4TLFA

Crystal structure of thiol dioxygenase from pseudomonas aeruginosa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
194
Chain Sequence
LRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cysteine Dioxygenase Homologue from Pseudomonas aeruginosa Is a 3-Mercaptopropionate Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
total genus 49
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4tlfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tlfA02
2XKOA 4MH0E 3B02A 3TNQA 2ZCWA 5I8SA 2IXLA 4XFBA 3D0SA 5FCCA 3NKTA 2XNDH 3KSCA 3HQXA 3FJSA 4FT8A 3PLQA 2B9UA 2QVSB 1J3QA 1RUNA 2MPFA 4JTOA 3KGLA 2BYVE 4AVBA 4QM8A 1Q5OA 2MHFA 1VJ2A 2PHLA 2P17A 3H8UA 1ZX5A 3MDPA 5KHKA 1O3TA 2IXCA 3M3IA 2Q1ZB 2HKXA 4LULA 1WA4A 4XFIA 5KHIA 4A2UA 5EZWA 5FLHA 3TNPB 4HLTA 1ZVFA 3QACA 3BPZA 1O3RA 3KCCA 3E5QA 1CAWB 2D40A 3E97A 3CJXA 2VQAA 2CV6A 4KWJA 2B5HA 5FQ0B 1IFPA 1RUOA 4WBBA 1JUHA 1OI6A 4KWKA 3PJSK 2PFWA 1UCXA 2XHKA 3S7IA 5EFUA 3GYDA 1BSHA 3E6CC 5FPZA 3RPQA 2EVXA 3H1MA 3ROUA 2H6BA 4HN1A 4HVOA 4D7SA 5I0TA 2V7QH 4XF1A 2WSSH 4R52A 2Q4SA 4YRDA 4HZFA 4JVAA 3HT1A 1O7FA 3EO6A 1UIJA 3OGJA 4MGKE 1LR5A 4E2SA 4L2NA 3UKTA 3HT2A 5BV6A 4IEOA 4UBGA 2Q0AA 5KHGA 2UYAA 3ZDSA 3DN7A 2DCTA 5JCTA 4I0BA 4MV2A 1IPJA 1PM7A 4I3PA 3CO2A 2GH2A 1ZZCA 5I8TA 4EROA 2EAAA 1QXRA 5BXXA 2MNGA 2XLFA 3QOPA 4KL1A 3ST7A 4XFAA 1IPKA 2XGXA 1YUDA 3H3ZA 1Y3TA 1YHFA 3ES4A 3FHIB 1FXZA 2CK3H 4PIZA 4R8HA 2OA2A 2GC2A 2XLAA 5D1IA 4N9IA 2UY8A 4IEVA 3WW4A 4B29A 4FAGA 4HBNA 3C3VA 1ZZBA 2K0GA 5LEJA 1OMIA 2QNKA 3E5UA 3NL1A 1SFNA 1EY2A 1CGPA 1BSNA 3RYPA 4WVZA 2VECA 5J48A 1RTVA 3S0MA 3OTFA 4Q0UA 4H7LA 1UW8A 2UY9A 3ACLA 4KU7A 4EV0A 1J3PA 3WW3A 4P9GA 4XFFA 3I59A 3NSTA 1QWRA 4I0AA 5K8SA 2Z69A 1CAXB 2PAKA 3FX3A 4QX5A 3ELNA 5J3UA 4XFGA 3KGZA 1H1IA 4GULA 1PMIA 3R6SA 3CF6E 4QGNA 3SCGA 2EA7A 1YLLA 1FT9A 1GQHA 3CEWA 3LZZA 1GQGA 4QXKA 5BY5A 1NYWA 1X8EA 4LLOA 4YARA 5JSPA 4JV4A 4QMAA 2WC2A 4AQ6A 1VP6A 1EP0A 4XF3A 3WW2A 2QJVA 4IEQA 1ZZ9A 2O1QA 5LEKA 3MYXA 4Q0VA 1UPIA 5CVRA 2XLGA 1NE4A 5I0SA 4EWEA 3BALA 5FQ0A 5JSRA 3VHRA 3SMHA 2OZ6A 5KHHA 5F1RA 1O4TA 4LTAA 3KMHA 3BCWA 3SCFA 1Y9QA 4KU8A 4FBFA 1HW5A 2PYTA 1QXJA 1ZZ8A 3MPBA 4X6QB 5I0UA 1J1LA 4O9EA 5FLJA 2IXJA 1JEKA 4OLLA 4X6RB 3I59B 4KWLA 1DZRA 4CYDA 2XL9A 4LA2A 3N4MA 4D7TA 4ONUA 3ES1A 4YXWH 3H1WA 4XEZA 3IWZA 4LEJA 2FQPA 3H50A 1WLTA 2PTMA 4ORFA 4BIFA 5C6CA 5LRSA 2ET1A 3H3UA 3DKWA 3D0JA 2E5TA 5AVPA 2FMYA 2PAEA 3IIAA 5C8WA 5FDBA 3HIFA 4MX3A 2GC1A 2IC1A 2N7GA 2XL7A 1ZRFA 3LA7A 1NE6A 2E5YA 5I0RA 3DL3A 2QCSB 1J59A 4AQ2A 4BYYA 4I01A 1V70A 1X8MA 4ZU5A 4XETA 4OFGA 1AQTA 2GC0A 1CX4A 2CAVA 1ZNPA 3NW4A 5I93A 1RL3A 2KXLA 4Q0QA 4MZUA 5JR7B 4BH9A 1I5ZA 3D82A 3NJZA 4IEZA 3U10A 4O9GA 4IEUA 1DZTA 1CAUA 1RGSA 4IEWA 4DINB 3O14A 1XE8A 1SEFA 2H0VA 4QGMA 1NZCA 4NVPA 3FFQA 2O8QA 3OCPA 1ZRDA 1E79H 3E6BA 3IDCB 2ET7A 1SQ4A 5E1RA 5T3NA 4EWAA 4FAHA 3I7DA 3CLPA 4F7ZA 3FE5A 2OZJA 3SXWA 3S7EA 3PVBB 4J1WA 4META 1I6XA 2BNOA 3EBRA 1UD1A 2V09A 1EYBA 1J3RA 3RNSA 5HI0A 1VR3A 4BHPA 4HVRA 4IEPA 3IDBB 3H1YA 1YFYA 3MZHA 5LRRA 4I2OA 3BU7A 4I02A 3PNAA 4XF0A 2ATFA 2WFPA 4IERA 5KHJA 2IXIA 2CGPA 2VPVA 2UYBA 1LB2A 2BEOA 1XRUA 2PAMA 4PJYA 1O3SA 1XE7A 3M70A 5KBFA 2I45A 2W6JH 4YNIA 4N9HA 1YFXA 4UXAA 3FZ3A 5CU1A 4XFHA 3EJKA 3EQEA 2ZKLA 2OYZA 4XF9A 4K8FA 5BPXA 4E2GA 1NXMA 2D5HA 4ZU7A 2GC3A 2JDIH 4AXOA 1RC6A 1Q43A 3U0ZA 2H6CA 3USSA 3U11A 3LWCA 4IETA 4MUVA 3RZZA 4RD7A 3GBFA 4IEXA 1ZRCA 4HSLA 3FWEA 4Q29A 2D5FA 2OPKA 2PA7A 3LA3A 3UKNA 1OFNA 1ZZ6A 3RYRA 4Q0SA 4XFCA 1TQ5A 1CAXA 4LA3A 2IXKA 4ZU4A 4F8AA 1YFWA 2K9ZA 2QDRA 4QM9A 5JSOA 1ZREA 3I54A 1UIKA 2GAUA 5BUVA 1Q3EA 4I09A 1O5UA 3E6DA 3OD0A 5J7MA 4WZCA 1O3QA 2CAUA 4PIXA 5FLIA 1QY4A 4LUKA 4Z82A 4Z07A 5CADA 1CAVA 4UBHA 2GU9A 4HN0A 4EWDA 3G7DA 3LAGA 2QE7H 3EHKA 1U12A 1DGRA 3WW1A 5I8YA 3EFFK 5JAXA 4PIYA 2Z2SB 3LA2A 4HMZA 2XKPA 1LRHA 3OF1A 2B8MA 3SCHA 3RDIA 2C0ZA 2IXHA 1YWKA 1L3JA 1H1MA 1WGPA 4AVAA 1ZRRA 4J1XA 4JTNA 3LOIA 3NVCA 4MGYE 4YYOA 4TLFA 1X82A 2PQQA 3SHRA 4AVCA 2D93A 2F4PA 1G6NA 2Y0OA 5FPXA 4HSJA 1ZZ7A 1X7NA 2BNMA 3ETQA 2HJIA 2GZWA 4IEYA 1YFUA 4IESA 1O5LA 2E9QA 2ETEA 1DGWA 3E5XA 3JZVA 1J58A 3H7JA 3DV8A 4MGIE 4E2QA 3H7YA 4MGZE 3L2HA 3UKVA 4QGLA 1CAVB 1CAWA 1EPZA 4XF4A 4YSFA 3BB6A 4L11A 4LUMA 1FS0E 3RYKA 1FI2A 4DJGA 2BGCA 1CAUB 5E16A 3H9AA 3IBMA 4HVQA 2BNNA 5I91A 1OD5A 2Q30A 4Q0PA 1LKNA 2PHDA 3CL1A
chains in the Genus database with same CATH superfamily
1NLSA 1GICA 5C8CA 2RHPA 1IS3A 2VAUA 3KB5A 2J7MA 3RJ2X 3C2UA 3NKTA 3BN6A 3SH5A 1YNAA 1G9CA 2G9FA 3KSCA 3RMXA 4FT8A 2LXBA 5FJHA 1CQ9A 1REEA 3ZN5A 4K3AA 3I55P 5J36A 1NCRC 4YW1A 3VHNA 5CCGD 3CWBE 3AB0A 3L74E 2IZWA 5KAFH 1GWMA 4JX0A 2C9AA 2RR12 2R3CA 4G3YC 1OH4A 2MPFA 2QJPC 2P3JA 2V5DA 1MFZA 3LIDA 3KGLA 3POWA 1PP9G 3AEEC 3CCVP 3MIBA 1D4VB 4QM8A 3OEAA 2DUQA 4AVBA 5FZ9A 2E31A 2WYSA 1W3XA 1AX2A 1V6NA 3GHMA 3AZWA 1IC2A 4WY4B 1VBA3 4UFJA 4H44B 2OTJP 1GWLA 1ZX5A 2VMDA 4M3CB 1MS0A 3DYOA 3VD5A 4AHZA 1ND3B 1S4CA 2BBAA 5FZMA 1I9RA 3H1LE 1NLRA 3MIGA 4LULA 5FYHA 3HBZA 5EZWA 2ZX1A 3IN9A 5EYYA 2O1KA 3MW2A 5FLHA 5A7WA 1C3HA 4GA9A 1RUE3 3TNPB 2B46X 3QACA 4CSWA 3BPZA 3CXHH 1JU4A 2BDRA 2FXPA 5DZGA 1CAWB 2D40A 1QXPA 2P1BA 3ZN6A 2VZTA 1PVC2 2CV6A 4KWJA 1AR93 2I2SA 2SLIA 5ABJA 1RUOA 2PFWA 4YW6A 2R30A 4D6QA 4Z1VA 5IUQA 2XHKA 3IAQA 2JDKA 5H2FH 2NMOA 1GL2B 1UY0A 1SQVG 2OYHC 1Z7S2 3ZXEA 1BSHA 3AX4A 1QOTA 2WQYC 3WD5A 5FPZA 5J98B 3H1MA 2JDPA 1POV0 1MEC2 2RJKA 4SBVA 3PU3A 2V7QH 1W03A 5A6ZA 2WSSH 2WT0A 3AZYA 5KXEA 1K05A 1JOJA 4R52A 3FLTA 1Q81Q 1BE3G 3LSDA 3C1LA 4JVAA 2ZHMA 3N9QA 1WMDA 1SZBA 2QEXP 2WPRA 2WRAA 5IATA 2VNVA 2XVGA 4N43A 2VH9A 4MLOA 2PLV1 4K35A 4NAMA 1JYNA 3E7KA 4YVSC 4L2NA 4E8DA 2DV9A 1S0GA 4HPKB 2MKVA 3FUOA 3WP6A 4CE8A 4AI2A 3ZFGA 5BV6A 3RZHA 2BVBA 2Q0AA 1ZA7A 2KZIA 3GHGC 2VZPA 4UYBA 1RUH3 3L72G 1DIPA 3AKRA 4WB4A 1KYOD 3PDQA 2Y6FA 2WFF3 4C46A 5CCHA 1SCSA 4HKOA 4MV2A 2GP3A 5GLTA 5FUIA 2ZEYA 3U78A 1R091 2ZBJA 2P3YA 3TNUB 1LGNA 4GXLA 4I3PA 4B1LA 1W8HA 1ZZCA 2EALA 3FFZA 1MZ5A 2IBZI 2CDOA 2OVUA 3CNAA 5EQUA 2VUJA 5FYCA 1QXRA 3BIWE 1C8M1 4XW3A 4W7ZA 1O8PA 5BXXA 1L7QA 5LY2A 3D70A 2XLFA 4QDRA 1KB9I 1PGOA 2ZGTA 4KL1A 3W21A 3ST7A 2NPSB 4XFAA 1ZBE2 2XGXA 5H9PA 5A3MA 2WQ8A 1DQ0A 2AXCA 1GNZA 1NWQA 1OLRA 1ULCA 2C5DA 2Y26A 3FWNA 3ALQA 2DU0A 3BASA 4TLGA 5SV5A 2CK3H 3FC0A 3A2AA 3JB8A 2Q8EA 4C1XA 4DZGA 2XJRA 2OA2A 3H1LJ 5KC5A 1XNKA 1FNZA 3HE5A 1UU4A 4CCMA 1JUNA 4B29A 1DD3A 3ZR5A 4FAGA 3D8CA 1M8OB 1S55A 4BWNA 2VXRA 4NPLA 2OKXA 4M4PA 5KAFE 3B5LB 3UJQA 4DXRA 4LGDE 5FY4A 2W3JA 1OMIA 1JHJA 1N3OA 3ZXDA 5JR2A 2QE3A 3E5UA 1SFNA 3NL1A 1SQPG 4NOTA 2V4HA 1Q86Q 3H1KE 1YIJP 2H43A 1RVF1 3RYPA 1S2KA 3P5BA 4E4ZA 1CZVA 2R041 5CJ0A 2CGOA 1KQGB 4MGTA 1VMJA 4CU6A 4XE9A 1W8TA 2R5DA 4LKEA 4C90A 1JZ4A 3ZSLA 4V2VA 4GOEA 3J8F3 1Z56A 2AREA 3CDZB 1OF3A 3CQOA 1N7SB 3PU8A 4I7ZB 1YJLA 4WVWA 3AECC 5IAVA 4D6TE 1GK6A 1D7PM 1EUUA 3CZUA 4LK6A 3P8MC 5CNAA 2AACA 1DU3D 2DBIA 1PO11 2LW8A 1GL2D 2KXPB 1TME2 2J1SA 1RMU1 3VTPC 3H25A 2PP6A 3WW3A 4FSJA 1OPOA 2JDUA 2ZGRA 3TOJA 1QWRA 1JZ5A 3LB9A 4Y1VA 3HUSB 4K7JA 1FBMA 2PAKA 3JU9A 4QX5A 4AQRD 4AI0A 2YDEA 1ENSA 5C9AC 1RF0A 1GW3A 5L9RA 3WG1A 4AGRA 3M3OA 2VUDA 1J1TA 2VM9A 3WG3A 4GULA 2X5IA 4QGNA 5DXDA 2D2CD 3O6QB 1H2NA 1YLLA 3KT7A 3TF5A 2ZHLA 3AJYA 3ZOIA 4BDVB 1SQBE 4FPGA 4N43B 1IFIA 3CEWA 1ZRIA 3HPNA 4CDUB 2C26A 1GQGA 1OOPB 2NPSA 1R093 1XNTA 1PGJA 2RS33 3ZYPA 3UNPA 2E74C 1NYWA 2D6NA 1RUC3 4KH9A 1X8EA 4LLHA 2BOJA 5AC92 2XZRA 3GCWA 4XMAA 3ZN4A 2J1TA 2DCJA 1PZ8A 2WSEH 1PNFA 2V73A 4GB32 3L4FA 1GQPA 3EMRA 4FPLA 3KVBA 4JV4A 3TN92 2JEEA 4FPHA 3O0XA 4BK5A 1U5YA 4CUCA 1W2BO 1XYOA 5BNNB 4IEQA 3U4XA 3I3MA 1OVPA 2O1QA 2XJVA 2PMWB 3M3QA 1ZXGA 5IVFA 3FBYA 4PJ0E 1BE3J 3KHCA 2DTYA 3FN9A 5BNOB 3VD9A 2KK7A 1BVP1 3B3QE 2E51A 5CVRA 5H9SA 2XLGA 3HE4B 3I2KA 3WQ1A 4BQXA 2R49A 2VMIA 4EWEA 2HEVF 4FXKB 2M0BA 1HQWA 1S0FA 4LE3A 4XQWA 4AI3A 3N7KA 1P84D 1W2TA 3VHRA 3VD7A 3AFGA 4AFMA 1LT9A 2OZ6A 4U3FE 2DW3A 3H1HJ 3F2ZA 5KHHA 5F1RA 5KWRA 4MYEA 1X22A 1N47A 1JCCA 1Y9QA 5E88A 1W5CE 3N9OA 3NO8A 2QA4P 1Z0HA 5IVVA 3WNNA 1L0LJ 2WWWA 1FZEA 3CCJP 1QXJA 3MPBA 1AR71 5TISH 4GWMA 3QH9A 1NKNA 1J1LA 3BCCG 1ND3A 4XJWA 2JDYA 5I0UA 5FMBA 5LCWL 4YGBA 3POJA 1JEKA 3QH6A 1PPJG 4X6RB 2JG9C 2Y60A 2WZPP 2P6HA 3LFIA 1AR92 1VMFA 1SBFA 2QUOA 4HANA 4EJRA 3RL0C 3RK3B 1M4WA 2DF7A 3O1RA 5AVUB 4YXWH 2ARCA 3ZKUA 5KLVG 1OOPA 1FC2C 1IHMA 2ADEA 3IWZA 5FYYA 1SQBD 4XHXA 3AYCA 5JUVA 3CJIC 5C6CA 5LRSA 3IR9A 3GBWA 3AYAA 4QPWA 1DG6A 4CCCA 3H3UA 1VBA1 5CISA 3D0JA 4AEKA 3NNMA 3L36A 3T97B 1KS4A 1UU6A 2JE7A 2WPQA 3PL0A 5AVPA 2WJSA 1ULEA 3M3EA 3CJIB 2VW2A 4AEJA 3HIFA 3MUDC 3R0RA 3MIWA 2GC1A 2IC1A 2XL7A 4MX3A 4CDXB 3LA7A 2VD7A 1W2AX 5GLVA 3VBSA 3J7MA 3Q5PA 1DF0A 3T30A 1OVVA 2V72A 3CL1A 2RVAA 4LBQD 2R062 2RE9A 3DL3A 5I0RA 3RK2D 4OQ8A 3AC0A 2JG9B 3QH7A 4BYYA 1OLQA 2JWAA 5J1XA 4GWIA 1P84E 1K5MA 1K45A 1SG3A 5AVSB 1PZ9A 2A3YA 2DVFA 5L9BA 3I3DA 1EDIA 1KILE 1DGRN 5APTA 3I2JA 3SH4A 4MG2A 2Y6KA 2BCCE 5AVTB 1E5SA 1ZBA3 1A34A 1IKPA 4QX7A 3RZGA 3TEWA 1A6CA 1F4AA 2XQXA 3M3CA 1A02J 3NFQA 2JR8A 1CJDA 2QJKC 2K3RA 1GZ9A 2FCTA 2UU8A 4TYSA 4CP9A 2JG9A 3VZOA 3MV01 4NR1A 4XBNA 5JR7B 4BJ0A 5CKQA 1FZFA 1AL21 1YIFA 3JQXA 4K40A 4M3CA 4BH9A 1G7YA 5FJKA 4GWJA 4DUWA 1OX3A 1NKGA 3ASIA 4IEZA 3U10A 2OYIC 1BZWA 1S4XA 1D0GA 5FY5A 4QQOA 1T8ZA 1V6MA 1WZXA 3CHXA 4TXWA 3HTKA 3VZNA 2JENA 1GZTA 2JX9A 1JYIA 4RFT0 3GZTB 4ZXEA 4UB8H 3IN6A 1VQ8P 1FOSE 1KQRA 2QZ3A 1CD3G 1H2LA 3O14A 4QPGA 3TYYA 1ENRA 2HFED 4OUSA 2H89C 2K9JB 2JEMA 5A7OA 5AW5B 1YO8A 2E75C 2GDFA 2BASA 5IAXA 1N86A 3FFQA 2QJPB 2W1SA 2ZZJA 1DEEG 2O8QA 2WQ4A 1ZW0A 1CJPA 1H88A 4YGCA 2VE1A 4W6XA 1E79H 3SH3A 3IDCB 4XHBA 2ZX3A 4FAHA 1SQXK 3PH0A 1NVOA 2O01N 1NTMG 1NTZG 1EV12 2A6VA 2W52A 2Y6LA 5FKCA 4CDXC 1T2KC 1UZZA 1V6KA 3VKNA 3HD8B 2WSCH 3H1HE 3S7EA 3PVBB 4JHZA 3VBRB 2ZVNB 1PX3A 4J1WA 5APXA 1DYPA 2V5YA 1D2SA 1UD1A 4GQ7A 1QJEA 4K6BA 1NCQA 3W5MA 2JWDA 3GGLA 1T2KD 3V64A 1ALYA 1NTKE 2VO5A 3MV11 1SDWA 4CTEA 2B42B 3VD4A 3I2FA 1F8VA 1WUVA 1J3RA 2G9ZA 3RK3C 1JB0J 1SQXE 1VR3A 2DVBA 4P02B 4BHPA 4COWA 4PLOA 1L7LA 1G2CB 2HLOA 2EIDA 1JTZX 2W91A 1NTME 1NTZE 3H1YA 1MUUA 4H44C 3IIIA 1S0JA 5LRRA 3T0BA 3WV6A 2VNRA 2W1UA 5HCFA 1GR3A 3W58A 2IFRA 2K1AA 4I2OA 1KYOE 1MACA 3AE9C 1KDKA 1LTIC 2G8YA 3L71D 4L73A 1QJU3 2J1AA 2XH6A 3EYPA 2A1XA 4A4AA 2E7QA 3B5NB 1KMIZ 2ZJSE 1US2A 1EAH3 2VUCA 1OA2A 3NRUA 2BCCJ 5F2WA 1W6PA 4BZ4A 2K88A 4NIHA 3I3EA 1MV8A 4H0LB 4Y5SA 3JUUA 2BEOA 4D94A 2DUOA 4BLIA 2G3AA 4RL7A 5FY0A 1NU1E 2RMU1 5AVXB 3W9AA 4PJYA 2JG8C 4B7KA 3M70A 1O3SA 3FUQA 1YBKA 1AHSA 3OUHA 3GBGA 1VBA2 3OGGA 2WAAA 2XONA 4YNIA 5T5OA 2VC9A 1YFXA 3RK3D 2WT7A 2XJUA 1U7MA 1WKYA 4UXAA 1JZ3A 2WO2A 2QG4A 1AR91 5FYSA 5A33B 2ZAHA 5AW2B 3MBWA 2OUJA 1L4AD 3EQEA 1KEXA 1SCRA 3H1HD 2QQNA 5DN2A 4OMCA 5CKNA 3EFGA 3HUSA 2NYYA 2IBZD 2HWE1 5CBOA 1NXMA 3KYQA 2XJTA 3ZMOA 1OQEA 3K48A 3VBSB 1UZWA 1IG3A 4PT6A 2D5HA 4NHMA 3OAKA 2VMFA 4CCOA 4XBQA 4ZU7A 3M8LA 5FO9B 2YNYA 1KB9D 1Q2NA 1Y7BA 3LDBA 2M8RA 3TGUE 1RC6A 1HGVA 4CA9A 3L74D 1FDMA 4CPBA 4PV1D 1PPJD 3BPSA 3UK9A 3OYWB 1HJBA 4IETA 4RHV1 3OPWA 2O1JA 4LORA 5EXOA 2JKBA 1JY3N 1FPN1 3GBFA 2ZAEB 2YROA 4OZOA 1W8UA 3Q8FA 4Q1PA 4RGKA 4EE2A 4URTA 1WW6A 4Q29A 5F6KA 2D5FA 2I1KA 4KJMA 3I97A 5F5QA 3U59A 1HUCA 5FAXA 5ABJC 2UWJE 3CCMP 1L0ND 3ZX7A 3RYRA 3E1F1 4E4DX 4GWNA 1N1TA 1CAXA 1IK9A 1TQ5A 1X8YA 3B9CA 5FZ7A 5C71A 3O1VA 4ZU4A 4DB5A 2ZGQA 1W06A 1S3JA 1DGLA 2QDRA 2W6BA 1OT5A 3RMYA 3GLMA 4Z8BA 3MUDA 2D44A 3ZSJA 5JSOA 1ZREA 5FYBA 1OQDA 4R4MA 3K75B 1F31A 5LK7B 3FLPA 4IGQA 5EJZB 2FD8A 3P7KA 3ETPA 2WT7B 5J7MA 3OD0A 2BEZF 2D2CB 1OA4A 1MVQA 3WF2A 4YW7A 5EV7A 4LUKA 3RK3E 5CADA 3KV9A 1VQOP 2GU9A 5GM0A 1QJY1 3GZEA 3BCCJ 3RJRA 5A70A 2NRGA 5BU8B 1H0TB 1F35A 1OKQA 1R1A2 1VAKA 2QM7A 2ZHKA 2VZRA 5DDJ3 3VMYA 3EFFK 5F3IA 5T54A 1O4ZA 1SLLA 3EWKA 2BRTA 5JAXA 3HNMA 5FZ3A 3G4SP 2HEYF 1VF5B 4IW3A 4Q4W1 2Z2SB 5BNOA 4MO3M 2IFMA 2A45G 4ZS3A 3AP5A 3GF6A 4IL6X 2FZ1A 1ZLLA 1G86A 1QJY2 2X29A 2EXKA 1ZBA2 3L74J 2KD7A 3TGUD 4LKSA 4S2FA 4OI1A 1PPJE 1UWWA 1DX7A 4W6YA 1WGPA 1XNDA 2VTFA 4AR2A 1LOEA 2DVGA 1VBD1 1L0LD 1DQ4A 2AH2A 2ZA9A 5KXBA 4QB2A 1AR63 3VZJA 2D6KA 1ULDA 1LENA 3LQCA 4MGYE 1OFCX 4X8PA 5HV4A 1VPCA 1I5PA 4TWTA 3SNMA 1XSRA 4G9SB 4LO6B 2I8DA 1L0NE 1RQVA 1SQPK 2IFNA 3FWLA 1UPSA 1NCRB 2D93A 1OVUA 1VQ7P 1HB2A 2F4PA 2GH8A 3DUIA 4LOTA 3C9IA 1G6NA 1W0PA 3K3NA 3RL0D 4J6GA 2Y0OA 1FOSF 4MXWB 5FMDA 3SC7X 1N73B 4YVWB 3WDWA 4GIQA 4JBZA 3AVSA 3LEIA 2ILMA 2HJIA 1HB1A 1SQBJ 2GZWA 1SQQE 1YFUA 4IEYA 2HWF3 5GKAC 4CDQB 4LXLA 1RUF1 3ZYFA 1O5LA 2PRRA 1LOFA 2E9QA 3KHUA 3BGAA 1GUIA 2JDMA 2VQ0A 3PIJA 2FYZA 5KTBA 4JHTA 4GJYA 4DZOA 5A3LA 3H6PA 1EV13 2GSYA 4Y5Z0 2WZ8A 2PHWA 1GKBA 5LA0A 1SLTA 1SQPE 1RUI3 4MVTA 3UKVA 4JYCA 1V6LA 3THPA 1IFMA 4J25A 5JOXA 4DXZA 3NNJA 5FMOS 3ZFEA 4GOFA 1D4M2 1QHDA 4XF4A 4P08A 4ASLA 1UIIA 3L72E 1LWUB 2W2IA 4YTPC 4NIIA 4OUMA 4DJGA 2R16A 2R073 5CJ4A 3N7JA 2QQLA 3CIHA 3ZVXA 1JHNA 4LIUA 1LOFC 1EQ7A 2PXJA 1RUI2 1XNCA 3A0HH 5K5GB 2YBPA 3CXHE 5IVCA 3D6ZA 2ZTNA 4QHZA 1LKNA 4GAZA 3ZIWA 4TZDA 3WY6A 3L73J 2WZR3 4E4HA 4AEDB 3B02A 1NA1A 4YZ2A 2ZCWA 5I8SA 1KYOI 2A6ZA 3AXEA 4DIQA 1L0LE 1XYNA 3ZSMA 1N73C 1JOBA 2W95A 1JYVA 3HQXA 1MS5A 1K9MQ 2BCCD 2PN5A 3WUDA 3BVHA 1JO5A 1Q8PA 1R64A 4PF1A 3CXHI 5A7QA 4UWDA 2VULA 4QQLA 1BYHA 3CMAP 2JP3A 2KNCA 1URXA 1J3QA 2N1TB 4EI2A 3V0BB 2YGLA 4PD4H 2WSEJ 4NPMA 2MHFA 4FO9A 1VJ2A 4P5YA 3E1IA 4K9SA 4Y1ZA 5CG9A 1JOPA 5DAWA 3VBUB 5JWPA 2A75A 4A3ZA 4AEDA 4BB3A 4Z1MH 3KXDA 1AR73 2ZMNA 4C7NB 1NO4A 3HQRA 1P84H 3ILNA 5KXDA 3MDPA 5FY1A 3M2MA 5KHKA 5L7OC 2FXOA 1CI6B 2XWJB 1MS8A 2R042 4XFIA 5KHIA 1H8TA 2OYIB 4BOWA 1PO21 1UZYA 1V6JA 4Y4RA 1JCDA 5DZFA 1FJKA 1RYYA 5CA6A 3GZAA 1O3RA 2C9NY 1OW8A 4H14A 3ZPYA 2QIWA 1VALA 2EIGA 1OUSA 2SBAA 3N7LA 2A06G 3OPZA 5LA1A 1LGHB 3G6EP 2VQAA 4AVTA 3MP7B 2E33A 3NV2A 2B5HA 5FPLA 3O1UA 4P9WA 2WWSA 4B86A 4QHBA 2PGDA 1NY72 2HWD1 1OI6A 2FMDA 4PLNA 1S0BA 3U4SA 2D2CC 4RQPC 2M5AB 3ITQA 5C5TA 4CP0A 3S7IA 4FTSA 1LHWA 3EB7A 5EFUA 3WNKA 4FOWA 2W08A 5C4WC 5C8CC 2W92A 3LCPA 1CIWA 4HONA 1OW6A 3WEZA 3E6CC 4Q8KA 3IT8A 4M0HA 3L72J 1ODMA 1W6MB 3MUY1 2P2UA 3TDKA 3Q2YA 1HRV2 2FCUA 4QQ2A 3ROUA 2WO3A 5KR7A 1WWYA 4D7SA 3CWBD 5I0TA 4D6TJ 4XF1A 3LOBA 3RI8A 5CFDA 2Q4SA 2V7QJ 2D3RA 2G4IA 4MGKE 3V6IA 5KLVE 4R4LA 4E2SA 4RKUJ 3RZKA 5KJ7D 2JDNA 3TEYA 1YQ5A 4LBNA 1SQQK 1JYCA 4IEOA 4UBGA 1DQ1A 4GH4B 2MJZA 4Q27A 2UYAA 2F6BA 2E63A 1KGYA 2GUVA 1VQ9P 3USUB 4FFHA 4ARXA 4CUBA 1EZVD 5K0UC 1AVOA 2CNAA 4AI1A 4GDOA 1YCIA 4CEWC 4CXYA 2Q1KA 4MOAA 1G1JA 4WY4A 3MICA 3JXSA 1XQNA 2XVKA 1SACA 2GH2A 1KFXL 4EROA 2EAAA 3RK2B 1LT9C 2GNTA 4M3LA 3N35A 3V2QA 1FU1A 4Q4X2 5LASA 1TU3F 1GU4A 1C4RA 3ATGA 5DAPA 3KV5A 4RFRB 3GXUA 3ZXLA 3VB9A 5GZCA 4PHZA 4WM7B 5DUVA 4JPZB 4LHSA 1VBB3 1CWPA 2LS6A 2XUMA 3KZIE 1Y3TA 1YHFA 4NHLA 4D3WA 5GZDA 1FXZA 4FVVA 3AL6A 3OG2A 4PIZA 4Q4X3 5FZIA 4C0HA 1B09A 4LO4B 4OHVA 2BCCG 1P84I 1BQPA 2ZX0A 2GC2A 3S6PA 1L4AB 1A78A 2XLAA 2XVLA 1OXCA 1QLED 4CU9A 2VNOA 1S0CA 1EXIA 5A80A 2XDVA 3AP4A 3ILRA 4HBNA 4XAEA 3A0HE 2DYCA 3IKWA 2AEMA 5HCBA 2R44A 3I2GA 1LNSA 3EQ2A 1HKDA 5LBFA 3VBUA 3J7NA 4MXVA 5JOZA 3I3QA 1TMF3 4QXHA 4FPJA 3VBFB 1HXS1 1CGPA 3B7MA 4LHKA 2AXTH 5TSWA 2P58A 1WMKA 4NWVA 5EJ1B 5C33A 1SP4A 1SFYA 2FFDB 2VZSA 3PIGA 3WQ0A 3ZIXA 1KD7A 5FZKA 2OX0A 2HR3A 5JIAA 1GMJA 2HPCB 2W47A 1HX6A 1JTHA 1GP5A 1Q82Q 4OHZA 4CU7A 1VRBA 1YQ8A 2B9BA 3VL8A 5CYYA 1LHVA 2P2KA 1MVEA 4EN6B 2XG3A 1MEC3 4YGDA 5C70A 2VG9A 4M00A 1UW8A 3RWKX 1NU1J 4QDQA 1LOCA 4KU7A 5SV8A 5K7PA 2BP6A 5JOYA 5FXVA 4RESB 3LEGA 4JDOA 1RUJ2 4XFFA 3JQWA 1XSQA 3I59A 2RS11 3J26N 3NSTA 3THDA 1W39A 5E79H 1YQ2A 5E79E 1LESA 1OVSA 3U1XA 4C7RA 2JO1A 5J3UA 1HRI3 2ZX4A 1HRI1 3FGAD 3JD73 3OSDA 5L73A 3VKMA 2WZR1 3KGZA 3T4VA 3ZDVA 4ZNCA 1VAVA 3MIDA 1CSBA 1FZAA 3MZWB 1HF9A 3CWBG 5LBEA 5DUUA 3ZXFA 4FTEA 3CF6E 1OQ1A 3POGA 4H2AA 2JXAA 2RS12 2WO7A 4Y4YA 5FZBA 1AYN1 1GQHA 2DWRA 3IMMA 4IV1B 1HN1A 2WNVC 5BU5A 3AL5A 4D6RA 2YXSA 5JPNB 2UURA 3BKZA 4YW4A 4L75A 1JMUB 1BE3E 1ASJ1 1GANA 4SLIA 5BY5A 3T08A 2YO2A 2LTNA 3GJBA 3POSA 2VGDA 1AR82 3SISA 5IYYA 5FYIA 3FXEA 4NUBA 3TN91 5JSPA 4ARYA 3VBFA 1QJX3 4NHKA 1LT1A 1IOAA 1NCQB 1QU0A 4YXDC 1VP6A 3DXTA 3PUSA 4OHXA 2YB7A 4XF3A 4JQTA 4GZ9A 1XNBA 3KS7A 4QB6A 2Z5IA 1R092 2NLRA 1YTZI 2WA3A 4IFFA 4KQ7A 4IV1C 2WO1A 5IK7A 5CG8A 1NE4A 1OZHA 2JG8B 3U1CA 3B01A 3BALA 3MF9A 3O0VA 3PMSA 4QXBA 4AHXA 1W2UA 1DIWA 1UMZA 4QPIA 1BBT2 1LU1A 2OS2A 2QQKA 4EN7B 4DUXA 2XU6A 2Y6GA 4Q26A 3SMHA 5A3TA 3NJYA 1N1YA 2IZ0A 4E27A 3I49A 4LTAA 3OW2O 3KMHA 4Y1YA 3TRSB 4XMIA 3WDUA 1BXHA 2W5FA 4FBFA 4I0WB 3BIEA 1NQJA 5AVWB 4UF0B 1FAVA 2ARAA 4H0LD 1ZZ8A 4QAWA 1ZR4A 5APQA 2TNFA 5CIRA 1X50A 4O9EA 1NCQC 4LKFA 1W6PB 5FLJA 1AR61 2IXJA 1RF1B 4E8CA 2FDKA 4RGAA 3RZJA 2KLVA 4OLLA 4PQQA 1IQAA 3HNYM 1SQVK 3I59B 1LP1B 2JWPA 2OUHA 3AE5C 4QPIC 3N7NA 2FBWC 1IS4A 2YZ4A 5DQ0A 4U36A 2J58A 2O0OA 2JD9A 3N4MA 1UZVA 1VBD2 1ZA4A 2YPDA 1SQPD 4ONUA 4AWDA 3ES1A 1GSLA 1Q8SA 2BQPA 3CU7A 4RJTA 1PVXA 2A6XA 1DGWX 1S5LE 3NXSA 2A71A 2LALA 4XEZA 1G2CA 1JY2N 2K2SA 2YBSA 4URAA 2FQPA 3OEBA 1WLTA 2PTMA 4L99A 4ORFA 1BE3D 1J1DC 4UB6H 3V2NA 1JNMA 4WZFA 3WHUA 3DKWA 1IFDA 3AE3C 1HV0A 3JSVC 1NZIA 1RUG2 3HUSC 5L8RJ 3LIEA 1KN7A 1PHMA 2D6PA 1EDKA 4JGZA 4YVSB 2IPPA 4YG3A 5FDBA 1E5RA 2OTKE 2WWJA 3NV1A 3WU2H 3ZYRA 5JXHA 4XE5B 4DQAA 4E9KA 4NPRA 1BK1A 1KB9E 2YV8A 3DPRA 4YW5A 3ZLIA 5C4WA 5IT6A 4IOIH 1KDMA 1IK7A 2ZABA 3IB3A 1X79B 3UYJA 1CX1A 2HYKA 4I7ZC 5LA9A 5F37A 1VPHA 1LJ7A 1K5JA 2WAOA 1JW6A 3WCSA 2BOIA 4RS5C 4W6WA 2CL2A 2D97A 4AQ2A 3Q1MA 2B4KA 1HRV1 1V70A 1RE3A 3K51A 3LPGA 5T5JA 5DAQA 3UV9A 1Q8QA 4KG8A 3PTZA 1QVGO 2EXJA 2WSFJ 2Q3EA 4HJGH 2P6CA 3ON7A 4LO5B 3GMAA 1QJY3 4RA0A 4Y20B 3AKPA 3B69A 1KQSO 5APSA 1DQ6A 3HN1A 4IFMA 3IMNA 5FUPA 5TJHA 3X29B 4CDWC 5CAZA 3WDVA 1DEBA 2POHA 2W27A 1EUTA 1Y9GA 3JBG2 4WVMB 2KXLA 3HOBA 4B8EA 4EZ4A 1V9U3 5JLVA 2A06E 1WMEA 2RDRA 3W59A 1OSGA 3ORJA 1LJ2A 2YFZA 2VZQA 3H1KG 3JCUH 2WSVA 2QQJA 3FHQA 3LIHA 3MLKA 3WUCA 4QDSA 1WCDJ 1ULFA 2D6OX 1I3HA 1XU2A 4O9GA 4YZ5A 1JY3P 4XC9A 3N9NA 3PURA 3MFCA 3WVJA 4NN0A 2E76C 1DZTA 3MIHA 1JZ6A 1WCSA 1N3QA 5KXCA 1XE8A 4AL9A 4QGMA 3OGRA 3CC7P 3R4YA 4LT5A 1W8FA 4YFWA 4CRQA 4NPFX 1Z7S3 2WTYA 4Y22A 2LROA 2ZPXA 3ZXGA 1BKZA 3IF4A 3L73E 4MHRA 2HLEA 5FZOB 3VBOC 3OCPA 4PBPA 4QKNA 2OYHB 2BFUS 4K20A 5E1RA 3P3NA 2ET7A 1SVFA 3TGUJ 1SQ4A 2W68A 4KBBA 1NTKJ 3I7DA 5FP4A 5C3PA 1KXGA 3ZFFC 5LZ6A 3FE5A 3WDYA 1UU5A 5KLIB 1ODNA 1M56D 1RE4A 2KP8A 4Y24A 4ES8A 3GCXA 3SXWA 3HBKA 3KD4A 1RF1A 5AVQB 1XC6A 3WG4A 4XDQA 4CDXA 3MIFA 4META 3WQ7A 5DPNA 3H8XA 1KILD 5ACA1 4QU1A 4MHUA 2JJLA 1QQP1 1LTJA 4NPDA 1EYBA 3VOPA 3WUTA 4H44D 1PO22 2JB8A 3DXUA 3PVEA 3WINE 4D0QA 4PDWC 5IVEA 1L0NK 3FX0A 3DECA 3WUUA 1H0TA 5FP9A 1SS1A 4XCBA 3T09A 4YM0A 1HWTC 5KLVD 1LTJC 2ZFCA 1A3KA 1APNA 1NKZB 2WUHA 3IDBB 4HVRA 4IEPA 3CCUP 3SEPA 4BISA 1UMHA 1PIXA 2A45I 1F5JA 2R071 4Y99C 3VZMA 2WLPA 1SQVE 4CEYB 5FYZA 3KPEA 2VTXA 4UW3A 3PNAA 1EZVE 4CXWA 5AC91 1US3A 3AMQA 2RH0A 5AW1B 1N7SD 1MQTB 1UQXA 1JODA 4Y28J 4O65A 4ZKPA 3GM8A 4XF0A 1VIWB 1AYN2 1WBLA 2ATFA 4QQPA 5C5UA 5KHJA 1IGOA 3VDDC 1UY1A 5JOWA 1ZN5A 1NH4A 3T2PA 2KS1B 4GKGA 1LB2A 2WS93 4WM8A 5L7OB 3AEAC 2X5IC 5FZEA 1BMV1 3E1RA 2OYOA 4CP1A 2Z42A 3LGRA 1RUF3 4ZONA 1V00A 1AV1A 5GZGA 2EIEA 2YUEA 2R7EB 4Q4V1 1BJQA 3KHBA 4P5HA 2CWSA 4BQ1A 5CEHA 1AYM3 1RUJ1 1XE7A 2XJQA 4H3WA 1M90Q 2W1QA 1JM0A 1GP4A 2I45A 1POQA 4U7JA 4N9HA 1FX5A 5F32A 2QJKB 3IPVB 3WT3A 3AMMA 3I2IA 3CXHD 3TAYA 4QB1A 3HE4A 3VDDB 1LTSC 3LF7A 1SQQG 3EJKA 1WCUA 1YI9A 2VMEA 2W94A 1DFQA 4UFLA 4XF9A 2OYZA 1YTZT 2HODA 2WSFH 1PGSA 3AP6A 1LHUA 5GJ6A 4LKDA 5B5EH 2P3IA 3P3PA 1FYUA 4FPYA 3H1JG 2J22A 2JIGA 2VOXA 2V4AA 4GKYA 4QXCA 4UAPA 1LOAA 1URQD 1LTTC 1G9FA 1LHOA 1U5IA 1SQXD 3UL2A 1W9TA 1W6QA 3LW5H 2RDNA 2BWAA 4LBOA 4DT0A 5KAIH 1GP6A 5FZLA 2H6CA 1U5XA 1QGKB 2LM3A 1VBB1 3LWCA 3BODA 1NAYA 4MUVA 2WZEA 4PBOA 4BQ4A 3L71E 1NAFA 3PTYA 3I5CA 1ZP0C 5A32B 2PA7A 3LA3A 3WXPA 4LE4A 1S2EA 1W8OA 1HVVA 3UKNA 1JXNA 4W8JA 4YVWC 4BXSV 2VQUA 4Q0SA 2VZVA 3KCXA 4DOUA 2H7HA 2IXKA 4LLFA 4DXSA 4W7YA 2BFUL 3PTRB 2P7JA 1YQ3C 1SPPB 2K9ZA 1F15A 2R0FA 3O5SA 5GZEA 3SITA 2VL4A 4AOCA 1QDCA 2JICA 4ZMDA 3I54A 3ZN6B 1YHQP 5FZ1A 3RBZA 2GAUA 3GF3A 4L9BA 3LEMA 1M1JB 2WABA 1S0IA 4LBMA 1VQNP 2QFEA 4UF0A 3H1JJ 1PGPA 4WZCA 2CAUA 3NNFA 2VTXJ 1WD3A 4AYUA 5A1LA 2Z5HA 4LO7A 2PHFA 5BNPA 2Z79A 1JY2P 2HYXA 1Q7YQ 2E76B 1UY2A 2WSUA 4ZPIA 1IFNA 2ZT9C 3G9RA 1FOD1 1UN1A 3LAGA 2R32A 3EHKA 4H13B 2IBZE 1EDJA 1DGRA 1U12A 2DDUA 5F2SA 1GOGA 3WW1A 4I3GA 5C3RA 4ES9A 1XE0A 4HXCA 3VMAA 2BW8A 2JDAA 5F3EA 3ZO0B 5BNQA 1L4AC 3T0DA 3LA2A 2KI7B 1JOCA 3KLSA 4H13C 1VBB2 4A41A 4EN0A 2EXIA 2Q6QA 2QVAA 4DY5A 3VDBA 3SWYA 1ZMEC 1CN1A 3H32A 3SSUA 2VU9A 4FXGB 2C0ZA 3Q9OA 5GLUA 1YWKA 5F8PA 1D7MA 3KDPB 1L3JA 3Q5SA 2RM22 5IVYA 1RUC2 5AFEA 1NCRA 3VBSC 2Y33A 1SQBG 4OGQC 1NLQA 3O7OA 4GH4A 4Q4Y3 3WR0A 4AVAA 4CCLA 2RJLA 2ZXQA 1X9PA 1RHZB 2J59M 2YY1A 4D7YA 2DTWA 3LOIA 5K4LA 2Y0IA 2FXMA 2N1TC 4ASKA 1N7LA 2PHRA 5A1AA 5T5LA 1K12A 4TLFA 4RR3B 1AXYA 4ATEA 4XACA 1UAIA 2PQQA 3KV6A 3WF4A 3BTAA 3O1SA 1IQDC 3Q8EA 1IO4A 1YJNP 1POV3 4Q4Y2 2H0BA 1CZQA 1S1AA 3LKJA 5FPXA 1W8NA 1YXWA 1AJOA 2XBO2 4RS5A 1RUD3 1J2JB 1X7NA 2BNMA 1M06G 3AKTA 3POBA 2YBKA 1RE3C 2WBKA 1OBNA 1DDLA 1TNRA 2ZGNA 1BGYD 1FPN2 2WLQA 5FZ6A 1YYCA 1PVC3 4RHV2 3JZVA 3MHZA 2XWBB 2Z5WA 1JZ7A 1RB8G 3MTUE 1FOD2 5GZFA 1IFJA 5FZFA 5HCHA 4E2QA 4CP9B 3T2QA 3BTYA 4MGZE 3L2HA 1K73Q 2VY0A 2JKXA 3LIGA 5CKMA 2Y9YA 1ULGA 1RUJ3 3VL9A 1CAVB 1S5LX 4YSFA 3BB6A 3O0WA 4QPYA 3AEDC 3O6QA 2HWE3 1Y9MA 3VKOA 4O61A 4AFAA 1W28A 4ZS2A 2B89A 3L74G 4BQYA 1E5WA 2D6MA 2B45X 4DNYA 5KKZB 2LUWA 1SLAA 5L36A 2AC1A 1PGL2 3AEBC 1QJFA 3VBOA 4KT0J 4U3FJ 3K4AA 2ZGMA 2Q30A 2RJ2A 1K5MC 4DXTA 2Y38A 2FYNB 2P10A 2YXRB 2GN7A 2XKOA 3AP9A 4MH0E 4D69A 3S57A 1GMMA 2ARXA 2CGPA 2G9GA 1KQLA 2N1TA 3F5HA 1N7SA 5CMZA 1URQA 1YC61 2RMU2 4NAOA 1MS3A 1Y8AA 5FCCA 5ACA2 1ZOYC 4Q4V2 4M3CE 2XNDH 3QWOC 4N53C 2BGOA 2WFF2 3JCUE 4Y20A 5KLIC 3N3HA 4DFSA 1R081 4YGEA 2GP5A 3PLQA 5JMOA 3I2OA 1EV11 2FCVA 2B9UA 5FKBA 4BA6A 4P9JA 4N53A 5CCHC 2QVSB 1UO9A 1RUNA 1USDA 3D3AA 4JTOA 1BHGA 4NE9A 3JB4C 4TTGA 1HDKA 1ONAA 1QJU1 2QJYC 5FPUA 1DQ5A 1Q5OA 4LPLA 2NZ2A 2Z4EA 2FKWB 2PHLA 3MPPG 1FMD1 2VQTA 2P17A 1VL2A 3MO4A 4XILA 3ZFFA 4AVSA 2C24A 3M06A 1O3TA 2VCMA 2IXCA 1MZFA 3WF3A 2ORXA 2Q1ZB 4HK9A 3AE8C 1NOVA 1WA4A 1BGYJ 1L2PA 4A2UA 2VZ3A 3L72D 3HEIA 3TSIA 4TN7A 4FFFA 1FMD3 3TB0A 1W8ZA 1YI7A 3NV4A 3A0BH 2OTLP 4QD2A 2HPCA 1GDTA 1JMBA 3VYIA 5C9AB 2ZT9B 2HWF1 1FATA 5T5PA 1DBNA 3A23A 3AP7A 3VBRC 4XJAA 2H88C 1W6OA 3G6JB 4WBBA 5IW0A 4PV1B 2R043 3PJSK 2OQ6A 1YQCA 3DYPA 3QCWA 1UCXA 4KWKA 2ORZA 4AQTA 1RVF3 2WMMA 2W1WA 5ISLA 1DYOA 4YZ1A 3GYDA 3JC22 2HWB2 5A7PA 5JPMB 3VBOB 1ENXA 3H1LG 1BLZA 2PHDA 4GT1A 4PD4D 1GK4A 1OHFA 2EVXA 1C8M3 4NPEA 3IDAA 1FZGA 4XUPA 2GM4A 2M5AA 2H6BA 4HN1A 1OLMA 4HVOA 4HPKA 3T97A 2DCZA 1AFOA 1QJU2 3ZFGB 2Q9IA 3VD3A 3A0BE 1B35C 1X9VA 3DGTA 4BMEA 3HT1A 1O7FA 2RS52 2Y6HA 2C6SA 4QX0A 1MZ9A 4JCKA 1UIJA 3OGJA 4QKBA 5FRAA 1LR5A 3OGVA 3FXDA 3T0AA 3CCRP 3HD7A 1Q90D 4F83A 3UKTA 2XUEA 3HT2A 3ZYHA 4OULA 4B3NA 1AL22 4LBQA 1J83A 2CGNA 2PLV3 3VKLA 5KHGA 1WLCA 2Q8DA 1OIPA 2HBUA 4XDPA 1F9KA 2DCTA 1XTCC 1CR7A 4LQRA 2QTWB 2TBVA 4FQ4A 4K1YA 3LE0A 2Y0DA 2IYPA 4I0BA 4LR4A 5DDJ1 4OVEA 3OGSA 1IZ3A 3U07A 1AJYA 4RQPA 5I8TA 1PZ7A 3U37A 2C4XA 5EIYB 3OPTA 4O9BA 2DVAA 1CIYA 4S2HA 1W04A 3O1PA 2MNGA 1GOHA 4FFGA 5AC93 4DEVA 3NAPA 2F17A 4AAPA 3QOPA 3NV3A 2I1JA 4QX2A 1GNYA 2A45H 2W83C 3S9OA 1IPKA 4BRYA 2LKMA 1GNHA 1UX6A 2VNGA 3AVRA 3WDTA 1M7LA 2E74D 1K04A 2K9JA 1E5HA 1NYHA 4LC1A 3CCEP 4GKXA 4XIKA 5EP9A 4PI0A 1ZYBA 5L9VA 4R8HA 3A7OA 1H8AA 3TBDA 3SFDC 5DMYA 5D1IA 4N9IA 1GTWA 2ERFA 3C7EA 2VRSA 4FOVA 3WZ1A 5CFCA 4BXLA 1ZRTD 2ZAAA 2ZGKA 3M9BA 3K2OA 3PUHA 4LK7A 4BWOA 3WNMA 3TK1A 3OB8A 2QNKA 4Q4Y1 2HODB 4DUVA 4HK8A 1EY2A 5FXWA 3L70D 1RUD1 1U0AA 4QKDA 1VLNA 3MW4A 4HFSA 5FZ8A 3AJZA 3POFA 4YM1A 5FY9A 5C3SA 5J48A 3MUZ1 3S0MA 4S2DA 3PLNA 5BNPB 5B2GB 1W3VA 5B66E 1W2NA 2AZ5A 3AZZA 4NROA 3OTFA 4GB31 4PI2A 3OYWA 3SKVA 3VLBB 3ZYIB 1HTLC 1RE4C 3NNLA 1RUC1 1JZ8A 4IE0A 2RM21 5ERLA 1FOD3 1TVGA 1RF1C 4Z07A 4B1MA 3GJAA 4H7LA 3AE2C 2UY9A 4EV0A 3FLRA 1EPWA 5C8CB 2PELA 2AEJA 3HTKB 3L70G 1GU5A 1J3PA 3K4ZA 2FZ2A 1UOFA 4TT3H 2WKKA 2RKLA 5K0UA 1U5ZA 5CB7A 3THCA 5EJ3A 1G1IA 3FX3A 3NMBA 3ELNA 5FY7A 5F7UA 1AL0G 3ZSKA 2ZT9D 3R4UA 3TEXA 2O01H 2ZVOB 5FWJA 3FMGA 4XFJA 5APUA 1OW7A 1MS4A 4Y5TA 1PIV3 2XHNA 4NMIA 5BVZA 3R6SA 1PV3A 1OC1A 1QNWA 1QOSA 4ISRA 2EA7A 3RWNA 3SCGA 1AYN3 3PP5A 1FT9A 1WA6X 1GLHA 4AGVA 1PO12 4XJZA 5FPBA 3GHGA 1MZ6A 2ZKNA 1AA0A 2E76D 5FZGA 3RZLA 4YW3A 2YIUB 4GD4A 3WG2A 1W8WA 3VHPA 2EIBA 2B87B 3RL0g 5F39A 3J9SA 4WV8A 2E75B 2BVVA 2DVDA 1SLBA 1UYYA 2XXZA 5H9QA 1YIPA 1C5IA 3V56A 4YARA 2HYNA 2WC2A 4GALA 2G1MA 3ZM8A 5HCAA 2RS13 1EP0A 4JKLA 1AYM2 2JIJA 1QOOA 3AE4C 1ZBE3 2YC0A 2QJVA 4S2GA 3UT0A 1ZZ9A 3MYXA 2HEWF 3RK2C 5KLVJ 2XOMA 1G9BA 1AJKA 1WW7A 2PHUA 4FPCA 2Y0EA 3HRNA 1GWKA 3CJIA 3RZMA 2IUWA 5I0SA 4ZZ5A 1VMHA 3PJQA 4UOJA 2WZ7A 5FP7A 1VBC2 3OY8B 4JF7A 1DLLA 2J42A 4RR3A 5FIXA 3S30A 5JSRA 2FDIA 3KF3A 5A6XA 3BTXA 1QGLA 2X5IB 3T2OA 4L92A 2M3BA 4LJHA 2QQVA 1N8RQ 4QPGC 2WWUA 4R9BA 1H6XA 1H4GA 4AHYA 4XCAA 3RG0A 2FYNC 1HW5A 4AUWA 4XJ9A 3MLLA 2PYTA 2RS51 3F95A 1GZWB 2Q1MA 2N9BA 1DCSA 2CU5A 3KF5A 4XPVA 1AYM1 2FYUG 4CVUA 4P9YA 4CPGA 2UWBA 2E7TA 4BQ2A 3J8F1 1MKMA 2VR4A 3CWBJ 1WD4A 2VJXA 4YVWA 4EYUA 1MS9A 5AVZB 1HGZA 1T3UA 1DZRA 4CYDA 2VBBA 5K9YA 1NJIQ 5D8AC 1IKQA 2X05A 3ZXAC 1JS9A 2VCBA 2ZGOA 3K77A 3R4DB 1RVF2 1KFNA 1SLCA 3A22A 1W05A 4LEJA 3ITKA 2ZHNA 4YWAA 2Q1FA 4BIFA 1CPMA 1QMJA 2ET1A 2ZGLA 4M4RA 2P3KA 5E8AA 4DRVA 1FNYA 1GFF2 1X36A 1KV4A 5FXXA 2QM8A 4YPCA 2HBTA 2E5TA 1M1JA 2YMYA 3ZDMA 3SWFA 1HRI2 1P8JA 2EF6A 4L76A 3G71P 2FMYA 2VCAA 3IIAA 5D2AA 3M9QA 4INDA 3VKFC 4EN8B 5C8WA 5I0DA 4OVNF 2ENRA 4MN4C 1DD4A 3M9HA 4ZKUA 1PGW1 5LATA 1ZRFA 5DUXA 1KRIA 2QQPA 5K0UB 3PHMA 4JDNA 5DG2A 5T50A 1IS5A 2HWC2 1NE6A 2YMZA 2E5YA 5ANQA 3PJYA 1HQNA 2QCSB 5FREA 1J59A 1JBCA 5G05L 1GZLA 4XQDA 2CPBA 3HE5B 1QJX1 1VB4A 3ACHA 1X8MA 5KAIE 1XTGB 4WVVA 1AVYA 4AQSA 3CMEP 2R0HA 5FZDA 3TN93 1FE6A 2C9KA 3ME2A 1HN0A 5FWEA 1AQTA 1RF0C 1SHWB 2FY8A 2CAVA 2C0XA 1PMHX 1UIXA 1QH7A 1WLDA 1ZNPA 2VMCA 4K1ZA 4LBKA 5F3GA 3W20A 2JD4A 3L70J 3WHTA 5CFDB 2RM23 1RL3A 2WFF1 4Q0QA 3V0AB 1ND2A 1H9PA 2OT7A 4JGYB 4MZUA 4OCTA 3OBRA 1RUH1 5A3NA 2ZS6B 1BBT3 4EOTA 1FZCC 1QQP3 2CY6A 3P8CD 3D82A 3NJZA 4YW2A 3L35A 4UB8E 1WT6A 3ILFA 3KZIH 5GTHH 3WX5A 5CCHD 5GTHE 1YITP 1DZQA 2CYFA 5HV0A 1ND3C 3BYWA 3D6EA 1RGSA 2WQZC 4IEWA 4DINB 4CEWA 4HYTB 3I8TA 2IVJA 3TYJA 1SEFA 1Z78A 1HJGA 3MI8A 1OA3A 3VDCA 2N1TD 2WT2A 3LFMA 2VCCA 3CPWO 3B5NC 2GMPA 2XBO3 3N36A 3QLQA 1Q8OA 3KQRA 4ASVA 4NVPA 1FDOA 3L37A 3UGGA 1UOBA 1XB9A 3H1IE 2YIUC 4HKLA 1LEMA 2ZGUA 1W99A 1DH3A 1ZRDA 3KQGA 1H8VA 3E6BA 3B5ND 3T1LA 2JJ6A 4N6JA 3VBHC 4F7ZA 1Y9BA 2P67A 1PX4A 1X9TA 1W9YA 4RQPB 1ST8A 3AEFC 3O8ZA 1NT0A 4P9XA 3ZYBA 2ZXEB 2QBXA 3I3BA 5F9TA 1QL2A 1BGYG 1ZM1A 1QX8A 2QQUA 3GDBA 4GH4C 5CFDC 3NAPC 1PP9J 1RITA 1LULA 2X09A 2WNUB 4CU8A 1F4HA 4W65A 3LPFA 3PUAA 1AX0A 1OD3A 3NWKA 4IE7A 5KJ7C 1RJ7A 4IXLA 3AKQA 4JAAA 2XBO1 4WVMA 2RMZA 4GIFA 1UXXX 2NN8A 1RUH2 2IFWA 3HD7B 3MFAA 3H1IG 2ZMKA 3HJRA 3SEEA 1VB2A 5FXZA 3R05A 5D8AB 5FBZA 3RNSA 5FO8B 5HI0A 2A06D 2WPVB 1LTEA 3DYMA 3HN3A 1SDDB 1RHI2 4JQRA 4FI9A 1M57D 4GJZA 1HH0A 1AR81 1COV3 2E32A 2FBEA 2W87A 1OUXA 3Q8CA 3O1OA 3VBUC 3O12A 3BU7A 4I02A 1BGYE 1BCCE 3MGNA 5DAXA 5F5IA 1BDDA 2HWB1 3WQBA 3TNUA 2ID4A 5IK5A 1JU3A 4C8DA 3H32B 1RMU3 2WFPA 3HD7D 1PGW2 2P37A 4IERA 4K3UA 2IXIA 5JXJA 4XQ4A 1FJPA 1NTMJ 1NTZJ 3Q8BA 1RQUA 5FMOL 1VQ5P 2VPVA 2UYBA 2ZEZA 1COV2 2L91A 4UFHA 4W4ZA 3UGHA 4N78D 4ISQA 4AAXA 2BPA2 4IV3A 2OYHA 4XUTA 1WMXA 4NRMA 4CDQC 3L73D 3EO6A 5IWFA 5AVVB 2B87A 3CC2P 4N7UA 5FZOA 5A6YA 4DOJA 1YYNA 1K8AQ 4DY3A 2OQQA 1HLCA 2A3WA 2YGMA 2W6JH 1HB4A 5APWA 3HNBM 1WCKA 1Q8VA 2OYIA 1EXJA 4XFHA 4COVA 4COYA 1X0TA 2YHJA 2WNVA 1MPXA 1VRH1 3DEMA 3AMPA 1AR62 1VBE3 1VBE1 3ZXKA 3VBRA 4YLZA 2GALA 3P32A 4PJ0H 4OGQB 3CL3D 1VRH3 1H4HA 1NU1G 4XA4A 1HV1A 3L70E 2C1FA 2CTVA 4OI2A 4Y1UA 3A5TA 5LY1A 2XNXA 3A0NA 3SFEC 2QQOA 3KWVA 5J09A 2WR9A 1KJRA 1Q43A 3C7GA 2YU1A 3KT4A 3THTA 3U0ZA 3V0BA 4KG0A 3USSA 1TNFA 4U2AA 3U11A 4NJ4A 1PGQA 1I1EA 1SQVD 1VF5C 1SFCD 1S5LH 3VP8A 2C9LY 2VOKA 3AYDA 4PDWB 1VBC1 4RD7A 4XVHA 4DRRA 1N1SA 1S9KD 2UWAA 4XTPA 1ZRCA 4XBLA 3FWEA 4A44A 1O4YA 2D6LX 3DKQA 1KILB 1ASJ3 1JH5A 5J37A 2R5BA 1OFNA 3WU2E 5H9RA 1W6QB 2B88A 2ZEXA 4JRLA 4LOSA 2YXQB 4XFCA 3ZFFB 1R083 4ET7A 2RS53 3NMDA 1N7SC 3VBHB 3L75G 1YFWA 3NQHA 4ZY9A 4F8AA 1NXD1 1TZOA 4UB6E 4QM9A 2DFCA 1SFCB 4N78E 4LIVA 5AW7B 3WDXA 4EQVA 1UIKA 2J5UA 1EDLA 3PVNA 2Q8OA 4FPFA 5BUVA 1AR83 1Y47A 5A33A 4PD4I 3VDDA 5A32A 3AEGC 3K4DA 5FBJA 1O3QA 4ZHNA 4CUGA 5FLIA 3GZUC 4MGSA 2XV5A 2KOGA 3ZFEB 2HWC3 2OW4A 2HWC1 3WNLA 1LODA 3VBFC 4HN0A 1PP9E 4Z2WA 4EWDA 3G7DA 1B35A 4FFIA 4MGQA 5JVVA 2QE7H 4NRQA 5LK5A 1QIQA 4AEDC 1RUF2 2OQ7A 4UW5A 4XXPA 2IWGB 2J1EA 1UNBA 4PIYA 3WNXA 2ZYGA 4IQPA 1NAEA 2ZJCA 3IAPA 1W6MA 2BZDA 2YFUA 2XKPA 4A42A 1D2QA 3OBZA 2KLUA 2VOTA 4XURA 4NIAA 1J84A 1JN2P 2JDHA 3Q8AA 4Y1XA 4XYXA 1OWAA 2D7FA 5E89A 3BCCE 4IL6E 2V4VA 3SCHA 4CCDA 4D8MA 1HXS3 1LHNA 2BUKA 2WT1A 2E53A 5CFCC 1SQVJ 4UFMA 5G04L 5AW4B 1NTMK 1NTZK 4Z2AA 1BCCJ 2E26A 4LBQB 1ZRRA 5FTTC 4JTNA 4GB33 4HOOA 3WOGA 2LXCB 5BNNC 3I4IA 4HKZH 3NKGA 3GF7A 3I2DA 3NVCA 5IFTA 1KS5A 4HL0A 5AW3B 1ENQA 2YG0A 3HQUA 4PQ9A 1RHI1 1SFCC 1POV1 2GA1A 2KSJA 1FZCA 2R1BA 5EFWB 4AFDA 5IHRA 3BUCA 1HXS2 3SHRA 2Q5TA 1G9DA 4KHXA 1PL5A 1LGCA 5APVA 2WA4A 1BK0A 1W0NA 3WMM0 5T3NA 2X10A 4YM2A 3G3ZA 5KLVK 1RUE2 4ASMB 1FDIA 2RV9A 4EYYQ 3CZJA 4XOGA 1CVNA 1SPPA 3K46A 4IESA 3VZLA 1MQTA 2ETEA 4AF9A 4DEQA 2I74A 3OBAA 3OD4A 5JIUA 4H0LC 1R1A1 5FZAA 1JYXA 5EPAA 1J1DB 3DV8A 4MGIE 1W0OA 3H7YA 1USEA 1KTMA 4OHYA 5M0TA 3HAGA 5F5CA 2FDHA 1VQPP 4QGLA 1LNQA 5JI9A 5AVYB 1PP9D 1SQQJ 1CAWA 1S0EA 2ZYAA 5IVJA 2E75D 4A7KA 4L11A 1FS0E 2R063 3CX5H 1RY3A 1FI2A 3A3YB 4RN5A 4DCKA 2Y9ZA 1AVBA 2QQMA 4LBLA 2CPSA 2GNDA 1GL2C 3L71G 2Q7CA 1OFSA 2RR11 1AX1A 3AYEA 3MLJA 5E16A 3H9AA 5FZHA 2KZJA 1PIV2 3IBMA 4HVQA 3W5NA 1EAH1 2D43A 4C0BA 3CC4P 4W50A 4BK4A 2WVRA 2VVDA 4RSUA 3PUIA 3VBHA 1GZCA 4Y33A 4BM8A 2KYVA 3BOPA 2UWCA 3DPRB 4XUNA 2VZOA 4CUAA 4CZSA 1QVFO 5A3UA 3JBG3 5DDJ2 3AE6C 1T6GC 3TWIA 3TNQA 1LEDA 1W9WA 2IXLA 4JKKA 2FYUD 3AFKA 3D0SA 4XFBA 1BDCA 1RINA 3WP4A 4ZZ8A 5FPAA 4LMFA 1FAYA 4P9IA 1KITA 3BATA 2IZ1A 1HIXA 3FJSA 3M7AA 3WCRA 1G9AA 1COV1 4L8QA 1JTHB 3ZR6A 1JYTA 1RXFA 3MEPA 4K21A 1GYKA 4PDWA 4DMIA 2HWD3 3M4FA 4CDWB 2E43A 2VBDA 4IGOA 2JECA 4KGQA 5BNOC 3HWJA 4CCNA 3BOWA 2IX7C 2BYVE 2NQYA 3H1JE 1UOGA 5AFBA 4IUGA 2IBZG 4KBZA 4B4QA 1SQXJ 5AW0B 4M0NA 2Y0CA 2Q5UA 4KWUA 3H8UA 4QWNA 1VQMP 3J4UH 1NY71 1OPMA 2HWD2 5CBNA 5FYMA 1OH3A 3M3IA 1W90A 2H8PD 1WRGA 2HKXA 1V9U2 2QZ2A 3M1HA 4GMP0 5D21A 5LBBA 3A0KA 2WN2A 4CP2A 3IPVA 3ZYJB 1IG0A 4PLMA 4OYUA 2XPJA 1RUD2 4HLTA 3AE7C 1ZVFA 3SKJE 1QDOA 1TG7A 3KCCA 1RUG1 1XBFA 3E5QA 4NHXA 3B93A 2HWF2 4X8NA 4D6TG 3E97A 2XDJA 1AUYA 1FPN3 1R8EA 1TMF2 2A5ZA 2A70A 3CJXA 3WP3A 4BLJA 5IK4A 5KC6A 2BGPA 2OIIA 1IFPA 5FQ0B 5L19A 1JUHA 1PO23 1NA1B 1T2XA 3C7OA 3A7QA 2YYOA 2PQSA 2KS1A 4N90A 5C39A 1TEIA 4QX1A 1FMD2 4JKMA 1UKGA 1A02F 1UXZA 1M1JC 4AGGA 1VQLP 1WBFA 1Y4WA 3ZFGC 4UW6A 4FQZA 5FOBB 4CEYC 1BVVA 2O14A 1W6NA 4N8MA 1IS6A 1OLME 3RPQA 1YQ6A 4ATFA 3J8F2 3ZSEA 5JZGA 2FYUE 1A8MA 4FOYA 4LO8A 3UESA 2R072 3MD0A 3OOXA 1LU2A 3GG2A 4OZXA 1ZBA1 4YRDA 4CCJA 1R082 4HZFA 4AZZA 2CWMA 2VXJA 4IDZA 1F5FA 2YKPA 2F4LA 3RFRA 3RVHA 4BQ3A 3H1KD 3IAOA 3I56P 1BCXA 1UZ0A 2RDSA 2VOWA 1MZEA 1YJKA 1KILC 2NM1A 4JGYA 4KNCA 2KM2A 4A6OA 4BPZA 3V65A 3M0DA 3NNGA 3JD72 3B94A 4QX8A 1N2DC 1H89A 1H0BA 4A7ZA 3H1JD 2RMU3 3FBMA 3WP5A 1J1EC 1W9FA 4FCAA 3ACFA 3DN7A 5FP8A 5AVRB 2DCYA 1LP1A 4Q4V3 3ZDSA 3ZYGA 4AW7A 4V1PA 3U14A 1PGL1 5JCTA 3KQ4B 1NTKK 1RUI1 2B9VA 3DF0A 1IPJA 4YZ3A 1PM7A 1DYKA 1N73A 3CO2A 4AE2A 3VZKA 3ZXJA 3L2YA 1LTBC 1WLWA 2GN3A 2YC2A 3B9IA 3FHAA 1PFIA 2D98A 2K46A 4C1WA 2VOVA 2Y34A 2E6VA 1ULOA 5EYXA 3VHOA 3M0DC 1QJX2 1UF2C 4CCEA 5EWSA 4PCRA 3B4SA 2W46A 1GOFA 1YUDA 3H3ZA 4QU2A 3APBA 2I07B 3ES4A 3FHIB 2ZEWA 1D4M1 1PMJX 5FP3A 2DCKA 3VN0A 3LEKA 1N1VA 1V6OA 4B4RA 1HJ0A 1REFA 1XNAA 4PD4E 3D4KA 2B39A 4EIJA 3LW5J 1PM4A 2E7AA 2UY8A 4IEVA 5FUNA 3WW4A 5JZGC 1E57A 1KB9H 5AVAA 2OPWA 2DU1A 1L0LK 3C3VA 1NU1K 1GD2E 1ZZBA 2X8KA 3ENRA 4JGYC 5LEJA 2ZX2A 3WUVA 1UY3A 4YZ4A 4IGPA 5CCGC 3HMYA 3ACGA 3LSEA 1T3JA 2GMEA 1EZVI 1BSNA 5M1BA 1UKRA 2W39A 1HB3A 1ND2B 1H6YA 4L74A 4WVZA 1YI2P 1NQDA 1MQTC 2VECA 1H1AA 1RTVA 3INAA 5BYNA 4H7MA 5CCGA 1TME3 4Y3OA 4MSVA 3VV1A 4Q4W3 2Y64A 2E42A 5KJ7A 1PK6B 3WF0A 2FDFA 1AXKA 2AUYA 5A7WB 1QNYA 3FL7A 4Q0UA 3H1KJ 2EICA 1MFTA 2DFBA 2FFDA 2MEV2 5IFPA 4U3FD 1S72P 1BEV3 1VBD3 3AXDA 4IE6A 4L97A 5BNPC 3ACLA 3MGUA 3H8OA 1SFCA 2WIIB 1LECA 3HD7C 4TSVA 5B66H 1UX7A 2GNBA 3WNOA 3CCSP 4P9GA 3CX5E 5FMCA 2JE8A 4HETA 4Q4W2 3BVCA 1S2BA 3ECQA 4I0AA 2VMGA 1IJDB 5K8SA 2Z69A 2WNUC 1CAXB 3B5NA 1AXZA 4AYCA 2WSCJ 5FV3A 4XFGA 1L0NJ 1FZBA 4A3XA 1E5IA 4GODA 3GW6A 1AL23 1JY3O 1BEV2 1H1IA 2RS31 4GMP3 3NJXA 4CDUC 3T4HB 1PMIA 2AENA 2O01J 2BTVC 4WY4D 5FK8A 1VAMA 4RYDA 1LWUA 5A6QA 4A7PA 5C3OA 1RMU2 2AEZA 1R5LA 4BRYB 1C8NA 1U57A 4JRAA 3PUQA 1LOGA 4E4SA 4JDMA 3H1LD 4EN9B 3C8XA 3VGIA 3LZZA 1JMMA 1VDFA 4XDOA 4QXKA 2FYUJ 3ZPOA 3AMHA 1QEXA 1ZRTE 2MEV1 1UMIA 4QPIB 5AW8B 4KI5M 4NIDA 2YKOA 4WY4C 5TISE 1PIV1 2W6AA 2XJPA 1SMVA 1KFUL 2YPJA 3EXUA 4LLOA 4R4XA 5L7OA 4QMAA 4KMQA 4AQ6A 1SQPJ 4OGQD 3AZVA 4UFIA 1L0NG 4YG6A 3WW2A 2AXTE 2QJYB 1KD1Q 4CXXA 1JI6A 5F6LB 2EXHA 1PO13 2E74B 4XZUG 3BCCD 3L71J 1YJWP 4Q0VA 5LBCA 5LEKA 1YEWA 5B5EE 1UPIA 2A6WA 3P6BA 1SBDA 2WNVB 1CW5A 3OJAB 1GV9A 4YG0A 5J96B 2WNOA 5A3PA 3MW3A 1GZWA 5T52A 2JB4A 1C57A 4CEYA 3L75D 1FZCB 3L9JT 1A8DA 4GMP1 5FYUA 1XXNA 4JYBA 1J1EB 2XMLA 4WBAA 1STMA 4KGGA 3BTZA 3RGUA 2A7AA 1O4TA 4WM7A 3V4WA 4XAAA 4AK3A 3ABVC 4EDFA 1SFPA 3BCWA 3SCFA 3I2HA 3W67A 3HVDA 4KU8A 4RHV3 4XTMA 3H3LA 3OY8A 5A7NA 3URFA 3DCQA 4V2WA 3U1AA 2XR4A 1WW4A 4X6QB 2JKVA 4XUOA 1XPWA 5C3QA 5A1FA 2VUAA 5AW6B 4I2LC 1URQC 4NO4A 3S1KA 4Y99B 3B00A 1IPSA 1G8WA 1QF3A 1KORA 4RGGA 1F2NA 4KWLA 4RS5B 2HWE2 5FZCA 3VP9A 1NX9A 1UYZA 3R2PA 1RJ8A 3N9MA 2XL9A 5FPVA 3CCQP 1ASJ2 2R1DA 1W6OB 1UY4A 4LA2A 3VDAA 4BQ5A 2XQRA 4N43C 4D7TA 4IFDK 2P5BA 3OUJA 2G19A 5LW9A 4YPJA 2HH9A 2A3XA 2KNCB 3H1WA 4OUEA 4A6SA 3POEA 2KUBA 4IL7A 2RG4A 3H50A 5ANNA 4IV1A 2P4EA 5HXVA 1N3PA 5D8AA 2KR2A 3GHGB 3A21A 4Y22B 4DPNA 3IDEA 3CI9A 2M3EA 2AGSA 2VVEA 2XKMA 3S4RA 5ABJB 1BMV2 2OXBA 2PAEA 4LHNA 5A7SA 3D6YA 1QJZA 4HH2A 3WF1A 2WS91 3RSJA 1O8SA 2ITAA 5FQ0A 5JZGB 3POIA 3GHNA 1XOYA 2N7GA 1CI6A 1ACCA 2ZXXA 3AK0A 1SLQA 3WLUA 2BBVA 1XYPA 3ABZA 3A4UA 3RL0B 4IE4A 5JXIA 3LDKA 1NG0A 2A73B 5CZKA 2BWCA 5C7GA 4OI0A 4W80A 4NHYA 2B7YA 2JDZA 1KJLA 3KVAA 3L75E 4I01A 1AQ5A 4XABA 3UJOA 2WYFA 2XJSA 3K5BA 1S9KE 3J7LA 5IJRA 1Y43B 3AMNA 4UT5A 4ZU5A 4XETA 1NGMB 4OFGA 3UGFA 1HBWA 2GC0A 2P1JA 1CX4A 5FR3A 4HB1A 2P34A 4FPOB 3NW4A 1AF9A 1VQKP 1NUKA 4NIGA 2NMNA 4AI9A 1RXGA 2WS92 5I93A 1ZR2A 4QPGB 1W2EA 3OA7A 4BE3A 2KA3A 4CEWB 1PVC1 1SLIA 3IM0A 4RO0A 1D0HA 3L73G 2YC4A 2ZOEB 1NTZD 1NTMD 2PFXA 2CDPA 1OVRA 1UL9A 3C8VA 1I5ZA 3OJBA 2Q8CA 1W9SA 1H2KA 3KV4A 4C91A 2NPSD 3S5AA 2VZ1A 3TGUG 1EC5A 2BV4A 3QBQA 4Q2FA 1KYOH 4JC1A 3H1IJ 3SWKA 4IEUA 1L4AA 1C28A 5FFOC 1CAUA 1LGBA 2VW1A 3PMEA 4OMDA 4AVCA 5JI7A 3W68A 2ARBA 5FYVA 3S5QA 3ZFEC 3OBTA 2LRPA 2NPSC 5KKZC 1C1FA 1C5HA 2H0VA 1JZ2A 1NZCA 5F5AA 1W2OA 1CESA 2AEYA 3N9LA 3IZOA 2ZYDA 2W0XA 4Q8LA 1T6AA 1AR72 5HBAA 1H8TC 1NU1D 3OUIA 2KSEA 1YJ9P 3SQOA 4Q4X1 4CPBD 4U3FG 3AKSA 1PZQA 5FYTA 1JY2O 4EWAA 4YFZA 3BI3A 4OHWA 1U7JA 3WNPA 3CLPA 1SQBK 3N7MA 1LTJB 3KT1A 3F89A 3Q3DA 4FP2A 3M91A 2ES3A 2OZJA 4K8RB 5APAA 2DURA 2RDQA 1W6NB 3AM2A 1EZVG 1WCQA 4PF5A 2Q3IA 2QRXA 1I6XA 2BNOA 3EBRA 1JYWA 5GTIH 1S1CX 2V09A 5A3WA 2L5GB 1RUG3 3JBG1 2MEV3 3DPRC 5EHDA 2GUSA 5AW9B 2WINB 3CCLP 1VE0A 4LITA 1UYPA 2PLV2 4IE5A 4A45A 3H0OA 3RBXA 2BERA 1B35B 4H55A 4JGZC 1JUIA 1EAH2 1O6UA 2HWB3 2R6QA 2K9YA 2OGUA 2QQIA 3GNEA 4FPEA 1YFYA 3ZMNA 3MZHA 1XJAA 3P8CE 1HRV3 2Y6JA 5H2FE 1UYXA 2CHHA 4OH8B 2R061 1H8TB 2X53S 3M0AA 4BU2A 4WM8B 3JCIA 2FYUK 1V0AA 4Q5OA 3O1MA 4MADA 2ZZQA 4EZHA 1V6IA 1GBGA 1KC8Q 1LTAC 5DABA 2WPSA 5JMCA 1MS1A 3R4SA 2HG5D 4M3CF 4QKFA 1K3IA 1R5SA 1BEV1 2FDJA 2RS32 1R1A3 2Z4FA 4FTBA 1OKOA 3Q5RA 1FV3A 1XRUA 4AEMA 2BEQD 4WWIA 2O8OA 1VF5D 3H1ID 2TUNA 2VVFA 3J7HA 1O59A 3T1MA 2PAMA 4A7YA 3BU0A 4N7IA 1QQP2 1MR5A 4AFCA 1DHKB 3SLIA 5DJUB 3VMXA 5GALA 1VQ6P 3CX5I 1TME1 4P9LA 2KIKA 1IZNB 4UFKA 5KBFA 3CD6P 5HPOA 3LD8A 4XUQA 1L7RA 3WSOA 1OF4A 3FZ3A 5CU1A 1DQ2A 3U75A 2W9XA 3L75J 1OURA 5LWBA 2R3SA 2LR2A 5FZ0A 2ZACA 4Y26A 4WM7C 1M1KQ 2AR6A 4HKWA 2GNMA 2D3SA 2ZKLA 4LBJA 4H13D 5HXMA 4K8FA 2VMHA 5BPXA 4E2GA 1R1ZA 2L9LA 3N4XA 4IL6H 1X33A 1OOPC 2WNEA 1UOJA 3ACIA 3P1IA 3LDRA 3PVOA 5CFCB 2N9YB 1O91A 3BRVB 2GC3A 4UW4A 2JDIH 4HG6B 3NTNA 4AXOA 4O7XA 3V5BA 2PHXA 4FP3A 4ASWA 2IVIB 4CDWA 4JGZB 3C7FA 1VQ4P 4YVSA 2D3PA 1YRZA 1AZDA 4N53B 4NRPA 5DG1A 3VUOA 1XU1A 1PK6A 3RZZA 1BBT1 5FZ4A 1BCCD 4IEXA 4LHLA 5LA2A 4HSLA 2OPKA 3NAPB 3ZKYA 1RUE1 3T2TA 2IDBA 1K5MB 1ZZ6A 4XJ8A 2SPZA 5LB6A 4IV3B 5T55A 3V4QA 4COUA 1K42A 1KZUB 3CX5D 4D6TD 4C7NA 1DLCA 4HT1T 4LA3A 1LAJA 5JXGA 5IVBA 4N3YB 4OI4A 2QKDA 1D4M3 2EAKA 1L0LG 4JQ0D 4CDQA 4RR3C 1RHI3 5DJTB 4B4PA 4CDUA 4G4FA 5FOJB 2WDBA 4AFBA 2FDGA 1LWUC 1PK6C 2ZMLA 4LNVA 3H1HG 1RIRA 4FPKA 1Q3EA 3CBNA 4I09A 1KILA 4P00B 1ZV8A 5B4XA 1SQQD 2YO3A 4BCUA 5B4NA 1O5UA 5C4WB 1LCLA 4BIOA 3E6DA 4XXAA 2CSGA 2AEFA 4UI9L 3PRJA 2GMMA 4PIXA 4CCKA 4DS0A 3UIAA 2BU9A 1NA1C 1QY4A 4Z82A 2KB7P 3K3OA 1NTKG 4IV3C 1CAVA 4I6MC 1GU3A 2PAJA 3VMZA 4M01A 4UBHA 2QSIA 2ZGSA 3RI9A 4AG4A 1PNGA 1WMFA 2BJSA 2WZR2 3KM5A 4Q1RA 5FO7B 4ZKTB 1H30A 3JD71 4JZRA 5E6HA 4AVVA 1HJFA 5I8YA 5ACA3 2NP0A 4BQWA 4QT6A 5CHXA 1REDA 1NHLA 1VBC3 1S0DA 1CONA 1WW5A 3QD6A 1QL1A 2RN0A 3N9PA 2NPIA 4HMZA 1DP0A 4P14A 1CZTA 1LRHA 2J1UA 1TE1B 3OF1A 2B8MA 4OWFA 2VBPA 3UETA 4R9DA 2W8ZA 3POYA 4B7EA 1KQFB 3RDIA 2C0WA 2O3JA 2IXHA 2IYOA 4MXWA 1MEC1 3H8RA 3B71A 2J1VA 3USUA 4BMBA 3CLQA 2VZUA 3HR9A 4NWWA 5DUWA 1H1MA 5GLWA 4OQ9A 4Z92B 2QDNA 3T3YA 5F3CA 4J1XA 3GALA 3RS6A 4R9AA 1Z7S1 4QHOA 3KZ4C 1VBE2 4WM8C 3C7HA 4I1LA 1H9WA 4R4ZA 5C9AA 3AE1C 2DBNA 1LT9B 4YYOA 5APYA 3D5OA 1VRH2 3B8EB 1NOHA 1NTKD 1HQLA 1Q56A 2Y8KA 1ULPA 3MIEA 5DZEA 1X82A 4R9CA 4D6SA 2K37A 4XJUA 3BRTB 4BXFA 5JDBA 1QKQA 3MHVA 4L0PA 1TMF1 2QQWA 4XIOA 5DAVA 2AYHA 2YU2A 4I30A 4HSJA 5A3OA 1ZZ7A 2YKQA 1H2MA 3KCYA 4QQHA 3VN4A 1GW4A 3ETQA 1CPNA 2W90A 3H42B 3MF6A 1FV2A 3AZXA 4FOQA 4QX3A 5CBLA 1LTGC 3PHLA 5BNNA 1DGWA 2DUPA 1V9U1 3E5XA 3O1TA 1RH5B 1J58A 1SBEA 2J1RA 2WL1A 1SQXG 2OARA 5GTIE 3H7JA 3V2RA 3V0AA 3V2PA 1CZSA 1KFMA 1ZBE1 2A6YA 2YMKA 1T6BX 2FHRA 4ITCA 2PHTA 4XZPA 4ZXKA 3TEZA 1EPZA 3CMGA 5FY8A 3RGBA 1BCCG 3RRDA 2TEPA 4COZA 2WITA 1C8M2 2JE9A 2VW0A 3D71A 4LUMA 3RYKA 2JG8A 4F3JA 1QH6A 3IFMA 2BGCA 5FK7A 4AHWA 1CAUB 4AI8A 1URQB 4YM3A 2WNUA 2ZGPA 3II6A 2NZ9A 3RQ0A 5GLZA 5IK8A 2BNNA 4PV1C 2ADDA 1OXZA 5I91A 2FFDC 1OD5A 2WN3A 1ND2C 3CKHA 1GL2A 4Q0PA 1C1LA 3NJVA 4DO0A 1YQ4C 2XB6C 2K0GA 1LOBA 2RR13
chains in the Genus database with same CATH topology
1NLSA 1GICA 5C8CA 2RHPA 1IS3A 3RJ2X 3KB5A 1G9CA 3C2UA 3NKTA 3SH5A 1YNAA 2G9FA 3KSCA 3RMXA 4FT8A 1CQ9A 1REEA 3ZN5A 5J36A 1NCRC 4YW1A 3VHNA 3AB0A 2IZWA 2C9AA 2RR12 4G3YC 2MPFA 2P3JA 3KGLA 3POWA 5KXCA 3MIBA 4AVBA 4QM8A 1D4VB 2DUQA 1AX2A 1V6NA 3GHMA 3AZWA 1VBA3 4M3CB 1ZX5A 1MS0A 4AHZA 1ND3B 1I9RA 1NLRA 3MIGA 4LULA 3HBZA 5EZWA 2ZX1A 3IN9A 5EYYA 3MW2A 5FLHA 3TNPB 1C3HA 4GA9A 1RUE3 2B46X 3QACA 3BPZA 5DZGA 1CAWB 2D40A 1QXPA 1PVC2 2CV6A 4KWJA 1AR93 2I2SA 2SLIA 1RUOA 2PFWA 2R30A 4Z1VA 5IUQA 2XHKA 2NMOA 1Z7S2 3ZXEA 1BSHA 3AX4A 1QOTA 3WD5A 5FPZA 5J98B 3H1MA 1POV0 1MEC2 2RJKA 4SBVA 5KXEA 2V7QH 2WSSH 2WT0A 3AZYA 1JOJA 4R52A 3FLTA 3LSDA 4JVAA 2ZHMA 1WMDA 2XVGA 4N43A 2VH9A 4MLOA 2PLV1 4YVSC 4L2NA 2DV9A 1S0GA 4HPKB 3FUOA 3WP6A 4AI2A 3ZFGA 5BV6A 2BVBA 2Q0AA 1RUH3 3AKRA 2WFF3 1SCSA 4HKOA 4MV2A 5GLTA 1R091 2ZBJA 4GXLA 1LGNA 4I3PA 1ZZCA 2EALA 3FFZA 1MZ5A 3CNAA 2OVUA 2VUJA 1QXRA 3BIWE 1C8M1 4XW3A 5BXXA 2XLFA 2ZGTA 4KL1A 3ST7A 4XFAA 1ZBE2 2XGXA 5H9PA 5A3MA 2XVKA 1DQ0A 1GNZA 1OLRA 1ULCA 2C5DA 2Y26A 3ALQA 4AE2A 2DU0A 5SV5A 2CK3H 3FC0A 3JB8A 4C1XA 4DZGA 2XJRA 2OA2A 5KC5A 1XNKA 1FNZA 1UU4A 4B29A 4FAGA 3D8CA 1S55A 2VXRA 3UJQA 3B5LB 3ZXDA 1OMIA 1N3OA 2QE3A 3E5UA 1SFNA 3NL1A 4NOTA 1RVF1 3RYPA 1S2KA 4E4ZA 2R041 2CGOA 4XE9A 3ZSLA 3J8F3 2AREA 4WVWA 1YJLA 3ZFFC 5CNAA 1DU3D 1PO11 1TME2 3WW3A 1RMU1 4FSJA 1OPOA 2ZGRA 3TOJA 1QWRA 3LB9A 4Y1VA 4K7JA 3JU9A 2PAKA 4QX5A 4AI0A 2YDEA 1ENSA 5C9AC 3WG1A 4AGRA 3M3OA 1J1TA 3WG3A 4GULA 4QGNA 5DXDA 1H2NA 1YLLA 3KT7A 2ZHLA 3AJYA 4C91A 4FPGA 4N43B 3CEWA 1GQGA 1OOPB 1R093 3ZYPA 2RS33 1NYWA 2D6NA 1RUC3 4KH9A 1X8EA 4XMAA 3ZN4A 2DCJA 1PZ8A 1PNFA 2V73A 4GB32 4FPLA 4JV4A 3TN92 4AW7A 4FPHA