5AVRB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avrB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avrB02
2XZRA 2IPPA 5AVWB 1SP4A 3B8EB 3NXSA 5AW5B 3TNUA 3M0AA 5APSA 4LC1A 1MFZA 1GZLA 5AW4B 3IR9A 3M91A 3I5CA 5APWA 2WTYA 5AW6B 2R5DA 3HE4B 2QM8A 4GT1A 2P2UA 5AVYB 3VMZA 4AUWA 4C7NA 4RETB 4C46A 1CZQA 4EOTA 5AW8B 1MV8A 2ZFCA 2P7JA 4JYBA 3KQGA 1KQLA 3NTNA 1J2JB 1HJBA 2C9NY 3VYIA 4DZOA 3MD0A 2Q7CA 2YO2A 4KHXA 3TK1A 1CSBA 3T97A 3TYYA 5AVXB 3P32A 3M9BA 1MUUA 2Q5UA 3A7OA 3L36A 2Z5HA 3M9HA 3TNUB 1NWQA 4GKGA 2E42A 2WT7A 5AVZB 1IO4A 5AW9B 3WGVB 2R5BA 5AVVB 2N9BA 2R32A 1S9KD 3O8ZA 1CI6A 3UIAA 5AW3B 1GD2E 3HE5A 3SWFA 1NAFA 3P7KA 1G2CB 1SLQA 2WWWA 1OWAA 5APVA 3VMYA 1H88A 4C7NB 3V4QA 4B86A 2WPQA 3L37A 3VMXA 3V5BA 2BASA 1T2KD 3MGNA 1H8AA 2Z5IA 5AW0B 5AVSB 3LIDA 2W6AA 5APYA 4M3LA 2WPSA 3VTPC 3V4WA 4AQRD 1GK6A 5AW2B 3VN0A 3LIEA 2W27A 1JUNA 2WT7B 2WPRA 2JJLA 3A2AA 3L35A 1FOSE 1GK4A 4I6MC 1A02J 5AVQB 1T2KC 1CI6B 3HE5B 2YO3A 2ZXEB 3A5TA 3NMDA 3P8MC 1X8YA 4RESB 5AVTB 1H89A 3WGUB 3NFQA 3A3YB 1GU5A 3KDPB 2R3CA 2E43A 5APUA 2C9LY 2VRSA 5AW7B 2XV5A 1FOSF 1HWTC 3OAKA 4I2LC 5CMZA 3HTKA 5AVRB 5APTA 2Q3IA 1GTWA 2QM7A 1FAVA 2KP8A 2YNYA 3M06A 1S9KE 2XU6A 3HE4A 1JNMA 5AVUB 1YYCA 2P67A 4JYCA 4XE5B 1GU4A 1A02F 1HUCA 5APQA 3M0DA 2H7HA 5AW1B 1DH3A 5APXA 1OXZA 1HBWA 4AYCA 4HYTB
chains in the Genus database with same CATH superfamily
4JS7A 1A3LH 4WFFD 4M8RA 1L5GA 2VDRB 5D1ZC 2A9BA 3L1GA 4M00A 5CN2A 3CVHL 3MV8A 1KT2A 3VD9A 3TFKC 3LHPL 4ZUVB 3W0WE 1W2KT 2HFGL 2BWQA 1FSKC 4TNFA 3KJ6H 5AYTA 2R0KH 4EPSA 3FFDA 2AAAA 3FO9B 3WN5B 2AKRA 2FZ3B 2YAHA 5F71A 3EXJA 5GZOC 2VN4A 3BT0A 4IRJD 4JY5H 3LKRB 5L2KE 4B5ZA 3RPIB 1EH9A 5L0QB 1GL4B 5EIQA 2P58A 1FVDA 4ASVA 2DQUL 3G6JA 1IEHA 1D2OA 1PG7X 5CP7B 2OMUA 4NQSA 1D6VH 1ZDSA 3S96A 1XXDC 2Z65C 4JFVA 2DLFH 1L4IA 2Q5UA 5TTRA 1NUDA 1GMIA 3GHGB 1KN2L 5F7DB 2UXGA 1LK3L 3ALPA 3EYVB 4UILH 1YEWA 4Q52A 1FBIH 4H0LB 3KYKL 1HEZB 5TE7H 3QUYB 4ODHL 1J9SA 3KPQA 3O4LA 4BUGA 4ADIA 1H6EA 4WTZA 1UB5A 1CWVA 1OARH 3IE4A 1FDLL 4WWNA 3S36H 3WE6A 3B7RL 1CICB 4FA7B 1R3JA 2Y36H 4ZTPL 4B86A 4FFZA 4BFEA 3ARDD 3PP4H 3V9FA 4AJ0A 4A6YA 4ODXB 1D9KB 3GSUA 4GAFB 3QNYB 3NJHA 4WCYH 1WBXA 3FQNB 1A1OA 4R0LC 4FFYH 4ZAKA 4KKQA 2AQ2A 5FDYA 3TXAA 2XTJE 2X05A 3L16A 3SY0B 4Q2ZB 4Z7WF 5IBLD 4TVPD 2VKXA 5DEFA 2VZOA 4YOKA 5IROD 1OAKL 1GK6A 1OGAE 3GRGA 4I2XE 4YXWH 4IJ3B 1X7TA 4JZNB 1U42A 2EP6A 2IOMA 3SGKC 4UQAA 5JLZA 1U8OA 3A2AA 3CLFH 2V9TA 1ADQA 5EUOB 3C6LB 3RVVC 4AW4A 3S3DB 2FCBA 2ZWSA 7PCYA 2JJTA 1KIQB 5EBMB 2WC7A 2FJFB 2EVFA 2F53A 2G9HB 2LR4A 4L3ED 5F70A 3D0VA 4Y5YA 2ZOWA 4E41A 5A43C 5CCGE 5BQ7A 4GBXC 1UH4A 4YHNA 1CZ8L 4N5ED 3S4RA 1FNGA 2ZIDA 4OAWA 9PCYA 1J18A 1KQGB 4PRPB 2FB4L 4GQRA 1XH3A 1SQVG 4YHZH 3OBAA 3T2NL 5CFAA 3U4AA 1TTUA 3VD7A 1S9KE 1KDIA 1AXIB 3BAWA 3IFLH 4HCGA 3VACA 3FMGL 4WW1B 4Y8DC 4PJXB 3OAZK 1T1ZB 5D4JA 3BYTA 4ATTA 1FV1A 2NUPA 5FIEA 3AQXA 1OPGH 3BZ4B 3LB6D 3NJNA 4R7XA 2B9AA 4N0UA 5EEYA 3O3AB 3O6LL 5L6YH 2C3GA 4IRJA 1YEHH 3NXSA 5AOIA 1IGFH 4DN3L 1RF1A 1WFMA 3ECUA 4Z7UA 5IVOA 5F8QC 4N1CA 4XBPA 1BVKB 5CAYB 5CCKL 3RFZA 3B2PA 1KLGA 3BJ91 2R5DA 1OTTD 3GRWH 2FATH 2OSYA 2KLTA 2Z7YA 3HI6L 4D9QE 1KYAA 1X7QA 1FFOB 3LV3A 3SPVB 3VFGL 3S5LG 5I1IL 4MJID 3VXMB 3MRHA 2DRUA 4TQ8A 5CKGA 4M3JA 5F7BA 3LKQA 4OT1H 1U8NA 3KH4A 4NXKA 3SDDC 1FE8L 1U9KA 2KUTA 2XZAH 4AENB 4BQ6A 5GGVL 5FO7B 3VG9C 4S1DD 2P42B 1AGEA 2Q3EA 3QJFA 4WW2C 5A16B 4CSPA 1FGVL 2XPGB 2WOBA 1F41A 1IFDA 2B7DT 3MBXH 3P2DA 4LEXH 1IBGH 4P49A 3T0DA 3KPNB 1G1JA 5AVXB 5IMLB 4PGCA 4NNXB 3HRZA 3ARDA 1YHPA 5GSVB 4OZIE 3PUCA 4HZAA 1P2CB 3GSOB 4G80B 3GFUA 3FONA 3NA9L 4XWGL 4AEIH 1PP9G 3L3KA 2QELA 2V5SA 2Y23A 5BJTA 4CSZA 3US0A 3MLZL 1I8UA 3P30L 4GS7B 5IROA 4ZMYA 3U9UA 2SPZA 3Q8FA 4XX1G 3VX1A 1KYOH 1JY3O 1JHTB 5FUOL 5D72H 4EIBA 5A7EA 5EC2B 1BZ8A 3U25A 2ADIA 2FXOA 2YC1A 3QQNA 1QRNB 5E5RB 5D2LB 5EA0H 3E1RA 1R33A 1LO0H 5DRXA 1REIA 1HKFA 4H1LB 1H8SA 3WY2A 4ELKA 4IK6A 1AVAA 1HINH 2J6EA 3CDYA 5C09B 3DRTA 4L3EA 4CNIB 4ZFGL 2DQGL 3H9HB 2FX8H 2N1TE 5I1GL 2ITCA 3AADB 2Q7NA 2HG5B 4NM8H 2A0LC 4UTAA 5ICZA 3EIFA 3D69A 4LASL 1MJUH 3ARFB 2WZ5A 5J11B 1AMXA 1MIML 4Y4FC 4ORGB 3SIKA 2W94A 4YHLL 1IAKB 2ZXCA 1GXEA 3OKKB 1NBCA 2VITA 4AT6B 1A7QH 4RFOL 4I9WE 4YXKH 3KZIE 3LNIA 1T3UA 1DVFD 4PJ7E 3C9NB 2XKSA 4GOFA 2YXFA 1JVLA 2DAVA 2VDOL 1TT6A 1WFJA 3PV7A 1LE5B 3L73G 1IX2A 2MOGA 1WCQA 3NGBC 5IUSA 3F7YA 4N8CH 3TYFB 2MFNA 2OMZB 2XFXA 2X70B 1NMCC 1BAFL 5IJKC 1YLBB 5AVUB 1R5WB 3TIEB 2G0LA 4L4VB 2ZT9C 2IBZE 2E76B 3HD7A 2FYUE 1RURH 2IIJA 2DH3A 4P23D 5EPMB 3PAZA 1N4XH 3ZYIA 3JWDH 4MYWB 4W7YA 1E2ZA 2K9JB 2IQ9H 5EZJA 4TQEH 2P5EB 2PTTA 3RY4A 5FGBA 3WUZA 5MP6H 4O2FB 4MJIA 3VWJD 2R4SH 2YXRB 2E27L 5H37G 4F2FA 2OULB 1FDIA 2K37A 4H7VA 4WNQB 2Q1EA 1FZCA 2WLYA 1IZNB 1HHIB 2AHIA 5KSAC 1GAFH 1T5XA 3NSYA 3FRPG 5F72S 1CE6A 4RWYL 5KVMC 3PDDA 1SQMA 3CSGA 3PL6A 3DX1A 1ZLVK 5L8LB 3QUML 4HU8A 1AIFB 4NUQA 3N9GL 4WWIA 3MODH 1FFPB 4OV5B 4KZEH 3H4FA 4RETB 2G2PA 4Z3TA 1KJMB 1RHFA 2AAVA 5EEUA 2MWCA 2R0LH 1SBSH 4IKIA 4W9DC 3CG8A 1ZY9A 2FWUA 4M93C 1WA1X 1QFWH 3ML9A 1TYJA 4U6XA 2YARA 4AMWA 3ETSA 5CBEA 3TBYB 3ZYJA 1SQXK 1L9TA 1GGBL 3QZWG 5DHVA 4X8XA 1TTGA 5IHZB 3PWJB 4M29A 3CSYB 1E9PB 2J7LA 4PHXA 4NC0B 1IC7H 5KUMA 5E8EB 4ZKUA 1SQ2N 2F7QA 2BP5M 2VSKB 4RA3A 3ZMEA 4G8IB 2CGZA 1RIVH 1TTAA 2HJKA 1OY3B 4I3SL 3U2IA 3D9AL 1QUNB 1Z3RA 3CFBB 4EN3B 3RKDC 3BUIA 4P57B 2NY4D 5AVSB 1YMMD 4XE0A 3IJ7A 5DUMH 4XHJD 5JXAL 5KZCD 3OJAB 5GGSY 5L9DL 3L3GA 4M7ZC 3D87B 2EUZA 1L0LJ 1AJYA 3MNWB 4PGDB 3H25A 2A83B 4XTRC 4UOW0 3TPKA 1DVFA 1GKEA 4FQ2L 4FNLH 2O5YL 3OZLA 4RZCA 1EAOA 4Y1AA 4FFYA 1ZLSL 3CMAP 1BLNB 2ICCA 4MDJA 3Q7JA 3CDGB 2FKWB 2F8OA 1CI6B 2OCFD 2OTLP 3QJOA 4M5SA 1SYSB 3HFMH 5DA4A 1KYOD 4CKQA 3AE7C 3UYPB 3VQ1C 1WHPA 2Q8BL 3PHLA 1WRGA 2H6PB 1QABA 2NT1A 2GY5A 4IBQA 3ZTNH 2IFFH 5HGBA 1WAEA 4NBXB 4NSKA 4X8JB 3GXPA 3B2VL 1EGJA 2OCCB 3P40A 5GTHE 2A5UA 3T97B 2IADB 1J5DA 3TGUJ 3S35L 3I6GA 4DH2A 5GS2H 3AU0A 2HYNA 3SWKA 3LPFA 2X28A 1Z3GH 2AQTA 2GSIA 3KYAA 3QA3A 1FNEA 4O9HH 4PAZA 3P4MB 4K3DH 4LSVL 2V2XA 8FABB 5I19L 5JYMA 1LO3H 1WWWX 2FL5A 3AWEA 3GLAA 4NI3A 4PD4E 5CMAB 3NIGB 4I5BB 1FUNA 4NCDA 4GIPD 2AV7B 5FS5A 4KQ3L 4UIKH 3U1SL 4AE0A 4KHTH 2W9DH 4GB9A 3CFKB 3AAZA 3D50A 1ILUA 3G4SP 4H2CA 4NKMB 12E8L 1BFSA 3QAZB 1U0QA 3ARWA 5D7LE 4AQ1C 1J1PH 3UGXA 1KXQA 1KB3A 3GUFA 2H1XA 2QGCA 3CWGA 3H1ID 2ZX7A 3V6FB 2X42A 4BKLA 1G4RA 3FBQA 4FS0A 4L05A 4EAEA 2NY1D 4UTCA 4JRXD 3GKZA 1FFNA 5E9DE 3IDJB 1IM9D 1JWSA 1XWVA 3MOAL 4ZTEA 5EF3A 4CKVX 4RMUA 1EHNA 4HIXH 2R69L 5K5YA 3PGDB 4Q8BA 2CGYA 3GJFA 1AI1H 3GRWA 3T6XA 1NCUA 4FXKB 1D7MA 3VD3A 4GAGL 2NNAB 43C9B 5DZJA 4KV5E 3MLVL 2J4WH 2XN9E 1BG1A 3S2CA 1ZT4B 4U0QB 4MJ4A 2IEPA 5AUMA 1QR1B 5DZAA 1D7BA 1DVSA 4NLHA 4F37F 1Y9BA 1T1WA 2CCWA 3ARBD 3CFJA 3DBSA 4AYDC 3JWOL 4BGDA 1NBZB 5J6SA 1URLA 1N8ZA 3WKMH 2D03H 1KYUA 1KDJA 4ZO9A 1XD0A 3RWFA 4MNGA 1T5WA 4XPTH 1H5BC 1NKRA 1WAPA 3JUYA 4KJQD 2FEEI 3OKMA 4PG2C 3QIWB 5C8JA 4PJDE 4QTHB 4NO2B 3B37A 2A6KB 5IFAL 1NDTA 1ZSDA 1G7PA 4MCNA 5GISL 5GPRA 4NNYA 4N6RA 5D1QE 4JPKL 4G8GD 5K59E 5L4FA 5K1VA 5M7QA 4KZDH 1WF5A 3FN0L 3G5ZB 3TCTA 4Z77B 4HIIB 4XXCA 3IJSA 5ALCL 1SJHB 3H9SB 2Z4TA 3S8FB 1AANA 4RAHA 4NOBA 2AJYL 3IJ8A 5CEYB 4XPFH 1GS7A 4KI5C 3MMEB 2A4EA 3RDTD 4UQBA 1EAPA 1WHOA 4NHCH 1G4MA 3STLA 2VDKH 4KNSA 2CPBA 3AWFA 4AYGA 2C4FT 4YFLF 3DMMC 3QFJD 1GZQA 1UXLA 2FT7A 1NJIQ 3HAEA 2YO3A 4NIKB 4XT1C 4ODSH 5IOKA 2L3BA 4KRPB 3X12B 3L70J 3T3PB 4PRBB 4B6ZA 5FUZH 3QIUD 4QCIA 1J9QA 4BK8A 3B7YA 5M95B 3HTKA 4JFED 4G6KL 4WUKH 4OI8A 5AFAA 3D34A 5IR1A 3PGCA 5F3FA 1F90H 2NXYB 1IC4H 1KPVB 3B9KB 3AXHA 5D1XC 5C0AD 1A5FL 4OLZL 1QI4A 1WD9A 2VDRL 2LVEA 3M7OA 2X2IA 1E4XI 1CIDA 4PP2A 1G7IA 3P1VA 4JDTL 2R23B 3ZKNC 2DQJH 1Q1JL 5KVDH 3VJ6B 5AZEL 3NCWA 2PCPB 3FXIC 3V95A 2J5UA 5JOFA 2HWZL 2QVKA 5IEHA 1A9EA 3JQOB 1Z5YD 5D7IE 4OZFG 3RIFK 4PGEB 1PSKL 3M1BA 1MDAA 3LS4L 1O6VA 1JZ2A 5EU3A 1AC0A 5GS2D 1J1OH 3RIFF 1LTJB 2HFED 1DVQA 4MCZA 2IGLA 1LNQA 2DEYX 4BZYA 1T21B 3ARGB 4LSRH 2IZ0A 4RZKA 4L75A 4JRYE 1VQMP 1I9JL 2YKLL 2UX6A 2Q3XA 4HPOH 1I53A 3EJYC 1LT9A 4GAAA 1CR9L 1AR1C 2M8RA 4U3FD 4CDHA 1DVTA 4PYGA 4M6OH 5EBLB 2FYUG 1A6ZB 4M3HA 2QTEA 3N1FC 3OD3A 4KK6D 5DYFA 2QHRH 4RBPK 4TVSa 1F4WL 3TA3A 3X14B 5GS3A 3TIDB 3L74E 4HWZA 5DR5H 4NDMB 3VGHA 2M5AA 2D2OA 4XMZA 3T8MA 3V79C 2Q6QA 2Z91B 2ZE0A 4MDIB 3K5SA 4PTUA 3SDXA 3WMSA 1UM5L 2FYNB 1X4XA 3FB8A 1EQ7A 4GEIA 2AS5M 1EMTL 4F7MA 2ZYDA 5GXBB 1MHPL 5B39A 4X9FA 3RBSA 3K6SA 4C56D 5GGUA 3QCUH 4JJ5B 3DVFA 3VCLB 3VI4E 3FDWA 4GW4A 1Q94A 4G5ZH 4PLOB 5GS0L 4BZ2L 3RDTA 3C87A 3JTSB 4G6FB 2NY2C 3U1CA 4DETA 3CVIL 1TTRA 1COBA 1JY3P 3OKLB 4ONOA 2DZEA 3FT3B 1OP3K 2H4EA 4KJWD 3GHEH 2LVCA 4QHNA 1K85A 2OR8A 2CPCA 4DGVL 1I1YA 5IMOA 4E0RA 3JV5A 4AGNA 1ESOA 1H8NA 4R4LA 4OJFH 2WNKA 3ZZQA 1IM3D 4JFHD 4FRWA 1MHCB 3QIUA 1LWHA 3QISA 4XO8A 5E94B 3QW9A 3FYIB 2FECL 2OJ1A 4XPAL 4N20A 4JFEA 4XVUD 5T3ZH 2BW5A 4IGBA 2VDPH 2CO7B 2PXYA 3HHMA 3V9EA 3GMRB 3WHE0 1SJEA 5C0AA 3REVA 1YEGH 4W9HC 2GBTA 3MCG1 3ZDWA 5B1JA 2BHZA 1PGJA 3B83A 2IDQA 4YFEA 1JY2N 2E6JA 3RA7L 1RZGA 2BSRB 4P46A 3S88L 4AC4A 1S9XB 4D9LL 3LEXA 3MRQA 5IVZB 5I6NA 5C3LD 3PNWA 4FQXD 1JZFA 4KMLB 4HWBL 4PRDB 4GINA 2BX5A 3L7FB 5JHBA 1B0IA 3PDGA 1DD4A 2GW5A 2ETWA 1V7ML 2VZUA 1F6AB 4NBZB 1WCBB 4NQDE 5C97A 3B71A 4LVNB 2P46B 1UXWA 1IBBA 4WV1B 1TJHH 1MCBA 3WIAA 1KJ2B 4D0DB 5AD0A 4YAQB 1U93B 4QD2E 1CXIA 1I7ZB 4OLYH 5AVWB 4KVNL 3FL7A 2M26A 1J48A 3FXEA 2ZUTA 5GIRB 3L3OA 3Q8BA 1IKFH 1HHGB 3MI6A 3IR9A 4AYFB 2CU9A 4ZMLA 1HQ4A 3TNNA 3VFOA 4MQSB 1JZ8A 1OW8A 3TDKA 2Y06L 4WFGD 3S4SB 1IFHH 1JK8B 3VYOA 3U59A 4D3CL 3OSVA 3RL0D 3SGJA 4M8VA 2OAAA 1AQDB 1AQMA 1G9MC 2HKHH 3WMPA 3X1EA 1AKJB 2EIJB 1J1DB 4UV4L 1Y8AA 1UWYA 4HXAH 2BVQB 2ZPKL 4XMXA 3MACH 1V10A 1KB5H 2AXJA 1T2QL 5DJZA 2DBLH 4YE4L 4F2ME 4UNUA 3MXWH 2Z31B 1FIGH 1F45A 2K7PA 5ILTH 1FZOB 4Z8FH 3C60C 5JIDA 1U8QA 4J3OG 3OSKA 2ITFA 3H0TA 2VAJA 4NFBA 3WLBA 5I30H 1GGUA 4P5MA 2IBZI 1HN1A 2EZ0D 3JZ7A 3HC0A 5GGRY 1EZVD 2BW4A 4XB7A 3HHSB 3O6QB 4LLQB 3JBG7 3LCYA 5FC9A 4W70A 4ABQA 1SYVB 2XNXA 1IM3A 3M45A 2SODB 3RWCA 3DIFB 1IAIH 3AZUA 2BIPA 3APCA 3ZKXC 1YYMH 5CILL 2VQ1B 1V8HA 1L9PA 2M2DA 2YIUB 4PRHB 5EN2B 2FJUB 1P4BH 2NQCA 3DXAD 1KCUL 2BWDA 3KWWA 5IMKA 1MG3C 1TJGH 4I18A 4NZUL 1N18A 2CHNA 3A67L 4WWKA 1HZHL 1UEYA 5K69A 2BNUA 4XAWL 1NMAL 4QHMB 1PGOA 2BXYA 3UYRH 3VO0A 4M5YL 2HLFD 1OT4A 4XP1H 2X4NB 3FT9A 5G5DA 1BWMA 2R4RH 3RVXD 3EO1A 5BMFH 1OE3A 2PPDA 3DX2A 3Q5OA 2XQBL 4OM1L 1PD0A 3KNBB 4GKZA 1KIPB 3WN6A 4GEJA 5BZWA 2LKMA 4TUUA 2ENYA 3FUJA 3O3BA 3UZEC 1SN5A 3PP5A 3SQBB 3QK0A 2W83C 3AM8A 3AE5C 5B4MC 2YXVA 1P5UB 5DCCA 1N3NB 5JIHA 3GUTB 2QQKH 3BYYA 1XQ4A 3WNLA 1J8SA 2FHCA 4FQLH 4L4TB 1I8MA 4KKBC 4KQ0A 5MEOA 1KILD 2A45I 4FN0A 4J4PD 3O9WA 5CLYA 2EXYC 5EOQL 4POYA 3DETD 5T3ZD 2E75B 1VFOA 1W0VA 1LEIA 2UY7A 2BIQA 1TZHA 4NN5C 2VKWA 5D7JC 2WV3A 2HLOA 1I3UA 4H20L 5LG6A 1JB0J 2ARWA 2EO9A 4XWOD 4JG1L 3ZKQD 3HG4A 5KSVB 1S7RA 1F3DJ 4E5XG 4N0CD 5CSGA 4I89A 5HYJD 1IEBA 4LKXB 2VAAB 4LARH 1OTSD 2G3MA 2CIIB 1E5WA 3B6SA 3QUZA 1RJLB 3QS2A 1J8KA 2X2JA 4BFFA 2B5IC 4HIJA 2ZKWA 4MCYB 1U8CA 2OTJP 5CU5A 2JFCA 3ASOB 3BQUB 3BUYB 3KM1A 3V2NA 3R19A 4MNHB 2YXQB 4WHYG 4QXTA 2X41A 3MRBA 2HKFH 4XMLH 5EF1A 4PV9A 2MPAL 3P0VL 5FO9B 2EVHA 3Q1EA 2OYIA 2NZ9D 5I1EH 2BY2A 4LIQH 3WJMA 2YD6A 5JTWA 4PW9A 2Y6SD 4ZUTA 1RULL 4ISVA 4AJWA 2NPSB 2JP3A 1O5DT 1U91A 3WDJA 4QWWD 3VFTB 2YAFA 1MQKL 1T0MB 4GUPB 2V4LA 2BCCE 2DYPD 2KLUA 3FTUA 4LSPL 5C0BD 1JERA 1OLZA 4MS8C 3FFCB 4E9LA 1DEBA 4FLRA 3KXDA 4WU5B 3DXAA 3IDYC 1XGYH 4PI0A 3ARED 3BVHA 5I1JL 5APVA 2YMOA 4J8QA 3K4DA 5AZ2H 5CGBA 5TE6L 4EI0A 3SWYA 3QJTB 4YSEA 3ABVC 2PFXA 4PMFA 3L08A 5DA0B 2OK0H 3O0RH 2XNDH 1H0TA 2E5EA 1BVNT 2F68X 3PXHA 3QUXB 5C0CB 5BRQA 3AWGA 2XWBA 4N1HB 3KVDD 2YD0A 2ZWZA 2ZNXA 4WQOA 3ZRCC 3CSFA 4I87A 1XGPB 2QQQA 4Z7VF 4HS8H 5CP3H 3CTTA 4RFNB 5FA3A 5KVGH 4DIXA 3L74G 3OX8B 3K0WA 4RAUB 4WTZG 3HNTL 2IPKA 1M1XA 2F5AH 4I4WB 1XCTA 2DEXX 1RCYA 1Y0LB 1U8MA 2V9QA 2X09A 3QZNA 4K3GA 4LPWA 3NMDA 5L2JA 1MCDA 4Q58C 2PCFA 1DIPA 1YEIH 1RVFH 2VT0A 2XA3A 3BP6A 3D0LB 4J4PA 5KYYA 1QFWM 3GKWL 4X5PA 3P73B 3I75A 3ZMNA 2WWMC 2LABA 2C0WA 1KN4H 4J6RL 1CIUA 2KDGA 2VXVL 1A6UL 5BV7H 1WT6A 2A73B 3MLPA 1JL8A 1OAUL 3TVMB 4TSAH 3WXVL 2XU6A 1M7LA 1LTIC 2DJMA 4OQTH 1QFUL 1D7CA 2V7NB 2PW2B 5HYJA 1ZMEC 3GI8H 2X40A 3GMNB 1W0WA 2CNZA 3FAXA 5HHVL 1G1KA 4RA0C 3WS3A 1ZVYA 2H6OA 1DTUA 4BFNA 1WC7A 2FJGA 4KOCA 1ZHNB 3L72G 3EH5B 3IKCA 1CYXA 3N44F 5FYKL 4GIFA 3HG1D 4U3XA 3WS6A 4JQXA 2CBTA 4WAFA 1ZLVH 4ZMPA 3QJHA 3PWVA 4GQZA 1Z66A 5JHLA 4ZSOB 3NFSL 3Q2VA 3HUJF 2WB7A 3VMOA 4DUWA 1XCWA 4JZOA 2EECA 5APWA 2NW3B 2BO0A 4HHAB 4PRAA 5SWZD 2XVGA 1JHKL 1AAJA 3HNVL 1N7SD 4Z7QE 2F15A 3EJUA 1RUQL 2EDDA 3IU3A 5CCGC 1NBYB 2VDML 4B7IA 3ZGIA 2WBWB 3K81A 4XN7A 2DYPA 1CCZA 3CFQA 1NGXA 3JWNG 5C0BA 2WMPB 3QXWA 3SYCA 3CZFB 3CD4A 3GF3A 4BRVA 4AG4H 2VUYA 2AVGA 2QBWA 5EO9B 4OJAA 4LOEA 1EAQA 3N5AA 1S72P 3AREA 4OR1A 1U2CA 5HHMB 4KJMA 3UCQA 3JXAA 3DX9B 2DWYA 5F1IB 3O2VH 1JGEB 2HX7A 1I9RL 4N78D 1KB5A 1NPJA 3CAFA 3ZTCC 5ID0A 1ZTXL 5DHEA 4BSWB 4KDWA 4Z78B 1QVGO 4IMLA 2WWOA 1DBBH 3VMNA 1CFVL 1ZIAA 5JDJA 1V7NH 3NZSA 3HR6A 1T7YA 4P3DA 1PY0A 5JW3H 2ADYA 4KXZH 1MCRA 3DKHA 3EGXB 3DBXB 1XR8B 4KKCC 4OGXH 1H6UA 1WK0A 3WFCL 3LRGA 3MRNB 3CPWO 2BP0B 1USQA 3BWAA 3DV4B 5A2IH 4U1JA 3IF1A 2GEQA 2WCPA 1I9EA 2ZYGA 4JAMB 4Z9KB 5I1AA 3E2HC 3DECA 5AQ0A 5TE4L 4HVBA 5I5RA 5J89A 3E6FB 3EDDA 1U33A 1NHLA 1DQDL 5HJ3A 2P47B 1BVZA 2M3EA 5FOBA 2Q3ZA 2YGPA 4G6JH 3ULSA 4FFWC 3X3GH 2VZSA 1HHHA 4L8DA 5DJ6A 3BATA 5C07D 5LBVA 3Q3DA 3U30B 3IFMA 5I76A 4Q9CA 5SV4A 1MFDL 2RHEA 1X9LA 3DYPA 3OPZH 4RIRB 4X4XA 4BDVA 3P9LA 2VR8A 3RJQB 5D7EA 3HG1A 4HCRL 5G4OA 3VQMA 1SDDB 1U8JA 5IVXE 1BVLA 1PX3A 3BSZH 1ZANL 3EFFK 3DO3A 1X5XA 5DJ2B 3W39A 2EVJA 3LHAA 3H1IE 3QORB 1HU8A 4JRXE 5TDPB 4MJ5B 3APDA 3BASA 4MA8H 4G6MH 1MIEL 1LP1B 1TO4A 3D4YA 4R97C 1U8LA 4XBEH 2R0WL 2RQEA 4FEIA 4KU1A 3PJSB 4PQXA 5E8NB 3L6FA 1IBFA 2N1TC 3V5HA 5I75B 2E0PA 1E4WL 4PV1D 1F1DA 2ATPB 2ZWKA 3OKDA 4NQXA 4Y4KD 3MJ8A 3H8NA 1EVTC 2BSTB 2GSMB 2CBOA 1CLOH 3JZYA 4R4ND 3PIQA 3R0NA 1EXUA 3VNYA 3IVKA 1IBHA 1PLAA 4PJHE 3UAJD 1GY2A 2CR3A 4X5QA 5GRUL 3MV11 1QLEB 4GP8B 2FVNA 5CEZL 3OJDB 2I69A 2VLJB 1RJYB 3H3PL 4OCMC 4DKAA 3F5HA 2BC4B 4URKA 2NNXA 2GAZA 2YUZA 3QNZB 1UOKA 3KQGA 3HZKB 3KLAA 3DX7A 1IL1A 2JXMB 4P5TD 5LKNA 1RPUA 1YI2P 1NAML 2DQEL 4G8GE 1EJFA 5CO1A 1MJ8L 2WXKA 3MYJA 1Q9WB 4P59H 3RVUD 3AE2C 1CFQB 4WUUB 3Q5PA 4RGNC 2PWDA 2JH2A 3LRKA 2K3HA 4GYBA 1EXGA 1OTUC 1KCSH 3UPRB 2RFXA 2WGXA 5D2NA 2KZBA 1W16A 3FQTB 5EZIH 4M1CC 4ZXBD 2UVEA 3EDFA 3PWNA 1FO0B 1VFAB 2WZPD 2I5YL 3O8ZA 2QSCL 3NAAH 4Z3IA 3ZL4L 2MJWA 1W72A 1USZA 1PFCA 3IU4L 2D2CB 4PY8I 4KT0J 2W65A 4BHUI 1Y6NR 1U58A 4PJCE 1N7ML 2Q5BA 4HPYL 5J6HA 1NAYA 1U3ZA 1YNTA 4ZS6D 3RNKB 4GUOA 1C12A 3DK2A 3DTXB 2Y24A 1EHXA 4QLWA 2EH8H 3GNML 4OIAA 3VXUE 2G5RA 1ZHBB 4AQRD 3VWKB 4OFYA 3BCFA 5D6CB 5IFJB 5GRXG 1TKWB 4PP1D 5I74C 5C07A 1FVEA 1WLHA 1UKQA 3SJVB 4JREB 3H1HE 3HE7D 5CD5C 3CFCH 5CSBA 2YMXL 3IN2A 2BCCG 1A8ZA 1MXGA 1QNZH 4LHQB 3VXOB 7TAAA 4OFKA 5HI5C 1YG9A 2PR4L 4I3GA 1A6AA 5CP3A 1RSYA 5MENE 3AEDC 4LVHC 1MRCL 3S6CA 4TMPA 3D39B 2JK5A 3EUDA 3IS0X 1MCPH 1MOEA 4RVBA 1OAZH 3LNEA 3WIFA 3MV7D 4JZJA 6FABH 2E56A 1AXSB 4JX0A 4PY7B 2YZ8A 1YQVL 3LRMA 5E6ZA 3HUJB 2FGZA 1N0LA 5EG6C 3WJJA 3WY4A 3WHXA 2FSEB 1KJ2L 1S7QA 3CQFA 5JA8B 4DVRL 4KXDA 4PRNA 3TO2B 3KJ4C 3LS5H 3HLKA 3DJTA 3BRGC 1S7WA 2J57A 3HE4A 4DP5X 1H3TA 4RMVA 3ZMRA 4XPGH 1BE3D 4I0PB 4ZMTA 3QNXB 3WY3A 1NCIA 1T5KA 2EDNA 4HAGA 1R3LB 3F7VB 1NFDE 3HB3D 4HS3A 4K8RL 5H2BB 3SDCD 1Y47A 3OC5A 3HOGA 5E24E 2ZCKH 3BKML 1NTZE 3UAJA 2V9RA 2YPKB 1LE9A 1MW2A 4WEEA 3A0OA 4HMDA 2LQRA 4N8VB 3FO1A 4B50A 5J1SC 4V1DB 2DKUA 3KCPA 3BWUC 1FP5A 1IFIA 5AW6B 4P5TA 3MRJA 4U1GB 2Q8AH 3L70D 1T66C 4KDTC 4XNMB 1KACB 1UJ3C 1TQCB 1Q0YL 1NMBL 1YRKA 4ZYKA 2QVTA 3ZR5A 5KOMC 3RKPA 2ZUVA 3FO2B 4J3TA 5EOCL 4GMSL 4C56E 1PGPA 2P4AB 2N4IA 4HJIA 4PRID 3RWJB 1J87A 3ES6A 4LRNH 5F6HI 4JDVA 4ZXBA 3TJPA 3D07A 3FSWA 1WV7T 5DD3H 5AAWA 3L4FA 5BVPL 2EIEA 3PGFH 4TUJB 3TBVB 1GZPA 1LMIA 5CJOL 5FX3A 4Z95H 1CFSA 2H45A 5E2JA 4FQQB 4ANKA 4NPEA 1JXFA 1XF1A 1PQZA 4N0YH 5AW9B 4XZUA 3STZB 1NPNA 3FCGA 3IRPX 1FZMA 4JFHE 4YDJB 3MNZB 4DERA 2OMYB 2CLRA 3POCA 2ICEB 1SJMA 2QZ5A 1H15B 4CVZA 4J3OC 1LT1A 3HE6D 2ED7A 4NNPH 4A66A 3DVNA 3S37H 5J56B 5IJCC 1A02N 1PAMA 3H3BC 1B3JA 3E8UL 3CXHE 1Y6KR 3GO1H 4J8RB 4U1KB 5I9QB 1QFHA 4QRTA 3O11B 1AGCA 2J1YA 3RL1A 5INDA 2ARJB 3DSNB 3OC8A 3MLSL 3MR9A 2JWAA 4EVNB 1JZIA 1M7DB 3JT0A 2F54E 4KDVA 4LF3A 1B3IA 3AXLA 3MV7A 4WGWB 2WLIA 5IFHH 2WSEJ 2PPCA 1TU2B 2QJPC 1T6AA 2Z93B 2ZJSL 4NWUL 3RY6C 1T4WA 5DWUL 2JKLA 1QOKA 1WGVA 2E7DA 2BOCB 4I1RA 3GXFA 5C6PB 4A7PA 5KLVK 1HIML 3FUKA 4P5KA 5D5MF 3JSSA 1VQPP 2C0XA 3GS0A 3B9VA 4G9DA 4M3KB 2ZKXA 2FGWL 2IALB 3CVHH 3GSQB 3SDCA 5L4MA 4M1GH 5CGYD 2EC9T 1WSST 2AJVL 5F96L 3LHPH 4QNPE 1EDLA 2HFGH 5CIPH 2NSXA 1K73Q 1HXYA 1ZVNA 5HYSG 1SQQJ 2XN9A 4MD5A 3VXPA 2PYEB 1D5MA 3FB5B 5CGTA 4HAKA 3C1LA 1HS6A 2QMJA 5D1QC 1SFCB 3MJ7B 2V8MA 1XF3A 3BSZA 5AW1B 4HZ1A 4F3FB 2B15A 1CDGA 2WPVB 4O4YH 5C0EB 4K71B 5DHMC 2DQUH 5I5MA 2HVJB 1CFTA 5T1JA 4DK6A 3R1GL 1QFPA 3E1F1 4PJXE 5IQ9B 3M0AA 4PRIA 2WXLA 3DDGA 4L37A 4PJDA 1G9HA 4W4OC 2MCPL 1KN2H 1VKXA 4IBVA 1LK3H 2DQ6A 1U92A 2EKSA 2FUTA 3GXIA 2H41A 4P3CL 4WWOA 3VFWA 4LBEA 4CC4A 2WQVA 1FNLA 4KROC 3JV6B 4ODHH 3G3LA 1M1KQ 2FEDC 1F3DH 1DSWA 4OCYL 2GCYA 3ZZLA 1NOHA 4FNPA 3EHBC 1EZVE 4U1SA 3H1IG 2VMDA 3L5WA 1FDLH 3V2QA 5LGHL 3RGVB 2VMCA 4N0FA 3MTUE 4ZTPH 2P7JA 1IFNA 1I4FB 1ZA3A 3NPSB 4Z76A 2VM4A 4PIRF 3CZUB 2RQ8A 1M9SA 3JVFC 1CGYA 2WXGA 3VXME 2WVRA 3GSNH 4X6FA 1YJWP 4BWTA 3HE6A 2O1AA 3CMGA 3ALXA 4AEHL 5I1DB 3WNOA 4P04A 5LGKA 4YSCA 4K9EH 2FFDA 1OGPA 3OMZA 5IVNA 5DJ0A 3RRQA 1J11A 1BMZA 1JK9A 2Q86B 3D6GA 4EIJA 4NFCA 5FA4A 2CK0H 4KHXL 1W8EA 4D8OA 3CLQA 4I48A 1T1YA 5KJ7A 5H4ZA 4OLWL 3UZVA 4CA4A 3WFHB 1BBJA 1JDAA 5J1AA 3OXRA 3S5ZA 4CGTA 5HHOB 3VW3L 1XCQB 5IB2A 2DMCA 1ZEAL 4R4BA 4ANXA 1FG9C 1CZ8H 3GMMB 2HVKB 3L9EA 1N9PA 4BGLA 2WPSA 2GHWB 2XCMC 3BUTA 4P4KC 1NBVL 1A14L 2WUBH 2AQ3A 3MA7B 2FB4H 3PU7A 3O3DB 2C5DC 3IMSA 2VN3A 3BVWA 2WT7B 3IDMB 4MAUH 5IZ7A 2IDSA 1GK4A 1U95A 1EZVY 4L8CB 3FMGH 4WKZA 2JCCB 5C09E 4NPKA 2Y5TA 3NH7L 5T3ZE 3S3PA 3L3DB 3K6DA 4WW2F 4FQCL 2AEFA 2ZYIA 3KXFE 3EDKA 5DVKA 4NP4L 4UU9A 1U3HC 2KZWA 1HWGB 1JTPA 1A8JH 1JD7A 4ZG1A 2BFGA 5CBNA 3AFLA 2K45A 3NJKA 3OLGA 3QR1A 4HUXA 3UO1L 2XG5B 3MOBL 4DN3H 1CC3A 2AXTE 1U41A 3MXVL 4LK4A 2NY6D 2BCKB 3SCMB 3BE1L 3QC5X 4HULB 1WBZB 4Z0XA 1CGSL 3F89A 4UI2A 5CCKH 4OSUL 1MN4A 4CGUB 1I3GL 5I2IA 1F4YL 4LCYA 3AY4C 4NRZB 4UT9A 4BH8A 3VFGH 3ECVA 5I1IH 4BK4A 1MRDH 1EDHA 3L48A 2WLZA 2B88A 1JMXA 4UM9B 2WCGA 1XF4A 3QQDB 3R06B 3T3MB 4RH4A 1FE8H 1HSAA 2PO6D 5GGVH 1CI3M 1FI8C 4TNVF 2FLRT 4XCEA 3RAJL 3WUWB 1NCCL 2WQAA 1FGVH 3BCCJ 2QQNL 1CDBA 1KYDA 1HTLC 4L4VE 4POZC 3ZDXB 2ENSA 2DYSB 3VI4A 1XCXA 5MEPA 1M53A 1U6AL 2GUOB 4Y5YC 3MX0A 3OR7A 4XN8A 3FQRA 3P0YL 3BPNB 4JL2A 2P5EE 4EI5A 3NA9H 4YPGA 4XWGH 3RZWA 1UH2A 3B2MA 5EMYA 5IW6A 4N8PA 3VMPA 4BXLA 3FT4A 2J12B 5DRZB 3MLZH 1OP4A 2VXQH 5F0MB 3MOQA 4MHHG 1MHEA 5D1ZB 5KAQG 4L3AA 4R8WL 1JS4A 1R17A 1Q82Q 3VYIA 4J7RA 3RHWK 4R5TA 1KCWA 1NTZG 4G43B 1FSKB 2W81C 1WT5A 3JWNC 4MX7A 2E3VA 2AXWA 3SPHA 4ZFGH 2DQGH 4OV6F 3PLNA 3SE9L 5HHPA 1QD0A 3EO9L 4XXDA 3NCMA 4NZFA 4XNZC 2AI0H 2IANA 4KZ0A 4RKUJ 1RF1C 2XKMA 1UA7A 3EFDL 4JY6A 3F6LA 5CF3A 1HKLL 1MIMH 3RFZC 3QS3A 1F18A 3QQ3B 3QDJB 5I18H 3EH2A 3AEEC 5CR1A 1LEGB 3V0DA 4U6YA 3H53A 4QHLA 1FJPA 4LXFA 5F9JB 2VDOH 1HEHC 5GGRA 5F7YC 2ESVB 4X5WB 5SX4H 3QCTL 1XXFC 1BPLB 2AERT 3M07A 4X6BA 2GJ6B 1ZV2A 2VN7A 5F97E 2ZXQA 1WVZA 4HUCA 4JCWA 4L5FH 3FCTA 1MFCL 4IOIB 4LNRB 4N2CA 4XVTL 5DFWH 5KUKA 4Q9RL 1RV6X 5F6IC 3AU1B 4BKTC 2EUWA 2OXGA 1BAFH 4HWEL 3BD5A 3CXDL 3HRZC 2PF6A 3ARDC 4PM1A 1VADB 2GTQA 2E47A 4FKKA 3SDAC 4JCMA 3CZSA 1UT2A 1FH5L 2WIIB 3MREA 1LILA 2GFBA 4OJEH 4X4YB 1R0AH 1QFWI 4X4KA 2G75B 4R0LB 4IHBA 3PQYB 3B8YA 1LHZA 2ZWLT 3BP5A 3QFGA 4N2BA 5IROC 1EDKA 3IMUA 4PJIA 3Q9PA 1ACZA 4QOKA 4JFZH 4JR9L 2E27H 3LXBA 3L95B 3LTVA 4H88L 4KGJA 3TCLA 1PYWB 4O02L 2PO6A 3QRBA 3NCEB 5TPWL 1YQ2A 4QXVA 4GG6F 2WNWA 1P4LA 3EOTL 4L76A 1AY1L 3TBBA 4Q6YA 4RWYH 2H26A 2QR0A 3TBSB 1GCFA 3HBPA 3VD0A 4C4UA 3QUMH 1NGYA 3CVHA 3N9GH 3GYRA 2XIIA 5F89A 4DZ8A 1G7HA 5K9KB 4GBXB 2XVLA 5FPIA 3SO5A 1BZOA 2KYVA 4LLMA 4N5EC 3UTQB 5HYEA 2BWIA 4GH7B 2BHUA 5KW9L 3BH4A 3QGVA 4WDIB 3O45A 4PWFA 3DOIA 4CN6A 3NIGE 3HI1A 3LXAA 3UJTL 1QLEL 2HRHA 1RY7B 3GB7A 5JDSB 2OL3L 1GGBH 2F08A 4UDUB 2J25A 3P9WB 3P3SA 4LP5A 4Q9QH 2F1BA 3FS9A 2R0ZH 4OIIL 2IZ1A 1UD8A 3RX9A 1KPRA 1S3KL 2XY2A 3ARTA 3AEBC 5HHNB 4X9IA 4RX4D 3LB6C 5I24A 4X9BA 1HH9A 2HJFB 3OZ9H 2VIRA 3LN5A 4AEEA 2WOYA 3QIBA 5SWSB 3TCXA 3UTSB 1CTOA 2NYZA 2V0AA 1M05A 1E3XA 3D9AH 5T33L 3M1CA 4YDZA 4LIQE 1MFTA 5JXAH 3ZE0B 1OTTC 5L9DH 2OQJA 1BFOB 3PREA 4HF5H 1DJWA 4MHHI 2ZWYA 4FQ2H 2O5YH 2APXA 5BOZG 1MZYA 1NCBL 4LGPB 5DURD 1ZLSH 3DC0A 4U1MB 3SDDB 4BK5A 2DD8L 1MQ8A 2GG1A 4KJPC 3EW3B 2C1OA 2TAAA 2YHGA 2YUWA 4HGMA 4M6AA 4S1DC 3TU6A 2YPLB 1C7SA 1OO2A 4WFEE 3QG7L 4Y89A 1EZVG 2Q8BH 2AEJA 3MGNA 1INQB 1LDSA 3ZO9A 2I9TA 5A2CA 2G0KA 4LCWB 2WYTA 3KYMA 1FLTX 1KG0B 2VWEE 1QQDB 2IOIA 3B2VH 4CSTA 1S7SA 4HKXA 3S35H 3IMVA 4NAQA 4JN2A 4YE0A 2H32B 4L73A 5I19H 4PJFF 1UD3A 3D12B 1M2VA 2GI7A 3OKNB 4GW5B 4YNYA 1L0LE 2H2PD 5TISE 4ONHA 4KQ3H 5ALBH 3QDGE 3F3HA 4X6CB 3U1SH 3AXIA 4HMCA 1N64L 3QWQB 3LX9A 5DTFB 4FQHB 1T6WA 4XMWA 5GZNA 3T8VA 4ZPVA 1VCBC 2XV5A 2NNRA 4AKPA 3HLAB 12E8H 2FWLB 3N41B 5ICXB 5BZXA 1TU3F 2XWCA 1I7TA 3ZT5A 1Z5LB 4DP8X 4HV8B 1GYAA 5D7KE 2EDKA 2WQ8A 5DUJA 5B3NA 4YZWA 3VE0A 4Y4FB 2WXJA 3T3PE 4IM8A 5DVOA 4MA3A 1L4AB 5KOVC 2ZCHL 3MOAH 3ZTJH 3GSWB 4YK4C 1DVFC 2R69H 1GA2A 3TGUE 4E9WA 3B2XA 3CXHI 2UYLA 1F42A 3AE8C 1IAOA 4GAGH 1U8KB 2ZOKB 4RX4A 4UDTB 2PTUA 1QSFB 3NGBB 5TQ0L 1WJ3A 1A3ZA 4YDIH 4NGHL 3T1WA 4KI5F 2PPEA 2G5BA 4NYLA 1L0YA 3UX9B 2AEQH 3BD4A 3JWOH 1G9NL 4K7PL 1V3KA 5DDHB 2XNAB 2QZQA 1J8HB 3GJEB 3QXUA 4WI8A 1PX8A 2ZT9B 2OYHC 1BCCJ 2Q1KA 3CDZB 4P23C 5DI8A 3ZBMA 3NBNA 1LWUC 1MREL 2QG4A 3L3HA 1Z6JT 4Z7NB 1BIIA 4HHWA 4Y19D 5DYOA 5I8EA 5EBGA 2D7NA 3DGCR 1TCRB 4YC2C 4TSCL 3OKOB 3VWJC 3ZN6A 4FAAB 1ETZB 4WI4A 5IFAH 4ZUSB 1G6RL 3FT2A 3S8WA 3JC22 2KNCA 5GISH 3X1GA 3P77A 3C6SB 4JPKH 4NKQB 4KRMB 3FN0H 5KSAB 3M9BA 1X6LA 2VJ0A 3MUZ1 1DUZB 4CU6A 5ALCH 1G43A 1PKQE 1PCXA 3CN4A 2AJYH 2CGRL 4UQ2A 5DSCA 3H1JE 3U48A 2VDQB 3NA4A 5E99H 3ZZ1A 1TFPA 1OSPL 5E6UB 1FL6A 1N68A 1JXDA 3OGCA 2G9KA 3OTTA 2YUVA 4D2NA 4S0HA 2LAGB 4WEUD 2H7WA 4M93B 1SLQA 4C4KT 2E7LA 2GSGB 2IV9A 2W07B 4PB9L 2HPCB 2XV2A 1O9ZA 4BRYB 3T8XA 3FBKA 3MO1B 4FI6A 2EE9A 4D9RD 5CM1A 1DQQB 2L4OA 2CPSA 2OSLA 4OF7A 3DURB 3V0HA 3QYCA 3HPLA 1SPDA 1M1JA 2P5WD 4G6KH 2LHAA 3KLSA 4GG6B 1PD6A 2DI8A 3L4WA 3L2NA 5ADPL 1A5FH 4OLZH 2ILLA 1HGVA 5I1KL 2VOTA 2VDRH 1MKMA 1LD9B 1IGJA 2Q9IA 2YD2A 1JGDA 4OY9A 4PVMA 3T65B 3X11B 2HN7A 4G9FB 4LHUD 4MXVE 5DZPA 4H13D 5I1CH 2APVA 4JDTH 1EEYB 2OZ4L 3EOAB 2NY4C 2NUTA 3WTVA 5AZEH 5C08D 2F0CA 2EKJA 4LQ1A 3ZW3A 1RXLA 3VFNA 4XA4A 5AKRA 2WSEH 4M7ZB 5IHLB 1E3ZA 1J0KA 3QQ4B 2MQ3A 3IWVA 2YLHA 1GOFA 5HHQB 4IIQC 3V5KB 5I8KL 4PJAA 3LS4H 4HJGA 4N2EA 3HMXA 1V5JA 3ZE2F 3LW5J 3A21A 4WY7L 5JHDD 4Z0BL 1QHPA 2W0FB 1KXTB 1G9EA 3H4HA 4XCNB 1AD9A 1UWGL 4ONGH 2P67A 1OT2A 1I9JH 3U36A 4NPDA 1AP2A 3RZCD 1S9VB 2VERA 5IB1A 2A9NL 1CR9H 1NM9A 1RPQA 2Y1VA 3NP3A 2ZAHA 3HHRB 1NGZB 4LFHD 2C8NA 4H8QA 43CAB 2KB7P 1L9QA 3ISYA 3G9VA 2YKPA 3IDNA 3O0LA 1F4WH 5HGAB 2Q6WA 3WTWA 5TJHA 3W5NA 2W0KA 1T7VA 2BNQB 3JYBA 5JIPA 3C09C 1QSED 3S48A 3MRGA 4WENB 4YQXL 2K1AA 1LK2B 2D0FA 2XZZA 4M7KL 1TMQA 4BA8A 2X2UA 3MQIA 2DWTA 1KTLB 1ZHKA 4ZFZA 3UG4A 5E1IA 2HT2D 1LTAC 2W80C 2C3VA 1MHPH 2XETA 4H5SB 1T4KB 4C47A 4LMQE 1AQ5A 4OZ4B 4M03A 5GS0H 1OGSA 1VFBB 4BZ2H 5LNDA 4LLUA 1NAKL 3WNPA 2IBBA 3CVIH 4AQ1B 1K4CB 1PBYA 3MUDA 1E4JA 2OBGA 3P9MB 1T22A 5EU6A 3ZDYB 2XRAH 3AS3A 3UPCA 3T0AA 4XCFL 4ZUUA 3RNQB 2NY1C 4DGVH 1F8TH 5CBAA 2V5YA 3MRDB 3C5ZC 4G59C 5DFTA 5FYJL 3THML 4JQIH 2A06D 1VPOL 4XPAH 3JWDC 3UC0L 2P5WA 3P7KA 1G2CB 3BPOC 1JMMA 5IVXA 5ES4B 3EO0A 1QVOB 3IJYB 1N73A 1NGPL 1W80A 4YHML 4PGBB 3H42L 1CO1A 3ARBC 3IN6A 1F58L 1UD4A 3UBXB 2QKSA 4LHUA 4WU7A 3RA7H 3BEWA 4DKFL 2Y0DA 5FR3A 3S88H 4D9LH 2GT9B 3STBA 2O01H 4LDCA 1U8IB 4QRRD 3P3RA 1TCMA 4HWBH 2Y7SA 4Y0GA 1NUFA 1H5BB 2BSCA 2WYIA 4KJQC 5FF6A 2MQCA 3EJCA 3U0PA 2ZG1A 2FUQA 2KI7B 4A04A 3P2TA 4PRHE 4Y5VB 4JRFA 2ZUSA 2HLAA 2UY6A 3CPLB 4YSUA 1KUMA 3W67A 2I07B 4ZFQA 1WPCA 3FUNA 4N22A 5F3HB 5JHDA 3D3VB 4H0IA 3FF7A 2UZYB 1B2YA 1P4IL 3GI9H 2J5WA 2VRKA 3MLYL 2NX5B 5KBKA 1NJ9B 2OMWB 4KVNH 3RZCA 3RDTC 4HEME 2PKDA 3VFUA 1BD2B 1YA5A 2HMID 4NFDA 1LJ2A 5APTA 5EOCJ 15C8L 5B22A 4ADGA 3AQDA 4ASWA 1VF5D 1P0SE 2EDLA 3CUPA 3EFFA 4APQD 1RF0C 2P52A 2Y06H 4F7EB 2EUXA 2W90A 2X3CA 3MLTB 2IQAA 3DMMB 1YPZB 3FOLA 1UACL 4D3CH 3FSOA 1A0QL 2O3JA 4XE5B 1FAKT 4NS0A 5B38B 1ECYA 4HG4K 3HIZA 1JZJA 1B0RA 1YN6B 3FYEB 3M0DA 3N43B 4UV4H 3MRLB 5ERWB 4LGRB 4TF4A 4MFHA 1AZZC 3NIDF 3VXRB 2ZPKH 3QIUC 3PWUA 1BHGA 4P4RB 2E4FA 3VH8G 1T2QH 1BYOA 4NPJA 5K9OB 4GODA 4YE4H 2YMKA 4IEFB 3N1GC 4G71B 5I0YA 2O01N 2Y3AA 2X1QA 3CZKA 5DJCA 2GITA 2O6PA 1YC8A 5B1JC 2NZIA 4KUZH 2GIYA 3K6IA 4PGZA 4MGXA 3B2UD 3HZ3A 4XMPL 3OA7A 3BGMB 3KPMB 4PN6A 3UDWC 1USEA 2ZOLA 4ZFFB 2V5MA 1EO8H 5HDQL 1IC0A 3T1FB 1HQRB 2Q87A 4QRBA 3ARVA 4N6JA 3PG2A 4P2QB 1E43A 1OB1B 5CN1A 1P7QD 3JV4A 1QW8A 3KVPA 5ANME 5C86A 3IPFA 1GL2C 1KCUH 1CICD 4NZUH 3GHPA 4FFZL 3A67H 1EXIA 1HZHH 1QEWA 1OE1A 5EZPA 2DJUA 4P2RD 3QWOA 4XAWH 1NMAH 1M6OA 3CHXA 4M5YH 3GSRA 3JSVC 2EEDA 5ECJE 1AR1B 1JUFA 2J1WA 1E90A 2PCYA 3LZFL 3DVGB 4ACTA 4QRRA 4OLVL 4KK6C 4OM1H 5GS0D 8CGTA 4APXA 5CD3B 3FFCE 3SGJC 2OXHB 3LQZB 2K88A 1SQBK 2A6IA 4X6DA 2I26N 3RY5A 1MF2H 2WXQA 1BVNP 5FK9A 5FKPB 3IFPB 1E8YA 4JFUA 4TNEA 4TL5A 4WI0B 2IXQA 5LBGA 1MCWW 1CLCA 3O3EA 5I71B 1EIBA 3HZYB 5C0IB 1JEKA 5C0CE 2LT9A 3UZQA 2HG0A 4ELMF 1L0NE 1PP9J 3VD1A 2P10A 4ZDHB 1A7RL 4KJWC 1CG9B 4IOSD 4H20H 1AR2A 1QATA 2O93L 4JG1H 1NIFA 1QO3A 4XPBL 3NSDA 3OAKA 1C8QA 4A1RA 3QO1A 4HD9A 4XVUC 5KLVD 1KJVB 3FO9A 1TSRA 4BKSC 1TG8A 2FZ3A 3OG4B 4YBLC 2LU3A 3MGOB 4BWUA 3LKRA 3K5RA 7PAZA 2RA1A 4I18C 3RPIA 1R5IA 1KBWA 4YUEL 5DS2A 2QL1A 4L74A 1OP5K 4G5AA 2H7HA 1EDIA 2MPAH 3P0VH 3ZUNC 2W0LA 4EEEA 1BE3G 1KC5L 5FM5M 5GJTL 3V2PA 5F0PB 2ZX6A 3BFWA 4FQXC 1BWWA 4HZLB 4HALA 1AKPA 4N26A 3P4OB 3GHGA 1EANA 1TETL 5APSA 2X0WA 3BAEL 3EYVA 3QBTB 2CXKA 2A6JB 1LP9B 2CJTA 3ESUF 1HEZA 3ESPA 1F02I 3KYNB 3MZGB 3VSQA 3QUYA 5KBDA 4LSPH 2WTYA 4LRIC 4MQTB 2KSJA 2VISB 4ZSOE 3T9WA 4X8CA 2WD0A 1CICA 1QLFA 2J44A 2VRAA 2EABA 2O6DA 3NJXA 2O61A 3L70G 5TE6H 1NU1K 3BZ5A 4IRSB 4ODXA 4P2RA 4YSSA 2BZCA 1ZT7B 3IE9A 5I28A 3QNYA 2GBVA 3FQNA 2Z7ZA 3WUTA 1FYTB 3P4NA 3FUIA 3SY0A 1EUUA 4Q2ZA 3BHBA 2BS8A 1D5XB 1HSBB 4Q0XL 5F88A 4JZNA 5E51A 3RL0C 1QRND 3RK3E 3KL5A 2R5BA 1BCIA 5EUOA 3BCCD 3I6SA 1T8ZA 4JDZB 4R3SB 1JV5B 3N85L 1KIQA 5EBMA 3VSTA 1J0JA 5E8DH 2B1OA 5AAPA 1NEPA 1A6TB 3EYUL 3S5LB 2XWTB 5AKTA 1KIRB 1XTMA 3C2AL 2L91A 1VHPA 3C60B 3GKWH 5I8CB 3ARFD 1NZRA 3MRMA 4PRPA 4NERA 5AB2A 4UZGA 4J6RH 2EZ0C 2VLKE 2OYIC 3FTWA 1EDQA 4QMAA 1A6UH 1ZT1B 4IOSA 4GKNB 2CM6A 1OAUH 4R7VA 3ITKA 3ZUCA 4WW1A 1BOGB 2X6CA 1YY8B 4KY2A 4PJXA 4EQ2A 1T1ZA 1ASOA 2HLEB 2WWNA 2WN2A 3ARUA 4J6IA 4QRFA 4PJBF 3PP3K 3HE5B 1UXMA 3BZ4A 4HWBA 3ZKXB 3PJSK 1HT6A 3SBRA 2RMZA 3O3AA 5FYKH 2P8PB 4JL1A 3RVWD 4G7SB 3QWRD 1T20A 2MKVA 4OD2B 1RZ7L 4RAVB 1NCDH 4AVIA 1JCDA 2FR4A 4M8UA 1XMEB 2XYBA 2E76D 3RUGB 5DHXB 3NFSH 4FLQA 3IETB 2Q3IA 4ODUA 1BVKA 2HLFC 3BZDA 1XGQB 1U4EA 2ZUQC 2D31A 1VQNP 4YO0B 1VERA 3SKJL 1OXYA 1JHKH 3GDCA 5HD8C 4PVBA 5I0DA 4Y4HC 1YJNP 1AFVH 3GBML 2VDMH 1HUCA 1OAQL 4AGOA 4AENA 3FUFA 2QSTA 1S7TB 2JI1A 1NINA 2DQIL 5FO7A 1CL7I 3GD1C 1GVIA 5A16A 2XPGA 4AZ8B 4F7PB 3CWBJ 3HC3L 3KPNA 4OD1L 5HYQA 5IMLA 4NNXA 4KAQL 5GSVA 2VLME 1JDDA 5C0ND 5E4EC 1P2CA 3GSOA 3ASWA 4G80A 3VOPA 1KILC 1RLBA 3FSVA 4J4PC 5FWQA 1I9RH 4MMZC 3RL2A 1IJDB 1DQML 1ZTXH 3DETC 4BQ9A 5A6LA 4HIPA 3DO4A 2HFFB 4BCYA 1ZS2A 4AMXA 4EBQL 4WKXA 1JHTA 1KQFB 4NN5B 4AUWA 2WBXA 1VQOP 4P2OD 5D7JB 5EC2A 1AVOA 3DTDA 5F7KC 4GXVH 3VU1A 4XWOC 1QRNA 1J5CA 5D2LA 1CFVH 2VDQL 4NQEB 3V0EA 1PPJD 3TTSA 1T03H 3MV9B 4N0CC 3B7SA 4NQCD 5E2VL 4H1LA 5MERB 1CVRA 4ES9A 1OTSC 2H1PL 5C09A 2BNRB 2ARJQ 4CNIA 2VLJE 4UNTA 3WFCH 3WDIA 2J58A 4OGYH 3WMQA 4UB8E 3MFFB 4GOSA 3FU0A 4M56A 2HG5A 5ICYB 1BX2B 4N2GA 3D09A 4PJEA 5HJGA 1JZ3A 5KAFE 2F19L 1OSZA 2XDJA 1TZOA 2MH4A 1AGFB 3ARFA 2H5UA 1A25A 4RCAA 5TE4H 3V9CA 1ZRUA 4M4RA 3BISA 1IAKA 1SN2A 1DQDH 4AT6A 4Z7VE 4CSSA 3SPJA 5F7HA 1YUHA 5AWNH 2XWXA 2Y6SC 1A6PA 4XZ4A 1SFHA 1A9BB 4QWWC 2G4GA 2PGDA 1MAML 2EDWA 4AM0B 1LE5A 1XIWD 2E4TA 4OZGB 1NOFA 1VDFA 3QEQB 4FXGB 4BD4A 3IPEA 4DGYL 1MFDH 2F58L 1ONQB 5E08L 3OKYA 2J8UF 4HCRH 2OMZA 1OALA 3QJSB 4L5FE 1G7QB 4XC3L 1WUNT 3IDYB 5D70L 3AREC 3QWRA 4LMQI 1R5WA 3TIEA 1KEML 3DV6B 4TN9A 3QZWB 1UGNA 1UYWL 4OKDA 5EPMA 1H3GA 4NC1C 5JQHC 1EGJL 1MIEH 2K9JA 1I8LC 2P5EA 2R0WH 4PWHA 3SJVE 3T09A 3W0WB 5EO0B 1P69B 3GK8L 4O2FA 1VQ5P 3L5XL 1SVFA 2WXHA 4R5VA 2R1XB 1E4WH 2EDEA 5D6DA 4E9TA 4PJ0H 3VI3F 2CO6B 5JXED 1DDHB 3G3ZA 1TVDA 2YSSB 1AIFA 2EEFA 3DLQR 4JG0L 1L9MA 2C9RA 4OV5A 2M1KA 3ATAA 5GRUH 1KJMA 1UOLA 3HUJE 1AACA 3SFEC 1HE7A 1Q9OB 5CEZH 2DQDL 3H3PH 1BJ1J 2VQTA 4F33B 5APXA 1JZEA 4YFLI 5FYKD 1IBZA 1T6BX 1T83A 1OVRA 2FQEA 1XVSA 3TBYA 2XQYK 1MNUL 2IDCA 1NAMH 3DROB 3DVIA 3APMA 1GZHC 3JVGA 3RGUA 5EZOL 3C5JA 1MJ8H 2CZNA 1MUJA 1QBLL 1S7UB 4A7VA 4W9IC 3CMOL 3PWJA 3CSYA 2VN5A 3DRQA 3QRGL 2I5YH 2QSCH 4MXWL 3ZL4H 3QULB 1WAAF 2NYKA 4G8IA 1C5CH 1TIUA 2C1PB 1FVCB 4J3BA 4V1DE 2D4FA 1RIUL 1OGAB 1ZTMA 4I2XB 5GGTL 1BSNA 1RL1A 3CFBA 3CVCA 4U4IA 4EN3A 4P57A 1N7MH 1QBAA 2YEZA 4HPYH 2V5TA 3C9IA 4WK0B 2GEEA 4F8LA 4MJ2A 4PGDA 3MNWA 2VDNL 2A83A 2ZKMX 3GNMH 3L36A 1N7SC 2K7QA 5EF2A 2B20A 2PRRA 3RVTD 1I8AA 1RK0B 4LDOB 2ORBL 1N2DC 1BLNA 2QGEA 2QLYA 3DNKA 3CDGA 3TS8A 1CI6A 1UXSA 1SYSA 3SE4A 1ANUA 1CGUA 1BW8A 1CFNA 4S1QL 3UYPA 4KGLA 4OFIA 4JPIB 4J5VA 1H88A 5KS9F 1DE4B 2H6PA 4HFUL 1BCCD 2E7HA 3UXFA 4KQ4L 3MRRA 3R8QA 5DO2C 3ZHFA 2GUYA 4X8JA 3FTSA 3SDYL 2UUDK 1BQHG 3RTLA 2OYOA 4DSYA 1JY3N 3BWUF 2IADA 3V4WA 4JANB 5TK4A 3P4MA 1KJ2H 4ZQTA 8FABA 1KFGA 4DVRH 1TVBB 1H3VA 2N9YB 1Q72L 4I5BA 2CO2A 4G8EB 1JNHB 2JKRM 2AV7A 3K8MA 4YHIB 3SGEH 3AB0C 2HTKD 3O4OC 2WKGA 5HBBA 5D2NC 5JXEA 1NC4D 4NUPA 4K8RH 1XGTB 2NXYD 4A68A 3B9KD 1FN4B 3CFKA 4N1EA 4NKMA 3BVVA 2E59A 4J2XA 1U7JA 3ML8A 3RLSA 1J5IA 1DVYA 1DCLA 2OKMA 3TL5A 3E2HB 1IKOP 5IKCB 4DP1X 2UXTA 2ZTBA 3IDJA 1BM7A 1Q0YH 1NMBH 1RZJL 3K71B 1SXSA 1JNNH 4FULA 2PAJA 1DBJL 5EOCH 1HJCA 1P4UA 4YX2L 4MMXA 1BOYA 1NSNL 3ELQA 4QTIL 4U7SA 4CU8A 4HXBL 4FXKA 1JIBA 2NNAA 2VWEC 3TF4A 4BQ8A 2IPPA 1ZT4A 2EEXA 2PYEE 3CK0H 1SXZA 3PDOB 5F1SA 4JVWA 5BVPH 1QR1A 1F4HA 1VCAA 2JSFA 2WB1A 5CJOH 1CE1L 2AJ3B 2LGNA 2BJML 5DXWA 5IK3B 1NBZA 1PIGA 1E0OB 3NK4A 4F24A 4Y2DB 4GRWF 4R97B 3WG7B 3WJJC 4QTHA 4NO2A 4BEIA 2A6KA 5BO0D 3MGAA 5CEZD 2N1TB 1I9IL 1NIBA 4PV1C 1ODAA 2RTTA 4Y4KC 5JORB 1PJ9A 5C71A 3ULVF 2F18A 4NP9A 4R4NC 1FDOA 1O9WA 4DTGL 4DQOL 3E8UH 4QKXB 4Z77A 4HIIA 5BV7C 5K9JL 3H9SA 5CEYA 2FIRT 4KX8A 1LO5B 4HT1L 4QAMB 3MMEA 4CMMA 4LLYB 4PJ9D 5I66B 1XGRA 4OZFB 4ZPTB 3MLSH 1PVHA 2VL4A 4MNQE 1ZVSB 2MOQA 4PJ7B 4K7FB 4F5CE 3RIKA 1WTGT 4M5TA 4XNQB 4C7RA 3BT2L 2ZJSH 4NEHB 3DYMA 4HK3N 4NWUH 5D93C 4YXHL 1D3CA 5DWUH 4GO9A 5ESQB 4AJYV 2BZ7A 1HIMH 4N2FA 3X12A 5C0GB 3RVUC 2VYRE 3ME0B 3OB0K 3Q5RA 3KLLA 1A2YB 2CO3A 4PRBA 3O8XD 4NENA 4RGNB 4GAYA 2COQA 1DEEA 5KN5B 2FGWH 5MHSD 3US9A 4ZXBC 1MFBL 2AJVH 2YKQA 1SEBB 3B9KA 2CDFB 1B6UA 4JGUA 4OZHA 5F96H 4ZNCD 1BECA 4XPHL 3ARRA 1N8OE 3MLXL 1OW6A 5JIIA 1PF3A 1V3LA 2E46A 2YGVA 1JE6A 5CSZB 1R8EA 4EIUA 2R23A 2ERJB 4PMEA 4FZEL 4XXWA 4HCRA 5GGSB 3VJ6A 2PCPA 4ZS6C 1ZXQA 3BZFB 3WFDL 3L4YA 4GKSB 3V4PB 1TZ8A 5CCHD 1T80A 1XEUA 3ZSTA 2JCCE 4PP1C 3SY6A 4LSDA 1SN0A 5I74B 4A67A 2JIXB 1TQUA 3HE7C 5BRZE 5KAIH 1SHXA 2MCPH 4YBQD 4P3CH 2CDGB 1ZV8A 1UA6L 5ENWB 3T0ED 3QDME 4BUHA 1URQB 4L18A 5LWYH 4JYCA 4LVHB 4X8GA 5F9AC 4O9BA 3G08B 5CZVL 1FC1A 3EBGA 4Z23A 5LGHH 3DI2B 4QO1B 4K8RD 5EBLA 1A6ZA 3ROLB 3IBEA 4QRQB 1SQQE 4Q4IA 3TIDA 1Y1DA 3G6JF 5HJBA 4NDMA 3FOMB 2OZNA 1AKJD 2XIBA 2CMRH 2Z91A 4IFMA 3KJ4B 1NCWL 4U05A 4AEHH 4FEMA 4BE5A 1KYFA 1FAIL 2ZSWA 3H2QA 1NAMA 3EJPA 2Y07L 3HB3C 1MCCA 3ZDXE 4JJ5A 3SDCC 3VCLA 3CN1A 4KHXH 4H26B 3JTSA 2NNCA 1AJ7L 4KTYA 4TRPL 4OLWH 1HILB 1ZR2A 3V7AE 1IC5L 1XB8A 3VW3H 1EEQA 4Z1MH 3FT3A 1MXDA 5DJDB 1TQBC 2JKSA 1TQSA 5D4IA 3N50A 3EG9B 2ED9A 3L71D 3MGTB 3S34L 5AENA 5C0RL 3FX0A 2CIKB 2MSPA 3N40P 1NBVH 1A14H 2FX9L 2X4OA 1NWQA 1UJ3B 4FHJA 3BLBA 2DIJA 1MHCA 4ZZKA 5C0DB 1QWNA 2GI0A 2PWHA 3HC2A 3BP7B 1DJZA 3A4AA 5IBUG 2CO7A 2DLHA 4PHZA 1G7LB 3GMRA 4EOWH 1EHLH 4ZNCA 1KGIA 3NH7H 1HL4A 3O3UN 4XO3A 4AQ8C 3DX8A 2JB5L 4NP4H 2EIBA 2BSRA 3QZMA 4PI2A 1S9XA 5IVZA 1JZHA 4FG6D 3UO1H 3MOBH 3MXVH 4PRDA 1F2XK 1ICTA 4DESA 1AXTL 3BE1H 3IYLW 2RH0A 5D5ME 2FWOB 1CGSH 2QKIA 3LKSB 4Y9FA 3FCSB 4OBRA 3IGLA 1F6AA 1OT1A 1F4YH 1WCBA 3HE6C 3PNRB 1IJNA 2O1KA 2CUAA 2YSTA 2VLRD 1KIUB 5D7LB 2WJ7A 1NCHA 4R83A 4WV1A 5AYQA 5HHXL 2FFDC 1KJ2A 4D0DA 1CD9B 1VGKB 3BH8B 1U93A 2O30A 2QV2A 3KD4A 4X4ZA 1I7ZA 1KGYE 4LHUG 1KY6A 3RAJH 3BIKB 1NCCH 1HNFA 3L75J 1JXJA 2QQNH 5E9DB 3KEDA 5GIRA 1EZUA 4X83A 4AYFA 3A0HH 1XR9B 2CHXA 1U6AH 4LPYA 2E75D 4YDLC 1F13A 1QPPA 1MH5B 4HUVA 3P0YH 1OP5H 3UCRA 5I16B 1N10A 1RE3A 3PQYE 3QZPA 2DQFB 4I9XA 4P2CG 4Z7UF 1JK8A 2QJPB 3S4SA 2KZJA 4I77L 4QYAA 2D7MA 4JE4B 2Y7MA 3B7UX 1AQDA 5BPPA 3V55A 2FLMA 4H0HB 1AKJA 4EUPH 2K9UA 5E8OA 2P9RA 2X9YA 3FQWB 4KK8D 3DUSA 3TN0D 5L8JB 2C7UB 2XWJB 5ESQA 4XP5L 4K3EH 2Z31A 5CGYC 2VH5H 1FZOA 2W6BA 1BSIA 4NO0B 4NCC1 5DVLA 3BQUD 4KVCL 1NTMK 2I27N 4W7ZA 2FQGA 3GPEA 4N2IA 4QF1A 2WZ0A 2VO8A 3DIVA 3FT1A 2GBAA 2JEEA 4XOEA 1PL5A 4IDJL 3SE9H 1K8DB 2DLGA 3C5SA 3A22A 3CC5B 3HFFA 5D1QB 4LCIH 3BCCE 1THAA 3O6QA 3K2KA 4LLQA 4RISH 1DDTA 2OYMA 3EFDH 4GP4B 3CXFA 2BHFA 4XR8C 5DQDL 1PY9A 1HKLH 1UUSA 2P7TA 4OCWL 3CSBA 4JFXB 3DIFA 1G1CA 4LKCB 3GS7A 4JFFD 1VGEL 2VUOA 3U9WA 4Z3JA 1GJUA 1TZIB 1VL2A 3ZTJG 3AROA 1KC8Q 1UB6B 3LKPB 4K5MA 1BGXL 4G6AC 3L72J 5EN2A 1UURA 1ZJAA 5CU9A 4BFJA 1ZAGA 4D8PB 3TWCL 2N0KA 3QCTH 3VFSB 1MUUA 4WTWA 3BX7C 5H2FH 4KROB 3AT9A 4XVTH 2V7QH 3L7EB 1MFCH 2N01B 4Q9RH 4E5XB 3EHBB 5DK0B 3Q6FB 2X4NA 1EJOH 3U6XA 3OPUA 2C3WA 2OCJA 4HWEH 3CXDH 2PTVA 4NZ8A 1DBAL 4U3SB 1P84K 5HYIA 3KNBA 1FL3B 1M71B 1H3UA 1FH5H 3BAJA 2JKJA 1KIPA 4N24A 1J7VR 3U1PA 2A06G 2FEEL 4CDGC 4F9LC 2WLNA 3MBED 1MCHA 4JB9H 3HI5L 1QVFO 1SJXA 3FN9A 3SQBA 1JJUA 4JR9H 4H88H 1RUMH 3FQ1A 1UASA 1P5UA 2ZF8A 1N3NA 3KE0A 4ZW3A 4O02H 3PP3H 5GTIH 3GPSA 4L4TA 3D2UD 2E5YA 3EOTH 4B7LA 3ISWA 2JTDA 2WPRA 1GS8A 4B9KC 5HI4D 1BBDL 5EORH 5D7IB 2DPKA 4ANVA 1JP5A 1SQBD 5IQ7L 1M7IB 4WIQA 2GJZB 3DSFL 1M8OB 4FCAA 3WKPA 3TVMD 4N5UA 4P4KB 2ZQKA 2O72A 2WAQA 4PFEA 4JRYB 2HJLB 3TJHD 1BAWA 2Z3FA 3G6JB 1Z32X 1R6VA 4UAHA 4CC0A 2VAAA 2OMUB 3AS1A 1BV8A 2CIIA 2OL3H 1DX7A 3TN0A 3VQLA 1RJLA 5ACZA 3D48R 1UEMA 4MCYA 4OIIH 2CQVA 3BQUA 3BUYA 4L2YA 4MBOA 3D18A 2OQQA 1OAJA 5JHLL 4Y99C 4OLXL 1S7VB 3KPQB 1EBPA 1U3HB 1SVBA 4XP9H 3W38A 1E4XL 4OCXL 4OTXL 4S1RL 4HKJB 1UB5B 5D7HA 5I5JA 1JPGB 1QX1A 1BGYD 4HYTB 2YAQA 2NY6C 3BLKA 5T33H 2XLLA 4A6YB 3BAYA 3GSUB 3VFTA 1T0MA 3FH7A 4GUPA 1BJ1H 6PCYA 4TTGA 5LG1A 4FERA 2KS0A 4O2EB 3QJQB 1HXMB 1T0NB 2A4CA 4UBDD 3GLMA 4WU5A 3WO4C 5DLMH 1ET7A 1KZQA 1NCBH 3HBZA 3D85B 2PO6C 2H43A 2BMKB 4GSQA 3FW6A 4YDNA 1DUYB 5E79E 4FTVD 2BS9A 3QG7H 5E1AB 3ATBA 3BZEB 3NTNA 1X5AA 3D5OF 1FJKA 1EPFA 3O6FD 1HVVA 2X4UB 3D0VB 1U3NA 4KHXA 1D6EA 5F7EL 3R8BB 1XGPA 2EQDA 4YHNB 3C8VA 4XNUL 4EN2A 4OAWB 3OX8A 4PB0L 3MBEA 1DBKH 3NDYE 4RAUA 5DZNA 1AZBA 1XB6A 2VM3A 1ES0B 1MPAL 2X9ZA 4UMGA 3IFOB 4I88A 1ZCRA 3WOVA 1YEKL 2MRYA 4I4WA 1YUKB 1Y0LA 3QHTC 1OEZW 4M62L 5FFGA 5MENB 4TTDD 3N42F 4ZW6A 3CCHB 3D2UA 3GMLA 4UZSA 4X5RA 3ZHDA 3TO4D 3D0LA 4P2AA 1NEUA 1NEZG 3LAFA 1T2KD 1N64H 3P73A 1JN6B 4K35A 2JKNA 3BEVB 4BZ1L 4KMQA 3LIDA 5TQ2H 3V7AG 2ATKB 4NQDB 3F5WB 4OJCA 5EUKB 1JTTA 2A73A 3K2UH 4XNZB 4LDLB 1B0GB 3TVMA 1BVOA 2FSDA 3CCUP 3R2PA 3D30A 3F7KA 2V7NA 3PYCA 3JTTB 4XBPB 1GPOH 1I3RB 1YN7B 3BCDA 4HJ1A 3GMNA 4L1SA 3M7FB 2R8SL 5T5FL 1M4KA 2XN1A 2ZCHH 4QHKI 4Y16D 4BV1A 4ZK8A 3Q05A 1JTHB 1ZKAA 1ZHNA 3VMAA 2CKBB 2MCG1 2F8XC 4GG6E 3AEFC 5D4HA 2LU5A 4NX0A 4IFFA 4W93A 3MUY1 4ZSOA 3BUQA 1L6XA 3V6OA 5TQ0H 3CI9A 2QADB 3B5TA 4NGHH 3EJQA 4K9EC 5F6IB 1LNUB 2NW3A 4HHAA 5KBPA 3KLDA 3HUSC 1G9NH 1PDKB 1RUAL 5FEBA 3HRZB 2EDJA 2KZKA 1M3IA 5ELIA 3SDAB 1RKRA 3FONB 3TC9A 4WFHD 2I32A 2WMPA 3ESVF 3CZFA 5IQLA 4FQPA 3KPLB 2ROYA 4J28A 2KZ1B 4TSCH 5EO9A 2AJXL 3GJFK 4GQPH 3AUWB 1JFQL 3E6HB 3WXWL 1G6RH 2ADIB 3T0BA 2MMXA 2DQMA 4KJYB 5CNHA 4TM9A 4FTVA 4HWUA 4NUMA 5D55A 5F1IA 5KSBA 1JGEA 5DUBB 3UH8A 3H1LD 4ZMDA 5TJWK 1TEGA 3UGUA 4ELKB 5KJRH 3WU1A 4PJ5D 4JFWA 4BSWA 1OSPH 1W8OA 2W59A 3LPWA 5G4NA 1OW0A 4Z78A 1O5PA 4XNYL 1I7UB 4E9QA 5ICZB 1FBMA 4OF8A 2OTUB 4FXLA 2B4CL 4TL4A 4IJTA 1PGQA 3DBXA 2WN3A 1BCCE 2ZXBA 4GUCA 3IGKA 1AV1A 2WHVA 2XZQL 3MRNA 2FE0A 2BP0A 3TYYA 3DV4A 4LL1A 3M9HA 1TNNA 3I50L 2D2CD 3TO4A 3AT8A 4OU3A 1S1CX 3BPLC 5IIEB 1J5HA 2R56L 4JAMA 4IOFD 4Y2OB 2QV4A 5IG7B 5ADPH 4B3EA 2YAEA 3FC8A 3E6FA 1T89A 3NRFA 5I1KH 2WK2A 1E5YA 4I13B 3ZDYE 1RMFL 2CXGA 2UUDH 5DMKB 5J6GB 3VWKD 1ORSA 4JVPA 3BCCG 3O81A 4AYID 4GKLA 4TQHA 2TRYA 1PFOA 3EBHA 2XN0A 4PJFE 4OF6A 4ZX4A 1CBJA 4Y16A 2PTTB 2GK2A 4UYPA 5BOPA 4KMTL 4MJIB 5KLIC 2IWEA 2PP7A 1MCIA 1SDDA 4LU5H 5I26A 1U21A 3CHSA 5I8KH 1AD0B 3AE9C 3EYOB 3QI9C 2BSBA 2O5XL 3QORA 4ZUWA 5BVJB 3V4PL 1N19A 4JFYB 4WY7H 2Q3AA 3TJEL 4UQIM 4ERSL 1V54B 4MJ5A 1H3WM 1UWGH 3VGAB 3DOHA 1X5YA 3KLHC 2B1HL 4H8HA 5L8KB 2A9NH 3PJSA 4YEFA 5IOPB 1EQWA 5E8NA 5DC4B 3WIIL 3QH3A 1P7BA 4HIEB 2ATPA 1RIHL 2KS1B 2AQPA 1AC6A 2OARA 1JZDC 2RD0A 1JGLL 4I0PD 2MJZA 4U6XB 5FHAL 3AECC 4YQXH 4PJ0E 1E5UI 4M7KH 4JFDD 4UUJB 4A7UA 2H2PC 1I7RA 2B1AL 1G84A 3II6A 4PS4L 3RG1C 3IJEB 1M1JC 4IKJA 3OJDA 4KI5E 2VLJA 1DBML 1RJYA 2BC4A 3WTYA 3QNZA 3EYFB 3HZKA 3APNA 4GRWH 2XXFA 5C0JA 1OXZA 3S36X 2JXMA 1NAKH 4KKLD 4EDWL 3RWDA 1YJDL 1OAYH 5C3IA 3VXSD 1A6VL 3ZTDC 1AQTA 1Q9WA 2KL6A 2DH2A 1CFQA 4WUUA 4QRUB 4U3CA 1ML0A 4XN1A 1DJYA 3GBDA 1MI5E 1NANI 4XCFH 3ULVH 3FQTA 3UPRA 3VXRE 1KYOJ 4B3VA 3L3GB 5MEQB 1FO0A 1IRAY 1VFAA 4WY4C 3CCSP 5FYJH 4F57L 3J27A 1X5JA 4YK4B 1AO7D 3THMH 3SDXF 3ZTEA 1DVFB 5TDOB 2JR8A 3L1OH 1VPOH 3DHMA 3UC0H 5D1XE 4HCIA 3FTYA 1OCZB 5DUPL 4EOTA 3AMKA 4BQCA 1BG9A 5KKZC 2EYTB 5DGQA 1EWHA 4FNSA 4XAKD 1NGPH 5IB4B 4BM7A 3RNKA 2OX5A 3DTXA 1DLHA 4PTTA 1F58H 4LSTL 5GS1B 4NKDB 1ZHBA 3VWKA 5DZ9A 1A64A 4YHKL 4HIQA 5J12C 5D6CA 4DKFH 4LSQL 5IWLA 5IFJA 5HGBB 1PPJG 2EVGA 2NCMA 1C8PA 1TKWA 2WO4A 2OYHB 4LCUB 4P23B 4QKTA 3RWHB 3QPKA 1N5YL 3D33A 3PHQB 1LWUB 2X6BA 4KBPA 1D5ZA 4PJGA 1JRHH 3F04A 3VXOA 1F2QA 1QHQA 4N68A 4YC2B 3VWJB 3MUGB 3WEXA 1HTYA 2WWWA 1I31A 2BIOA 4JPSA 3VU2A 4YSAA 3D39A 5CR8A 3QWNA 4ZRGA 3GLDA 1P4IH 2XSKA 3ABZA 4ADJA 1J10A 2BP8B 3MLYH 5CCHE 3UYOD 1AXSA 4PY7A 1MCSA 5TH2A 5CS7A 5DWPA 3V5DB 2IYPA 2I60L 4MD0A 4IU2A 1CW5A 2FSEA 4JPQA 4UYQA 5ABAA 4F7KA 2VGLM 5D8JL 5IHUH 5DS8B 3MUDC 5JPMA 2DQTL 1IBDA 1ZMYA 4L9LC 4WTQA 3IF4A 4I0PA 4DPAX 4P0DA 3QNXA 1A0QH 4H44D 2GABA 1R3LA 3F7VA 5H2BA 2G2RB 1AZNA 2ZF9A 5DMGD 4LAQL 1R5LA 3EKCA 4LLDB 5KVFE 2YPKA 4N2LA 3NFQA 4GO8A 4ATWA 3WLWD 3B1TA 2BOBB 1CGWA 4N8VA 4ZOCA 4TOYL 1PZAA 2NR6D 4QHPA 1Z0NA 4V1DA 3T6QC 1SFCD 1RH5B 1N73C 1R3KB 2MHAB 1SXNA 3DX3A 3KPSD 5AUMB 4XNMA 1KMIZ 5F7LB 1GTFA 3N1QC 3B5ND 4H13C 4XMPH 3SPIA 2DN7A 1FPTH 3FO2A 1OLLA 1SQVK 2R29L 1MJJB 1YMMB 4ZNEA 5HVHB 1KWKA 4F58L 5KZCB 3RWJA 1WA2X 2LLNA 3MLUL 3PHAA 4PLNC 5HDQH 5DJYB 3IMRA 4AYCA 1E27B 1INDL 3QARA 1HCVA 2Q2LA 2NXZD 3TBVA 5F44A 1OM3L 2XQYA 3CE1A 3GHBH 4H8UA 4IIQB 1EA9C 3TP4A 3TZVB 4X98B 1GGIL 3GSVB 4LC1A 2L0DA 4FQQA 4PIBA 4F91B 4DPBX 4ANUA 2WCSA 1EFXB 1VIWA 2CRYA 3RGVD 2X1XR 3V4UL 3STZA 4FFZH 3LEYL 4TNWK 4YL4A 4YDJA 2MCAA 4CW1B 3MNZA 3B5HA 3RZCC 1L7IL 2FBRA 1MCNA 2ICEA 3OHXC 1H15A 2DMHA 3A0BH 2LE9A 3NZ8B 1OZTG 3H6PA 2JF1A 5HYSB 3FZUD 1G87A 5FFOA 4GJTB 2WLMA 1GZQB 4AKQA 2BINA 3GF7A 4U1KA 1MLCB 3O11A 1S9YB 4OD3L 4PBVC 5A1AA 1PY4A 2ARJA 5AALA 2WVTA 3DSNA 3TEYA 4EVNA 2HT2C 1FNFA 5EDXA 3ULVD 4QCIB 1M7DA 3FUDA 3WTUA 1CMOA 5HHOD 5G2NA 1FIEA 1YEJH 4Z3HA 1ZGLM 3S3SA 5FYJD 1TU2A 2Z93A 5KYWB 5J9PB 5AW3B 4DT0A 4RMTA 2BOCA 3UACA 1RHHB 3MFGB 4ODBD 2C26A 3DJ9A 1BA9A 1G7IB 3NSJA 3SBWA 3IXTB 4IMKA 3VX0A 4LCCB 4NZTL 2IALA 2NY1B 3BW9A 3MRKB 3N0AA 3PH0A 1CDYA 1KV7A 3GSQA 3JWOC 3FK3A 4HJSA 4JRXB 2YD3A 1IM9B 3VTPC