5AVRB

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 1.5 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5avrB01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5avrB02
5AVVB 3A7OA 3IR9A 3TNUB 2KP8A 1CI6A 1GU5A 3NXSA 1SP4A 4JYCA 1T2KC 1H89A 4RETB 1CSBA 5CMZA 3V5BA 4XE5B 1NWQA 3P32A 5AVTB 5AVQB 2Q7CA 2XZRA 3SWFA 2WT7B 1KQLA 2E42A 3UIAA 3V4QA 5AW1B 2P7JA 5APQA 1X8YA 5AVZB 2P2UA 1HWTC 1IO4A 3L36A 2C9NY 3WGVB 2WPQA 1FOSF 1GK6A 2E43A 5APUA 2W6AA 1H8AA 2W27A 2VRSA 4M3LA 2WT7A 2BASA 3M06A 1GZLA 5AVWB 5AW4B 5AW5B 5AW3B 1HBWA 5AVYB 5AVSB 3KQGA 3A3YB 2Z5HA 3NFQA 5APSA 3VYIA 1S9KD 4I2LC 3VMYA 1A02F 3LIDA 1GTWA 4C7NA 2H7HA 3L35A 3V4WA 3P7KA 2R3CA 3HE4B 3LIEA 3A5TA 2QM8A 3VMZA 1H88A 5AVXB 1GU4A 3O8ZA 4GKGA 1A02J 5AW9B 3T97A 4RESB 2Q3IA 2IPPA 2QM7A 3M0AA 3TYYA 3L37A 3NMDA 2WPSA 1SLQA 1MUUA 2Q5UA 3NTNA 3A2AA 5AW6B 2JJLA 3WGUB 5AVRB 3HE4A 1CI6B 4LC1A 3M91A 1GD2E 3VN0A 1OWAA 2ZXEB 5AVUB 3I5CA 1DH3A 4AYCA 2WPRA 1J2JB 5AW7B 4AQRD 3HE5A 4B86A 5AW2B 2ZFCA 4GT1A 1CZQA 2R5DA 1S9KE 2Z5IA 1JNMA 1T2KD 1OXZA 1GK4A 4KHXA 2N9BA 2YO3A 1FOSE 5APVA 1MFZA 4JYBA 5APXA 1NAFA 3VTPC 3HE5B 2WWWA 2XU6A 3B8EB 2R5BA 5AW0B 1MV8A 2P67A 3MD0A 3TK1A 3M9HA 1HUCA 4C7NB 4EOTA 2C9LY 1YYCA 1G2CB 5APWA 5AW8B 3M9BA 4DZOA 4HYTB 2YO2A 4C46A 3KDPB 2WTYA 4AUWA 3P8MC 3OAKA 5APYA 1FAVA 1HJBA 3VMXA 4I6MC 3M0DA 3MGNA 5APTA 2R32A 2YNYA 2XV5A 3HTKA 1JUNA 3TNUA
chains in the Genus database with same CATH superfamily
4LCCB 1Q94B 1RZ8A 3MJ7A 4I3RL 2KHAA 2EIZB 3P30L 5DC0A 1NFKA 5ICYA 1QKZL 1JPFA 5F93C 2KXPB 1SQBD 1ZLDA 4J3UA 1FS0E 3I9IA 3RGUA 3IJEB 4FJ6A 3P32A 5LGYA 1S9XB 3HRZC 4WI0A 5E5RB 2GCYB 2X2JA 4YBQC 1KB9H 2KL6A 2Y6SC 4Z7WA 5DJ8A 1W2BO 1VJSA 1V3LA 4U6XA 1I9IH 2G2PA 2VMEA 4EIGB 4X5WB 1HESA 3HLAA 3ILQD 3KZ8A 1J9TA 2BNQE 1X4YA 1Y1UA 1NM9A 3OLDA 4IOFC 1R3JA 3CHSA 1KJ2L 3LQAL 4HBCH 2JQZA 4M43L 1ECYA 1JZEA 2MCG1 4OFYD 3DOIA 4JM2D 5L6YL 2VR7A 4BBWA 2P5WE 2WLNA 1KYUA 4NPYA 3W0WA 4QXTA 5EOCJ 3AJ7A 5CEZE 3WAKA 3I9GH 3VW3L 1IX2A 1CDBA 1KXVA 4DKFL 2GJRA 4Z18A 5DJ2A 3N40F 3B5NA 4X5QA 2PW1A 1PKQB 3GBEA 3VFMB 4KDWA 4RRPG 4WVZA 1OAQH 3CZUB 3WD5L 4P59L 4ODTH 1H6TA 4R96B 2O72A 1L4IA 4GBXC 1CMOA 3L2LA 3IJYA 1NANH 1TLMA 3A2AA 4KMLB 1K4DB 1T1XA 3RTQD 4BUHA 2AF2A 1I8KA 4GP5B 3ZT6A 5MENA 2DMGA 5AEAA 3V4PA 1WFTA 4L5FL 2H0EA 3KPRB 2EYRB 5H94A 1LT9A 2Z91B 3Q2VA 2HKFL 2EYRA 3HG5A 4QWWC 2N0KA 1SOXA 3R7RA 4EN3C 5I26A 3BIKA 1HJ0A 4Y5XA 1IFHL 1L0LJ 2WWNA 5E8DL 2OA9A 1MZZA 3IFOB 3VMNA 5HJGA 3CK0H 2GHZA 4BWWA 3WS3A 2PWEA 2P7TA 1WBXB 4GODA 3RK3B 1CR9L 1UKSA 2CBOA 4Z0XA 3U48A 5BZXA 3B2UD 2FYNB 5IV2B 2H9GA 4UDUB 3NJMA 2QQNL 3BDBA 4BFJA 4JQXC 3ULUD 3HFFA 4X7TB 3ARPA 3BAWA 1X5LA 1JMBA 2VC2L 2IADA 4DSYA 4YMPA 4J5VA 4XPTL 2C7UA 3OXSA 1A6ZB 3GIZH 3G3ZA 4KHXH 3UTTE 4DK3A 1XEUA 4PJ5B 1A6AB 5IB2A 4E5XG 1E28B 2IQAB 3LD8B 1VACA 2CHZA 1UGNA 4GI8A 1SLUA 1YPZE 2Y4SA 3G04B 3CX5J 4S10A 2EEAA 3RRQA 2ZOTA 1I1AA 2N1KA 2W0LA 3QGVA 2GJ6A 1MFNA 3QEGH 4PP2B 5E8PA 1URZA 4DN3H 1JXJA 3JZYA 1OGAA 4DETA 4JRXE 2QJKC 3W5NA 3N43F 1RZIA 3G08B 1S7VA 2E7BA 3P0VH 3V7MA 1IBGL 4F33A 4D8PA 1GL2D 3HE7A 2E9GA 2F6AA 2J4WL 3ARBC 4G7YL 1A22B 1SP4A 1RE3A 3Q6FA 3ZHKA 2J88L 4XAWL 4FI6A 4OD1H 5DC9B 1ONQA 2VDNH 4XFJA 1E27A 3AG4B 1REIA 4BA8A 3CE1A 2WT7B 3FB8B 5D1ZC 4F7KA 5JR1L 4YZWA 1XTMA 3H3BC 1F58H 3MLVH 5C0NC 1P7QB 4LAJH 3JTSB 3RVWC 5DRWB 5ESVB 4XP5H 2NY4B 4Z6AT 1T89C 4MXWL 4NO0B 1E4KA 1Y7VA 5H35A 3WFCH 1P4LA 1PYWB 1QSFB 2HX9A 5DJ6A 3K71A 4POYA 1ODAA 1JGDA 2L4OA 1AXTH 4N2AA 1OAUH 5C0GB 1AR1B 3GBLA 1JZ7A 5F7UA 1P5UC 1YTZT 2AEPH 1HI6B 2QLYA 32C2A 3FQWA 4EZLA 5HYSG 1SFDA 1TOXA 4DTGL 3CC2P 2K6YA 1XD1A 2XVLA 1WMKA 4FG6D 2R23A 3M1CA 4FEMA 3LZFH 3SPCA 2CDEA 5DD5L 4K3JL 1IBGH 2BZ7A 3MACL 1XGQB 3ZR6A 5AAPA 1RHFA 5C0IA 3MNVA 5F1IB 4BDVB 1E5ZA 4HOWA 2KYVA 3D1MC 1QA9B 2WSSH 2VQTA 1G1JA 2WOBA 4JREB 5I6KA 2J5LC 4K8RL 1J1OL 2XQYG 2YA0A 3RWFA 3HBZA 3V0HA 3ZDXE 4EPSA 1X7TA 4OCWH 1BA9A 4Z3EA 2HKHL 4OR1A 1ZEAL 4ELDA 2HG5B 3AGVA 1YPZF 4JG1H 5DVOA 2FBRA 1HZHH 1OM9A 1YCSA 4LEOB 4XNUH 5GSVB 4X7CC 3MUGA 2W90A 1P1ZB 1YY8B 4R97B 2PW2A 5LN4A 2EIKB 4AQ1B 3EO9H 3WKPA 4OB5L 5E0QA 2MOGA 3WY3A 3ESMA 1ETZA 4QGTA 3SJVE 2A9MH 3NCYP 1WC7B 3GINA 3D39B 1LXMA 1PLGH 3NAAH 4G8FA 3ESPA 4ATWA 4F5CE 3MRRB 4XX5A 1QSZA 1O5DT 4NKIH 1BLNA 1AH1A 4BYHA 1DDTA 1P4LB 1PYWA 4G8GE 5DJ6B 4XCEB 3SPGA 3G6JA 3MV8E 3SO3B 4XMPH 3AM8A 1QZNA 1X6LA 3B5GA 4MA3B 3S3PA 2FFDB 3OJMB 4H1LG 4OZGF 9CGTA 5KVGL 3S9DB 3EOAB 1T4WA 3C60A 3LRSB 2YIUB 5DK3A 2PR9A 3QS2A 4EBQH 3MBEA 3WG7B 1II4E 3INUL 2AEJA 3VRIB 3H1IG 4XGZB 2WZ6A 1GGBL 1RQUA 3WUZA 1IM3D 2YEVB 1AQTA 2IFFL 1INDH 2Y2YA 5TE4L 3UADA 1NEZA 2MOVA 4QYAA 5J1SC 1IL1A 5DZPA 1DQMH 5I1KH 3LX9A 2YPKB 4KROD 5GGRY 4O2CA 1YNKH 3LQAC 1MXDA 3C2AL 3CSTA 4Y4FC 5E1IA 4JKLA 4ZS6C 1XF2A 4DCQA 2F74A 4JZJC 2AJ3B 3O4OB 4PP2A 3GPEA 1A14L 3GSUB 1CWVA 2ICCA 3QDAA 4S2SB 3CMAP 2BOBA 4WWKA 4XT1C 3U25A 5AYQA 5L7XH 1ZKAA 1NJ9B 5CCGA 1DQTA 5IB2B 1CFTA 4AG4H 1BD2D 3MZWB 1OP3H 4N8PA 1J7VR 4NDMB 1KILC 2CRIA 1F11A 1LK3H 3KHOA 1UT1A 4TPRH 1EANA 1GS8A 1H3VA 1AAJA 1N3NA 1NPJA 4ZUVB 3VUAA 1JVLA 1SJXA 5IIEB 1FL6B 3CWGA 4L3EA 2WUCL 4X9YA 4YHIA 5JXAL 1DE4B 3P30H 5MI0B 4CJ0A 2EDWA 3ZYJA 2CBQA 1FIEA 5J13B 3VU1A 1GZHC 1UCTA 2KI6A 2VW6A 2HLFC 2UZYA 1F4YH 4I4WA 4WJKB 1LO5B 4PLJC 4M62H 3L73D 4LKCA 2WYHA 4JFPA 2BSBA 1JV2B 3BAEH 5DMGC 1WYJA 4B41A 5KYWA 5L9DL 2HFEB 3EG9A 3LMJL 1LTIC 3RY6C 4ZMPA 1PY4A 4L0YA 3F83A 3FSOA 4MA7H 1SN2A 3FB6B 1U8IB 2PW1B 1DD4A 1DQDH 4KU1A 5BW7C 5KYNA 4UZSA 1BQUA 3N0AA 2ZT9D 4Y16C 2AJZA 1B0IA 1PL5A 1UJ3C 2NY0B 1I8MA 3SY0B 4X83A 1W72A 3KLAB 2I1JA 1NEZG 4I3GA 3GSRA 4L2YA 5FO8A 1FI8C 3M1BB 3DUSB 3OF6A 5D7KD 2HPOA 1J9CT 1PGRB 3VFUB 1ECZA 5TGBB 1D6EA 1A0QH 3RWIA 3PXJA 5EO1A 4YDKL 1NC4A 2GVYA 1RQVA 3BPNC 3GBNL 3T4AA 2WLLA 4FXKB 3VXRB 2AXFB 3BUYA 3V4UH 4MWFB 4WI0B 3IEAA 5LGHL 4JFFA 4P9HC 3HI5L 5C3LD 2J8UF 5TE7L 4P4RA 2N56A 2IF7A 1L4AC 5L8KB 1BAFL 1S5HB 4MS8D 1J86A 2FEDD 3N9GH 2UZXA 3JTTA 4NNXB 4R0LB 4BZ1A 3QJSB 3MGNA 3EFFA 1FZJB 1VESA 2XWDA 1AHWA 1DDHB 2HYNA 1LWRA 4XODA 4EN3A 2AKRB 4IKJA 4S1RL 1V7ML 2DBLL 4ADGA 4MNQB 4Z95L 1CLVA 4OKDA 1NAMB 4HKBA 5D8JH 1KTJA 1FG9C 3MRGB 4DVRL 5DUBB 5L2KE 2JK5A 1AHMA 4K3AA 3L3JA 4A37A 3QFDA 3OSKA 3IBOA 3OJ2C 5E8NB 4FQXC 4LLWB 1R5LA 4TQEH 3O0RL 2Q7NA 2Z7YA 3T6ZA 2I8DA 3MRJA 1WIOA 3ZRCC 4JFYA 1VEPA 1CK0L 4NQED 3RILA 1OTUD 4MJ4A 4PS3A 4WEUD 4IW4C 3NSXA 3GHGC 4DH2A 2NTFA 5I0XA 4Y19E 2DJSA 4XMVA 1F1AA 5FUCC 1A1MB 2V0AA 4XNQB 3P69A 4J23A 2QVFB 4HAKA 3AWFA 2DQJH 3WUWA 3F12B 3VFRB 5FO9B 2H2SC 1MCOH 1P53A 2ZWNA 1PNCA 4KX8A 4MMZC 1CD0A 2JCCE 4OGXL 3L73J 1MJJA 3NFQA 3FXEA 2K1AA 1QLEB 4JZNB 3IFNH 1IC7L 2FZ3A 2TSAA 4HETA 4NQEB 2BW5A 3L5XL 1VFMA 2CR0A 3RX8A 3ULUC 3BCCD 2XICA 2KKQA 4NI6A 1GU4A 4YLQT 3WTXA 5HP5A 1A7QL 3PJLA 4AH2A 3GRWH 4HWBH 1AGFA 1OMIA 4W68A 4WKZA 1IKNA 2FL5A 5I24A 2JF1A 4OIFA 1PG7L 2YD4A 5FGBC 4HUXA 4XN8A 3DK0A 3RPIB 2DIJA 4IEFA 4R6UA 3P9LB 1EXUA 1RU9H 1IBHA 2B87B 1UGKA 2SEBB 3UZEC 3EDEA 3FUHA 5ISZD 2RMZA 2J71A 3JUZA 3DPBB 3QUYD 4QT5B 1KEML 1NL0H 3ESUF 3ZJAA 1NC2B 2P8LB 3R1GH 3DPDA 1T0MB 4OLZH 1PFOA 1JYVA 1MY5A 2J8UE 1AIFA 1ZT7B 3C8HA 4W4OC 3TBTA 5CJQH 1XGUB 2CUIA 4G6JL 1T83A 2XZAH 1HCVA 2IANE 1IC4L 4Y9BA 2OXGA 2VLKD 2J8HA 4WCYH 4FKEA 4HLZH 5K1JA 2AEFA 3SDDC 3NFSH 1ZRTE 1X5JA 4PGCA 4F7MA 3PAZA 3F05A 3WTSA 2XJKA 5DLLA 5HVHB 4YHZL 3D50A 4I1NB 3VXRE 4CN6A 3DTDA 3BLBA 2QV2A 5E2WL 4OJFH 4AC2A 3T97B 4ZOCA 2KK7A 1GTFA 2XQYA 3I50L 4XBPA 2VWEE 2CE6A 2X4UB 3ET9F 4UNTA 1BZDA 1HWGB 1PG7H 2A6KB 3MCLH 4MCZA 1FZCC 1URIA 5CZXC 5H2FH 1N2RA 2JKSA 3HTKB 2Q6WA 5TF0A 1RURH 3F89A 3QEHA 1JOIA 2HFED 3V4PH 4PVMA 1EXJA 3OBAA 2GJZA 3BH4A 2E6PA 1VQOP 1BE3G 5IEHB 1IC7H 1W8OA 4X6BB 5E1AB 3STZA 3SE4A 3TNUA 1X7QA 3QUMB 3PABA 4JPKH 2FR4B 1IAII 2VB5A 1R3IH 3OPZL 2XBDA 2DWXA 1XGYL 3H3PH 4JFZH 2F1EA 1J0KA 2YJLA 2RD0A 1FLTX 1NTKJ 3MRHB 2PMZA 4YDLC 1QI4A 3LIZL 1SVBA 1QX1A 4Y5VA 4OM0H 3VXSA 4MKTA 4PJAE 3UIAA 3L3KA 3FONA 3P2BA 4HC1A 4YHYC 4P2OA 2KOGA 4R97C 4ZFOA 4FL4B 3BCCJ 1FC1A 3IFOA 3L5WA 5MHSE 1U4EA 1LEKB 5AKTA 4P9HH 1N9PA 3M86A 2W6AA 1VKXA 4KFZC 1VLXA 3ABVC 3C5JB 3DGGB 4EUPG 5H94B 4YXKL 5E9DD 2HLAB 1RJCA 4GT7A 3QZBA 5DJXA 1T6AA 4OGZA 4HIJB 4FG2A 4P2QA 3WFBL 4TSCH 1FAIH 4K3GA 2HP4A 2D0HA 3BZEB 1GMIA 5E70A 4UT9H 1UIIA 2VZOA 3ZL1A 4HC1L 4HF5H 1YEIL 1SQQD 1PKQA 4YLBA 3W56A 1PP9D 1ETB1 3N44B 2P8MA 3BO8A 4HOZA 3ARVA 1QD0A 5I1LA 2DQGL 2DYRB 2ZQKA 3ZYIA 2CCLA 2F5AH 5JPNB 2CIIB 3ZK0A 4TQIA 2EDHA 3P4MB 1NCGA 4K7FA 4E41B 4E9VA 4ZPVB 5FXCH 5KG9A 3GHEH 1BVKA 3MRMB 1LO4L 3U1PA 1CI6B 4MCMA 4ZNEA 3FTWA 3PHQA 4YDKH 5C7XL 4L4TA 1R3KA 4KK8D 1UXWB 3TA3C 1KJ2A 5F2FA 2EIJB 3RK2B 2L3BA 4HS3B 4TVPH 4N5UA 3B56A 2I7SA 1DCLA 1VPCA 4NKQB 2NDFA 3KEHA 5B1BB 1SYSB 3ZZLA 5LDSA 1NWPA 2P80D 3IJEA 4FFTA 4R7LA 1YAIA 4TNWF 1XCQB 1PPJD 5I1CH 1MFZA 4HWUA 1SXZA 4ESKA 3SWKA 1BE3E 1W91A 1M42A 2VR8A 5HYJB 4KDVA 4GQRA 3E1ZA 2EXYD 4Z7UB 5HPMA 3BXNB 3FQRB 5F0PB 3MJ7B 3I56P 1B4RA 2A1WH 2ZP0T 4Y1TA 2HT2D 2DLGA 4YE0A 1J0IA 1J87A 3OZ9L 2IYOA 2N7BA 1HKLH 2NPSA 4DQOL 4Q9QH 1O9WA 2IDFA 4PLKC 4K9EH 5KAIH 4W6YB 4GIFA 4PIBA 2VMCA 2VL4A 5HDOA 1Z3GH 1VERA 3ZGIA 5DI8B 2GI0A 1M1XB 1FAVA 4LRIA 1JK8B 1MREH 3TPUB 1CDUA 4P48A 1E9PB 1NMCB 2PTUA 3AUVA 5ILTH 5C0BB 4PV9B 5EBLA 2FO4B 2IWGA 2NCEA 2BIIA 1T04B 3MOBH 4WW2B 2VQUA 3Q8EA 2WTRB 1G4MA 1PCSA 3DLQR 4CU7A 5KS9E 1T6WA 3UP1A 4G6AC 3L4XA 1LD9B 1UJ3A 3OA7A 1HSAB 5FGCE 3FQNB 4M3JA 2I07B 1JK9A 3SODB 5CR8A 3GXPA 4OBRA 5IHZB 1MCRA 2EZ0C 2WN2A 3D39D 4F3FB 2PNDA 1BAGA 1J1PL 1MNUL 1Q81Q 2ZG1A 3LNGA 3DVGA 4Z76B 4ZPTB 3GMMA 4MXVF 2IAMB 4V33A 1LTGC 4QTHA 4S1SH 4QUOA 3WJJC 5F7EL 1QI5A 4QRPA 5EV7A 4YHNB 3FUIA 5FO7A 4JQXA 1ZT4B 2CR6A 3RVWD 4CBZA 3GF3A 3B9EA 3L3IB 4YDNA 3SKJL 5CBEB 3GRGA 3KPMB 4U6VH 2J44A 4PTUA 1XBRA 1M1KQ 1JWUA 5IM7A 2AK1L 1LK2B 2F9BT 3QAZB 4FTVD 4GBXB 2ODIA 3BHBB 1IT9H 2FYYB 4WW2A 2Y3AA 4XZ4A 1INDL 5GS1B 3HD7C 2BEQD 2RHEA 3HNSL 4YUEH 4EZKA 1S8DB 5F7FA 3IDJB 1M56D 1ZV8A 3LS5L 3FFDB 4C4BA 3INUH 1SN0A 4ETQB 3A0HH 3FHAA 5KJ7D 1LO0H 5FB8B 5KVGH 3WYRA 4YAQB 2Z7UA 1XIWB 4YGVA 3S48A 5C0CD 5FIEA 3EH3B 1NAML 3IDXL 1Q4NX 5FK9A 1YNLL 1NPNA 1OE2A 2FNBA 2VAJA 1ZV9A 3U79A 5LXGL 4ODXB 3Q44A 4GP8B 3ARRA 4NKIL 2WKLA 2ZPKL 4NB7A 3KJ4C 2WXLA 4OIIH 1VADB 2VMDA 3QRGL 4POZC 5KJ7C 1WG3A 3T0DA 1O7DC 4N2MA 1E65A 1S5IH 3VO0A 3HI6H 2XTJB 1LTJC 2KZKA 3VCLB 2R7EA 5DUPL 2IH3B 1IK7A 5H8DA 4WHDA 5DA4A 1IV8A 5GIRA 5B3NA 2EIDA 3QIWA 3QHZH 2AJVL 1QQDA 2VE6B 2R44A 4EI5A 5D70H 1JGVL 2CK0H 2AS5M 3GSNL 2HKHH 5G5DB 4JG5A 5KJ4A 2K78A 3PV6A 1QACA 4LCCC 3U0TA 3ZGHA 4E9QA 5KANG 4U05A 1KCUH 1CIUA 4EOTA 2XRAL 4AEHL 3QCTL 5B1KA 3ESOA 3KS0J 3NCXA 5E24E 3WUUA 3DRQA 1V5JA 2Y7OA 3QZNA 1KGIA 4G2AA 4JPWL 3ASWA 4K71C 3IGAB 4L37A 2IDUA 2ZOKB 3FXDA 3B7TA 5IQNA 4X9IA 2CLZB 2OJEA 5BO0D 4Y28J 4H1LB 1FNLA 1RFDL 3DGDA 2AEQL 3FQUB 4CADB 2VXQA 4TMPA 2EC8A 3QUZC 4ERSH 5L0QB 2GSGB 4N4YB 3JV6A 4MD5A 4WWOA 3BGAA 3PIQA 3ILEA 3QG7L 5C0EB 3VRLE 2IEPA 4DTGH 1UWEH 5FKAA 3MRFB 4P2RB 4DEPC 5BVJA 3H9SE 5BV7H 5K9OB 4R9HA 4RIRA 3R19A 1S72P 2C1OB 1QWUA 3PE9A 3UAFA 4MB3A 2J8UB 4GIAA 2L91A 2PTTB 2H1PL 3RZWA 5HHQA 3V6FB 5SX4H 2E8ZA 4IRJD 5B1JA 4FXGB 4EE2A 2B88A 5T3XE 2WQSA 4PRHA 1N73A 2X1XR 5HHMD 5IB5B 4TNFA 4FADA 4UILH 4XMUA 3DV4A 2F5BH 3SB3A 1A7OL 4PJGB 4G7SB 3L5WB 5DZLA 4ZFFB 4BK5A 1GW6A 2VDNL 2FB4L 1KF9B 3AT0A 5TDOB 4Q9RL 2JTYA 1ES0A 1KCRH 1TZIA 4KX9A 3FF8A 4G7YH 1XTGB 1A64A 3EJJX 2W9DH 3W37A 2GI7A 1FN4A 2HTLD 3KGRA 3TA3B 3ARGA 4PWEA 4DP4X 2KERA 2ZOOA 1QEWB 2ADIA 1SJEB 3L4TA 1CG9A 4WWPA 5D5ME 5F7LB 1KCVL 3TV3H 1WBYA 2BHUA 4WO4A 3DOSA 5T5FA 4AIOA 1DJWA 5E6ZA 4PJFB 3J7HA 4FNLH 1CGYA 5T5FL 3HHSB 3UAAA 3WLBA 3CH8A 5I9QB 2BIOA 2N01B 4QRQA 3MYZA 1DBMH 4Z78A 2WQ8A 2Q76A 1WFIA 5H37A 4L8DA 1TJMA 3QWQB 4GQZA 3OJAB 2XKMA 1ZHKB 4KJQC 4M6NH 3CDFA 4WZ9A 3WIFA 4P5TB 2NNAB 3SIKA 2HAZA 1EK3A 1RIHH 5EZJB 2A6IA 1LQSR 5E8DH 3FCTA 3BH9A 5ADOH 1AIFB 3TBTB 4AOFA 4H0HB 3PDOB 2CRYA 2MPAL 1K8DA 3NJVA 3MLRH 2VLLA 3BPNB 2R5BA 5ELIA 3APDA 5D4HA 2Y72A 2P8PB 4PV8A 5BV7B 4Z7VE 3A5VA 3HJEA 3VD3A 2DJ4A 5LGJB 3FT0A 2A77H 3PWPB 2N0MA 4D9QD 2QVAA 4F8OA 1YC8A 1X7SA 3E3QE 2J56A 1HINL 2B1AL 4I2XA 2KI7B 4YDJB 5EN2B 3K8LA 3T6QC 3BH8B 2HH0L 2UZIH 3TEUA 1VA9A 2OMTA 3FT2A 3FT4A 3RZCD 3U1AA 2W88A 1NSNH 3QDJE 3QWOA 4NC1E 4WFHD 1KBVA 1NCJA 5KVFE 3REVB 1CN4A 3UTPD 4GQPH 1ZMEC 5T33H 1QUPA 1I3VA 5HHPB 4LEXL 5BO1L 2BOCA 3WSQL 3OGCA 4G9FD 3OXRA 3N1MC 1MELA 4XVTL 4HCRA 3SGEH 1A4KB 1P6AB 1FUNA 3MA9H 4JFEE 4ZSOE 4NC1C 3MUJA 1XIWC 3O6KL 3CFKB 2XETA 4DKEH 3QG6A 3O4LE 1R6VA 4AL8C 3L9YA 2M3EA 1C16B 2YKLL 2BIQA 4IRZH 3FH5A 3DX4A 1Q9LB 4G9DB 1D7CA 2IWFA 1KDIA 1MQ8A 2H3XC 5IUCA 2AK4A 1LEGB 4LARL 3U7AA 2FO4A 3NOIA 2B5IC 2G0KA 1W0VB 2FUTA 2XQ0A 5E2VH 3V9CA 3D2UD 1FORL 2QPEB 4QMEA 3BRGC 4PGDB 4JR9L 2MFNA 3JUYA 5CLZA 4I77H 3V55A 1JB0J 2YBRB 2VXSL 4PS8A 5CFAA 4NKMB 4FKHA 1DEEA 4QHUB 3KPEA 2WAQA 4NZTL 1RIHL 2COQA 3ISYA 2AV1A 3VH8B 1PVHA 4L2LA 3VFVB 2PO6A 3AABA 1I1YA 1FJ1A 3SGJA 2WXKA 4FYQA 5T3XL 2F7OA 2Z8RA 4L3FA 4C55A 2BSED 1T2QL 3ZBMA 5CCGE 4ABUA 1Z5LB 3KWVA 1IM9A 4WJ5A 3BGFB 1DBML 4TTDD 3PWUA 3RWEA 3ARXA 3I75B 2OSYA 4M03A 3QI9A 2APBA 2ZXEB 4DO4A 3N1FC 4NBXB 4LQ1A 1J1XL 2QSCL 3D2UB 4X0KB 1N6QL 5TGBA 1PLBA 3T77B 3MZTA 5GS0D 1LMKA 4OJCA 4YEEA 2CLRA 3ZSTA 4G5ZH 2GG1A 1NDGB 1I1FB 1W72B 2VH5L 2W94A 3GBML 1QL2A 3H7BA 3KLAA 2OFQA 4KTDL 3BVNB 4ABWA 1IB5A 1KJ2B 5FFGA 2XDHA 2NMSA 4B9JA 1Q2NA 4M8QB 3T0ED 1JTHB 4FFYL 3KDMB 2OZ4A 5E9NA 2FT6A 1BQSA 4MHHI 3AE5C 3FQYA 3GGWA 4ZTOH 4HLEA 1OP4A 4JF7A 5EO9A 1MDTA 1HXMA 1IE4A 4N8UA 3OJVC 3AEBC 1C7TA 3QR1A 4PIRF 5D72L 1JBJA 5I15L 4YSDA 2IXQA 1UYWL 5I8OL 1IBBA 3GKWH 1QBLL 1NBYB 4AEEA 3UPAA 2AJXH 3LIUA 3D12B 3UAJC 2LVEA 1BZ9B 1A1NA 2VT0A 2D2CC 3KHQA 1FFRA 5HD8C 2PXYB 1BREA 5J1AB 4ZQTA 3W9DB 4LCIL 3GUTA 1UH3A 4HIJA 3CH1A 4YSEA 1ZIAA 2AJYL 3RWDB 3DTXB 2ITCB 4W9KC 1BFOB 4RA3A 4HX1B 4N0CD 3IJ9A 1MFCL 2YA2A 4IHOB 4KNUA 5IB3A 4OH8B 4JO1H 3CIAA 2OYHC 4W9FC 1KENL 3ZKXB 1ZSDB 2GTQA 3UZEA 2HJKA 3H1KJ 4QTFA 1OIOA 4HBQA 1F11B 1SQPG 3GM8A 5HDBF 1NBQA 2I60H 1KB3A 2AEQH 3FONB 1RFDH 4MZ2A 2OJEB 1PZUB 3L3DB 2Y9YA 1G0YR 3SYAA 1J5HA 4BSWB 1RHZB 2BNRE 5E9AA 5JW4M 4JFFE 2BNQA 4PVNA 3TJPA 3QE5A 4R5XA 2BOBB 2WXMA 4GKNA 4Y4FD 3QNYB 1QLEH 5AB0A 3CDZA 3KR3L 3QCTH 4GKOA 4LF3A 4AEHH 2HWZH 3U0TB 1XF2B 1JF1A 4Y16B 5GGUB 1BYNA 4BK8A 4BZ2H 4WEBL 3DROB 4O4YH 4YVNA 3FCGA 1OX3A 3GSNA 3K5SA 3AEDC 1AQDB 3O3DB 4NQXA 4PJXF 3V6OC 5CZVH 5F97E 1QFOA 5JO5A 3UO1H 3MMEA 5EF1A 3WIAA 1C1EH 4A68A 2ENYA 1FDIA 1RZGB 1NQBA 3CCLP 3CDGB 4P5TC 3QVAA 4GEIA 4OM1L 3L4YA 4I0PD 4M1DH 1AIZA 3PP4L 5D7SL 3T4AC 3UAEA 2W83C 4KUZH 5J6HA 4ODXA 3OZKA 3BWUC 3KWUA 1ND0B 3D4ZA 1LDPH 5AW6B 2MTPA 2OMZB 4ODUB 3WE1A 5IMKB 3ES6A 2ATAA 3X17A 2MCPH 3C9IA 4A6YA 1UD2A 1L7TH 2VISB 2Y6SD 3CLQA 3BCCE 2JVUA 4U4BA 2FYUJ 1DH3A 1O9ZA 2LW3A 2X12A 3Q1SH 3LKRB 4BRVA 3VSQA 1E3ZA 2ZX5A 4Y5VC 3US9A 1M7IA 5TF1H 4P46B 5GHWH 3WXWL 1PP9G 1I9JH 2X6AA 3K7UA 2A6IB 2XLLA 1T3FA 3MLUH 3MOQA 3LW5J 2N9BA 1FFPA 3P4OA 3DUUB 3ZHFA 2AANA 1D9KD 5EUKB 3CVCA 4TNGA 4XHQA 3Q3DA 1OARL 5HHMB 5J56B 3MJGX 3O2DH 4KO7A 3QH3B 3CUPB 2RIKA 4KI5F 1FZKA 3T2NL 3M9HA 2Z92B 1G7MB 3L8QA 5D71L 4D6TE 1G94A 1LDSA 5F7DB 1O9VA 5T1KD 4B5ZA 2J21A 3AQXA 4IDJH 3B2DC 1KC5L 4JRXA 4WUKH 3SDXE 1LM8V 5JNYA 4KQ4L 5E94A 1F4WL 4M7JH 5ERWB 4O9HH 4KJWD 5TJHA 5JPMB 2YSTA 5HHOA 3DOSB 1PAMA 3HTLX 1MJJB 4ZUUA 2WBXA 3TPKA 3HCVA 2ADIB 1WSST 3BQUC 1CICA 3NK4A 4M7LT 4ZMVA 2H6UA 3EJSA 1XB8A 1KLGA 1A21A 3VSUA 5E56A 3B5TA 5AZEL 1WZMA 1NTKE 5DQ9A 4BQ9A 3FRPB 2DI9A 4NC2B 3QDGE 1TG8A 1T5WB 4PVLA 2NQ3A 5D93C 3U4EA 5I71B 5KAIE 4U1HA 4EUPH 3GDBA 1Z3GL 2Y69B 1L6PA 2BP0A 5D96C 1OW6A 1IAIH 1KYFA 1FOSF 1WITA 4P5KA 4RMVA 3Q48A 3GB7A 4APQD 5B39B 1BBJA 2Q9OA 4AW4A 4I2XE 5JUEL 1MIEL 5IBTL 1HN1A 2OYIA 1BFVH 4G8GA 1A6PA 3RBSA 1AHWB 1T83C 1WAAA 2BNRD 3DGCR 3FTYA 3N4XA 5GS2H 4FNQA 2C1OA 1T4KB 4XOAA 1CU4H 1BZOA 5A2CA 1EGJL 5F3HB 3QQDA 3AU0A 4KZDL 1Z32X 2GK0A 3EFDL 4TVPE 4LPWA 4IKKA 4KMTH 5B1AB 1KYOK 4KJPC 1KMIZ 3BCFA 5SX5H 2G3XA 4ONGL 2CUAA 2VQ4A 4GAGL 4HUWA 4M6AA 3ZE0B 1GPOH 3O6FD 3S35X 5J12B 1I1AB 1SLQA 2CHXA 4JN1L 1T7XA 3QUML 3RLSA 4F92B 1VACB 2GAZB 3QNZA 3MODL 1Q90D 2XSKA 3H9YA 1KILB 5KG9B 1S7XA 3BDYH 3FB5B 4FTVB 4GBXD 4MNGB 4UNIA 3HS9A 2BIPA 3E8UL 4OLYL 3RIFF 5ECGA 4W6WB 4WY4D 1X79B 3FO2A 3PU7A 4UT7H 5EOCH 1S9KE 5IK3A 2APSA 4MLSA 1VFAA 3GLAA 3AG2B 4TYUA 5DR5H 3TBVA 5IV2A 1MCDA 4H5SA 3AG3B 1YY9D 3MRKA 3HZMA 2HJFA 1P5UA 3VQMA 3O6LH 1KULA 1SEBA 3TZVB 5B8CC 3T0EA 3KH4A 3ENEA 2OL3A 4ANUA 1BXUA 2F54D 3CFJB 1G7IB 2JKWA 4LHUD 4OD3H 5DS1A 5GGTL 4OLWH 2L5GB 1WS8A 4AITA 3QQNA 2YMXH 3VXPB 2YZ8A 3H1JJ 3WE6B 5EEXA 4OLVL 3X3GH 2DQEL 4ODSH 3IWUA 1LEKA 3U6RB 4P9HL 5C08D 4N2OA 4WW2C 1SEBB 3FUNA 4PJCE 1YYLL 4NZUL 1C5BL 2QT6A 3ZE1B 1B4JH 4KJYA 1V05A 4ORGB 2Z93B 1MHPH 1KN2L 3ATBA 3HPJB 5CUSH 5SWSA 3K2KA 3D18A 1E4WL 4PRHD 1NGMB 2X4OB 1TT6A 4PJ9C 4XPHH 3RHWK 3W39B 2W80C 4J3OF 4E41D 3TNUB 4XC3H 3CQQA 1G1CA 4JPKL 2Z7WA 3STBA 4OJDH 3QNZB 2XXMB 3GSXA 4KK9D 3T3PF 4TLTA 3CVHA 3X12A 3B9AA 5FO7B 3EFGA 5DSCB 3ZMNA 4JFUA 2ALWA 2FK9A 4PJ9D 3S37L 3SJVB 2R4SL 2WK2A 5D1QB 4LEBA 1NTDA 3BN3B 4XOEA 5DJ8B 4Z7WB 5IEKB 1N8OE 3J27A 4PJAB 2MPVA 2X09A 4HUUB 3RVXC 4M3LA 1JN6A 1IUZA 3HD7B 2DJUA 4P3DB 4PBXA 5D2LB 4S0HA 3O3AA 3HC0A 3N85L 3UBHA 4N28A 4NN7C 3KW7A 5CF3A 5I1DB 5K1NA 5K59E 1JZJA 3CX5I 3X14B 5KVDL 1N7SA 1LD9A 2FX9L 1T20A 3BPCB 3A3YB 4MASA 4R2GD 1T2JA 4BKSC 4B9IA 5J57B 1ZHLB 1SQBG 5I8EB 1IC4H 3MBEB 2GJPA 2G5BB 4RGNE 1D5BB 1F1DA 2EXWC 1NEUA 1DP0A 2QRXA 1A6TA 1U8QB 2QL1A 4NJ9L 5BQ7A 5ETUB 3CMOH 3M17A 2WO2B 2H6PB 3H0TA 5CN3A 1NGWB 1M6UA 4NBYB 3AG1B 1ZGLA 2V2TB 2VUKA 2NPSD 3NTNA 3BRTB 4M6OH 3SOBH 4PJAF 5DF0A 1SQPJ 1UT2A 3AREA 5C0CA 3PP4H 1YNTB 2OTWA 1TENA 1OWAA 4NQQA 3H1LG 1NFDF 1LP9E 1P84K 3H1JD 1AJ7H 2R27A 3BLPX 4NFBA 4PRIE 5IBUB 4Q97A 3ISRA 3OAZK 4K35A 4GT1A 4KKPA 1FZOA 4LCWA 1OXYA 3X14A 4ZMYA 3CZSA 4XB7A 5L2KB 4JQVA 4Y4FB 4PBWD 1SQQG 5H2BA 3RFZC 2QVKA 3B9KD 4XI5D 5B38A 2F2HA 3RVUD 4PAZA 4J3OD 3BPOC 2MMXA 5D1QC 1FIGL 1QLEL 2H41A 1FQ9C 1QFUH 2IOIA 4D8OA 4HS3A 1CW5A 3IU4L 4H8QA 4CW1A 1NFIA 3WUWB 3GD1C 1ZLSH 2IDSA 1LEIB 4RAUA 2YAQA 2YR3A 3MJ9H 3L70G 3TOPA 2M5AB 4WV1C 5J1TC 4NN7B 3CSPA 4NWUH 2PCFA 2NW2A 5FUCE 5B4MD 3AECC 2A38A 1KBWA 2ZCZA 3QXDA 1AKJB 1RZ7H 1CK0H 4X7FC 3MLWH 1O7DE 1WICA 4D0CA 3MRLB 2WSPA 1KC8Q 2E4FA 5APYA 3IS0X 4TQEL 5FA3B 3VMXA 2YPLD 4JDEB 1XWVA 3A4EA 4MJID 4U49A 4KJQD 3LKRA 3BSGA 5IG7A 4LNRA 1YJDC 4HKZA 3RX7A 1YEHH 1ZGLB 4M5YL 4N87A 2OS7A 5INDB 1YZZA 3QSKB 1IGCH 2W0FB 3MBWB 4MMXA 4OSUL 3GMRB 3X3FH 4HZ1A 1N6UA 1E9QB 1IARB 4MN4C 1FDOA 1E8XA 3ATEA 4HJEA 4PJBF 4ZUWA 2DDQL 4FMKA 1EDKA 3V4QA 5B3JF 4FQ1L 3C6LB 5TE7H 4IIQA 1MAML 3SDCA 2FX7H 3DI2B 2VLRE 1SXSA 1A02N 3WJMB 4Y9FA 2YN3A 4LL9A 2WB7A 1FA4A 5IB1A 1JD9A 2EJ1A 5D1ZD 5I1DA 3MJ9L 4X5XB 1YHQP 3GSNB 3O3DA 4NQXB 4JB9L 2D4FA 5AW5B 3CLWA 2ZT9C 2QGEA 1CD8A 2VH5H 2A74B 4KTDH 4ORZC 2VN6A 2H6OA 5AOJA 2YOCA 4B9GA 1AQ5A 2EQDA 3MKGA 3II1A 4LF3B 4U1JA 2G9HA 3SJVA 4BZYA 2YD0A 3FMGL 3QXAB 4PJEA 1YIJP 3FS9A 2FLRT 2OL3L 1KCKA 2X1QA 4HW6A 4Q6KA 1BV8A 3KJ6L 4JN2B 1EZLA 1DQDL 3O41A 2Q8AL 1H9VA 1OL0A 4MA7L 1MXGA 1R0AH 3QPKA 4G11A 2EYTA 2WVVA 2Z65C 4GEJA 1U33A 1LE5A 2BY3A 4XMKL 1KNOA 3EOTH 2VM4A 4HULB 4Z23A 5EU7C 4U1LA 4AX3A 4KK5C 2VL5A 4J4PA 3HG1D 2DOCA 1YUHA 3GXIA 4CA4A 1D7DA 3K5RA 5JHMA 1UB5A 2F68X 2H2SD 3E38A 3BIKB 5T3ZD 2RJMA 2DAVA 3V2AR 2OM5A 2PXYA 3NFPB 5M94B 5DHEA 5I5MA 3H1LE 3L3GA 1VFUA 3BEVB 3H85A 3PFQA 4LMQE 1EO8H 5HI5D 4YFLI 3TVMC 4M93B 5CINH 2CBPA 3H1LD 3DMMC 4ALAH 1W6LA 4M3HA 4UUJB 2IAND 4H20H 1KTCA 1GYCA 1YN7B 2WHVA 2WSFH 3MN8A 4LSVH 2X4SB 1JAEA 1MI5E 1FCGA 1LO3L 1YEFH 2ZT9B 1XSIA 2NXZB 4YL9A 3UBGA 3W9EB 1DL7H 3WKMH 3S8WA 1E2ZA 3ARFC 1NCBL 4M56A 1MJ8L 4G43B 3UAJD 3UTOA 4NSKB 3GS7A 3O9WB 4JKNA 4XPFH 1MCSA 2BMKA 4G80A 5IEHA 4R7VA 4A55A 5J7CC 4DQAA 4XPHL 3H54A 4JYCA 3KLHC 4EIJA 3QRFM 1IGIL 2L7EA 3VG9C 3C6LA 4KWUA 3FC8A 1OFCX 1KN2H 1R47A 3UPRA 2QJPC 1BHGA 3ESNA 3V95A 1QSVA 2W92A 2NSMA 1CZ8H 3VI4E 4ZFZA 3ZRFC 3PAYA 3IKKA 3QJFB 1FVCA 4YSRA 4QAWA 5FM5M 5JHDE 3MBWA 2A2QT 1QLFA 3AFLA 3H1JG 4MGXA 3EDDA 1M7IB 2HKAA 2JB5L 4OD2B 5HVGB 1GL2A 3BISA 3CZFB 3HE7D 4UV7L 2BVEA 2A9CA 3ZN6A 5MHSD 3B1UA 4FJZA 4BQ6A 4PYHA 1L4AD 4P5KB 2QSVA 4PD4I 4KI1A 4EAEA 1OTSC 3K6FA 1EHNA 3MROB 4LMQI 4Z7UE 5DDHB 5F70A 4Q56A 2Y7MA 1TQCC 3V4WA 4UT9A 3E1RA 1RUPL 1LYQA 5JORB 1U93A 3RDTD 5HHOD 1ACYH 3KZIH 2V9TA 2HJLA 2WVRA 1UM4H 3EJYD 5K9QG 5GSVA 1J5IA 5HHNA 2FLBT 3P73B 1UURA 4M1CD 1HZHL 1L0QA 4WW1B 5TFSH 4MQXC 2OSWA 3D3VE 5HPOA 1H3UA 3LYRA 1RI8A 4XP4H 4JRXD 1MW2A 5L8LB 1L9PA 4YDMA 3E8VA 2YMOA 2X2UA 3H1HG 2CG9X 4PB9H 5A6IA 3IRCA 3H7LA 4LPXA 1P5VB 2X4TB 3M88A 3GLZA 4JN1H 5EO1B 1L2PA 5D1QE 4ELMF 4GMSL 4RSYA 1GPOL 1D6EB 3TFKC 3UC0L 4F9PA 4XP1L 1FBMA 1IFPA 5F6HJ 5BW7A 1PBYA 5MI0C 1ZS8A 2R15A 3VFWA 5CLWA 4XP6H 4CPGA 3I02B 1ZXGA 2Q0ZX 1V3JA 1CF8L 3DSNA 3KYMA 4NP4L 4Z5RB 4G7VL 1F4XH 4MTMA 5B7FA 1KCRL 1MAKA 4GW5B 2MQCA 5KOMC 5DS8A 3PWPA 4LVHC 4YPGB 3HB3B 3OC5A 4PJBE 5DEJA 1FGNL 2AC0A 2X4RA 4A39A 1SQVK 5A2LH 1UKQA 3L3HB 4ZO6A 3ARDA 2WYZA 1A3LL 5TDNA 3GMLB 4K5MA 3ZU8A 1B6UA 3BGMA 1RH5B 4MXWH 4P46A 3WO4B 2P45B 4GUOA 4WKXA 4ZODA 4XNAA 3LEVH 4XC1L 1LO5A 3VFNA 3HMWL 5DJCA 2H1PH 3U6XS 1CFMA 1HWWA 1OB0A 4IYKA 1WEJH 1SFCD 4E41E 2B2XL 4JO4L 2O61A 3L13A 3QH9A 2E6JA 2VXTL 4YS4A 2KZJA 4Q58C 3UGEA 2Q2LA 4PFEA 1UWEL 3JWOC 3M07A 4YFEA 2NY2B 5F0MB 3M0DC 3GUTB 3U7YL 3E6HB 3BKCL 3MV7A 4ERSL 3SN6N 5ABZA 2MQGA 1S6NA 1H5BB 2JJUA 2CLVB 1V3MA 2FEDC 5G4OA 1IFGA 4C54A 2B3IA 2JKRM 2NY0C 2ILLA 4OQTL 1JHLL 5DJ0B 4N78E 1AO7E 2ZAIA 5GRVL 4N2IA 5KEZA 2I9LB 4OV6F 1NWQA 1K73Q 2O5XH 3VG0L 4AZ8B 1GHFL 4JFVA 2I25N 3GHGA 3CVHB 3X12B 2VERA 3EUUA 4S2SA 2JKTM 1X4ZA 5CIPB 2QTVA 1BQLL 5JIHA 1MRFL 4AYBA 5A6LA 1JF1B 1IC1A 1AKPA 4B97A 2AXGB 2C7UB 3C5ZA 4AVIA 5EU3B 4IL6E 2R2HB 3NZSA 1F00I 3AXLA 4XPTH 4B9PA 3AEFC 2D2CD 2ZUTA 3VP8A 4ELME 1OD7A 5KBPA 4PQXA 3PLNA 2ICWB 2A6DB 3DX8B 2VQ1B 3EF4A 3IDGB 1JYXA 1HYSD 3F6JA 1ZVNA 1DR9A 1KJVB 4PY7B 4RISH 1FFOB 4G9FE 2X5PA 2DIAA 2QJYB 3C60D 1INQA 1VRSA 2ZWZA 3G9VA 1NFAA 4AYDC 5FYLL 5KLIB 4EI0A 5ADPL 2Z91A 1OGAE 1LT9B 1LTBC 5GJSL 5AB9A 5D7JC 1FDMA 3QFJA 2B1OA 4DZBA 4H26B 4PREA 4HK3J 4BIKA 4IBWA 3OKYA 4NKMA 2WW8A 1H0TA 3VWJA 4PGBA 1XCXA 4RIRB 5A2IH 2CDGB 1PCXA 3BSZA 1BDDA 2QPFA 5IG7B 4J4PD 4KZEL 2I9TB 1QFWM 2EIEA 3TBVB 3RWJB 1CFNB 3EYOA 3KPSD 1G1IA 5AL0A 4ZKUA 3CSGA 3H1ID 4EEEA 1O6TA 5MEPA 3MRLA 4G6KL 5LG1A 2A83B 2PN5A 1BDYA 3NA9H 3IXTB 4O5LL 1XSJA 4U6VL 3UABA 4AL8L 4NPYB 3VW3H 1U42A 4PCSA 4PJ5D 4PRBA 2DH3A 1M57D 4QDGA 5EIIG 2XG4A 5KSBA 1DQVA 3KCPA 3HE5B 2IG2L 5DURB 2DWEA 4HJGB 5KSAB 1MG2C 4NLAA 2NX5B 3WCYA 1PZ5A 2RAMA 2DQMA 4HMEA 4MAZA 5FUZL 3C8VA 4L4VE 2DQDL 3OB0K 4PV1B 3MGTB 3FK3A 5GGVL 3ZTNH 4DGIL 5KVDE 4WFGD 2HYMA 3DX9B 5I1AB 1GYVA 1PPIA 4FFVD 5DWUH 3G7TA 5HY9B 3H8NA 2IH9A 1Q9OB 1EEUA 2NY2D 2QHLA 1S7RA 1OVZA 3FB7A 2PYEA 5IBUG 3GTNA 5BRQA 1AZZC 4B7LA 1E3XA 1LP1A 5FFLA 1NGYA 2FQDA 4PCTA 2E4TA 3UFIA 3WEXB 2VXQH 2XFXB 4WHYG 4GLRH 4ELMA 3QUYC 3FW6A 5ALCH 3BATA 1HQRA 1RJLA 4GI6A 3BWZA 5IESL 1N7LA 1QBAA 3L4FA 4IRJC 1DN0A 1OAYH 1L0LG 2B2XH 1HI6A 3DVIA 4H44D 1RD6A 3EGDA 3FQWB 2ZP8A 3F6IA 4TVPD 4NRXA 3SGKA 4WI7A 4TLKA 4Q9QL 3EWKA 3ZTDC 2OZ4L 4FFYA 4DGUA 5F7AA 5BQDA 1HIMH 3ARTA 1KIQA 4H8HA 2FH6A 2AQ3A 4LFHG 5CP3H 4AV0A 3IAOA 5F9DC 3V0WL 1HWTC 1AXSA 1NOAA 1U30A 4M61B 3VFSA 2V33A 2Y5QA 5FECB 1B0GA 5I82A 5DQ9B 2AJXL 4CVZA 3BP6A 2WT7A 3LRHA 1KQFB 2QA4P 4Z7QB 4KKCC 3LPWA 3BHBA 3OKKA 1FRGH 2NZ1A 2WV3A 4JFDB 1UWXH 2I32A 3C8DA 1XD0A 2J1YA 4QHNB 3V52L 1N0LB 2E7DA 3TCTA 3T09A 3VGDA 4PWIA 3VFOB 3O3EB 3QYMA 2HRPL 3G6JE 3MV8A 3O0LA 4QRPB 4L8DB 1A8JH 4XP1H 3JWDL 1X44A 4NHCL 1SLVA 3CMGA 1ED3A 2FNWA 1DJYA 4WU5B 1EZVI 1OGAB 3VXMA 3U2SA 3QXTA 2Q3IA 2UUDK 5EFWB 3CFMA 4CU8A 5BXFB 2BOCB 4LK4A 1A7PH 2VAAB 2Z92A 2QMJA 1NCWH 3GJFB 3ALXA 3CWBG 1OF2A 4LGDE 4FFVC 4UAHA 4MDIA 1UM5H 4U1MA 3V5HB 3V0GA 4GRLC 1E28A 2NY4C 1Q0YH 3MYJB 4KVNL 2YXFA 4RBPH 2YC1A 4HV8A 3KXFA 3TA3A 3B4NA 5EC2B 1D5ZB 3DIVA 2JCCF 5D7IA 1A6ZA 3ZZSA 5TQ2H 2V7QH 1LO3H 4HC1H 4NP9A 4YXHH 1CLZH 5DD6A 2HN7B 3O4LA 2LABA 7PCYA 5A1AA 3TT1H 1XGPA 4TRPH 1YEEL 2P43B 3O45A 1BG1A 2BPBA 1WBXA 3SYPA 3SBWC 4PJEF 4FHJA 3WIHA 2JEEA 1XZWA 4CVUA 4FFZH 3S34H 2XACC 1RJZB 5EEZA 4A6YB 1HYRC 4YHLH 2N3JA 4RMTA 4FNTA 4RRPM 4U0RB 3BAJA 3EW3B 1ND0A 2E74B 1Y9BA 4CMMA 5IGXH 4MDJA 3KW8A 5HHME 3GS0A 3VDCA 3RL0g 4UTBL 5AW8B 3JBG7 4F2EA 7CGTA 4L74A 3SWYA 1QFWH 1XCQA 4J12A 2A0LD 4P9MH 1TQCB 2PYEB 1KPUB 2WXRA 3BUQA 3MMEB 1DX7A 2FXOA 5FKAB 4JFZL 2OR7A 3PS6A 1QL1A 2FEEL 2OARA 3ELQA 2O01J 1GSMA 4OZGA 4IHBA 1E4XI 1IFNA 2I85A 3ZL4H 5HGGS 2NXZD 2K9JB 1D5MA 2BINA 2Y1YA 5C6PB 1AQKL 4TQHA 4R4FL 4GRWE 4CU6A 3QNFA 3RL0D 3OTTA 2B0SL 3M7FB 4GYBA 4P5SA 3TF4A 1N18A 4A7PA 1IILE 3UTSE 5L4MA 1QEWA 5FPIA 3QJZA 2UZIL 4GRLD 5CBAB 4PJXB 5JIPA 3PWNB 1WZ1L 1F0LA 5AVZB 2AK4E 4Z7QE 4LLDB 2VE6A 2LOEA 1EIBA 1KJMB 1BJMA 2IQ9L 2L7JA 2GCYA 4UMGA 2V7QJ 5K9QI 4EQ2A 1OCWL 1KB9E 3CBKB 4X8JA 3U59A 4OZ4A 4QCIB 5ENWB 5I18L 3WIHH 4S11A 1EO8L 3TJHC 2YD6A 1Z1WA 1JY2P 3MIWA 3G5VB 1QHPA 1FVDB 2XPGB 3C6SA 3EJPA 5AUMA 4P06A 1S7WB 1JNHB 2JCCB 1U58B 2V7NA 3SZ6A 4HWNA 2NNCA 4GKZA 1JCVA 4XP9L 4GAAA 2EC9U 4PI2A 1E0OB 5HHVL 3ILPB 4UT6L 2MWCA 5TPWL 4A2EA 4PGJA 4WK4B 1PNDA 5DLML 3FCSA 1J5DA 2C3HA 2L04A 1E3FA 7TAAA 4HA1A 2Y6TE 4JY4B 1MRCL 4M8VA 25C8L 2VDML 1KGWA 5KTBA 3AB0B 3UGXA 3UACA 5KKZB 4KKLD 1RZ7L 2V3EA 3QAZC 3FCUB 3FQTB 4ELKB 3DX7A 3LN4A 4JAMA 5J9PB 3BPOB 3MV9B 3WMPA 2B4CC 2J2ZB 3SKNA 2ZOKA 5I28A 4NO3B 2GFBA 1JPST 4C56A 3BFOA 2NY7H 1EZUA 5IKCA 4OGXH 2XVBA 4U1IB 5ALBL 4QWWD 2Q7YA 3Q06A 3H4FA 5ICZB 3IF4A 2Q3ZA 2B59B 1E6OH 5IB4B 2ZX7A 5F7DA 5IHUH 4Z0BL 1IKFH 1U3ZA 2GTZB 2VLRD 5BU5A 3NIFF 2EUWA 4XMXA 1QTSA 2B7DT 1MAMH 4LPVA 5IQ9B 3OLGA 2P5ED 2IH3A 1N0LA 2H47C 1AJ7L 3L7FB 4RWHA 4OF5A 3LNIA 4OLXL 4QXVA 4D3CH 3B6SA 3I3EA 1DEEG 3CSFA 2OMWA 2E27H 4HG4K 2OK0H 2QPUA 3RHWF 3GZKA 1P1VA 1JPGA 2DD8H 4PJCB 3VFNB 2LHAA 3MTUE 2CJ3A 2P8LA 4F8NA 2CPUA 4IOIH 3CMOL 1HTLC 4G6FD 3D51A 4ADJA 1XMEB 1KT2B 1BAFH 2NPSB 3CQPA 3KYNB 3RUGE 2OLDA 2YQ3A 1CI3M 2HZHA 3IRPX 3VX1A 4RETB 1G6RH 1MIMH 2R2BB 2HLFD 3G6AA 4NWUL 4Z3IA 4IRSC 4RZCA 1QW8A 1M8OB 1EZVY 1DVQA 3GSOA 1F97A 1AQMA 1X8YA 3WEXA 1HXYB 1MCEA 5CCJA 3WGVB 1B0WA 1WZ1H 1RK7A 2EH8H 1DVSA 3B9KB 5IW1A 5D1ZA 1GZLA 3CCEP 3KLDA 4GO6B 1CGXA 1FAKT 1DBJL 3REVA 3C5SB 2WUBL 3RL2A 5M1BA 3GXFA 3BWAA 4I0PC 4N6RB 3ZIYA 1MW0A 1CS6A 4AIEA 1WAEA 2X4PA 4AQZA 4KNQA 3KPPB 3B71A 4MQ7B 1KGCE 4X6CA 3LMJH 1SMOA 3AUWB 8PAZA 4G82A 5GGSY 2W5PA 4JZOA 5ISZA 1RULL 2D3JA 1KFMA 5T1MB 1TJIH 1W2KT 4KOCA 4PV8B 3QRGH 4WTZA 2EH7L 1E4WH 2FIKB 4G8AC 2ZONA 1WDAA 3KLLA 4RGMB 3S4SB 4XTRC 1AD0A 2DWSA 1GOGA 2D7QA 3FU8A 4GKZB 2DEWX 2KUBA 1OAJA 35C8H 1A3RL 3ELAT 3BZEA 3QDGA 5AUMB 3S5LG 4Z77A 1M05A 5CJOL 3L1EA 2FXMA 1MFMA 5JXAH 4ODSL 4HHAA 4P2QB 4FHKA 2R1XA 4H26A 4PREB 4DZBB 1EAJA 1SDDB 5EMYA 3CH1B 5FEBA 1FSKB 1HDMA 4L29B 4Y8AA 2Q5BA 2VCOA 4NRZB 5C08B 1T2KD 2JIXA 2PP9A 2B89A 1AD9A 1LO2L 4TRPL 3TT1L 3MKKA 2WZPA 3TX4A 2NZIA 2AK1H 2BSSA 3O3BA 1K4CA 4YXHL 1DYZA 5TQ2L 1SHXA 3I6LD 2UZPA 1CI5A 3EZJB 4XO8A 2G9KA 5JMOC 1PL3A 1DQJA 4JGNA 4WI6A 1IFRA 3LJ3A 2R4SH 4U1IA 4XH2B 4YBHA 3RVVC 1HL9A 1OOAA 2CO1A 3N50A 2R2EB 1QASA 4JFED 5F1KC 2VIRA 3FTZA 1OVVA 1JGEA 5IREA 1YNKL 4AKPA 5J9PA 1UXWA 2DLEA 3W9EA 1NFDE 1NDGA 2QVMA 3NP4A 5D1XD 2WBJA 3VWKC 1DQML 3F6LA 1A7RL 1L9SA 1LWJA 2YHGA 3GHGB 2VM9A 4WB4A 4GAGH 4JMXA 4XH2A 4NNPH 3HTKA 2MSPA 3I3DA 2FATH 3P4MA 4PD4K 2EZ0D 2CD0A 2K8QA 3ZY7A 3A7OA 3WNIA 4ENEC 1TMQA 2WSFJ 5IJVA 1IGJB 1YQVL 5D93B 2NYKA 4EBQL 2F15A 2V9RA 1YEGL 2PYFB 3K2UH 4MDJB 3VGAC 2DQFA 4Z7WE 2DLTA 2UZYB 1GKEA 2V5RA 3BFQG 5J11C 3V7AE 4AYID 4M00A 1A9EA 4Y4KC 1Y6KR 2PWFA 1HKLL 3CD4A 5GGTH 3ZQ9A 1AI1L 1E40A 3L1FA 4A6YH 4DP0X 2GKIA 4TVSa 3N40P 1AI1H 1O6SA 1IAKA 2P4AB 5E4IA 4A6YL 4TUJA 2HA1A 5EBWA 3FH7A 1MJ7H 5DA0B 4MYWB 4X6DA 2TRYA 2W8ZA 1DCEA 3K4DA 1ADQH 3LKPA 4OY9A 1DZBA 3PNRB 1LE5B 1A7NH 2Q3EA 1AZVA 1DN2A 2DQCH 3NZ8A 4H1LA 3DTUB 4H25A 3VSTA 4CSPA 1U41A 4DOHE 4GG6A 5CN1A 2QVTA 4PS4H 1A4JA 3MRHA 2R56L 4TM9A 4X6CB 2HT4D 4FULA 4E42A 4RESB 5HTSA 3HAEB 1OGSA 3PABB 3VFWB 2X28A 2VR6A 1XEDA 1AOZA 4UOW1 1JHTB 4OUUB 5CZXD 4GMTL 2OCFD 1IE5A 1S78C 5IFAH 5DD5H 5BUPA 1YYML 3EFDH 2PETA 2WLYA 1F56A 4JM0A 2P44B 1MI5D 1SZNA 2F58H 4UV4H 1KTKE 2DQGH 5I1HL 5D71H 4Z1MH 4NQDA 3T2NH 3RK3E 2X4UA 5H4ZA 2Z5IA 4IIZA 2DZEA 4AL8H 3P73A 4I2XB 2W6BA 3BP6B 4L3AA 1ITCA 4CC4C 4OU3A 4AJYV 1PZAA 3EOAA 1UM6H 3D0AA 3S3CB 3L1OL 4QYOA 2XDJA 3I6GA 3WFBH 4NHUA 1KIQB 4PR5B 4K3DH 3WN6A 4XCEA 3RKDD 2V3FA 4RFNB 3NJLA 1TXKA 2KH2B 3R2PA 3VXQB 1FHGA 1QWHA 5LBSH 3Q1SL 3AITA 2H8PB 4NRXB 1C9SA 3HUJF 1S5LE 3NSCA 3JWNE 3Q7JA 1C08A 3BH9B 4FJYA 5D7IF 4U7SA 3DYMA 1DVTA 2HCZX 4N8CH 1DDHA 1TSHA 2YA1A 5J06A 2QG4A 1BIIA 1I8LA 4X2UA 5GS1C 3OX8B 1XBDA 4LGRB 5ESAB 1KGJA 2NW2B 3UTPE 5J89A 1HZLA 5TK2A 2XV3A 3V5HA 2M5AA 3BVUA 3L75D 2K6WA 5DHXB 3BMWA 4WI4A 1ZT4A 3NSJA 4MNGE 1CT8B 1KB9J 1OF2B 4DT0A 4OM1H 3H6PA 5AAWC 2QVIA 3LNFA 1O0VA 2C5DC 2VRAA 1QBML 1HS6A 3CCUP 1OIPA 4HCFA 4I0PB 2VMFA 1TTFA 4IDJL 1L0PA 5ICZA 4AYEC 1KIUB 1GYUA 3ZDZE 5CLYA 3B2UC 3F5HA 3MUY1 4NQEA 4WEBH 1QTPA 4AXWA 1JGIA 2YGNA 3LKNA 4B5EA 1KPVB 1T66C 5I16A 5L2KA 4G43A 2IOOA 5DRZA 3B83A 1V54B 3REWB 4ZOBA 4OIAA 1TF4A 4WUUA 3NCCB 3V9EA 3HG1A 4BFIB 4OWFA 1N7ML 4X8CA 4IJ3C 4WDIB 3V0DA 2CMRH 4GJTB 4A7TA 4IBVA 4M7KH 3RWGA 3IGLA 1Z9SA 4PJ8A 4DIXA 1E8ZA 1XF4A 3OKEB 4LGSB 4XNYL 5L88H 5B7EA 3L72D 3RWJA 1EVUA 4YHZH 3CK0L 4YEFA 4Y5YB 3T2LA 5KVFL 4HU8A 2H7HA 1FH2A 1S7UA 4L3CA 1L9NA 1RY3A 2C9AA 1HAUA 5IMLB 4LKCB 1KENH 3IJ8A 3K6DA 3N1GC 4C47A 3CFEB 4ZD3H 5IWLA 2O1KA 3V4VL 4JO1L 4XRCB 2Q87A 5E08H 4L5FH 3PRJA 1G9NC 1SBSH 2A4EA 3TYYA 1A1OA 4H44C 4M7LH 1KYAA 1E27B 4WW2F 5C09E 3HMWH 3N44F 3GRWA 2EE3A 4J3TA 4LCIH 1S2EA 4ODTL 2ICEB 1MCBA 4PY7A 4W4OA 1BQHB 4HKJA 1OY3B 4IMLB 1ZHNB 5K9OA 3D69A 1RAMA 5DCCA 3QA3A 2WYTA 4AQRD 2K45A 1QBLH 2JKLA 5CU5A 5FGBA 5CEYB 3IPEA 3SPVB 4HUUA 4BH8A 1IAOB 4JO5A 1CTNA 2JI3A 4F37F 3FWLA 5L8RJ 2XNAA 3IJSA 4BSVA 3T4AB 3N6YA 5E8OA 2EXYC 4HJGH 2ZNXA 4KHXA 1NCDH 3RQ3A 4ZTOL 3PL6B 1ZRTD 3RA7H 3G6EP 1P84I 2Y23A 3RNKA 3EKCA 3M1BA 3MXWL 1Z9LA 3CNKA 3HAEG 4FFZA 1IJNA 4QF1A 1EXGA 2NY7L 2NY6C 2K9JA 1D5MB 2ED8A 1FNGB 1BWMA 5T3XD 2A74A 3RZCC 1T0PB 2D3LA 2QMKA 2PPCA 3IKCA 3S3JA 4DZOA 1AO7D 2W8CA 1NKGA 4D6TJ 4XP4L 2ZYGA 3QDGD 3V6OA 1YDPA 2IV9A 2D7PA 4HUNB 1OPGL 3BP5A 4I88A 5TFSL 2E75D 1SOKA 4FP8H 4FS0A 1OTSD 4PHXA 5DUJA 3WKYA 5KZCD 5BOJA 2UY7A 2HFEA 3R4DA 1MVFA 1YJDH 1WE5A 3SDYH 3VCLA 1MRCH 2H89C 1YEDB 3BD4A 3BAKA 3QWNA 2C4XA 5DJXB 2XC8A 1FNSH 3GI9L 1G2CA 4WTZG 5DLMH 4DVRH 1JNNL 5TPWH 1J8HD 2LFGA 2NPLX 5JZ7D 4ZOAA 4GOEA 1CD9B 1BVNT 3SZKC 3WFEH 5DJCB 4N86A 1G7IA 4P2OC 1J1EC 1L0NJ 2Q6QA 3I55P 1IGMH 2DMKA 4OZFB 2ZXWB 2VXSH 5KLIC 4UV7H 3TYGL 1L3NA 5MENB 1ACXA 4IGBB 1SQQK 1BG9A 1XIWA 2IGTA 2ZWYA 1XR8B 1MFTA 5M7QA 4YSUA 1UATA 4W9DC 1C8PA 2ZCHH 1MJUH 2IV8A 5IT2H 2UXVA 3OVUB 1Z9PA 2YEZA 3IKCB 3NESA 2HN7A 3O4LB 3BSHA 3AT9A 4G6MH 2AI0H 1M1JC 1ETZB 1OCWH 1PDKA 3RK3C 4U3SB 5EB9A 2YS4A 1MF2H 5IVOA 2Y07H 3PWLA 3DIDA 1E50A 3J07A 1FJPA 1KUMA 1CFTB 4AJWA 4GAJH 4EI6A 4P23B 1X9VA 1PLAA 3KL5A 3ZX1A 2ZX8A 1MHCA 2O01N 1CDGA 5KUMA 3GJFK 1NUFA 4QHLA 3EO0B 4PJHE 1WCBA 1YN6A 4TNVK 1HE8A 2BLFA 1BE3J 4KI5C 4ODHH 3FTGB 3WUTA 5BO1H 3EBAA 1ILUA 3VMAA 1TO5A 3APMA 2NY5C 3DURA 3QDHA 2NNFA 5B38B 3RL0B 5MEND 2X7LA 3D69B 3KNBA 4U3CA 4YTPC 3O3EA 3K6IA 1DQIA 4IFMA 5DXWA 4HKJB 2EKSB 5D4IA 1JOCA 1C8QA 2C8NA 1SHMA 4O02L 4LNVA 3VYNA 4HD9A 4OFKA 5D6CB 2A77L 4FQLH 3TCXA 4V1DE 4RGND 4P05A 1DBAH 3Q13A 2ZCKL 3RAJL 4NO5A 4I77L 1VL2A 1ZGLM 4L9LB 4IBUA 5LXVA 1F90L 5F7KC 3ZXAC 2FYUK 2E74C 4KRLB 4NQDD 5F1NA 5E2VL 5A2AA 4KQ3H 3I6LE 1JZHA 2WUCH 1GK4A 4R4MA 2VYRE 4NCC1 5D2LF 3L6FB 5FOBA 3K0YA 1X5AA 2GT9A 3IFLL 4PHZA 1S7TA 1P7QA 3VI4B 4QD2E 4H13D 5LCVL 4G8FB 1SS1A 1EAQA 4O02A 4RSVA 2R59A 3B8EB 4MCYA 3BVTA 4CNIB 4IRZL 1A5FL 4U7KA 4V2BA 4H0GA 3TNMB 2FL5B 4JPSA 4Z7UA 4RFOH 5HPMB 2X53A 3DSNB 2GJ6D 3EDKA 5D7LB 1CICB 3B9VA 1CLZL 2GHWB 4DKEL 1RIUH 2PW2B 3H1JE 3O6KH 4TUUA 4MBRA 3VM5A 4W7YA 2ZIDA 4AUWA 1M53A 5FDYA 3OAYK 1ZV2A 3KGUA 1F2QA 4OZIA 3G08A 1XZ0A 2AQSA 1VQ5P 3ZO9A 3VGHA 1P4BH 1HHIA 2O26U 3CFBB 1OAXL 2YKQA 3D3VD 3T6VA 1AY1L 5E8PB 4YSQA 2E75B 5MENE 1H8NA 1PZ5B 1FU1A 1QA9A 2X1WL 4QRSB 2HH0H 4WY4C 3WEMA 2IBBA 1KCVH 1HVVA 4W9ZA 5F1IA 5KYUB 2NXYB 4U6YB 3SDCC 3VTAA 2XZCL 4CC4A 4YL4A 3CX5D 3TVMA 5JORA 1G0DA 2PUQT 4K73A 3P4OB 4JFYB 5IHBA 1UVQB 3EHBB 4Y1AB 4UOJA 3TA4D 3TJEH 1AOHA 5IR1A 3L3JB 1VQPP 2C9NY 3FX0A 3IE4A 5F7BA 2HT2C 4NPKA 3U4KA 2HX8A 2VRKA 2P7TB 2VRSA 5CMAA 3GIVB 1CE6B 4PLNC 1SQVD 2WINB 1RJYA 1A7OH 4XVUD 3T71A 5F0JB 4P5TD 2N1TB 4F9LA 2NR6A 4OSUH 2NW3A 5JXEA 4JFFD 3FOMB 4HDIB 1S3KH 2HLAA 1ZTMA 4Y1SA 3L54A 4JFDE 5FM8A 3PP3K 2LTQB 5LKNA 1WFMA 4UZGA 2G3MA 3U30B 1QRNA 3EYSH 5C0AA 3ARGD 4Q9BA 3NCBB 1VKXB 3VMZA 2APVA 4Y4HC 2ERJB 4ZYKA 2CA3A 4IRJB 2LVCA 5EUOB 3CAFA 3GMPB 1RZKC 4HVBA 3MRKB 4MFHA 5KLVJ 4WLCA 3QUGA 4F33B 4WFED 1G7PB 1VFAB 5ANME 1I8AA 2VSMB 4D0DB 5HDQH 3LXAA 2BHZA 1EEQA 4HEMA 1NBZA 1P84E 5FUOL 3BP4B 5GJTH 1UHVA 5ICUA 1WTGT 2DKSA 1IVTA 5GGVH 3ZTNL 1J2JB 2EDYA 2YKOA 1W80A 2WWKO 4B50A 3SDAD 4BKTC 3T5WA 5F6IC 5LBGA 1TCRB 4G71B 5DZOA 3UZQB 3HRPA 2VITB 3EBHA 4GG6B 4A2HA 2W65B 4CGUB 4AZ8A 1MEXL 2GBAA 4JDTH 9PCYA 2F53E 4JJ5B 4LVEA 3C8KA 2WIIA 4BWTA 4X7TA 3GC3A 3OQ3B 2AEPL 3CJJA 5KSAD 1YITP 1KD1Q 1G9MC 1EDHA 4L4VB 3QQDB 4M9OA 5DUPH 4ZUWB 1YBKA 5SWZE 4UB6H 4UF7C 3WU2E 3LH9A 4MS8C 1E9QA 4XWGH 2CJSA 1BQHA 5LQBH 1HH6A 1DLFH 4OGYH 3UTSD 2NQCA 2Z4QB 2H43A 4FQIL 5INDA 1U8NA 3LRGA 3EYQC 4M7LL 4JGMA 2LU7A 4HIHB 5JHAA 2B1HH 2QFPA 5DGRA 3IDXH 1J11A 1U8LB 2OXHB 5E08L 5IJBC 2JO1A 4MD4A 4MJ5A 1VEOA 3M1OA 5D4JA 5I8KL 4Y2NA 1G6RB 2NY5L 2BP0B 1E30A 4W81A 2NLJA 3UYRH 2YEQA 4YNYB 5IJVB 4Z7OE 4GH7B 4WO4D 3PNWA 3T6WA 3LS5H 1J8HA 4UTAA 4PJEE 4YBLC 4OIBA 3LZPA 4JK0D 4U6YA 3RPIA 2ADJB 1GTNA 2WBJB 2YWZA 2Z31C 1KCLA 4M7KL 4QRSA 4M8QA 3W0WD 4PTTB 1GGCL 1PQZA 3KPNA 1HL8A 3SWFA 4WDIA 3EYFA 5ANMA 1B4LA 4KAQL 1BMWA 4ZUUB 1E6JH 4N2HA 1QHQA 1TO4A 5F7EH 4DGYL 4JQIA 4OKVA 5JDJA 4QXGH 1BQLH 2QDWA 1GW0A 2AEMA 3P40A 5DFVD 1ZLVK 1T1WB 1NCUA 1JUFB 3QHZL 1NEZB 3CFDB 2VC2H 3MO1B 1Z56A 2KLSA 3A0OA 1M2OA 3H42H 2PWGA 4P4KC 3VI3B 1S9XA 4AV4A 5HHNB 1FE8L 2BSRA 2EYSB 4QGYA 5C0CB 2N9YB 1H0DA 5DYOA 3MJWA 4WNQB 4Y9CA 1GZQA 5ESAA 4GFXA 1N19A 5DZNA 4N8CL 3F7RA 1IFHH 4HHAB 1C12A 3NJHA 3OKLA 3L75E 1UXSA 4UQ2A 5IFHL 1DJIA 2DI7A 4MNHB 1IZKA 2VXVH 2DQEH 4OZFH 1HCFX 1TTRA 2BOLA 4NN6B 4N3TA 4ZS7H 3CZFA 4JFWA 2J6EH 4DQOH 3N42F 4XBGA 2VDPB 5D6CA 3ZYZA 3NEOA 1T22A 5T1MA 1CC3A 1B4TA 4PMEA 1OSEA 4DPCX 3L7EA 2AXJA 2R5DA 2GW5A 3UC2A 2YFOA 3B7SA 3HC0B 4I7ZC 2UYLA 2IAMD 3OB8A 1ASOA 5E4OA 4O51A 2FECL 4N9GA 4P5MB 1KYOE 1M7DA 1RPUA 3WEBA 1ZV5A 1JDCA 2O6DA 3IM1A 1QVFO 5BMFH 5GS2D 5BOZG 3EO0A 1LWUA 1YYMH 5JO5B 3S88H 1IMHC 4WHYH 4L1TA 1DANT 3CHXA 3QWOB 3WL9B 3CD6P 2MTAA 3TJHD 1DVUA 2KZIA 4F7TA 1YO4A 4Z7IA 5C7XH 3VXTA 1BXXA 1DLHA 5C0BD 1N0XH 2F1BA 2AJZB 1AS7A 3CN4A 3D52A 1UOLA 4GI9A 2YUZA 3OAUH 3TFKD 5SWSB 3MOBL 3LB6C 5CFHA 3KWTA 3CCQP 4F58H 3D3VA 1BEYH 1A7NL 4V1DB 1CU4L 4H25B 1ET8A 3EFFK 5KYWB 1LT9C 1AS8A 4HF5L 1KYOJ 1NTZJ 3QDJA 5IQ7L 3SKOB 5BVPL 1PP9J 2B77A 4KVCL 1A6UL 3VXPA 3HMXA 3DX6A 2YGPA 4QHPA 1QPXA 5CHNA 4W9HC 2QJYC 4GINA 1HQ4B 2OMWB 1U8LA 1KB9I 4NPJA 4TLFA 2CGZA 2P2UA 1YMMD 3PXHA 4X7EC 1QR4A 4R2GC 2Z4QA 3TZVA 4Z8FH 2WNKA 3HUSB 3T1FA 3EDFA 2QGCA 5F7NC 4GQQA 4MB5A 5K1VA 3KL0A 3IJHB 5E9DB 4QNPE 3HE7B 4LBEB 1OO2A 1RK1B 3HD7A 1SGKA 2DQFB 3THMH 2QJDA 4H4NA 1TIUA 5BJTB 1G4RA 4AQ1C 4ZFGL 1H8SA 1H19A 5E5LA 1G0XA 1MFEH 1Q90A 3MBXH 4QJ4B 1R3IL 3DHMA 3FBQA 4GXFA 5HDBB 2BCCJ 3PL6A 3WN5A 2DLFL 3D0LB 1LE9A 1PKOA 3L95B 1QBBA 1TTAA 3BVNA 3NIDB 1O75A 3GHEL 3S6CA 3DX7B 3LN4B 4JAMB 5DMGD 4HGWB 3GXDA 1U95A 1H5BC 2FSEB 2QQLL 3CHPA 4J1UB 4TSBL 5DK2A 2QJPB 3BDXA 1FO0B 1FYTE 1Z7JA 2FSDA 4EMZA 4DK5A 2F08A 4JLRB 5EO0B 3U4BH 3BCCG 1CL7L 1T66D 3L3OB 3O2DL 4X5XA 3I75A 1WS7A 2M0BA 1TITA 4Q8BA 3U46B 4ENZA 1K05A 1IM9B 1IFIA 4Z7OF 1HHGB 4XPBH 1CGWA 1LO2H 4Y5XB 1KBGL 3LVEA 4NUJB 5EN3A 3MLYH 4ALAL 2FJSA 2XZQH 4UB0L 4YXKH 3FNKA 1UH4A 2AJSH 3K1DA 3KPRA 2J1XA 2AXTH 4JYBA 5CGYD 1K2DB 1QABA 2VZUA 2XZAL 1P0SE 3G6JB 1RJYB 1P5UB 2XXCB 1A3RH 4PGDA 5IFJA 3VWKD 4N2KA 4X8JB 3RZCA 4BFGA 1KACB 3W0WE 5F9OH 3RY4A 4JFQB 3NTCH 4JY6A 5E6ID 3VFPB 4KKCD 3EH4B 1J8RA 5D7SH 2Y0DA 1SQMA 5CSBA 1XGYH 3X1BA 2V2XB 4PGEA 5E7FA 4U3FG 3VXMD 1E4XL 4JZOB 5ISZB 2IBZD 5DRZB 3M0DA 4XO3A 3VB9A 1DANU 3KBEA 2P9RA 4KK5D 4AEIL 1EVTC 3QK0A 1R34A 2EC9T 5IROA 1XQ4A 3ZE0E 3HLKA 1QMUA 1CLCA 3TYFA 5KLVG 1VGEL 2X70A 1KY7A 2FJHB 2J59M 2HXAA 4KGJA 1EO7A 2KDGA 4NZ8A 1ZHBA 1FDLH 2OMYB 2YZ1A 5DHYB 1S4XA 4F7EA 5AVQB 2F53B 4AQ8A 5IJKC 5F3HA 4IBZA 4R3SB 1OK8A 3FHEA 4LPYA 1DVZA 3LEXA 1ADWA 2TRHA 4BUGA 4YXDC 1JXDA 4FNRA 2Y1ZA 4JFHD 3ZHLA 2XNDH 2C1PB 2BASA 3D08A 2OTWB 3UIYA 3S5LA 5AW3B 1MW1A 3H1HE 1ULVA 4KJWC 4ZFQA 4G6JH 3AQYA 3O0RH 1S7TB 1F2XK 1NLDL 1J0HA 4NIYE 1XT5A 2BWDA 3SDDD 4LHQB 3EJZC 2EDMA 2HG0A 1QFPA 1RZJH 2EE9A 1MW3A 2AQPA 3BYTA 3K91A 3PHAA 3QIUC 1A47A 5J6HB 4JM2C 5ESQA 2DM3A 5JPMC 2CK3H 3KL3A 5EC2A 2NYYC 1KLGB 1HXKA 1AGBB 2KMWA 5DJZB 3U7WL 3MC0A 2H3NB 2ITDB 3LIZA 3HI5H 2OTUA 4X98B 3VN0A 2QQLH 4OI8A 3QQ9C 4WI5A 3TEWA 1IKFL 2Q76B 3D48R 3RB7A 1SJHA 3QEQD 3U9PL 5D7JD 1QRKA 5KAFH 2QZ5A 3D8MA 4PJAA 5C6TH 3H25A 4NN5C 2AJUH 4WHTA 1RP9A 5LO7A 3AEGC 1WWWX 5IHZA 3QARA 1AR1C 1B3JA 3Q01A 2A9DA 2RQEA 3AVEA 3AE6C 2DQJL 3HE6C 1PV3A 2OQQA 2F7QA 8CGTA 2E74D 4MXVE 4PJ0H 1HSAA 4M5TA 2IQAA 1IIIA 4AVJA 2OMVA 4GKSB 3Q2CA 1MFDH 1T3FB 4GSDL 3WY1A 1YA5A 5ADOL 2Y5TA 3U83A 1R9FA 4RAHA 3LPPA 3KPOA 3LKPB 2Z35A 4E0RB 1KIRA 1T1ZA 2UWEF 4YZFF 4XXWC 2VDLL 2VZVA 3VD9A 3INOA 3OR6B 4ORGA 4X4YB 2ROYA 2D7TH 3H9SD 4F8PA 4JPIA 5INCB 4FGMA 1GOFA 4UQIM 4G5AA 1QSED 1ZW0A 3ES6B 4D9RE 3RFZB 3V0FA 4OV5A 5ABAA 1S7WA 5E6IB 5C3TA 3HS0C 4MKMA 1X5HA 3L4ZA 4PJ7B 5AAMC 4S1DD 2A06G 1U9KA 4WSKA 2DY2A 2O5ZH 5B1JC 3OAUL 1LP1B 4LDCA 3PREA 1AMYA 4O58H 5BS0E 4KHTH 1MH5A 1QUNB 3WFHB 4OZ4B 4TPRL 5ENWA 1KQSO 1NJIQ 1UD4A 2FGWH 5KVDH 5KBKA 2JNZA 5F9WB 3BRFA 1W8NA 4FQJL 5B7MA 3UDWA 4HXAL 5KSBE 4PJXA 1ZDQA 1T1YB 1LWHA 1U91A 2XWTA 3J2PA 5JDSB 5DFTA 4OGQC 1F6AA 4KZCA 2R2EA 4X4XB 3HD7D 3MCYA 4GW4B 2AITA 2OZNA 5I1IL 1ML0A 4KNTA 5LDUA 4GAYA 5EZLA 4HQQL 4RA0C 3HC4H 1CFBA 1IGTA 3BAXA 1WF5A 2OYMA 3CBRA 3CDCA 2F7PA 1H88A 4FEIA 4K23L 1QYGH 3CN2A 4MD0A 5CXPA 4K5LA 2ZUSA 4JY6B 3VE0B 3VFPA 5CD5D 5L9DH 2O4EA 3IE9A 3V2NA 2GK0B 1I9RH 4JS7A 3X11A 4P9ML 1L0NG 4NJAL 3TBCA 5KJ7E 1EUUA 4NT6B 3LV3B 4Z7NF 5I75C 5HYSB 3VWJB 1GGBH 3MRNB 3I2CH 4IRSA 1Z6JT 4KV5F 3RWDA 1HSBA 3L5HA 3VQ1C 3FO1B 4QRPD 5F1OB 3G5YA 3RK2C 4OFDA 2GUSA 3CHOA 1CVRA 3ML9A 2PP7A 4YHPA 2DEYX 2UWEE 3AMLA 3ZT7A 3KLSA 4MXQD 3FTXA 2YMXL 3CX2A 1G9EA 4I1PA 4OD3L 1RV6X 3L4VA 2HRLA 2G75B 2ZOLB 1U3JA 3ZTEA 2VQ1A 4JO3H 1NOFA 1VQNP 2IDBA 1PG7X 3H1ZA 2ZVOB 1YMMB 4G9DA 4HK0B 4TNVF 2EEFA 3SEPA 1YECH 2IYPA 2MJZA 3EH5B 3ETSA 3GGWB 4PG9B 2Y5TB 4N85A 1QR1A 4PJ8B 3TBWB 2FR4A 2H2PC 5EOCL 2OMVB 4HFWA 1U57A 1A14H 1J1EB 1GJUA 3W11D 1NO4A 1XH2A 4JGJA 4KROB 4WTQA 4Y89A 1TKWB 1FHNA 2YK1L 2CLRB 3RIAK 4B9YA 2CJTA 3IPFA 4LDOB 5DUML 5F88B 3DO3A 1OGTA 4FNLL 1AZRA 4YHNA 2X6BA 1P7HL 4WENB 1IEBA 3AZUA 4OT1L 2MCMA 1H3GA 2HG5D 4ZPTA 1IM3B 3PL6C 1VZGA 4LCVA 3L2MA 1JZDC 3QUKA 1JD7A 4P07A 3P3TA 2W60A 1WP6A 1GY1A 3IPBA 1RZKH 4AE1A 1HH9B 3FKUS 1R5WA 4JEGB 2MHAA 4XPAH 2ADFH 2PPAA 3AADB 3BPLC 2EAEA 4AUUA 2PO6B 4KRPC 1DZ0A 4E9XA 1KGCD 3LKSA 3AGWA 3EGXB 3QIBA 5I8KH 4KGLA 5BZZA 2FB4H 5JQ6H 1BGYE 2DWDA 5CSZA 3ZYOA 4RRPA 2ISDA 3FN0L 4A7UA 4L1SA 4R5TA 4MJ6A 4HXBL 4OF0A 3L70E 1DUZA 4YPCA 1CLOL 5F89A 4KXDA 4NQSA 4KV5E 3ZVVA 2WZPD 3ASOB 2MJWA 4YSAA 1U6AL 1H3WM 4NO0D 2O5YH 1SXBA 3STLA 4HWBA 3QWRA 5EU7E 3RWHA 4I18A 3UTTA 4FQQA 3DBXA 3FRUA 3OR7A 1MSPA 2RFXA 1JPSL 2IWEA 4OD1L 2ENPA 3MVSA 1R5WB 4XNUL 1BPLB 3QG7H 5HDLA 3VXTB 1CXEA 2NUPA 3TBYA 3VXUB 3HE4B 1SHWA 1UADC 1Y07A 4FCHA 4XVUC 1FYTD 3F7PC 1RZGA 5FYKD 3ZUCA 4NQVA 3WL9A 1OTTC 4P5RA 3HZVB 1BFSA 3NPZB 3EJCA 3ILDA 3KYOB 2WZ7A 2X4TA 1SDYA 3L81A 3B7UX 3K0WA 2EDLA 3WS6A 4WO4B 2Q9IA 1S9VB 3LNEA 3MJ6A 3QUXB 3ME0A 3HPLA 4H8VA 4U3FJ 4B60A 2GITA 3VFRA 2X0WA 2FJFB 2IGLA 4WUKL 1XH3A 4Y4KA 4FYTA 4YHMH 5EN2A 1A1MA 3GSNH 4XNQA 1XV8A 1AR1D 4B3EA 4IBTA 3QDME 3HE5A 4FG0A 1JGVH 1RF0C 2APTA 2EDOA 3FQXA 3G6JF 3IGFA 2LV4A 3MRMA 4LCWD 3BX7C 1UZ8B 4ZW7A 3UJTL 5KOVC 1R5SA 4APQC 5C8JB 4HUMB 4JY4A 4YSSA 5DEFB 4F2MB 1I75A 3DMMD 3D87B 2AMGA 1OARH 4G6KH 5IMOA 3VOPA 1MRDL 2L7QA 2B15A 3C6EA 4JFTA 4H0LB 3K6SA 5E99L 1NAFA 3MLUL