4TLFA

Crystal structure of thiol dioxygenase from pseudomonas aeruginosa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
194
Chain Sequence
LRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cysteine Dioxygenase Homologue from Pseudomonas aeruginosa Is a 3-Mercaptopropionate Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
total genus 49
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4tlfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tlfA02
5FLHA 4HVOA 3S7EA 3PLQA 4QXKA 2HKXA 2XLFA 4MGZE 4EV0A 2Q0AA 1YFWA 2QVSB 3DV8A 4QX5A 5LEKA 1Y3TA 1IPKA 1QWRA 3SCFA 2V7QH 3ELNA 2PA7A 2Q30A 3ACLA 3E6BA 1FS0E 2D40A 1EYBA 4KL1A 2UYBA 2BGCA 2EA7A 3FX3A 1GQGA 4I01A 1VR3A 2WFPA 1CGPA 1L3JA 1AQTA 4HN1A 4JVAA 4IEWA 4JV4A 1O3SA 1CAVA 2BEOA 2OPKA 1Q5OA 3OCPA 1VP6A 1WA4A 3PNAA 4Q0VA 4ZU4A 2XKOA 1V70A 2Z69A 4WVZA 1CAUB 3KSCA 3RYPA 4HLTA 1FXZA 5JSPA 4F7ZA 4O9GA 5J7MA 3ES4A 4PIXA 4QMAA 4FAHA 1TQ5A 4Z82A 4E2QA 2QJVA 4I09A 2B9UA 5EFUA 3HT2A 5I8SA 4QGLA 5I8TA 1J3PA 1O4TA 1O3TA 1E79H 4HZFA 2VPVA 1ZZ9A 1H1IA 3BPZA 3WW1A 3I59A 4KWLA 3M70A 4XFFA 1FT9A 3SHRA 4XF4A 3KCCA 4Q0UA 4D7SA 1O3QA 2OA2A 4WZCA 2ET1A 5BV6A 1OI6A 1CAXA 4PIYA 5BXXA 1RTVA 2O8QA 3PJSK 3HIFA 1PMIA 1ZZ8A 1UIJA 4J1XA 4RD7A 2WC2A 3IDBB 2XHKA 5JSOA 1J3QA 4NVPA 5LRSA 4I2OA 2FMYA 1LB2A 5FPXA 2BYVE 3E5XA 4WBBA 4QM8A 4XF0A 5BUVA 4I02A 2XL9A 2XLAA 4B29A 5I8YA 3MZHA 3I59B 1X7NA 2HJIA 1XE8A 4R8HA 1YHFA 1OFNA 1U12A 1ZZBA 2PFWA 3ETQA 1ZRRA 2D5FA 1YFUA 4N9IA 1QXRA 3IDCB 4XFCA 4XFGA 4YSFA 1SFNA 3I54A 5FLIA 3B02A 1RGSA 3EO6A 3DL3A 2PYTA 3SCHA 4FBFA 2GH2A 3WW2A 2PQQA 3EQEA 4XFBA 1ZVFA 3KGZA 4YRDA 3JZVA 3OGJA 5FCCA 1G6NA 4LA2A 1I5ZA 4QM9A 3L2HA 1CAXB 4GULA 1J1LA 5KHIA 4XF3A 3RYKA 4META 4EWEA 3H7YA 3NW4A 3D0SA 2EAAA 2WSSH 1J58A 4MZUA 1YLLA 2Z2SB 1RC6A 4LA3A 5D1IA 1RL3A 3KGLA 3LA2A 4IETA 2EVXA 1RUNA 2ZCWA 3SCGA 4I3PA 1I6XA 5I91A 3U11A 2BNOA 2CV6A 4EWAA 4BH9A 4PIZA 3MYXA 1CX4A 4MGYE 3LOIA 4IEUA 4I0AA 5KBFA 1J3RA 4IEQA 4OFGA 3WW4A 3R6SA 5FQ0A 1EY2A 4MV2A 2GC0A 5F1RA 5T3NA 4KU8A 4HN0A 3H1YA 4IEYA 1SQ4A 1BSHA 2H6BA 2ATFA 1ZRCA 1UW8A 3H1MA 2PHDA 2GC1A 1DZRA 1Y9QA 2PAMA 5I93A 3OD0A 2XKPA 1CAWB 2PHLA 3UKTA 1LRHA 3LA3A 4JTOA 1UIKA 3MDPA 4XFHA 1NYWA 2UY8A 2ETEA 4A2UA 4YNIA 1ZNPA 2IXCA 3E5QA 1DGWA 4KU7A 4AVCA 5J3UA 1OMIA 2I45A 5C6CA 1FI2A 3RYRA 5JR7B 1ZZCA 3C3VA 3FFQA 5EZWA 1XRUA 4HMZA 3E6CC 2E9QA 4H7LA 1O3RA 3CL1A 4MUVA 1EP0A 4DINB 3USSA 3LA7A 4ONUA 1LR5A 2Q4SA 4IERA 1H1MA 4XF9A 2CGPA 3PVBB 3MPBA 4J1WA 3FJSA 3UKNA 1J59A 4AQ6A 4HVRA 3ROUA 2IXLA 2V09A 4E2SA 4I0BA 4N9HA 1BSNA 1UD1A 2MNGA 1O7FA 5E1RA 1NZCA 2PTMA 2JDIH 4IEOA 5LRRA 3FE5A 5CADA 5BPXA 5LEJA 4XFIA 2B8MA 2CK3H 1X8MA 2GU9A 3D82A 3DKWA 3E5UA 3E97A 3HT1A 2GZWA 4LEJA 3U10A 4KWKA 4DJGA 3RZZA 4UXAA 3ZDSA 3NJZA 1YFYA 1NXMA 3D0JA 2D5HA 3H1WA 4P9GA 3CJXA 1DZTA 1LKNA 4ZU5A 3IWZA 1JEKA 1X8EA 1YWKA 5AVPA 5BY5A 2MPFA 3GBFA 4JTNA 4QGMA 4XETA 4MH0E 4Q0QA 3H50A 2ET7A 4K8FA 2E5YA 4MX3A 1Q3EA 3EHKA 3RPQA 3E6DA 3EJKA 3H8UA 2KXLA 4AVAA 4OLLA 2H6CA 3SMHA 4IEVA 3LAGA 1GQHA 1ZX5A 4LUMA 3BB6A 2VECA 4PJYA 3NVCA 1HW5A 5HI0A 4UBHA 4AVBA 1Q43A 3FWEA 3OTFA 4LULA 4YXWH 2XLGA 4L11A 3S0MA 2W6JH 2IXJA 2GC3A 1NE6A 2QDRA 4X6RB 2B5HA 5C8WA 2QNKA 2Q1ZB 5I0TA 3CEWA 1VJ2A 2D93A 2Y0OA 5FQ0B 3IBMA 2OYZA 5FDBA 3RNSA 4TLFA 1YFXA 4HSLA 4BYYA 1YUDA 5CVRA 5E16A 1IPJA 2VQAA 5I0UA 4EWDA 3FHIB 3S7IA 4XFAA 2IC1A 4Z07A 5FPZA 1OD5A 3CF6E 3NSTA 3CO2A 3RDIA 5KHHA 1JUHA 1CAUA 4FAGA 1RUOA 1WGPA 4L2NA 3WW3A 2C0ZA 3H3ZA 4EROA 4IEXA 4F8AA 4BHPA 3OF1A 1QY4A 3FZ3A 4ORFA 3N4MA 1O5LA 3EFFK 2CAVA 1NE4A 4CYDA 2UY9A 3QACA 1WLTA 4FT8A 3VHRA 3IIAA 3U0ZA 2XL7A 3I7DA 3NKTA 2XNDH 2K0GA 3H7JA 4O9EA 1CAWA 3KMHA 2N7GA 4YARA 3BALA 3TNPB 2OZJA 2PAEA 4MGIE 2IXIA 5FLJA 4LLOA 1XE7A 2GC2A 2QE7H 3HQXA 5I0RA 4E2GA 3QOPA 2FQPA 3UKVA 3M3IA 2DCTA 5JCTA 5J48A 5KHKA 4HVQA 1SEFA 3H3UA 5K8SA 3GYDA 3SXWA 2OZ6A 3BU7A 5JAXA 2H0VA 4Q29A 2BNMA 4AQ2A 4IESA 1ZREA 2ZKLA 4AXOA 5KHJA 5I0SA 1UCXA 5JSRA 4Q0PA 3ES1A 4HBNA 4X6QB 4IEPA 3ST7A 1EPZA 4LUKA 4UBGA 2QCSB 1ZRDA 4ZU7A 2PAKA 2UYAA 2F4PA 2MHFA 1ZRFA 4BIFA 4R52A 3DN7A 4XF1A 2IXHA 2P17A 1CAVB 1X82A 2CAUA 3EBRA 3TNQA 1ZZ7A 4XEZA 2XGXA 3H9AA 3LZZA 5CU1A 4QGNA 1O5UA 4IEZA 1QXJA 3LWCA 1UPIA 4D7TA 1IFPA 2K9ZA 1DGRA 2O1QA 4MGKE 4LTAA 3O14A 4YYOA 5KHGA 4KWJA 4HSJA 2IXKA 4Q0SA 1ZZ6A 3G7DA 3BCWA 2GAUA 3CLPA 3NL1A 2E5TA 1PM7A 2BNNA
chains in the Genus database with same CATH superfamily
2A70A 1NOVA 4WVWA 3VHOA 1GMJA 5KC5A 2FDHA 5FZGA 1SQXK 1NCQB 4YZ1A 1Q56A 1E57A 1X22A 1SMVA 1YJKA 5FZ7A 2VCCA 3HOBA 3KV5A 5CIRA 1LGHB 4RSUA 2HKXA 3T2OA 5LA0A 2K9JA 4MGZE 5DAVA 4TT3H 4XHBA 2Q0AA 1QOSA 2B45X 1SP4A 1PVC2 1KS5A 3AYEA 3I2JA 4YW4A 4Y99B 2BWCA 4PIZA 1Y3TA 2WT0A 4G3YC 2HODB 4LT5A 1PO21 1QIQA 1Q86Q 2HPCA 1GP5A 2CHHA 1R1A1 3SITA 3N7NA 4A44A 4CCOA 3IPVA 1PNFA 4MVTA 3CXHI 1AR62 2W6BA 3NRUA 5A3LA 1PVC1 3HAGA 2O1KA 2PA7A 3B9IA 1GLHA 4PV1B 2R3SA 3E6BA 3ATGA 1H9PA 3WCRA 5FO7B 5C9AA 2BGCA 1QJX2 2KSJA 2W39A 2WAOA 2ZPXA 5K0UA 3USUA 1PGW2 4I30A 5B4NA 2VGDA 3FX3A 1GQGA 2JXAA 2ERFA 5ABJA 2WWWA 4XUQA 2WFPA 1SQVJ 5KXEA 1XTCC 1VAVA 1ZN5A 1AQTA 1XNTA 3MI8A 4UW6A 4Y1XA 3NV4A 4JVAA 5F2WA 3W9AA 1MS3A 1JY3P 4YG0A 2PHWA 5F39A 3SLIA 2BEOA 4HONA 1OH4A 1RXGA 1O3SA 4NIDA 1F8VA 4XC9A 1WA4A 4FI9A 3U4XA 2A1XA 4CDWC 1VQ6P 3JCUH 2DCKA 2WBKA 4NRQA 2UWJE 1HQNA 4OULA 1S5LH 2VOVA 1WCSA 5KAFH 2QJKC 3LSDA 1KS4A 4JQRA 4OUMA 4CCKA 1SQXD 1FXZA 3EXUA 4DY3A 3S5AA 1COV1 1B35B 3OGSA 2E31A 1Q8SA 1AXKA 5AW5B 4K35A 3WCSA 1GICA 4A45A 2QRXA 2WSFH 1AR63 1TU3F 4PIXA 1KC8Q 2L9LA 2XWJB 4R9DA 4DUVA 1SCRA 2QJVA 1S5LX 2B9UA 3N7KA 4OQ8A 2B39A 5DUWA 1JZ6A 1JTHA 5HCHA 1QJX3 4GWNA 4K20A 1FMD2 3POWA 4GH4C 1RUI3 2WPSA 3U1CA 1BE3D 1SLBA 3N9MA 1VBC2 3A23A 5DN2A 3VZKA 3POIA 3WQ7A 3DUIA 2NYYA 4HZFA 2XJPA 3JD72 4AUWA 1J83A 2RVAA 3AZZA 2FKWB 1W90A 2WSVA 4LHSA 4QXHA 3T2TA 3WW1A 3O0WA 4AAPA 5JXGA 3M70A 2ENRA 4XFFA 5EYYA 5FOBB 1JXNA 4XURA 1FT9A 4XBQA 1PGOA 2P6CA 1W6NB 4JGYC 4NN0A 5GLWA 3KCCA 1GR3A 4Q0UA 1O3QA 2WZ8A 2JE9A 2V4AA 4Y1ZA 4WM8B 5I0DA 3RWKX 1RXFA 3T30A 3ZFEA 1KQRA 1DQ5A 4DUXA 2BBVA 2IX7C 1CAXA 4DXRA 3OUIA 3PTRB 4WM7B 2D6KA 1V6IA 1AYM2 2PXJA 1NA1B 1XSRA 5A7PA 2XJQA 3IKWA 5LCWL 5DUXA 5C9AB 1HX6A 3JSVC 2JJ6A 2HWF3 3ME2A 3RMXA 4YM1A 2W3JA 3P32A 3AFGA 5A3TA 4C7NB 1UMZA 3CZJA 4YW5A 4TXWA 4RD7A 1EDLA 2P10A 1HUCA 3NL1A 4PDWB 1WCDJ 1MEC2 5L36A 2VRSA 3THPA 3B5LB 5FMBA 5FZEA 2XHKA 1SQXJ 5AW8B 3NQHA 1OSGA 3BU0A 2QDNA 3C8XA 1J3QA 1X9VA 3LPFA 4NPFX 3POGA 1M1KQ 1PGQA 3MTUE 2FMYA 1JZ4A 1KQGB 2NQYA 1QMJA 1EDIA 3L72J 4JHTA 4EN6B 2LUWA 2WUHA 2BYVE 4YW1A 2A45I 3E5XA 1J1EB 1JM0A 4H13D 2G3AA 2CL2A 1LWUB 2VMEA 3RZHA 3C7HA 4QM8A 4WBBA 1G9FA 2VQTA 3LEGA 4FVVA 4XF0A 5FZDA 4DOUA 1KFMA 4YVWA 1EXIA 3B00A 5H2FE 5J36A 1NTKJ 2PP6A 3L75D 2Z79A 3I59B 4NE9A 2ORXA 4FP3A 2EALA 4QQOA 4BZ4A 1C5IA 2ZAAA 1IS3A 4Q1PA 1FPN3 1YHFA 4ATFA 1PZ9A 3AP4A 1ZZBA 2BCCD 1UQXA 4Q2FA 2FXMA 1MZFA 3PMEA 5CFCB 1ND3C 1YFUA 1ZBE3 4N9IA 1K5MB 3WF4A 3A0BE 3IDCB 4XFGA 1HH0A 1HB1A 4AEMA 1SFCA 2X10A 3I54A 4RL7A 5FLIA 1RJ8A 3B02A 2XUMA 4TSVA 4Y1UA 5FZOA 2WN2A 2PYTA 2ZZQA 3IPVB 2EXKA 2GH2A 2FBEA 3WW2A 4P9IA 2FYUG 2VW2A 5AVQB 4IV1B 1KGYA 3UYJA 1AFOA 1ZVFA 2W46A 4DT0A 1WZXA 2FDKA 2V5DA 4MHUA 5F3IA 2VBPA 2J22A 1MV8A 1JHNA 2VZOA 1HXS1 4QM9A 2IFWA 3B01A 3L2HA 4YFZA 3AP6A 1CZSA 3FN9A 1J1LA 4H3WA 5L7OB 4AOCA 5C4WB 3RI9A 5KHIA 2M8RA 2P5BA 3PRJA 1WLDA 3I49A 5APQA 3RYKA 3CMEP 3ZN6B 1GZWA 3H7YA 3MLLA 3ZXLA 3V0AA 2VE1A 4OI0A 3T1LA 3BCCE 2M0BA 2WSSH 4PD4I 1BEV1 1RVF2 1MS5A 2YNYA 1IC2A 4C7RA 2F6BA 2GH8A 3AMHA 4FP2A 1OFSA 4N8MA 4Q4X1 1VLNA 1HWTC 2NLRA 2UU8A 5LB6A 1RUD1 3T97B 1M7LA 5IWFA 5JVVA 3WP3A 1L0NE 1QQP2 3NAPC 3JCUE 3CCSP 1BLZA 2VZSA 3KGLA 4AHWA 3ZXAC 1LT9A 3L75J 3WUVA 3TF5A 2W94A 4YG3A 4S2DA 1H89A 4AG4A 4E4HA 1W6OB 1EAH1 2I8DA 1AL21 1MZ5A 4U3FE 1SFCB 5AW2B 4W80A 2AEMA 2BVVA 2UWAA 1S0DA 5L9RA 3K51A 4HB1A 5LBCA 3UETA 4EWAA 4Y3OA 2I07B 1HV1A 4M0NA 3AKPA 1GANA 1SLCA 3LIHA 4BH9A 1CX4A 1JZ2A 4OGQD 4MG2A 1NTZD 1SQVG 1JODA 5GALA 2N1TA 1DQ2A 4XFJA 5KBFA 2GM4A 2HBUA 1WT6A 1JY3N 3PUAA 3RFRA 5J09A 1M4WA 3WW4A 1BJQA 2RR11 2ZMLA 3R6SA 3TN91 4R9BA 5CA6A 1XE0A 3V56A 3H1JJ 3CCJP 4TYSA 3HMYA 2CPBA 4L92A 4HN0A 2HFED 4AI2A 4EN9B 3QD6A 2KIKA 2W83C 3HE5A 1GU3A 3HD7C 3I2OA 3VBFB 1M1JC 1UW8A 4GQ7A 3RVHA 2WT1A 3WT3A 1R8EA 4XMIA 2IUWA 1KB9H 1OXCA 5FJKA 2D3PA 3SH5A 5ERLA 4P08A 1ZXGA 1DZRA 1NTMK 1XB9A 3UGGA 4CU7A 5BNQA 2XV5A 5BNNA 1HQWA 3CL3D 2OTJP 1GZCA 1UO9A 2XKPA 1CAWB 4QPGA 3SC7X 1W6NA 2DBNA 3V65A 3TSIA 5B4XA 4MYEA 1XTGB 3GHGC 1IHMA 1HN0A 3VMZA 4FPYA 4JTOA 1ND2C 1AJYA 3KT7A 3AYAA 3VBHC 4HKLA 4DZGA 1GDTA 4ASMB 4LMFA 2WPRA 1NAYA 4B8EA 3O1MA 1PGJA 1VRBA 3HQRA 4GJZA 4YNIA 3ITQA 3HN1A 1S0IA 2ZYGA 2XUEA 2I2SA 2JENA 3VP8A 1W03A 3ENRA 4FPEA 4KU7A 4N43B 5DDJ1 4AVCA 5CCGA 3GALA 5LWBA 1ZR4A 4L8QA 2W2IA 1QJY1 1KDKA 2OYIB 1NHLA 3BTZA 3WDYA 1A6CA 5DUVA 2K9YA 4NPLA 5FZOB 4D6TE 1N8RQ 1FPN1 1W8HA 1ZA7A 3FFQA 4YZ3A 2GA1A 1UKGA 4BB3A 5F37A 1W2NA 4I0WB 2E9QA 5A70A 3UK9A 4FOQA 1DG6A 3WF0A 1YBKA 1L4AD 4HJGH 1SHWB 2X09A 4LKSA 3ZR6A 4D94A 2Y9YA 4H7LA 3MHVA 3AKRA 5FPLA 5FKCA 4QX1A 1SFPA 4LHLA 4MUVA 4ZONA 4I6MC 2F4LA 1U57A 4LBQA 4BK4A 3MW2A 3KZIH 4DINB 5HCBA 1JO5A 1V00A 2ZYDA 5CHXA 5FK7A 1UU5A 4JPZB 5FZ1A 3AL5A 4BDVB 3V4QA 2OYHA 4LITA 3VKMA 1BGYE 5JWPA 3W20A 3J26N 2ZTNA 4IERA 1H1MA 2EIGA 3Q8AA 4RYDA 3BVHA 2A45H 4QDRA 3RSJA 4NPMA 1CONA 3PVBB 4AL9A 4J1WA 3T0DA 1RUF1 2CGPA 5LA2A 2ARCA 5L9BA 3UKNA 5DAXA 5JDBA 1RUJ1 1GOFA 3INAA 1VF5B 5FZ4A 2EIDA 3V64A 1G9AA 3EWKA 4WY4A 2Y9ZA 1BE3J 3POEA 2CPSA 2NN8A 4KGQA 2YHJA 2V09A 4PDWA 5IHRA 4N9HA 2XNXA 2QQOA 1QU0A 1BSNA 1MUUA 1WKYA 1N7SC 2MNGA 5FZ9A 1TMF1 2Y64A 4QB1A 3P5BA 4PT6A 3ILNA 5AVSB 1LTEA 3U4SA 4COVA 4QKDA 2KK7A 4HK8A 1GYKA 1DHKB 2E32A 1LT1A 2JDMA 4CXXA 5LEJA 1SLIA 2YBSA 4QPGC 3UJQA 1SDDB 1X8MA 3D82A 1VQ8P 3AMPA 2Y0CA 2XJSA 3E5UA 4FO9A 3KQ4B 2OARA 4H44D 3SKVA 3UGFA 3VLBB 1G9CA 4JKKA 3RK2D 3TGUJ 4DJGA 2OUHA 2RM21 3WF3A 3BI3A 2AUYA 3MW4A 1UXXX 2RKLA 2EAKA 2YB7A 3AKQA 3NJZA 2IWGB 1K42A 3ZFGA 1QLED 3PH0A 5J98B 1W6PB 4JGYA 3AM2A 5T5PA 2DU0A 1Q2NA 3CNAA 2IBZI 2RM22 3CJXA 2C4XA 4PF1A 4IFFA 1DZTA 1G86A 2JECA 4K21A 4XABA 2A3WA 3IWZA 1JMBA 1PIXA 2N1TB 4PJ0E 5BVZA 2K46A 3HBKA 4WM8C 5C3QA 1YWKA 5C7GA 1MS4A 4IDZA 4L99A 1URQD 5G04L 2Y6GA 1SQQK 3GBFA 3TWIA 1NA1C 1OPMA 4DS0A 4QHZA 3QH6A 1CJPA 3HRNA 3H50A 2ET7A 1XBFA 5FPUA 1CX1A 1OOPA 1H9WA 4DIQA 3AYDA 2G8YA 2P3KA 4AE2A 2YU2A 4WBAA 1Q3EA 2VR4A 2HWC2 3EHKA 4L76A 3OPZA 4QPIC 4PDWC 5A7SA 1RHZB 3CX5H 2AXTE 2FDGA 5KKZB 1W2TA 4CP9A 2D2CB 1XOYA 1ZM1A 2IZ1A 4IEVA 2C9LY 4FPGA 4N78D 2R32A 3BASA 1RUH2 1UF2C 3CWBG 1K5JA 3L75E 3RBXA 1J1DB 2V4VA 2ZEWA 3LDRA 1VAKA 4DXSA 4AVBA 4WVVA 3K3NA 4CTEA 2VG9A 4X8NA 2RMU1 2WYSA 1LAJA 2AREA 3PL0A 4CXYA 3AE5C 1A02F 2C1FA 1LWUC 3VBHA 2A6VA 2XU6A 3RJ2X 1BK0A 1O6UA 3VL9A 4QDQA 1YTZI 2YFUA 5AVYB 3WG1A 3S0MA 3DXUA 3RL0C 5T5OA 1PGL1 1NE6A 2O8OA 1FZGA 3VKNA 4G9SB 1ACCA 3JBG2 3B9CA 2WSEH 3T2PA 4C1XA 1KFNA 2YMYA 2J7MA 3GXUA 2OS2A 3PUSA 5FPVA 3WXPA 3FXEA 3M1HA 3KT1A 3HD7A 5GTHH 3WHUA 1YFXA 1TME2 1N3OA 2A3YA 1YUDA 2BZDA 4XBNA 3NFQA 5E16A 4ZXKA 5CMZA 2VQAA 1K9MQ 1D7MA 1LOFA 2WRAA 4AFDA 3WUTA 3POJA 3WQBA 1YO8A 5FZ8A 1AA0A 4XFAA 1S0JA 2IC1A 4FFFA 3ZOIA 2RDSA 5A1FA 2D6PA 2YBKA 4LBNA 1B09A 1JUHA 1MVQA 1CZTA 1RUOA 1SZBA 2YU1A 1AR72 1GWLA 1H6YA 2C0ZA 1AX2A 3MUDC 3CBNA 3H3ZA 4IEXA 4B4PA 1AR71 4BHPA 3OF1A 5L7OC 1CWPA 2CYFA 5FO9B 1BGYD 3AE6C 5C4WC 2P1JA 3PTYA 4OMDA 2NM1A 2A06E 2RS11 3J9SA 1KILC 4EDFA 1S9KD 1C28A 4XBLA 2WSFJ 3VDDB 1JU3A 3ZSMA 2RMZA 5APSA 1NE4A 3MUZ1 4DZOA 1JZ8A 1GOGA 1H2KA 2R0FA 4IL6H 1NO4A 1Y9BA 2JEEA 3QACA 4FT8A 4E4ZA 1OOPC 1QGKB 1NXD1 4AF9A 2XWBB 4DEQA 4RO0A 4U3FD 3WUUA 1UWWA 1XNAA 3NKTA 5TISE 2AGSA 1GFF2 1LU2A 2K0GA 3KD4A 3NWKA 3RRDA 3WNLA 2KP8A 3IF4A 1UZZA 4JQ0D 5L8RJ 2E42A 1TME3 2C9AA 2VU9A 2I1JA 3GGLA 3K77A 5CNAA 3ZXDA 5BU8B 1RF1B 3TNPB 4Q4X3 2IXIA 3C9IA 2JG9A 1JOJA 2QKDA 4XAEA 4Q4W1 3O1RA 2FD8A 2GC2A 3C7EA 3PMSA 3CXHE 2QQLA 1NH4A 3ZFFC 1UOJA 5JXHA 4E2GA 2AXTH 1S0FA 2OYHC 2Q5UA 4GT1A 1QXPA 1SACA 1GNZA 3KXDA 4MGQA 2N9YB 1YI9A 2YC2A 1AR73 3CMAP 4C0HA 1Q82Q 5CFDB 1HGZA 3V0BB 2JG8B 5CCHA 4IGQA 2VW0A 1PZQA 3H3UA 1BZWA 3RK2C 1H0BA 2XJTA 1RHI3 2VCBA 3N4XA 5FIXA 4XOGA 3VBSB 1MPXA 1AYM3 2XVKA 4UB8H 1FAVA 3NMDA 1OZHA 1PK6B 2HWB3 5KLVE 3C7FA 1AQ5A 1H8TA 1RF0C 4PJ0H 3GYDA 2OZ6A 4QT6A 5FZ3A 1SQXE 2HWF2 5FYCA 3T08A 3FWLA 2J1TA 3A7OA 5DDJ3 3CCLP 1ULFA 4CCDA 3O8ZA 3JXSA 4IGOA 1IS6A 2H7HA 1UAIA 2EXIA 2H88C 5FZLA 5LZ6A 1MACA 4S2HA 2P4EA 1UCXA 1XNDA 2FYUK 1ST8A 2RS31 4S2GA 2Q8EA 5FREA 1NTMD 3MFAA 2ES3A 2UURA 1YIFA 3AZVA 2BP6A 1N1SA 4IQPA 1DIPA 1EPZA 4NUBA 4UBGA 3ST7A 5ABJC 5GZCA 2V72A 2Z5WA 2LR2A 2YIUB 3T2QA 1NLSA 4AFBA 2HWE1 5AVVB 2UYAA 3APBA 2RS33 3POYA 2ZGQA 3L9JT 4R52A 5FRAA 3DN7A 4XZPA 1ZOYC 1T3UA 2IXHA 5BNPB 1GZLA 2DCZA 4COYA 1YYCA 4K1YA 3KF5A 1CAVB 3VBOC 1FNZA 3EBRA 5CCGC 1HBWA 4N43C 1LNQA 2YO3A 1RUG1 4BXLA 2AZ5A 5DJTB 3B7MA 1FX5A 5KXDA 2FYNB 3AE2C 3H9AA 3LZZA 2C9NY 3GM8A 1PP9D 1QXJA 2JG8A 4ZNCA 2BCCJ 1V6OA 1ZBE2 4LBJA 5A3UA 3C2UA 3A0HE 2HODA 1LTAC 2JICA 1NA1A 2EIBA 3RQ0A 4BPZA 4D7TA 5A33A 1U5IA 2WAAA 3VBRA 1JYIA 1URQB 3F2ZA 2A5ZA 4XTPA 2K3RA 2R3CA 5AW0B 1S0EA 2LALA 2VQ0A 3H32A 1ENXA 3K4ZA 1ND3A 4KWJA 5E89A 2JB8A 2WSCJ 3AEBC 2NRGA 1S4CA 1W6MB 2QQIA 3NO8A 1OXZA 4CDUA 4PBOA 3M0AA 1F31A 1Z56A 1AX0A 2E5TA 3J8F1 3KVAA 5DPNA 2Q7CA 2P3JA 1QJEA 1UY1A 3HUSB 4HVOA 5F6LB 1NZIA 2XKMA 4HPKA 1KYOI 1NTKD 4R4MA 1J84A 3N9LA 2VZRA 3DCQA 1RUF2 1RYYA 3PLQA 4QXKA 1DEEG 3UV9A 4OZXA 1JB0J 1SQPJ 4GB32 5GZFA 4OGQC 4ZZ8A 1JW6A 1DGWX 1OKOA 2BWAA 4OYUA 2F17A 4AW7A 4CU9A 4JAAA 3ZYJB 1VBB1 4AI8A 2WO7A 2B89A 3HD7D 1XNKA 3A7QA 5H9PA 4OI1A 3MO4A 4GH4A 4XDPA 4QX7A 1L4AA 1QJU3 1RUI1 2V7QH 5F5IA 1N73A 3KDPB 4BQ3A 3AEGC 1PZ8A 3ACLA 4JDOA 1FS0E 2BEQD 1MEC1 2W52A 4BXFA 1JY2N 4KL1A 1N7SB 1GU4A 1EDKA 2JKBA 2UYBA 2KS1A 3VBRC 2RMU2 2HWE3 1MR5A 1OPOA 4CDQC 4BM8A 4BXSV 4N53C 1OFCX 4N7UA 4AQSA 4MXWB 2WYFA 2IDBA 3U1XA 2GUVA 1YIPA 2DF7A 1CGPA 4DXTA 1RQUA 3NJVA 2XBO1 1Z0HA 5H2FH 3OB8A 4IEWA 3T0BA 2ILMA 1X9PA 3C8VA 2YMZA 1SBEA 1ZA4A 4IXLA 4PI0A 2HWC1 1RUJ3 3ZFFA 3KV9A 5D8AA 3KWVA 1VP6A 4YW7A 4KH9A 3CX5I 5SV8A 1D7PM 2ZEZA 1G9DA 1AXZA 1W9TA 5F3EA 1BDDA 3AE9C 3ZIWA 1XYNA 3LQCA 1K5MA 2WDBA 2W6AA 5L7OA 3TGUE 4XDOA 3HN3A 4NRPA 4F7ZA 5JSPA 1OVRA 3MGNA 2VL4A 1USDA 1RINA 2XONA 3WNOA 3BIEA 3ES4A 1TG7A 1JU4A 3BODA 3CZUA 2A3XA 3OBTA 1L0NJ 3RL0g 2YXSA 2BOIA 4FAHA 1TQ5A 4IV1A 1KTMA 3LW5H 3VD4A 5AW1B 4I09A 5EFUA 2R063 4XQ4A 3HT2A 3L74J 3TB0A 1LOEA 4QGLA 3O0XA 4HKWA 4NMIA 2W91A 2M3EA 2A6YA 2HWE2 1J2JB 1J3PA 2ZGKA 1ASJ3 3F95A 1O4TA 3ZFGC 1O3TA 3VBFA 1CI6B 3V5BA 1W6QA 3I2IA 4P9JA 5G05L 1ZZ9A 2BERA 2Y6KA 2Y0DA 3H1KE 3POBA 3BRVB 3GBGA 3A0NA 1XQNA 4HKOA 3AE8C 2E33A 4Y22B 3WSOA 5F3CA 5KJ7D 3R4UA 4UW4A 4IUGA 5F9TA 4W50A 4K1ZA 5LBEA 4GZ9A 4ET7A 4PQQA 2R5DA 1RE3C 3AMNA 5IVJA 1NX9A 4M3CB 2ET1A 3RZLA 1OI6A 3RK3D 5CJ4A 2HEYF 4EN8B 4Y5SA 1NCRB 5BXXA 2W5FA 1RTVA 1V9U3 3BVCA 5JR2A 3PJSK 4MGTA 1JOPA 2R043 3N7LA 1PP9J 3KZIE 3BIWE 4I7ZC 2QQKA 5A7WA 4YM0A 3VZJA 2BJSA 3H1HE 2FDJA 4QB6A 4IV3C 4D6SA 4N3YB 1ZRTE 4CDQA 1L4AB 1FZCC 4FOWA 2K37A 4RQPC 5F6KA 4AI1A 1GP6A 3DPRA 3WV6A 1LCLA 3WNNA 1L7QA 1NTMG 2VUDA 1M56D 1ASJ2 2HLEA 4A7PA 1WD4A 4C1WA 1LTJB 1LULA 5F7UA 2JWAA 3L37A 4JBZA 3CC4P 1XU1A 3ZYRA 5FPXA 5KR7A 3H8OA 5CKQA 1SQXG 5H9RA 5A1AA 5CISA 3U07A 3HE4A 3L70G 4WM7A 1C3HA 5BUVA 2XJVA 1PX3A 2YGLA 1WWYA 2YUEA 2XLAA 4B29A 3FWNA 3AECC 3HUSA 2XPJA 4OI4A 3L72G 4Y99C 2WZR3 3CCEP 1Q8QA 3VKFC 3BATA 1HXS2 4P5YA 2YXRB 1QDCA 1X7NA 2HJIA 2B9VA 1UL9A 1G8WA 3KM5A 1U12A 1S55A 4IFDK 1IQDC 2PFWA 3ETQA 2WFF3 5GZDA 4OZOA 4HXCA 4A3ZA 1W2OA 1QXRA 1GP4A 1Q8VA 2P2UA 2XMLA 1SFNA 4BRYB 1W3VA 2R042 2WR9A 4XPVA 1AUYA 5FYHA 4PLNA 4QX2A 4XDQA 2WSEJ 1IFJA 2WITA 1DF0A 2VM9A 1TVGA 2HYXA 1OT5A 2VCMA 3EO6A 3MIGA 2FCTA 5KWRA 3L35A 1W0NA 4FFGA 3CC2P 4AGVA 4B86A 4K8RB 3MUDA 3K4DA 2R071 4NPRA 2ZAEB 3A0HH 1P84D 1E5IA 3J4UH 4NR1A 2WQZC 2DCJA 4XFBA 4ZS3A 5A3OA 2IBZD 3L71E 3KGZA 2C9KA 1L0LE 2Q8OA 4CP0A 3L74G 3RK3E 4R4ZA 3OGJA 5T50A 4YM3A 5APAA 1S4XA 1AHSA 2BQPA 1UXZA 3D8CA 4Y5Z0 1RUC1 3FHQA 1OA2A 4CCJA 2KZIA 1H0TB 5M0TA 2Q8CA 2DWRA 3VBOA 2M5AA 1KYOH 2QJKB 5J1XA 1DEBA 3CCQP 3V2NA 1OQ1A 1UX6A 2ZKNA 4S2FA 4META 4XF3A 4XXPA 1PVC3 1NGMB 1ZRTD 4Q5OA 5CFDC 1M1JA 3NW4A 1HXS3 2P6HA 2ZMKA 3JBG1 2JG8C 1CVNA 1YIJP 1E5SA 1KD7A 1Q8PA 1GQPA 1U5ZA 2VCAA 1J58A 3L36A 1FOD2 4L75A 1DYOA 2R7EB 3AZWA 3THCA 2P58A 1NU1J 2GN3A 3I2DA 5EIYB 2Z2SB 1RC6A 2B46X 1MZ9A 1UPSA 5IK8A 3RS6A 1V6JA 4FPKA 1BBT2 2NPSA 1JMUB 1LEMA 1GZTA 1UZVA 2J1VA 2ZA9A 4RQPA 4Y26A 3IMNA 1HRV1 5AVZB 1BKZA 1OF4A 2GP3A 4CUCA 3GHNA 4IETA 3HE5B 3KT4A 5IJRA 1GKBA 1NQDA 1DIWA 2ZCWA 3J7MA 1Y47A 4Q1RA 3U14A 4D6RA 4I3PA 5GZGA 4ZHNA 5FTTC 1RUH1 3D6ZA 3R05A 5K9YA 1DX7A 1ND2A 4EI2A 3TNUB 1DLCA 2BNOA 2ZACA 2ZX4A 3QBQA 1L2PA 4AQRD 4D8MA 3N9PA 3B5ND 1NY71 2HWD2 5ABJB 3MYXA 4MGYE 4A7KA 2GNMA 1SPPB 4I1LA 2W9XA 2Q1MA 2W87A 4I0AA 4URTA 1DQ6A 2E74B 4Z2WA 1RUD2 3OGRA 4JCKA 2G1MA 4R9AA 2QG4A 3AEAC 2XHNA 3K2OA 1YYNA 2E26A 2V73A 3OW2O 4LE4A 4OFGA 5FY9A 2Y38A 4O9BA 4KMQA 1SBFA 4UF0A 3F5HA 3W58A 3AZXA 4DRRA 4K3AA 1RVF1 1FOD3 1WLWA 2GC0A 4LO7A 3L73E 1D0HA 1ALYA 1VBB3 1W04A 1UYYA 2IVJA 3LEIA 4LBQB 3I55P 2ZXQA 4LOSA 3L70E 1W05A 2AEZA 1SQ4A 2RV9A 4YLZA 2JDYA 4WVMA 4MGSA 5LASA 2UWCA 1Y9MA 4AK3A 4BU2A 3H1MA 5BNOC 2PHDA 4IL6X 1GK6A 3MIWA 1R1ZA 1FMD3 2PLV2 1GL2B 3CCUP 1VE0A 3FXDA 2D6LX 2ZGOA 2JIJA 1Y9QA 3HVDA 2Q5TA 1HJFA 1VBC3 2WZ7A 4XJAA 4CRQA 1JCDA 2LM3A 3OD0A 5I93A 3PVNA 1P84H 1H88A 1G2CB 3L73G 3N7MA 5CZKA 1LRHA 5BNNB 1CIWA 1QDOA 3I3QA 2P34A 4XFHA 1N86A 1EAH3 3N9QA 4IE6A 2UY8A 2ETEA 3JB4C 4A2UA 4D6TD 2NZ2A 1RE3A 3TEXA 4BJ0A 3U1AA 1N1VA 4JKLA 1ZNPA 2DW3A 2IXCA 3JB8A 4JDMA 4MLOA 5FY8A 1WLCA 2JE8A 3O1OA 3P8CD 4HH2A 3M0DC 1RUD3 3AXEA 3D6EA 3VL8A 4A4AA 5CFCC 1JOBA 5TISH 1ZP0C 4OGQB 3EMRA 4XQDA 3ACFA 5FR3A 1SBDA 1CZVA 3H1KD 3ILFA 5JOZA 2ZT9C 1ZZCA 2Y60A 2CDPA 5AC93 4HMZA 2VZPA 3GNEA 5HXVA 3E6CC 3MF9A 5LBFA 3ZMOA 4LO5B 1R5SA 4H44C 3VZNA 3HR9A 4U36A 4JQTA 4CUAA 5J37A 4U7JA 2QQVA 5APTA 2ZS6B 3OY8B 3VBRB 1EP0A 1O3RA 3WQ1A 2YXQB 4OCTA 3USSA 4XCBA 1AR61 5JMCA 3AEFC 3FGAD 5C39A 3VB9A 1PO22 1FJPA 1A3KA 3LA7A 4RKUJ 4N53B 2MEV3 3ZO0B 4ONUA 3B5NA 1EDJA 1HB3A 5AVUB 4HL0A 4Y20B 3ZYFA 5B66H 1KJRA 3ZXEA 1G9BA 1PX4A 2RDQA 1LTJA 3NMBA 2W1SA 4YM2A 1EV11 2NMOA 5IW0A 1F9KA 1LWUA 5DZGA 3H1IJ 4FFHA 1NLRA 2A75A 2AH2A 4JDNA 4EIJA 1FPN2 1LEDA 1Q8OA 2AENA 2BGPA 1M8OB 3JQWA 3HQUA 3IDAA 4QQHA 5AW4B 4NPEA 3MIFA 3ROUA 1AYM1 1KITA 1WBFA 4D69A 1VBE3 2Y26A 3NAPB 5FZFA 2VVDA 2W95A 1S9KE 5DJUB 1IS4A 1D4M2 1O7FA 1OBNA 1P84I 1FZCA 2E7TA 3AJYA 4H7MA 5DDJ2 3T0AA 3AE4C 2CWMA 2JDIH 4IEOA 5LRRA 5CADA 4UB8E 5BPXA 5J96B 2RDRA 2FYUE 2E53A 3Q8EA 1SQBD 4N90A 2GSYA 1XXNA 1ULGA 4ZKUA 3I2GA 2B8MA 2VMCA 1FC2C 2CK3H 1W39A 1W8UA 3M7AA 1WW7A 2CGOA 4Q4W3 4YGEA 5FMOL 1AL23 3C7OA 1VBC1 1LP1A 4RHV2 1HVVA 3HT1A 3SEPA 5JIAA 3PJQA 1CSBA 5GTIH 1DQ0A 1HQLA 5CBNA 5E79E 3ZDSA 1TZOA 2WSUA 1ZR2A 2SLIA 3CXHH 3IMMA 1YFYA 3K48A 1NXMA 2CU5A 2W1UA 3D0JA 4OVEA 3PHLA 1U5XA 5CFCA 2J1AA 1W2BO 2ZGMA 3LDKA 3N9OA 2VOKA 3R2PA 4P9GA 4AGGA 1H2MA 1GW4A 2IBZE 3L71D 4YXDC 3KPEA 3SWYA 1JEKA 2IPPA 1H8TC 1LKNA 1RVF3 2FFDC 1SPPA 2DCYA 2E74D 3ASIA 2D2CD 3VBFC 1DP0A 1JYTA 5EPAA 1NCRC 1V0AA 4XETA 4MH0E 4CEWC 1L0NK 2FHRA 3WNMA 1PK6A 5IAXA 2ZHKA 4JF7A 1AR83 3MEPA 5T5LA 2NPSC 3H1KJ 4I7ZB 2Z5IA 1NUKA 2WO1A 4MX3A 1IG3A 4PLMA 3IM0A 4XJ8A 3ZDVA 3T97A 3E6DA 3IR9A 4OLLA 2BGOA 2P3IA 3N36A 3SQOA 4RQPB 3SMHA 3H3LA 4Z1VA 2QEXP 1GQHA 3LAGA 3VHNA 1KV4A 5KJ7C 5KXCA 3BB6A 3NVCA 1HW5A 3S4RA 4OWFA 2VAUA 4TTGA 1JHJA 2QE3A 1XNCA 1CZQA 1LTJC 2ZJSE 1KILD 1VQKP 1Q43A 4LO6B 3TYYA 1QJX1 1FBMA 1RUF3 3O0VA 2Y8KA 1WCQA 4XUOA 2PHXA 2Y33A 3VDCA 3OTFA 4GB33 1SQPK 2DVFA 4IE4A 4GMP0 2QJPC 4LULA 5T52A 5F5QA 1PHMA 1PP9G 1HB4A 2ZEYA 3NV2A 4XIOA 1WW6A 5A80A 4EJRA 2GC3A 4FPFA 3V4WA 4GIQA 4PLOA 4QXBA 4CP1A 2RN0A 3O6QA 2LRPA 2V7QJ 2R6QA 2Y6JA 3PUQA 3O1TA 5K4LA 3FUQA 5A33B 3B4SA 2Q1ZB 3PVEA 4PBPA 3WOGA 3ZPOA 2K88A 3PIGA 2E7QA 2P37A 2Y0OA 1BCCE 3L71G 3EFGA 1V6MA 2OYZA 1FZBA 5FDBA 4CSWA 3GLMA 1W2UA 2DURA 2B87A 3EQ2A 1RUE2 4FQZA 2ZT9D 3EB7A 4RGGA 3SFDC 5I0UA 2WZPP 3I3BA 3L70J 4OMCA 1EZVE 2LKMA 2XDJA 1C8M1 3PHMA 1NTZK 2D6OX 3HJRA 1O91A 2YMKA 3L73D 1OD5A 1RJ7A 2NMNA 2WLPA 3CF6E 4XJZA 3CO2A 2DUOA 3O1PA 5KHHA 3CC7P 1CAUA 2Y34A 4XIKA 4EZHA 3ABVC 4FAGA 1OQEA 1QNYA 3CCMP 4EROA 3BTXA 2YBPA 1T6BX 1QNWA 4NRMA 3H25A 1XJAA 4KBZA 1BXHA 1QH6A 1QOOA 1QY4A 2BDRA 4DQAA 3NAPA 2FZ1A 3CJIC 3LFIA 5CFDA 2V4HA 2XJUA 2JD4A 4RGKA 4M01A 3KF3A 1URQA 1EZVI 1IKPA 1LT9B 3L72E 1S0CA 2KA3A 4M3CF 1ULEA 2Z4FA 2AXCA 1CPNA 4FPHA 1LESA 4K7JA 4RR3A 4YZ5A 3U0ZA 1AR81 4Q4Y3 2LXCB 2XNDH 3BCCJ 3FX0A 2FYZA 1VB4A 3SISA 4R4XA 4O9EA 1CAWA 4MOAA 4QPGB 3WDUA 5CG9A 1EZVD 3BALA 4W6XA 5DXDA 5FFOC 3OPTA 2ORZA 5GM0A 4M3CE 1ODMA 2YPDA 3AB0A 4MGIE 4YWAA 4D0QA 3LOBA 1MS9A 2ARXA 5CYYA 1MZEA 2PHTA 5CB7A 3SNMA 1JYWA 1G1IA 1OIPA 2GUSA 3VMAA 2QE7H 4C8DA 2Q1FA 2QM7A 1A8DA 1ZW0A 3TN93 1W2AX 4N43A 1OF3A 1JMMA 3VD9A 2NP0A 1IO4A 1KILA 3BGAA 1LGCA 1CI6A 1POV3 5FO8B 3AE7C 4IGPA 2B88A 1HIXA 4LK6A 1K8AQ 1YJWP 3TYJA 1OWAA 2N1TC 2P7JA 2HWD1 1IOAA 2L91A 2QFEA 1T2KD 2WSCH 1SCSA 1ZBA3 2IZWA 3KLSA 1VPCA 3LKJA 4QQLA 5DABA 5FMDA 1GNHA 1JZ7A 1A78A 5C5TA 1S5LE 3ZM8A 1REEA 1KDMA 1UZ0A 2JE7A 4AVSA 3AE3C 3AE1C 2M3BA 1DYPA 2C0XA 4B7KA 5C33A 3H1LJ 2PHUA 4V2VA 3ZSKA 1VMHA 1NTZG 1L0LG 4IESA 4OHVA 2FMDA 1HLCA 2ZGSA 3E1IA 5FZBA 4NIAA 4BCUA 2D2CC 5KHJA 2BV4A 5AW6B 2CNAA 3G71P 3HNBM 1OUXA 1KQSO 2VOTA 3ES1A 4HBNA 4SBVA 3WR0A 1J1DC 2OQ7A 3JD71 1GL2C 4HPKB 1XC6A 1BK1A 2R1DA 1VMJA 3P1IA 3V0BA 4XVHA 2A6XA 1HV0A 1VBD2 3O5SA 5IATA 3BRTB 1S0BA 4BIOA 1OX3A 1WBLA 3UESA 2R16A 4P9LA 2F4PA 3L72D 1JY2P 1GZ9A 2Z42A 4R9CA 1BHGA 2VULA 1KYOD 2R061 2XOMA 2OW4A 3I5CA 1FYUA 1RE4A 3IFMA 3L73J 1SVFA 1A02J 5AW3B 2ZX0A 3H42B 3RL0B 4KBBA 4KQ7A 1KEXA 2LS6A 4LHNA 1S1AA 2YFZA 1X82A 2OUJA 2MEV1 2KR2A 2EF6A 2VVEA 3CLQA 4L74A 1N1YA 1PO11 5A7WB 3S57A 3W59A 3HNMA 4BQXA 5C8CA 3NNFA 4QGNA 4LNVA 1W28A 4EN0A 2XXZA 3LIDA 1N3QA 2R072 2DBIA 3AMMA 4B7EA 3LWCA 4A6SA 1DGRN 1NCRA 2ZT9B 1IFPA 1HTLC 1BCXA 2WNUA 3AX4A 3NNMA 2O1QA 3TRSB 1Z7S2 1OVVA 5KHGA 3O12A 1W5CE 4D6TJ 1R5LA 5A6XA 4Q0SA 1HRI2 3G7DA 3CDZB 4H44B 1M90Q 2ITAA 2O3JA 3JUUA 4A7ZA 1JYCA 3ZYGA 3RGBA 2B87B 3K5BA 2QUOA 2WS92 3DXTA 3LB9A 1VBD3 2VMGA 1K04A 3D3AA 4WWIA 4WY4C 1PGW1 2WNVA 1VQMP 4H13B 1AR92 2CY6A 4O61A 4UFLA 2XLFA 3L4FA 3MIDA 1NU1E 2D3SA 3I8TA 4Q4V2 1SLTA 1KILB 3VDDC 1YFWA 4NHKA 5KAIH 2QVSB 3DV8A 4QX5A 4LE3A 4EYYQ 4ARYA 5LEKA 3S5QA 4ES9A 1I9RA 4J6GA 3CU7A 4CPGA 3I2HA 3ORJA 5GJ6A 1OOPB 4CEWA 3A0BH 3BN6A 1SQQG 2IYPA 3M9QA 3SCFA 3UL2A 1YI2P 3ELNA 3E1F1 2FZ2A 1KRIA 4COUA 1SQBE 1VL2A 3KV4A 1BE3G 1VDFA 2O1JA 4RJTA 1WMKA 3AKSA 3WU2E 1RF1C 3I97A 3IAOA 1AV1A 2EA7A 5A3WA 1LTSC 1REDA 1XPWA 1SDWA 3VZMA 4A41A 4AGRA 1NTME 1P8JA 2VZQA 5JZGB 2KXPB 1VR3A 3JC22 4FPCA 4LK7A 3J8F3 3ZFFB 1I3HA 4CP2A 5FOJB 4H0LB 2VVFA 5F32A 4HN1A 3U78A 3PURA 1UX7A 3DPRB 1P84E 1LGBA 1UN1A 2HWD3 1MS8A 3DGTA 4P02B 5L73A 5KC6A 4JKMA 3TAYA 1Z7S1 4CUBA 4Q0VA 4XTMA 2IFMA 2DTYA 3OUJA 2JO1A 2XKOA 3CXHD 4ZU4A 1HJ0A 2Z69A 4WVZA 1POV1 1CAUB 3LPGA 1H2LA 4XACA 1K12A 1PK6C 1VBE1 5IK7A 4HLTA 1UMIA 5J7MA 1PO12 3FL7A 2QSIA 2Y6HA 4F83A 4M3CA 5AVTB 1H8VA 4RR3C 3FFZA 5FUIA 4UFHA 1EV13 4LHKA 1KB9I 2RH0A 3I2KA 4D7YA 4E2QA 2VXRA 4URAA 3VUOA 2WKKA 1UIXA 5F2SA 4GWJA 5EJ1B 4CEWB 2ZHMA 5I8TA 2VUJA 2OTKE 4NHMA 1L0NG 2NPSB 2VTXA 2X8KA 5K0UC 4WVMB 2E75B 3A4UA 4UB6E 1QVGO 2X5IA 2C24A 3N9NA 3UJOA 3RBZA 2J5UA 5FP7A 2Y6FA 5HV0A 1H1IA 3BPZA 2LW8A 1CR7A 4D6TG 3D6YA 1JI6A 3DF0A 3I59A 4KWLA 5CBLA 1NKGA 5BNPC 1EC5A 1YXWA 3MV11 4FOVA 4QU1A 3SHRA 4AHZA 4BA6A 5JZGC 3TK1A 3A22A 4IE7A 1FZAA 2WMMA 1B35A 2OA2A 2YY1A 1LJ7A 2KNCB 4FFIA 3P3NA 4GAZA 4YGDA 3WP4A 2WO3A 1LNSA 5FZ6A 2J1EA 5BV6A 2YKPA 4RESB 4DY5A 1UKRA 2HWB1 3VP9A 4PIYA 4CCNA 2QJPB 4XE5B 2HG5D 2OTLP 3KHUA 1SQPG 3ILRA 2TNFA 1C8M3 1RHI1 2RS52 2EIEA 3LSEA 3H0OA 2NPSD 3HIFA 1PMIA 1A8MA 2QQMA 1ZZ8A 5A3PA 1UIJA 2OIIA 1FDOA 5A3NA 1S0GA 2W1WA 1EV12 2WC2A 3IDBB 2X05A 5FP9A 4E27A 1BBT1 3LFMA 4IE5A 1YQCA 2W1QA 1VMFA 2HEWF 4XHXA 2C26A 3ZKYA 3PIJA 1HB2A 1FATA 1RUI2 3LF7A 4NVPA 5LRSA 4MSVA 2AEJA 2ZXEB 4PV1D 2FBWC 2VMHA 1PO23 3CKHA 1NVOA 3OYWA 5JOXA 3AEEC 3RWNA 4DUWA 1MZ6A 5A32B 5IVFA 1YRZA 2WPVB 2QA4P 1QF3A 2JG9B 2J1RA 2V5YA 5FUNA 1R091 3OBRA 2FY8A 1IK7A 4N6JA 3CI9A 4I02A 4AYUA 2P67A 5FP4A 1SFCD 1BCCJ 1H4GA 2QQUA 1XE8A 4N78E 5IFTA 3ZXFA 5EP9A 1T3JA 1VBA3 1ZRRA 4XJUA 2PFXA 4PI2A 1IG0A 4WZFA 3OEBA 3P7KA 1PPJE 1WRGA 2FYUJ 2RS53 2WNEA 3ETPA 4BISA 5DAWA 1JZ3A 3VBSA 1L0LD 3IDEA 1LECA 5IK4A 1RGSA 3VMYA 3OGVA 5C3SA 1VRH2 1MFTA 3DL3A 1YQ8A 3PU3A 3V6IA 3THTA 3HEIA 4A42A 3CX5D 3EQEA 3ECQA 4MO3M 1FDIA 4Y33A 1QVFO 5LY1A 4QPWA 3Q9OA 2FDFA 1WCUA 3JZVA 4LJHA 4HANA 1RUG2 5KLVK 3C1LA 5FCCA 5KTBA 1GD2E 1W6MA 3PUIA 4NJ4A 4BQYA 1FZEA 5D2AA 3WDTA 1SQBK 5APXA 2PLV1 4DPNA 1GOHA 1YITP 1BDCA 1HJGA 1RUE1 4F3JA 1K73Q 4QXCA 4H2AA 1USEA 3J7LA 5IVBA 4Q4Y1 4AQ6A 1W9SA 4YVWC 4LQRA 2G9ZA 4XUTA 3D0SA 5LATA 2W0XA 5LK7B 2ZMNA 3P6BA 3POSA 3H1KG 4QWNA 4MZUA 1QJU2 1OW8A 3ZYPA 2YKQA 5KLIC 1OVUA 1UY2A 5KAIE 3KZ4C 5D1IA 1RL3A 2ZAHA 1KFUL 1MQTA 4Y5TA 5JI9A 3PLNA 1NU1D 2H43A 3WP5A 4D3WA 2RMU3 3LA2A 2GNDA 3OGGA 4Q8LA 2EVXA 4Y20A 4ZY9A 1G2CA 5FK8A 3VDBA 4I2LC 4FPJA 1YJ9P 2W92A 4LKDA 4QKFA 1RMU3 3WG2A 1L0LK 5I91A 1NTZJ 1UY0A 3AVSA 5FP8A 3E7KA 1GL2A 3ZXKA 1M06G 2DUPA 2PAJA 1YQ3C 1IFNA 1Q90D 2WVRA 2YGMA 3PP5A 2KOGA 2W8ZA 3FUOA 3IB3A 4K3UA 2E75D 3IZOA 1PGPA 2FCUA 4YGCA 5AW9B 3ZKUA 4IEUA 4XXAA 3PU8A 3WF1A 4AWDA 2X5IB 3Q5PA 1AJOA 4Y1YA 1UY4A 1NAFA 2DVGA 4NIGA 1J3RA 1UY3A 4GKYA 5KLVD 4B4RA 3CWBD 2TUNA 4IEQA 4QX8A 4Y4RA 5CKNA 2WT2A 2XBO3 3VZOA 1QL2A 2B42B 4GOFA 1R1A3 1EY2A 3U59A 3Q2YA 1ULPA 4AR2A 2JEMA 5F1RA 4KU8A 3H1YA 1YJNP 2Z4EA 1NYHA 2SBAA 3D5OA 3K75B 1OLRA 1GU5A 4IEYA 4IV3B 4KNCA 2ADEA 2ZGPA 4WM8A 2H6BA 4CDUB 2ATFA 5EQUA 4GOEA 2W90A 4IFMA 3FLPA 3I4IA 3HTKA 1BVP1 2Q1KA 1WA6X 2GC1A 2DYCA 1VQNP 1DBNA 5IK5A 1SQBG 3MGUA 1QKQA 2C0WA 5DZEA 5CCHD 5A7OA 4YVSA 4E9KA 1BCCD 5C4WA 1RH5B 3IN6A 4QHOA 3ZSLA 4P9YA 4RGAA 3FLTA 1SQBJ 2JKVA 3GJAA 1RITA 3MDPA 4YPCA 3OPWA 3OYWB 2CSGA 4NWWA 3VDAA 3ZIXA 2SPZA 1W06A 3P8MC 2D3RA 4WY4B 4PF5A 4RN5A 5FYBA 5T5JA 3E5QA 4H13C 5GTHE 1D4M1 1DGWA 2BBAA 1N7LA 2R041 3Q8FA 3EYPA 4LXLA 4P5HA 3RJRA 1X8YA 2I45A 1SQVE 1PNGA 2ZGTA 5D8AB 1V9U1 1AXYA 1NKZB 2XBO2 2P2KA 1VBA1 3TOJA 3KCXA 3RYRA 5C6CA 2WN3A 1LJ2A 2KNCA 3AFKA 4WB4A 1CJDA 5JR7B 5GTIE 2Y0IA 2YDEA 2FFDA 3C3VA 5EZWA 1XRUA 3GF6A 5C3OA 2J58A 4Z92B 3OY8A 5DUUA 5F5AA 4DCKA 2JDNA 4MXWA 1EZVG 2HPCB 1SQQD 4KJMA 3AXDA 1I5PA 1YEWA 2ZXXA 1N73C 4KWUA 1DH3A 2POHA 2WNVC 2IFNA 3CIHA 2O01N 4MN4C 2WLQA 1D4VB 2BFUL 4Q27A 2R30A 1SQVK 4PHZA 5AW7B 1WUVA 4P00B 1JTHB 2OQQA 1ASJ1 4FQ4A 1PIV3 2GN7A 2GMPA 4TLGA 3U37A 1Y43B 1LR5A 2BOJA 4H0LC 1GL2D 2HH9A 3DECA 1PV3A 1NTMJ 3S6PA 2H89C 1OKQA 1UU6A 3DPRC 4XF9A 1KMIZ 2C6SA 1HKDA 3MPBA 3O6QB 2JP3A 3AYCA 1GWMA 2WZR2 3DEMA 3H6PA 1O4YA 2WWUA 1F15A 2YZ4A 3TDKA 3O1VA 4EZ4A 4MHRA 2QBXA 4QPYA 2OPWA 2IFRA 4JGZA 4YW3A 3H1LE 2MKVA 5GLTA 5ACA1 3ZMNA 1JY3O 5FZAA 3OA7A 1PGSA 2FCVA 3I3MA 3D4KA 4E8DA 2E76D 4QQ2A 2ZABA 1UD1A 3GCXA 3O7OA 3GDBA 5LW9A 1NZCA 5FYUA 1G7YA 2PTMA 1WMDA 3VKLA 1HRV3 5IVEA 1QX8A 3RL0D 1YQ4C 2HWC3 2EXJA 3N35A 3OG2A 5FYTA 5A7QA 4CDXC 3W5MA 1F4HA 4RS5C 1C57A 4YZ4A 4IOIH 1C5HA 4WV8A 4WY4D 5FYVA 5A1LA 2LTNA 1X33A 3VHPA 2RE9A 2K2SA 5ACA3 3USUB 5K0UB 1DFQA 5IVYA 3AZYA 4LEJA 2GZWA 1PIV2 4KWKA 4EYUA 5EYXA 1YJLA 4UXAA 2E74C 4OI2A 2AR6A 4CDWA 3M3EA 5FYZA 1D0GA 1YC61 1XSQA 2PMWB 3LEMA 3TEYA 3H1WA 4Y22A 1RUC3 3UT0A 5LA1A 4RFT0 1PIV1 1KFXL 3P8CE 5E88A 2HEVF 4CUGA 4CEYB 5C70A 4AQTA 1X8EA 2Q8DA 3AKTA 2Q3IA 5AVPA 1KYOE 5EJZB 5BY5A 4GA9A 3N7JA 3ZXJA 2O01J 2MPFA 2QIWA 2VJXA 1C1LA 1FU1A 2KB7P 3VN0A 1GBGA 3PDQA 4FXGB 1MKMA 4JTNA 4Q0QA 5CKMA 5FZMA 5FXZA 1U7MA 5IUQA 1ENRA 1MS1A 1UYPA 1LTTC 2OT7A 4K6BA 1MQTC 3MFCA 1Z7S3 3KS7A 1LOFC 3MUY1 2XJRA 1W8FA 1KILE 2BRTA 1NY72 2DVDA 2QVAA 3EJKA 3MW3A 1N3PA 5FYSA 5TJHA 3WVJA 2WJSA 1IFIA 1FE6A 2H6CA 4AVAA 4XQWA 1W0PA 4BQ4A 2JIGA 5BNNC 1ZX5A 1AVBA 4QB2A 5ACA2 3WMM0 3AK0A 3VD7A 4BQ5A 4PJYA 5AVXB 4UFJA 4UBHA 5HI0A 4YVSB 3WEZA 3ZSJA 1JH5A 1K05A 2OQ6A 1WCKA 3FWEA 2DFCA 4FOYA 1K3IA 3W21A 2BU9A 3IT8A 4A7YA 2VBDA 3GG2A 5B2GB 1Y4WA 4Q4V3 2KM2A 1SQQJ 3R4YA 2IZ0A 4LBKA 3N3HA 5JPNB 3LIGA 2OYOA 3Q5RA 3ZN4A 1VQ5P 1MVEA 1FOD1 2QDRA 2DTWA 1L0LJ 2CGNA 1VQ9P 2VOWA 4HT1T 1U5YA 1VBB2 2Y6LA 1ULDA 3VYIA 1Y7BA 2B9BA 2RJKA 1N2DC 1OW7A 3KQGA 1JN2P 3CEWA 4IE0A 4XMAA 3VD3A 3W5NA 5EXOA 3IBMA 1RF1A 1GUIA 4C91A 3RNSA 4TLFA 2E7AA 1VALA 5C71A 3TEWA 2VC9A 1FNYA 2P3YA 4BRYA 4NAOA 2PELA 5JXIA 1QL1A 1OD3A 1EXJA 1ENQA 3J8F2 3FHIB 1GTWA 4BLIA 3SWKA 4ISRA 3NSTA 1H30A 3OEAA 2GALA 3QLQA 2VMIA 3H1HD 3WU2H 3KB5A 1X36A 1W0OA 4QHBA 4DNYA 2WQ8A 2ZJCA 4Z2AA 2DVAA 5H9SA 4F8AA 3CPWO 2VZ3A 4OHWA 5KLVG 1KN7A 3GBWA 5H9QA 3B5NB 1YNAA 4OQ9A 4H14A 1ZV8A 2G9FA 2JKXA 4ORFA 5FUPA 2N9BA 3N4MA 1ZBE1 4PD4D 1O5LA 3NXSA 2AC1A 4GDOA 2PHRA 3I3DA 5FJHA 4QKNA 5IT6A 1DDLA 1CN1A 4YVWB 3EFFK 2JD9A 2HLOA 1PO13 2CAVA 2XZRA 2OXBA 2WNUB 2ZHLA 3J7HA 4CYDA 4JGZB 5AC92 1LOBA 1W8TA 3JBG3 4XA4A 2UY9A 2VOXA 2VZUA 3VHRA 1RQVA 1KB9D 3H8XA 3H1LD 2XL7A 3B93A 3OAKA 3FBMA 1N1TA 3I7DA 3H7JA 5CCGD 1JOCA 3M8LA 4XE9A 4PV1C 5C8CB 1PFIA 3KMHA 1X0TA 2ZVOB 1HF9A 1K45A 1N7SD 1UNBA 3KV6A 4YARA 4JRAA 2E76C 1OH3A 3RZGA 2OZJA 3MBWA 4CDXA 2BFUS 4LLOA 5FLJA 1OVPA 1KXGA 3AJZA 3MLKA 4UW3A 2L5GB 3JD73 1DYKA 4K40A 1URXA 4XUPA 3HQXA 4ARXA 2YG0A 4HK9A 4CCCA 3ZR5A 3QOPA 2RS32 2D97A 4Q26A 5I0RA 2BPA2 2A06D 3ZVXA 4JYBA 5HCFA 5A7NA 2DCTA 2YC4A 5JCTA 4XJWA 5FYMA 1NJIQ 1D2SA 4FPOB 3MLJA 3ACGA 5J48A 1H8TB 4HVQA 4E4DX 4IV3A 4OUSA 3UNPA 1R083 2FFDB 2HWF1 2W08A 3JCIA 4UWDA 4CDWB 3A21A 1PMJX 2JDUA 1DD4A 3WP6A 2YKOA 1TNFA 5FXVA 3M9BA 4Y24A 1BYHA 4AEDA 5K8SA 1Q81Q 3SXWA 4DB5A 2R44A 1B35C 5JAXA 4U3FJ 5APUA 4X8PA 3H32B 2J1UA 1VQ4P 1F4AA 1SG3A 2OKXA 3L74E 3H1JG 4PQ9A 2ZKLA 1MEC3 5FMOS 1TMF3 3THDA 4AXOA 4CDUC 2VBBA 2DFBA 1LGNA 1T6GC 3VD5A 4U3FG 3M06A 2EXHA 3K46A 4NROA 5D21A 5JSRA 3VBUC 1G1JA 2JDZA 5HCAA 4Q4X2 4X6QB 4IL7A 3TEZA 1ZLLA 2WT7A 1H8AA 4OH8B 1OUSA 4Q4W2 2QCSB 1BEV2 3DYPA 4NWVA 4FTEA 5GLVA 3BTYA 1ZRDA 1W6OA 1LOGA 4ZU7A 1BCCG 1C4RA 5FPBA 3GHGA 2MHFA 3IAQA 5C3RA 2R5BA 5FBZA 4BIFA 5A6YA 1WW4A 5FAXA 4XF1A 3FLRA 4QU2A 4OHXA 4LLHA 4NIIA 3DYMA 2CAUA 3TNQA 1U7JA 4XAAA 3OJAB 4B1MA 4ZS2A 1R082 4JYCA 2FYUD 4B4QA 1DGLA 3M9HA 3L70D 2DUQA 2EICA 2XGXA 3KCYA 4XEZA 5CU1A 1NKNA 1COV3 4YFWA 4XJ9A 5F8PA 1IZ3A 1O5UA 2ARBA 4IEZA 4WM7C 3H8RA 1RUNA 2I1KA 1GWKA 3SFEC 2JX9A 1NT0A 4W6WA 1UPIA 2BTVC 1W8NA 4BOWA 1JZ5A 1SLQA 3T4HB 3RPQA 4LBLA 1LODA 4YYOA 5AVRB 1PZ7A 1TMF2 4HSJA 2IXKA 1ZZ6A 2HYKA 1N73B 1QGLA 2GAUA 3O1UA 2ID4A 2WNVB 3MV01 1H2NA 3R4SA 1BE3E 3BUCA 4UAPA 1PM7A 1RMU1 2BNNA 4OUEA 3CQOA 4AVVA 3PUHA 4XILA 3CD6P 1BEV3 3BYWA 3OOXA 4W7YA 4RA0A 5FLHA 1RUJ2 2X53S 2ZGLA 1WMFA 3JU9A 4NOTA 1RF0A 2E6VA 3MHZA 5C3PA 3S7EA 1XYOA 5FV3A 2VUCA 5CAZA 1BVVA 2XH6A 3ALQA 2CDOA 4GWMA 3CJIB 1Q7YQ 1YQ6A 4EV0A 4KI5M 5EWSA 3Q3DA 3KQRA 5FZKA 2CTVA 2ZGUA 1LT9C 4CVUA 1IPKA 1QWRA 1VB2A 4ITCA 4AEKA 1DQ4A 1NWQA 4NPDA 3WX5A 1PGL2 2Q6QA 4C0BA 4DMIA 3AP9A 4DXZA 4A3XA 2ZOEB 2Q30A 3OJBA 3CCRP 1ND3B 3M91A 4GB31 4FTSA 1QQP3 1K5MC 2D40A 2TEPA 4W6YA 5IVVA 3F89A 1EYBA 3GZEA 4LORA 1TE1B 4XZUG 4W65A 2YPJA 5BU5A 4I01A 5LBBA 5KJ7A 4M0HA 1LHNA 5JIUA 2QJYB 1PL5A 3L71J 4I3GA 1NCQA 1RMU2 4LC1A 4RS5B 3ITKA 1L3JA 5JMOA 4IV1C 3OD4A 1HGVA 1HJBA 4KGGA 2ZGNA 1PM4A 1W8WA 3BOWA 1CAVA 2OPKA 4JV4A 1DLLA 1Q5OA 3OCPA 3GF3A 1W9YA 1O59A 4OHZA 2QTWB 3PNAA 3T09A 3RMYA 5F5CA 1V70A 4CXWA 1S3JA 3RG0A 3TGUG 4M3LA 3KSCA 2C5DA 3RZJA 4LIUA 4QDSA 5FZHA 5GLUA 3RYPA 1NLQA 4LKEA 2K9JB 3LIEA 1H4HA 2J1SA 4O9GA 1H6XA 1QHDA 2XG3A 1LTGC 5FWJA 4BWOA 1R081 4PD4H 3VBHB 1N7SA 1XNBA 4CEYC 2R49A 4ISQA 1NG0A 3HBZA 1FOSE 4M4PA 3WF2A 4QMAA 1FMD1 2VUAA 3M3CA 1QOTA 1RB8G 4Z82A 2PN5A 4UFMA 1STMA 4FCAA 4DRVA 5I8SA 5TSWA 1KORA 3M2MA 1R64A 2FXPA 3AVRA 1MQTB 1JYXA 3SKJE 2AEYA 1NTZE 2VMDA 1E79H 3ZN5A 4AFAA 2VPVA 2OVUA 4QQPA 1OA3A 5FWEA 3TN92 1SFCC 3SWFA 2XQRA 1CW5A 3AP7A 4CA9A 1KB9E 2JR8A 3A3YB 3ZYHA 3II6A 2YYOA 3M4FA 4UT5A 4XF4A 3WLUA 1C8NA 4D7SA 4H0LD 2RJLA 2UWBA 3L2YA 2W27A 4WZCA 1OURA 2E63A 2D6MA 4LBQD 1SS1A 2PGDA 4BMEA 3QCWA 5CEHA 1X50A 3WZ1A 1UZYA 3IAPA 3BCCD 3D70A 2WQYC 1E5RA 2QZ3A 2VNGA 2KZJA 2AYHA 2O8QA 3L75G 3LE0A 3TBDA 2KS1B 4IW3A 4AEDC 1T2XA 4QX0A 3ZFEB 1L0ND 2D43A 2DDUA 4J1XA 1RIRA 2O01H 3M3QA 2QQJA 5FXWA 1X9TA 3CWBJ 4GIFA 5LY2A 2XVGA 5JLVA 5JSOA 1FOSF 4JC1A 3OBAA 1ZMEC 1NOHA 3NV3A 4CZSA 4I2OA 4QX3A 4P9WA 1DU3D 1OLMA 1OLME 1H0TA 5EJ3A 2KD7A 1MS0A 1SQQE 5FY4A 2GP5A 1T6AA 1N47A 4AHYA 1LB2A 1D2QA 3V2PA 1S2BA 4JX0A 5ANQA 4BLJA 4YW2A 2W68A 4LKFA 4NHXA 3WNPA 4ZKPA 3G4SP 1ND2B 2AACA 2XL9A 5I8YA 4GXLA 1O8PA 1OLQA 3LCPA 5E79H 1PPJD 3NJYA 5ISLA 1NU1K 3W68A 1SQPE 1F2NA 4C46A 3VGIA 1APNA 1IQAA 3GZUC 4ZXEA 4CU8A 1LTIC 4R8HA 5AC91 3MICA 1VQOP 1OFNA 3B5NC 3IIIA 2GMMA 3CJIA 4N7IA 5APYA 4YGBA 5DAQA 3ZXGA 4BQ2A 2D5FA 1AL0G 3PTZA 4UB6H 1V9U2 2E51A 2RS12 2ZYAA 2OYIC 3BKZA 2VH9A 4XFCA 3ZYBA 4YSFA 1GV9A 2WNUC 3AL6A 3JQXA 4EN7B 1CPMA 4CE8A 2H0BA 4JGZC 5DG2A 3SCHA 5IYYA 3VBUA 1BGYG 2VQUA 4O65A 4UYBA 5SV5A 3WD5A 4COWA 3NV1A 4C90A 4FBFA 1HRI3 3Q5SA 1V6LA 2PQQA 5C8CC 1AYN3 2QQWA 4V2WA 1X79B 1AVYA 1O4ZA 1YTZT 5FY1A 3IN9A 2XQXA 5JOWA 5GLZA 4AEJA 2E76B 3G6JB 4Z1MH 1ZBA1 4YRDA 1F5FA 1BGYJ 1LU1A 2WPQA 2WABA 2WS93 1G6NA 2YC0A 2ZEXA 3OUHA 1I5ZA 4LA2A 5EFWB 1RE4C 3AC0A 3HD8B 1UOGA 4HFSA 4FTBA 2AEFA 3NTNA 5KAFE 1AR93 1CAXB 4GULA 1TME1 5FZCA 1PMHX 4EOTA 3S30A 2ZFCA 4EWEA 1Y8AA 3SH4A 1JS9A 1ONAA 1WD3A 2DU1A 1XYPA 2RM23 2WA3A 2WL1A 3I3EA 2EAAA 4ASLA 1ODNA 1JUNA 2XB6C 4RR3B 4YVSC 2ZX3A 1J1TA 1VF5C 5HBAA 3MIHA 2WFF2 3MP7B 1GK4A 1YLLA 4HKZH 2B4KA 3MIBA 4KG0A 2QZ2A 4KG8A 5T55A 2JDKA 3HTKB 4LA3A 4ASKA 1KJLA 5CCHC 4YG6A 1JBCA 1YI7A 5FP3A 5DAPA 2A71A 4UF0B 4LGDE 3VN4A 2E75C 2A7AA 1I1EA 4E4SA 2OX0A 4AI9A 1UIIA 2X29A 1EUUA 3PVOA 4UFKA 5GZEA 3SCGA 1JYNA 2RS51 3A0KA 4L97A 4OVNF 2VTXJ 1Z78A 4INDA 1I6XA 4QKBA 3WNKA 3U11A 3K4AA 5A3MA 2WO2A 2CV6A 1LTBC 3VBUB 2O14A 4LO4B 2NPIA 5DG1A 1EPWA 3GZAA 4AFCA 4E8CA 5JZGA 3WG4A 1EAH2 2A45G 1IS5A 2VTFA 2J42A 3LOIA 1VQLP 1GMMA 3TNUA 1OVSA 4HG6B 4TN7A 4AFMA 4EQVA 5K5GB 1QQP1 3Q8BA 4CCMA 4NHYA 5EHDA 3VMXA 4M00A 5ANNA 1VQ7P 5FY7A 1OW6A 4B3NA 2ZVNB 4BQWA 3O1SA 4GODA 5FQ0A 1LHVA 5A6QA 3RZKA 1AVOA 2BEZF 3ZSEA 1F5JA 4MV2A 5JPMB 4CPBD 5T3NA 5JOYA 3POFA 5FZ0A 1POQA 1YQ5A 5AFBA 4UOJA 3RK3C 5AFEA 1OA4A 4DO0A 3R0RA 2RG4A 1BSHA 2G4IA 3QH7A 4JZRA 4LIVA 1ZRCA 1VAMA 2FDIA 1BBT3 5FY5A 5BNOA 2WQ4A 2RHPA 3CX5E 2D98A 2PHFA 3H1ID 1JTZX 5FBJA 5IAVA 4CCEA 2JWDA 2ZGRA 2PAMA 2VXJA 4UFIA 4QPIB 1AX1A 2FXOA 3A5TA 5AVWB 2A6ZA 3H1HG 3I2FA 2PHLA 3WG3A 1WMXA 2M5AB 4MXVA 3UKTA 3RZMA 5KLVJ 5KKZC 2ZBJA 1T8ZA 2JG9C 3LA3A 1LHWA 3ZYIB 2BUKA 4Y4YA 5A6ZA 4AVTA 3SSUA 3HWJA 5BNPA 1BQPA 1UIKA 3MF6A 1US2A 1NYWA 4SLIA 3J7NA 1VRH1 1UOBA 1KD1Q 4BE3A 5JXJA 2BCCE 3TGUD 2Y0EA 1NTKE 3Q1MA 2CWSA 1W2EA 5J3UA 1OMIA 3LW5J 3E1RA 4YTPC 2GDFA 3PJYA 2DVBA 4M4RA 1IZNB 4GJYA 3MD0A 5FYYA 3BCCG 1FI2A 2BASA 1LHUA 3KHCA 1C8M2 4GD4A 3ZN6A 4LO8A 3SEEA 5E6HA 2VZTA 4AI0A 1D4M3 5FXXA 1FDMA 4L9BA 4GWIA 2WZR1 1W8ZA 5IVCA 3NJXA 3GF7A 4QAWA 2KI7B 3WHTA 4W8JA 3WY6A 1EUTA 1R092 2A73B 2GNTA 3HPNA 1EQ7A 3ON7A 4EE2A 3CL1A 2NZ9A 2QQPA 2PLV3 3GHMA 5BYNA 5F3GA 1NAEA 2PRRA 1QH7A 4Y1VA 1W99A 2WWJA 2VD7A 1WW5A 1NCQC 4RHV3 1DQ1A 2QJYC 4AZZA 5DMYA 1CQ9A 4J25A 3H1IG 3C7GA 2YV8A 1SFYA 2Q4SA 1GZWB 3V0AB 1CIYA 3NKGA 4Q4V1 3R4DB 4QPIA 1W8OA 3BTAA 5KXBA 3FJSA 3NNJA 4P14A 2MJZA 4AYCA 2JDPA 4G4FA 4CEYA 3DYOA 4Z8BA 5A32A 1J59A 2HR3A 1Y9GA 4BMBA 3S1KA 2G19A 3A2AA 1L7RA 2WS91 1RHI2 4HVRA 1TEIA 5APVA 2ADDA 2LROA 1CD3G 3T3YA 3WQ0A 4FSJA 3M0DA 1VBA2 1LOAA 2JDAA 1NTKG 3RGUA 5KLIB 1VQPP 1QJY2 3QH9A 1V6NA 2HWB2 2IXLA 2R0HA 4I0BA 4E2SA 1O8SA 1HRI1 2WTYA 3GZTB 1JYVA 1QJFA 2KLUA 5BNOB 2J59M 2WIIB 5E1RA 2VNRA 2BVBA 1PVXA 4XUNA 1DZQA 5FYIA 5GKAC 4JRLA 4N53A 2YO2A 1VRH3 4COZA 2B7YA 3URFA 3B71A 3FE5A 1R093 3VOPA 1ENSA 2D6NA 1TNRA 3FMGA 2ZZJA 1VIWB 4XFIA 4XW3A 3GJBA 4LR4A 5LA9A 3KHBA 2GU9A 3DKWA 3OSDA 3ZDMA 3E97A 1M57D 1UU4A 1RUG3 2WA4A 3B69A 3WUDA 2LXBA 2MEV2 3U10A 4GKGA 3VV1A 2X5IC 4BWNA 2N1TD 3RZZA 3ZX7A 3LGRA 3KVBA 2WT7B 1FV3A 1FV2A 2OYHB 1UYZA 4W7ZA 4FPLA 4L0PA 2Q9IA 2D5HA 1SQVD 1SLLA 4XYXA 3B3QE 3HNYM 2VZ1A 1IPSA 4ZU5A 5HPOA 1JNMA 1W6PA 1LOCA 3RK2B 5CJ0A 1COV2 1GSLA 1QJZA 2RR12 2VNOA 3H1JD 3FBYA 4LBMA 3T4VA 1NQJA 1QJY3 4TWTA 1VBE2 1FAYA 3MIEA 3GMAA 1GW3A 1US3A 1UYXA 2WWSA 2XR4A 4QGMA 1A34A 4DFSA 3G3ZA 3WDXA 4AEDB 4GH4B 3ZFEC 2JB4A 4K8FA 2E5YA 5M1BA 1RUE3 5DQ0A 1AZDA 5L9VA 5CBOA 5HXMA 3WDVA 1KZUB 1OHFA 4K9SA 5FY0A 1AJKA 1LP1B 2KXLA 3H8UA 2JJLA 4HOOA 4B1LA 4NAMA 4ZZ5A 1L7LA 2HYNA 4HYTB 4IL6E 4LUMA 3WUCA 2VECA 5APWA 1AL22 1SQPD 2H8PD 2G9GA 2RJ2A 4JGYB 2A06G 2YIUC 2O0OA 2R1BA 3G9RA 1HN1A 1ULOA 3VZLA 5FMCA 4BQ1A 1NTKK 2OYIA 5D8AC 1PP9E 4Y28J 2W47A 1CESA 1ULCA 4YXWH 2XLGA 4L11A 4KHXA 2W6JH 2GMEA 2IXJA 5C9AC 1QJU1 1IGOA 4MADA 1H1AA 1R1A2 3GCWA 3VBOB 2VO5A 1JUIA 4X6RB 2B5HA 3BOPA 4W4ZA 5C8WA 2QNKA 2RR13 3AP5A 5I0TA 2FYNC 3MPPG 4Q4Y2 1VJ2A 2D93A 5DZFA 5FQ0B 2YROA 4A6OA 5B5EH 3G6EP 3VDDA 4HSLA 4BYYA 1T2KC 1AR82 1AR91 1LENA 5CVRA 1ZRIA 3ABZA 3OBZA 3V2RA 1IPJA 1URQC 2I74A 3CHXA 4ASVA 3SH3A 5CG8A 4EWDA 4ZKTB 3HE4B 4FXKB 1J1EC 4ASWA 4ES8A 3S7IA 3B8EB 4Z07A 5FPZA 4O7XA 4AHXA 1AYN1 1UZWA 3RDIA 3VBSC 2VNVA 3MZHA 3S9OA 3VTPC 4DEVA 3UIAA 1UOFA 1WGPA 1OC1A 4L2NA 3WW3A 3H1HJ 3HUSC 2TBVA 1W3XA 1OQDA 1VPHA 5JI7A 2BCCG 4U2AA 4CU6A 3FZ3A 4LLFA 1QEXA 1BMV2 5T54A 2IBZG 2P1BA 4JHZA 2K1AA 4QD2A 2WZEA 4GKXA 2VW1A 4RFRB 1LHOA 4GMP3 4KT0J 1U0AA 2D44A 1W9WA 1DCSA 2KLVA 1GNYA 1WLTA 4LBOA 1JY2O 3IIAA 3ACHA 3K3OA 3NNLA 3LD8A 4CDXB 5FZIA 2ARAA 2R062 2N7GA 5FPAA 1RY3A 5JUVA 4C7NA 2IVIB 2A6WA 2DV9A 2PAEA 3NNGA 1VBD1 1YCIA 4CDQB 1IFMA 4ZPIA 1XE7A 3FC0A 4UI9L 1BMV1 1FJKA 4P9XA 4UW5A 1IK9A 3LDBA 2RDNA 5FKBA 2FQPA 1REFA 1YHQP 3B94A 1S72P 3BPSA 1S2EA 3LEKA 3M3IA 4V1PA 3UKVA 3UGHA 4ATEA 5IFPA 1FZFA 2IYOA 4LPLA 1YQ2A 4ZMDA 2ZX1A 5KHKA 1NU1G 2XVLA 3ACIA 2D7FA 1SEFA 3FHAA 4H55A 5B66E 5E8AA 3L74D 2ZX2A 3H1LG 4GMP1 3WINE 5AVAA 4GALA 5K7PA 2QM8A 3ZLIA 2R073 3DKQA 5EV7A 4CPBA 2GNBA 3BU7A 5C5UA 1S1CX 1WMEA 3WDWA 4AI3A 3H1IE 1UMHA 1E5HA 1HDKA 2H0VA 4R4LA 4Q29A 4XCAA 1HRV2 1W6QB 2BNMA 3Q8CA 4AQ2A 1ZREA 3RK3B 1S2KA 1JCCA 2WNOA 3X29B 5I0SA 4AAXA 4Q0PA 4L73A 3CMGA 2WFF1 1KQFB 4IEPA 1C1FA 2XDVA 3RI8A 3ZFGB 4LUKA 5HV4A 3W67A 2QQNA 3V2QA 1DD3A 2KYVA 1W9FA 3D71A 3T1MA 2Q3EA 2PAKA 1SLAA 1KQLA 1V6KA 1PPJG 4PCRA 2WINB 4YPJA 2E43A 4BK5A 1ZRFA 2JWPA 3P3PA 1MFZA 2JDHA 2P17A 4TZDA 3QWOC 2BW8A 1RUC2 1ZYBA 4PD4E 2VY0A 4D6QA 2PQSA 3M3OA 2HBTA 4RHV1 3VKOA 4OHYA 1ZZ7A 3AMQA 4YW6A 2Z5HA 4CCLA 1ZBA2 3GW6A 4LOTA 4DOJA 4NHLA 3HD7B 1IJDB 1IFDA 2RS13 1M1JB 2VZVA 1F35A 3U75A 3KYQA 3CCVP 5L19A 4NIHA 3ZPYA 4HETA 1VF5D 2K9ZA 4CP9B 1DGRA 4RS5A 3CWBE 4MGKE 5B5EE 4YZ2A 4LTAA 3O14A 4NO4A 2ZHNA 1XU2A 3WNXA 1AF9A 4Q8KA 3AEDC 2VMFA 5LK5A 3BCWA 1L4AC 3GHGB 1AYN2 1IKQA 2KSEA 1FZCB 1E5WA 1POV0 3CLPA 3MZWB 3I56P 2KUBA 2OGUA 1RUH3 3H1JE
chains in the Genus database with same CATH topology
2A70A 1NOVA 4WVWA 3VHOA 5KC5A 4YZ1A 1NCQB 1Q56A 1E57A 1SMVA 1YJKA 5CIRA 4RSUA 2HKXA 4MGZE 4XHBA 2Q0AA 1QOSA 2B45X 1PVC2 1KS5A 3AYEA 4YW4A 2BWCA 1Y3TA 2WT0A 4G3YC 4LT5A 1PO21 3SITA 1R1A1 1AR62 3IPVA 1PNFA 4MVTA 5A3LA 1PVC1 3HAGA 2PA7A 3B9IA 1GLHA 3E6BA 3ATGA 1H9PA 3WCRA 5FO7B 2BGCA 1QJX2 2W39A 5K0UA 2ZPXA 3USUA 1PGW2 4I30A 2VGDA 3FX3A 1GQGA 2JXAA 2ERFA 5ABJA 2WFPA 5KXEA 1VAVA 3MI8A 1AQTA 3W9AA 4UW6A 4Y1XA 3NV4A 4JVAA 1MS3A 4YG0A 2PHWA 3SLIA 1O3SA 2BEOA 1F8VA 1WA4A 4CDWC 2DCKA 4OULA 1HQNA 2VOVA 1WCSA 3LSDA 1KS4A 4JQRA 4OUMA 1FXZA 3EXUA 1COV1 1B35B 1Q8SA 1AXKA 3WCSA 1GICA 1AR63 4PIXA 2XWJB 4R9DA 1SCRA 2QJVA 2B9UA 3N7KA 2B39A 5DUWA 1QJX3 4GWNA 4K20A 1FMD2 3POWA 4GH4C 1RUI3 1SLBA 3VZKA 1VBC2 3WQ7A 3DUIA 2NYYA 4HZFA 2XJPA 3JD72 3AZZA 3T2TA 2WSVA 3WW1A 3O0WA 3M70A 2ENRA 4XFFA 5EYYA 5FOBB 1JXNA 1FT9A 4XBQA 4JGYC 1W6NB 4NN0A 5GLWA 1O3QA 3KCCA 1GR3A 4Q0UA 2JE9A 4Y1ZA 4WM8B 2BBVA 3ZFEA 1KQRA 1DQ5A 1CAXA 4WM7B 2D6KA 1V6IA 1AYM2 1NA1B 2XJQA 3IKWA 5DUXA 5C9AB 1HX6A 2JJ6A 2HWF3 3ME2A 3RMXA 4YM1A 3AFGA 1UMZA 4YW5A 4RD7A 4PDWB 1WCDJ 1MEC2 3THPA 3B5LB 2XHKA 1OSGA 2QDNA 1J3QA 2FMYA 2NQYA 1QMJA 4EN6B 2LUWA 2BYVE 4YW1A 3E5XA 2CL2A 4WBBA 4QM8A 1G9FA 4XF0A 4FVVA 4DOUA 4YVWA 3B00A 5J36A 3I59B 2Z79A 4FP3A 2EALA 4QQOA 4BZ4A 1C5IA 2ZAAA 1IS3A 4Q1PA 1FPN3 1YHFA 4ATFA 1PZ9A 3AP4A 1ZZBA 4Q2FA 1MZFA 3PMEA 5CFCB 1ND3C 1YFUA 1ZBE3 4N9IA 1K5MB 3IDCB 4XFGA 4AEMA 3I54A 4RL7A 5FLIA 1RJ8A 3B02A 2XUMA 4TSVA 4Y1UA 2PYTA 2ZZQA 3IPVB 2EXKA 2GH2A 2FBEA 3WW2A 4P9IA 2VW2A 4IV1B 1ZVFA 1JHNA 1HXS1 4QM9A 2IFWA 3B01A 3L2HA 4YFZA 3AP6A 4H3WA 5L7OB 1J1LA 5C4WB 3RI9A 5KHIA 1WLDA 3RYKA 3ZN6B 1GZWA 3H7YA 3MLLA 3ZXLA 3V0AA 4OI0A 3T1LA