB 3P3TA 4KRPC 4UQ2B 2DQTH 5C0EB 3TSIA 3HE7D 4OAWB 3V6FA 5H35A 1EHNA 3EH1A 3V6OC 4PIRF 2DQEL 3EBGA 3UMNA 5JDSB 4KK6C 2BHFA 4J2XA 3TBCA 4NCDA 1PAZA 3O4OC 3DVNB 1I8KA 2D7PA 4JYBA 4S0TD 3KLAB 2CXKA 2O01J 1A6VL 4G42B 3H6PA 1G5GA 2X1QA 4YGAB 4GP8B 2AEPL 4RMUA 3EAKA 3IAQA 5HJBA 3ZVVA 4BKLA 3PAZA 4WK0B 3WFDL 1ZA3B 5FECA 4PGDA 7TAAA 4M48H 3BLKA 3ZE2E 5D1XD 2LVEA 1SVCP 3NFNA 1BXVA 4H1LG 2KHAA 2OZNA 1U92B 2D0HA 1GYUA 2BSSA 2ZXDA 4C54A 2KZJA 3MXWL 1R3KB 3AEDC 1CE1L 1ZPUA 4N5EC 1IGJB 1QFUL 3BPLB 4HK3J 4K3EH 4PJ9D 1FDOA 3E38A 1EEZB 2AMUA 1JNHA 1TQTA 4NC2B 4Y5XB 5DC9B 1P5VA 3MI6A 5KAFH 3GXTA 3QIWC 1L4AD 4WHTA 1H15A 4NNPL 1XVSA 3OR7B 4F1ZA 2YSTA 3ZZLA 1WA1X 2NYYD 3QFJD 1EJOL 3C6SB 2XZCL 3TLRA 4Y4HC 3WHE1 2A6DB 2B1HH 4L0PB 3IB4A 5GZOC 1ORSA 3EFDL 1CF8L 1WHPA 5T3ZH 2NLJA 1QLFB 3NG5A 5DJ2A 4G8GB 3L16A 1JPEA 4HS8H 3SKNB 4B9IA 2JO1A 2JEEA 1J0KA 2XG4B 3LQZA 2C9XA 4GIFA 5CCHA 1XGZA 3JTSA 4HUNB 5DRZA 3WI9A 1N0LA 1P84J 1EAJA 4QPEA 3TN0C 2FX8L 4AT6B 2R2EA 4PRPD 2ARWA 3K6FA 3E2HC 4BRYA 3K5BA 1LK2B 3RTQC 1CPUA 5CBEB 4PG9A 3I02B 1F6LL 1T22B 4W9HC 3OKMA 4KZCA 5I8EB 2A99A 5CD5C 3HZ3A 3BQUC 3T09A 3F5HA 3VXRE 2XIDA 3HB3D 2XA8H 2ZUQC 4J6RL 3GF8A 2FWSA 5DZ9A 2E9BA 2WSDA 3LXAA 3PU7A 2A77H 2DIBA 1I8IA 4PCYA 3FN0L 4QYAA 3KJ6L 1G43A 1M1JC 5ERWA 4YR6B 2AJSL 3HMXA 1BIIA 4X7DC 5GGRY 3OPUA 3X14A 4F27A 4KHTH 3RZCD 3ZQXA 2WW8A 4HCIA 2GABA 3UOAB 2ROXA 1UYWL 2VISA 4FEIA 4GOSA 4IU3A 1AGDB 4QT5B 5HYEA 1TKWB 4G80A 2G3ZA 4JFSA 4IDJH 3QEQA 1JK9A 1S5LX 4N2IA 3KXFE 5BJTA 3AITA 2ORBH 1CGWA 2W65B 4TF4A 1JCDA 5I15L 1NAMB 4MMZB 5F8RC 1UWEH 3AW5A 2X4TB 3O11B 2ICWB 2J3SA 4JY6B 1C5DB 4MVBD 4XCYA 4GG6F 5IT2L 4R4FL 3SO3C 4XNZC 4Y5VA 2CK0L 1MY5A 2PTTB 3T77A 4LHQB 3VH8G 3DK0A 3T6QC 4OLZH 1PX3A 4QXVA 2ZTBA 4MXQC 3O6KH 4NUGH 1R8EA 3P3YA 4FEMA 4PS7A 4EZLA 4Q9QL 2JELL 3C60C 2AJ3A 4LOEA 1USQA 1F18A 4U1SB 5EZOL 4Y16B 1HESA 2V4HA 3ZLQC 4MS8C 4G6AD 2NNAA 3MO1A 5E99L 4FLOA 3CPLA 2PP6A 1K8AQ 1L0YA 4JM0A 2FGWL 4N24A 1SOSA 2BVUA 2J6EA 2WAHA 5D55A 4FLHA 4Q0XL 2MCPL 5BOZG 5DYFA 5L4MA 3IGAA 2XN9A 1XGRB 3DMMB 4GRWB 1NMAH 4R3SA 5DWUH 3U1PA 4DVRL 2NZ9C 3HFFA 1A3QA 3QULA 3BZEB 4HJJH 3DIFB 1ZRUA 2GSGA 2GUVA 4HUKB 2E75B 3Q3GA 4G5ZH 4XAWL 2L7UA 3FB8A 3OSVA 2YPLB 4LEOA 1IBFA 3MBXL 2CR0A 4QRPA 5FO7B 5ICXB 1KXVC 2GCYB 5DF0A 3GDBA 3EO0B 1WP6A 4M9OA 1NCOA 2CMRH 4I18A 3HZMA 3HNSH 1QHOA 4PLKC 3FUNA 4H26B 1OGPA 4S1DC 4JZOA 1QYGH 3NRFA 5J9PA 2XNAA 3BPLC 3DOSA 3M0AA 3KYMA 4I87A 5LWYL 2Y9YA 1PP9G 3LRKA 1YSOA 4Y5XC 1G1OA 4O02A 2EXSA 1R75A 4AL8C 2DTSA 4GI6A 4C4KO 3GM8A 2OAAA 4JQVC 3SZKC 3NT0A 3UEZA 3NTCH 4G83A 4WW2A 3ARDD 3QRGL 4X5QA 2BCCD 3IGKA 2IDFA 1H0TA 2CLRB 5D2LE 3SYCA 3T2NH 5EUOB 4AYDC 1GMEA 3P0VL 1FZBA 4ZZKA 1RUAL 3HMWL 5DJ8B 4MAYA 3TGUG 1OGAA 5L2KE 4OZIA 1MHPL 2QVTA 4HK0A 3INUH 4PY7B 5EU4A 4OCWL 3HEIB 4H7VA 3ALWA 5GISL 4K7PH 3N1PC 3L7EA 1BXXA 3TXAA 5CFAA 1KIUA 3PL6A 1A2YB 4X98A 1AO7B 4OD2B 1J88A 1HKFA 4M6MH 3ROOA 1YEDA 4LHUA 4L2YA 5C97A 4M1DL 2C4XA 1RHFA 3V0WH 1CU4L 1XTMA 3HBGA 5E23A 1TEFA 4YSQA 2UZYA 2WWKO 1S9YB 1SQPG 4D7PA 1OK0A 1SQQK 1FE8H 3MBED 5BQ7A 3AG2B 5E79H 3M9HA 4UCFA 3A22A 3QP3A 2J6WA 5T5FH 1Q90A 3HE5B 3DTDA 4X7EC 4ZW6A 5C07B 4IOSD 1HHIA 1FC1A 1MVYA 3AACA 1RY7B 2CBMA 3SDDC 2OFQA 3FU6A 3CNKA 1OCOB 4G71B 4RGNE 4FNLH 4EN3A 1UD3A 4FZ8L 4IIQA 5D7IA 4A7VA 3QHFL 1YMME 3B9AA 2QA4P 3QAZB 2OR8A 4J4PD 1ZA6B 2EO1A 3QQDA 1BE3G 5KBKA 2BP3A 4HWEH 2AXGB 1SFCB 1TEGA 5L8KB 4XVTH 1E65A 4U3FE 2V0AA 4X7TB 2WVTA 3HPLA 4MCZB 5LKNA 4NKMA 4MCMA 4GQPH 2W83C 4J39A 4DWHA 3S4SG 5DO2C 3ALXA 2I5YL 5KJ4A 2QFPA 3BP7A 4HP5A 3NZHH 4IMLB 3B4SA 4MMZC 5B1KA 4PWJA 5FO8A 1OVUA 2YUWA 3GS0A 4ORGB 5IOPA 3BWAB 3K8MA 4HOWA 5LDUA 3D06A 2IOIA 2WOBA 1FDMA 1QQDB 2HX9A 2R69A 2EJ1A 1BQ5A 4G70B 4H0HB 1A1NB 3T0XA 3UTPD 2D2OA 4XPAH 1MVUB 4YH6A 3L9BA 3OKDA 3ROLB 2A45G 4X4XA 5C08A 5H4ZA 1H8OA 5ISZB 2YAQA 2E47A 1UWGH 3IU4H 4MLIA 3S37X 3KGSA 1YNTB 5T33H 2FECI 4S1RH 4Y16C 4FADA 1HHHA 3CSYA 3BT2L 2UWEB 3MUGA 4JFUA 3HE6B 3MCLL 5EBWA 3L35A 1AGCB 4AH2B 5GTHH 1F8TH 4RWYL 4B7IA 1A6WL 1GZHA 3DMMC 2OQQA 1FFNA 2ZUYA 1HH6A 3I9GL 4YE4H 3CMAP 3VFNA 4G8GE 1MFAL 1N2RA 4PWKA 4A2GA 3BOVA 5CCGE 3RIKA 5FO9B 3K2UL 1OEZW 4RSYA 5IFJB 5IR1B 4JHZA 5IROA 1E4KC 4YLBA 3V0VA 4GDOA 2QVIA 3GSOB 4POZD 4EDWH 3V0AC 1OTTD 4NI6A 4Z3TA 2YMKA 2PFXA 1HJ0A 1YEIL 3WIHA 5KAQG 4PJHB 4WW2F 1A7NL 4EUPG 5DQJA 2M1KA 1TFPA 1TVHB 5I0DA 4JQXA 1AS7A 1RJZA 2N3JA 4F3FA 4ZUTA 2BNQE 1OIOA 4MD4A 1O6TA 3WN6A 3GSNA 2DJSA 3OZLA 2PETA 5FEBA 1GGIH 2BS71 2IAMC 4GW5A 5LXGL 1PDKA 4NNYA 1YPZE 1SGKA 5AAWC 2CXGA 5EFIB 1RF1A 1UZ8A 2D31A 1HTLC 1MRCL 2J7LA 4N2GA 2X9WA 3L17A 3L37A 4U6HA 2IV8A 3MRJA 3H1HE 2C3WA 1O7DC 2EEDA 2H26A 3AXHA 1GK4A 4JHUA 1IM3B 2YA1A 4PR5A 1I9IH 4ZS6D 5JHMA 2E6JA 4M7KL 4HGWA 1KTRL 2J88H 1HUCA 2ZYGA 2BMKA 3VA2C 1CTNA 1U2YA 3MNVA 4U1MA 4MQTB 3LH2H 5DD5H 3WNJA 5F3HB 4JBZA 1FPTH 1R5IB 3MRKA 1HVXA 2W80C 3UBXG 3VFVB 1VZIA 1DIPA 2CH8A 3QJUB 3M9BA 3FQUA 3S4RA 5DI8A 3CFBB 3K1DA 3A2AA 1RY3A 2FECL 4CMHC 3OM3B 4HXBL 3M88A 4CC4A 4OQTH 3L13A 2XZQL 4BZ2A 4JQIL 3NIDF 5FK9B 2C9VA 3RIAF 1CIUA 1ZRTE 3S37L 2DQGL 3FU7B 4F1SA 3L08A 5DXWA 4Y1AA 1CLOL 1S7XB 4OZHF 1TVDA 3QAZC 4R4BB 4JBSA 5A2LH 4YSAA 1Q86Q 2ZWYA 1XCWA 5D96B 1RXLA 5DFVC 1ROCA 3VXRD 2BHUA 4KRPD 4NO0B 4DQOL 2YPLE 1YEWA 2OMZA 2EADA 3WSQL 4H0LD 4JRYA 3LNFA 5D5ME 1ERNA 4DAGL 2P24A 3IK2A 3HR6A 4UB8H 1DTUA 1FYTA 4FFWD 4CNIB 2FGZA 2P80D 4FLSA 5IQ7H 1WZ1H 3KXFD 3WL9B 3TV3L 4MDIB 2RTTA 1T03L 1URQA 1ZIAA 1KOAA 4DGYH 5C0FA 1QBML 1BWWA 4FA8A 5LLIC 3STZB 1HYRC 2BCKA 3K6OA 2UY7A 4EZJA 2CALA 3B2PA 3R4RA 3FF8A 3O3DB 5TPWH 1QRNA 1KPUA 1DQJA 3HE6C 2ADJA 4N5ED 5EUOE 4E42A 1S6NA 3HG4A 2XG5A 4XPFL 4Z76A 5KTEL 1RUML 1HZHL 1FVCA 1UT9A 3ME0B 4FHKA 4KH9A 4N28A 4BGLA 5BZDB 4M3LA 2W6AA 1S7UB 4K3AA 2XN0A 4HWBA 3N6YA 5HTSA 2BSRA 3RTLA 2EIBA 9CGTA 3H6JA 1OWRM 1BDYA 1AO7E 2ZAGA 3C8KB 1A6UH 3K7UA 1RJYA 3OLGA 4GIOA 1LE9B 4LQFL 4JFXA 2R2BB 3AU1B 2WB1A 4Y4HD 3RY6A 4ELMA 1FL6B 1OOWA 3RIAK 3HTLX 3FTUA 1A64A 3K6IA 1S9KE 3C6LD 3SGJC 4PGJA 4ODUB 1GS6X 1TQSA 5AW1B 2VLJB 1I4FB 1Q9WB 1EJ8A 2OTUA 3JCUH 1YEJL 2ZE0A 4IFDK 3L7FA 1AZVA 4WFGE 5D7LB 3SFDC 1IFHH 3IMSA 1ZGLB 5I17B 2IZ0A 5G4OA 2ZG3A 4C56B 2P45B 4WTZG 1KJVA 2IADB 2Y69B 3Q5OA 2G5UA 4OKVA 5DJYA 1KACB 2WBXA 4LSSL 1LK3H 4U3SB 4D0BA 4ETYA 3SDAB 3OG4B 3TN0D 4QHMA 3AMKA 3BD4A 5FKAB 4OCYH 3WNPA 1D7BA 1IGTB 1V7MH 5DMIL 2FT6A 5AVXB 1CSBA 2Y06H 2MNUA 3L6FA 2M2DA 3WNIA 1RUPH 1MRFL 3VFSA 1HOEA 3QFDA 3BATA 3BQUD 3K0WA 7FABH 2FQFA 2D3JA 4IBSA 3B2DC 4Y5YA 1D5XB 4YZWA 4J5VA 2BSDA 1EPFA 4JKPL 4MSWA 4NLHA 3CSPA 5C0CB 1CLYH 4DPCX 2GK0A 3V4UL 1BEXA 3TBTA 4Q6IA 4MA7L 3B7TA 3UTTA 3BZDA 3RWIB 4DGIH 4PTUA 4MWFB 4YO0A 4DN3L 2ICWI 1WZKA 4B9JA 3X13A 3HCVB 3MC0A 2FX9L 4ZTPH 5K59E 1N6QL 5L2KD 3T0AA 5ISZE 3JV6B 2F9BT 5KVDE 4Z95H 4H0GA 1DLHB 4JO4L 1JUNA 2LQRA 4KQ3L 1CI6B 1CL7H 4H88L 5EC1B 1CDHA 1BQHB 2QV2A 2W6JH 1VJSA 1AC0A 3O0RL 1CCZA 3IMRA 2FT7A 2J12B 5E9DE 3WDHA 4MXQD 4QJ4B 3VGFA 1P1ZA 3AABA 2HVKB 1X7SA 2QVFB 2FH6A 3N42F 3LV3B 5D4QA 2CO7A 4NZ8A 2D3LA 4MZRA 3EYFA 3HG1A 4ZFOA 2EIKB 3SJVB 1F86A 5D96C 2X7LA 4DQAA 5CSBA 1DLFH 4WFEE 4HGMA 2BVOA 2C3HA 1DDTA 4CC1A 3GRGA 2DEXX 4RGND 5ITFB 3DO7B 5I1AB 5MEQA 1PTZA 1JPFA 1XIWB 1I1YA 2P10A 1I9EA 1YMMD 2WANA 4XHJC 2ZQKA 4OVUA 1BOGB 3RWHA 4YHIB 3JZYA 3SPHA 5DO8A 5BRZE 3UTQB 5HI5C 1IC5L 2DM2A 4U3FD 1NCCL 4ASVA 4JFQB 3P4LA 15C8L 5IFHH 1SLQA 1QFPA 3FZUC 4HVBA 5KJ7E 4F5CE 2H2PD 2WQWA 1HNGA 4UILL 2EDNA 4RVBA 3Q05A 1BQKA 2N7SA 5I6PA 4FQCH 4S1SL 5FCUL 1XF5A 1TQBB 2P5EB 5JUEH 3MLPA 3WTSA 2VL4A 4JPSA 5DHYB 1JGEA 2GB2A 3A5VA 3DX7A 4S1DD 1XB6A 1YYLL 4ODBD 2WSFJ 1GGUA 1O6SB 4P2OA 4ZAKB 2BX5A 3SD2A 1GTNA 1CLZL 4JO8A 2BC4A 2Q76A 2QTEA 1MH5A 4LKXB 4Y8DC 3EXJA 1TU2A 2AJXH 3SGKA 3SKMB 1KTCA 4IBWA 5EOQL 3US0A 1WITA 3BP6B 4ZTPL 3VWJA 3ASOB 2WQVA 4QTHA 2BIHA 1MFBL 1FL5B 2OW6A 4MKMA 2MJZA 1SJVA 3JZ7A 2UYLB 3KXDA 1VHPA 3DHPA 1SJHA 4L9LB 1YEKH 1YN6B 4CN6A 4ZW7A 3VD4A 3FT3B 4MBRA 5DRWA 4ZBJA 1CGUA 2R0LH 2H41A 2J6EH 2TSBA 3FFCA 3G71P 2R83A 3GEFA 2JNZA 3RIFF 1HN1A 4G8GD 3KPOB 2AXFA 3PTZA 2AXWA 2LLNA 2YMXH 3B8YA 3C87A 3TGXA 1SHMA 3RILA 5CCGD 3EUDA 3ULUE 4D9LH 4XPGH 4YXHH 4MRBA 4O9BA 5J6HB 1DQDL 4P2RE 4F20A 4HOXA 5DUML 3CXHE 1F4AA 2NY0D 1CW5A 3B56A 1AGBA 4FTVA 4OIBA 4DHLA 2F74A 1KN2L 3CD6P 2UZXA 1TZIA 3BISA 3C5ZD 2FATH 3KPLB 1OM9A 5IB5A 3KYKH 1OAYH 3FUJA 3HMXL 3CCJP 4ABVA 1JY3O 4WUUB 3RAJH 2K6WA 2XZAL 4JR9H 4HUCA 4E9WA 3CCSP 3BD3A 2BNQD 4LPUA 4ONFL 3OLEA 1IUZA 3SE3C 4KXCA 3UJTL 3QARA 4O02H 3ZZ1A 5J3HD 4RMSA 3B37A 1T1XA 4KTYA 4PJEA 5MERB 1T2QH 2NY7H 2LXBA 2PUQT 1FJ1B 3SDXB 2D0FA 3INOA 3L1OL 4N8UA 2NR6C 4Z7OB 4XNYH 4N86A 5SWQA 2VRAA 5BW7C 3AGVA 2CBPA 4MD0B 3MLZH 3U36A 3H1HD 4JHWL 3ARGB 3B2MA 3R1GH 2W95A 4ODSL 1ANUA 1N7ML 1A65A 2HCZX 2PCPA 2ZG2A 2FJSA 2YXVA 4FQLL 5GGVY 4XP6L 1MWOA 2XWZA 2I07A 3SPJA 3JVGA 4JJ5A 2W0FA 1BYPA 3BEWA 3FTGB 1Y07A 4ZS7H 4Z77B 1M7UA 5TH2A 1MUJA 3N55A 5D93C 4BH8B 4EVNA 2BCCJ 4PJ0H 2VL5B 1EZVY 4HXAL 4JFPB 3L71E 4N2NA 2VMCA 3IXTA 4Y16D 4ZPVA 5AW7B 5H94A 4YSUA 1KTDA 3H3KA 5E00A 1VFAB 3ARPA 1KYOI 1L6PA 4OLEA 1ZRTD 1XIWC 1F0LA 2K70A 3QUZB 4Z5RB 3GLDA 4XO9A 3N2JA 3ZQ9A 2WN2A 5HHQB 1EMTH 3D4ZA 5CSGA 3MX0A 2V7QJ 2WQRA 1GR7A 3B4NA 3CDFA 4PLOB 3QQ9C 4F8QA 3QWRA 3HD7A 4JLRA 5ESQA 3K2KA 2E75D 4FE9A 3T8XB 4C56E 1OWAA 1IBGL 2IWGA 2VW6A 2YPLD 3G6DL 4L8BA 3O6QA 3PF2A 3PQYB 1Q2NA 3FUFA 1MKFA 3WHE0 1FDLL 1GK6A 5I1DB 3LW5J 1NPUA 4F8NA 1X8YA 3USSA 5DHEA 4LDOB 5FYLE 1H6EA 5HGHB 3VXMA 4LAJH 5I0WA 1F97A 4O02L 5DR5L 4MD5A 4LC1A 4FZEL 4PIBA 2KNCA 2R69H 3PH0A 3KPEA 1TCRA 1CQYA 1QSFB 1SEQL 1J10A 3FB5B 4PLNC 1H6UA 5C0CE 2EDLA 1M05B 4FI8A 1WEJH 1YJDH 1RF0A 1ZEAH 2UVEA 3VFGH 4LLVB 1P7BA 4OLXL 4XC3L 1U3ZA 5L2JB 4M1GH 2Y5TB 1M6OB 4JO3H 3BUIA 3ZDXE 4L9LC 3C8HA 1C5BL 1BQHG 1TZGH 3L70G 1F42A 4S2SA 3DGCR 1ZTXH 4P5TD 3BH8B 5B39A 1E3FA 4NKOB 4ZS7L 2E42A 1NFDE 1AO7D 1XAKA 4FXGB 3H3PL 4LFHG 1UH3A 5KVDL 2OJEA 1KCRH 4KJPD 4N8CL 2G4EA 3ZXAC 2NZ2A 2P58A 3X11A 3LIZL 1TYJA 4ZOBA 5I28A 5BZWB 1A9VA 1M6UA 2WQAA 1S9KD 2V5YA 1YZZA 3RVTD 5AG8A 3GS7A 5KYNA 5EORL 2I9LA 2XWRA 4KVCH 3V4LA 1L4IA 4WFGD 3V5KA 4U7KA 4AYGA 5CSZA 4ES9A 5JQIB 1H3PH 3FHQA 3FUHA 3CXHI 4IS6B 1GRWA 1MFNA 4PJEF 4F7PB 1WHOA 4HUVB 4KKQA 5F7DA 1V3LA 2DTMH 3GMMB 4LEXL 5JLZA 3B34A 3BH4A 3GSXA 2ZCLL 4KQ4L 4HIHA 4LARL 5JIQA 1GD2E 3CN4A 1J8HA 1DBMH 1SXAA 3GSNH 5F9OH 5BZZA 3JUYA 1SFCD 1YUHA 3N1GC 4D9LL 2AGJL 1AD0A 2W07A 5GGTL 5SX4I 1HDMA 1G7PB 3V0DA 3W11D 3EW3B 4GXUN 1P7QA 3ARGC 1WWWX 4JM2B 1ZLSL 4NPYA 3MV9A 4B3VA 3VXTA 4L0YA 1JZIA 4U1HB 1BMWA 1XEUA 4S1QH 3ULSB 2ETWA 2IX7C 5F21B 4IKNA 2ZXGA 4YS4A 1HIML 4PJDE 3MR9B 4LAQH 1MZ9A 2R5DA 1W0VA 3ZKMD 5DC0A 2WITA 3QDMB 1MLCA 5GS0L 2ZPKL 3P2BA 1AIZA 4U1IB 1JZFA 3CZKA 5ISZD 2E46A 3LZOA 4NPFX 2FZ3A 2PO6B 2VN6A 2YARA 4QRQA 4X50A 3S8FB 3HNVH 1AZRA 5IB4B 3IMVA 3QO0B 3MA7A 4MX7B 3FH8A 2AXTH 4M03A 4BFJA 2IXQA 2JV6A 2HN7B 3N40P 4XVOA 3O3BA 4LU5H 3HE6D 3HZVB 3VX0A 4BFOA 2ILLA 1KELL 3QUKA 3L4WA 1S7TB 4DN3H 4XMWA 5DJDA 4BZ2H 5E9DD 1PF3A 1HXMA 1PYWA 1KEGL 3QUZC 5F3BB 1NAYA 4JY4A 1R9FA 1MCBA 1W8NA 2YUXA 4GSXA 2KT6A 3F7KA 3TBYA 1SN2A 4JFOB 3CI9A 5JMOC 1VQ7P 4NJ9L 4BV1A 1K85A 1OAQL 1TZ8A 4WFED 3SPVA 3WXWH 3ETSA 3LKNA 4LCCA 1L5GB 1T3FA 2Z64C 2KS1B 3RB7A 4R96B 2EDBA 2IFGA 1LE5B 3PWVA 1G6VK 4PGBB 1U8PB 3EYVA 2VMDA 2QBWA 3HPJA 3HHMA 5F1KC 1L9RA 2NTSP 3WIHL 4AKOA 3ULUL 2WZ5A 5GRJH 2NX5B 1CG9B 2K8QA 3NOIA 3SPCA 3VFOA 1HHGB 1AG6A 1PL5A 3MXVH 1I8LC 4NQCE 5BRZD 4P2YA 2AEWA 2O6EA 1DBML 5KJ7D 4UQAA 2AXJA 4MHHI 4ZUVA 1ZT1B 1HCYA 1S5HB 1N9PA 2YSSB 4GS7B 2AJZB 4APQB 4LOUD 5EBMA 2GI0A 2K78A 1WFTA 3WTVA 1LTJA 4E9VA 5BU5A 1S7WA 2GVYA 4PJIA 5C0AE 4BDVA 3ALPA 3EJTA 5GS0D 2VM4A 5G2NA 5FM5O 5F1NB 3OWRA 2P26A 3SDXE 2EDWA 2JJWA 2DQ6A 2HJLA 3G6JF 3FB7B 4FCHA 5HHVH 3P9MB 5D2NC 3ZTJH 1UASA 3P3SA 4MNQA 3WFCL 2X6AA 2HA1A 2Q8AH 1IM3D 2DQDL 4BCZA 3RVUC 5FW7A 3HI6H 4OGXL 2B4CH 2N01B 4KJYA 4NOFA 3WUWG 1QEWA 4JB9H 4HWBH 5LGJB 4AY0A 1SHWA 4FXGC 3VB8A 1XF1A 5EV7A 4ZTOL 2OARA 2BOCB 2WINB 4NM4H 2EDXA 3KVPA 3QCVL 4JDEB 4HD9A 4AM0B 1MJ7L 2NZIA 4XN8A 4R4ND 4ZZFA 4X9BA 1RSFA 4LL1A 1CMOA 4G9FA 1CFSA 5DJ6B 3GMLB 5C6TL 1FDIA 5E9NA 3F7RA 1ZV5A 3GSUA 5F7WC 1J1OL 4KO7A 2AQ2A 2EDYA 4G11A 1MCQA 3OKEA 3LNEA 4JJHA 2GTWA 5K9JL 5CBOA 5F96H 1FLRL 1DFXA 4YXWH 4ZPTA 1OK8A 4ZW3A 3ULUD 3M0DA 1ZS8B 1Y6MR 1IB5A 2H6PB 2DQCH 4LLQA 4TTDD 1SQXG 4N90E 2YC1B 4P2RD 3CXHD 3IDXL 3QWOA 3RA7L 3TEYA 1XTLA 1QFOA 2DY2A 2X88A 4XZUA 5GJTH 3TNNA 4YHMH 4J3OC 3PWNB 2O5XL 2ZNXA 1W6LA 1J86A 5IY5B 4LOVA 3EIFA 4MFHA 4NO0D 4UV4H 5DYOA 3HN3A 4UI2A 3O3EA 2BWIA 2EYTA 3PQYE 1FC2D 2QE7H 1ED3A 3EH2A 1VQNP 3HRZA 5B3JF 3JXAA 4WU5B 1JNMA 4OD1H 2PCFA 4TSBL 3SBWA 1OAUH 1QTSA 4JFDA 4KKAD 1XBDA 4Z7UE 3ECQA 3TO2A 3O3AA 1K6QH 2JXMB 4DSYA 4J8RB 5FYLL 3S3JA 3LB6C 5J13B 3PIQB 2GTZB 4OFKA 2ATPA 3RY5A 3H42L 3A4AA 3RWFA 2PO6C 3EYQD 4BRVA 3EGDA 5APXA 1H3TA 2IPTL 4R7DB 2XTLA 3UIAA 5IHZA 5CINL 3PGFL 1LGVA 2Z7WA 1Q9LB 5D1QC 4QO1A 1KBVA 4RCAA 4RFNB 5E1QA 5EU5A 5CO1A 2APVA 3AE6C 1EK3A 5F9WB 4NAJA 5E5MB 3V4VL 3NK4A 3K3QA 5C0GA 3MAWA 5ID0B 1NH6A 1O7VA 3QAQA 1OAKL 4EBQH 2DIAA 2I25N 5IB2B 1N0XH 3EZ8A 3IS0X 2CIKB 2CGRL 3L5XH 4JFZL 4XMLL 4F9PC 4FA6A 2W8ZA 3L71D 3IFPB 4WB4A 5ABDE 2Q3IA 1AVAA 5CGTA 1Z9PA 4EIUA 3RJDA 1YEGH 1UXSA 2ZX7A 3K71A 3L3DA 1BWMA 1BFOB 1D5MB 2OR9L 4E5XB 1YO4A 3NA9H 4U6VH 5TQ2H 4Q74A 1BQRA 2F53B 4JRXB 1ETJA 4LL9A 1TVBB 3QDGA 5DQDL 4KMTH 1K8IB 2WPGA 5ENWA 4EN2A 1OM3H 4C56D 5MENB 3NJJA 4UTAH 2PP8A 1URIA 3EYOA 1KWKA 3BDYL 1MEXH 4GS7C 4APQC 3SDAD 3A67H 2QMJA 3UYPA 5IFAL 1L7IH 2VDKH 4PLJD 1ECZA 2DMCA 2Z8VC 3CZLA 4KUCF 3TNMA 1HU8A 5HYIA 5FYLD 3O4LE 5KOVC 5I6XB 5JQ6H 3F5WA 3FO1A 1UUSA 2Z7ZA 1Y1UA 3MV7B 5CR8A 4TMPA 1AKJD 1ZHLA 1FCGA 4Y99B 3BIKA 1OCRB 5JA9A 4OLUL 4RAVB 1PGPA 4X5XA 2WNKA 4JE0A 2HAZA 2I60L 3AREB 1YY9D 2FWOA 3F83A 4L3EB 2G4GA 2GITB 4OUOA 5C0CD 2E27L 5FM8A 1JHKL 2JKNA 2P5PA 1JZEA 2YJQA 4JFFA 4L8SA 3HE4B 1RFDL 4P59L 2J1XA 2WZ6A 5SWZA 3WS3B 2E7LC 4XE0A 4P9MH 1CFTA 4U3FJ 1LO0H 2QQKL 4Z0BH 5JPMB 3W81A 3QZLA 3MLVH 3RGHA 1CGVA 5IUSA 3M9QA 2WKGA 2OYLA 1Z9SA 1ET5A 4AQ8A 5AVTB 5FC9A 2I9TB 3OKOB 3W9EB 2N4IA 3QQNA 4GAJL 5MEPA 2N9YB 1H6FA 4HETA 2OK0L 2NOYA 3VI4F 3LKPA 4OIAA 4PB0L 1DQVA 5DS8B 4G43A 3MRDA 3N91A 4HUUB 1U6AH 3SWKA 2E9GA 3GI8L 2ZYHA 2FJUB 2XWCA 3BZFA 4TNEA 4EIZC 2OS7A 1OV8A 4TUJB 1HEJC 1FN4A 2XJLA 1SM3H 4NSKB 1YEEH 5EEXA 3OAUL 1QNIA 3QUGA 3X1EA 2DWDA 1IAMA 3K72A 5ACZB 2XWXA 4YHOL 1CYXA 2BCCG 2P8LB 4GINA 1ACYL 1E4WH 1UA6H 3MSPA 4GAFB 4UB0L 1G9EA 1SDDB 4DKEH 3K81A 5FX3A 1CFVL 3M46A 5CEYA 1UACH 4PV1D 1WO2A 2OSXA 5IGXL 4ZNCA 1AIFB 1PLBA 3MYJB 4TSCH 2DBLH 4GI8A 4KV5F 4NYLB 4UDTB 3P2TA 3SSGA 5GIRB 1IKNA 1GS7A 2COVD 2ITCB 5C9JB 4YDJA 3L5WB 4DTGL 2XWTB 5J13C 2HRPL 1QBAA 1ACXA 1IU1A 3OB0H 4MZ3A 3MV8A 3OD3A 4X4KA 4Y0GA 3DX6A 4XMZA 4KBPA 4PH8A 3V2AR 3VACA 2MNJB 4RGOH 4WO4A 5A2JH 2A83A 1ZVSB 3UIZA 3LKQB 3GRWL 3ESMA 1M2VB 2XHNA 3NCXA 3GBMH 4GAYA 4OGQB 1IGYB 4RFNC 4ZAKD 5KSUB 4MNGB 5C0DB 1NC2A 4U31A 2VIRA 2J58A 2F5BL 2R1WA 5DMKA 1ILUA 4PGEA 4WDIA 1OSZA 5LVEA 2DS4A 2V6HA 5CZXD 1T7ZA 3X3GH 1CFMA 2WYHA 4B9GA 3ELAT 5KVEH 1RMFL 3T97B 3FFDA 4NCC2 4PD4E 1G1YA 4OGYH 3H1HJ 2EVJA 4QF1A 5LXVA 5B1BB 2AEFA 4DP4X 2E76B 4UUJA 3FC8A 1TDQA 4UIMA 4PP1D 5EPMB 3AE7C 2ICWJ 4UMSA 1KJMA 3KL3A 4U1GB 5D7EA 5IJVA 1IARB 2VW4A 2DM4A 1D7MA 2Y9RT 1ZIBA 1SDYA 2OGUA 3HHSA 1JPGB 3SCMA 2QLVB 4LIQH 3SDCA 5CEZL 4L29A 3QRLA 4ZSOA 4PSRA 1FZEA 1GL2A 2NPSB 1SHXA 2DDQH 1JV2B 4M5ZH 1LYQA 2VB5A 3STLA 3CVIH 4PG2A 3ISRA 5I6XC 1XX9C 2F19L 2H0FA 4MBOA 3RX5A 5J6GB 4Y4KA 1XF4B 2A9NL 2VAAB 3LPPA 2CDEB 4APXB 4NQCD 5JNYA 5A6MA 3MP7B 4Y99C 1AJ7H 1NU1K 1J12A 2PTVA 2V37A 5FUOH 4BYHA 2ZX5A 1L9PA 4LRIA 1M7DB 1EIBA 1T5WA 3JWDC 3L3GA 5EIIB 3MTXA 1G7MA 3KLDA 2R0ZL 1DFBL 1HXYA 5A3IC 3PWLB 2KZ1B 4MS6A 5C0AD 1XF2A 4PJFE 3MKGA 3SDYH 1R3JA 2O26U 2UXGA 3M8OH 2JWAA 5F0JB 1F11B 1F3DH 4JKLA 4HKJA 1QA9B 2JCWA 2VXTH 5IW1A 3RVVD 3UYRH 1Q82Q 5GS2H 2IDSA 4JY5L 5IW6A 1URLA 5EO9B 4X7SL 5BZXA 5HDQH 4HQQH 4CKQA 4HJUA 2OZ4A 3LKRA 3FQTB 4KXAA 1MI5E 4G9FE 1QPKA 3VNZA 2Q3AA 5HGAB 3GTNA 3KPSB 4OCMC 4ICWA 3VFRA 2FYUE 2YQBA 1AVYA 2BPBA 4L5FH 2BXZA 4N9GB 4KTEL 1OD9A 3LPOA 5IVNA 1T21B 1U33A 1FZJB 3FS9A 3GB7A 3R0MA 1NDGB 3VM5A 1SYSB 4TOYH 2QQNL 4K2UL 4X0KA 4R90H 1E6JH 4HB1A 3F7YB 1N68A 3CFJB 4NJAL 4M00A 3PE9A 3QPXH 4AEFA 5DJCA 4M6AA 1N3NA 4R8WH 5KN5A 2QKIC 4ZQKB 4I2XE 1RZKL 2ALWA 4X6DE 2K4AA 2VN7A 4N90D 1Y47A 5ESVB 4RMTA 4U4IA 4DKDC 5MEOB 1WAAA 2F53E 2FUQA 4JRXE 3M45A 4Z7VF 3D18A 2FBOJ 5LGKA 2JSFA 3CVIL 5GGSB 1KMGA 1BLNB 4OT1H 5KSBE 4YNYA 5MENE 4P5RA 1F00I 3IWUA 2BVQB 3K91A 4WJ5A 1RZPA 1H3VA 3QJZA 3PQYD 3WEMA 1ETB1 4GNKB 1LEIB 1N6VA 1OZUA 2YAOA 5FDWA 3PJSA 1G9MH 4AQ1B 5E4EC 1UVQB 3GUTB 4QHNB 4KZDH 4OGQC 1FI8C 4GUQA 2K6ZA 5E7FA 1I85A 4ZUUA 3Q0HA 5H35B 3V6FB 4P4RA 1FNFA 3FK3A 3RK2B 2ESVB 3IJEA 3KBPA 1KULA 1GC1L 2ZCZA 4PRDB 4B60A 1I8KB 1NM4A 5HDQL 3MODL 2Y7QA 2EIZA 1QABA 2HT3D 2VE6A 3NQIA 3IRCA 1W91A 4WEEA 2C1PB 1E9OA 2J8OA 3IBOA 1YECL 4MYWB 2E76C 1FS0E 4I89A 4W81A 3SYPA 1EDJA 1QTPA 2DWEA 3U0TB 4ZFZA 3D3VE 2B2XH 3NFNB 3RVUD 5F89B 4PD4I 5IMOA 2APFA 1J05A 1LM8V 3MREA 5SV4A 1D6VL 4Y2DB 4XNMA 1KYAA 1WH0A 4NO5A 3UC0H 2DWSA 5FUZH 5D8JH 4C7NB 1J9CT 2NPSC 3ULAB 5GPRA 5I16B 5I1IH 1PGOA 3B5TA 4OLWL 3GZPA 1C1EL 4WI2A 5KYXB 1P5VB 5EN2B 4QD2E 4I3GA 2Z31D 1CBVH 3RNQA 4WHTB 1H15B 2DLTA 4KI5F 2BSEA 3N50A 5HI3C 5CIPA 1KENL 1QR1B 3LHPH 3H9SA 3GHEH 4TRPH 1RU9L 4X6BA 2EVGA 4N9OB 2YQGA 1KYOJ 3R2PA 2IH8A 2NLJB 1EHLL 2CA3A 3MLUH 5DJ2B 1KF9B 3VWKA 3O4LD 1A14H 1X5ZA 4NWUH 2C3XA 5IMMA 3KHUA 2JWYA 1E2VA 1HINH 3ZR6A 4FJ6A 3LQZB 4IBUA 3QXAA 4HF5L 3JTSB 5GTHE 3L4CA 4GXVL 4JM2D 1WT6A 5DRZB 4BINA 1GJWA 3NCMA 3R4DA 3C09B 2GIYA 4FQ2L 1SEBA 3HS8A 3MJ7A 5BO1L 1F1AA 2R2EB 4UQ3B 4X4YB 4BRYB 5EZIL 4B9ZA 5C0BE 1EV2E 5EU6B 4YFLI 4PG9B 1LDPH 2O6DA 4Q8BA 3OKMB 1SXBA 3ATFA 2FY8A 5IBTH 4KGJA 4AIZA 1I3RA 4G7YL 2FT8A 3EXLA 1NGWA 3G5YA 4YAQB 5E2WL 3R19A 3FCGA 4JHAH 5EF1A 4PP2A 3CWGA 2VXVH 3F84A 1I8IB 2X4QB 3DX4A 4UT7L 5ERWB 4K8RL 4YDIL 3VI3F 5LJYH 1N64H 2B15A 3QI9A 1OQOA 1F4YH 3L75E 2WKLA 2GQHA 1SQBE 2Q9OA 3MLWL 3N41B 3RWEA 1GPOH 2VISB 4IU3B 4KY1H 1U8LA 1A6ZB 1INQB 3U4BH 1VGEL 3QEQB 2CJ3A 1JK9B 4W68A 5TFSH 1JNLL 3P11H 1KCUH 5BJTB 5DUBA 1LT9A 3ARUA 4CVUA 3RJOA 3LS5L 3CXFA 4HUWB 4N26A 3RRQA 1ZLWK 3GFUA 1S7SB 1OF2A 4R0LB 4XCYB 2OMBA 4GXFA 5E2VL 1OAJA 4AV0A 4UINL 3T77B 4BH7A 1XCXA 1H89A 3MRHB 1MCPH 4J2QA 4F7EB 3OAYH 4HSAC 3QVAA 4KRLB 1WVZA 2P43B 3AE2C 5JW3L 1LVEA 1DN0B 2AJ3B 4TV3A 2JK5A 1XO8A 3OZ9L 4BK5C 3TFBA 2CGZA 3KH4A 3V8CA 4NM8L 4XMTA 2BCMA 2EDDA 4KKCD 2F8VA 3WKQA 3B71A 3MO1B 3CDYA 1CS6A 2EECA 4QWWC 5DK2A 1M57D 2D7NA 3MRQA 3CPLB 3JV4A 3MNWA 4BKTC 4N3UA 3RK2C 3AG1B 3CXHJ 4L48A 4RMQA 4GLRH 4G9DB 5JOPE 5JXEC 3D39B 2XN9B 4OCSL 4D94A 1ZGLM 2VXQA 5LBGA 4U1KA 5DSCA 3FU0A 4OV6F 5B5EH 3E8UL 4UV7H 1ORQA 2GSGB 3DARA 2HR3A 2V8MA 3W0WB 3FB8B 1WFUA 4FABH 1XGPA 4GUPB 1IT9L 1Z5YD 1D9KA 2E59A 1BAGA 2J2ZA 1IC7L 1TJHL 3LX9A 4UAOB 1VIWA 2PRRA 1S9VA 2NUPA 3WGUB 5AG9A 1OALA 1QSEA 3HC4L 2ARJA 3ATBA 4I18B 4M3JA 4Y2DC 3HZMB 4ECNA 2WUBH 4WCYH 3C2SA 4LNVA 4G1MB 3HG2A 2QGEA 4PD4D 1WK0A 2MKWA 1QNZH 2QPDB 2XNAB 3DOSB 1C8QA 3KCPB 4LSRH 1HHKA 3C8DA 3NZUA 4ZSOE 2XIBA 3MACL 1LL1A 3V0HA 4EOWL 5FYKL 3CBKB 2A73A 2F0CA 4OZFA 3BVUA 1U2CA 4WW2B 1FVEA 5AKRA 3TONA 4MDJA 4EEEA 1KN4L 5E1AA 1RZ7H 1T7WA 5AVVB 1NIFA 1H0TB 2HT2C 4N0CD 3PJSK 4R2GD 3OF6D 4M5SA 4XVUC 4A7QA 4CW1B 5E8EA 3REWA 1QX8A 4ANUA 5EFWB 4ANWA 3VGDA 4MAYB 4WWPA 3ZDZF 2KBGA 1SBSL 2Z7UA 4Q14A 3L71J 4HK0B 4TQEL 3VFPA 1PFCA 1BM3L 3IFLL 2ZVNB 1E40A 1KIUB 3PL6B 4X98B 3SE9H 1JB0J 5DMYA 3O6LH 1YMHA 3ROOB 1YEDB 5CCHC 2XWEA 1Z6JT 3MJ8A 4PJAE 4I6MC 3DPBA 1U8JA 3GO1L 2QSCL 3VW3H 2ZVOB 4GG6E 3C09C 2R1XB 4AEHL 2BS9A 2UZYB 4S0HA 4QHPA 4BZ1A 3MUY1 5BQ7B 1RIVH 5FHBH 4XRCA 3MOAL 4BM7A 3VG0L 3GXDA 1HHIB 1F4XL 4JANB 1T7YA 4R7NA 1R1CA 4WY7L 5HJ3A 3PV7A 5T1KA 3D30A 2ZCKH 1NAFA 1LGHB 4HOMA 4DW2H 3GJFA 4OFIA 1G7IB 2ESVE 3G5VA 5D7IB 1W72B 2Q20A 5HHOB 1SQQG 1MI5D 1KXTA 4G9FD 1AR1B 4JKNA 1IO4A 3NIDB 4F8OA 3FQXA 4CVXA 1J11A 3QPKA 3KD4A 4N5UA 4ZMWA 2YKOA 5HJGA 2ADYA 2FYUD 2FQDA 3PAYA 3WKMH 3ZSSA 4AZ8A 4JPVL 4BXSV 4Y7MA 2R8SH 1LT1A 4WTWA 3QC6X 4CVWA 3TNUB 5MP6H 1MWAA 3J8F7 2IOOA 4NQDA 5FO8B 6FABH 2J8UF 2HH0L 1AH1A 2A9AA 4DESA 1PIXA 1Q1PA 4POYA 3ZE0F 1NBQA 3LN4B 2IV9A 4ZO7A 2A0LC 1ZAGA 3F58H 2QG4A 3OW2O 1FCCA 4DZOA 2B9AA 2Y2WA 1OP5H 5DMGC 2H8PD 3OKDB 1BCCE 4X4XB 2DEYX 4ZQTA 2QJDA 4QRFA 5DD3H 5DLLA 2Z8RA 3MRMB 2F53D 3P3RA 4JRXD 4V1DE 3V9CA 5AVYB 1RPKA 2Z1PA 3TTSA 1YN7A 1EBPA 3IMTA 4JG0H 4LO9A 3CSYB 1IC0A 3MUGB 5MEND 3QORA 2DL2A 3A4FA 4NAMA 2KH2B 1GJUA 4HIJA 4ZD3H 1F90L 4IRSB 4Z78A 5EBWB 4NPEA 2AVFA 4HH9B 3MLTA 4J3XA 1KC8Q 1UC6A 1J1XH 1ZHBA 4A6YA 2OTWA 2PXYA 4AXWA 3VFNB 2Z3FA 4IOFD 3S36H 1F3RB 4FL4B 3SOBL 2F54B 4PJCE 3GSRA 4PV8B 5ALBH 1Y9BA 1N2RB 4LVHB 2KSEA 4GRMB 2FB4H 4WEUD 4XMUA 3ARED 3N4XA 3F01A 2J59M 1WRGA 5L8RJ 5C3LD 3CN3A 1DBBH 4UAOC 4XPHL 1B0WA 2GSMB 2XZZA 4I18C 1AGFA 5APTA 3TK1A 4I3RH 2R59A 4P2CG 5EU6E 3NACL 1R5WB 1UCBH 4XX1G 3FBKA 3NGBC 1A1OA 4WTQA 4AVKA 5DQJB 4JAMA 5HDRA 2C4FU 1AE6H 1RJZB 4GG8B 4LMQE 5A2AA 1XGTB 3UAFA 4F3FB 3SODB 4DIXA 2HODA 5K5GB 2WO2B 3D3VD 3GSNB 1JXJA 1BFVH 4WW2C 4GW5B 1N59A 4NNYB 1I1AD 2EDHA 5FV2A 3AQXA 2D31B 2BIMA 3DSFL 1ESOA 2G9HA 2RACA 3CLEL 1VRSA 2FJFA 4U6HB 3BP4B 5I1LA 5FXCH 2H1PL 3MRJB 2F1EA 4V11A 3IJSB 1Z3GH 4R97B 3PNRB 2A6IA 4YXDC 3GMNA 4MAYC 5FA4B 1UQSB 4OSUH 2R56L 1RK1A 4FQJH 1A7BA 3G3LA 4RGMB 1MCJA 4WKZA 4DO4A 3PL6C 1HILA 1FJPA 4P23D 2A1WH 3ABKB 4U1MB 5F88A 3W68A 2RCSL 3AE3C 1UT1A 1HH9B 1UTDA 1ZLWH 5E8PA 4OD3H 1FVDB 5DD6B 4Y1SA 4ZO8A 1PG7X 2XI9A 1IBDA 3FQUB 3MRNB 4UF7C 4WI4A 4XMKL 1DVZA 5DI8B 3EKCA 3UL4A 1Q8MA 3MNZB 4ENEC 2DV6A 2NCMA 4KJQC 3ABGA 4YDVA 4BK4A 1BEYH 4XNBA 2G8YA 2NW2A 4DUXA 3QUXA 2IWFA 4ESKA 3BASA 5I1JL 2VDLL 3PDOB 1FZGA 4AGMA 1KGYE 4F8TA 2HLFC 1NINA 2VMEA 3AT9A 4EI6A 1GYAA 1AR1C 4Y1AB 3D39E 2CKBL 3BC9A 3BVVA 2OZ4H 5C0BD 2OJZH 4YJZL 1PG7H 5AKVA 3V0JA 1MFDH 3DURA 3O9WA 3GBLA 2KZKA 3TBWA 4PMEA 4LSUH 5EH1A 4F24A 3W0WE 2VH5L 4GSRA 3N42B 5C86A 5I30L 5HYJE 2OMZB 1FL3A 4CVZB 4JRYB 2EXWC 4LBEA 4ODWA 1DBAH 1PGRB 2NDGA 2CO4A 3BE1H 5DZLA 3T0DA 3O8ZA 4RO0A 3L75D 1BGYE 2I7OA 1CXLA 1SQBD 1FYTB 3GKWL 4QTFA 4HOZA 1GGCH 2GC7C 5FF6B 3QNZA 2B1AH 2K7PA 3CVHL 4DKFH 3M91A 1I1RA 4RBPK 2FFDA 1EXUA 4I5BA 1URQB 3KM1A 5C0FB 1AFVL 5I74C 4G82A 2WQXA 3BUBA 2WWNA 1YJDC 2BCKB 1V7NH 3QJQB 4YVNA 4I13B 1PD6A 2UY7B 3OKKB 1FH5H 2XOTA 3WN5A 2O3JA 2QGCA 1A4KB 1YQVL 1QRNB 1KPUB 1JWSA 3CLFH 1N7SA 5DS2A 1VA9A 4IRSC 1KGJA 2J44A 4TT3H 3JV5A 4C57C 1U58A 2XPZA 1ZCRA 1NGZB 3HJ0A 4LHUG 8FABA 1OTSD 4FQXD 4OJFL 2AJVL 4QIRA 4OD3L 2BSRB 5CEXB 4WWKA 4FL4C 4Z7QB 4U0QB 1IAII 3UZEA 4B9PA 4HPOL 4LVHC 4I1PA 3TJEL 1RJYB 5I73C 3LKSA 2EKJA 3OG6B 1MZZA 4UQBA 4F80A 1JWMB 2AKRA 4U1LA 5JOPD 4IBVA 1S5IH 3VRIA 2R4RH 1PFIA 5PAZA 4AGNA 2VSCA 2P67A 4PV9A 2OTUB 2YA0A 4ZYKA 3BW9B 1L0XA 4LF3A 2K37A 2GJ6B 1B2WH 3FTYA 4JQXC 1KJVB 4IYKA 4M7LL 5DJYB 4JS7A 5FA3B 4L1HA 3RL2A 4OUUA 3HZYA 2APWA 4HJSA 2ITDA 1TJGH 5HHOE 5HGDA 4XBEH 1BD2A 3NIDE 1A7RH 4U6YB 1TZHA 4LMQI 3V2NA 1RF1C 4OCNC 2FLMA 3A3YB 4NXSA 3VFSB 1ZXKA 2JCCF 1HGVA 4XWOD 2CIIA 4G2AA 4KKLD 2ADFL 4OZHE 4R97C 4FKEA 4KK8C 4Y5YB 1JGUL 4PGCA 2CRMA 4QKXB 4XGZA 3PHOB 5J0BA 2GK0B 3RUGF 4RGMC 1TQCB 2O1JA 2VAJA 4Q6IB 3WTTA 4NPDA 5AW6B 1JGVL 2F58H 5DFWH 1IQDA 1L0NK 1A9BB 3TEUA 4P4KA 1W0WB 1CTOA 5LO7A 3W2DH 3NP4A 3CQFA 4Y2NA 1T0OA 1EH9A 4J3VA 4GSQA 5CIPH 4XODA 3FXIC 1RKRA 1OANA 5CD3B 2X28A 4DGVL 4K35A 5I66A 3O8XB 1CZ8H 2XBZA 1EFXA 2ZSWA 3PYCA 3S3DB 5CJOL 1J5OL 1KBWA 5KJRL 2HJKA 3LPWA 3BSZH 1HFUA 2WMPB 5B4MC 4QY8A 1WWAX 3TH3T 3NSXA 1IAIL 2CO7B 4I77L 4ZFOB 1ET8A 3ULVH 2JIXA 1S5IL 2F54E 2WO3B 2XWBB 2FJHA 4LPCA 4N2LA 4QXTB 3ZUCA 2E4TA 1AY1H 1IGIH 4GSDH 1RL1A 1WIPA 4N2CA 2BVOB 1ETZA 3B5NA 3P0GB 4XBGB 3B8EB 2XCMC 4XNUH 2VLKA 1HJBA 2CGYA 2NTFA 4TUOA 2BIPA 1YEHL 2ESVD 1JPFB 1KZYA 3DRQB 4GBXB 5DK0B 4Z1PA 2VSDA 5JXED 4C8XA 3A0HH 5FUCC 1ASOA 1MW1A 4HT1L 3KMDA 3RWHB 4UT6A 1PBYA 1KLFB 3NH7H 1CT8A 3MCG1 4NHUA 4WSJA 1DH3A 3EOBB 3B2VL 1URQC 2OYHA 2VDKB 4IRJA 5DEFA 3T3MF 3BKML 1PZSA 5IQNA 2OL3A 3ABLB 4LPVA 2B5IB 4A2LA 1TUPA 4ZI8A 1BOYA 3WKNA 3GXNA 3QR1A 2AV7A 4MJIA 4Y2DD 1OMIA 3ARZA 3ZR5A 1JGEB 3B9KD 3IDMA 43CAB 3L3OA 3V0EA 5F7FA 1R3HB 4K3JL 3HI1A 2YXRB 3MN8A 1QFWH 3DYMA 1A9EB 2DIJA 2BC4B 2UVFA 2Q76B 2X4PA 4PBWD 1BCCD 4W9IC 1NKOA 4DP2X 2B4CC 1MH5B 5JDJA 2Y0DA 5JHLL 3QUYA 1RJCA 1MHEA 4ZUSA 4V1DD 1FIGH 1P5UA 2HFEA 2WXJA 3ARVA 3VWJB 2CJTA 2IGFL 4QTHB 3QNXB 3RB5A 3CSFA 4WLCA 5AB0A 3I2CL 4YGVA 3MRGA 1BJ1H 2QJKB 2E56A 2XKUA 1KIRA 3GIVA 1VADA 3RY6C 1CFQA 1SJHB 4EIJA 2IZ1A 2B7DT 3BEVA 2CJUL 5DRWB 1I9RH 3U9PL 2G5BA 5GGVH 1H9DA 1A5FL 3FFCB 1MG3C 3UJJH 4GIAA 2YS4A 4TLSA 2AXFB 2VXQH 3L71G 4L76A 4NBXB 1AANA 2IDUA 4L74A 5DD0H 1TTUA 3K5SA 4H20L 5HHNA 3GM0A 1HAUA 3GZOA 2NW3A 3KLQA 1JF1A 4L2LA 3MLXH 2XKMA 5DGQA 5EU6D 4KK9D 3MRCA 2F74B 3SN6N 2WLYA 1QLRA 1TZIB 2B08A 5BQDA 3RJQB 5KLVJ 3G5XA 4PCKA 4DN4H 1E5ZA 4OFVA 5I2IA 2GUOA 1SLVA 4G6ML 2RKLA 4Y5YC 5AOZA 4G6FD 3ZIMA 4EUPA 3BDXA 5DQ9A 25C8H 1U7JA 2LV4A 1M7IB 3F12A 1TQCC 4F7KA 2BZDA 4KVNL 4PJEB 1T1XB 4OZFH 2XNXA 2VO5A 4OZGF 1GH7A 4P04A 4Q6IC 3G5WA 4R83A 1GU5A 4MHHG 4WHYH 1NOLA 1M3JA 3DTXB 2C9NY 5SWQB 3U36B 3QEGL 1VZHA 4P5KA 3FJTA 1QI3A 4NP9A 3QJSB 4ZMLA 4JFWA 3ZTJG 3FPXA 4RMRA 3VD2A 3VYNA 3NZ8A 2CA4A 3T2QA 3WD5L 3OMNB 4PD4J 3ZBMA 4OJYA 1K2DA 1O5DT 5EU7E 2HRLA 1P9MC 4OQ1A 1UM6L 2SPZA 3CMOL 3D2UA 3F7LA 3PPSA 3ARRA 4K73A 4NZFA 1A1MA 2AAVA 1KC5H 2I07B 5AVRB 2PKDA 5IHWA 5DMGD 2JFCA 1KB5B 3BX7C 3BEWB 1WGVA 3JWNE 4R9HA 1G7JA 1IAOA 1PIGA 1MJ8L 4EVNB 3F00A 1XSOA 1B4JL 2J20A 3E6FA 5EU3A 4BZ1H 3V5DA 1U95A 1YNKH 5IWLA 5GQBA 5H94B 3RGVA 4HU8A 1KTDB 4ELKA 3FO9A 4X8JA 4XPTL 5DJZA 1WWBX 2K8MA 3WFZA 3II2A 2DH3A 1NJIQ 3QIBB 3AEFC 4GBXC 1TNMA 1JRHH 2UZPA 4TVPH 5BOPA 1QSZA 3SGEI 3D39D 1UENA 4DERA 2WIIA 3GJFH 3Q6GL 4NQXA 2WXRA 3MX0B 4GW4A 1JPTL 4JFYA 3MLXL 2CO2A 3HD7B 3IJ9A 4JLRB 5I8KH 2A9ML 2ZX9A 3LS4L 2HFFB 4QGYA 3QQ3A 3OAZH 2GJ6E 3W0WD 2M3BA 2PYEE 5LDSA 5HYJD 1JYNA 5F9JA 5IBUG 3QG7H 2BS8A 4N2HA 2VYRE 3TEZA 2VDML 2B5IC 3TBVA 4IBZA 5L4FA 1HCVA 3HN5A 1MWAH 4EZKA 1E3XA 1BGYD 1U8OA 3TO4A 1Q0YL 2Y36H 4JFEB 4Q52A 2V4LA 2WZ0A 1QLEH 3CH1B 3IJYA 3MBWA 4IL6H 2JJSA 4P2OC 4X6EA 3S9DB 1IGFH 3GNML 5FYJU 2KNCB 4HG4J 5SX5K 4MB1A 1BGXL 2NNXA 3WY4A 2XFXA 1V5JA 5K9KB 3SWYA 2WXMA 1FNGB 3SGKC 4UU9A 1I9JL 1N6UA 1XDTT 2WBJB 7PAZA 3VWJC 1JOIA 2DBJA 2FYUJ 4LLMA 2MCMA 1TPXB 4F57L 2KERA 3BPCA 3ET9F 2QJKC 5ITBH 3BKYH 1BQSA 3UCQA 1DANU 1SQPK 4TSAL 2BOBB 1MJUL 1DEEB 3LRHA 4S2SB 4M43H 4E9XA 2EE9A 4M7JH 2X4RA 3FQWB 2YK1H 1R6VA 2EABA 1LO4L 5D9SA 4A6YH 4ZW5A 4FFZA 2W8CA 2OJEB 2O1KA 4GRLD 4YIQB 2BNUB 3LJ3A 2Q86A 3PHSA 1G84A 2ZAIA 5KYUA 4PRBB 3SHSA 1BVNT 1G6RB 5IG7B 4YN3A 2X4SA 1K04A 1ZSDA 3SB3A 1W2EA 2WD0A 1NGPL 3NJNA 4KJQD 5KAQF 3V5KB 5GRXG 3GYRA 3UACA 2DQUL 1FZOA 5CSZB 2AERT 2BH0A 3B3IA 5ADPL 3KQGA 4M6OL 3T2LA 1ND0A 3DNKA 5ABZA 3DLQR 4HIEA 3KWTA 3OMIB 4MASA 1A25A 3CX5K 4LRNL 5HHOD 1U8MA 5CCKL 3TJHD 1D5IH 1FGNH 4OF0A 1OB1A 3G5ZA 5DLML 3Q2YA 3RVXD 3C9IA 4HIHB 1Q72L 4HC1L 3KWWA 4Q7DA 3FQNA 4I8DA 1ZKAA 5CP7A 1YUHB 3OV6A 3Q2LA 35C8L 5E6IA 3HC3H 1AD0B 4EI5A 2W07B 5HBBA 5J1AB 3JYBA 5T3XL 5ID1B 1P7QB 3AAZA 2R27A 5I5JA 4NPYB 3MV9B 2DN7A 5C7XH 3APDA 1NIBA 5EEVA 5D70L 1H88A 2Y3NA 1KLUA 3OTTA 4HLZH 4FQQA 1KFMA 3ABZA 2GEQA 1UJTA 1TNNA 1SYVB 3T71A 2DKUA 3NIGE 4XN1A 5E8DL 5JHDE 3VRJA 3VVWA 5KYYB 1U36A 2QQQA 4IGBB 4ODHH 3TV8A 3L48A 3ECVA 5JW4M 2W9EL 5C3TA 1PSKL 1LD9A 4QRQB 1LWUA 3MA7B 3PCYA 3POHA 4ZMOA 2VOTA 2X38A 2FQEA 1PGQA 2IXQB 3PDGA 3Q44A 2H47C 4H44D 1A6TA 1IEBB 1CK0L 3O3BB 4PRAB 3QUKB 5INCA 3SD5A 3UBHA 4IRSD 3BAWA 3QIBC 4PVLA 5DJDB 2ZOKA 1HXMB 1PYWB 2OMWB 2QHRL 2GI7A 3PAUA 4JY4B 4F7TA 1Y6NR 5KS9A 3TBYB 2IH3A 5AD0A 1UGKA 3H1KG 2F54D 2NY2C 2QLYA 3F7QA 3HD7C 3FAWA 1YNLL 3DX8A 5IB1A 2VDOH 3SPVB 4LCCB 5GGRB 2WSEH 5AEAA 3PABB 2HFGH 3VP8A 2C3VB 4CILA 4H8WL 4JHBA 2QFRA 3PWVB 1NTDA 4YDKH 4YPGA 3IDNB 2V8LA 2VZTA 1MNUH 2ZAHA 1A0QL 1BMZA 3VFOB 2YAMA 3FCTA 1BSIA 3PWJB 5FS5A 3AADB 2HG5D 4ZUVB 1DE4A 1J9TA 2VR4A 2FL5B 1NCAH 3A23A 4R84A 2WKOA 1J1PL 3GTVA 2HJFA 2EYRB 2VLRE 2WBJC 3C5JB 4MJ2A 5EBMB 5IB3B 1AXSA 1FNAA 5DJAB 3DJ9A 3FXDA 1RF0C 2ZOUA 4I85A 4PJIB 1HYSC 4DVBA 2AK4B 2Z92B 4TKWA 2HJLB 2J56A 5T1LB 2X89D 3APNA 1IFRA 4MNQB 3C2AH 5HD8C 1WBYA 4W4OA 3L75J 2EXYD 1K5NA 3D4YA 3UPCA 1SQBJ 3EJQA 1EJ6A 4H40A 3MRRA 3H7BB 3PGDB 4KJYB 1E28A 2AMGA 5TISE 4PJBA 3B83A 2YJLA 2EC8A 1JXGA 2MJWA 5L9DL 2IJ0C 2BVPB 4RESB 4AJYV 4IEFA 4P46D 5CFHA 1YAIA 2X6CA 3A6BL 1AHWB 4PJ5B 5T1DH 3D87B 4K3DL 3GSUB 2FHFA 2VZUA 4PRHA 3ZQWA 3LRSA 2C34A 3I55P 1G7LA 2CPUA 3EWKA 1NFIB 1SMOA 2OCFD 4G3YL 4NPKA 2W90A 4BQ9A 2KDYA 3NRPA 4ZPTB 1U8NA 5HHXL 5KZCD 1L9QA 3VI4B 4LLQB 4ZXBA 5B4MD 4MJ5A 2D3VA 1U8QA 3BUDA 1VKXA 4WY4A 1U42A 3QWOB 4YHZL 2V9UA 4MA3A 1EAPA 4AUYA 3H1IG 5LNDA 3TNNB 1SPDA 4KAQH 2E5EA 4HFUL 2WN3A 5DYOB 1L7TL 1X9UA 3O3EB 4A04A 2EYTB 1G9MC 5HDLA 5JIDA 3B3BA 1ED3B 1RP8A 4R7VA 1JFQH 1KCSL 3ECBA 5B21A 4L4TA 1OWWA 3I6GB 1U8HA 3IVKA 3K46A 5KVFH 4JFEE 4CN4A 3GF7A 5F3FA 2FXMA 4JKMA 3T3PB 1OW8A 2UWEF 4BFIA 2FR4A 4A39A 4ES8A 4IJTA 3N85L 1J18A 4Z0XB 5D4JA 1KCWA 2DYPA 3NN8B 3EDFA 3U7WH 3RWFB 5H2BA 2IQAA 3EGDB 4YLCA 4G6JL 1Q7YQ 2V2XA 3NJHA 5TQ0L 5IHZB 4TVUA 4F33B 4QO1B 5EO0A 3UC2A 4K94H 5SX5H 5ICZA 4WTXA 5KS9F 5EO1A 2YUZA 4X6FB 1CD1A 5B39G 5CS7A 3U0WH 5C09D 4N2MA 4BFEA 1VDGA 3D9AH 4OLVL 4FFVC 3ARYA 1M1XB 4XA4A 1KQGB 4JJOA 4XH2A 1VLXA 4M7ZB 5HVHB 4NUQA 1NC4D 5F2FA 3G6JE 1ZHNB 5AOKA 3VXPA 2VABA 3PLNA 4LCCC 5C0ND 1BHGA 5LQBL 2KQMA 1UXSB 3AG4B 2N1TA 3ZL2A 3ZDWA 3S88H 5G55A 4W4NA 1UOKA 4O2CA 3O6FD 5HVWA 3UO1H 4LGPB 3QDGB 4QCIA 1NTKG 2K9JA 3RU8H 3OR6A 4GAAA 3BKJH 5ENWB 5GXBB 4NRXA 2GJ6D 4UT6H 1UH4A 2PYED 4JG1H 5BMFH 3FYIB 5FDYA 4PW4A 3NRQA 3QCUL 1CDBA 4ABWA 2DL9A 5B38A 5IVZB 1R5VA 2IH1B 5T8IA 3UEQA 4ZNEA 4MN4C 1LTJC 1CQKA 3FOLA 3F5WB 1N86A 4XAKE 1MDTA 1RP9A 1WZMA 2IQ9H 1CLCA 1ZHLB 1JPSL 3IAOA 3APCA 4ZUWB 3I3BA 1I82A 4NHCL 3BVDB 3S1KA 1NCBH 3U0PA 2EEXA 1A8JH 3S5LA 2QGDA 2ZCHH 5KLVG 1NL0H 2NY6C 4HUXA 1N8ZB 3LEYL 1D5ZA 4JFFB 2EH8H 1X6LA 2CKNA 1TG8A 2XTJB 3CL3D 3CZFB 1VFOA 2R29L 3GI9H 1CFTB 3MCKA 1DCEA 1K8DA 4NQVB 1JMXA 2VR6A 2WWWA 5FHAH 4K94L 3K6SA 3P1VA 4LSTH 2CUMA 4WBAA 2FO8A 5MEPB 3U6XA 4IQHA 4NQSA 2H32A 5H4YA 3WJLA 5ETUA 5I1HH 1KIPA 2BHZA 3O8XD 3F6JA 1N5AA 3ZK0A 4B5EA 2EVFA 2HPCA 1JY2O 1KJ3H 3Q01A 3T0BA 3VGBA 1SXNA 3BZFB 3M0DC 5D6DA 3I6LD 2QELA 3FONA 4HIXL 2OYIB 1EAOA 3UP6A 3CD4A 1KY7A 3H9ZA 3QWOC 3X17A 5KVGH 2HKFH 1KY6A 3D85A 3WNMA 2AI0L 1REIA 3HBZA 3S35H 5JQHC 3G08A 4TLFA 4ORZC 3Q5RA 1WCBB 4Q9CA 1ZMEC 3K72B 2FSEA 1YEFL 1Y8AA 3UO1L 2F61A 1PX4A 1P4BH 2EVHA 3IPBA 1MAML 2AK1L 3DHMA 2F7OA 3I50H 4GBXD 1G1JA 1AQKL 3VMPA 4K5OA 3SY0A 1E9QB 2WWOA 1UXWA 5CEYB 4EUPH 3ISWA 4QRRE 4UM9A 2WNGA 4R5XA 4HCRL 2WYTA 4WNQA 3QQXA 4BCYA 3U30C 4KWUA 1R46A 2BP0A 4CMMB 4NERA 5AWNH 3LNIA 3LPFA 3QWQB 2H2SC 2OL3L 4YDJB 3NUKA 3HBPA 1UA7A 4AUJA 4H13B 3L72E 2AQQA 1G9NH 3P77B 2J4WH 2LHAA 3MKKA 4R5TA 1SRDA 5IVOA 4JG5A 4WO4B 3CV5A 2WB7A 4H4NA 4LCWA 5KYWA 2G30A 3NJVA 2AK4E 5HGBA 1ADQL 3TYFA 1B0RB 2P46B 2VUYA 5F0MB 2AABH 4GAYB 4N78E 2FXPA 3CC2P 4OCXH 4D0DA 2OP4L 5JHDD 2VIRB 2JVUA 1TTRA 1HS6A 2R1WB 3CX2A 3LHAA 3UAJD 5DMKB 1K9TA 3HZKA 4WDIB 2IAAC 5F97E 2C9PA 1N18A 4JMXA 2NT1A 5CXPA 4G59C 3VVVA 5HVHC 1UA3A 2XLLA 2LLGA 1JVOA 4JGUA 3IMWA 3PJLA 3VMYA 3Q8EA 2J71A 1F4WH 5C7ZA 3FFDB 4X5WB 4W7ZA 3TVMA 3WNKA 1GAFH 2DMKA 4QF1B 5IMKB 3TT3L 3KBFA 4UIMB 3I74A 3ILQD 5I1KH 1KJMB 4PJ5E 5IJVB 3DKHA 3EJUA 1SMDA 2JQMA 3TOPA 4Q4IA 2QADD 5IHHA 1KB5L 3HHSB 4GJTB 2Y1ZA 3SCMB 1NBZB 1SQVG 5I1CL 4L29B 5BUPA 4D9RD 3L1EA 4UQCA 2K9UA 5DVLA 2RIKA 2VWEC 1IILE 3VI4E 5T5NG 3BUYB 2V17L 1T7XA 3STLB 1P4BL 1VQ5P 2ZT9B 2VDPL 3GGWB 5GZND 1JXFA 2B3IA 5F7KC 2MWCA 4Y4KB 2CE6A 3SBRA 1PMYA 1WWCA 5JNYB 3FMGH 3UGUA 2C9LY 4EOTA 5E6RB 1DL7H 2YD3A 1S8DA 4JCLA 1DX7A 1UB6B 3SIKA 1FRGL 1IJDB 2WXNA 1T5WB 1BSNA 3L3GB 3MLSH 4NENA 4HIIA 1VACA 2VLRD 4AITA 4RMWA 2ADIA 2KSJA 4L8SC 1QO3A 2XTJC 3NABL 1HXYB 3AS3A 4XBPA 1DD4A 4KFMA 1WBXA 4N8VB 3T0EA 2ZX6A 3HUSA 4D3CL 2YAFA 5IW1B 3S96B 5CP3A 4TNGA 4PWGA 2CBTA 1MCIA 2PAJA 4KV5E 4KOBA 4AQ8C 2AQRA 4HLJA 3ZKNC 4DP6X 1BGYJ 1RZ8A 3LKRB 3VU1A 5IJKA 1NU1E 4PJXE 1HX0A 1LEGA 3J07A 2YMYA 5GGUB 1VCBC 3HE7A 4NZUH 1TZAA 2A06E 4LLDB 2Q7CA 3WUWA 5F7AA 2ZNWA 3QS2A 1L2PA 3GHBL 4FFZH 3ECUA 3MGTA 4P06A 2OYIC 4O51A 1NEPA 3BWZA 2A9DA 5B66E 4PY8I 4XN9A 1PEWA 4PJGA 4ADGA 4X0KB 1RUKL 1BJ1J 1HCFX 3HUJF 1ZN5A 2WCSA 3BN9D 2ADGB 2V7NB 5D1XA 1NMBL 4M8VA 3BLBA 3IT8D 1RJLB 2EH7L 2F1BA 2CO1A 5D1ZI 3VJ6A 3QIBD 5CZRA 3VI3B 5BRQA 5KANI 1BYOA 3UH8A 2WLMA 5EDSA 4LNRB 2G0LA 2M3EA 2Y4SA 3RWGA 3V7AG 4AQ1C 2JB5L 3P32A 3P8MC 4KXZH 3A6CH 3SWFA 2J5WA 4PJ9A 1G6RL 1X6NA 3C9NA 3Q1SL 3H56A 3D18B 4XTRC 3K4ZA 1IKNC 1E8YA 1T0NA 2PWDA 1T89A 1L4AA 3FRPA 3BGFC 1P84H 1CE6A 4H13C 1KTLB 2BIOA 4J3WA 4PGZA 3BGMA 4I0KA 1EANA 1MJJA 4ZKPA 1XZ0A 3CFKA 3PJSB 3QFJA 4L4VA 3PWPB 3AZUA 4WO4C 1KYUA 1I8MA 2V5MA 3S48A 4YL9A 1KJ2A 3VRLF 4JFED 2VXSH 1B3IA 2QZQA 2FH8A 1D5BA 5CHNB 2L3BA 2ZOOA 3KPTA 5HP5A 1SVBA 3NFSL 2JKXA 5L6YL 2G60H 2IALA 3QJHA 4ZUUB 3BVHA 4YBHA 3EH4B 4P4RB 3CSBA 3OJAB 2X6BA 3IDUA 1DQLH 1ZS2A 3VGEA 3WIFA 4FNTA 2WBJD 2P8MB 4CA4A 5C2UB 1ZXQA 4M1CC 3CE1A 2ZYAA 2XPYA 3V55A 2DKMA 1AI1L 1GGBH 3QC5X 2ZJSE 4JDZA 4YBLC 2K6YA 4DK5A 4PRPA 4M02A 5AW9B 4EKXA 1FBIL 4NZUL 2OYOA 3X3FH 4R4LA 4BQ8A 3U9UA 4N25A 5CMAA 5HD8D 1PZ5B 4ZFZB 4AK1A 1MFCL 1EJFA 3OKYA 3WMPA 1NGYA 2VDRL 3UAAA 2IWKA 2ICEA 4WUKH 4M5YH 3SCMC 2EE6A 2MSPA 1PX8A 4WI3A 1SQBG 4YL4A 4AKPA 4W1TA 2QPUA 2AXHA 1EQ7A 1U57A 3RZCA 4CAGA 1WIOA 2OMXB 2R1YA 1VF5B 4PG2C 2ZT9C 2VSKB 1E9PA 2C9QA 3OKLA 2IDTA 3G3ZA 3QUMB 2BP8B 2QJPB 4NP4H 4Y4KC 1AR2A 3BHBA 1P4IH 4DNLA 4Z1MH 1LO2L 5LHDA 3V6ZA <