4TLFA

Crystal structure of thiol dioxygenase from pseudomonas aeruginosa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
194
Chain Sequence
b'LRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol dioxygenase
publication title The Cysteine Dioxygenase Homologue from Pseudomonas aeruginosa Is a 3-Mercaptopropionate Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 49
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4tlfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tlfA02
5KBFA 2CK3H 2EA7A 4Z82A 3LA2A 2PTMA 1UPIA 2XHKA 1LB2A 3NKTA 3C3VA 4JV4A 4Q0QA 1OFNA 3OF1A 3ETQA 5KHJA 5FPXA 5F1RA 2OZJA 5CADA 2D40A 5I8SA 4IEZA 5K8SA 5KHGA 4XF1A 2P17A 4PJYA 4ZU7A 5LEJA 4XFHA 1HW5A 4FAHA 2H6BA 1LR5A 3OCPA 5E16A 4UBHA 3KMHA 4YRDA 4O9GA 2ZCWA 4JTOA 3ELNA 4AXOA 5FDBA 1ZRFA 5FQ0A 3NL1A 1YFXA 4MH0E 3U10A 4LULA 3MPBA 3NJZA 1EY2A 4B29A 2XGXA 2K9ZA 2QVSB 1CGPA 4MGKE 3E5XA 2Q30A 3L2HA 5JCTA 1VR3A 3LZZA 4MGIE 1OI6A 4E2SA 1ZRCA 4UBGA 2D5HA 4CYDA 1LKNA 1WGPA 2XLAA 4OFGA 4I3PA 4HMZA 2WSSH 1CAWA 5EZWA 3E6BA 2EAAA 3RYKA 4KU8A 4QXKA 1CAUB 4META 3G7DA 3M70A 2QCSB 1VP6A 3H50A 1FS0E 5FPZA 3LA7A 1NE4A 4PIYA 3CJXA 4I0AA 3EFFK 4N9HA 1I5ZA 1G6NA 5CU1A 3I54A 2V7QH 3EBRA 2WFPA 5I0UA 1FXZA 4XFFA 1Q3EA 4IEUA 3HQXA 3LOIA 5BUVA 2PAKA 4R52A 5LEKA 2DCTA 3OD0A 1IFPA 1YFYA 5FLHA 1DZRA 4Q0VA 3IDCB 1BSNA 1X8MA 1XE7A 2Y0OA 3RPQA 2QNKA 4YARA 4BYYA 2BNOA 4XFCA 3H3ZA 3I59B 5E1RA 3S0MA 1ZVFA 2BGCA 2VQAA 3FX3A 3KSCA 3RYPA 4EROA 2CV6A 3H1MA 1ZZ6A 2XLFA 2PHDA 1YWKA 2QE7H 4LA3A 5J7MA 3B02A 4QX5A 2GC0A 1RTVA 1PMIA 3ES1A 4HZFA 4N9IA 1O3SA 4I0BA 5JSRA 1UCXA 3H9AA 4IEQA 4AQ2A 1QY4A 4PIZA 4RD7A 4KWLA 2ET1A 4I02A 3CF6E 5KHHA 1QWRA 2UY9A 3IIAA 3UKTA 3FE5A 2PYTA 3E5QA 4AVCA 1U12A 1Y3TA 3RDIA 4XF3A 2B8MA 1VJ2A 2PA7A 2CAUA 4HVRA 2OZ6A 3RZZA 2ETEA 4MV2A 4Q0SA 1EP0A 1Q43A 2MPFA 3D0JA 4LTAA 4XETA 4FBFA 4XF4A 4IESA 3UKNA 2IXHA 1ZX5A 2B9UA 4I01A 4IETA 1CAVB 2QJVA 3IWZA 2D93A 5LRRA 1UW8A 4MX3A 2IXLA 4MUVA 4MGYE 4XFIA 1WLTA 2QDRA 4HSLA 3E97A 3HIFA 4HN1A 3I7DA 3NW4A 4YSFA 4QMAA 3FWEA 5LRSA 3E6CC 1QXJA 4QM9A 4IEVA 2OYZA 1DGRA 3RYRA 2IXJA 1CAXA 1AQTA 4IEYA 3U0ZA 1SEFA 2Z2SB 1UIJA 4QGLA 4Q0PA 2W6JH 2Q0AA 4QM8A 4ZU5A 1YLLA 1NE6A 4ONUA 3BALA 4XFBA 3OGJA 3JZVA 4LUMA 2HKXA 3BU7A 4Q29A 3DN7A 4AVBA 4E2QA 2C0ZA 3LWCA 5I0TA 1SFNA 3QOPA 2IXCA 3TNQA 1XRUA 5FQ0B 2IXIA 5BXXA 4WZCA 4A2UA 4LA2A 4QGNA 5J3UA 1RL3A 3EQEA 1DZTA 4BH9A 1FT9A 1ZZ7A 3FFQA 4AVAA 5T3NA 1IPKA 4JTNA 3WW3A 3KGLA 2V09A 3M3IA 2B5HA 3TNPB 2GU9A 4Q0UA 5KHIA 1UIKA 3I59A 2H0VA 1CAWB 4XF9A 5KHKA 2GC1A 3MZHA 2XLGA 2IXKA 3PNAA 2XNDH 3WW2A 2CAVA 3LAGA 4XF0A 5C8WA 5FLJA 4JVAA 5J48A 4YYOA 3H1WA 1X8EA 3HT2A 3KCCA 5D1IA 3D0SA 2OA2A 2XL7A 4YNIA 3SCGA 2I45A 4DINB 2D5FA 1H1IA 4LUKA 1X7NA 3UKVA 1EYBA 3EO6A 1NYWA 2ATFA 2KXLA 2VPVA 1L3JA 3D82A 1FI2A 4HBNA 1Y9QA 5FCCA 1ZRRA 2Q1ZB 2Q4SA 5C6CA 2BEOA 1O3QA 3E5UA 4F8AA 1GQGA 4HN0A 1SQ4A 1NZCA 5I8YA 1JEKA 4NVPA 3PJSK 2BNMA 5EFUA 4MZUA 4P9GA 3USSA 1PM7A 4L11A 3BPZA 5BY5A 1CX4A 3DKWA 4IEOA 5JSPA 1O7FA 4I2OA 4X6RB 4EWAA 2Z69A 1CAVA 1ZNPA 2MHFA 2UYBA 2ZKLA 4KWKA 3ST7A 3IDBB 2GZWA 1GQHA 2N7GA 4KWJA 1ZRDA 2IC1A 1RC6A 3GBFA 4WBBA 4D7TA 3ES4A 3NSTA 4J1XA 1J3PA 1YHFA 2F4PA 2XKOA 5FLIA 3CO2A 3SXWA 3KGZA 1YFUA 2GAUA 4XEZA 4IERA 2PHLA 4IEPA 1DGWA 3WW1A 2CGPA 2FMYA 4OLLA 5JAXA 3OTFA 1RUOA 5JSOA 4E2GA 3VHRA 1O3TA 5JR7B 3SHRA 3ZDSA 1E79H 3GYDA 2E5YA 2E5TA 1NXMA 3PVBB 4BHPA 3PLQA 4XFGA 3EHKA 4EWEA 3H7YA 5I93A 3H7JA 1CAUA 2BNNA 2OPKA 4EV0A 1ZZ9A 5I8TA 2WC2A 2VECA 4UXAA 4PIXA 4QGMA 3NVCA 4R8HA 4GULA 2K0GA 2XL9A 4DJGA 2ET7A 3HT1A 3U11A 4XFAA 1J58A 1OD5A 4X6QB 3RNSA 4J1WA 1CAXB 4L2NA 3FZ3A 3LA3A 1EPZA 2O8QA 5I0SA 4WVZA 1TQ5A 2GC2A 5HI0A 4LEJA 4FAGA 3BCWA 2JDIH 1XE8A 1X82A 1ZZBA 1IPJA 4I09A 1BSHA 1OMIA 1O4TA 2GC3A 3H3UA 3S7IA 2GH2A 4EWDA 5CVRA 4KL1A 3H1YA 5AVPA 1Q5OA 4MGZE 4ORFA 2MNGA 4K8FA 3MYXA 4IEWA 1YFWA 2O1QA 3BB6A 3O14A 2E9QA 1UD1A 3CL1A 3SCHA 1WA4A 1RGSA 1O5UA 1LRHA 1J1LA 1O5LA 2FQPA 2BYVE 4LLOA 1J3RA 1YUDA 3SCFA 3CEWA 4KU7A 4IEXA 4HSJA 4H7LA 5BV6A 4BIFA 2PAMA 4HLTA 1QXRA 2UY8A 2H6CA 4HVQA 1H1MA 3IBMA 3E6DA 3SMHA 1ZZ8A 3ROUA 3QACA 2PQQA 3DV8A 2UYAA 3CLPA 4Z07A 1O3RA 3ACLA 3FJSA 3DL3A 1RUNA 4D7SA 3EJKA 4HVOA 3WW4A 3N4MA 4TLFA 5I0RA 1J3QA 4AQ6A 3R6SA 3MDPA 1JUHA 3S7EA 4FT8A 4O9EA 4YXWH 4F7ZA 2PFWA 2EVXA 2PAEA 5BPXA 4ZU4A 2XKPA 1ZREA 5I91A 1I6XA 1ZZCA 3FHIB 1V70A 3H8UA 1J59A 2HJIA
chains in the Genus database with same CATH superfamily
1SQXK 2CK3H 1MS0A 1OLME 1SS1A 1UPIA 3UGFA 3NNFA 1YYCA 4EDFA 4Q0QA 3VP8A 4Y5TA 1LNSA 3RWNA 5K8SA 5IVYA 2DCYA 3T09A 1SPPA 5CBLA 4XDPA 4YRDA 1JTZX 2OIIA 1BBT3 2X10A 5F39A 4P00B 1X33A 1P8JA 2VW0A 3BTAA 1W6OA 2YIUB 3EB7A 3NL1A 1SQBG 1VBD1 1SFCB 5L73A 3KB5A 1PIV2 4AHZA 4XUOA 1NCQB 1HX6A 2EIEA 1VR3A 2V4HA 4E2SA 3EWKA 2VNVA 2GA1A 4W4ZA 1Z7S3 4CEWC 3SC7X 4OHYA 5JOXA 1IHMA 1UX7A 3G7DA 4N8MA 2QCSB 1WW5A 1UXZA 2OPWA 2ZGMA 3AYAA 3O5SA 4N43A 3K48A 3PRJA 4CVUA 3GDBA 1UYZA 2O3JA 3OOXA 1W39A 1IFPA 1VBE1 4UFIA 1FPN3 5K0UB 1QVGO 3PTRB 4YW1A 3OGVA 4EROA 5AVYB 2PHDA 4YVSA 4ZZ8A 2AEYA 4QD2A 1OBNA 3H9AA 3WV6A 3MIGA 5KHHA 4L74A 2VZRA 5HCAA 5CA6A 3JCUH 2EICA 1CPNA 1Q43A 2R49A 2Z42A 1PO12 4Q4X3 3SLIA 2FBWC 1D0GA 4DZGA 4PLMA 1W0OA 5GLVA 4OGQB 2YBSA 3W9AA 2HYNA 3LIHA 4XCBA 1X0TA 2UWBA 3ZN6A 1MEC1 1WLTA 4HSLA 4HN1A 4CUAA 3FWEA 1XNCA 1UOJA 2A71A 4CP1A 2LUWA 3RYRA 3VZJA 2RVAA 2POHA 4XAEA 2W6JH 3L71E 2XPJA 4ZU5A 2VO5A 4A44A 4BB3A 1IKQA 3CCMP 5HXVA 3H6PA 2JKVA 1DQ0A 5FMOS 2LM3A 5HCHA 3NXSA 1W8FA 1SQVE 5FQ0B 3GLMA 4G4FA 2E76B 5LWBA 1JW6A 1RUC1 3EQEA 2WT7A 1TE1B 4UFMA 3ZKYA 1YQ2A 2VBPA 1U0AA 3TNPB 1RF0C 3WMM0 1L7RA 2K9JB 4UT5A 4XDOA 3H1LE 4L97A 3GHNA 3WNXA 1LGCA 5IHRA 4OVNF 3E1RA 5DUVA 5FP7A 2MEV2 1XNKA 2LRPA 4Z92B 3RK2C 1HVVA 2BBAA 2O1JA 3OGSA 2D5FA 1JN2P 2XDVA 4YZ5A 3C7GA 4QDRA 3WP6A 1IC2A 2FXOA 1WRGA 4HN0A 2JDNA 5C3QA 2W6AA 2HWE1 3AEDC 5E79H 1OC1A 3ME2A 4JGZC 4I2OA 4Y33A 3P3NA 4YVWB 4X6RB 2Z69A 1GOFA 2AGSA 2MHFA 4CDQC 3VP9A 4IV3A 1UF2C 3GW6A 1NA1A 2BGPA 2ZX0A 3AMMA 3THTA 3WNPA 4UW3A 2JG9B 2G9ZA 2ZEYA 1HQWA 3AX4A 1W99A 4OLLA 4LJHA 5JSOA 2WO7A 3L73D 1P84E 2PAJA 4XILA 1FZBA 5A7WA 4URTA 4CUGA 5IFPA 3H7YA 1L7LA 3QH9A 1Y47A 1RUI3 3H7JA 3L71G 2AEJA 5I8TA 1SACA 1US3A 5A3MA 3WP4A 1AR83 2W91A 3A0BE 3RK3B 4RN5A 1HQLA 2O8QA 3GCXA 3MW3A 3VHPA 1VBC1 4XJWA 4QPYA 4C7RA 1OMIA 3VYIA 2YZ4A 1YQ4C 2FDIA 2RV9A 3HN3A 2VD7A 4RHV2 3H1YA 1FMD1 4RGGA 4YFZA 1PVC2 1VBA2 4BQ4A 3HRNA 3H1LG 4CCKA 1V00A 2QA4P 5TJHA 2VOVA 3RL0D 4AGGA 1F35A 1LTTC 1LENA 4IGOA 3GGLA 1GMJA 3NAPB 1H1MA 5C8CC 2ADEA 5KTBA 3CLPA 3IAQA 2B9BA 5ACA1 1J1EC 4YTPC 4TLFA 1J3QA 4UAPA 4LBKA 2HH9A 1B09A 1SQPK 1LODA 4F7ZA 2PFWA 2PAEA 4Y20A 1AR73 5I91A 1ND3B 5F5AA 4CCDA 3H8UA 3D71A 2HJIA 1LB2A 3N3HA 3C3VA 5CZKA 4IDZA 3ZYBA 2ZHMA 2D40A 5I8SA 3POEA 1ZBE1 4FO9A 2W39A 1OLRA 4B4RA 4NPFX 5LA9A 4H44D 1COV1 2HWD3 1IO4A 1PZ7A 4AXOA 3T2PA 1IZNB 5JXIA 5J96B 3AZVA 5EWSA 1PO23 2XGXA 4JKMA 1E5WA 3PU8A 2VNOA 3LE0A 1CVNA 2YFUA 3I2OA 3WVJA 4UBGA 5JLVA 4CYDA 3C9IA 5L9RA 4WM8A 3B93A 4H13B 4XJZA 2O01N 4QXKA 4XABA 1DEBA 2GMEA 4ASVA 4YW7A 2D98A 4O9BA 3I54A 4GMP0 2TNFA 5L7OA 1FXZA 2V4VA 2RJLA 4FTBA 3VN0A 3G6EP 3L2YA 4LBLA 2QEXP 4I3GA 4QDSA 2Y0OA 2FYUD 1MVQA 4QKDA 3VKLA 1L2PA 1DG6A 3JC22 3ZVXA 2YBKA 4W8JA 2P58A 3WZ1A 1NU1D 4Q4W3 2AEFA 5JSRA 5A3NA 1KS5A 3B9IA 1SCSA 2Z4EA 4QX0A 2QM8A 1QJZA 4HK9A 1ST8A 3JBG3 1U12A 1CW5A 1VJ2A 1RF1C 1UYXA 3I2FA 4LHSA 1C5IA 4GH4B 2C6SA 3M7AA 4L73A 3I2KA 2WZR3 4GKXA 1IS5A 4H7MA 1MZ9A 5D8AB 2HEYF 2X5IC 3RG0A 2Y26A 2QJYC 1UIXA 2RDQA 1KJLA 1K5MC 3WG2A 2JIGA 4ASWA 3L4FA 1WLDA 4ASLA 3HR9A 1KN7A 1GNHA 3CC2P 3M9HA 4CPBA 1LHOA 3CIHA 1AR63 1BCCG 3VBSC 3M3OA 2YB7A 3BU7A 3NNLA 1KTMA 1EDLA 1L0LK 4QPIA 3VDDA 4G9SB 3USUA 1L0NK 2WZ8A 1RL3A 1ASJ1 4D6TJ 5FZGA 3ZYPA 3V64A 4JTNA 2HODA 4LO5B 4BQWA 3GXUA 4LKFA 1JY3P 4XF9A 4LO4B 4Q4V1 2XLGA 1RUF3 4GD4A 4QU2A 1PGL1 3H1WA 2BASA 3D0SA 4OHVA 1NTKD 1LWUC 1RVF1 1JBCA 1BGYD 1RXGA 2GUVA 3CCUP 3I3BA 5DUXA 4DFSA 1M7LA 1V6OA 3EO6A 5AVUB 5E6HA 5AW3B 4XOGA 3MHZA 4MOAA 5HBAA 1YTZT 5HXMA 1ZBA3 2QQKA 4TT3H 4XFJA 2B4KA 2VU9A 1H6XA 1A6CA 5BNOA 2WINB 4NJ4A 1I5PA 4HL0A 4LK7A 1CONA 2WMMA 1J3PA 4HKWA 3FXDA 3P5BA 1AX0A 3SXWA 1OOPA 4NPRA 3CWBE 3WW1A 5DUWA 2FMYA 1PZQA 2DWRA 2GH8A 3CC7P 4MGQA 3LKJA 4AYUA 1K3IA 5AVVB 4XQWA 1REFA 1RUOA 4GOEA 5HV4A 1O91A 2PHUA 3II6A 2JP3A 3WQ7A 3GMAA 5LBEA 3RMXA 3OEBA 1GP6A 3H1JJ 1W2UA 5CIRA 1L0LG 3AP6A 2ARBA 5KLVK 4GULA 5AVQB 1W6NB 4FFFA 3LIGA 4XFAA 1KFMA 2D6KA 3IT8A 3T97A 4AG4A 1Q8VA 5HI0A 2GP3A 3BCWA 4CXWA 1V6MA 2QJPB 5A32B 1CZSA 3V0BB 3AM2A 2RS11 1X79B 2XWJB 2MNGA 2XR4A 1HUCA 3MYXA 4QQ2A 1Q8SA 1NT0A 3BB6A 4L9BA 1V9U1 5J36A 2YYOA 2GSYA 2B87A 1S9KD 4N43B 5LBBA 1O5UA 3KF5A 1NKNA 2AXTE 2YPJA 5KC5A 3P1IA 2WZPP 4LKDA 1R093 4A4AA 2HG5D 5IK4A 4IOIH 1R5SA 1EAH3 3ROUA 3LEIA 4M01A 3AEBC 2OGUA 1C1FA 1QH7A 1MVEA 1JS9A 3EJKA 2VVFA 1QX8A 1W3VA 3FUQA 1GWKA 1CSBA 1J59A 1URQB 1RYYA 5KJ7D 1HRV1 1Q56A 1QJX1 4KJMA 3OBRA 4MXWA 4PJYA 3CLQA 2JDYA 2Y38A 1POV1 1LR5A 3R4UA 2VZPA 3CWBG 1YJKA 1GOHA 1VQ9P 2R062 2ZGOA 3CZJA 2R30A 1GL2C 5E8AA 1SVFA 3BCCD 1LGNA 2Q30A 2XBO3 4HPKA 5EXOA 1LKNA 3AZYA 1RUH3 3RI8A 5T5JA 5C7GA 1BE3E 4R9CA 4XUPA 2HWC1 5CFCA 2A75A 4Q26A 5B4XA 5JZGA 4JC1A 1NTZJ 3M70A 1VRH1 5GJ6A 1N7SC 5FYYA 3R05A 3CCLP 2VBDA 3HN1A 1NY71 3PVEA 4NRMA 5CFDB 1TMF3 3EXUA 1UAIA 4WY4C 1LECA 1D0HA 1ND2B 4H0LD 3VB9A 2SLIA 3RYPA 1RUD3 1OHFA 4W6YA 2IPPA 1JHJA 2VW2A 3VD3A 4ZXEA 2JR8A 3TN91 1H0TA 1LU1A 1AZDA 3N36A 4URAA 1RMU2 4M0NA 2EXJA 1AXYA 1H9WA 1RUG1 2D97A 2ETEA 4MV2A 1NKGA 5ERLA 1RUJ2 2A5ZA 3KVBA 2IDBA 2C9KA 4E4SA 2IXHA 1MQTA 4JQRA 2RMU1 4U3FD 4L0PA 4P9JA 4XFIA 4IV3B 1JY2O 4OULA 2RG4A 4QMAA 2HYKA 3WU2E 2W47A 4QM9A 2CPBA 3ZXAC 1OW7A 4IV1C 2HBUA 3ZR5A 2VMIA 4N78E 1T3JA 1ZR4A 3P8CE 1AYM1 1VQ5P 2ZKNA 2N1TC 1FYUA 2PXJA 5AW1B 3V2RA 1U7JA 5A7WB 2VULA 3QBQA 4WZCA 2E51A 1K12A 3AMNA 1BE3G 1LOBA 1NLSA 4JHTA 2JDAA 2P3IA 1ZR2A 4Z2WA 1M4WA 2E32A 3KGLA 1RQVA 3VBFB 3C7HA 3ZLIA 3CXHH 4Q0UA 3LQCA 2CL2A 1KD1Q 1A02J 1AJKA 2EXIA 1CAWB 2BJSA 4W50A 4D69A 1NTMJ 5IAVA 3WW2A 5G04L 4XQDA 3LAGA 4YG0A 1RE3A 4L99A 3BI3A 4FFHA 1WCUA 2DBNA 1HXS3 2GUSA 5BU8B 2VOTA 1H1IA 3UESA 3UKVA 3VLBB 3VN4A 4DXRA 5C33A 1R5LA 1LJ7A 2ATFA 4FCAA 5BVZA 3ZMNA 3D82A 4CCJA 3WNLA 1WCQA 1Y43B 3JU9A 1U5YA 3E5UA 1UWWA 3NV3A 1DGWX 2J1UA 1NZCA 2WQ4A 1KILC 1LTBC 1T8ZA 4MZUA 1HIXA 3CMAP 4GA9A 2JXAA 2JE7A 2YUEA 2TBVA 5AFEA 3KQGA 3L75D 2ZKLA 1CPMA 3ILRA 4KWKA 1WD4A 1W6PA 1AVYA 4QQLA 2BDRA 3GBFA 4CP9A 4U7JA 1W2TA 5IWFA 2BVBA 3HD7D 3Q2YA 3J8F2 3DYOA 4ZMDA 1EQ7A 3L74D 3WT3A 2TEPA 3OB8A 1FZGA 2RM22 2BCCJ 4HKLA 2XUMA 4E2GA 3NWKA 3I8TA 4UW4A 5APSA 4KHXA 1UZ0A 4DRRA 3WQ1A 3VBHC 2XDJA 5AVTB 4IQPA 5JXHA 3LA3A 2KK7A 4ATEA 4YZ4A 4GODA 4SLIA 2FZ1A 2FDKA 1I3HA 3DYPA 4OQ8A 4RS5A 1SLQA 5APVA 4ZNCA 1QOOA 2Q5UA 2WWSA 3B5NA 2FD8A 1N3PA 1VQ4P 1QU0A 1FNZA 2IYPA 1PFIA 2GMPA 2LXBA 4KG8A 3VKNA 4LLOA 5FFOC 3JD72 3P7KA 4B3NA 3LGRA 1UOGA 3N9MA 3VL9A 3HE4B 2VCCA 3R0RA 5FJHA 1QQP1 3ABVC 4CCMA 2XV5A 5CCGA 1RQUA 4OWFA 2XVGA 4OVEA 4CA9A 2O01H 1FOSE 4CCLA 3O12A 5GALA 2CDPA 4KI5M 1RUE3 5AW8B 1BDDA 3WDUA 1VQNP 3BRTB 4WVVA 1YRZA 5EQUA 4BISA 3MZWB 1SQBJ 5T50A 1RHI1 2FXPA 5LATA 1VB4A 4COVA 1FZCC 4AFCA 3SWFA 2VZOA 1ZRFA 3FFZA 1MZ6A 4LBMA 2H7HA 3ZFFC 4LULA 2D6OX 3MPBA 2QVSB 2E75C 1R081 5A70A 5DN2A 4GQ7A 4YZ3A 1KJRA 1C8M2 3N9NA 1Y9BA 1ZRCA 4EQVA 4OFGA 4YPCA 1LESA 4Q27A 1AF9A 3J7MA 5FO9B 3TEZA 2WPRA 1F15A 2EXHA 2JIJA 2QQUA 3NV4A 1VP6A 5CCHD 3MUDA 3AXEA 3VDDB 3WQ0A 1WMKA 1K9MQ 3LIEA 3USUB 4XTMA 3GBWA 4QXBA 4M4PA 1FOD3 3B01A 2D2CD 4GB31 1Q3EA 5FZIA 4OMDA 1SQQD 5AC92 5LEKA 2J22A 4MLOA 4D6QA 1O6UA 1N1SA 3O0WA 1IKPA 2WIIB 1PHMA 1BEV2 1QL2A 2YKOA 5DJTB 3H25A 1PNGA 1CIWA 2XMLA 1W8NA 4LO8A 2G9GA 2FFDA 2H88C 2IWGB 4WBAA 1W2NA 3E5QA 2FY8A 4FTEA 2XJQA 4LLFA 2ZEZA 2JDHA 1SHWB 4QHBA 4Q0SA 2BOIA 4I01A 2OYIA 1UW8A 2DUPA 1U5ZA 4RHV3 2O0OA 1LOFC 1OVPA 3IDAA 3L73E 4XE5B 3C7EA 4XJAA 1PVC3 2W87A 2Q8OA 1VBA3 1DYOA 5JMCA 1QF3A 4C90A 5C4WC 4C0BA 1CAXA 5C70A 1NH4A 4AWDA 2WS92 4R9AA 5GTIE 1GV9A 4XTPA 3ZFGA 4QX2A 1OVUA 3WF4A 5FYIA 4ONUA 4B86A 2JO1A 3JZVA 4XHBA 2HKXA 2Q3EA 3N4XA 2PQSA 2IXIA 1JZ2A 5DUUA 4LKSA 2KLVA 2H43A 5KAFH 4NOTA 2OYHC 3AP9A 1KQSO 2QIWA 2GU9A 1G9AA 5IVVA 1SBFA 2DDUA 5H9QA 3AEEC 3H1HD 2IXKA 1F4HA 3PHLA 5FMDA 3WDYA 3WF3A 3TGUD 2W5FA 5L8RJ 1STMA 1JZ4A 1S0IA 3HEIA 4LUKA 3IN6A 5IVCA 1XNAA 1YJNP 4HJGH 5FZMA 1VBB2 1YIFA 5JVVA 4IW3A 4RYDA 1F5JA 1JEKA 4CEWA 3PJSK 4WVMB 4L11A 3BPZA 2QQWA 5JSPA 4H44B 1NO4A 3N35A 4PQ9A 3Q5RA 2VZTA 2RS51 3TWIA 3ZFEC 1MS1A 1EZVI 3L35A 1DCSA 5FZAA 2P10A 4NIHA 3ES4A 5FY0A 4PHZA 3MGUA 4KMQA 4BWOA 1ENRA 2BERA 4GT1A 4XEZA 4IERA 3L71J 5BNNC 3L73G 2WBKA 4MXWB 2P6HA 1HBWA 1CR7A 4IL7A 3SHRA 2E5YA 3K3NA 3WNKA 1GW3A 4NRQA 4PQQA 3N9LA 3ZKUA 5A7QA 4QGMA 1RY3A 2K0GA 2XL9A 2ET7A 1OW6A 4X6QB 5KLIB 3OAKA 2C5DA 3H1LJ 1GNZA 5F9TA 3H32A 3MFAA 4EWDA 5CFCB 2FYUE 3SEEA 4K8FA 3PUSA 1VQMP 5CJ4A 3V2PA 2VM9A 3AFKA 2P3KA 5CG9A 3A0HE 2ZGRA 1V6KA 1NU1E 1ZYBA 3FL7A 3T4VA 2YPDA 4XZPA 4FQZA 4CDUC 1ULFA 1WMFA 4I30A 1FU1A 2QQLA 3VZKA 5BV6A 1AX2A 4UB6E 3PUIA 5FZ6A 1IG3A 1JZ6A 2P67A 4YM1A 5JI7A 3DV8A 1ULDA 3DL3A 2P3JA 3DUIA 5C9AB 4HVOA 2C0WA 3U59A 5M1BA 3MDPA 3NKGA 2UURA 2E7AA 4MGSA 2ZGSA 1VF5C 3CJIB 3GZTB 4LOTA 4UOJA 1RF0A 3NKTA 3DPRB 3OF1A 4XBNA 2WO3A 3BODA 2ITAA 1ZM1A 3MLLA 5DG2A 3I55P 5FXXA 1VAMA 1MQTB 4P9IA 1TZOA 1Z0HA 5DJUB 4B29A 1CGPA 4MGKE 4P5YA 2JX9A 5B5EH 4UF0A 3B00A 1YBKA 1YQCA 2EALA 4JGZA 4FPJA 5EV7A 1OF3A 1QL1A 4CDQA 1LHUA 1OKQA 5FPZA 3K77A 4V1PA 1KFNA 1OPOA 4LITA 2MKVA 4RFRB 2YIUC 1NTKE 1W2BO 3I56P 1YJ9P 2WFPA 3NNJA 4W6WA 2FYUG 2WZ7A 1SFCC 5FY1A 1B35C 2AXCA 4HH2A 1DZRA 1BBT2 2Q8CA 3ABZA 1M8OB 1NCQC 2DVGA 3ZOIA 3KSCA 1NU1G 5F2WA 1VBE3 1C8M1 2A6XA 4KQ7A 3O0XA 3AKTA 1AL0G 4O7XA 3WF2A 1O3SA 1UCXA 5KR7A 2P1JA 3SH4A 3ACFA 1EC5A 1YYNA 4C7NB 4JX0A 3IMMA 2PA7A 2VMGA 4HVRA 2I74A 3B9CA 4HKOA 2WSEJ 3AB0A 4XETA 4XF4A 2O14A 1BYHA 2DVFA 1DH3A 5LRRA 1J1DB 1XTCC 1BCCJ 2ZT9C 2E33A 3RBXA 2NN8A 1FPN2 4NR1A 4CP9B 1JUIA 4Y22A 5KXBA 1YI9A 5FWJA 1LTAC 2VNRA 5FYCA 3A0NA 4Q0PA 3D3AA 4XFBA 4JQ0D 3CBNA 3A4UA 5C8CA 4HYTB 4L92A 4WM7C 3VBRB 2BWAA 1N7LA 1SFNA 5JUVA 5H2FH 3TNUA 2VR4A 3S4RA 2WT2A 4BH9A 5EYYA 3BYWA 5L36A 4N53B 3ZYIB 1NAFA 2VUDA 4UYBA 2ZX1A 1S9KE 3UIAA 4JRLA 1X36A 1YCIA 1NTKG 2K88A 3KCCA 1BXHA 3FMGA 1BGYG 2XL7A 4RS5B 3JCUE 4DINB 2CWSA 1X7NA 2HWB1 2E76D 5FXZA 3VD7A 2JE8A 4E4ZA 3LEKA 2R063 2NPSD 1W5CE 1TNRA 4HG6B 4XE9A 3HOBA 1OFSA 1G9DA 3NV1A 2NYYA 3HNYM 4FPLA 4OI0A 1L4AC 2DTYA 1Q82Q 3IDEA 3ZPOA 1UN1A 2RR12 1JY2P 1H2LA 2HWE3 2ZS6B 1PGPA 1EZVE 2Y9YA 3CQOA 4QQHA 1OQDA 1EV11 2OQ6A 2ADDA 2V5YA 5C71A 3I5CA 3BATA 3D4KA 3IFMA 2SPZA 1AVBA 4AVSA 5HPOA 1QLED 1L0LJ 1VBB1 1AL21 3BCCE 2NZ9A 1POQA 4AFDA 1O3TA 3ILNA 2E5TA 3AE9C 4IE4A 2FHRA 4DEVA 1RHZB 1XC6A 1D4VB 3A7OA 4DJGA 4Y1UA 1UY4A 4LE3A 5ABJB 1E57A 1JO5A 5AFBA 1RF1A 4W6XA 1RMU3 4H0LB 3FGAD 1TQ5A 5BNOC 2JG9C 4FAGA 2BBVA 1HWTC 4Q2FA 4WY4D 1ZZBA 3ZXKA 3K46A 2FYNC 5JPMB 1YI2P 1VBC3 3POBA 2KNCA 1XYOA 4ORFA 4IEWA 2B9VA 4FPHA 1K5MA 3I3DA 3O14A 3WF0A 5E79E 3FLPA 1OOPC 1O5LA 3POSA 4BM8A 5DPNA 1W6QA 2WITA 3BUCA 3VBSA 1RUI2 2JJ6A 2W94A 1FDMA 2Q8EA 1H9PA 3BIEA 4QWNA 2GN7A 2FZ2A 2PLV2 3K2OA 4Y4RA 5FZBA 2DFBA 2VMEA 3K4AA 3ZYJB 1BK0A 2WKKA 3MW4A 1FAYA 1SQPD 4U3FE 4LGDE 2B46X 2BV4A 3CWBJ 4JV4A 4TXWA 2WQZC 4CSWA 4P5HA 5K4LA 1V6IA 4PV1C 4XF1A 3AE2C 3SH3A 4XXAA 4GWIA 1CJPA 3NAPC 5LBCA 1ZBE3 3GALA 2WWJA 1KMIZ 4YG3A 1JTHA 1LWUA 4A45A 3DGTA 5FDBA 3UGHA 3BCCG 2YDEA 5K5GB 4R4ZA 4Z2AA 1S0CA 3J26N 3RS6A 1PGJA 2K9ZA 4C8DA 1ND3C 2WSCH 5FP4A 2VH9A 2XLAA 1CI6B 4OCTA 5EZWA 1AR72 1KITA 5B2GB 1J83A 1CAUB 5LA2A 1W9TA 1AJYA 1REDA 5I0UA 1Q86Q 2C9NY 1R1A1 3MGNA 1N2DC 2IZWA 4BQXA 4XMIA 3Q8FA 1X8MA 4LNVA 1PGQA 4CRQA 4V2WA 3FX3A 2HWF3 4I6MC 3M06A 3AP4A 5A3TA 3T2OA 3KDPB 2DBIA 4H13C 1JYXA 5JI9A 4A42A 4HZFA 1VPHA 5FTTC 4KWLA 2DYCA 3CCJP 4LBOA 4Y4YA 2PYTA 3BOWA 3F5HA 4TYSA 5FRAA 1G9FA 1VAKA 4AVCA 3L75E 2OYOA 4ZY9A 3G6JB 4XF3A 5F6LB 4DUXA 3ZO0B 2B89A 4WB4A 2MPFA 2YMYA 4OH8B 1W8OA 2WZEA 4U3FG 1M57D 1BBT1 4ATFA 4NIDA 1XNTA 1JMMA 4A7YA 2A06E 1PMJX 2RDRA 3WG4A 4JBZA 2IXLA 2W08A 1N47A 3NW4A 5FYTA 3IZOA 3WDWA 3M4FA 3O1TA 2N9BA 3HNBM 1DGRA 1Z7S1 2FYZA 4NPMA 5FXWA 1BE3J 4M4RA 5D21A 3JD73 3CU7A 5BNPC 1GR3A 3VL8A 2AUYA 3D5OA 3JBG2 3GHGB 5D8AC 1YQ8A 1IZ3A 5IFTA 4GIQA 2HPCB 2WZR2 4QX7A 3W58A 2VCMA 3B8EB 1L0ND 3C7OA 1RB8G 1D4M1 1PP9D 1H1AA 2BPA2 3MZHA 3AKRA 4M3CE 3CX5D 1RJ7A 2XNDH 1TME1 3S5QA 3H32B 1PX4A 1RE4C 1UU5A 1JCDA 1VQLP 4JKLA 4Q4V3 2YC4A 1AA0A 2WT1A 2XZRA 1W6MA 1D7PM 2R6QA 1GL2A 3G3ZA 3U07A 1SP4A 1CJDA 3KT4A 4OHXA 1KV4A 3O1UA 4F8AA 4YGCA 4BRYB 4GDOA 2WYFA 4QX8A 4Q4X1 3BRVB 1O7FA 1DQ5A 3L75G 1W8ZA 1KYOH 2QDNA 1GDTA 1N7SA 2A1XA 4K7JA 1GQHA 4ASKA 2FXMA 2OTKE 1RC6A 2BFUS 2ZYGA 3AZWA 2CDOA 2F4PA 4EE2A 2A06G 3AEFC 4WY4A 4DOUA 1KB9D 5FZ8A 4YLZA 2E75D 2ZXEB 2WSFJ 4AW7A 5AC93 4L75A 4PI2A 1E79H 3AL6A 2JICA 5GZEA 3PVBB 5FBJA 3W21A 2VUCA 3HMYA 1ZZ9A 3CXHI 1WT6A 2D2CB 2M8RA 4PIXA 1YI7A 3IKWA 1SLLA 4L8QA 4R8HA 3U11A 2OW4A 4Y5Z0 3PURA 2QRXA 3JXSA 5KLVD 1N1YA 1KQLA 1JYWA 3KCYA 4XCAA 4PDWB 4DXTA 1USDA 5CVRA 2KSEA 1SQQK 3AVRA 2XXZA 4CDQB 5APXA 2RS13 2QQPA 3ENRA 3QH6A 3T0AA 3Q1MA 4GALA 3OJAB 1RGSA 1IGOA 1V9U3 2FQPA 4QPWA 5CBOA 4IV1A 3KYQA 4KU7A 3VBOA 3NTNA 1U57A 2VBBA 2P34A 1LHVA 1VQOP 1ZV8A 1A3KA 2N1TA 4XBQA 4R4LA 2WS93 4WV8A 3POYA 4DO0A 1O3RA 1RUNA 4XYXA 2R041 3TYYA 4PT6A 3OYWA 2EVXA 1G2CA 2OTLP 3FHIB 1H0BA 3KCXA 3AE1C 1W2OA 3GJBA 1KGYA 5F5IA 4NAMA 5AVAA 4XZUG 4C1WA 1OFNA 5CKNA 4C91A 4IL6E 3H8RA 3LEGA 3JSVC 4HFSA 4Z1VA 4LC1A 1HRV3 3MIHA 2JB8A 3OCPA 3B5NC 1R092 1F2NA 2VUAA 2CY6A 2IZ1A 2OX0A 4NPLA 4MH0E 2QKDA 2Q6QA 1AR81 2LROA 1EAH2 4CDWB 2WDBA 4PD4H 3LZZA 1URQC 3L72D 1OURA 1KILA 2BCCD 1WGPA 2VGDA 2P1BA 2VMDA 2KS1A 4QKBA 3I49A 2BP6A 2PMWB 2RHPA 2C9LY 2JKBA 1UL9A 1J1EB 2VXRA 1LGHB 3H1HE 4UFHA 5F3CA 3CMGA 1SQQG 3H1KD 3TGUE 2E53A 3TNUB 2K9YA 1VRH3 3HNMA 3MLJA 1KFUL 3RZMA 3PTZA 2CSGA 4S2HA 5A3UA 4KT0J 4R52A 3BKZA 3S0MA 1PZ9A 2LW8A 1T6AA 4EIJA 2JE9A 1Q2NA 1H2NA 1W2AX 2XBO2 4COUA 1NZIA 1LP1A 3VBHA 1LOCA 3PVOA 5FZFA 2WO2A 4RD7A 2ET1A 1QWRA 5FV3A 5EJZB 4Q1PA 1OQEA 2LKMA 4LIUA 1LCLA 4PLOA 1GZWA 1SLIA 1N73C 5CFDC 4Y1YA 2Q1MA 1MS4A 1CZTA 2CWMA 3RZZA 3L36A 1YXWA 2YGLA 2CGOA 1ND2C 4IESA 4AFBA 1TMF2 2HWD1 2WJSA 4BWNA 2OT7A 5JMOA 4OI4A 1PO21 1FATA 5DAWA 4DS0A 2ZYDA 1LHNA 1DQ2A 1S0FA 1AHSA 4S2GA 4OQ9A 1RUD2 4AQSA 4NPEA 4M3CA 5FPBA 2DUOA 1ACCA 3IM0A 3UYJA 2DCKA 4JRAA 2FCUA 4QGLA 5APYA 1J2JB 4CCNA 3KV9A 3CHXA 4E2QA 5KXDA 1WBLA 5I0TA 1AYM3 5A80A 1UZVA 5H9SA 3GF6A 4YXDC 4IL6X 2Y64A 4ZS3A 1HTLC 1LTJB 3OBTA 3AE4C 1DZTA 4NN0A 3AKQA 4E4DX 1IPKA 1MV8A 4GKYA 1MFZA 3H1HG 4XA4A 1RF1B 1XYPA 3TGUG 4LPLA 4K8RB 5IJRA 1VALA 1I1EA 1A78A 2I1JA 2VMCA 5J48A 1FZCA 2X5IB 1W9WA 3OUJA 4Q4W1 2QJYB 2J1VA 4B8EA 2OKXA 1JUNA 2WQYC 3RGBA 3ZFFA 4JCKA 4NIAA 3B69A 3WCRA 3WG3A 3SISA 1W6QB 3BTZA 1EDJA 3VBFC 5I8YA 5BYNA 2WZR1 4NVPA 1H8VA 5EFUA 4BXLA 4P9GA 3USSA 2XQRA 3M3CA 1DEEG 1SQXE 5B4NA 1S1CX 3QWOC 3VBUB 3L73J 4LT5A 5AW0B 2W9XA 5F8PA 4BOWA 4MHRA 5FLIA 2A6VA 1AR61 1QDOA 2ZAAA 1HXS2 5JAXA 5KWRA 5FZKA 1LTIC 3D6ZA 1FNYA 2W2IA 4GMP3 1K05A 1NXD1 5GZCA 5C5TA 1NAEA 1WMDA 5ISLA 3U1CA 1UPSA 4NHYA 1FDOA 4ZKTB 3CXHE 2VVEA 3PUHA 3AYDA 2BNNA 1DIPA 1S3JA 5M0TA 2ZMKA 5FPAA 5A33B 1YEWA 4Y5SA 1IFIA 4FOVA 1AYN2 3DEMA 2OUJA 4WVZA 2M0BA 2GDFA 3IF4A 2HFED 3FHQA 1JNMA 2WWWA 4I09A 1WLCA 1RUF1 2GC3A 2R071 4FOWA 2GH2A 2IFNA 4BQ5A 5KXCA 2HR3A 1KEXA 1XE0A 3N7MA 1LOFA 1W28A 3M1HA 3CL1A 1LRHA 3OPZA 5J1XA 2VL4A 3PJYA 3ZYHA 1ZBA1 3OY8B 5C4WA 1NVOA 4AAPA 1NAYA 3MPPG 1UXXX 3LPFA 5LZ6A 5FK8A 3GHMA 1ZP0C 1LTEA 1LJ2A 3CCVP 4AEDB 1LEDA 3M0AA 3M3QA 4DMIA 2D43A 1LT9B 4D7SA 2V72A 1Y9GA 4YXWH 4ZU4A 3RQ0A 2OYHA 2Y9ZA 1SQXG 4YFWA 1KC8Q 2JWPA 3E1IA 2WPQA 1VQPP 2P17A 5IVEA 1HQNA 3WD5A 3ACGA 3WUUA 4Z1MH 4JTOA 4YZ2A 3V65A 2QQMA 1OZHA 5L9VA 5HCFA 2E42A 4R9DA 1YFXA 2Y6KA 1D2SA 2QZ2A 3AKPA 4DRVA 4RESB 3KPEA 3SEPA 3D8CA 1UOFA 4O65A 4U2AA 4CDXC 1SQVD 4AGRA 3RYKA 2FYUJ 4W7YA 1RUE2 1Z78A 3ZFEA 4UB8H 2ORXA 3WNMA 4JHZA 3OD4A 2RR13 1NE4A 2NPSB 2VQ0A 4I0AA 4XIKA 3EFFK 3BIWE 3VDAA 1NU1J 5FZ7A 4LXLA 2L9LA 4XFFA 4YWAA 3T0DA 4MHUA 1PGSA 1POV0 3HQXA 4YGBA 4CPBD 1T2KC 2AYHA 2IUWA 5BNNA 1WD3A 4Q0VA 4DXZA 2CV6A 3APBA 2R44A 1L4AD 3AKSA 1KYOD 4Q8KA 2VZQA 5FYUA 4LBQA 1W6MB 2YROA 1JHNA 3POIA 2UY9A 1GL2B 3UKTA 3ZYFA 4D7YA 4LMFA 3CDZB 1LULA 3KF3A 5J37A 2JDMA 2JDKA 2UWJE 4D6RA 2P37A 2CTVA 3AYEA 2RS32 5EP9A 4A41A 4N7IA 3CI9A 5BNQA 1FZFA 1H88A 2XJRA 4AQTA 3VUOA 1FOD2 3TK1A 1YHQP 3IWZA 4K20A 4RGKA 2I07B 3GZAA 3E97A 4FTSA 2RN0A 1DDLA 2G1MA 1W03A 3UGGA 1M1KQ 1F8VA 1QXJA 4CDUA 2J1TA 5EJ3A 3WF1A 4WY4B 1RUH1 2A45H 2ZGPA 4D3WA 3I3MA 1ULGA 2Z5IA 3DN7A 2VOKA 2YG0A 1XNBA 2ERFA 5C39A 4A2UA 5A1LA 5KC6A 2PLV3 1TMF1 4JZRA 1NTKJ 4Q4Y1 2GNDA 3GCWA 1ULEA 3IAOA 4HONA 3LFMA 1NQDA 2Y6JA 3M3IA 1BGYJ 4Y24A 1VMJA 1ZRTE 1SLCA 4CEYB 2KI7B 5KHIA 1CZQA 3I59A 2Y6FA 3HUSB 4B4PA 5FY5A 1RUD1 5AVXB 3PNAA 3RK3E 2JDZA 1QJY1 1X8EA 4RR3B 1DD4A 1KZUB 1OLMA 3A0KA 4IFMA 4ZS2A 1JMUB 2BWCA 3THDA 3T08A 5AVWB 2JDUA 3RL0C 2N9YB 2A3WA 1QNYA 1BMV2 1ZRRA 2Q4SA 1JB0J 4IV1B 2AZ5A 4COWA 3R2PA 3O1MA 1SQ4A 2KSJA 3LSDA 3LPGA 1SQPE 1Y7BA 4DZOA 3N9PA 2DCZA 4BK5A 4CUCA 5FK7A 2J1SA 5ANQA 1W0PA 4D6SA 2UWAA 1W9SA 2D44A 1DBNA 2GZWA 1UZZA 1M06G 3G71P 3CCQP 3INAA 3OYWB 2XVKA 1G2CB 2RS53 4AGVA 1MZFA 2XWBB 1SFCA 1PGW1 4DOJA 2ZOEB 4E8DA 3SFDC 2XG3A 1B35A 2WLQA 1YFUA 2ZGKA 1NCQA 2ZFCA 2W1SA 4PD4D 4CZSA 1VQ6P 4AE2A 3KLSA 2WWUA 5F37A 2DVAA 5KAFE 4A3XA 5A1AA 3ON7A 3O6QA 1PIXA 4BHPA 4H44C 2Y0DA 5FYHA 1BCCE 4EV0A 2Y0EA 5IW0A 1DGRN 2J42A 3M9QA 4NE9A 1VDFA 1ZA7A 4AYCA 3HQRA 1O4ZA 1G7YA 2WFF1 2WPVB 2LALA 3L70D 1N1TA 2ZZJA 2KS1B 3PDQA 3WP5A 4KH9A 4KL1A 4CCEA 1HXS1 1OPMA 4QPGC 4JGYC 1H89A 3UL2A 4DUWA 5A3OA 2E9QA 1VQKP 3I3QA 3VMZA 1QGKB 2A6ZA 2KP8A 3VD4A 1S72P 2GM4A 1SDWA 3CEWA 1RIRA 1HRI3 1PIV1 4BIFA 5FOJB 4NHLA 4NHXA 3NJXA 5FZDA 4WM7A 4Y99B 2HYXA 2XJVA 2ZX4A 1IPSA 3LW5H 4XJUA 4AQ6A 4FT8A 2XB6C 1SQPG 3KWVA 5H9RA 2Q5TA 3ALQA 3PUQA 1H8TB 2PTMA 3HWJA 1AR92 2PRRA 2KIKA 3HE5B 1K42A 2EIDA 3AEGC 4IEZA 3BCCJ 3U78A 1MZ5A 4UBHA 1EPWA 3CZUA 2R5BA 3ELNA 5FQ0A 5C9AC 3VZOA 3ZYRA 1O8PA 5F5QA 3ITKA 4J25A 2ZGNA 1ZN5A 1URXA 1W8HA 3CJIC 1UNBA 5JIAA 1L0LE 1H2MA 2K9JA 3DPRC 1L4AA 3CPWO 3OPWA 1SFYA 4D94A 2AREA 2ID4A 3E6BA 1PO11 3GNEA 4QT6A 5FYBA 5CU1A 1G6NA 4QHZA 4C1XA 4H3WA 2V7QH 3V0AA 2LR2A 1X9VA 4AL9A 3U1AA 1NTZK 4IEUA 1U5IA 2ZHNA 2JG8B 2PAKA 2W1QA 3J7HA 2BFUL 4YARA 1OXZA 2KXPB 5E1RA 4B4QA 2X09A 2IFMA 2A6YA 4QAWA 3NJYA 3MD0A 1FZCB 1WCSA 4IGPA 4W65A 1LTSC 1NJIQ 2WNVC 1Q8QA 4ZKPA 1OA2A 3FN9A 4PIZA 1GZLA 1MPXA 3VDCA 2KZJA 1RUE1 2E75B 4U3FJ 3VD5A 2E6VA 3VD9A 4GJYA 2B8MA 2OQ7A 1GBGA 4NAOA 3ACIA 2JB4A 2JG9A 3W68A 4FSJA 5H9PA 2OQQA 1HV1A 2BGOA 2VAUA 5FY8A 3TEWA 1GKBA 1JZ8A 5GLTA 3FXEA 3MHVA 3UNPA 2QFEA 5FBZA 4AR2A 4IFDK 2YC0A 5B5EE 1XYNA 3J4UH 2MEV1 1LT1A 4B7EA 1NCRC 3BVCA 2PFXA 3HIFA 3E6CC 3ZDVA 2YMZA 1GUIA 1VBE2 1PMHX 4YG6A 1W8WA 1C1LA 1A8DA 2PHXA 1US2A 4JYBA 2NMNA 2Z2SB 4IEYA 4LE4A 1UIJA 2BVVA 5DDJ3 1YLLA 2E74D 1SPPB 3OGJA 3JB8A 2OTJP 4Q8LA 2F4LA 2XU6A 2QJKB 1W6OB 4SBVA 3VKMA 3TRSB 2JENA 3VHNA 1DGLA 4FOYA 1J1DC 1L0NG 2LXCB 4GKGA 4NWVA 4M3LA 5DAXA 4EYYQ 1PP9G 2VG9A 3NQHA 2RMZA 3Q8EA 3ZXFA 1UX6A 3BPSA 5HV0A 3IR9A 3O1SA 3U14A 1VL2A 3NAPA 2CAVA 2CHHA 5C8WA 1T6GC 1OLQA 1J1TA 1HB3A 5G05L 5FR3A 1MEC2 3VBRC 2VUJA 3OUHA 1JY3O 2XJUA 1IK9A 1NTMK 2WN3A 1VPCA 3PHMA 4G3YC 3L75J 4N3YB 1AFOA 1ND3A 2RJKA 4QXHA 2ZZQA 4N53C 1MUUA 1PM7A 1JOCA 5CNAA 2VZ3A 4YVSB 3LEMA 3L74J 4XUTA 1RUC2 4BXSV 3F95A 4RHV1 3B5ND 1UZWA 3V56A 1PVC1 1VBA1 3NSTA 5FZHA 1EV13 3RSJA 3KGZA 2XJPA 5KJ7C 3OBAA 5H2FE 5AW7B 2VTXJ 3WLUA 5A7NA 3WUCA 1PL5A 4DNYA 1AL23 5IVJA 3FWNA 2Y60A 4RSUA 1WZXA 2D6LX 1LEMA 5CCGD 3ZN6B 2GMMA 2WC2A 2VECA 2VJXA 4XDQA 2BEQD 3SFEC 4B7KA 3MV01 3J9SA 3LDRA 5KLVG 4UFLA 1A34A 4CTEA 3C8XA 4B1LA 3FZ3A 2HWE2 1R1ZA 4AVTA 3H1KE 1C28A 1GW4A 1UIIA 4D8MA 4LEJA 5FKBA 5K7PA 3ZYGA 3EQ2A 1O4TA 3H3UA 3PL0A 1SBDA 3P8MC 4A7KA 1X9TA 3VZMA 3ZFEB 2WT7B 3I4IA 1WA4A 3H1ID 1J3RA 1KYOI 4FPFA 5ABJC 4DEQA 4IEXA 1XPWA 4H0LC 4GJZA 5CISA 2YGMA 5BNPA 4XHXA 3FJSA 5L19A 2FDJA 5D8AA 2LTNA 2Q7CA 5LBFA 5AW5B 2KLUA 3DKQA 4LBQB 2W0XA 4XVHA 3W59A 4UWDA 1IFJA 3WX5A 2J58A 2EA7A 1VBC2 3K3OA 1REEA 1AUYA 1S4CA 4BE3A 2Y0CA 3AE3C 2CGNA 1S2KA 4P08A 2QG4A 5FOBB 3Q5PA 1FMD2 1RE4A 3TB0A 2DTWA 1Z56A 1NA1B 5SV5A 1SQBK 4LKEA 1DZQA 4YW3A 3SH5A 1FV3A 1DP0A 3J7LA 3L72G 4AHXA 4BU2A 2YY1A 3VBOC 4N78D 4R4MA 1NOVA 5JWPA 2ES3A 5B66E 4MGIE 2WQ8A 1SQQJ 4ZHNA 1IFDA 4I3PA 5ACA2 3OA7A 1JZ3A 4KU8A 5FREA 4META 3H1KG 3H50A 1IQDC 3OG2A 3WNOA 4N7UA 2W46A 4CE8A 2ZEXA 3MIEA 1W3XA 1AJOA 5DAPA 2XNXA 1BCXA 2BRTA 1ZBE2 2YKQA 1XQNA 2VZUA 3IMNA 1R1A3 1NYHA 3I59B 1W06A 4IXLA 1GZCA 2XLFA 1COV2 2QE7H 4LA3A 1RTVA 3LDBA 4ARYA 3SKJE 1GANA 3DECA 4I0BA 1KDMA 1QY4A 2YMKA 3E7KA 4I02A 4AF9A 1N1VA 2VCAA 3Q8AA 1NOHA 3LIDA 1AVOA 5DXDA 1AYN3 2AR6A 2WNUC 3M9BA 5FO7B 3BVHA 4HK8A 4QKFA 3KQ4B 2B9UA 3VZNA 4CU6A 5APQA 2G9FA 3P32A 4PD4I 1W90A 2ZHKA 4Y20B 1JU3A 1UU6A 1VQ7P 3WUVA 2HWF2 1W6NA 4IEVA 3WXPA 3HD7C 3FBMA 1B35B 4E4HA 4K3UA 2Q0AA 1V6NA 2G19A 1MFTA 5FY4A 4V2VA 3BALA 4LUMA 1HB1A 3A23A 3O6QB 4NWWA 5A32A 3V0BA 1QOTA 4NMIA 4JF7A 3H1HJ 2VQUA 4FPYA 5FYSA 1X9PA 4P02B 3TGUJ 5GLUA 4XMAA 3FFQA 4LHLA 4YM2A 3J7NA 3RZHA 1Y8AA 4IUGA 5LA0A 1FE6A 2KM2A 1MR5A 4ISQA 4AI9A 4WM8B 4I0WB 3ZSMA 1D4M3 4BJ0A 5FLJA 3MF9A 4HOOA 4JYCA 4LOSA 4ZPIA 3HT2A 4YYOA 3AE6C 1HJBA 1LTGC 5LK5A 4LO7A 1TME3 2Z5HA 2I45A 1S2BA 4RJTA 1QJFA 2NRGA 1M1JC 2ZT9B 3GHGC 1NYWA 5L7OB 2QQOA 2AEMA 3HBKA 1L3JA 1FI2A 2E63A 4CP0A 1URQA 2PELA 4Y28J 1EXJA 4NO4A 2NP0A 4WM7B 1KDKA 1CAVA 4GZ9A 3CMEP 1FBMA 4ZKUA 3RVHA 3JUUA 2VVDA 3T2QA 5CB7A 1ASJ2 5FMOL 3ZDMA 3AMPA 3VZLA 3VHOA 2CPSA 2GAUA 2QQJA 4Q4V2 1DGWA 3OGRA 1PGL2 1R64A 2V4AA 1OFCX 5JOWA 1RVF2 5CYYA 3PLQA 3NRUA 2Q8DA 4UXAA 2Q3IA 2VZVA 5LK7B 4EOTA 5KKZC 1N73A 5CFDA 1ZLLA 3RNSA 1SQVK 4QB2A 5T55A 4NROA 2G3AA 3I2JA 3ECQA 1Q81Q 4INDA 1T2KD 4EJRA 4NRPA 1L4AB 1ND2A 4PBOA 4AI8A 1GQPA 2WSVA 2RS33 4C46A 4QPIB 3ILFA 5AVPA 3RK2D 1SDDB 2DF7A 2D6NA 3TBDA 3AJZA 4HANA 5CCHC 3ASIA 3FUOA 3JQXA 2R061 4YM3A 1KYOE 2D2CC 2HODB 3V0AB 1M56D 1S0BA 1AV1A 4LBNA 1JU4A 1G9BA 5IVBA 2PAMA 4HVQA 3E6DA 3SMHA 5APAA 2E26A 5A6QA 3M0DC 2JD4A 5EPAA 4Z07A 5C3PA 1SQXJ 3KZ4C 5AW4B 4PDWC 2RH0A 1KQRA 2BZDA 3ZIWA 1XBFA 2IFWA 5T5OA 3M91A 4DPNA 1KD7A 3MP7B 2R043 4H14A 1OUSA 4RL7A 4FPEA 3BN6A 2D6PA 1C8NA 3ETQA 1IK7A 5BNOB 4O61A 2PHTA 5CADA 4KGQA 4LLHA 3B4SA 2Q9IA 2RS12 4ZU7A 5LEJA 4K1YA 2FYNB 1QHDA 5TISH 1V9U2 4RA0A 1HN1A 3HBZA 3NJZA 3S1KA 4WVWA 1OOPB 1OA3A 1BK1A 3B94A 2WVRA 1RMU1 2K37A 3WR0A 3VBFA 4D0QA 1SQVG 2W90A 2D6MA 4CU7A 1CAWA 1QGLA 1YJLA 3Q3DA 4YW2A 3L9JT 2EAAA 3OBZA 2VXJA 4FI9A 3WUDA 1RUJ1 3I3EA 4JKKA 2Y6LA 2GALA 3JCIA 4QHOA 1FS0E 3OGGA 5BU5A 4RGAA 1EUUA 4BQ2A 5DQ0A 1HRV2 2YC2A 4TTGA 3T97B 1QJX2 5LY1A 4CDWC 1YFYA 1FV2A 3ZN4A 1YIJP 1UY0A 4PV1B 1QJU3 3T4HB 4DT0A 1BVP1 1RXFA 4BA6A 4DUVA 2B87B 4AI1A 5FZLA 1GZTA 1SZBA 2P6CA 1V0AA 3ZPYA 2QTWB 4KNCA 3RJ2X 1WUVA 1APNA 2FCVA 5FPUA 1JZ7A 2HWC2 3WNNA 4P9YA 3DCQA 3RGUA 4NIGA 1VRH2 3PMSA 3L37A 3UKNA 2QBXA 3A5TA 1ZX5A 4PD4E 1NY72 2DUQA 3AJYA 1JYIA 1FZEA 3OEAA 5AVRB 3O1PA 4I7ZC 4YM0A 5CG8A 2W27A 2J1EA 5JDBA 4Y1XA 2RDSA 3RBZA 2B39A 3URFA 4TSVA 2C9AA 3GF7A 3MIBA 1NGMB 4OI1A 2OARA 4Q29A 3R4DB 3TN92 4JDMA 3L70E 3PJQA 3A3YB 1ULOA 1VIWB 1GOGA 1RUG2 1PK6C 4EN8B 1GWLA 2QUOA 4HPKB 3DF0A 5JOZA 3MIFA 2Y34A 4OYUA 2O01J 1GD2E 2PHWA 2H0VA 1HV0A 2NLRA 3J8F1 5KHKA 2GC1A 1AR93 2HWF1 2R16A 3OUIA 1H8AA 4BLJA 4MGTA 2RMU2 3WG1A 5JZGB 3HE4A 4UW6A 1MS8A 2RM21 2D7FA 2OA2A 4OZOA 3SCGA 2J59M 2L5GB 5FXVA 2TUNA 1FOSF 4A6OA 2LS6A 1LTJC 1Y9QA 2B88A 4YW5A 5FCCA 1O3QA 3CX5H 3O1VA 2GNBA 1AYM2 5CHXA 3I2DA 4CDXA 3RZLA 2B42B 2WNEA 3DKWA 1LU2A 3GZEA 5BNPB 1HF9A 2M3EA 5DZGA 2Z79A 1K8AQ 1H0TB 3AXDA 5FZOA 1ZRDA 2YXSA 2A45I 3TOJA 1DX7A 4CP2A 1FJKA 3D6YA 2FDFA 1ENQA 4WWIA 2XKOA 3FLRA 5JPNB 3JD71 3HTKA 4OHZA 1GLHA 1IS6A 4E9KA 4XFGA 3EHKA 3R4SA 3LFIA 4PJ0H 4S2FA 4RQPC 1WKYA 1KB9H 2QQIA 1S5LH 3VBUC 2ZEWA 4XUQA 4EZ4A 3A21A 1VBD3 4EN6B 3H8OA 1NHLA 1OD5A 4FFGA 3L70G 2UWCA 4CCCA 3MV11 1EPZA 3RJRA 4CUBA 2GC2A 5FY7A 1V6JA 3P3PA 1OT5A 1NUKA 4Y3OA 2PN5A 4QQPA 1GU4A 2HEVF 3O8ZA 3EMRA 2R073 5FPLA 4AAXA 3VDBA 1BGYE 1SMVA 1MKMA 2W52A 2K46A 5FAXA 5C5UA 3TYJA 1SQPJ 1KQGB 2UU8A 1BJQA 2UYAA 3IB3A 4MG2A 1PPJD 1VLNA 3ACLA 1ZW0A 3NMDA 3WW4A 2PP6A 2ZABA 4XPVA 2YFZA 1BQPA 5JXGA 1QDCA 2XKPA 3H42B 5TSWA 3PP5A 3KHUA 3ZSEA 1DHKB 5F3IA 5F1RA 2E74B 1OD3A 5AC91 1JOJA 2MJZA 2IVIB 5K0UC 1C57A 5KAIH 1K45A 4XFHA 3POJA 4FAHA 2WR9A 1FZAA 1JYVA 1IG0A 5LB6A 2GNTA 1BEV1 4AEDC 4DCKA 1W6PB 1RINA 2ZA9A 1LT9C 4KBZA 4X8PA 1MEC3 1HB4A 4IL6H 5GLZA 4XXPA 4FXGB 4NPDA 4F3JA 1VRBA 3L2HA 4KWUA 3ZR6A 1UO9A 3MEPA 1OI6A 2W3JA 3HAGA 2DCJA 4Q5OA 1QQP2 3NJVA 4A7ZA 3ZMOA 4OGQC 3CNAA 4LHKA 1OQ1A 3V4WA 1PNFA 4K6BA 5IK5A 1GWMA 3MTUE 4UW5A 4PIYA 1Q8PA 3AYCA 4HT1T 1RUC3 4FPCA 5A1FA 1IJDB 4PI0A 1WBFA 3WSOA 2VQTA 5FLHA 1XXNA 1SG3A 3IDCB 1XE7A 4ZONA 1RHI2 1OIPA 5APUA 2AEZA 2WS91 1XNDA 3TSIA 4WVMA 4K40A 1UYPA 1S4XA 3B5NB 4K1ZA 4OI2A 4AUWA 5DABA 5CKMA 3HVDA 4X8NA 3JB4C 4KBBA 2E76C 4AQ2A 1R082 4BQ1A 4W80A 1GP4A 3FC0A 1IOAA 3FE5A 1EDIA 2J1AA 2NPSC 3AMQA 4K35A 1HDKA 4ES9A 2WLPA 2XONA 2B45X 4M00A 1EP0A 2J1RA 2E7TA 5DG1A 4YGDA 1N86A 1KXGA 2HBTA 3KHCA 2C26A 1EZVD 2IYOA 3IPVA 3IAPA 4QPGA 5T52A 4JGYA 4IETA 1CAVB 3WINE 1G9CA 2D93A 3WUTA 4MX3A 3SWYA 2O1KA 1OA4A 4GB32 5GTHH 5KXEA 2FDHA 1GL2D 1U5XA 1HB2A 2NZ2A 1VMHA 4BZ4A 4UB8E 4AI3A 1S0JA 2P7JA 3M8LA 3UJQA 1L0NJ 4A7PA 1PM4A 4YVWC 4QX1A 4AVBA 1PP9J 2C0ZA 5T54A 5A3PA 3TNQA 1N7SD 1XB9A 4LA2A 3KZIH 4QGNA 1XU2A 1GK4A 2VMHA 1FT9A 1ZZ7A 4AVAA 2C24A 1N73B 2GNMA 3RFRA 4Q4Y3 4JPZB 1W2EA 2VE1A 4K21A 4XJ9A 4OZXA 3H1IE 3CC4P 2ARAA 5APWA 4XJ8A 5FZ3A 1BZWA 4JVAA 4RFT0 2VTFA 1Q8OA 1Q90D 3SKVA 1FMD3 4D6TD 4E8CA 4R9BA 1QJY3 1HJGA 5LW9A 3C8VA 2IBZD 1FJPA 5C9AA 2KZIA 2ZBJA 2VPVA 3VTPC 4HBNA 1UMHA 1WMEA 3RK3C 3CJIA 4BMBA 4OUSA 3DPRA 2HLEA 4CEYC 2BU9A 5FO8B 4IEOA 2WPSA 1NQJA 3HUSC 1LNQA 3NMBA 1ENSA 3C1LA 3TF5A 3SWKA 2ZGUA 5ACA3 1CD3G 4RR3C 2FFDB 1JM0A 1LHWA 4JDNA 5DZFA 3LD8A 3N9OA 4J1XA 1TNFA 3CCRP 3CO2A 1MS3A 4IEPA 2AC1A 4MYEA 1E5HA 4QXCA 2JD9A 2N1TD 3O0VA 5KLVJ 1A8MA 1WW7A 5F2SA 2OYIB 2WNVA 1W05A 5I93A 3ZIXA 4K3AA 5A7PA 1COV3 3HPNA 5FIXA 2R5DA 1TEIA 1OVSA 4CU9A 1ALYA 1CAXB 5D2AA 1PZ8A 3ZFGB 3PTYA 1X82A 5F32A 2C1FA 1IPJA 2ENRA 4UFKA 2WFF3 4FOQA 3S7IA 3H1JD 2NMOA 2RS52 3PIJA 1TG7A 1NLRA 4A6SA 2FDGA 1NCRA 4HXCA 3A2AA 1UYYA 4ASMB 3H1IG 2A6WA 4J6GA 3PLNA 4COZA 1YUDA 1UY3A 3JQWA 4C7NA 1U7MA 5F7UA 2ZX2A 1KILD 2H0BA 3VV1A 2H6CA 4LO6B 3AE5C 2Y8KA 1PIV3 3S30A 3ITQA 1PV3A 5FY9A 2DFCA 1JY3N 5EFWB 2QQNA 4GWJA 1SFPA 5I0RA 2YBPA 2XVLA 2V73A 4PF5A 3KV6A 3AFGA 1G8WA 3FHAA 3MFCA 2ZMNA 5KBFA 1WA6X 2K2SA 2EXKA 1DYKA 2A45G 4CEWB 5KHJA 2HLOA 2K1AA 5FZ9A 4BIOA 4GMP1 5KHGA 4DXSA 2SBAA 1KORA 2VW1A 3L74E 2A06D 5IAXA 3L72J 1WWYA 4Y99C 4CPGA 3VBRA 1BVVA 5FYVA 1HRI2 4GXLA 1GMMA 2F6BA 4LQRA 1WW4A 2EF6A 1ULPA 3RZJA 1F9KA 1H8TC 3WOGA 3E5XA 1YC61 5APTA 3H1KJ 4GH4C 4N53A 1OXCA 1M90Q 4HMZA 2WSSH 1WLWA 5F3EA 1Y9MA 3AVSA 1YTZI 1PO13 4AEMA 1GSLA 4Y1VA 3U4XA 2WRAA 1ASJ3 1KQFB 3POGA 1FAVA 4FPGA 2P4EA 2YNYA 5KJ7A 1FPN1 2KUBA 3LOIA 5BUVA 5DMYA 1BSNA 4BYYA 5DAVA 2CYFA 1NTZD 2P3YA 1ZVFA 5F3GA 1GK6A 3GM8A 5F5CA 4DIQA 2WUHA 3H0OA 5J7MA 3SQOA 1HKDA 3ES1A 4N6JA 1RVF3 1JCCA 3CF6E 1IFMA 4XUNA 4QDQA 3RDIA 5T5LA 1HGVA 2CAUA 2OZ6A 3E1F1 2JG8C 4HB1A 2WNOA 4CDXB 4LTAA 2ORZA 1JOBA 1KRIA 1JYCA 2E31A 5FZOB 3ZSLA 1N3OA 4RO0A 2QDRA 3V2NA 2W1UA 3L74G 1T6BX 2MEV3 3I7DA 4AK3A 4FPKA 5LRSA 4MSVA 4CU8A 5ABJA 2Z5WA 1WCDJ 2B7YA 3O1OA 1DD3A 3K5BA 3AEAC 1OF4A 3VMAA 4QM8A 2FCTA 2QSIA 3RK2B 3HTKB 3MF6A 4QQOA 3UV9A 1XSQA 3QOPA 4QKNA 3S57A 2RR11 5IVFA 2FBEA 4Y1ZA 3N7NA 1P84H 4UF0B 4JDOA 1YJWP 1V6LA 1SQQE 3U4SA 4JGZB 1OSGA 2M5AA 3QCWA 3A0BH 2QE3A 5FUIA 3RRDA 2XQXA 3AZZA 1XTGB 3WP3A 2QJKC 4AVVA 1EYBA 4MVTA 3ATGA 4FP3A 1LOAA 5DDJ2 2WA3A 2M3BA 5C6CA 3H8XA 1NTMD 5ANNA 2WABA 2Q1FA 1ODMA 2ZVOB 2EAKA 2NQYA 1GQGA 2Y33A 3BTYA 4FQ4A 2BNMA 1OX3A 1CX4A 4LBJA 4TWTA 1Y4WA 2QJPC 3KT1A 2WSCJ 2WO1A 2JECA 1H4GA 2XJTA 2WYSA 2ZMLA 2ZVNB 3IDBB 3NNGA 4KWJA 1J84A 4N43C 5FZEA 2YHJA 1E5RA 3CD6P 2KYVA 4WZFA 3T2TA 3MW2A 2VMFA 3FX0A 3G9RA 1W04A 3WHTA 1W9FA 2WL1A 2ZAHA 1QJX3 1QMJA 3OTFA 3LF7A 3VHRA 2J5UA 3NO8A 1RUI1 3WQBA 4C0HA 1CI6A 3UJOA 1NXMA 1POV3 5JR2A 2HWB2 2PHFA 4YVSC 1CAUA 4QB6A 2K3RA 3ETPA 2XH6A 4FVVA 2PLV1 3D6EA 1T2XA 3BOPA 1W8TA 2WSEH 3M2MA 4Y22B 3RL0B 1W8UA 4N90A 5K9YA 3GBGA 2WNUA 5FZ0A 2JDIH 1XE8A 1DIWA 5C8CB 1QJEA 1KS4A 2HWC3 1EV12 2R32A 5CMZA 2AACA 2H8PD 4XURA 3VOPA 1UD1A 1GU3A 4COYA 5JOYA 3SCHA 4PCRA 4HKZH 4XW3A 5IK7A 2BYVE 3HD7A 1DQ6A 2JEMA 2Y6HA 2AENA 1AL22 3D70A 5CJ0A 4H7LA 3UK9A 3IBMA 3W5NA 2PQQA 3N9QA 1S0EA 4ISRA 1DQ1A 3P6BA 1AR71 4BQYA 1VMFA 4LHNA 3R6SA 3TN93 4O9EA 5IYYA 3ZXLA 2VTXA 4ZZ5A 1W0NA 1MS5A 1ZZCA 1V70A 1JODA 4Z82A 1QVFO 2W1WA 1X50A 1RUG3 3MUY1 1JOPA 1ZRIA 2ZTNA 3KVAA 3MIDA 2H6BA 1LOGA 1F31A 3KMHA 1VQ8P 4O9GA 3WDTA 4Y26A 3IPVB 4QPGB 4JGYB 2RMU3 1JI6A 1M1JA 3GHGA 1GTWA 1SQVJ 4LBQD 1EY2A 2HPCA 2IVJA 1SQBD 1AXKA 1G1JA 3W67A 3OJBA 2R0FA 1VB2A 4AOCA 4TLGA 3I97A 1XU1A 2DU1A 4IE0A 4DY5A 2Y6GA 1MS9A 5EIYB 4M3CF 2E7QA 3U1XA 3QH7A 4M0HA 3N7KA 1N8RQ 4IV3C 2YU2A 4HETA 1NA1C 4N9HA 2ZGTA 2R3SA 1HN0A 1C5HA 2G8YA 4XQ4A 2FYUK 2X05A 3POWA 4IFFA 3B71A 1HRI1 2QVAA 2DCTA 1L7QA 2IBZI 3DXUA 2QNKA 3KXDA 4FXKB 4BRYA 5CEHA 2YXRB 1NU1K 4P9LA 2KNCB 2JDPA 2RJ2A 2ZX3A 3Q8CA 2WSUA 3WHUA 1K5MB 3T1LA 2BQPA 1C3HA 1MZEA 4N9IA 3JBG1 4IEQA 5AVSB 2ZPXA 3AP7A 1BKZA 3IIAA 1WW6A 1VF5D 1Y3TA 3VBSB 5GZGA 2KD7A 3ZSJA 3D0JA 1SQXD 3AMHA 5CCHA 2QJVA 4TZDA 1R1A2 3SSUA 2ZACA 5EJ1B 1OVRA 1RITA 3F2ZA 1UY2A 5FUNA 4YSFA 3MLKA 4AEJA 2JWAA 5AW2B 5CBNA 2OYZA 2IXJA 1AQTA 3U0ZA 1SEFA 2ZJSE 3T1MA 4XIOA 1ULCA 2QM7A 2WN2A 4XACA 1GP5A 3MO4A 3M0DA 3CXHD 3MI8A 1JTHB 1LWUB 4PDWA 3ZXDA 4QB1A 4EZHA 1XRUA 2WNVB 1CX1A 5BXXA 1S55A 5A7SA 1K04A 5J3UA 2QQVA 1H4HA 4BPZA 3THCA 2R1BA 1SFCD 4NIIA 2B5HA 2CU5A 1A02F 1UIKA 1NTKK 3T30A 5EYXA 4YPJA 4XF0A 4IE5A 1CWPA 4YNIA 5FP3A 1NCRB 1K73Q 2OUHA 3ACHA 4QU1A 4I1LA 5HCBA 4EN0A 1PPJE 4BMEA 1ZOYC 1Z7S2 1NG0A 2BEOA 1IFNA 2OS2A 3HQUA 4P9XA 4XBLA 2XJSA 5AW6B 3OSDA 2XUEA 4WM8C 3V4QA 2AXTH 4EWAA 1LAJA 1ZNPA 1QQP3 2X8KA 3ZSKA 2UYBA 3KM5A 2N7GA 2ZT9D 2IC1A 2OVUA 4WBBA 4D7TA 3EFGA 2RKLA 1D4M2 5L7OC 2VOXA 4CDWA 1QKQA 4FPOB 5GKAC 2DW3A 1TME2 2WAOA 5DDJ1 5A6YA 3T0BA 2F17A 5FPVA 3BGAA 1IS3A 1RHI3 4AI0A 1QH6A 4EN7B 3MBWA 2YO2A 3RZKA 3L70J 5FKCA 2OXBA 1VE0A 4OGQD 2OPKA 3KV5A 2DV9A 1H6YA 3L71D 1N3QA 2NM1A 4J1WA 3SITA 3WY6A 1R083 3WDXA 3G4SP 4IE7A 4Q4X2 1HJFA 2VY0A 3ORJA 5LA1A 3T3YA 5GZFA 2VCBA 3X29B 5LCWL 5GM0A 4LORA 1HLCA 3B5LB 1X22A 3BTXA 3CX5I 2O1QA 5FWEA 2YU1A 4YW4A 1R091 2A7AA 3CKHA 3H1LD 1J1LA 4GB33 3SCFA 1EAH1 1SCRA 5F6KA 1PPJG 1ZZ8A 3QACA 4LR4A 4LIVA 1S0DA 3V2QA 4QPIC 3Q9OA 3VDDC 1EDKA 2I1KA 5BPXA 1PK6A 1JYNA 4PLNA 3LA2A 2ZYAA 3UT0A 1UOBA 1F4AA 5LASA 1HW5A 1KB9I 2X53S 3S6PA 1DU3D 1N7SB 4UI9L 3RWKX 2A73B 5C3OA 1I9RA 4GOFA 5GLWA 2XBO1 1FC2C 3U10A 3K4ZA 1LTJA 1OH4A 3KD4A 5J98B 1PVXA 1F5FA 2WAAA 4MN4C 1CQ9A 3CCEP 1P84D 1ZMEC 1XSRA 2D5HA 2C0XA 2JJLA 4ET7A 1S1AA 1GZ9A 1DLCA 2R042 3WU2H 2CNAA 2W95A 3R4YA 2X5IA 1CIYA 1XJAA 5C3RA 3O1RA 3LA7A 1RUJ3 5B66H 3CJXA 2WSFH 5GZDA 3EBRA 1ZRTD 4D6TE 4LK6A 3PIGA 1GU5A 5AVZB 2IBZE 2H89C 1DLLA 3RK3D 3GG2A 2BNOA 3H3ZA 4P9WA 2BGCA 4ZXKA 2A70A 3H1MA 5JXJA 2M5AB 3QD6A 4QX5A 5IK8A 2GC0A 1HGZA 5LY2A 1PMIA 4RQPA 2BOJA 2DVDA 1AR82 2R0HA 4EN9B 3VBUA 4FFIA 1BHGA 2JKXA 5FZ4A 2D3PA 5TISE 3VBOB 3FBYA 1GFF2 3GZUC 1HJ0A 2N1TB 1EZVG 4PV1D 4TN7A 4EI2A 5FJKA 1S2EA 3LSEA 1IQAA 1CZVA 3LCPA 3W20A 3K4DA 1HH0A 3I2GA 1OKOA 4MADA 1PX3A 4U36A 1QJU2 3A22A 5A33A 1NWQA 5JIUA 4JAAA 5IATA 3DYMA 3ZM8A 4QX3A 2W92A 2DVBA 1NE6A 3OW2O 3LOBA 4DB5A 5IT6A 1BCCD 4XAAA 4ARXA 4GWMA 2BUKA 1YQ3C 3LWCA 3A7QA 5IUQA 2IXCA 2KR2A 4R4XA 2VOWA 3F89A 3H1JE 5FYZA 2VRSA 5T3NA 2X29A 2FKWB 3Q8BA 3V6IA 1KILB 3OY8A 3VGIA 4H2AA 5FZCA 4MO3M 5K0UA 2P2KA 2WNUB 1AQ5A 2HWD2 4D6TG 4AHYA 3PMEA 3CCSP 4Z8BA 2IBZG 3J8F3 4H13D 4AEDA 2DU0A 4NHKA 1KILE 3S9OA 1PO22 1LT9A 3M3EA 2RM23 2C4XA 1ZA4A 3N7LA 2KXLA 2DURA 1CN1A 3MICA 5KLIC 1O4YA 3HD7B 2VZ1A 3NV2A 5E89A 3THPA 1AYN1 5BY5A 2EIBA 3K51A 3VMXA 5CFCC 3AK0A 3VKFC 2KA3A 1LP1B 4YW6A 3VBHB 5JZGC 1USEA 3FLTA 3AP5A 1GZWB 1FDIA 2ZXXA 1YHFA 2VNGA 3N7JA 2E43A 5EHDA 1BDCA 2BW8A 5DZEA 4BXFA 2Y0IA 2Q1KA 4Q4W2 2ZXQA 3AC0A 5JR7B 4A3ZA 2KOGA 3ZDSA 5C3SA 3GYDA 1E5IA 2Z4FA 4EWEA 2EIGA 2W8ZA 1E5SA 1M1JB 3LDKA 1UKGA 3Q5SA 3NVCA 2NPSA 4B1MA 4MXVA 3HT1A 1L0LD 4M3CB 1J58A 1PGOA 1S0GA 3BU0A 3VKOA 4ES8A 1UKRA 1QXPA 3H1JG 4YZ1A 1L0NE 3H1IJ 2QZ3A 2YXQB 2V5DA 5CKQA 1CESA 1PP9E 3H3LA 4KGGA 2I8DA 3BASA 3CX5E 1Q5OA 1MQTC 4AFMA 2NPIA 1NTZE 4YGEA 5I0DA 2D3SA 1XOYA 1UY1A 4CXYA 4PF1A 4E27A 1AR62 2P2UA 1JXNA 3KT7A 3W5MA 5FYMA 1VAVA 1QIQA 4AEKA 1ENXA 1JH5A 3S5AA 2UY8A 4K9SA 1SLAA 4YVWA 2D3RA 2FMDA 1VBD2 1TVGA 1C8M3 1ONAA 2ZAEB 3ZFFB 1JUHA 1ZXGA 1NLQA 1ZREA 3PU3A 5KKZB 2RDNA 2XHKA 4AZZA 1NKZB 1RH5B 1C4RA 4PJ0E 5FPXA 1RUF2 2OZJA 2R072 1KB9E 4NUBA 1S5LE 1RJ8A 1G86A 2YKPA 1G1IA 5E16A 1AXZA 1RE3C 4IGQA 2ILMA 2ZCWA 4OHWA 1JY2N 3CWBD 1LOEA 1BEV3 3IN9A 1ZBA2 1H2KA 5SV8A 2GP5A 3B3QE 3AE7C 2IX7C 5JCTA 3O7OA 1YQ6A 4CEYA 4BLIA 5J09A 5KLVE 5A6XA 4P14A 2E74C 2RS31 3HUSA 2ARXA 1QOSA 4OUMA 1MACA 3GJAA 4RR3A 1FOD1 3TEYA 4FP2A 2YV8A 2ZGLA 5GTIH 2RE9A 4BQ3A 3ZX7A 1W9YA 1I5ZA 5A3LA 4OMCA 2VZSA 1D7MA 1NTZG 4EYUA 1O8SA 4Q1RA 1Q7YQ 3OD0A 3RPQA 4OUEA 4XFCA 3NNMA 2R3CA 2VQAA 4AQRD 2W68A 4H55A 1NTME 3PVNA 2O8OA 2BTVC 2PGDA 1AX1A 1ZZ6A 2WT0A 1YWKA 1DFQA 3B02A 3CL3D 4GAZA 2IZ0A 3OPTA 2HWB3 3POFA 1UMIA 5KAIE 1EXIA 4IE6A 5C4WB 3RL0g 1WMXA 1OWAA 1SLTA 3VMYA 3KQRA 3WCSA 1OW8A 4CCOA 2R7EB 4NHMA 4AHWA 3PH0A 3RMYA 4FBFA 1KFXL 2YO3A 3V5BA 3U75A 2G4IA 4RS5C 1JMBA 4DY3A 2XOMA 4MUVA 4MGYE 2OYHB 3AECC 2ZJCA 3KHBA 5A7OA 3ZN5A 1UU4A 2JEEA 4XC9A 1BMV1 1IS4A 1URQD 4RKUJ 2W83C 5FP8A 1T3UA 3L72E 1VBB3 3AL5A 2BCCE 1R8EA 1UQXA 3SNMA 3AE8C 2WTYA 3NFQA 5CCGC 2XHNA 2A3YA 1GNYA 3U37A 4PBPA 1S5LX 1BE3D 3LW5J 3WW3A 2V09A 3MUZ1 1OVVA 3FWLA 2GN3A 4AI2A 1YIPA 3IIIA 1JZ5A 1QJU1 2VC9A 1D2QA 1TU3F 5FMBA 5D1IA 4DQAA 4JQTA 1QNWA 4I2LC 4BCUA 5L9BA 1NTMG 2KB7P 4I7ZB 3KV4A 1H8TA 1SBEA 1H30A 2Q1ZB 5AW9B 1DYPA 1RUH2 5BNNB 4L76A 3RI9A 1WCKA 4GH4A 4ITCA 3HE5A 5E88A 1UZYA 5GTHE 3AZXA 2P5BA 1SLBA 3A0HH 3ZXEA 4KG0A 1EUTA 3ZXGA 1GYKA 4Q4Y2 3ST7A 3MUDC 5FMCA 5FUPA 4UB6H 5A3WA 4S2DA 1YO8A 1PK6B 5DAQA 2I2SA 1DF0A 4UFJA 2PHLA 2CGPA 3PUAA 3KZIE 2XKMA 1QJY2 1NX9A 2V7QJ 2J7MA 1LGBA 1SQBE 1OUXA 5FZ1A 2IFRA 3I2IA 1P84I 1BLZA 3QLQA 1K5JA 4BK4A 2PHRA 2FFDC 1O59A 2BCCG 3UETA 4W7ZA 3MIWA 1QEXA 1OH3A 1JYTA 4CDUB 3RZGA 1FX5A 3P8CD 5A6ZA 3LB9A 1DQ4A 4L2NA 3HJRA 5I0SA 1YQ5A 2JG8A 1AR91 2WA4A 2AH2A 3TAYA 2ZGQA 5CAZA 1BSHA 1GICA 3TEXA 3HD8B 3I2HA 4CXXA 2ARCA 1YNAA 1ODNA 4MGZE 1YITP 2ZHLA 3C7FA 4AFAA 3K75B 1YFWA 4F83A 2OYIC 3TDKA 3KS7A 1VF5B 1PGW2 1X8YA 3DXTA 2BEZF 2L91A 4GWNA 4BDVB 4HSJA 3EYPA 4HLTA 1QXRA 3ZFGC 3GF3A 2W6BA 1UMZA 5FP9A 3WEZA 2A3XA 3C2UA 3N4MA 2HEWF 3S7EA 4RQPB 3WDVA 2JWDA 3B7MA 3ZXJA 1I6XA 4GIFA 5T5PA 2R1DA 2WFF2
chains in the Genus database with same CATH topology
5KBFA 2CK3H 1MS0A 2PTMA 1UPIA 1AR92 3HWJA 2K2SA 3NKTA 2EXKA 1DYKA 3DPRB 4Q0QA 3OF1A 4CEWB 5KHJA 4XBNA 3RWNA 4BIOA 4IEZA 4GMP1 3BODA 5K8SA 5KHGA 2SBAA 1ZM1A 1MZ5A 2DCYA 2VW1A 3MLLA 5CBLA 4UBHA 5DG2A 1EPWA 1VAMA 4YRDA 1JTZX 2OIIA 1MQTB 1BBT3 3VBRA 1BVVA 1X33A 2VW0A 3BTAA 3ELNA 4P9IA 1W6OA 1HRI2 4GXLA 5FQ0A 2F6BA 5C9AC 3NL1A 3VZOA 3ZYRA 1WW4A 2EF6A 1VBD1 1Z0HA 5L73A 3KB5A 4B29A 1F9KA 5F5QA 1CGPA 1H8TC 4MGKE 1PIV2 3WOGA 3E5XA 2ZGNA 4AHZA 1URXA 2JX9A 1NCQB 1HX6A 3CJIC 1VR3A 3B00A 4E2SA 5JIAA 4GH4C 4N53A 1H2MA 2EALA 1Z7S3 3DPRC 4CEWC 4HMZA 2WSSH 1SFYA 4JGZA 4D94A 4FPJA 1WLWA 2AREA 4OHYA 3E6BA 5JOXA 1PO11 5EV7A 3GNEA 4QT6A 1IHMA 3G7DA 4CDQA 1LHUA 2QCSB 1WW5A 1OKQA 5FPZA 2ZGMA 1PO13 3AYAA 3O5SA 4V1PA 1OPOA 4N43A 4AEMA 1GSLA 3K48A 5CU1A 1G6NA 4C1XA 4H3WA 2V7QH 4Y1VA 3U4XA 3V0AA 2WFPA 1ASJ3 4FPGA 4W6WA 4IEUA 1U5IA 2ZHNA 1FPN1 2JG8B 3LOIA 5BUVA 2PAKA 1B35C 1W39A 1IFPA 1DZRA 1BBT2 1BSNA 2BFUL 1NCQC 4BYYA 1VBE1 4YARA 2CYFA 1FPN3 2DVGA 5E1RA 4B4QA 1ZVFA 5K0UB 3KSCA 4YW1A 4EROA 2A6YA 1VBE3 2PHDA 1C8M1 5J7MA 2A6XA 3H0OA 4YVSA 4KQ7A 3O0XA 1WCSA 3AKTA 4QD2A 1AL0G 1HKDA 4W65A 2WNVC 3ES1A 1O3SA 1Q8QA 1UCXA 1RVF3 1OA2A 3H9AA 3WV6A 3MIGA 4PIZA 3SH4A 3CF6E 5KHHA 1RUE1 1YYNA 5HCAA 2E6VA 3RDIA 5CA6A 2B8MA 5T5LA 1GBGA 2PA7A 2CAUA 2VMGA 4HVRA 1CPNA 2JG9A 2OZ6A 2I74A 3B9CA 2JG8C 4FSJA 5H9PA 4HKOA 3AB0A 1HV1A 1Q43A 2R49A 2Z42A 1GKBA 1PO12 5GLTA 4CDXB 4Q4X3 3SLIA 1D0GA 4LTAA 4XETA 2QFEA 5FBZA 4DZGA 4XF4A 4PLMA 2YC0A 1W0OA 5GLVA 3W9AA 1BYHA 2DVFA 1KRIA 1XYNA 3J4UH 1JYCA 2MEV1 5LRRA 4B7EA 1NCRC 2UWBA 3ZSLA 3ZN6A 1MEC1 1N3OA 1WLTA 2NN8A 2QDRA 4HSLA 1FPN2 3HIFA 4HN1A 2MEV3 4NR1A 3I7DA 3FWEA 1XNCA 2A71A 1JUIA 4FPKA