5AVRB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avrB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avrB02
3NMDA 3IR9A 3O8ZA 3P32A 2JJLA 3UIAA 5AW0B 4M3LA 3VN0A 1X8YA 1FAVA 3M06A 1GD2E 2Q5UA 3NFQA 3WGVB 1MFZA 3OAKA 4AUWA 2ZFCA 2C9NY 3A2AA 3TNUB 2WPSA 1HWTC 1NAFA 4I6MC 5AVWB 2C9LY 3VMYA 1FOSE 5APQA 1HBWA 4HYTB 3LIEA 2R32A 1YYCA 3M0AA 2ZXEB 2H7HA 3L35A 3VMZA 2QM8A 1H88A 3M0DA 3A5TA 3M91A 1HJBA 1S9KD 2Q7CA 2WPQA 5APYA 2P2UA 2VRSA 4RETB 3HE4B 4JYCA 1MUUA 2E42A 5APVA 3VTPC 2P67A 2QM7A 3B8EB 4GT1A 3TNUA 3KQGA 5AVQB 4RESB 1T2KC 1A02F 2BASA 1CSBA 5AVRB 3HTKA 1H89A 3V5BA 1SLQA 3HE5B 2E43A 2XV5A 3MD0A 1CI6B 3L37A 2YO3A 5AW7B 1JNMA 4LC1A 5AW6B 2WPRA 5CMZA 3T97A 2R5DA 5AW5B 3V4WA 5AVVB 2Z5HA 3A3YB 2IPPA 2WWWA 5APXA 1KQLA 3V4QA 2WT7A 3M9HA 2Z5IA 3HE4A 1MV8A 4KHXA 3LIDA 2WT7B 1T2KD 2KP8A 1CZQA 4JYBA 5APSA 5AW3B 5AVTB 5AW4B 3NTNA 3I5CA 4AQRD 1GK4A 1OXZA 5AVZB 2W6AA 3P7KA 5APWA 2WTYA 1A02J 3MGNA 3TYYA 1NWQA 2W27A 5AVYB 3WGUB 4C7NB 2R3CA 2R5BA 3VYIA 3HE5A 1GTWA 2N9BA 1H8AA 5AVUB 1CI6A 5AW8B 2XU6A 5AW9B 5APUA 1GU5A 1J2JB 4DZOA 5AW2B 2Q3IA 1G2CB 1GZLA 2XZRA 1FOSF 3KDPB 3M9BA 5AVSB 4I2LC 1IO4A 2YO2A 1GK6A 2P7JA 1DH3A 5APTA 3TK1A 1GU4A 3VMXA 4EOTA 4B86A 3SWFA 3A7OA 1SP4A 3NXSA 3L36A 1HUCA 1OWAA 2YNYA 5AVXB 4AYCA 1S9KE 3P8MC 4C7NA 1JUNA 4C46A 5AW1B 4GKGA 4XE5B
chains in the Genus database with same CATH superfamily
5H37H 2NZ1A 3ZSSA 1VEPA 1YEFH 3L74D 2YR3A 2DL9A 3ARFA 4ZMDA 3L8QA 1FVEB 1A25A 3RNQA 5JDSA 4MZ2A 3DARA 3SDAC 1TSRA 4ZUVA 3RB7A 2FBJL 2ARJQ 4QXVA 1T1YA 2AZUA 5BCAA 1H0TB 2FFDC 2KS1A 5C0EA 4QHUB 5C0BD 2X9YA 3S2CA 3ZTEA 4Z7VF 5GGTL 1L9SA 1VGKB 5DRZB 5TDNB 4OZGA 1FDLL 4U1JB 5K9KA 5F1OB 3J07A 1HWTC 5JNYA 4UUJA 2XICA 1SMDA 2R0LH 3IJ8A 1MFCH 5IEHA 5FYJU 3NABH 4LIQH 2H3NB 3BRDA 1FNEB 1BIIA 5L2KB 3AQXA 3NDZE 4BE6A 1A9BA 2VXQA 1ZT7A 4AEHH 1Z5LA 3V0JA 4UT9L 2G8YA 2CRIA 3L7FB 4D9QE 3CQQA 1JK8B 1HJBA 1S9KD 2CH8A 4H5SA 2WPQA 4Y19B 5I8EA 3TTSA 4OBSA 2QKIB 3UO8B 1KC5L 3V2RA 2PPDA 4Z1PA 1CLOH 5D7LD 1HF9A 2OR9L 3D69B 5EPMB 3UERA 2AP2A 4OD3L 4ZO6A 5DCCA 5I1HL 1TVBA 1GMEA 5JPNA 3C5JA 3W1ZA 5LCVH 1T2KC 3LKRA 1CFSA 4XC1H 3RYMA 3SE9H 1QZ1A 3IRCA 4GW5A 4A68A 3QWOA 1OAUH 4L9DA 3BFQG 5LLIC 4H88L 1ZIAA 4G42A 4KKLC 3CZGA 2YO3A 3L3OB 2WD0A 4Z7WE 3MA9H 2R4SH 3T3PF 5GRUH 4B3EA 4HZLA 3BPNB 2PYFA 4PY7B 5KG9A 4XP4H 3WIIH 4RISH 4LSVH 4U3XA 2HLAB 5A7EA 5GS2H 4PD4K 5FECB 3CX5I 1RJZB 1F6FB 4JQIA 1NTKK 1YUHA 1Q9WA 4FCHA 2Y5TB 2EEXA 5ABAA 1O6SB 2AEQH 4AYSA 5B38G 3O6FB 5GZOD 1J0KA 3B2VH 4BE5A 5C0JA 5DR5H 2E59A 1VQ4P 4PD4E 2NY3B 2YSSB 3DWTA 3UFIA 4JGNA 4N2KA 2R2CA 3S3PA 1M6UA 1NTKE 3EJSA 3GJFH 4LF3A 4QF1A 5DC9B 5C09A 3WTVA 4FXLA 5IMOA 1ODAA 1HEZA 4Y4HD 3NMEA 2YAQA 4X6BB 1FYTB 1QA9B 4UZGA 4KTEL 3UACA 1YC7A 2JF1A 3RVXD 4DUWA 1DH3A 2G9HA 2WMMA 4GIAA 4N2FA 2JQMA 4EDXB 4OZFA 1I9IL 3T6QC 4G5ZL 4QOKD 5GSRB 3SBQA 2Y06L 3KCPB 4ONHA 3GMNB 1HQRB 4HH9B 1FNFA 2OYHB 1LQBC 1RIVH 4XP1L 2Q7AA 1IAKB 4W9DC 5E2UH 1YTZT 1NMCB 4Y2LA 4PJEA 3LEYH 1FDMA 4DIXA 3A23A 5CMAA 1BX2A 1CFNB 1NDGB 2FYNB 3HG1E 4U33A 1XMWA 1MW0A 1TXKA 3FT2B 4G7RB 4NT6A 4W9LC 4X6EB 4HUUA 1J9SA 3DBSA 5DD5H 3FMGL 5KVDH 1J5IA 1E4HA 4K73A 3DBXA 5EUOA 4IS6B 3VXRB 3Q2WA 5KN5B 3CBRA 1OCCB 3EHBD 4J3OF 3CNKA 4O9HL 1TYEB 5CBNA 5LO7A 3F89A 1MCJA 3JWNH 2NY1D 4I0KA 1C08A 4LL1A 2ZUUA 4N28A 1FBIL 2ZE0A 3RWHA 5AAMC 1QLFB 4OLYL 1CE1H 4YS4A 1K5NA 3EBGA 4HD5A 3M0AA 1FO0A 5GQBA 5F9WC 5LGJA 4M4RB 4JM2F 1CK0L 1ED3A 1N6UA 2C7UB 2H0EA 2DQGH 3IBOA 1DQTA 1YITP 2Z4EA 2OXHB 3FOLB 3CZSA 2IDTA 3FN0L 4WHTB 5T1DL 3CXHH 1SQQG 2KQMA 1KB5L 1OB0A 1CD0A 4U4IA 4UQ9A 3IDGA 2O6PA 3X1FA 2ATKB 2EDXA 3GSWA 3KYMB 4IBQA 4L8BA 3FO9B 3V0WH 2JSFA 4ORZC 1Z9SB 4P23B 4JFXB 4GAYB 3M0DC 4PP1D 2ZPKH 3MPCA 5FYJD 4AE0A 4RZCB 4AV5A 5T5NF 1HSAB 4PV8B 4A7PA 5BOPA 1ZLUK 3AE5C 3D2TA 1HH6B 3WFDH 2BS71 2P44B 4JX0A 2IPPA 4JREC 5IFAH 3FRPA 3BWUF 1A9EB 1Q0XL 4PRBA 4F57L 3EXLA 2BVQB 1JXGA 5FO8B 2VNCA 3TV3H 2DLFH 3BKJH 4DVRH 3IJYA 4DKTA 2C4FU 2IH3A 3CAFA 3U2SB 2B08A 2ORBL 3RX5A 4HUWA 3QPXL 2F61A 4FQLL 3ZUCA 3MRJB 4X6DE 1XF3A 3UAAA 4O2CA 1NGQL 2R3CA 2DQEH 3K6IA 4JM4H 5JXEA 4QXWA 2G75A 4PB9L 3MOAL 4PJCA 1UOLA 2DLEA 4PJHE 2P80A 1NFDF 5C0AD 2MPAH 3Q5OA 5TFSL 1A1OB 4DO5A 4LL9A 4PV1C 5D1XC 2RHEA 5SWSA 4LO9A 3RWCB 1SY6A 1CT8A 3ATBA 3EFOA 4E9RA 5EBLB 4IRSC 1NUNB 4QRRD 1G7PA 3WFHB 1WT5C 2ROYA 2QJKC 4K07A 3KLAA 4FFWD 1JMBA 4A7SA 1CXLA 3MACH 1WVZA 4C7RA 3CZKA 1AGCB 1HILB 2B0SH 2Z7YA 1OE2A 4HGWB 4Y5YC 5CCHD 4J3WA 2WXFA 1WT6A 4JG5A 4APXA 1IEAA 1XZ0B 3UC0L 2JKWA 1FNGA 2YJQA 3AEBC 2GI7A 3MNDA 1QLRB 4DCKA 1EHAA 1V5JA 1C12A 2W1NA 3DVIA 3M86A 2IZ1A 4NQCA 4P4KD 4WU7B 5LBSL 1AHMA 1NMBL 1N59B 1P4IL 3RFRA 1N0LB 2X4NA 1URQA 3GMOA 5ICZB 4BWUA 4OQTL 4XCNB 4PGDA 3T65A 5IJCC 2P5EA 1WGVA 1K4CA 2DQFA 5DRNA 4W93A 3VXOB 2XYCA 4J1UA 4FXGC 3WNIA 4HZ1A 3QEQE 4HLZH 4UM8B 4ZOBA 2ZNXA 5FHAH 4GSDH 4Y2DA 5DJAA 5C7ZA 4WCYH 2PTUA 3QI9C 4LEEA 5I2IA 5KJ7E 3PREA 3ULVD 5JIMA 2WXLA 4NZUL 1N6QH 3EDDA 1MH5A 3K91A 5IB1A 4I7ZB 1ZE3C 2DIEA 2OL3H 1J9TA 2HX9A 2WVVB 3FH5A 3NJFA 3QXWA 4QXUL 1C5DA 4MB4A 3TNMB 4B5EA 4HWEH 3F62A 2VDPB 4O02A 5EO9B 2WUCL 4M00A 1RY7B 1XF2B 4IOIB 5DXWA 4AKQA 2ZCZA 3CDCA 4OZIE 1T3JA 3HN3A 3H1ZA 1W8EA 1SQBK 3WUUA 3O6MH 2QADB 3UBHA 4E0RA 4WFFD 4NO0B 5K9JH 1YAIA 2W0KA 3IJHB 1O9VA 3TC9A 3WJLC 3ZR5A 4A63A 1OW0C 2JI2A 4AJ0A 3SSUA 1DDHA 3DIFA 3VD9A 2HYMA 1OTSD 1P1ZB 1B3IA 5IOKA 1FE6A 2OGUA 4XPFH 4M5ZH 1BSHA 1SXBA 3BZ5A 1KPVB 3NP4A 5GGUB 4YK4B 1A7QL 4Z76A 3WIFB 1JZJA 1EGJL 5HDWA 2OMTB 3C60B 4PD4J 2KPWA 2N7BA 3EGXA 4JRLA 1M57D 5DQDH 4GAFB 1NTKJ 4JYBA 2KUBA 5IR1A 4RDQF 1VQ8P 2Y7QB 2ZG3A 3KLKA 4WKXA 1RUQH 1QP1A 5CIPA 5DURB 3VFRA 3ZKND 4LK4A 3D9AL 5KSBF 4WNSA 1SMAA 2XQ0A 3ABGA 2FATL 4GFTB 3PUCA 4N9GB 2K9FB 1NKRA 2KI7B 3V5KB 2X87A 1JXFA 4ZXBD 3WSQH 3AGVA 4WY7H 4QLWA 3QJVB 1VF5C 4RWHA 2BHUA 3RL0g 4YXKL 1UACH 4R2GC 5I66B 3UJJH 3RVUC 3IXAA 3WS3A 1H3GA 1T03H 1X9UA 2Z91B 2AJYH 3M8OL 2BNUA 1P7QA 1TVHB 4FZ8H 3WXVH 2AXHA 5ANHA 4X8GA 5DMGD 1NDMA 1P4BL 3QUZC 1XZWA 1X5ZA 4RH4A 3PWUB 5HHQA 3PHQB 1Q38A 1XEUA 2NY5C 1ZGLP 1NGWA 4IJ3C 1ESOA 1NOAA 2ARJA 4XE5B 2AQ1A 3SDXB 2R0KH 2XTJD 3U7WH 3MMEA 5FB8B 1MSPA 5HHPA 2GJRA 2CLZA 1Q0YH 5IVXE 4ELKB 4X6CA 4AGNA 2BXZA 1NAMA 3S3DB 2LU5A 3IMUA 4PJ7E 1I9RL 4OSUL 4DKFH 2XQYA 1U3HD 4BCYA 4FX5A 1MVFA 5DJCB 4FNLH 4FYRA 4E42A 2IBGA 3GO1H 3O9WD 4RAUB 2BVYA 3KGSA 3ZE0F 5IVZA 1HNYA 4HKZB 3AG3B 3PV6B 3VX0A 2FQEA 2AKRB 3WFCL 1N73C 1BJ1H 4HPOH 3UTZB 5SWZD 1P5UC 4PJBA 1YO4A 1AQKL 1PFIA 5TDOA 4AG4H 2M3BA 2BW4A 2F74B 3OAUH 5E5RB 4DK6A 1WS8A 1QVFO 4F93B 5B3JF 5ISZA 4MD4A 4MJIB 3RGVA 4OCXH 2DEWX 3ZZQA 1OGAE 3OR6B 4NZ8A 3IEAA 1OHZA 2JIXB 1PPJD 2WCPA 4MQ7A 1FGVL 3PP3K 4KRNA 5ALCL 3VQ1C 4LLQA 4NQED 1FSKC 3H3BC 2HP4A 5C0GA 3WU1A 1ZPUA 2VLRA 4FFTA 4TLUA 2K9YA 3DXAB 4KFMA 5FA4A 1ZA6A 2VMFA 2K7PA 2QMKA 2X7LA 1SHMA 1N64L 2NY4C 1NTZG 4XT1C 4DJMA 4WWPA 1QBAA 1URZA 1NSNL 2CO1A 4OD2B 1T22B 43C9A 3B8SA 4U1SA 4GJTB 5FYKL 3FSZA 1J1DC 1HHHA 1KQLA 2R44A 3N9GH 1KLGA 5DRXA 1HEHC 4MXVE 2GJZA 1R1CA 1BCCD 4LEOB 5I26A 3WKNA 3R4DA 3TA3C 1CVRA 1MAML 2Z4QB 4DESA 1NBYB 1TJIL 5CF3A 1ZDQA 3T0EC 1TEFA 4FZEH 3OAYK 1QLEL 2C9RA 3L70E 2IC2A 2XNAB 5FGSA 2FBRA 4FP8L 3OXRB 4NQDB 4WK4B 2HKHH 3VFTA 2O6CA 4DEWA 3QBTB 5B1AB 5D2LF 4NPFX 4LLDB 4H7VA 1INDL 1YPZF 4KPHH 3ARGC 4XVSL 2HJFA 5DQ9B 4HMCA 1J0YA 5FK9A 3RVVC 5KANI 2XCMC 5E8PB 5L2KD 1CXEA 3ASOB 3QZPA 4PLNC 3FO2A 2YD9A 2ZUQC 2DRUA 3TT1H 2EVFA 1R5WA 3NXSA 3K74B 3RFZC 4Y1AA 5GTIE 2VR4A 1CD9B 3T0XA 1EXUA 1AY1L 5MEPB 2XN9A 3L5HA 5T3XD 4BK5A 4PGBB 3IN2A 4EUPB 2N1TD 3FTSA 5MERA 3HPLB 4XMTA 5JLZA 3RBSA 1DEBA 4RGMB 1ND0A 5ACZB 3B5NC 4HG4K 1NUGA 2B3RA 1IFDA 4Q6YA 5JHLH 3HRNA 5ACLA 2NY2C 1QQDA 3PRZA 3QH3A 4X8JB 1S5LH 3H4HA 3NFQA 1QX1A 2W60B 4JDEA 3ZKXC 3S4SA 1GOGA 1IC7L 1RQ5A 2WPSA 2MOQA 3MLXH 4AV4A 4Y4FC 1T83C 3IGAB 1WFNA 4F58L 2XT1B 2CIIA 4H0LB 5I71C 2Y1AA 4PJDA 3CVIH 4EI2A 3UTSE 2ZWLT 3RZCA 1UXMA 3NIFB 4LVOC 1ORSA 5TGBA 5T3ZE 4NQQA 4D8PA 5H35B 3O6FD 1D7CA 1J8HB 1L4AC 1QFWL 1RZ8A 2K3RA 3BGFC 4RAVB 4ZMWA 2CDFB 2FYYB 3T4AA 3CC1A 2NY3D 3FTUA 4IKKA 2DMKA 3RWFB 3QIUA 1ZTMA 1LO4H 4GRWF 3NIDE 2A9NL 4XVTH 4FQXA 1FYTD 1YYML 3GS0A 4DAGL 2VR5A 4AK1A 4XP5L 4WUUB 3S96B 3UAJC 1PL5A 2PPCA 1V10A 3LKOB 4LCCB 2DYPA 4JQVA 1KV3A 3S5YA 4GKNB 3T8XB 2Y0DA 2F53B 4NC1C 1IGCL 1BJ8A 1TJHL 5I8CB 4N2LA 5D2NB 4GG6B 5DUBA 5JXAL 4HS8L 1M05B 2PW1A 1JNLH 3SE4C 2AEOA 1WIUA 3F7RA 3HBZA 4UOW1 2W9DH 3ZYOA 1BVZA 2H8PB 4M6NL 4CC0A 1KTLA 4LPWA 4ZUTA 2GJ6A 3RL2B 5KW9H 3QIBA 3KR3H 1C1EH 3VXRD 3F5HA 1UKTA 4QJ3B 1LK3L 3IXTA 3SPCA 3VH8A 5CCGC 1I85A 3V6ZA 2P8MA 2NZ9D 2Q86A 4NS0A 1UYWH 4I13B 1CDBA 3L74G 2YUVA 2XY2A 3SGEH 3KVQA 1TYJA 4DN3L 3TT3H 2Q6QA 3UZVB 3RIFK 1ZR4A 3KLDA 1ZT1B 2CHNA 1K6QH 3WN5A 1A3LL 2A45I 2ZF8A 4FQ1H 4MJ4A 2AEPH 3RWGA 5F1KC 3REWA 3OPZH 4DO6A 1NKNA 2YIUC 3TZVC 3CC4P 3NH7H 5G4NA 4ETQB 3QG6B 2H43A 5TD4A 1F4XH 1MFEL 1S9XB 3P3UA 5TISH 4I87A 4PREB 3ZE2F 4JO1H 1N2DC 3L72D 1ZANL 4KBPA 3GW6A 1AXIB 1D6VH 4ZT1A 1E30A 1FF5A 4F2MA 4JRYB 4G83A 1NCGA 2EDQA 2WBXA 4P23D 4N8VG 3KLHD 1MCFA 1F6AA 2W91A 5SX5K 3MJWA 4YR6B 4Z8FL 3G6AA 5DK0B 1U2HA 2VR3A 1HHIB 4FG2A 3CWBE 4UQ3A 4M48L 1OSPL 5JMRA 4J6RL 1N7SB 5E2WL 4F9PA 3WLBB 4V2BA 4G7YL 2RJMA 4UQAA 1NFIA 3R8QA 1DZ0A 4DZBB 3VXMA 3ORJA 4PJ5B 2VDRH 3H3PH 4XO5A 2VDOH 1WCBA 3HS0A 3TO2B 3ARDA 2WO3B 2AGJL 3RPBA 4ATWA 1Z56A 4HC1A 5CBEB 3DO3A 2AEMA 1OIOA 4NNPL 4KXAA 4GLRH 5E56A 3POHA 1BVLA 2ZCHL 4MCYB 3VXTB 4R8WH 1PEZA 1LP9F 4XO3A 1Q9KB 2VUOA 4DW2H 1H15B 3VTPC 4LLMB 2JH2A 4PRPE 4XZUB 3IDJB 2OI9C 1U8MB 1OK0A 3E8UL 4Y1SA 2H88C 5E6IA 3ASNB 2CAKA 3LV3B 2HX8A 2E7CA 3GRWA 4OM1L 3IPBA 1MF2H 3SKMB 4R97C 1PJWA 3H1KE 4IFMA 3BSHA 1LP1B 1D9KA 4PJ6A 4UQEA 3L70J 1D7BA 1LT9A 3QAZB 4JY6B 2ZYSA 3LW5J 5L8RJ 5IGXH 3MLRL 5PCYA 1X79B 1MV8A 3BPCA 3JVGC 1THAA 4W9EC 5EIIA 3V2PA 3HRZA 3UJTH 1NGPL 1JPTL 5BU5A 1N70A 2FT6A 2IAAC 2XKNA 4HDIA 5HGBB 3L4FA 4MVBD 5C9JB 4M7JH 3AWGA 1BMZA 3ZT5A 3FCTA 1DUZA 1A14L 1DL7H 1BVKB 1LO2L 2F54E 2IANA 2MQGA 2WXGA 2XV3A 3L9EA 4LRIC 4YHPA 1QBLL 3EYSH 4JUTA 5F21B 1KCKA 1OTTC 4K2UL 1E28B 5H94A 1I1YB 4Q9QL 1S46A 1UM6H 5AZ2L 2FYZA 4EN3A 4PWKA 1KILE 2ENPA 5IVXA 3VTAA 1BQHG 2ZXWB 3ZIYA 4JRWA 4ZQKB 2GSMB 3TK1A 5CEZD 3G9VA 4IQHA 1XEDA 2OW6A 4OCRH 2WXNA 1WPCA 4ZTOH 3DROB 1KV7A 1FCGA 2F2HA 2CGRH 2WLJA 1RPQA 5L2JB 1Q9OB 2IQ9L 3FQRA 3SKJL 3GKZA 2DEXX 5EORL 4C46A 4KO9A 1A6WH 1JGLL 1HL8A 2BCMA 1GHFL 5ICUA 3UX9B 5I8KH 1E6JH 2F8VA 2Z8SA 4FMKA 3N91A 4RFNB 5B4MD 1JD7A 5GRYA 1G2CA 4R83A 2AMUA 2YA2A 3PG2A 1P5VB 4HMEA 3QFJA 4L0PB 3BE1L 1RUKL 3ZE1B 4PR5A 1XCXA 5MENA 3QZWB 1CLYL 3WNPA 1JHKH 4Y7MA 4Z7NF 3IMTA 1T5KA 3VRIA 2E7BA 2AJ3B 3HMXL 5F9OL 3ZDWA 4HSCX 35C8H 4NENB 4FQCL 5B3SB 4H25A 2Q3XA 1GAFL 3VFPB 3C60D 4H2AA 4YSAA 1KJVA 1GL2D 1MY5A 1ZLWK 3MV8E 2JB5L 3O3DB 4A6YB 3A4DA 2GYSA 4MNQB 1UB6B 4I0PC 2W8CA 1G7JA 3L1OL 5GGVH 2YAHA 1MWAL 3D8MA 5EU5B 5E8DH 4A2FA 5DURD 2ZYIA 3EFFB 5IT2H 3CMAP 4UI2A 1ZHLA 3VXUB 3AEFC 4MZIA 4YSQA 5GS1A 4X8CA 1CL7I 3FQXA 1PSKL 2OS7A 3HE4B 5D9SB 4K5PA 1ZS8A 2H26B 5IMLB 3NK4A 4N6RA 2P24A 3A67L 1IBYA 4OJCA 5DJZB 1DQJB 4BWNA 1JWSB 2EIKB 2OMUB 3BVNA 4NCC2 4RESB 4FXKB 2OXGA 3BQUA 4GOEA 4LPTA 1NTDA 1NCBL 4LCUB 1IE5A 2IMMA 3QH9A 3C6SA 2VXSH 2VDKL 3FF7A 4ZDHA 3MD0A 1VB9A 3F83A 1EMTL 3D18B 1U8PB 1MVUB 1Z32X 2X6UA 1L0NG 1FO0H 3QO1A 1XWVA 4HH2A 1T7YA 4K8RL 5APXA 1IAII 3RDTD 3DJZA 3QS3A 5DJ0A 5DHYA 3GXUB 3V4VA 1H5BC 3PWVB 4MA8H 2DQHH 2CIKA 4PJ8C 2VKXA 4WWKD 5K9OA 7TAAA 1NHLA 3Q5RA 2PO6D 3UYOD 1MCNA 4KZEL 6FABH 4CJ0A 3A21A 2PETA 2GBAA 2W27A 3GSVB 3GSUB 2JQAA 3ML8A 5C0IB 4H8WH 4FRWA 4RQQB 4GRLB 3VACA 1SJHB 1M7IB 3QYMA 4DPCX 1KB3A 3P0VL 3T6ZA 1FOSF 3D0VB 3STZA 3VXSE 4OI7A 2ZCKH 3CMGA 4L1SA 1ASQA 3BDYH 3Q6FA 3L71G 2M83A 4Z7OE 3O3EA 1BFTA 1G7IA 4MJID 1A3RL 1UD3A 2X6CA 4MLIA 2EECA 4RJTA 2Q2EB 3G6DL 4HJJL 2VL5A 3GHGA 2FX7L 2QJYC 2ZXBA 3RJDA 2CRZA 2VLJB 2JIXD 3DETC 3LY6A 4LPVA 4BHUA 2LU7A 1QSFA 2GTWB 2Y3AA 1A6UH 5HHOA 4F8OA 4YX2L 4GKGA 2VJ8A 4HQQL 1MDTA 4X4XA 4ES9A 4H8HA 1XD1A 3HUJB 1C16B 3CWBJ 2A9ML 3H54A 2R3SA 1PLGL 1I1FA 4HU2A 3LRLA 5MP6H 4O58L 1E8WA 2D9CA 3DXAD 3ZDYE 4PV9B 3DOIA 4HT1L 3MRQA 1Z5YD 4YHMH 5DYFA 2HCZX 5H4ZA 3WFBH 2RCSH 5ID0A 1YEJH 1FFPA 3PAUA 1ZLVK 1V7MH 4N26A 2GEEA 2CU9A 4PJGE 4M1DL 2VZUA 3BPLB 5FX3A 1GJUA 2OJEA 1RERA 4ZOCA 1LTXA 2BEQD 1KXHA 2NUPB 4FTVE 3VRLE 5J6SA 4DETA 43CAA 3ARZA 3L95A 2ESVA 2BM3A 1JGDB 2Q3EA 1E42A 1JDAA 1E2VA 1HZHH 3IMVA 5KVGL 4W4OC 5J1SC 1W0WB 3L4VA 4HFWA 1IE4A 2YMXL 2V2XA 3BGAA 4MMZA 4DT0A 5GJSH 1YMHA 1NIFA 4YGVA 3VX1A 1FP5A 4Z95L 1OK8A 1E4XL 4KNUA 3BZEA 4LB8A 4LCVA 1SVZA 1WTGT 5L88L 5BUGA 3FB8B 3QXUA 4S2SA 4OGAC 3SIKA 5LG1A 1TCRA 5F6IB 1QX8A 3LKQA 3QNYA 4FERA 4G43A 2MCMA 3BFOA 1TETH 3LZFL 3QWRD 4JFQA 4M62L 4P2OD 5FYLD 5LHDA 1M3IA 5I73B 1PG7L 1RZ7L 4NBXB 1XB8A 1MI5E 2J2ZA 1Q90A 2PCFA 2I24N 2NY7L 3PY9A 2Q87A 5C07D 4ODSH 2PRRA 5BV7L 2POHA 1DJXA 4N2GA 2WQVA 4O02H 3MBXL 4Q6IA 3BN9D 2DQCL 4YNYB 2JMRA 5KVFL 3D50A 2WLHA 3GUFA 1L9OA 3RY4A 5DUPH 4YHZH 4UZUA 1E6OL 1QBML 1WZLA 3NFSL 1D5ZA 2B7DT 5GPRA 4A55A 4G1MA 4ZZFA 2VITB 2XU9A 2PTVA 3PYCA 1X7QA 2Z8WC 1NVOA 3HE5A 4G7VH 2NY6B 4XBEL 3OSKA 4HF5L 3TGUD 4OCYH 5AVUB 4Y4KA 5CZVH 3BUYB 4JJ5A 2DQUL 2XC8A 3N7NA 4XNBA 5BRPA 1KQGB 5BMFH 3KPPB 3O4LB 2P26A 1SQQK 4X9GA 3OB0K 1N2RB 3T77B 4H0LD 1F00I 2W07A 5CJXC 3NFPA 3BP6A 4U1LB 1AR1B 1JWUB 1W72L 4RIRB 1U3JA 3S37L 5JW3H 5MI0C 2FGWH 4BSVB 4I77H 4LGPB 4NC2B 3QORD 2JWAA 1J8HD 1QSEA 1OHQA 1Y6NR 1AYRA 5D1XE 3T8MA 5I6XB 1V3JA 2BHYA 4Y5XA 3TCXA 4G1EA 1SQQE 5D1QA 4JFYB 3GG2A 5CIPH 1SYSA 1T5WB 2GAZA 2FY8A 3T1FB 4CJ1A 3OKEB 4DEPB 1AXSA 1JY2P 3DPDA 1BYOA 1FFQA 2CXGA 4UMGA 5IROA 4KK8C 4GKZA 4CMMB 3S34H 3SYQA 5JHDD 5M7QA 3V6BR 5F3BB 1FGNH 1WBYB 4M29A 4XWGL 5HVHC 4WUUD 4GBXA 4G6KL 4QRFA 1AACA 4AITA 1QW9A 4KKQA 3L4YA 4WTZA 2QEXP 3AE4C 2DI8A 1ZSDB 1PPJG 5J7CC 2X88A 5E95B 1D5MA 2BVOA 5IV2A 2XXGA 5IMKA 3WIHA 1OZHA 1EZVX 1OARL 5E6SB 3QEGL 4GXUN 1WFOA 3S36X 1HTYA 1DQDL 2Z31A 4Z9KB 4NSKB 2R32A 1VQMP 4Z5RA 3IDIB 4XTRD 2KXPB 4QRPB 2OYIA 3SDCC 1G84A 3HE6B 1A22B 1T7ZA 4G8EB 3VGGA 3VI4B 1IFHL 2DWEB 3J27A 4NO2A 3VM7A 3BUIA 5CP7B 5BVPL 4HIEA 2CHXA 3NEXA 3AY4A 3QQ9D 4UNUA 2FX9H 2F58L 4APQB 5IBUB 1OMIA 5E00A 1FFOB 4AMKL 3ULUL 1OF2B 1MJ8H 5AVQB 4QTIL 1SXSA 1M1JA 5F70A 3U4EA 3WNOA 1D5BA 4K7PX 2F54A 2ICWA 4JFDE 3MROB 3HTLX 5HYJA 1JMXA 5DJXB 4NRYB 3E6HA 2E74B 2VSKB 1JOIA 2WLLB 2EJ1A 2FB4L 4POZD 4TNVF 4ATTA 5DJ6A 5C8JB 3KYKL 3NCXA 1XAUA 4LDEB 3GSXA 4FNQA 4Z7UB 3QDMB 1QPXA 2ENQA 2J6EL 3L3JB 3I56P 5AKTA 5F1NA 2CLRB 4UQ2A 3JXAA 1AHWB 2B1HH 3OJ2C 3AM8C 4V1DE 1AMXA 4X80L 5F1IB 5HI3C 3VXQB 1GTNA 1Q81Q 3OGCA 3TCTA 2BNQA 2G30A 4WW2B 1L9MA 4DZ8B 3NPSB 4NKMA 4C7NB 2WN2A 3NIGF 4J3OC 2WLMA 4B96A 5GISL 2NYZA 4AM0B 3MZTA 4CU6A 5AEAA 4MA7L 3C2AL 1WSST 1N7SD 1XL4A 4KI5E 5JIQA 8FABB 3BLKA 2H41A 1IAOB 4ORGA 3HRPA 4XBPA 4UANA 3KPMB 4QRQA 1MZ9A 4KMTH 4PJ5D 3VMNA 1TTFA 2XWXA 3F6IA 4PD4I 4AWJC 5B1KA 3SDAA 1MW3A 4JM2C 2CSPA 5KYYB 1GW4A 1IGJA 1KT2A 4ISVB 3WMPA 2V3EA 1AQDA 3QDJA 2FFDA 3LN9A 4EE2A 3UC2A 4GI8A 4GW1A 4K8RC 2E75C 2IBZY 4FNTA 4L3EA 3G6JE 4ALAC 2CJUH 1DBAH 3KAAA 1IJ9A 3O41A 5EOCJ 4HK3J 4R9HA 4LESA 1KJMA 5AFAA 1FQ9C 3GI8H 4NN6C 2VDPH 1MRFL 2K0RA 3ULSA 1LWHA 3MBEC 4IOIH 2A0LD 3IKCB 5E4EB 3SCMD 5HI5C 1HK6A 1JVKA 1KGXA 3AABA 4FULA 4QT5B 5C0EB 4XN4A 2VM9A 3F01A 5DJ2B 3G5YA 1CUOA 3LX9A 4IW4C 4OZGB 4FKHA 4H26A 4JAMA 5CJOH 1EDKA 2ZYAA 1R5VA 3QISA 4S1QL 3H55A 3CCQP 1LEKA 3U2JA 2A9CA 5E6UB 4L4TD 2Y6SD 4XAWH 4ES8A 3P8CD 2JKNA 4KY1L 4ZW5A 3RNKB 4L8CA 4HWZB 1COBA 3FHEA 5CNHA 1QABA 4DGYL 1JZEA 4IBYA 2BSTA 1V7NH 3EYUH 3K6NA 3U83A 5I9QC 3NGBB 4ZZKA 3NAAL 5EZIL 4TQ8A 2X4OA 3FU8A 4GAAA 5DUML 1AFVH 3BVUA 4QHKJ 1YNTA 1T5XA 2G2NA 4FQJL 4Z18A 3LB6C 1PNCA 3EDJA 4PLJD 2B2XH 3WHE1 3QUML 1TVBB 1KIRB 1HINL 4HS6A 5HVWA 4W6XB 1G1YA 1F90L 1LD9B 3CDYA 1NCUA 2AFNA 3H9SA 3MJ7A 4TVPL 4PJFE 4GW5B 4H20H 5DA4A 3SJVD 1TUPA 1QATA 3MUY1 4PIRF 1AP2B 1FVDA 3QWOB 4PY8J 3CCRP 3V8CA 4FYSA 4LHUD 1L7TL 5CUSH 4N6JA 4GMSL 3KEHA 1RZFL 2JKIS 5BS0D 3CK0H 3H7BB 1CE6B 2OMNA 3KE0A 1BE3G 3PGDA 2GCYA 2P1YA 1A47A 5HGAA 5IOPA 3M1BB 1L7IL 1NDTA 15C8L 4XXWA 3NOIA 3MRDA 3BX7C 2UX6A 3FU6A 2HUEA 3NG5A 3P4OB 4KAQL 1R3LB 3CDFA 1SQ2N 4G8AC 4WEBL 1N8ZA 3T0EE 5F8QC 1S9YA 3AAZA 4F8NA 2J88L 1CMOA 1SQQJ 4DZOA 3FZUD 1KYAA 1BP3B 1PKOA 1YEGL 3BVXA 5E2VH 1AD9B 4CGTA 3CZUB 1XVSA 4EDFA 4OLXL 3TO4C 4Z78A 4MNQD 1HEZB 4UIMA 1AIFB 3L72G 4KO6A 4GRMB 3FFDB 5KSUB 1YJ9P 3O11A 4HISA 3FXDA 5IB4B 1QEXA 4PPTA 3SDDC 3CN4A 2G9HB 1LTJC 2P5WA 4KJQC 1A7NL 4BH7B 1LE5A 4AZ8B 2AI0H 4XGZB 5DMKA 1VPCA 1ZXGA 1U91A 3LRKA 4BA0A 2WITA 3C5ZC 2RTTA 2CK3H 4P57B 4IFFA 2VERA 3BZDA 4IKNA 4HKZH 4IIQB 4WGVB 5AZUA 1PX8A 4AGOA 5BV7C 1I53A 4TRPH 4C4KT 5B38A 4BKLB 2A38A 4N0YH 4D0CA 4HPYL 5J9PA 1UZ6E 4NDMB 5D7IE 2XFXA 4WKZB 3D34A 4RSVA 5AAMA 4KDWA 1W16A 1IVTA 2FZ3B 2JJLA 3C09C 1NTZE 3CXDH 4W81A 5DC0A 2IFMA 1DVFD 5ESAB 1LDPH 2UV3A 2UZIL 2EH8L 3GMMA 4HFUL 4NIYE 4JRFA 3RK3E 4W7YA 3DBXB 1OM3H 2GIMA 2HH0L 4JGUA 2HMID 5IEKB 3UTQA 5L4IA 4QGTA 5DT1L 3H2WA 3Q3GA 4PW3A 1VDFA 1BGXL 2Z92B 4P3CL 4M02A 3W11D 2BY3A 1TMCB 5FLVA 4LSTH 2CCWA 3TBBA 1YEFL 1UHVA 5I8OH 5CLXA 4AT6A 3NCBB 4HKBA 1K5NB 4YGAB 3QDGA 3M0DA 4X99A 1IFPA 2AV7A 5CN2A 2AJZA 1I7ZB 3G04B 4GQRA 1OP5K 3BAEL 1CICB 3QQDA 2C34A 3V4UH 2I69A 1YY8B 5DEGB 1FJ1A 2QTVA 1M71B 3SPVB 3ILPB 1OP3H 2BCKA 4YWGH 5EEUA 3WJMA 2QSVA 3HNVH 1XR9B 2I25N 3S8FB 1PP9D 3ULVF 2H2SC 5DJUB 3IDGB 1MFMA 4L29B 1K8IB 4IRJB 2R0LL 3DDFA 4KROC 4JFPA 4LIQL 4ENZA 1K4DB 4GKLA 1J8RA 1FN4A 2XOTA 3KHQA 3MV9D 3OKOB 3QUYC 4AEHL 3GMRA 1IILE 4N78D 2VLJD 2E76C 1QRNB 5A2CA 2FWLB 4C4UA 5IY5B 3UTTA 5F97E 4MWFB 4YBLC 1OANA 3DUUB 4OU3A 3SBPA 1CLOL 1UOVA 1XCWA 2GQHA 4NC1E 3W57A 1XHHA 3RL0C 1YUKB 1W9XA 3N1MC 5EU4A 5G5DB 4ZRGA 5IW1A 1AOHA 1Z9PA 4IKLA 1XAKA 5LCVL 3ZL2A 1DUYA 4XC1L 4HX1A 4IRSA 4Z0BH 3VFOB 1UUSA 1DQLH 1OAUL 1WT5A 2E8YA 2KI6A 3APMA 2D3JA 4B9FA 5CILH 4EUPH 1QWNA 1JYWA 1R75A 1SEQH 1I7RB 3Q05A 4E9XA 3MA9L 2R4SL 3I6KA 4BFNA 4PJ9C 3U9WA 1E3FA 4Y5YA 5KYWB 3ULUC 1S9WB 4XP4L 1VGEH 4RISL 2J21A 4LSVL 5CCGE 2YO2A 2DW3A 4LFHD 4JRXE 3V0DA 4NAMA 3GLZA 1PZUB 1DBMH 2OTUA 1H0DA 3LS4H 1EFXD 1HWWA 3P3YA 4Z7QB 1KZUB 1JNHA 3CUPA 3KPNB 4ELMB 1KPUA 2X4RA 3B2VL 3JBG7 3VFMA 5DR5L 1UWXK 3EOTH 1NAKH 3OZ9H 4FXGA 4OCSH 2ED9A 3KLAB 2V17H 3LH9A 4XP6H 1NU1G 5B1BB 2BDNH 2CO7B 5IREA 2WXJA 3QI9A 4XNMA 1NM4A 1AAJA 5JO5B 4ANKA 2K7QA 1A7RL 5C0GB 4IHOA 4XVUC 4F37F 1OAYH 1X8YA 3CX5H 3PWJB 2W38A 3KNBA 3KYOB 2EYSB 2KNCB 2EVHA 2BOLA 3EOBA 4MAZA 2DJUA 3L7EA 3OKNA 2DBLH 3PL6D 2YBRA 2QA4P 4KHXL 4BUHA 1DIPA 4PGDB 3H32B 5E9DD 3T65B 3Q3DA 2Y24A 3SPIA 1E5WA 2IAMB 1KFMA 2ZFCA 4J1UB 1P84K 1T66D 3UL4A 1X5XA 1RIVL 2E86A 3N85H 4JN2A 2ADFH 5E2UL 4IBUA 3WJLA 3ZQ9A 5AB0A 1SDYA 1TU3F 5ITBH 2HLFD 1YVLA 1OW0A 3LEYL 2WIIB 1S7RB 1LWJA 5EU6E 1RJYA 4W9GC 1P84E 2RA1A 1C5DB 1QGKB 1BDCA 4NZTH 2Q7CA 5DD5L 1INQB 5KVDL 3DUSB 1YMMD 2NY6D 4KK9C 4ZMVA 5GS0D 1RUPH 5IB5B 1M4KA 2PP8A 4MYPA 4EXPX 4F15B 2UZPA 1TENA 3L74E 4JYCA 3CDGB 2N0KA 1KGYE 3JWOH 2PXYB 3O4LD 2V2WB 1U8QA 4X98A 3WEXB 1G7MB 3FRUB 3L9RA 2A77L 1GRWA 1FZCC 3VGFA 4HIQA 2LU4A 1CE1L 4FEMA 1JZ3A 5C0BE 5E8EB 4UT9A 1YN6B 3QEUB 4HP5A 1XFPA 4TSCH 2KDYA 4JKPH 5CCJA 3VGEA 2NLJA 2DQGL 5D1ZI 4K5NA 3LPFA 3TF5A 3U4BL 2YK1H 1ZIBA 1T3UA 3DX1A 3ZTDC 3OJAB 2XPGB 3VVVA 3HD7B 3W9EB 1OPOA 1KXTA 1XIWC 2YEZB 3KPSD 1A7BA 5KLVG 2X6AA 4A2MA 3TBSB 3Q2VA 2KDGA 2WSKA 3RVWD 1JGVH 3LNDA 4HS3A 4JE4B 3OW2O 4RBPH 5D7LE 3NFNA 1QR1B 1YN7B 3ZDXE 3QUZA 3N40P 4K71C 3C9IA 3EYQC 2CRYA 2O61B 3FB7B 2APWA 1HXKA 2RACA 1LTAC 5ETUA 3WDHA 3POCA 1OWRM 5IFAL 4J23A 3RUGE 3B3IB 1CIUA 1X5FA 2C9UA 3KVPA 5I1AB 4X7TB 3TV3L 4MMXB 2DLFL 3BKJL 2NUTA 3QQ3A 4DVRL 4PGCA 1NTZJ 3SQRA 5L4JA 4XC3L 2E5YA 3V4VH 3VWJB 2LAGB 4QCIA 3WY1A 1PBYA 3LQMA 2R2BB 5IHZB 3UEQA 2DQEL 3ENEA 4JM4L 2R7EA 4MJHA 3MRRB 3HE7C 3GHEH 4APQD 1ZN5A 1MHEB 2DM2A 2H1XA 2DIJA 4UBDD 1QD0A 1N73A 1ULVA 2AQPA 1JPFA 3I3DA 4GSUA 5FYKE 2MPAL 5J12C 1P5UA 4Q89A 4G80A 1S9VB 3WELA 1UH3A 3SE8H 4BK4A 3KPQA 3NJMA 4PB0H 3N40F 1S4XA 4XNQB 1NAMB 2XBTA 3WE6A 3ZQXA 5FGBC 2WZPD 3DX7A 4NQVA 1V55B 4XN8A 2ICCA 1FZBA 4YFLF 5H37G 3E8VA 3QDMD 2HFGH 3SQOL 5IVZB 4W1TA 3MACL 4MJ6B 5ERWA 5I1EH 2B0SL 2AJVH 3NA4A 3EGDA 1AZCA 3IDMB 4PJFA 5EV7A 1TVDA 1I4FB 4P5MA 4ZMLA 2X1XR 4TNGA 3QIWC 4EZKA 4WHYG 1WQVT 5CLYA 1UD4A 2R8SH 4Z7WB 3HNTL 4Q58C 1QUNB 4Y2NA 1TZHA 2XG4A 4P04A 5L7XH 1TR7A 3CX2A 4P2RD 2NXYC 1RHZB 1CD1A 1PAZA 5EU3B 4LNRB 1KLFB 1A6ZA 2AXCA 4L8SC 4HSQA 5IM7A 1BZEA 1KBPA 1EO8H 5D5MA 4WCYL 4ZO8A 1P7HL 1N3NB 2ZXXA 1PFOA 5FA4B 1IGIL 4Y8AA 4B6ZA 1LJ2A 1Z0NA 4POYA 1N6QL 2OL3L 4IRZH 3DTXB 2WAQA 4X0NA 4HWEL 2X53A 1S7UB 1LWUB 3UAFA 4S10A 2XWJA 3NCYP 3G5VA 2OULB 4JZNB 1KB5A 1SJMA 1WFIA 3ARGA 3ARFD 2AV1B 2WLIA 5TE6H 5K9JL 5DJ8B 2HJLA 1EERB 1U2YA 2GUOA 1A7PH 3QEHA 4JHUA 1UJ3B 2NPLX 4D94A 3OA7A 4LBEB 2H47C 5LWYL 5DO8A 2YGOA 1KLUA 1L6PA 1FFNA 3GIVA 1OE3A 4XPFL 3FHAA 4M5ZL 4U6YA 5I0VA 3MJ9H 4K7PH 2KZWA 5ICXA 5D7EA 2WBJC 3EO1A 1UH2A 2QVAA 1Y0LA 4BH8A 2ADYA 2E4FA 3U59A 3JZ7A 4R7DB 5IK3A 2YUXA 4IJTA 3HG1B 3M17B 1C9SA 3B5NA 3LKPA 5I1IL 3EJJX 4RMBA 1SBBA 1QEWB 4FA8A 5FYJE 3SKNA 4LVNC 3RIAF 1RIUH 2VQ4A 1RUQL 1PIGA 5BXFB 4PH8A 5KJRL 1JXDA 2V2TA 3CCMP 3W2DH 4QJ4B 4R4LA 1D5RA 3FQNA 1EXUB 5A6LA 4ZKPA 1X5JA 1RV6X 5HGHB 5LQBL 1QPKA 4G6FB 1VKXA 2HTKD 4A6YH 2BSRB 4DKDC 2KERA 1NIDA 1J0JA 4Y4FA 1T83A 2VZTA 4OLVL 4QXGH 4DP2X 3B9KB 3WSQL 4HZAA 3BKYH 4WY7L 5TQ2L 3VD7A 4BFIB 4JCWA 1UACL 4C58B 3UJJL 4QRTA 5CINH 1IFNA 1L0NE 1U92A 1T03L 3GZKA 1L4AA 1BSIA 2W65A 3ZUNC 2VSMB 1A21A 1A1MB 4FZ8L 3WXVL 2EIJB 2Y9YA 1P84J 3L4UA 3CC7P 1RXLA 1XF1A 3AU1A 5JDJA 3ZTJH 4HIXH 3L74J 1NCDL 3HA0A 5I17A 3B56A 4KH2A 2R0KL 3U7WL 2QFPA 3WMQA 2ZOKA 4ZUUB 1YYCA 4QRRE 5DDHB 1GCFA 5LBSA 1JNJA 2IGLA 1Q0YL 1MJUH 1P7KA 4FHKA 3UAJA 3NRQA 4WWIA 2IH9A 4JVWA 4OQTA 3JWNG 1VADB 5C08E 5C2BH 4NFBA 4BFGA 5CCHE 4FNLL 4FQIH 3CMOH 4XE0A 1P0SE 4OFQA 2OQJB 3S3BB 3AUWB 3PF2A 3L71E 3ZSTA 3AC0A 4J39A 3JCUH 4W9CC 1G9NH 3SE4A 1AZZC 4HPOL 2W8ZA 5I6OA 4FQXB 5H2BB 4AG4L 3SBRA 1IGML 4X6DB 1EEYA 1DN0B 1IL1B 1R3KB 4MAYB 4XHJD 1W5CE 4ODXA 4YMPA 5KYUB 3H1ID 2VN4A 1G0XA 3DX8A 4OCXL 4ELDA 4WY4C 2AJSL 4PJHB 2GM4A 4WV1B 2DYPB 3FQYA 3LH2H 2ID5A 4N0CD 5F96H 1IT9H 3CCHA 5IIEA 1EVTC 4RMUA 5CBOA 2NY0B 4Y89A 1CFTA 4M8UA 2HVBA 3NSXA 2EXTA 2GC7C 3ASWA 2Y1VA 3HB3C 3LKNB 1W0VA 2N01B 4YSRA 4KUZH 2VAAA 3CGTA 3R0NA 3Q8BA 3L3KB 4JFSA 2NNRA 4M6OH 3ROLB 3W9DA 2WHVA 4F33B 3CFUA 2X4QA 4PBXA 3LCYA 3QIBB 4KZDH 4GG8A 4WFFE 3L6FA 3C9NB 3TZVA 2FX8H 2PTTB 5LGHL 5FKPB 2J58A 2Z1KA 2PP6A 3JWNC 4GO9A 4Y5VB 1PD6A 5T33H 4NRZA 5CN3A 3N9GL 2XNDH 1WBZA 3UROR 3DRTA 3NJNA 2A4ZA 2PW2B 3LEVL 3GUTB 1SFHA 1UB5B 1NC4B 3D39A 1D5XA 1X4YA 4FZEL 4QXTB 3BEVB 5FW8A 5A16A 3QEQB 4JHVA 1QI5A 4ESKA 3U7YH 3HZKB 1I7UA 4P46B 4CADA 4LLWB 2X70A 3I84A 1EAPB 3TFBA 4R4FH 3RBXA 2NQDA 4AW4A 1MIEH 4LMQE 4AX3A 3O8ZA 5AB1A 4OV5A 4WFHD 4D0BA 1JCDA 4FI8A 1JSYA 4KPHL 4MCZA 4POUB 1GDTA 4KDVA 4F7PB 1A4KA 1BFVH 5TPWH 2G3NA 1R5IA 2I7OA 2PYEE 4GO6B 1UM4H 3B6SB 1VFMA 1VZHA 3CSBA 1GZHC 1N8OE 2R2HA 3EW3B 3EYVA 1U8JA 3QULB 4QHMB 5DFAA 4AKPA 1QRND 4OZIB 3TT1L 1TTBA 5CSGA 3PE9A 1ZWIA 1JO5A 1NBQA 2X09A 2MHAB 2YSTA 5F89A 2AQ3A 5DMIL 3AXLA 4OT1H 5F6HJ 1NFIB 1AGFB 4G7QB 3K8MA 4ONOA 4D0DB 3VCLB 1E43A 3OLEA 5JHBA 3IFMA 4RO0A 2R4RH 2CDEA 2AXTH 3TDKA 5JHLL 4HLZG 3VD5A 5MEQA 4FDWA 1M2VA 1XX9C 2UXGA 3DOSA 3WAKA 1NGXB 1IM9A 4LHUG 5JXED 5ENWB 3HI1A 3GMPB 4NZFA 4GT1A 1E7UA 3H4FA 3JVGA 4Z3GA 2PR9A 3TVMC 3MLXL 2DJMA 2CPUA 1D5IH 4X7EC 2DM3A 1HXYA 2YHGA 1G9MH 1KCRH 3MRFB 3D70A 4ZMOA 1SDDB 5TF1H 5CR1A 5SWSD 4QR7A 3NT0A 4N2CA 4X50A 2H1LM 2KIKA 1RZGB 1T21A 1R3JB 32C2A 1EEZA 3ILQD 3MLSH 1ZS2A 5GS0H 2ADJA 1D9KB 3GT6A 4LRIA 4CN4A 1LT9B 3BASA 3HJ0A 1Q1PA 3H6AA 4L37B 1VENA 3MRBB 4NIKB 2PPEA 2WLYA 2LFEA 3O2DH 3ES6B 5DQJA 5T1KA 1LO4L 1RP9A 2UWJE 4QHNA 3KHOA 3LS5H 4XVTL 4L1TA 3KS0J 4L05A 1MCPH 4NQCD 3BWAB 1PPJE 4KRLB 4HDIB 1UWYA 5E1GA 3QGVA 4NQEE 3FCTB 4P48A 2EYTA 5EFIA 4YE0A 1PGRB 2P5ED 4Y28J 3ZOAA 1AGEA 2R39A 4OZHE 5D96B 2DEYX 1DQQB 2B1AL 3IU3A 3SDXF 3PTZA 2R69H 2OJZH 4BSWA 5CSZB 5IVXB 1UT2A 4Y2DD 3AZUA 3MRIA 3BO8B 4JY4A 4PJ7B 4WI7A 4GP5B 2Z6FA 5DJYB 1JNLL 1KIUA 3F04A 2WK2A 4PS8A 4M6MH 3V0VA 4Y2OA 4N2IA 1VFBB 1GIGH 4GUPA 1L0NJ 3U36B 4U4BA 2AEIT 3K2UL 5I74C 4KV5F 5KW9L 2IDCA 3TEZA 2C9AA 2ZCLH 5T1JA 2AK4E 3KR3L 2GSIB 1C1EL 5BOJA 3L75E 2EP6A 4F7TA 5JZ7D 3KZIH 1G1JA 2OP4H 5IQMA 2QPDB 3C6EA 1DQVA 1QNIA 1XSIA 5D72H 3GSNL 1KJ3H 5BNXD 5HYSA 1RJLB 3HZ3A 1OGAB 5KYXB 2V7QH 4KJYA 1F0LA 3B34A 5J3HC 1IJDB 1K6QL 2OMWB 1M7DB 1IAMA 4FG0A 4FQ1L 2AEPL 1RIHL 2R2EB 2FT7A 5L4FA 4N1CA 3NH7L 5HDRA 5KOMC 5DZOA 5D1ZB 5C0FA 4ZFFA 4ZMTA 5B66E 1F4XL 4EDWH 3L71J 2UY7A 1UADC 3E7KA 3G5XA 3BAYA 1TQCC 1WTLA 4JO1L 4ZSOE 3T8VA 2VISB 3PWNA 1PNDA 1D6VL 3L35A 2YQBA 1Q94A 4NP4H 2DW5A 4P8QA 4RRPG 2IPKA 1I7TB 3LHAA 3MV7E 1MHPL 5T3XE 2N1TE 4PEEA 2A45H 3CFBA 1F6LL 1IEBA 4MA1B 4YC2C 2KC0A 3UH8A 4G72B 1OT4A 4H8PA 3WAJA 1LM8V 3VDCA 4A2HA 2YKLH 3D4CA 5EHFA 1B0GB 3O0RL 1WO2A 5LB1A 1H5BA 1BYNA 4JGJA 3LRSB 4LCYA 1CD8A 3B7SA 2OXGB 1KELH 2VDRL 3H3PL 2VDOL 1YEIH 2RQ8A 2ZT9B 4N0FA 5C39A 5GTHH 3HCVB 4XHQA 1MFAH 2X10A 5DK3A 4DN4H 1CDHA 3HG4A 4CPGA 4WEUD 4MMYB 4MHHG 2P7TB 2QQLH 4DK3A 1GYVA 1JCKA 1TNMA 1USEA 1GCYA 4P5RA 5EEYA 4R8WL 1T4WA 3M9HA 1EDLA 5KS9E 4DW2L 3FU9A 3HKZA 3FF8A 4C56A 3WL9A 1E5CA 1VCAA 1UZ8A 2IDBA 1L9QA 5G4MA 2OLDA 4QHKI 3R1GH 5EO0B 4PTUA 3R8BB 2K1AA 3FULA 3IDYC 4KHTH 1A3ZA 1MF2L 1P9MC 1SQVD 2D7NA 3CFMA 3M45A 3I9PA 2PCXA 4W9FC 2QE7H 2IXQA 2VQ1A 3GF8A 5IB2B 4PY8I 5EEZA 1X9LA 5CJ8A 3STZB 1GK6A 2WKLA 2P7JA 1FZKB 4JBZA 3O6LH 3Q6FB 1BEXA 3LEXA 3UEZA 4NQSA 3RGVD 3UJTL 5I75C 2JKRM 3PDDA 4GP4B 4M7JL 5DA0B 2VL5B 5CD3A 3FTVA 4MJ5A 4U6HB 3NJVA 2JFCA 3QUXC 1W0YT 3EYSL 3CCJP 5A2BA 1G7LA 2Y36H 1QO3B 1BFOA 1UM6L 1ZVYA 1DVUA 2UX7A 3UTSB 2VLRD 3BSZH 3QWQB 4CVXA 1I1FB 3LZOA 5AWNL 2HT2D 2DJ4A 2MEJB 1AGBA 1B0WA 2DQ6A 4MXQC 3CSYA 1KFAH 3GFUA 4E36A 4L18A 3NIFF 2OSWA 3WUWA 1F4YL 1UXWB 1YY9C 5KVFE 5SX4H 4ZMQA 1Q7YQ 2WMPB 2EDWA 2NZIA 4JANA 1Q4NX 2FO4A 4W4OA 5KVEH 4OCRL 1XGRB 1JPSH 4LGDE 4XOAA 1BE3E 2MMXA 3DVGB 3ROOA 4OGYH 2CGRL 2CQVA 2H7WA 3EYOA 3MO1A 3NIDB 1EDIA 1A6WL 2PNDA 5I8KL 1E6JL 3VSTA 5HY9A 3LIEA 2D7TH 1ZT4A 3ZYZA 3K4DA 2VSCA 4CDGC 2AK1H 1RK0B 1YQVH 2QELA 3OXSB 3B7UX 3R2PA 1I1AB 1LTBC 1U8NB 3RY6C 2EDBA 1H6FA 1AS6A 1WZ1H 3P73A 4MKTA 2B20A 1UA7A 1HHKB 3HAEG 3RWJA 2MTAA 4FGMA 5CM1A 3BPOC 4ICWA 4R96A 3BP7B 2J8UA 35C8L 3B8EB 3L72E 1OQXA 3FTZA 3OKLA 5FDWB 4GG6F 1IRAY 3GXIA 4ZI8A 5MHSD 2OMYB 3HG1D 4AVKA 4WO4A 2WNGA 1PQZB 3CWGA 2GITA 1DCLA 3BRTB 2VXUH 3MBWA 4WI9A 5BQ7B 2JXMA 4NUPA 3S97C 5GZOC 1T89C 5ALBH 1G1OA 4LVHB 1CS6A 5GGVL 3CIAA 4JFQB 5E8DL 5IT2L 3OF6D 2NTSP 1AD0B 1GSMA 1UT9A 3ERXA 5SV3A 2YWYA 3EBAA 2MCPH 1AZUA 2HUHA 4Z7VA 2WCGA 4IBSA 4ODWB 2IV8A 5J56B 3DO7A 2YFNA 4WFEE 1WP6A 5DGQA 5EZJA 2HPOA 3W0WA 5CJ5A 4MX7B 4NKOA 4Q6IB 1FG2A 1ZDSA 5CJXA 2BVPB 2WQYC 2GTQA 4WI0B 3LIUA 3ZZ1A 4N20A 5TE4L 3MNWB 2HJKA 3T2NH 2GK2A 1JPGA 5E8NB 2HG5A 4PHXA 1X7QB 4ERSH 1CI6A 5K59F 1ZPLA 3P3RA 1JYXA 1TKWA 1BQKA 1CL7H 1FO0L 3N1FC 5F0MB 5SWQB 4ZFOB 3L75J 1OXYA 5A3IC 3ESPA 3F58H 5E1HB 4UIKH 3UPRB 1G4MA 3MLWH 4RNRB 4IBVA 3BP6B 4MA8L 1MW1A 2DQHL 4URTB 1SFCC 4G9DA 3ULUE 3RZCD 1WAAF 3P4LA 4NPEA 3ZL1A 6FABL 1HUCA 4KJWD 2B87A 3EJQA 4LLVB 1OWAA 2YGQA 1MREH 4OLWL 5E6RB 3OKYA 5J5EA 4H8WL 4FABL 1XTCC 2ICEC 1RQVA 2MOGA 2YQGA 1HIML 1JV5B 4E5XB 2EDEA 5FO9A 25C8H 1A6AA 3AT9A 5CJ0A 3R18A 5D93C 3UYRH 2DLIA 1B4LA 4FQXD 2ZCKL 1BBDH 3BDYL 1EZLA 2Q8AH 3HG3A 3S5LB 4MAYD 4Q2ZA 3SDCA 4YSEA 5HYQB 2C1PA 1F97A 4Y16B 3QNZB 1TQBC 2FE0A 3TOPA 4NGHH 3GHBH 1MFZA 1BPVA 2DYPD 4HCRH 1KIPA 4PRPB 3X1BA 1CQKA 2A6KB 4MLSA 2BVOB 1HJ0A 4V11A 4I6MC 1A6UL 2BEZF 4RMWA 4BFBD 1MCCA 5CEYB 2NY0D 1JS4A 3A6OA 5CEZE 3WUTA 3TJHC 3VNZA 2YFOA 4F7EA 1X5MA 3JV6A 4BV1A 1KEMH 4L3AA 1B2YA 3PQYA 2FIKB 2I60H 2YGPA 2NPSA 2YRLA 3HPJA 3NJXA 4K0OA 2QPFA 3BESR 4PWHA 4YHML 3T1WA 2BRRL 2GJ6D 2RCSL 4XXCC 2GSGA 1YEJL 4WK0B 5F7MC 3HMXA 3QIBD 4B3VA 1PAMA 1T6BX 1Z9MA 3MOBH 3P9MA 4HIEB 5HJ3A 2AXGA 3ATDA 5HPMB 3L48A 2BHFA 1NU1K 3BKMH 3NQKA 5IVNA 5E00B 3AM8A 5C97A 1QTYT 2C4FT 1M1JB 3QFDB 5AYUH 4K3GA 1T2QL 1TITA 4GUQA 1N5AB 2NYYD 5TE7H 2YPLA 3E6HB 3HZVB 1NU1E 3ELQA 4NM4H 4U6TA 1Q9LA 1HZHL 3UADA 3V4WA 1T1XA 1KILB 4P46D 1ZP0C 2FJSA 4AXWB 5GJSL 3T08A 3AS2A 4G8GA 1GPOH 4ZS6C 5F7NC 2NX5A 4XNXH 4CNIB 4AQRD 1ETZB 2VDLB 4MNHA 5DTFA 3BH9B 1JY3P 4TTDD 2I9LA 3ARUA 3ME0B 2VLKE 4JM2A 4F5CA 2VXVH 4YDKH 3B4NA 1TETL 4GS7B 4F8PA 2BIMA 3OJDB 4IOFC 1RU9H 2M8XA 4JZOB 3WTXA 1FNLA 2BSSB 2RD0A 3D30A 2I1KA 2EE9A 2Q2LA 4HAFA 1U30A 2OJ1A 3X3FH 1CBJA 2P43B 4O02L 2J5LC 1C7TA 3SSGA 1K85A 4QRQB 3MA7A 4ETYA 3TIDA 2HFFA 3FQWA 1YCSA 5DUPL 2PR4H 4YHZL 2VW6A 2XN2A 4UT7H 1N26A 1LTTC 2KSEA 4Y99C 1T04B 3MBEA 1XCTB 2HYNA 2VLLA 4N8PA 4IK7A 1ZW0A 4XNUH 5IVOA 4QWWD 4FAAB 3MV8B 1AJYA 4ZOEA 1XGTB 4OCYL 1BE3J 3FFCE 4GW1B 5IFJA 1VQ5P 2VERN 1K2DA 3UBXG 4Z3TA 2ITDB 3GMLB 4KKBC 1RF1B 2BY0A 5GIRA 5BMFL 2FLRT 5C0DA 3T4YA 2CK0L 3U0TB 1AH1A 3EOYG 2AJXH 4OVNF 2P47B 2UXFA 5KLVK 3WNLA 2LXCB 2ITFA 4I77L 3O4OC 1CGVA 4KQ3H 5DHVB 2Q5UA 1D9KD 2X4UA 4GMTH 2KZIA 1CG9A 1KTKE 1N12A 5CWSA 4BDVB 1NFDA 4NXSA 2ZAEB 2L3BA 3TBYB 1KJ2B 2DB8A 4P5TC 2CKBH 1TJGH 4NPYA 3RTQB 5KLVE 5FHBL 4UYQA 3L72J 1AQMA 4I5BA 4AEFA 1OAZL 1UC6A 4DF9A 1KTBA 4JHWH 1KYOH 2F1EA 1KXVC 1BQLH 1S7XA 5B7FA 1FGNL 1EJFA 3L16A 3SPJA 3UPAA 5FF6A 3H1IG 2YMOA 4OZFG 5KS9A 2QR0A 2IAND 2K4WA 1KTRL 5KBLA 2C7FA 3V4PB 1TCMA 2DDQH 1G7HA 3KQGA 1BXVA 4NJAL 1T5XB 2HT4D 4WRLA 4YXHH 4JO4L 5ADPL 5IW3A 5AD0A 1CPUA 3RX7A 3E6FA 1U8IA 1NCOA 2RFXB 3APDA 5E5MB 4IKJA 4L8DA 2EDYA 2XV5A 2N9YB 2NCMA 3QUHA 2APTA 1KB9E 1T3FA 1FVDB 1WUZA 2YC1B 3SY6A 2WXRA 2X28A 5SV4A 3V4QA 2G3ZA 3QCVL 5FKAA 5DYOA 3VXSB 1ZGLM 2FX9L 3APCA 4ZXBC 1NPNA 4Z7OB 3V79C 5GRWA 1EDYA 3SE6A 2B4CH 2WQSA 1QUPA 4FFVD 2EC9U 2VUYA 3HLKA 3QFJD 1JI1A 1FL5B 3SDDA 2FRGP 4AKOA 1XQ4A 3HUSB 1LTJA 1M8OB 2F6AA 4X5XB 5KVMC 2XV2A 3K5RA 1UWEL 1CR9H 3DK0A 1M1SA 3IFOA 2BK8A 1HTLC 5FDYA 5DMGC 5CZRA 2IG2L 4QY8A 1KDIA 1XH3A 3C5ZA 4FHBD 2IYPA 1M1KQ 5KYNA 2IWFA 1KXQA 4ZPTA 3BVTA 2EABA 2WLZA 1EUUA 2OMBA 3IK2A 3ZDYB 1BZ7A 3HUJF 4P9HH 5D1ZD 1XSJA 5HHME 1I1CA 1USQA 1ZY9A 2B1HL 5FYLE 3GINA 5EN3A 3C12A 4DHLA 2FWUA 4U3SA 3O11B 4PG9A 2I07B 3ABZA 5GGVY 3IE4A 5KBMA 3ALWA 5C07E 4FMVA 1DANU 1JZ8A 4PJGB 4GH7B 1DVXA 2WLKA 4XN9A 3P1VA 4XO9A 4OGQC 1LJMA 3CQPA 5B38B 2OCJA 3FRPG 4FTVB 3P32A 3B43A 4U1MB 4KMTL 4GQ9H 2XV0A 1FAVA 2ZT9D 4JG0H 1OGTA 1PKQA 1KY7A 2LLNA 4HJUA 3RVTC 5KSBA 3MUDA 1E8YA 1IZNB 1AZRA 3MCKA 1UGNA 1DYZA 1JK9B 1FYHB 1XB3A 4HIHB 5LN8A 1ZRTD 3CCLP 1AXTH 2W83C 2E27H 4PTTA 3CFCH 4FEIA 4NN5B 3FJTA 3UG5A 2NMSA 3PWLA 2J1XA 5BQDA 3QB7C 2WXPA 2LTQC 3BVVA 4PD4H 4QGYA 4BSJA 1MI5B 4ZKUA 1WA1X 2X4TA 1MPAL 2XV6B 3FUEA 3K6SA 3QUYA 3VI3E 3GI8L 3V0GA 2YQ2A 4UAOC 4N25A 1ACCA 4H1LA 3ZW3A 3GJFK 2A99A 2AJZB 1CF1A 4H8WC 5KAQF 1U4FA 1NU1J 3SBWC 2DZEA 3A4FA 1F4AA 2W9LA 1U8KA 1P84I 1L9RA 2XN0A 5DRWA 2BCKB 3ZRCC 5CJOL 1WF5A 2E3VA 3ARXA 2ZYDA 1JTHB 1OVUA 2NXZB 3DURA 3D2UA 4P0DA 2VYRE 2EAEA 4XAWL 1S7WB 4YZFF 2MJWA 4HETA 2AQSA 3GQFA 4Q8BA 4WQOA 5KAIE 4RMVA 4OAWA 4FA6A 3EYUL 3I9GL 3CLEH 2FUQA 3P3TA 4KO5A 1RPUA 4PJ9A 2RIKA 3AB0C 3CLQA 3AADB 1I75A 4HJGA 4LEBA 1VFAB 2Q20A 4OFPA 1AFVL 4I9XA 4P2QA 4TUOB 4J3TA 2B2XL 3CCUP 4PV1B 4LLUA 5D1XB 1ZGLA 1U21A 3EDFA 4O5LL 4BIKA 3E1RA 4ZK8A 4JN1H 4BZ2A 8CGTA 4HX1B 1VQLP 2O5NA 4H20L 4JZJB 2FIRT 4ZAKA 2X9ZA 3BD3A 5HP5A 2WC7A 3TH2T 3HC4L 5CKGA 2J6EA 5CUSL 2A74B 2OMZB 4OZ4A 5KVDE 3O3AB 3TBTA 1GGIH 1MFBH 2XXFA 2XVLA 3QJFB 3ZO0A 2ITCB 2W92A 4YDVA 2J25A 1KACB 1X44A 4BZYA 3GMQB 3FSWA 4GT0A 2OARA 3VP8A 5AL0A 3JWNE 1I1AD 1V3KA 1T8ZA 2A6IB 5IF0B 2PAJA 4LDCA 4XN1A 3VYOA 1M1XA 2VTFA 1U8HA 3L3OC 1I82A 1JUNA 3F00A 4ABUA 3LRGA 3OKMA 2X4RB 1H3VA 3W37A 3BPNC 3MRPA 2BHZA 1WISA 3ISYA 1URQC 2W90A 3K1DA 3F3HA 2CO4A 3JYCA 3LKSA 4BXVA 4DPRA 3BZ4A 4YSUA 2F8XC 2NW3A 3EO0B 4D6TD 5E2VL 1XF5A 3IFLH 5KLVJ 3UTOA 2M5AB 1CIDA 3C6LB 4YHYC 3CXHE 3VG9B 3WEAA 1CW5A 1TO4A 2QVTA 2VDNH 3VI4F 2OTWA 5I1LA 4UU9A 2EO1A 4DQAA 4QKXB 5E94A 2G4EA 2NY3C 3PXHA 1Q90D 4P9ML 4JJOA 3VGHA 2CUIA 4K15A 1MJ7L 4QD2E 3PGCA 5D2LA 3CBJB 4HEMA 2BZ7A 1YPZA 1FL3A 4RX4D 1GGYA 4TRPL 4HIIA 4N0YL 3PJLA 1ZLUH 4K23H 2LKMA 1NCWH 2Y2YA 4JFDB 5EBMB 5LBGA 4A7GF 4UM9B 5TK4A 5I24A 1FZCA 2AITA 2CJTA 2H1PH 3VMZA 1P4LA 4LP8A 4OFIA 2V33A 3D1MC 4KK5C 4XH2A 1LDPL 3ZMNA 3PAVA 2CKNA 3ZMRA 2LABA 1KB9J 4AENA 4Z7UF 3OMNB 1OM3L 4V1DB 1FORH 3SQBB 3JUZA 1WWWX 1GGUA 4TL4A 3THMH 1NMCC 1X7TA 3U1PA 4EVNA 5IFHL 3K4AA 3MRKB 3QQNA 2VLKA 2EIBA 1URLA 1XIWA 4UV7H 2BP0A 2FYNC 4WW2F 4DQOL 4LSTL 5I8OL 3AE9C 2E43A 3MRCA 2O1JA 1GJWA 3OKDA 4K3HA 4X5WA 5F6HI 3PPEA 3TASA 5AW7B 2YXWA 3FT3A 5DS8B 3CWBD 1SQVG 3UJIL 1AO7E 4WEMB 5AYTA 1NEUA 2WBWB 1J8SA 3DMMB 4X4ZA 1E8ZA 5DMYA 3P4NB 3V4UL 1ACYH 1MOEA 4JDZB 2Q7NA 3EH5B 1RZKH 4L4TE 1N6VA 3P8CE 3QUMA 3V52L 1SOSA 1VF5B 3HNVL 4R2GB 3V5HB 2MJZA 5E5LA 2ED7A 1TPXB 4GBXD 1CB4A 4LQFH 2K88A 3VRJB 2X1OA 5CR8A 2IPTH 2ZXAA 3G6JB 1DQKA 3H9HB 4PRPD 1FV1A 2WJ7A 1F41A 3HE7A 3R4RA 3OQRA 1F3DH 4GIFA 1EXJA 4WDIA 3VAEA 4EKXA 5AOJA 3SJVE 1RHHB 3BJ91 4J4PC 4H13C 4TULL 1QFWI 2JB6A 1ZVHA 3ZTCC 3NZ8B 4C59B 2AEWA 1CYGA 4AL8H 3SDYL 5FGBA 5BS0E 1A3QA 2J55A 4M03A 5FO2A 3ZHFA 3KLSA 3H53A 4QCIB 4Z0BL 3QJRB 1DQLL 3MJ6A 4NXKA 1FPTH 1U93B 1BF5A 1ZLSH 5IKCB 2JCCE 5CILL 2R7EB 1BD2A 1SEQL 1LEGA 4OZGF 1IO4C 3IRZA 1ID5I 1N73B 5LGYA 1VGEL 3HC0A 1KGUA 2YPKA 4ZTPH 1HCYA 3QIWA 2WTRB 2F54D 4WAFA 3GLAA 1DBML 3IETB 4NQXB 4DNLA 3LS4L 2ZKHH 4NQVB 3ARSA 4XPTH 3VFVB 4AGMA 1KILD 4ODUA 2DQTL 3TNUB 3EOTL 1NAKL 3ZMEA 4HV8A 2OYLA 2V17L 4XP6L 2QPEB 2BDNL 3HHSA 3EGDB 2FJFA 1FIGH 4L8SA 4NB7A 5JHMA 4JK0D 4PJFB 3WKYA 2BNQD 4FQQB 2H32A 2QGCA 2Z65C 4AQZA 3AE2C 2XG5A 1CN4A 1OAYL 3U1CA 2X2UA 1KOAA 3D52A 4XRCB 1YSOA 2IF7A 2NY4B 2H2PD 5FM5M 1GYUA 2DBLL 3VGDA 4LKXA 3P30H 1R5LA 2CO6B 3FWNA 2BJML 1T4KA 1T0NB 1J1DB 4UILH 2WQ8A 3BXNA 4JFEA 2ZX6A 2P28B 3KYNA 2ADFL 5TJWK 4NNYA 4PJXE 3TA3B 1J1XL 3REVA 3OBAA 2EEDA 2PABA 4JFFA 5ITBL 4PS4H 1RI8A 4NI6A 3T0EB 1YQ2A 2DTSA 2EIZB 3SDAD 2ADGB 4JO2L 2WPRA 2VN5A 2HFEB 2Z93A 3H7LA 3WTWA 3QDJD 5INCB 3CC5A 4NZTL 5E9AA 1IC0A 5AG9A 4E9YA 5EIVA 2WBJA 1RUPL 3S4SG 2L7UA 3MHZA 5CD5C 4YH6A 1P53A 1PY0A 3NCJH 5IG7B 3SY0B 2IFFL 4F1SA 2FXPA 4W6YB 1H19A 1WBXB 2FXOA 4I7ZC 3QEHB 1MCDA 2GC4C 3QXAA 4G3YH 5FUOH 1DEEA 3D09A 5ESVB 1RD6A 3RFZB 1LP9A 3OL2A 4TSCL 4JKPL 4L4VA 2ZX8A 4DP6X 5D7IB 5EC1A 2HVKA 2QADC 3EO1B 1SBSH 5J1AA 4CL7A 2ZWKA 4CGUB 3KBHE 5JA9A 4J3VA 5APTA 3MV9E 1SGKA 3B5NB 1TYRA 1S2EA 2E9JA 3WS6C 4D9LH 3OHXA 3RWDA 3RK3B 4TQPA 5F7DA 3CXHJ 1RLWA 1I1RA 1WMKA 2B59A 1JD9A 1JGVL 3MGAA 4J2QA 1R47A 1URIA 4KKLD 1IGFH 3KPRA 3MRMB 1AKJB 1LK2B 2E7LC 1HFUA 3C60C 3FQNB 4GQQA 3QNFA 3RPKA 1F2QA 1UA6H 3DV6B 1VKXB 3PP3H 1SXNA 4OIAA 1ES0A 2BOBA 4L1BA 1HH9B 3ESNA 5EBWB 3V0AC 1ITCA 1R9FA 4M5YH 2Q0ZX 3H9YA 3H9SD 4F2FA 1T1WB 1CWVA 4LMQI 2WVTA 3V4VL 3QP3A 2WSEH 1HU8A 2X42A 4J3UA 1OVRA 3J7HA 4U2ZA 2H6PB 4QRUB 1KCUH 3KL5A 2GBUA 3VH8G 3DX9A 4HJEA 4KRPC 4OLZH 5C6TH 1S78C 2JKLA 2XY1A 1NANI 2Y07H 2DQJH 4U1IB 1F86A 1N0XH 3DRQA 5TH2B 2NNAA 1VESA 1ZJAA 5B39A 2ZXEB 4CVZA 3CQFA 2EEBA 4K3AA 1TIUA 3NRFA 4AV0A 4PB0L 5TQ0L 1PCSA 3FH7A 3I3EA 1KQSO 2K78A 4X9HA 4WY4A 5EDSA 2CCVA 3OAYH 1ZLLA 1EIBA 2C4XA 4R0LA 2CBMA 3A4EA 2WWOA 2YUZA 1JZ7A 2FJHA 3TPKA 3U82B 5I5RA 5GRVL 2HFGL 3QW9A 1JDDA 2ZUVA 5F2FA 4WI2A 3L3HB 4UF7C 5BZWB 2EKSA 2SEBA 5GTIH 4OM0H 4CN6A 1HQ4B 1TLMA 5E9DE 1WFMA 4U1KA 2P5WD 4ZUWB 4FN0A 1Z7JA 4ZO7A 2R8SL 5AW5B 2Q6WB 3C1LA 4AYFA 1EEQA 2VN3A 3DPBB 1CZQA 4JRXB 1HNFA 4KKNA 4FTVD 4NKDB 1WYJA 1NLBH 2X3CA 2BW5A 4HBQA 4LLYB 1LEIB 3H0TA 2ZSWB 4R4ND 2MCG1 5A6MA 1GK4A 3RL1A 2ZUTA 1EO8L 3DX2A 3BP4A 3ZU8A 2JR8A 1YMME 3KBEA 1SXAA 3STLA 1E50A 3KWVA 4IRZL 5E51A 1IB5A 3R06B 3S36L 3KXFA 3CC2P 3BEWA 4GG8B 1BZ8A 3M9BA 1OTUC 3UDWC 3VYNA 3KPLB 4DO4A 2ITEA 4J3OH 5T3ZH 2ITAA 1QSZA 5JORA 3F7KA 1MUJB 2AXFA 4W9ZA 4HOWA 2CM5A 1IGTB 2V7HA 1UOWA 5HI4D 2R0WH 5BRZE 3D0LB 1BXXA 5DWPA 5TE6L 1HYSC 1MI5D 1W80A 1A7PL 3HI5H 1SJVA 5L9DH 3AUVA 2UZXB 1H8LA 2X4PB 2ZZUT 4OF3A 5DHXB 5E8OB 3FT4A 4ELME 3X17A 2FEDC 4K7PL 3CVCA 1TOXA 4MDIA 3KPSE 1M6OB 2C9QA 2VWEC 5EU6B 3UIAA 2Y4SA 4C57C 5CLWA 3RA7L 5EIIG 2Y23A 4NKIL 3FONA 5MEOA 2EE0A 1BZOA 2X2YA 5ELIA 1RIUL 3VMAA 3S88H 2B88A 4JG9A 3HS0C 2ERJB 4I3GA 4TPRH 5DFVC 4L3CA 3W2DL 1QVGO 1CDIA 4ANUA 2B15A 3PHOA 3UTTD 1VL2A 4Q9RH 5I18H 4A6YL 4LCWA 3TVMA 1CGXA 3VFWB 4QNPF 4TQEH 1MHCA 5J13B 4XMPH 3QQ4B 4QXGL 5C0BB 4OFDA 4PV1D 1G7QA 4L9LC 5D1XD 4Z0XB 4E41E 4K5MA 3FQTA 1SQQD 5LAXB 1U8OB 5TDPA 3VXPA 4HKXA 5CINL 4IRSD 3DV4B 4JY5H 4HK0B 3KLQA 4LPYA 1X4ZA 3TBWB 3WTTA 1KORA 3DOHA 3D85A 1B0RB 3UZEA 4N8VB 1Z5HA 3PJNA 1MAJA 4RGMC 4M5SA 4H44C 2CO3A 3DVNB 4PP2A 5AUMB 4J3BA 2R23B 1UIIA 4JKWA 4P3DB 2OMVA 3OR7A 5D7LB 4UOZA 1LE9B 3ZDXB 1I8MA 4MS8C 4HUXA 1NWOA 1MJUL 3Q7JA 4X8XA 1ASPA 1EEZB 2V7NB 5A43C 2OX5A 3OKKB 4QPEA 1T1ZA 4U0RC 2XXMB 1K3IA 2IBBA 4KDTC 4AYMC 4FQIL 3CMOL 4PRIA 3RUGB 4ZJ9A 1FC1A 4J8RA 3I75B 4P4RA 4YSTA 3AWEA 2V9RA 4H0LC 3F7YB 2DY2A 3NA9H 4TUJA 3VSUA 3QI9D 4OD1H 4YBQD 1G9NL 3I5CA 2YRBA 2HB0A 4FF9A 1CXHA 2VQUA 1PZ5A 2VL4A 1NWQA 2XVKA 3WIHL 4EN3C 1MG3C 3H1LD 3HLAB 2OL3A 4FFZA 2R5BA 4P2RE 2NTFA 2WXIA 5J89A 4Z23A 4PJ0H 1S6NA 2BP8B 4OIFA 4KX8A 3JTSB 5E1IA 1RZIB 4ZFZA 2GEQA 3VD1A 3SYCA 4C4KO 4I48B 5SX5H 3LH2L 1KQFB 2V5SA 3H3KA 3IU3B 1BEYH 5F96L 1JWMA 1IT9L 1OM9A 3H56A 3Q5PA 1JVLA 4JDTL 4IMLA 2JJTC 2CLVB 2X4SB 3BP5A 1WD8A 2IH8A 2COQA 3F65A 3WJJC 4I4WA 1NBZA 1HL9A 3N3EA 2WTPA 3PABA 2Y2WA 5DD6B 4PJAE 1HX0A 4M6OL 2JELL 5AW1B 1QFOA 3IMBA 2WQXA 4R4MA 1PCXA 3CFQA 1NJ9B 2FQFA 3FK3A 1E4XI 3GYRA 4V1DD 5D2NC 4YOKA 1M42A 4KZDL 1IM3A 2V0AA 5FV1L 3JWOC 5ADOL 5JQ6H 5IB3B 4RGNE 4YHIB 3RG1C 5J06A 1F11B 1PD1A 3DX4A 5T33L 3LNFA 5B7EA 5DZLA 4I0PB 3AJ7A 5FM8A 3SB3A 4KJYB 2LVEA 1CLZH 4Z7WF 1BQHB 5C0CA 4PSRA 2BCCG 5EO1A 5D6DC 3RX8A 2OYOA 1QFPA 3T6XA 3A4AA 3DMMD 3WTSA 4LGSB 2OZ4H 3TA4D 3W39A 3KW8A 3U7YL 3F5WA 3WHXA 3CPLA 4QHLB 1L6ZA 3WYRA 5HYEA 4TMPA 3D3VA 4KJPC 4R4FL 1ZHNB 2CDGB 4KXZH 5ACMA 4ZFFB 1NGZA 1JHTB 1VF5D 2UZYA 2HT3D 3EHBB 3B7RL 1CLCA 3LNIA 4R2GD 1SJEB 1Z9OA 1H88A 4UQBA 2IWEA 3OJMB 3LN4A 4HIJA 1FZJA 1ONQA 3NSCA 1SMOA 4YEFA 1BFVL 5TPWL 2OZNA 3AEGC 1ECYA 1UM4L 2JKJA 5DZPA 3BQUC 5EC2B 1UH4A 3RPIA 4KVCH 4QMAA 2QSTA 1HHGA 2ALWA 4JQXA 1E0OB 1NH6A 1J10A 2ZSVB 1ZV9A 2VDLH 5BZDB 1IFIA 3RB5A 4OT1L 2GTZB 4PJ8B 1XL6A 3DSNA 3GWJA 3HFMH 4QTFA 2G5RA 3E38A 3ARTA 2OW7A 4UB8H 1LO3H 1HOCB 1P9MA 4NBYB 2R4RL 4EF3A 4WJKB 1IGYA 4A2DA 3Q2YA 4TTGA 3NZSA 5D6CB 3OMAB 3JV4A 4TS6A 2A06D 1VZIA 2FHFA 3FN9A 1A8JH 2KLRA 3DI3B 3NN8A 1MG2C 4CC4C 5AVTB 4L2YA 1EZVG 3IJEB 4LASL 5AVZB 3QRGH 3G08B 3IBEA 1D5IL 1RKRA 5HJDA 3TYYA 1G9ML 1KCRL 1BW8A 2ZXGA 5TF1L 1AI1H 1CGTA 1ZXKA 3DHMA 3ZR6A 4CW1B 1M56B 3C5SA 3MLSL 1HDMB 4OH8B 1J0HA 4FCAA 1BV8A 3MUGB 1I8LC 2EXYD 3QUXA 5C09E 5DSCA 2VQ1B 4TUKH 1FRGH 3X13B 3GHGC 3FQUA 4BXLA 4D6TG 2UXVA 1NLDH 3E3QC 1S7QB 3G7TA 3O2DL 3TIEA 3J2PA 3H1IE 3U46A 1ZLWH 4CBPA 2Q10A 1S7TB 2GK0B 3BCCD 2KPNA 2CNZA 2XACC 4NO5A 5DHVH 2DLGA 4A2GA 5CEXA 2E5TA 1MCPL 1JIBA 2QSCL 4PG2C 3QAZC 1J1PH 1QFWM 1IQDB 2NY4D 4WI8A 5DZNA 1OAQL 1XMEB 1JGUH 4O2FB 4FG6C 3H1HD 4PJEE 3T6VA 1EXHA 1AA0A 4G8FA 4QRRB 2IGFH 1LTGC 3A22A 3MNVB 2OAAA 4TOYH 4ECNA 1YEEH 2OJZL 2EXSA 2BZDA 3TA3D 4M61B 3L1EA 1C5CH 2H9GA 4XNZB 2WINB 3Q5YA 4RZKA 5EUOE 1U33A 3T0ED 5C08B 3RY6A 4M6ML 1XF4B 3N41B 3FB5B 4JR9L 3U2IA 4A2LA 3FO1A 2HFED 1GIGL 4KO7A 4UINH 3TYFA 5DEFA 4HUVB 4P4KB 2ZCLL 2C9LY 1UENA 1SEBA 2GHZA 2AEFA 4H8QA 1JZ5A 1SVBA 1QOKA 1IIIA 1Y18A 2E4TA 2OP4L 2FSEA 2VJ0A 3VU1A 5D72L 2JJVA 5HY9B 4ZMPA 1KJ3L 4R90H 2VDQB 3MQIA 4MMZC 2EUZA 3CFDA 4X6DF 3RVVD 3JC22 4AQ1B 5I1GH 4FJYA 1H6TA 1OB1A 3EYFB 1T89A 2DQDL 2FWOA 5GZOA 1TNNA 1XTLA 3QHZH 1RFDH 2ZOLB 4PJHF 3N4XA 3JTTB 1R34A 4X7SH 1TTUA 4YPGB 4K7PY 2ZD0A 4NPJA 2NQCA 1A8ZA 4R96B 1F58H 4WFHE 1PX4A 1DJWA 1NTZD 1JMZA 2V6HA 4Y4HA 2NR6C 1F4HA 1FJKA 3K46A 4EZJA 1DLFH 5I6LA 4C83A 4EDWL 3B5ND 1HCZA 3U0PA 3N42B 3K5SA 5F0LB 4QRSB 4FI6A 4NP4L 4QOKA 1HE7A 3O45A 5JHLA 2YOAA 4X7FC 2NY2D 2DYSB 2Y9ZA 1XGUA 4WTZG 3BQVA 2DMHA 1AKJD 5DJDB 4ZMAT 4PLKC 2FYUG 4K3DH 4UYPA 1I8KA 4OB5H 4GKSA 4GNKB 4MBOA 2K9JA 3SZ6A 5FCUH 2YD6A 1PZ2A 1E2WA 1FL6B 5KUMA 4G8IB 1SFCA 2JP3A 1KELL 1LNUB 5MI0B 2FECL 2XWBA 1X4XA 3NSYA 4HJTA 4PJCE 1M57B 5E70A 2Y5EA 1L4AD 1MFAL 4I2XA 4DN4L 5AW8B 2ZOUA 3ETSA 3OVUB 5HXMA 2KZJA 4AQAA 2RALA 2E6JA 2ICEA 3PWPA 4LSUH 5CFHA 1EAJA 1E67A 1PYWA 4RVBA 4YLQT 2D7OA 5SWSE 3MKKA 4FXKC 5EMYA 5D1QC 2K4AA 3PS6A 2FR4A 2CRMA 1X7SA 2PYEB 4RMQA