5AVRB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
b'FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avrB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avrB02
4M3LA 1SP4A 3HE5B 2E42A 3TYYA 3VN0A 3HE4B 3KQGA 4KHXA 2WPRA 5AW2B 5AW9B 2P67A 5AW8B 2R5BA 1MFZA 1T2KC 5APQA 1OWAA 2N9BA 3L37A 3T97A 5AVTB 3KDPB 2H7HA 4JYCA 1T2KD 1H89A 5APVA 1GZLA 3M9BA 3UIAA 1X8YA 1G2CB 3P8MC 3HTKA 2WPQA 3VMXA 4AYCA 1GU5A 1GD2E 4HYTB 5AVXB 3TNUB 3A3YB 2QM8A 2Q5UA 5AVRB 4EOTA 1CSBA 5APSA 3P32A 1GK4A 3IR9A 5APUA 3SWFA 1FOSE 2C9LY 2VRSA 3L36A 2BASA 2QM7A 2R5DA 3NFQA 4C46A 1S9KD 2YO2A 3NXSA 4RETB 2WPSA 2E43A 1HWTC 3V4WA 1A02J 3V5BA 1HBWA 4AQRD 1CI6A 3VTPC 5AVQB 4I6MC 3A5TA 1HUCA 4GT1A 1MUUA 3NTNA 5CMZA 4I2LC 1MV8A 3M0AA 3VMZA 3A7OA 5AW0B 3M9HA 2JJLA 5AVYB 3OAKA 1NWQA 3WGUB 5AW1B 1S9KE 4RESB 1GTWA 1YYCA 3P7KA 1IO4A 5AVWB 1SLQA 1OXZA 3B8EB 4DZOA 2ZXEB 3HE5A 2R3CA 2XZRA 1CI6B 3A2AA 1GK6A 3O8ZA 4C7NA 5APXA 3VMYA 4LC1A 5AVUB 5AW7B 1CZQA 1GU4A 3LIDA 5AVZB 1FOSF 2YNYA 2YO3A 2C9NY 4AUWA 2ZFCA 4B86A 2WTYA 2W27A 3LIEA 5APTA 5AVVB 3VYIA 1DH3A 2WT7A 5AW6B 4JYBA 2XV5A 5APYA 2WWWA 4C7NB 3V4QA 3MGNA 2IPPA 5AW5B 3TNUA 5AW3B 1NAFA 3M06A 2P7JA 2XU6A 2Z5IA 1J2JB 1FAVA 3HE4A 3L35A 3MD0A 2W6AA 1H88A 5APWA 1A02F 2P2UA 2Q3IA 1JUNA 2Z5HA 3WGVB 5AVSB 2WT7B 1KQLA 3M0DA 3M91A 4XE5B 3TK1A 2Q7CA 1HJBA 2KP8A 3I5CA 4GKGA 1H8AA 3NMDA 2R32A 5AW4B 1JNMA
chains in the Genus database with same CATH superfamily
5CJXA 3RG1C 4PW3A 1SP4A 2GB2A 4Z0BL 1F0LA 3FCSB 2XN9B 4IFDK 1HHGA 3ECBA 4JQXC 4PD4E 2CJSA 4N3YB 4MZ3A 3LQAL 4QKTA 3FT2A 1MCEA 5DQDH 2P58A 1U2YA 4NGHH 4LNVA 5GRJH 1SBSL 4PJDE 1XGQA 1VJSA 1WIPA 2KZIA 2X4UB 4EDWH 5IB5B 4P5SA 1VL2A 3R4YA 4KKCD 4NQDA 3Q13A 4XAKE 2NZ9D 3GGWB 1FC1A 2EYTA 2R51A 4UTAH 4FLHA 3CDCA 3LRGA 1DTUA 3SDXE 1IGTB 4WHDA 1GL4B 5I1AA 4QHUB 4L0PB 3I75B 3DRTA 3KG5A 3QRGH 4I4WB 1PZAA 5C2BH 3KPSD 4EI5A 1WBXA 1A6AB 3W9EA 1C5DB 3POCA 4MDIB 3U9PL 3BAJA 2FGWH 1AC0A 1X5ZA 2W9DL 5EBWB 1IKOP 1HKLL 3BZFA 4L37B 4NQVA 2GBTA 4NQEA 5AEAA 4F33A 3JWDC 5IHUL 2QQLH 1L9NA 4TLKA 3QZOA 5F7BA 5F7FA 1OT1A 2Q9IA 3M0AA 1BAFH 3EZ8A 4LSTL 4UQEA 5C08E 4V1DE 1DZBA 4EIZC 2F2HA 2V2XA 3GZKA 3VDAA 2EXWD 1FLTX 1SN5A 2XVLA 4MWFA 4PJBF 3DURB 3QNXB 1INQA 1UM6L 1L4AB 2H47C 3RVVD 1DJWA 1WFJA 4B9CA 4ZMLA 1E9PA 2AK4A 3E6HA 5I66B 4L9LB 5F97E 3JTBA 4NO0A 4TUKL 3G6JE 1M05B 1JMMA 4DOHE 5BOZG 2TSBA 1RZ8B 3NFSH 3U82B 3HMWH 1CL7L 4DT2A 1MFNA 1CR9H 2W90A 1S5IH 5A2AA 2X4QA 5IMLB 1RJYB 5IJVA 1EUTA 1AR2A 1DBAL 1S7RB 3JV4A 1DVFA 1BF5A 4C4KO 4D8PA 4EUPG 5CN1A 5C86A 5AYUH 3LIEA 4TTGA 3VI3B 3FQNB 1ZT1A 1NCGA 2EDEA 3L74J 1KULA 1V05A 1BWMA 5DVPA 3CVBA 4JFZL 5E00B 4FQ1H 2BERA 4PJ8D 4M7JL 1LE5B 4TQIA 5GXBB 5CJ5A 5J9PB 4JVPA 2XWEA 3VP9A 3VMAA 5CF3A 5E6YA 5IMKB 5C97A 1N6QH 3TF7C 5LO7A 1TTAA 4I1NB 4MQTB 3MRRB 4OCWH 2P5WB 4PY7A 2CA4A 4I5BB 5ACMA 2OK0L 2NPSC 3DO7B 3E6FB 3HNTL 1NL0L 2I60L 4DEPC 3C9IA 4HOWA 3MUDC 2ED9A 5DEFA 5C0GB 3UAEA 5HHXL 4XAWL 5AUMA 3Q1EA 4LLDB 5HYIA 1KEMH 2QV2A 1GS6X 1OB0A 3ARUA 3L3JA 5IJKC 2XPGB 5IBLD 2VDML 3X1FA 1OV8A 1I8LC 2ARWA 4G6MH 4HMEA 3C09C 3WHE1 3LTVA 4G8FB 5D1XE 3F05A 5E1IA 5IHHA 4PRHB 4HHAB 5AOIA 3QUXB 4I2XE 4JFHD 3GLMA 1HILA 4JRYA 4XX1E 4MA3A 4ZFQA 2YXMA 3LB6D 1U58B 1QW8A 3UTQB 2VQ4A 5EC2A 4OF3A 1WBYA 1X8YA 1QVFO 2YBGA 2DI8A 2ZOWA 4X0NA 2I9TA 1HCFX 1LO3L 4K8RL 4ODUB 4GW4B 4UQIM 3F2LA 2VQ1A 1IEHA 2J1KA 2HVJB 4WCYL 3HNVL 2AW2A 5I1HL 3VQ1C 4WWKD 4JKNA 3RY6A 3BRDA 4HEPA 3QT2A 2C9LY 2H6PA 4DKDC 1LE9A 2GHWB 3C8DA 2WSEJ 4LCIL 2YGNA 3OLGA 3T97B 3VACA 4WWIA 1FH2A 3FN0H 2IWKA 3ARGA 1OO2A 5B5EE 1IVTA 2QSTA 1B9KA 3FRUA 3C1LA 5IQ9A 5AAMA 3TURA 2QG4A 1BAGA 2RMNA 3EFDL 4JREC 1GPOL 5KYWB 3ARWA 1XCTB 5E2UH 4AIEA 5GJTH 2WSKA 3QWOB 1CZ8H 1A3LH 4LSUH 1K3ZA 1CLYH 4LSQH 4NC1E 1T89C 1ZKAA 4GKNA 4HG4K 3QQXA 4Z7VF 1TZIB 5EA0H 1SZNA 4BYHA 2N1TE 3RDJA 5I6XC 3LW5H 1XIWD 2F53B 1I3RA 4OZGA 3BN3B 3SKJH 1QI4A 4EF3A 3TN0A 4LVOB 2Y0CA 3C8KA 3UC0L 3RVUC 3RPBA 4LGDE 3QJVB 3BIAX 1AQDA 2BSTB 2VXVH 3SE3C 3ZMRA 2NXZB 1ZHBA 4PJIE 1KCWA 2VO8A 1S3JA 2DIJA 2Z7ZA 5H8DA 2R1YA 2W27A 5JDSA 1BE3J 2VZSA 3LH8A 3NEEA 2DQCL 3N04A 1OALA 1RQVA 5J5EA 1F00I 4DOJA 4UI2A 5I5IA 4JDEB 4TOYH 2VSKB 3AMLA 2Y36L 2IC2A 4OGQC 1ZS2A 3DNKA 2NY2D 3HZVB 5CZVH 2WQWA 3RA7L 1R5WB 1WISA 4MMXB 3N85H 5DD6A 1IK7A 5E94A 5K9JL 2J7LA 1F4XH 4BJLA 2NY5C 2PXYB 4H2CA 3N43B 4U6HA 1I85A 3FHAA 4BZ2H 1UA6H 3BCFA 1A02F 3L75D 3K4ZA 3UTZB 3BPNB 4LHUA 3EJJX 5ESAB 4PWHA 4JRYE 3P4NA 1K6QL 4EDXA 2KK7A 3DJRA 4MA8H 3TYFB 1CD9B 4BZ1L 2XXGA 3DI2B 1S9WA 4ATWA 2EDWA 1A22B 1NCAL 2XG4B 3DUHA 1UVQA 4WO0A 1FNSH 1JF5A 2XWCA 4GEIA 4XWGH 4QOKE 5I23A 5J6SA 1KIPA 5I26A 5EUOF 1UIIA 3AB0B 3NJVA 4W6XB 2HPCA 2YC1B 3AE4C 2RD0A 3AY2A 4CGTA 3AROA 1WZKA 2FATL 4PS7A 3NN8A 4U1NB 3F7VB 1N7LA 2ERJC 4FJ6A 3CVHB 4ODWB 3VGBA 3LZQA 3IM1A 4WK2B 1IX2A 2VLJB 2FX8L 1UXSB 3GIZL 1YAIA 2JWAA 4KXBA 5LQBH 3O4LD 1L0NJ 3OX8A 2F5AL 3P3RA 2BCCD 3W5NA 3FPXA 4K35A 4Z18A 1IARB 2FJFB 3QDME 2N0MA 2VDKL 1PLGH 2LABA 1LP9B 3AUVA 4HXAL 4IU3B 2FQGA 4Z7NB 3T71A 3TYGL 1SQVJ 2BP5M 2XFXB 3HZ3A 1JYNA 4H8VA 4U1GB 3FNKA 3REVB 4CU7A 5IGXH 1PZ5B 1VZHA 3KYNA 2C0WA 1N73A 4W7YA 1HN1A 5E95B 1MV8A 1CXIA 4FQQA 5FOBA 3S6CA 4N1CA 4BQ6A 5CIPA 4OBSA 3MNDA 4X8XA 3WEBA 1IGIH 4EDFA 2VZ1A 4MDRA 3QPQC 1AS6A 2E6QA 2PP7A 3OJ2C 5FXCH 4U1KB 5KSBA 1EXIA 3WL9B 4ELKA 3MV01 4LCYA 4M1DH 5EN2B 1GA2A 2VLRB 2XZQL 2KIKA 5JHLH 2ZVNB 2IQAA 3SGDI 1AGBA 4JDZA 1KG0A 2XWBA 3LKNA 3PGFL 2A0LC 3ZHLA 2WBXA 2EXYD 4EPSA 1JNNL 2CZNA 1GU4A 1Q0XH 3GBEA 4Y4KD 2ZUWA 3H7LA 1G9MH 3WUTA 3V6ZB 2UZXB 2VL4A 4FLQA 1CE6B 3PG2A 4MCZB 3QDAA 4RFOL 2D03L 1SUJA 5D2NB 4Y4HC 2OARA 1HXKA 2ZG1A 4GFTB 5E03A 5F3BB 3TZVB 3O4OB 1T1XB 2BSDA 3RU8H 4BUGA 1BZ9A 4DQOL 1O9VA 3IDNA 3U59A 1XGZA 2ENYA 4OT1L 1JYXA 4M8UA 3U1QA 5C07D 1ZGLA 1BVOA 3S5YA 3ARXA 4EUPH 2DD8H 3WIIH 3FH5A 4IGBD 3AW5A 4EJ1C 2CHZA 1IGFH 2YPVL 2I1JA 3ISWA 4KGLA 1DLFL 5K59F 4CL7A 2K9JB 5KAQG 3T0EA 5D9SB 4MGXA 4L8DA 1VQLP 3RP1A 1XB8A 4HC1H 3U0PA 3PWUB 2YA2A 2WLIB 3BZDA 5I0WA 2Q86A 3KWVA 3CDGB 1HXYA 4NJ9L 1N26A 1B88A 1OF2B 2EP6A 4KK5C 2YXFA 3PAUA 1GMIA 5D7KE 2HCZX 3RWHA 2VISB 4OUUA 1URZA 3HMXA 1IZJA 5CGYD 5IM7A 3RWGA 2IH9A 2X10A 3P3UA 1E5WA 3Q1SL 4PJBE 2I32A 4PRAB 3KBHE 4PWKA 5IB3B 2GJZB 4HWEH 4TULL 3CG8A 1JGUL 3VXOB 4HXBH 4EI0A 4JLRA 2EO9A 5EFIB 2UV3A 3PLYA 5AAWA 4HX1B 3N1FC 1KJVB 2CO3A 2VCOA 3BPCA 2VE6A 3PWJA 5HDLA 5BO1L 4I0KA 3QUMH 3UYRH 4H13B 4EOTA 1OY3B 3K71B 3LN5A 1U95B 3IR9A 2FQEA 4W9KC 1KCUL 1I7ZB 3L16A 1RU9H 3TCXA 4C46A 3GHGC 3B1TA 3MV9B 4P2QE 2HRPH 4AG4L 3MLSH 3ZYZA 4Z7WA 4A39A 2HR3A 5FW6A 1JL8A 3ETBF 4Q6IA 4ORGB 5EN3A 4F93B 1QFUL 1SLXA 5D7LA 5DFAA 1O0VA 3AGWA 1OAQH 4P23D 2JB5H 5ANMB 1VGKA 2H1XA 1EDQA 3FBQA 4J3BA 1B4TA 4DKFH 2OYIB 3GJEA 3SDDB 5AWNH 3PUCA 1SJMA 4HS3A 1NLDL 2MQCA 1CTOA 2PP9A 2BHYA 3FUHA 1CI6B 4AYSA 1EUUA 3QEGL 1S5LX 2FIRT 2DEYX 2IEPA 1PBYA 4HJTA 4A6YB 3BT2L 1T3FB 5EU5A 3JT0A 3PJSB 3B37A 1ADQH 1XX9C 3CFCH 4K71B 4IIQC 2XKUA 2X87A 5DLML 2YO3A 1JPFB 3L74D 3GFUA 1NAMH 2Q87A 3X13A 3ZLQC 4S1SH 3CWBG 3T0EE 1RH8A 1LGHB 3ULUL 2MOGA 2P4AB 3NJHA 4NT6B 1D6EB 3MJ9A 3SGJA 2AJXH 3T0AA 3VX1A 2Z1PA 4NYLB 2P5PA 1RUKH 4EOWH 2FO8A 3HZMB 4JW3A 2DTML 3BKMH 5SWZA 1FL6A 1SQPJ 3T0BA 4BH8B 4C56B 1S5LE 4U49A 1KB9E 3FU5A 2HX9A 3T8XB 5EZJB 2V5MA 2FXOA 1VZGA 4QO1A 3R8QA 2IH1A 1A2YA 4XBPB 4FNPA 2PPCA 4LRIC 4TUOB 1IZKA 2XPYA 4WI3A 3C9NA 1G6RA 1NKRA 1WS8A 3I6KA 3MRIA 1SEQL 1BFTA 3WEXA 1I9JL 1SMDA 1KYOJ 2OMTB 4ZZFA 1RP8A 5ALCL 2B1HH 3GNMH 3K7UA 5GTIH 5KANG 1RF1C 3QARA 2FHFA 4FNQA 1BVKA 4AW7A 1BXXA 5AW2B 1FVDB 2JQZA 4WUUB 3VRJA 4FXKC 1BBDH 3X17A 5IOPA 1HHJB 3LKOA 2XZZA 3NA4A 1YUHB 2ENJA 1AOHA 1ANUA 2K9YA 2BOBA 2WAQA 3TCLA 4DKEH 2ZG2A 5F1IA 4L4TE 1WAAA 2CJ3A 3ABLB 2FB4L 3FN3A 4Z7VE 2X44D 3DC0A 2HTLD 1WTGT 1KTCA 4KTEH 5D7LE 2ZAIA 3U1PA 2EDXA 2K3TA 2WQSA 3R19A 5BUPA 1Z9OA 3GMPA 5DZJA 1SN2A 3CC7P 2G60L 5BRZB 4IBUA 2AZUA 3P9LA 4IEFB 3VUAA 3A6OA 1TQBC 3GSQA 3L7FB 3KHUA 4N85A 1AVAA 1F4HA 4L8CB 1WUNT 5DHVA 2E43A 3TVMA 1WRGA 3FS9A 2FBWC 3FQRA 3HC4H 4D3CH 3BIBX 5HDBF 1VQ4P 2EDMA 4DEUA 1P2CB 3WNIA 3FL7A 4PRPE 4PREB 5T5FA 1RIHH 1RVFL 3MXVL 3M0DC 1NCCL 4XP9H 3LEVH 3FTGB 3C75A 1AZVA 2Q2EB 3BPLC 3FULA 1P84I 4MVBC 3RUGF 2LQRA 3EXJA 3BT0A 1V3MA 2ZYDA 1V8HA 2F0CA 2J2ZA 4NM8L 4NLAA 3I6GB 3LY6A 1UWGH 3ATEA 4NPFX 4FA6A 3D4CA 1OXZA 2F7OA 3K0YA 1TXKA 3L3IA 3FZUD 4ICWA 3ZE2F 4P2RB 1ZD6A 4GAGL 1H8LA 1CFVH 1I1RA 1N0XH 4LHJB 3UBXG 3KMDA 1NEZG 3VRLF 1VENA 3W2DH 4MJHA 2R8SH 4EQ3A 4NN5B 3GSWA 1RI8A 1T7ZA 5MHSE 1J86A 3MBXL 1BE3D 2CUMA 4XN2A 2ZPKL 1I3GH 1J0HA 1QBBA 2VQUA 5HYQA 5EUOE 4YHYC 1IFHH 5EZPA 3TGUJ 3V9CA 4BE5A 2HG0A 4XNMB 4O58H 1LEIA 3MBWA 4AT6A 5C0BD 4EVNB 3RI5K 1D5RA 2EDBA 2CXGA 3R0MA 1B6DA 5DJ0A 3DBXA 4FP8L 3QR2A 1WRFA 7CGTA 1AQKL 1MIEL 4KZ0A 4WQOA 2Y5QA 1UA7A 3BHBA 3ZPDA 1DX7A 2BNQB 2D7OA 4PCSA 2QL1A 3SQBA 2X4RA 3LNHA 4HUWA 4AYBA 4DEPB 2EUXA 3SGEH 5AB9A 3ZL2A 4QUOA 1Q94B 5C70A 4OZFB 4C55A 1UGNA 4O02H 4PLKD 3RVXD 4YHML 2DZEA 4P04A 1WAAE 2ICWB 4MMZB 5MEPB 4Y16D 1QO3A 1FWXA 4PR5A 2K6WA 4XOBA 2XHNA 3HI6H 3C6LC 4BZYA 2DQMA 4FI8A 1PD1A 4JO3H 3QIUA 3MLYH 4XNYH 2EDOA 1FYTA 2JKLA 3QSKB 1TITA 3NIDB 4FXGA 4YDIH 3PV6A 1ED3A 3QO0B 4PRIB 2V3DA 3BAEL 1L9RA 3FO9A 5FYJD 4FFVD 3D6ZA 4KDTA 4R4BA 2FBJH 3RB7A 5JXAH 1FRGL 3B9KB 5ACZA 2D0HA 1F45A 3CBJB 5BVPL 1NBVL 3H85A 2UZYB 3L4WA 4O9HH 5DUBB 4N25A 4YLBA 1M7DA 3QAZC 2VC2B 2DF3A 3K3QA 1PG7X 2L7EA 1L0ND 3DROB 1TJXA 1MAJA 1FG9C 2WSEH 1TSRA 3TL5A 4KRPD 4X2UA 2VM3A 3V0VA 4WW1B 3Q5TA 5I2IB 3RNQA 3ROOB 5FR3A 1WFUA 3MMEA 3NJIA 1SQVD 3CGTA 4UIKL 1EA9C 2F6AA 2UVFA 3OKEA 1R47A 4HWZA 3RFZC 1MJJB 3RDTA 3CPLB 3CUPA 3P77A 4JREB 3ZDZE 4XVTH 4BFRA 4N90D 2SEBA 4MHHG 3U0WL 1GY2A 4ERSH 1MPAL 4M6AA 4L3EA 3WEMA 3J2PA 4BRVA 4M1GL 5EDSA 2CDFB 3C5SA 3HBZA 4L5FE 1I8MA 1QP1A 1KBGL 4XP5L 3FB6A 3V6FA 1HJBC 3EADA 4FLOA 5C6TL 4TRPH 3IGAB 4AZ8B 4I48A 1LDPL 1DQJB 1SXNA 1WIOA 1S9KC 3QUZA 4ZYKB 4M7ZB 3JVGC 4QDGA 3V0HA 2P10A 3FF8A 2DWEA 2K70A 4OF6A 5J57B 4HS8H 2VLLA 2WBJD 1E5YA 2KL6A 1OZHA 3HUJF 1SQPG 2DJMA 2IZ0A 1J1XL 2LU4A 2ICWI 1GTFA 1JV5A 25C8L 3LZOA 4LDCA 2O1KA 4OLZL 4H44C 3O41A 2WWNA 2ZOKA 3Q6FA 1A1MB 2E5YA 2FD6H 2JXMB 3EO0A 5I8EB 4EI6A 1B0RA 3D08A 1JGDA 1S4IA 4HJEA 2A6IB 3QULB 4N6RB 5A2CA 3IFLL 3Q2WA 1QSEB 3PFUA 3S97C 4FTDA 5T3XE 4OF7A 5HHQB 3MRBB 5JOFB 4G7VL 4QRQB 4IKNA 5A7BA 1AR1C 2Y07H 1ZA3B 5JXEA 3OHMB 3UYOD 5H4ZA 1CGXA 4ODHL 1FYTE 2DLTA 5EPMB 3MA7B 5FGRA 4YOKA 3N1MC 1G1CA 3R06A 4WTXA 3RGUA 1XH3A 2V2TB 5D7SL 1KILA 5I5JA 1AJ7L 4F1ZA 1QX8A 1R5LA 3CZFA 3IJEA 2F08A 3CFBA 3MLZL 4IMKC 5DRXB 3TT3H 2HTKC 3ABMB 3DX8B 1Q9WA 3IU3A 1R34A 1BX2B 5DR5L 5IB4A 2VXUL 1JMXA 4XE5B 4RISL 4UB6E 2XT1B 1JCKA 5HDBB 1ZHNB 3EDKA 5FM5O 5ICXB 2R4RH 3MV8A 4GKGA 4PI0A 2QVAA 3H1ZA 2WTRB 4OTXL 3PP3H 4JL2A 3R7QA 1JYVA 2VKWA 4X5XB 3IRZA 4YXHL 2Z65C 5E4OA 5FYJH 1P69B 1SJXA 5E9DA 3LS4L 4I9XA 4KKPA 4P59H 1GGIH 4KKCC 5K1NA 2NZ9C 2ADFL 1S9XA 3BLKA 5CD3B 2ERJB 4GW5A 3WFDH 1YN6B 1JY3P 4CSZA 1F8TL 1ZIAA 2VMFA 3ZE2B 4F7PA 2J88H 2WYZA 3W67A 2QSVA 3CQQA 4WLCA 4LPWA 3D30A 3O2VL 5C0JB 5F7UA 5FUZL 4JJ5A 2XWJB 5DQJB 2DEWX 5FO8A 5I1LA 1ZGLP 2E6PA 1N5YH 2VITA 3VWJD 4LQFH 2WIIB 4WKZB 1IRAY 1OOWA 3V55A 2A77H 1MIML 4P49A 4M5TA 4TLTA 2ZONA 3MBEA 3VGAB 1OE3A 3D3VB 1YEJL 3VFGH 3QRFM 3HNSL 3QIBB 1KXQE 1BEYH 1NOAA 3GBML 4M5YH 2X0VA 4A67A 4HDIA 4EIBA 3O3DB 2CPBA 4ADIA 4W6YB 3ZVVA 5CEYA 1AI1H 1ERNA 4OV5A 3M7OA 3CPUA 5GISH 2Z8WC 1NGPL 3CI9A 1U3HB 2EXWC 4EIUA 4M00A 4TUUA 1H6TA 3RNKA 3SDCA 2W0FA 4Y9BA 1G7QA 1IK9A 1PPJG 2Z35B 2VN3A 3RVVC 3U7WL 2CGZA 3TGUG 1BG9A 1J0JA 1MCIA 3QC6X 5DD3L 3RWIB 3RB5A 3DPBA 3TBTA 4FQHA 5C0CD 3P9WB 1O6VA 1IMHC 3SKOA 4TQEL 2XFGB 4YXKL 4F24A 3VSTA 2AMGA 2V17H 1BD2D 1IC4H 5TH2A 4QRPD 2E27L 2OGUA 3MA9H 1JGEB 3VD4A 4U3FE 4QT5B 4YZFF 4TNWK 1D6VL 3NPSC 3F3HA 1E4KC 1R3JA 2AITA 4JHWL 2G75A 5K1VA 4FQIL 4TNEA 4Y4HB 3Q2LA 2MNWA 4RGND 2HJFA 1A65A 2AXFA 3NESA 5ID0A 5GGUB 2YBRB 3L5HA 1KPVA 4PJ8C 5LXGH 4KT0J 2OTPA 1SQPD 2E5EA 1PKQA 2UZIH 1OAKL 4R5XA 3AEFC 3KYMA 5T1MA 3WY1A 2XU6A 4R96A 1XH2A 2E9IA 5E9DE 4M6NL 5KVEE 3HE4A 5JPNA 1D9KA 2X4NA 4WV1A 3O11B 3BIKA 2Y7MA 5ESVA 5CCJA 4NWTL 1EJOL 5CSZB 3S3CB 1HI6B 1KYOD 3TK1A 2NRDA 4M6ML 4KX9A 4PBXA 4S1DD 5FO7A 5BRPA 4F92B 4RZCA 2EEFA 3TH4T 1B2YA 1WD8A 1N3NA 3BW9B 32C2A 3FTSA 4HMCA 2GITB 4YNYB 3GZQA 3D34A 1D2PA 5D5MF 3DX3A 4X6CA 2EUZA 1QLEL 3MI6A 1RJCA 3HAEG 1P4IH 1QATA 2FE0A 4IRZH 5KAFE 1JVKA 3LB6C 5IBTH 4KRMB 3RUGE 2ZCLH 3B7RL 2Z7WA 5ADPL 4NX0A 1OTSD 3CE1A 2MIZA 5TGBA 1VQ9P 1U8QB 2BOCA 1EGJA 3NIGB 1T2QL 3OF6A 1WSST 1W72B 4UT9A 4F8LA 3BZEA 3OLDA 1YYLH 4LRNL 3T1WA 5T1LA 5C0IB 5FA3B 1MH5A 4WWKC 1HX0A 4FA7B 3GHGB 4PGCA 4BH7B 1OLZA 4GUOA 4N0UA 3MOAH 3P8CD 2W0LA 3DMMD 2W9LA 4K7FA 4P4KA 4U6YB 2YKQA 3SHSA 3UAJD 3V7MA 3ZDMA 4CDGC 5I75C 3TO4A 1OPGH 4ZX5A 3S35H 1E40A 3QEUA 1AFVH 3AQYA 4F7MB 1XTGB 1I1YB 1WK0A 5TE6L 3HRZA 4F20A 4MD5A 4HUNB 4QJ3B 4R97C 3HN3A 2CO2A 2DIAA 2PYEA 2FNBA 1RZFH 2DW5A 5AD0B 3GINA 1FPTL 1NTKJ 4ZTOH 1QBAA 4ZOEA 4KXZH 4D0BA 3RX8A 1D5ZB 1JFQH 2AXJA 4U4BA 3T3PF 2JLPA 1OX3A 1TVBA 4AMWA 3TASA 1XIWC 2X0UA 3TJEL 2YJQA 3BGMB 1G5GA 3RL2A 1PKQE 3FCBA 4XPTL 1G7MA 5DZVA 3GHBL 3DSNB 3KPTA 1ZRTD 3S4SB 5I8OL 1KXVA 4AVKA 5GS1A 4QKXB 5TJHA 3MLVL 4IIQB 3U6RB 5HHNB 2DQEH 3SYQA 4YPJA 5C7XL 1P5UC 3MUGB 1IJ9A 1JK8A 1IKNC 3L3DB 3IETB 1GC1L 4YSUA 1OAUH 5HDRA 3TGUD 2AEJA 1G9MC 2JO1A 1JTHA 2YNYA 3KR3H 3R1GH 5D6CA 1F11A 4LCWA 4BINA 3ORJA 1WCQA 2O93L 2F5BL 1HVXA 3BUBA 4TLUA 3ZKXB 5GGQH 2NY2C 3TNMA 5F7AA 1VFAA 2ZSVB 3I50H 1NDMB 5LN8A 3V4VH 3RWFA 5LAPA 4X6CE 4L8SA 4OCSL 2A2QT 4F58H 5JQHC 4H0IA 2CE6A 3A67L 4MD0A 4OCYL 4LASH 4ZS6D 5JW4N 4HIQA 1UWEH 5LB1A 1KYOH 1KIRA 1CS6A 3GMMA 5E2JA 3WKML 4E9SA 4UAOB 2HKFL 1RF1B 3O2WL 2KH2B 2OL3H 3Q1MA 3QK0A 1YNTF 6PCYA 4KOCA 1LWHA 2BJML 4JO1H 4FXKB 1UZGA 2CALA 1DQMH 2WTPA 3WEAA 4FG2A 1H3PL 4N0UE 4P5TA 3KQGA 2G0LA 3SGKC 3KWWB 3FO1B 2Z91A 4X4MA 1EDJA 1GYUA 5F96L 3WIHH 1L0LJ 1NTMK 4PAZA 3W39A 2EXSA 1V10A 5I28A 1KZQA 4XPAL 4Z3TA 3UDWC 1MQKL 3D70A 3KXFE 4G9DA 4HIJA 5CHNB 4HUXB 5LBVA 3AXIA 2NYYD 1KTDA 3HUJE 4WNQA 4AYCA 2FCBA 3MGAA 5L4MA 1NQBA 1CF1A 2Q5UA 3FJTA 2BWQA 2IDTA 1XSOA 4JRFA 4YGVA 4YAQA 3P40A 5I1EH 5MEQA 3BWUC 4KU1A 2F15A 4B7IA 4XMUA 4DZ8B 5FO9B 3EFOB 4GG6F 4FABL 2OMWA 3STBA 1RZKC 5HI5D 2GI0A 1OM3L 1FAIH 3L7EA 4P4RA 1DQLH 2W07B 4X80H 5HYJA 4G43B 2DW3A 1KD1Q 1MF2H 2I7SA 1N8ZA 2BVPB 3BPLB 1FE8H 3CXHE 1ZRUA 1S7TA 3EJTA 3HLKA 3OQRA 2IFFH 4B9FA 3LVEA 1SVFA 5IFAL 4AYMC 4B0MB 1FH5L 3OR7B 3AE8C 1U8MB 4LCWE 4M4RB 4ZOBA 3VFWB 5CEZD 1M9WA 5HDQH 4RMWA 4WJ5B 1YYCA 3QFDB 4XPBL 1N0LB 5ETUB 3RZCA 2XBDA 4Q58C 3HFMH 3MKGA 2VRAA 5SX4I 1ZDSA 3LKRA 5I71B 2EXYC 3B6SA 1E28A 1XZ0B 3KGRA 3FTZA 1EFQA 2GIMA 4Y4KC 1GW0A 1XR9A 1WDAA 2PWFA 1A7QL 5ALBL 1LD9A 1PEWA 3MJ9L 5IHZB 4MZRA 4YHYB 4R2GD 1IEAA 1CJYA 2GCYB 3N41F 3P30H 5IHLB 3WIFB 3SQOL 4QXTB 4JO4L 3VD0A 3SN6N 3GSNB 5EO1B 4DP4X 2A99A 4WTQA 3UZQA 4YDKL 3UIZA 5KLIB 5FEBA 1L9TA 2FVNA 4N2AA 1UB5B 2ZKHL 4XMXA 4IGBC 4N0CD 3PWPB 3VXMD 4PJ5E 1G6RL 4I77H 1Q38A 1A14L 3AG4B 1Z66A 3MGTA 3QORA 1SFCD 4ZPTA 2OZ4A 2W6AA 5MENA 4ZUSA 4R83A 1VQMP 3OTTA 3JV6A 4P05A 3V5KA 4PQXA 3PHAA 4LVNC 2AFNA 1CDGA 5B1JC 2AJYH 5CS7A 1RPUA 3CV5A 4JBZA 1TNMA 2WO3B 3JZYA 2FHBA 3GBDA 5E8DH 5LAXB 3ILEA 1C08B 3KDMB 3IJYB 2VN4A 5CGYC 3MJ6A 1JPGB 1NIEA 5DUJA 5D4IA 2IADB 5HJBA 4RMBA 1KNOA 4KROD 3SE8H 3K5SA 3MZWB 3CXFA 2HVKB 4XOEA 5FK9A 2DOCA 3GBNH 4X8JB 5HYJE 4CC4A 2EXTA 1OGAA 2CLZA 4KKZA 4NKIH 1JGLL 4Z77A 2BZDA 4GKSB 1I1AB 3HAEH 2CO4A 3MLTA 2Y72A 2K6ZA 4AGPA 3R4RA 1USZA 1NTKG 4EN3D 3MRJA 5L4JA 3HJEA 4LLYB 5FYKU 3BKJL 2FR4A 2WJ5A 4YZFE 2C3GA 1UIXA 2EYSB 4HJGA 4N9OB 4B96A 3CFJB 2X2JA 3BAXA 4YXLL 2K0RA 1EIBA 2PPFA 2L3BA 5KSAA 3IJHA 3S2CA 5T5FL 5CSBA 5JW4M 2O6CA 4HBCH 1V7NH 3D85B 1UKQA 4Z7QB 1BA9A 4JFDB 1MDAA 4G7SB 2WVVA 3N9GH 1GMJA 2WZPD 4P23C 1R3IH 4XXDA 4Z7AA 4GOEA 4UUJA 1J1EC 1DUZA 5INDA 4BFBD 1MWAB 5HP5A 2G3NA 4YSRA 3ZY7A 1HZHH 5CEZH 5EU4B 4M3HA 5BS0A 1PD6A 4PV9A 1J8HA 4TVUA 1O9ZA 2NY4B 1ZVYA 3ARDA 3TF4A 5D7EA 1PG7L 2Y7QB 4U1HA 4GLRH 1FDMA 3GUFA 3ETTA 5ILTH 1F6AA 4H44B 1YNTB 3PL6D 4L5FL 4XP4H 1KTBA 5KSVA 4C7NA 2NX5B 4ZQTA 3ARBD 3QYNA 4HZLB 1RJLB 1NC2A 3LRSA 4E5XG 1THCA 3PDOB 4GKLA 1EFXD 4JKPL 5D5ME 2OYMA 3QNYA 3C5ZA 1TZ8A 1MNUL 4M48L 4NQCA 2AHIA 1IL1A 5H4YA 5FFOA 8FABB 3NJLA 1SQBG 5E6ID 3BGAA 3PHQB 5ENWA 5H94A 3ASOB 3VB9A 1OP9A 2EDFA 3QI9A 4KTDL 2DWSA 5I1GH 1URIA 4AH2B 1MKFA 4ZSOB 1Z5YD 1M7IA 3K5RA 3HG1D 3OZ9H 4OD3L 3VFSB 4CKQA 3QC5X 4F9PC 2CKBB 5IJDC 2GSMB 5T3XL 5KS9A 5F7DB 2NTFA 3ABZA 1NPNA 2QJPC 1L0LG 1SHMA 3VXUD 3K72B 1G9NL 3DXAB 7PAZA 5EIIA 5DJDB 2OMZB 2FYUK 4ELMA 3NG5A 1AO7B 1S8DA 3U1SH 4N5ED 2VXQH 4JE4B 4GI8A 1FFOB 2KZKA 3IDIB 2Y06L 5GGRB 1BVNP 2XWTA 1GZHA 35C8L 3QQ3A 1E4XI 5A16B 1W8EA 4UDTA 1ZANL 1ET7A 2NW2A 3QHTC 2LOEA 2BXZA 4GQZA 2HTLC 1J8SA 2H3NB 5D7JD 1EDKA 5GGSA 3T3PE 1PLBA 3I2CL 1KT2A 3KPQB 3PGDA 4HUUB 5CMAB 4AEIL 4MN4C 3WCYA 4IW4C 3E2HB 1KJ2B 1K8IB 4OFYD 2PR9A 2J1ZA 1NCNA 4R0LA 3N41B 4XXWC 1B4JH 1ONQA 3F85A 3LSOB 5BS0E 2Y0EA 4KAQH 4BFEA 1F58L 3KCPB 4WFHD 3MIWA 5I1KL 5DYOA 4X98A 3NSCA 3D69A 2D31B 3ZZQA 2ENSA 1KN4L 4Y5VC 2V9TA 43CAA 1GL2D 2FT8A 1D5IL 2COQA 3UGXA 5HGDA 4W9ZA 3DO3A 3NCEB 3WY3A 3EJZC 2NY7H 5HHOA 1C8PA 1OANA 3LZPA 5CBEA 1E65A 4I18B 4WFFD 4C57C 4X7SH 1RULL 1NTKD 3MCLH 4K7PY 1MCPL 4WI2A 1TJGH 4YMPA 3BAKA 3AM8C 1K8DB 4PGEA 4ZMYA 5DWPA 1A8ZA 3EOAB 3IT8D 3Q44A 4NQCE 3SBRA 4FQJL 4N86A 1GHFL 3FZUC 1S9KE 2YKOA 1CFSB 5JR1H 4Q9QL 5BV7H 5GIRA 5JA9A 1JHLH 3AUWB 2ZAGA 4G9FB 4YL9A 1I9RL 1SRDA 3D0LA 1A6PA 1R5IA 1RE3A 3RK2D 1TG8A 2A9BA 2OM5A 3FCTB 1U6AH 1NU1J 3PGCB 4WHYG 4G8GB 4PJAF 2QSQA 2RALA 2C9XA 5KS9E 1QTYT 2K7PA 1DHKA 3FU7B 5DHMC 2R83A 3CXHK 3BWUF 2M5AA 2HODA 4FA8A 4ZUTB 4PJ0E 4DW2L 4NRXA 3VG0H 1XCQB 4AQEB 5M95B 4ELME 4JKLA 2V37A 1GIGL 4PVLA 4OLYH 3TIDB 1BGXL 1H9VA 4CJ0A 4QLRA 3WYRA 5IW1A 4OFDA 1M2OA 4ZXBA 1OAYL 2GKIA 4RWYH 3PJNA 5KN5B 3AMKA 3FCSA 1F56A 2XN9A 1XL4A 4H8WH 4N0YL 3ULSA 2D0GA 5JO5B 1MG2C 2IO5A 1NUGA 5BCAA 4PLKC 3RVXC 4N1EA 2C9AA 1EBAA 1N70A 4YSAA 3AEEC 2NR6C 1LEGB 4WI4A 1FDIA 4Y16C 3TTYA 4XVSH 3H32A 5C09D 5IB5A 2E9GA 1JY2O 5B21A 4LIQH 3GGWA 5B8CC 4GG6E 4DGYH 4CUCA 5KVEL 1RIVH 2NY5L 2QTEA 5DD0L 1NTZJ 3FUNA 3VD5A 5CFAA 2ZIDA 3E1ZA 1IGTA 4FFVC 4LU5H 2YD1A 1TO4A 4O5LL 2H88C 3KLQA 1JZHA 2BM3A 1U33A 3I75A 5CU5A 4CVXB 1YJWP 3QXUA 4KZCA 3CVCA 4QHKI 3S37H 4G1EA 4I4WA 4OW6A 4P46B 4B0MM 2POHA 2J1YA 1OAZL 3HPLB 2FJSA 2IGLA 1A6AA 1C5DA 1QEWB 3AZUA 3QUYB 4YBLC 4BEIA 4MDIA 2APBA 3OKNB 4JFEA 5HHOE 4DPCX 2YS4A 5EBWA 4PGJA 1EXUA 1GZLA 3II2A 4KRPC 4L37A 3S88H 1Z3GL 5EH1A 4OB5H 3PUUA 2Q5BA 4XN5A 4BDVB 4XPFL 5D93C 5IMOB 4WTZG 3KPSE 5ISZD 3PQYD 2BY1A 2XXFA 3VD1A 2A4ZA 5MEOB 4TT3H 1TZHB 2YA0A 3ZUCA 1TEFA 1NFIB 2Z6FA 3MRHB 4KJPD 4DGIL 1QFWL 4DP6X 2DM3A 1YQVH 2JJUA 4ONFH 1L4AA 1X5LA 2PO6C 5J6HB 2VR9A 2RIKA 5I66A 1X22A 3IDJA 2ZXQA 4L9LA 4DCKA 4IMLB 1M05A 4Z6AT 4YDLC 3ZRFC 1RZ8A 2PR4L 5CJQL 1S7SB 1AAJA 4P06A 4E0RB 1SLVA 1LMIA 1N2RB 3QZPA 5E4AA 1JZ4A 1S7RA 2AEQL 1LO0H 5D1ZD 1AQHA 4JFPB 3VI3A 1F97A 2YPLB 4F8NA 3FQNA 5M7QA 1H6UA 1CD1A 4JO2H 1GKEA 1LE5A 1SLWA 3ZJAA 2YD9A 2Z4QB 5F1NB 3VXSA 3NT0A 3LXBA 4XC3H 3FHEA 5CXPA 3EWKA 1BQKA 2ZE0A 4KVCH 5IMKA 1P7QD 4MA1C 3GDBA 4NNXB 3DUSB 5K9KB 2X41A 1OVRA 1YVLA 4O4YH 3Q3DA 2YN3A 3MRRA 2P5WA 4I5BA 2VR6A 5EO0B 2ZFCA 3ZSTA 3FMGL 4LP4A 4IRJD 1OW7A 4NFCA 3E6FA 1DH3A 2GSGB 4H20L 4JYBA 3FPYA 3KYAA 1C5BH 2J44A 3SFDC 1YMMD 5TDOB 1F3DJ 1J9SA 1N4XL 2ROXA 4APQD 4EUPB 2J8UF 1KBBA 4KJWD 3V52H 4QHPA 1VA9A 2Z92B 2MOVA 2XPGA 4RSVA 3B9AA 3AE5C 3WMSA 3AACA 1CW5A 1JZIA 1TDQA 1MZYA 2GBUA 2NT0A 3ZRCC 3MRLB 4G8FA 3HE7D 4Y7MA 1W5CE 4I88A 4HHAA 2CXKA 4MA7H 1MFEH 2KDYA 4JG1H 4JFUA 4JFEE 3QUXA 2O61B 2NTSP 4BQBA 3TEYA 3DECA 2YQGA 1JF6A 3VFNB 3T65A 5ADOH 2WOYA 2YLHA 5FGSA 1JUFA 1CFBA 5L88H 4Y9GA 3F5HA 2YKLH 3LRKA 4ODUA 4GW4A 1JGVL 4AEHL 3KVQA 2R69H 1IAMA 2HVJA 4CW1A 1EGJL 1S46A 3N0PB 4JFHE 2ED8A 4UT9L 4X5LA 5FGBC 1E9QA 5CJ0A 4NOBA 4RFNC 4L4VD 2CD0A 2AEFA 3T97A 1XF4B 3O4LB 5ANHA 3G6AB 2E9WA 4E42A 3BI9X 1UUNA 1BPLB 1OZUA 4O51B 3VWJC 4YSPA 2C1PA 2RFXB 1G2CB 5D72H 2MJZA 1FJ1B 4J4PD 3N40P 1VHPA 1XCTA 3TNUB 5FYKE 3GSXB 5F0JB 5DD5L 1X5JA 3CFQA 5D1QD 4IK6A 3VFMB 3SWYA 3QWOA 5E2WL 4F2FA 2WINA 1GYWA 2MFNA 3L36A 3MR9A 3B2VH 4PGDB 1XF5B 2GTQA 3R7RA 3RYMA 4D7BA 2I69A 2GC4C 1NUDA 1HAWA 2CBOA 5JZ7D 1YEHH 1NU1G 3BESR 1ZMYA 2F53A 3VXSE 4ZJ9A 1UT9A 4BXLA 4HH9B 2H45A 5BW7A 3VMZA 3A7OA 5GGTA 2O6EA 4G6KH 1A6WH 1CIDA 2JCCF 3BSZH 4JMXA 1E7VA 2BSTA 3N2JA 1TLKA 1IAIL 3HE6B 3NEOA 3OKLA 3F83A 12E8H 4G3YH 4PRDB 5JQIB 1NCIA 1YPZF 2N56A 5E2TH 4Q52A 4LE8A 5JQ6L 1A3RL 3CSBA 3SO3C 3H3BC 3NAAL 1I1FB 4HHWA 4PV1D 2OR9H 4FNRA 5SV3A 3OMAB 4MMXA 1YEEL 3L3OC 4RGNC 5L2JA 4Z0BH 2JE8A 2PXYA 2YSSA 4LZKA 1ECZA 4Y2OA 1JRHI 3LQAH 3GRWH 1WHOA 5C07B 4F2MB 1MCSA 3P54A 4YHLL 1F2QA 1SBSH 1XBRA 2H8PA 4RMQA 5ESAA 3EHBD 4IGBB 5F9WC 1VQ5P 4WHYH 5C0AA 5AOLA 4JHAL 1NTZG 1BOGA 3G4SP 3L3GA 4XCEA 5LDUA 4UM8B 1HJ0A 2UYLB 4AM0A 3BUIA 2XG4A 4XCNB 3L75E 5T1KD 1IE5A 1N8OE 3CVIL 1RV6X 5KVGE 4S1DC 2YC1A 5AAPA 5F71A 4GO8A 2R0WL 4P07A 1RZJL 2HFED 3CAFA 4E9YA 2G4GA 2RKLA 4MDJB 3I5CA 4HK3N 4WGWB 1KB5B 4JO5A 2E47A 3U9PH 3ZYJA 1OK8A 2W9DH 1KTKE 2IX7C 3CVHA 4ODWA 3QJXA 4PJGF 1HKLH 1KTRL 2WYHA 3C6EA 2P8LB 1A6VL 1X9RA 3E7KA 1HKFA 1UXSA 3Q6GL 4JMNA 1YO4A 3UFIA 5M94B 1SVCP 1OTSC 3R4DA 5F7MC 2WP3O 2JLLA 5IUSA 5CAYB 4Y1AE 2P46B 3S3DB 2KI7B 5KKZC 4FMFA 1LP9A 3E8VA 3EJPA 4M03A 2H6UA 3O6KL 1FZCC 1RQUA 1UM6H 1AH1A 1NMAL 1PZ5A 4JDTL 1NGYA 5C3TA 4L74A 4WU7B 2BCCE 1RPKA 1T21B 3DMMC 4PJAE 4LSDA 1CL7H 3SPIA 3UAJC 3ILQD 4WKXA 3MXWH 3P32A 2C3VB 1F6FB 1URQD 3OZLA 2PFXA 2P26A 1DBAH 3ATBA 4U1KA 5L4IA 3A0HE 3WL9A 1UD5A 2J8UB 1N12A 4E41E 5EN2A 2VLRA 2C9QA 4LK4A 4XGZB 2WNXA 1VFUA 4JFZH 1MUUA 4M7JH 1IC2A 3AAZB 1PW3A 5HYSG 2FK9A 3MO1A 2V5SA 4JM2F 5F0PB 5I30L 5I1JL 1LK3H 4RESB 2GBVA 3DTDA 5DMIL 5C0AE 1G1YA 3QJTB 4GG8B 4M29A 2OK0H 1CE6A 4MCZA 5I16B 3MCKA 5LXVA 5D2NA 3AJ7A 1NL0H 4NHCH 2I60H 4NIYE 4AGQA 1JHTB 5F3BA 4TNGA 4UQ3B 4WGVB 1T1XA 3TZVA 1I8AA 5HHXH 4XAWH 2B3IA 2VDOL 3EYFA 1ZDQA 2Y22A 3D12B 5AVUB 3SPCA 2ENQA 2JJSC 4X50A 3OHXB 4PWGA 4ENZA 2EH8L 1L7TH 3LXCA 2WK2A 2KNCB 1D5BB 4ZMVA 1NICA 3H6AA 1R8EA 5D9SA 2IG2L 2QGDA 3ZKMD 3RL0B 1HC1A 2D0FA 3PWUA 2OZ4L 2WLIA 4HK0B 2WZ0A 2H1PH 4IDLA 4ZS6C 3IVKB 4EQ2A 4YN3A 2VZ3A 4OFQA 2QJPB 1KUMA 1XDTT 2YMKA 1OF2A 3DARA 3BCDA 4ZTPL 1LO3H 5KBMA 3ABVC 1YDPB 1RHZB 1FAVA 3KM1A 2BSSB 1F6LL 2VISA 3B7YA 4WCYH 1HHKB 1DZ0A 1BGYD 3HNVH 1BQ5A 4MX7A 5C3IA 1QX1A 4W81A 4H1LH 3H1LG 4MYWB 2BINA 3GMOB 4DAGH 4LCIH 4PRAA 2CGRL 3BLBA 3M8OL 1WEJL 2P80D 3VXRB 2GJZA 5GTIE 1U93B 1CLCA 5AOKA 1QLFB 3VXOA 1SXAA 3M1BA 3E7JA 1AKJD 4L1BA 3WEOA 1OIOA 4HX1A 2MTAA 5I73B 1KJVA 4K3JH 1GPOH 3RQ3A 2O30A 1EEQA 3KL5A 1G7HA 3SODB 1MHEB 3DX0A 3P4MB 1FZAA 2F58L 4U1MB 2OW7A 5EU6A 1KXTB 3SWKA 1I7ZA 2X6AA 1LP1B 2A45H 3AG1B 4N8PA 1YLBB 2A9MH 3MV9A 1WTLA 1KDJA 4PLJD 5DFWH 2NYYC 1PU0A 4HV8B 4MCMA 4KITB 4AUYA 3FSVA 3M9BA 5J3HD 2Z31B 2QBWA 4HIHB 5F9AC 2IQ9L 4ORGA 1K8AQ 1TU2A 3KYOB 4G6JH 4EDWL 5JPMC 4Y5VB 3WJLC 3EJYD 3UC0H 1FSKC 4MJJA 3APMA 2OYHC 5HI5C 1RH5B 1QLRB 4Y19D 3FXDA 3OA7A 5DHYA 3PP4H 3VGEA 2OYIA 3SDDA 3K2UH 5E5UB 4CADA 2EO1A 2DQCH 1AC6A 3RL1A 1CI6A 3HPJB 5C2BL 1E3ZA 1DVXA 4AKPA 2Y36H 3ELQA 1G1OA 4QAMB 1AIFA 1T3FA 1R33A 1UXLA 2WKLA 5EUKB 3SGEI 3PJSA 3LJ3A 4JE0A 2DMKA 3UO1L 5K9JH 1JPFA 1RL1A 3HB3D 2VMCA 4ECNA 4Y4FD 1NMCB 2QQLL 2NZIA 4F8TA 4ODSL 1H9DA 2E7MA 1GGUA 1JV2B 2NQ3A 1D6EA 4ZFFA 4PJGB 3HZMA 1MFAL 3IMRA 1TVDA 1B0WA 2XTJE 4NKOB 4R2GC 5IEKA 1GAFL 1KDIA 1XD0A 4BZ1H 1X7QB 3L74E 1FNLA 2WLJA 4X7FC 3UTOA 3D39D 3T8XA 1NCAH 5C0BB 3N1GC 5EZJA 3IS0X 1IT9H 1FIGL 2WPVB 2E76D 1BQSA 5MI0C 1R4XA 4XBPA 1LTJA 3B43A 2MCMA 4XN1A 3GZPA 4OAWA 1T4KA 3IAGC 4J23A 3CK0L 4N2LA 3F7PC 3VE0B 2LU3A 4N0CC 1ES0B 4D94A 2XQ0A 2FATH 2R59A 2YD2A 4JPIA 2HMID 3RRQA 4DGVL 3SPVB 4YFLF 4MQXD 1SFCC 3LHAA 5IJBC 2A9CA 2B8OT 2YUWA 4WGKA 5JOPD 2P5EA 1SQ2N 3GIZH 4Y16B 4F8PA 2VN6A 4I0PD 5KAIH 5EU6E 1TU3F 5B8CB 2A73B 2IPTL 2Z0UA 4D0CB 4NJAL 5LNDA 1KMGA 4JZOB 4BFOA 5GTHE 1K9MQ 2QJYC 2EDJA 2VDKH 4LEEA 2KXPB 2H6OA 4HXAH 2ZSWB 1EAJA 3TYGH 2AGJH 3U36A 3QCTL 4PCYA 3L9EA 4L3FA 4JY4A 1Z9MA 1DBML 4U7JA 1GOHA 3KJ6L 4YDVA 5BRZA 1H3VA 1WFTA 1N7ML 4YBLB 1GR7A 1RIUL 4I9WE 5DK3A 2IAMA 4NENB 3MV7B 2JCCE 3ZGHA 3QG6B 4PGZA 4JUTA 2X2IA 3L7FA 4KRPB 3KVPA 1UENA 5B39A 3HR5B 4AGLA 3CSTA 2CUIA 3WAJA 1XSIA 4XVJL 1T2KD 1S3RA 2CK0H 1YPZE 1ZV9A 1P4LB 5D93B 4EN3C 2BFVL 4LOEA 2XZQH 5IROA 1T20A 2K4WA 4M6OL 2BW4A 3KPRA 4JZJC 3T5WA 3IE4A 5I1CL 2DQIL 4GP8B 5T3ZE 1PZDA 1UJTA 3PGFH 2W1NA 1HS6A 3CN3A 1MJ7H 4AEFA 1JNNH 4WUKL 4MJID 1TOXA 1OQXA 3QCUL 4P48A 4YEEA 3D5OF 1YQ4C 2CIIB 3I6GA 1MLCA 1WA0X 2GHZA 4YDLB 1IAKB 1FHNA 3NP3A 1PZCA 1UGKA 2WLHA 4RFOH 2D03H 1NCDL 4UQ2A 2VR4A 3BSGA 4IDJL 4P2RA 5DRWB 4CU8A 1YC8A 2QELA 2ZT9B 2X4PA 1P84E 4DQOH 1HL4A 2UXFA 1NCJA 3AEAC 5DRNB 2WBJB 5CJ8A 4LSVL 2FJGA 3D2TA 4PJCB 4U3CA 4IBTA 1Z32X 2V7HB 2JR8A 3PL6C 5BV7C 1CPUA 5E2UL 1FF5A 3ARBC 4M3JA 1T22B 4EVNA 1EEZA 4J6IA 4DP2X 4GP5B 4MA1B 2IDFA 1BE3E 3EGSA 1U8JA 4NJ9H 1MEXL 2P5EE 5E79E 2VDPH 2IFMA 3DVGB 3O6FD 4UU9B 5K9QG 3UBXB 2X09A 2ZYSA 3MLPA 4N78E 2FKWB 1NEZB 4LP8A 1F3DH 5EA0L 5EBMA 1Z0NA 4RSYA 3CIAA 5E6IC 3SDAB 3EJUA 4UDUB 1BVNT 5KANI 3VYIA 5F3HB 1ITBB 1Q94A 4P57A 1J88A 3N91A 4OZFA 3O9WD 2Q2LA 3P9MA 2EE6A 1OSEA 5DK2B 3JWOL 1BLNB 4XX1G 2ICWA 2F8OA 4MMZA 5MEPA 1CICD 4AM0Q 4TULH 1JGUH 2A4EA 2Q8AL 4YE0A 2E75D 4PJ9B 3GI8H 4LLMB 4PRIA 3L81A 3QO0A 1ZLEA 1CXFA 5BO1H 3IDYB 1UT2A 4K3GA 5J8OA 1JZ8A 1FO0B 1FNHA 3IYLW 2XV2A 3INOA 4N5EC 4P2OD 4TPRH 3PIQB 4Z7IA 3M91A 4XAKD 3B9KA 1KCUH 3BVXA 5CBAB 2UZYA 4AG4H 5F9JA 3KPRE 1L3NA 3WMM0 3DOSB 4BHUI 3QWRD 4HFUL 5AZEH 1QFUH 4H26A 4MA8L 4PCKA 5I2IA 1SEBA 3QJFB 5D7JC 3ROOA 1W2KT 3VCLB 1W0WA 3VW3L 4H2AA 1ACXA 4WY4B 3CSFA 3X14B 2F7PA 3VWJB 3U30C 5DJ6B 1L0NE 1SF5A 1YJ9P 2IALB 3MAWA 1G7PB 1ORSB 2X40A 1XGTB 1VFOA 4HIEA 2UUDH 1NLDH 4KX7A 5FW8A 2DM4A 3QEGH 1FDOA 2CDFA 4V1DD 1SQVE 4YPGB 2MCPL 3IDUA 3TBYA 3BT2H 1PFIA 1TVHB 5IZ7A 5E08L 4UZSA 1GL2C 2MQ3A 3GMQA 1JZJA 4Y99C 4AQ8A 3UBXI 5IHUH 3IGAA 5DLMH 1PYWB 3ZE1F 4AZ8A 4CBPA 1MAML 1UUSA 1DQJA 2GJJA 4N90E 1IC7L 3L1FA 5L9DL 1EZVD 5LQBL 2TRYA 2XQBL 3V6OA 1EQWA 4LEXL 3GUTB 4J3WA 3GSUA 2IAAC 2X4TB 2WB1A 4JX0A 2KLRA 2CPCA 4WDIA 2P45B 2DTMH 2ICES 3I6SA 3NMEA 1PLGL 5C0CB 3KZIE 3Q8EA 5H2BB 3DJTA 4OCXL 3TSIA 2AVFA 3HD7D 3MDJA 4H4NA 1A1MA 2CR3A 2J3SA 3IPBA 4HMDA 5IGXL 3B9EA 1EANA 5I8EA 5LUMA 4HT1L 3UTSA 3LD8B 1RAMA 5FA4A 4G6FD 2A6IA 5JDJA 3QULA 3RIFF 3RK2C 1QSEA 3CX2A 43C9B 1T4WA 2Y5TB 5HHQA 5JOFA 4QRQA 3K6SB 4GXVL 2XZRA 3L3OB 3GXTA 1QRNB 2ZX9A 5IVXB 4BQ8A 5EPMA 3MA7A 2X4OB 3MRCB 5ALCH 5E6ZA 5ELIA 3TS8A 3HS9A 2D3NA 5IB1A 1UH4A 5D4JA 1ZLWK 1KB9J 3UBGA 1KLGB 1JEKA 4HEPG 4KO9A 5DRXA 2ZP0T 3DX8A 4N2NA 3V4VB 1JZ3A 3DYMA 4FNTA 3ET9F 1DP0A 2QMKA 5HI3D 1PTZA 1RERA 3BVNB 5F7HA 1BXAA 2P7TB 1DLHA 5ICXA 3FUIA 1PD0A 5EU3B 5KVDE 2UY7B 3EGXB 1G9ML 2WTRA 3RPKA 1T5WB 2YD8A 3FOMA 1CG9A 4ORZC 4OGXL 3GXNA 3RY4A 3GRGA 2J12B 1CVRA 3D4YA 4PWJA 1KV7A 2JKSA 4EI5D 1U8KB 2G60H 4QMAA 4E2OA 2Q3IA 1OB1B 5CD3A 2XLLA 1EX0A 4NQED 2APTA 2DD8L 4GDOA 1ZV5A 5EG6C 2XXCB 4GOSA 4QHNB 1IGFL 1ZTXE 5T8IA 3TBSB 2ALAA 2QVIA 5C0JA 3N50A 2J57A 5KVGL 1I8UA 2KS0A 3V0IA 3B2MA 4UNVA 4NPEA 5JTWA 3US1A 3RIAF 1O7DC 4MJ2A 5IBUG 1RVFH 4XNAA 3OKKA 4WKZA 1NCCH 3WO4B 3JTTA 3S35X 4JFYB 2AK4D 3UADA 4IBSA 3L37A 2NUPB 4N2OA 3QIBA 4NO0D 2ZUYA 1Z9LA 2H7HA 2Z0BA 3FQXA 1C12B 1HSBB 4ZPVB 4Y5YC 3DMMB 5CCKL 3GSRB 4A7TA 3EOYG 4LOFA 1OKEA 2QVTA 2YOAA 4PJHB 4NP4L 5AVXB 4KI1A 1U3HA 3O2DA 3U0TB 4KJPC 5IWLA 1DVFD 5IP4A 5J1AB 2EE2A 3MBXH 3UTSE 1DD3A 2Z35A 2Z8RA 2ZPKH 4LHUG 4B9YA 2OQJB 2G8YA 3M9QA 4X6DA 1FBMA 1UHVA 1KPUB 1IILE 3KHQA 3RWIA 5GGTL 4CNIB 4UQBA 4K4KA 5JYMA 3UYRL 1A02J 3P4OA 4P5KB 2XQYA 2VN7A 2ZG3A 3QJUB 1QSFA 5LCVH 2ZF9A 1LXMA 1HVVA 4QT5A 1AQKH 4Y9CA 5C8JB 4QPEA 2N9YB 1MIEH 1KYOI 3BN9D 5E1HB 1RZKL 5D1ZC 3HN5A 5AVYB 3PJSK 5H2FE 3BAIA 4JFOA 4BFJA 1PY0A 3H3PL 4AQ1C 3DHMA 2B4CC 5GRVK 5FM8A 3MLWL 1N8RQ 4KKNA 2ORBL 1GCYA 1MJUL 1BD2E 3VP8A 1BZDA 2EIZA 2R0KL 4HCRL 4IBLT 1OW0A 3DOHA 4QRPE 4YHMH 3PWNB 3V79C 3PYCA 3SKNB 2QKIC 1NBYB 1G9HA 3V0WL 2JWDA 1CZQA 3PU7A 4GJTB 3VDCA 4RGNE 1VDFA 4A37A 4IRJC 4BWNA 2WIMA 1P84K 1QPPA 3IDGA 3LQAC 4Q9CA 1PV3A 3QYMA 4APQC 3BYTA 4QIRA 2ZXGA 3FN9A 3BAEH 3O11A 3QEHB 4JRYD 3S0PA 3NSXA 4FFWD 3WDJA 5CSZA 4Z3IA 1HI6A 4KJWC 4W6WB 2Y69B 2XV5A 1FRGH 1HH9B 4LO9A 3CZEA 3B2UD 3RWCB 5HGHB 1RSYA 3CFCL 1U57A 1CI5A 1JWUB 1PSKL 2VZOA 1NAML 4S1SL 3BW9A 5FM5M 4YNYA 1UATA 1RMFL 1XD1A 3LKPB 4I3SL 2Q76B 4PS3A 2ZOTA 3HE7C 2Y24A 3RK3D 3UEZA 4DERA 2IF7A 3ZE1B 1FFNA 2XJKA 4K5NA 4HIXL 1FNFA 4NBXB 2YKPA 2YUVA 3BKML 3CVHL 3PPEA 4U3HA 4OJDH 4A2HA 1FL5B 3S9DB 4WWID 4Z7OE 5EU7E 1H8NA 3U4BH 3ARGD 4UIKH 3V0DA 1AGCB 4W9CC 4NERA 2LKMA 1U8QA 1TNNA 3FO2B 3U7AA 3PNWB 1W72A 3ARYA 4OGYH 1MRCL 3B3IA 3U0WH 1MPAH 5C0IA 1WH0A 4M1GH 4HWBA 1X5YA 1NUFA 4BH7A 1JERA 5GGVL 3C6SA 1KBGH 4WSKA 4XP5H 1O9WA 4X6DE 2PP6A 1R3LA 3FONA 3VQLA 5C6TH 5B5EH 2YGQA 4U6YA 1LDPH 5EIQA 4XXCA 3T3MF 4IFFA 4F7MA 2QA4P 4J4PC 3WENA 5JPMB 1I1YA 1QSFE 3TN0D 1KCBA 5D1QC 2VZVA 4PG2C 1YHPA 1J1XH 3CZNA 2XV0A 4WFHE 5GGRY 2DM2A 4OLZH 3V0EA 4DKEL 5AD0A 4GSRA 2VR7A 4KY1H 3V95A 2XVKA 4GRWB 1MSPA 2QM7A 5CLZA 5IW6B 1D5ZA 5HY9A 5JZ7C 4KC3B 4MLIA 3Q5RA 2FYNC 1QYGL 3BGMA 2VLKA 1HAUA 3O3EB 2G2PA 3IN6A 3A24A 1I7RB 3DSNA 3S4SA 5K93A 3W37A 4YDJB 3U6RA 2A83B 4KK6D 1XXDC 2VGLM 1KIUB 2VMJA 5FDWB 3ZE0B 1AE6L 1GOFA 4K5LA 4AKOA 3AEGC 1E67A 3IETA 1J5DA 4LHUD 4ASVA 3INUL 3DX9B 5D7SH 4YHIB 1AJ7H 4F80A 3MLZH 4XCCL 3SCMA 2VN5A 4RMVA 1ZRTE 5DR5H 1O75A 1WIUA 1CBJA 4R2GB 3HS0A 3RVWD 1RUPL 2VJ8A 5CP7B 3HE5A 4PV1C 3FFDB 3U4AA 2XX0A 1RFDL 4OTXH 2BNRA 2Y1AA 2P43B 5JW5B 4LRIA 4FHKA 1RZGB 1WT5C 3AE9C 3EHBC 4HAKA 1FZFA 1KORA 3LS4H 1QLED 3AWEA 1Q9OB 3LEYL 4OZHB 5APTA 3W2DL 2VNCA 1SM3L 4JPKL 2ADFH 1SFCB 1RHHB 1F8TH 4QD2E 3TA3B 3BQVA 4FXLA 1MHPL 3RWDA 4OJCA 3FH7A 3FU3A 2WSCJ 1U3JA 1U8LA 2ZX7A 3O2VH 3KBFA 4E9LA 2AK1L 3CZLA 5SWSB 4LCVA 2BH0A 3JBG7 2QJYB 3JV5A 2QEJA 3ETBJ 3NOIA 1ILUA 2G2RB 4U0QB 3CZKA 4JM4L 3KWTA 3KPLB 4HETA 4B9IA 2MMXA 1SY6L 1YEJH 4DUWA 5DXWA 5DZAA 2OTUB 4POZD 3HNSH 4NO3B 5ITFB 4KROB 3GBMH 3ESVF 5BJTB 4X5PA 2HYNA 3GF7A 2W9EL 1ZXKA 5CHNA 4PYHA 4O02L 2ZVOB 3ZYOA 2DMHA 5E6UB 4UZGA 1NGPH 4L1LA 2YRLA 3FU0A 3PWLB 4JQIA 3L08A 3EJCA 3GMNA 3SBQA 4GLRI 3U7WH 2Z4TA 2CR6A 3VXPB 2YXRB 4DZ8A 2VLKE 3BGFC 3EFOA 5DD3H 5FO9A 4JZJB 1A9EB 1WPCA 2WKOA 3BJLA 4UYPA 4OVUA 1GYAA 4NHUB 1FVCB 3JSSA 2JB6A 2W07A 4TQEH 4BFGA 3Q2YA 1HNFA 2FBJL 4G43A 3ILQC 2BVPA 4G71B 2X5PA 1URQC 2Q1KA 3H42L 3BZ5A 3DRQB 1D6VH 2R44A 4M4RA 4YJZL 4XNXL 4M7KH 1O5PA 1LTAC 1CB4A 2WCGA 5JIIA 3VFWA 5BU8B 4HCFA 2OTWB 4JHWH 1XR8A 4FQIH 3KYQA 4PCTA 4WJ5A 1N0LA 5ETUA 5T3ZL 4JRXB 1HHHB 5GRVL 3WTVA 2Q7YA 2VRQA 3VTPC 1P1ZB 1EHLL 2BNRE 5MERA 3CSGA 3V4UL 2XNDH 4L75A 4V11A 5CEZE 3PL6B 5BV7B 5IHZA 4OCRL 4ZTEA 3TF5A 2CUHA 4U3FJ 1XSKA 2GCYA 3ARBB 3L45A 4LARL 4M6NH 4P3WA 3T0ED 4HKBA 2R2EB 2R29A 1I3VA 4IKLA 4QXTA 3DX4A 3GSNA 4KK8D 3CBKB 1EFXB 1EJOH 5AKRA 3GEWB 1NCHA 2FLRT 4KHTL 4M6MH 2HJLB 4C83B 3E1RA 5C7ZA 1FCGA 5LBSL 4YSDA 2C0XA 3PWPA 1KB9D 3FAWA 4IOSA 1I82A 1ZS8B 3WJMB 1KN2L 3D6YA 2JI2A 1E90A 1QLEH 4LLVA 4KNUA 3H1KE 4NCC2 1OTUD 3ZKMC 3TEUA 3HG1B 1V3LA 3PHOA 1BSIA 2K37A 4XNZB 3T3MB 2EDNA 5F1KC 2B59B 5ADPH 1KC8Q 4P2CG 4B9JA 1T2QH 2MCAA 3RKDD 4KJQD 3WS6A 1EH9A 1NAFA 1S3KH 2H26A 3TC9A 5LAXA 4LRNH 1I7TB 3RWEB 4ZI8A 2AJ3B 2IFGA 2IADA 4A2MA 2LU5A 2FFDB 3MOBL 4GB9A 2J59M 1O7SA 3NSDA 4UTAA 2C4XA 2XKNB 4TVPE 4XPGH 2HVKA 3D25B 4ZMZA 4RMTA 3TO2A 1PGQA 1GKOA 1FGVH 3SO5A 1F3JB 3KW7A 1QOKA 3TT3L 4OZIF 3D4ZA 5D7LD 1D7DA 1AZRA 5CIPH 4HGMA 4N3TA 1B6UA 3DHUA 1I1AA 4GKSA 1EBPA 4FFYA 5TE6H 1RQ5A 2CLRB 1UASA 3QIWA 5FFGA 4XVUD 3U30B 2EYSA 1FPTH 3CFJA 4PLJC 1UJ3B 4S10A 1T8ZA 4BCZA 4BKSC 5J3HC 3LPGA 3QUKB 3D50A 3V0FA 4HW6A 4XP6L 2DIBA 4JYCA 4JFDA 3TJEH 5CINH 4NUQA 3EJYC 2LE9A 3GHBH 3WFDL 3UZEC 5I8OH 1MWAA 3GLEA 2PLTA 3MLVH 3S2AA 1X7SA 4NCC1 1ZT7B 2APFA 3V10A 1SMAA 1N7SB 1KBPA 3LYRA 4Y2NA 5D6DA 5EU4A 5C7XH 4MBOA 4AJVA 1GC1H 5DZOA 4J12A 2V2WB 1MQ8A 2OR8A 4AWJC 4A7QA 3F6LA 5BMFL 2QPUA 3H4HA 1U8NB 3Q9QA 1YY8B 3D09A 5SWZD 4KO7A 2EDYA 2VXTL 5GZOA 2X2UA 1TMQA 1CBVL 4AC2A 1GW6A 1GGCL 1IC5H 5AVQB 5KUMA 2R3SA 1F1AA 2XQYK 3FF7A 3HTKB 5MHSD 4HF5L 4M5YL 1BEYL 2NLJB 1RJLA 3EBGA 1J1DB 3ATDA 3HB3C 3HIZA 3QXDB 4HZLA 4OCSH 3PDOA 4Y4FC 1NCUA 5EOQH 4FL4C 5JIMA 3A67H 4OCYH 2PW1B 4EZLA 3ZK0A 2ITAA 1U8HA 3DV4B 3EBHA 1BIIA 4GUPB 5IFHL 2VIRB 2HAZA 1OK0A 4UTCA 3WKNA 2J72A 1GVIA 5DD1L 1NGXB 3O6ML 8FABA 2OYOA 3QHZH 4XN4A 3PHQA 2HKFH 2KQMA 1KB9H 3O2WH 5T1DL 4N8UA 1FLRH 1RZ7L 3HMXH 3F8UB 3FTWA 4HD5A 4ZSOA 4ZFGL 4LPYA 3HW7A 2VL5A 1YNLL 2CKBA 2VABB 2G3MA 4PJEF 1KLUA 2D2OA 2CMRH 1H3PH 4Y28J 3D8MA 4M7LL 3W81A 5DEGB 3O8XB 3ZR6A 4E5XB 2YWYA 3K72A 3DXAA 2HMIC 1MCDA 3C08H 5DJDA 2BVQB 5F96H 4MQXC 1NKGA 4ZZKA 1AO7A 3CL3D 3LV3B 3BRVB 2C9UA 1M1JC 1YEIL 4I0PC 3IDIA 4DSYA 1MQKH 1MCRA 1GJWA 3S37X 2OMBA 3Q8FA 3VXUE 1IB5A 2AV7A 5GGRA 5G2NA 5ICZB 1A9BB 3TV3L 3NIFF 2H9GB 2WWKO 2UZIL 5HDWA 2CHDA 4CSPA 5KVDL 4WHTA 5A16A 3TVMD 2WZAA 5IK3B 3P02A 1I7UB 2EH7L 4LIQE 3US9A 2H3NA 3CC1A 4OFKA 1EXJA 2OSLB 3HTLX 2KP8A 3KPQA 4U1IB 4HUUA 4WWOA 2QEXP 1MREH 5F7EL 2EDRA 2J1XA 1OM3H 3PXJA 3GG2A 3OGCB 2CPSA 1AS7A 1KJ2A 4MNGB 1K8IA 3H9ZA 3WHXB 4JY6B 6PAZA 2QQNL 5DC9B 3DV6A 1T80A 3LSOA 4R8WL 2J43A 3KCPA 3IN2A 3KPPA 4WAFA 2QFPA 1FH5H 1H6EA 1JS4A 1ZTXL 4QHMB 1T2KC 2D31A 4Y5YB 4F37K 1IQDB 1ECYA 4A7GA 1EEYB 1MI5A 1N5AA 1SQQK 2CDEB 1J5OL 3K80A 1T83C 1N86A 2XDHA 4XPBH 3ZMNA 3AG3B 5H37A 4LMQI 4I18A 1R17A 3DVNA 3U9UA 1NTDA 4JDVB 1Y1DA 3C8HA 3AE1C 4RNRA 3T6VA 2ATKA 2R7EB 5TQ2L 1MVUB 3CMOL 4DWHA 5BNXD 1BAWA 4YHZH 4U3FG 1EAPA 1K8DA 3CXHJ 3LX9A 2ETWA 1A7QH 2E46A 1OZTG 3MJ9H 3EOAA 4M3KB 4JKWA 5ALBH 5DJ2A 5KUKA 1WC7A 5EBLA 3TDKA 1YYLL 2DH2A 2TRHA 2WO4A 2ZX8A 4H88L 1CFSA 4JO4H 4WFFE 2VAAB 5TE7L 1JY2N 2QADD 4G9FA 4QXGL 4YDKH 4AQRD 4U7SA 1JVOA 1DQKA 3FCTA 2AQ1A 5D1ZB 3PGCA 3QZNA 4G8GA 4ACTA 2ZKHH 4X4XB 1OPGL 3S35L 4NSKA 3FU7A 3U2IA 4DK5A 4C54A 1G6RH 1NJ9B 2GSIB 3T1FB 1NKOA 5HD8D 3L4VA 4ZUTA 4FGMA 3WDIA 4QTHA 4YZWA 1X4YA 1KENL 4XT1C 2QTVA 1XCQA 2JF1A 3GYRA 5J11C 4TSBH 4AOFA 5HYFA 4JZNA 2N7AA 1TQSA 1A9VA 2I9LA 3O8ZA 1KELH 3O6FC 3QIUD 2L7QA 4IRJB 3TP4A 1JFQL 1FYTD 3VMYA 2E7BA 1VFBA 2OMUB 1JD7A 3I9GL 4MMYB 4A7UA 2PW2B 3VSQA 4QRTB 2NW3B 5AW7B 2DWDA 4FQPA 3KXDA 1LVEA 2LGNA 3G08A 4CN4A 5KN5A 2J21A 1QUNA 1NTMD 1HZLA 5FYKL 5DA0B 5JO5A 1IFRA 1M7UA 5K9OB 3EYQD 1I8IA 3O9WC 4Z7UF 4MSWB 4Z0XB 4DFHA 2GTWB 4AEEA 1AHMA 1KGCD 1LEGA 2ZNXA 1DVTA 2ZXCA 4AMKL 1CICC 3BC9A 2OMNA 3QW9A 4QCIB 3VTAA 3FUFA 3S3PA 4ALAL 1M8OB 1AHWB 1KIQB 3L1OL 3KR3L 1H6FA 1R24B 2CH8A 2E75C 1KBWA 2GT9A 3V4LA 2FRGP 1HH6B 1JGLH 3LNDA 3BWZA 4GKZB 2WYIA 4KJYB 4ABUA 1OXYA 2BVOB 4P2OC 3D9AL 5DHVH 4CVXA 3CLQA 1JE6A 3BKJH 4PTTB 3RDTD 4P46A 2YEZA 1MI5E 3HPLA 1EZLA 3A0OA 4YXLH 2ARJA 4PJ7F 3B2XA 1QEWA 4LASL 2W83C 5E5RB 3QUYA 5T5FH 3KM2A 1PP9J 1NZRA 2WQYC 3OKNA 4L3ED 3AEDC 3G5XB 1HH0A 2XIDA 1G7IB 1YJDL 3CXDL 1W2BO 4U1JA 4BIKA 1RZQA 4BDVA 2OYPA 5IMOA 5D1ZI 4LGRB 1W91A 1AACA 3QUZD 4G59C 1WE5A 3CCHA 5E70A 1ZE3H 1NFIA 2UZPA 2WBKA 3MRHA 5C1MB 1UEYA 5D7IA 3L2LA 1LILA 5CGBA 4NDMB 3O2DL 5J6HA 3GZOA 3CFEB 2PTVA 5I6NA 2JNZA 2WWOA 3LZLA 3UIAA 4CJ1A 5ISZE 3QDJA 3PQYE 3SDYL 3WIHL 4CA4A 1AY1L 4WI8A 4EAEA 4JFFB 5B7FA 1S7SA 1DQVA 1BJ1J 4E0RA 5EF1A 4MD4A 1Q9LB 1N2RA 1MCBA 2BVEA 2HVBA 5JHLA 3MRDB 1SYVB 1UG9A 1ZJBA 2KUTA 4FQCL 3NXSA 1B0GB 5JXED 3TJPA 1FZGA 1A4CA 2YPLA 1BM3L 3R8BB 4OJFL 3DTXA 3L5WB 5C0EB 4G83A 3QEQB 3HD7C 4KTDH 2HG5B 1L9SA 4U3FD 1G1JA 2QZ5A 2Z4QA 5F1NA 1KILD 4FQ2L 4I8DA 5E8PA 2QR0B 4YC2C 1DCEA 1A6TB 2X6VA 4CN6A 1MUJB 3FTVA 3DUSA 3WLBB 1HEZB 1MF2L 4GPVA 4PV1B 5EO0A 2Y25A 2XNXA 3Q06A 2F18A 4E9TA 4X6EB 5CJXC 2IFFL 3VNZA 1G9NH 1KFMA 2O6FA 3MV8D 2GSGA 1JMBA 4BKTC 4AIZB 5TDOA 4HPOL 4EUPA 2VDMB 4OM1L 3QBTB 1GK6A 4OGQD 2GQHA 4GSQA 2ZX5A 4XVOA 2V7QJ 1RJZB 3APDA 3H54A 4OZIE 2Z92A 1CLZL 4UYQA 3IMBA 1I31A 1OHQA 5E9DD 4X9FA 2L04A 3HFML 2Y06H 5IB2B 4M8RA 3D33A 1DDHB 4LKXA 4ZW8A 3EO9H 4GEJA 5HI3C 3V0JA 1YMME 3MRLA 3W38A 2WSCH 1F1GA 2VDRH 5T1KB 1WCBB 4OBRA 5DJCA 3O3UN 1ZANH 2OMYB 3V0AC 5CCGA 2O61A 1PF3A 4K23L 3P30L 4Q56A 2PCFB 3VFNA 5LGHH 3I2CH 2WVSA 4AEIH 3N44B 2YZ8A 4U3SB 3V9EA 3BATA 2HFEB 3VI4B 4EI5C 3CFTA 3IKKA 1Q1PA 4PP2B 3UPAA 4HSQA 1UOLA 1GSKA 2HZHA 3HS8A 3B4NA 3RWJA 4NEHB 3MBED 2GFBA 2EUVA 2IBZE 3OLIA 3K5BA 2YXWA 3T08A 1F58H 4X5WB 5D7IE 3CMAP 5I1KH 1MAKA 4W9IC 3VA2C 2YSTA 4KNTA 2ZXXA 4APXB 4NUPA 1KN4H 1XF4A 1QWUA 3O4LA 3G6AA 1EXGA 3ILPA 1D5IH 2GIXA 2W5PA 5BZWB 4QYOA 5DHDA 4R9HA 3QDJE 2OX5B 5JIHA 3LRLA 5FHBL 4ZDHB 3D2UB 4P9MH 3GTTA 2RFXA 3SDCD 3AWGA 3ZKQD 2YLKA 3MREA 4HISA 2B15A 3GSXA 1P7BA 5HGBB 3IBEA 2WLZA 4HKXB 3C5JA 3OJDB 4L8BB 1HWGB 1MLBB 5KBNC 1XF5A 2W60B 4FQJH 4PVBA 1OSZA 3Q2VA 3CDFA 1YZZA 5ERWA 5CCHA 4C58B 1XGPA 4UQDA 3K6IA 4Q9QH 1P9MA 2P8PA 3AG2B 5KZCD 5F3FA 1DVFC 5D1QE 3VGGA 2AV1A 1J1PL 3QHFL 1WLHA 2BIHA 4NC1C 5C0ND 4L9DA 3OAZK 3JYCA 3IGKA 3MGOB 1ZR4A 2WCPA 2X53A 1GK4A 4NKIL 4DPBX 4PJEE 4QRUB 4GIAA 4HLEA 3SYCA 3HE6A 5FFLA 2G5UA 4H0LB 4DFIA 3BH8B 1BXUA 1EDLA 2AEMA 4UM9B 1GIGH 3P3SA 1Z9SB 2BWDA 3BN9C 4I1RA 1BGXH 5HHME 1JXDA 2F61A 4HBCL 3AE3C 2V7NB 1J0YA 1FZOA 1S72P 2PF6A 1D9KD 3HKFA 1EMTL 4ZMPA 4MFHA 2JJLA 1H8OA 2YRPA 1ETZA 4N0YH 2FYUD 1TSHA 3NIFE 5C07A 4F2MA 3ARFA 2ZCHH 1Y07A 3L9YA 4JGMA 3MRPA 2VERN 5CEZL 2HN7B 5DUPL 3UPCA 2KPWA 5E24E 4PJXA 2ZX6A 5DD0H 3VFPB 1NPUA 4FXTA 4LC1A 3NGBB 1J5CA 3T0WA 4FFWC 4IRSB 5DJXA 4O5LH 3K8KA 1U2CA 3MJ8B 2WAHA 1ZLSL 2E7DA 4PBWD 4KV5F 3B2UC 3ZT5A 1X5AA 1JZ7A 2CO6A 2QFRA 2OI9B 2V3EA 3OF6D 1OAZH 3CX5I 4DP8X 5DJZB 1MCJA 3KLKA 2D7QA 1KB5A 3L6FB 5C3LD 4QXUL 5T1LD 1ZAGA 4RGMC 3RK3C 5IUCA 3RY6C 1VADA 3LS5H 3D87B 3RJQB 3MHVA 4YK4C 4ZQKA 2P8LA 1Z3GH 2CO1A 4NS0A 3NJXA 4LVEA 4RGOH 4DVBA 4XPFH 3ARGC 4P4KD 3H9SB 1OVVA 3TO4D 1S5HA 3ES6B 5AAMC 4KNSA 3SE4C 4F7EB 4PB9L 4JG5A 3KGUA 2QGBA 4FQXA 2WGXA 4DGIH 1H0TB 1QFWH 1PQZB 3UTTB 4GRLB 1G0YR 5DJYB 2P1YA 3B56A 3L4CA 1HCVA 5F89B 2B08A 2HFFA 3UEQA 1CIUA 3VJ6A 3VFTA 4TVPL 1IZNB 4BXSV 1T21A 5DDHB 2PR4H 5CJQH 2AKRB 4A55A 1SOXA 1LQSR 3EGDB 5AW9B 3UOAB 3E38A 2C3VA 5F9OH 5B1CA 3WE6A 2AEQH 2HRGA 2TAAA 3TN0C 1ZLLA 1MVFA 3VFVB 2Y6SD 2EACA 3UTPD 4DHLA 4GT7A 5AFAA 4PG9B 5J7CC 1IBBA 3OKDA 2KHAA 1OFCX 2XC8A 4XGZA 3SJVA 4F5CA 5DQ9B 3CXHD 3NCBB 5I6LA 4HUMB 3GTNA 1JAEA 2MNUA 2D7PA 1GRWA 2KS1A 1NFAA 4LCWD 1E9OB 1S6NA 4WY7L 4DNLA 2MSPA 1JN6B 2OULB 4GG8A 4Z7UE 2OZNA 3FMGH 1CDHA 1RD6A 3KH4A 3NA9H 5I16A 1AQTA 4H20H 2CGYA 4PJXE 2WZ7A 3CZJA 3HB3B 5I6MA 4P9HL 1JHTA 1N4XH 5CWSB 4UQ3A 4AYEC 4I6MC 1CYGA 1ZPLA 3TT1L 2NNAB 1NSNL 3T4YB 3L4ZA 3OHXA 1DJSA 4FG0A 5I76A 2NY7L 2KNCA 3QJSB 4X7SL 4ZT1A 3QUGA 3RVWC 5HYSB 3P3TA 1FV1B 5JMRA 2E76B 1TYRA 4PJ7E 1TZGL 1OGPA 1G84A 4HK0A 1SJHB 3IVKA 3NVQA 1USDA 1A7BA 4P5TD 4PJ5D 5JR1L 1K5NB 4OLUH 1JGVH 3V8CA 1AGEA 2X05A 4AEHH 3EBAA 1VPOL 3G6JF 2BSSA 3X1BA 4BFNA 3QJQB 4HSAC 1EGJH 1UKSA 2F7RA 3O3BB 4JFTA 2NRGA 1C16B 4KO6A 1T1WB 4UT9H 1UACL 1ZIBA 1PS3A 1SS1A 4I0PB 3SBWC 3EJRA 3GMOA 2UWEF 4JKMA 4ZRGA 3VXNB 1J11A 5ES4B 2DL9A 1EHXA 3VXRA 3WN5B 3VG0L 4EEEA 2ESVA 2ZAEB 5E1QA 1QLFA 2HJKB 1YG9A 1SQXK 3IXAB 1BGYE 4R4LA 4J3OD 4A66A 2VMDA 1GW3A 4M7LT 4UQAA 3Q0HA 1FN4B 4NIKB 4F3FB 2OAAA 4E9VA 3CDZB 4Y1TA 1FDLH 1MHEA 3PF2A 1BPVA 3P4MA 5DD5H 5BPPA 4POZC 3FH8A 1DEEG 1PP9D 4OV6F 2EINB 5E2WH 3EH1A 4HS6B 1N73C 1IIIA 1HYSD 1LP1A 3K81A 4RWYL 2ARJQ 1A7OL 1JXFA 4QTIL 5HYJD 3DOIA 5E5LA 3SJVE 3G5ZB 2WITA 4FOMA 4HV8A 4PIRF 2DEXX 2YD5A 3EOTL 3V6IA 3BP4B 2LXBA 2Z31A 4IJ3C 2ODHA 4HIHA 2BY0A 3PAVA 1T04B 3TYYA 3WS3B 1BQLL 4FE9A 4LIQL 3OKMB 5AQ0A 5F7LB 2JKNA 3CLWA 4DGYL 1L3WA 4QRRB 3RZCD 3MACL 2M1KA 4F7CB 5JIPA 1MWAL 5L2KB 1QR1B 2R2HB 3BCCE 1IAIH 1ZEAL 5E7BA 1E4XL 4X6BA 3H0TA 4DZBA 1U8PB 2CNZA 3CXHH 2B77A 1TQCC 1IM3B 3HPJA 3BMWA 5JQ6H 3MNWA 5CLYA 4RX4A 2GEEA 3IE9A 3NAAH 4PSRA 4UILL 4Y19E 2YD4A 5DJTB 3NFNA 1GC1C 1SQMA 1YEEH 3BPOC 4BK5A 5BQ7B 2R23B 2K8MA 1OPOA 2AJZB 4OB5L 3MODL 5EIIG 3OWRA 1XAKA 2IPUG 5JHDB 1JV2A 4U1SA 2PGDA 4P8QA 5KTBA 4YHLH 4H25A 3M07A 3ZMEA 4JHAH 3ATAA 4W9JC 5CSGA 5LDSA 2DRUA 4H0GA 3HLAA 3QORD 3T0EC 1OP5K 4LKCB 4ONFL 4Q7DA 3T0XA 1Y0LB 1MFDH 5L7XL 5C0BA 2GVYA 1ZR2A 4OKVB 5CR8A 4RA3A 3B4SA 1NFDA 4KK8C 1R3KB 3ZKSD 3CVIH 4PI2A 3FB7B 5BXFB 2XRAL 3UJJL 3E8UL 3O6FB 4R7DB 3JYBA 1IFGA 1W2EA 3U2SB 5EZLA 4ZD3L 3BVTA 3BUQA 3VE0A 2CKBL 5AZ2L 4M8QB 2R0WH 4Z78A 1WWAX 1RZJH 2ESVE 3DIFA 3D39E 3H9YA 3EJSA 3IXTA 3U1AA 2VO5A 3NK3A 1DD4A 2APXA 2AQPA 4J3SA 4R3SA 5ESQA 5K1JA 3I02B 5JNYB 1OTUC 2C26A 4N8CH 5I74C