4TLFA

Crystal structure of thiol dioxygenase from pseudomonas aeruginosa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
194
Chain Sequence
LRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Cysteine Dioxygenase Homologue from Pseudomonas aeruginosa Is a 3-Mercaptopropionate Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
total genus 49
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4tlfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tlfA02
4L11A 1GQGA 3KCCA 1CGPA 4HSJA 1ZRFA 1ZZ9A 2VQAA 2OA2A 3MYXA 4Q0SA 4MV2A 3EHKA 2E9QA 4YXWH 2ET1A 3QOPA 2WC2A 2GAUA 2GC2A 2N7GA 4IEYA 4RD7A 5FDBA 3ES1A 5K8SA 4I3PA 2D40A 4Q0VA 5KHIA 2KXLA 2ET7A 1YUDA 1Y3TA 1X8EA 3CEWA 5FCCA 3IBMA 1CAWB 3D82A 4OFGA 2V7QH 1LR5A 2IXKA 4UXAA 1O5UA 1ZZ6A 1YFYA 1QXRA 2IXLA 1O4TA 2CK3H 2D5FA 1UPIA 2Y0OA 5AVPA 4ORFA 4HBNA 5I8YA 3WW1A 3SHRA 4I2OA 3FWEA 2BNOA 1J3PA 4AVBA 5I0RA 4PIYA 1QY4A 2JDIH 1U12A 3SCHA 3NW4A 3L2HA 2XL9A 1J1LA 1RC6A 2I45A 5BXXA 1X8MA 2O1QA 2PAEA 2XLFA 3WW2A 4QXKA 4ZU4A 2XHKA 2PHLA 4WVZA 1L3JA 4HLTA 3BU7A 2ZCWA 2EA7A 4N9IA 4XFCA 1WLTA 2QDRA 5KBFA 4EWAA 2E5YA 3GYDA 1YHFA 4HN1A 1X82A 4QGMA 3ELNA 4F8AA 3RZZA 3E6CC 4DJGA 1O3QA 2EVXA 5FQ0B 5FLJA 3HQXA 5BY5A 3NKTA 3OGJA 4ONUA 4UBGA 4P9GA 2BNNA 1Q3EA 4YARA 2VECA 4JV4A 1SQ4A 4FAGA 5I0TA 1UD1A 4Q0PA 2FMYA 3RYRA 1VR3A 1ZRRA 5FQ0A 4HSLA 2IXJA 5HI0A 3FE5A 4HMZA 4BIFA 2Z69A 3ROUA 3WW3A 3BALA 2GC3A 5J3UA 4I09A 3DN7A 4I0AA 5C6CA 4TLFA 3UKTA 1LB2A 4EV0A 2MNGA 4QX5A 5I8TA 3U0ZA 4IEUA 3S7IA 4I02A 1CAVA 2Z2SB 4O9EA 2PTMA 1E79H 4AXOA 1QWRA 4B29A 5KHKA 3SMHA 4KWJA 4I01A 3CO2A 3RNSA 1RL3A 3MZHA 1VP6A 4Q29A 4PIZA 2WFPA 2QVSB 1UCXA 4LUKA 5JR7B 4QMAA 2GZWA 5JCTA 2QCSB 4HVQA 2FQPA 3G7DA 4XF1A 4O9GA 4QM8A 2QE7H 3BCWA 1JEKA 3EO6A 1UIKA 1YFWA 3ETQA 1V70A 1O3TA 4MGZE 3H3ZA 5LRSA 4QM9A 4XF3A 2Q1ZB 2DCTA 1JUHA 3RDIA 4LA3A 2XLGA 4IEOA 3H50A 3I54A 4OLLA 1BSHA 2ATFA 4D7TA 2ETEA 5LEJA 4ZU5A 3NSTA 5JSOA 4PIXA 5LRRA 3CF6E 3E97A 1DZRA 3D0SA 3OD0A 1ZZ7A 1ZRCA 1DZTA 2XLAA 1DGRA 2CAVA 3RPQA 3S0MA 4HVRA 3OCPA 3HT1A 4NVPA 4R52A 4K8FA 4WZCA 4JTOA 1FS0E 4N9HA 1Q43A 2QJVA 5I8SA 1NZCA 2Q0AA 4FBFA 3D0JA 3I59A 1NE4A 4IEZA 5FLIA 3RYPA 3LA3A 3DKWA 5CU1A 3CJXA 1WGPA 3H8UA 4META 4XFIA 5JSRA 1O3SA 1O5LA 4MGIE 2D5HA 5CADA 1XE8A 1O7FA 3FX3A 2GC1A 4A2UA 5I0UA 5JAXA 4J1WA 2CAUA 1QXJA 5E16A 1I6XA 3H1YA 4HZFA 3H9AA 3H1MA 5I93A 4KL1A 4YYOA 4AVCA 2MHFA 3R6SA 3UKVA 3DV8A 3E5QA 3MDPA 4EWDA 1H1IA 1J58A 1ZREA 2H6BA 3HIFA 3LA7A 2IC1A 1RUNA 3EFFK 4LTAA 3GBFA 2BEOA 4BHPA 3QACA 5EFUA 3USSA 2GH2A 2BGCA 5J48A 1ZZCA 3HT2A 2GU9A 2PAKA 4MUVA 1CX4A 4YSFA 2B5HA 3N4MA 1YFUA 4E2GA 1UW8A 3ACLA 5FPZA 4E2SA 4AVAA 5KHGA 2OZ6A 2H6CA 4MGYE 5JSPA 3FFQA 1FT9A 2P17A 4XF4A 1NXMA 3NJZA 4PJYA 5KHJA 4ZU7A 3I7DA 2UYBA 1OFNA 2UY8A 3H1WA 1YFXA 2O8QA 1RTVA 1XE7A 3E6BA 4XFFA 4QGNA 1ZZBA 3E5UA 4F7ZA 1YLLA 3KMHA 4HVOA 4LULA 2XKPA 2BNMA 2H0VA 1YWKA 2D93A 1FI2A 2XKOA 3BPZA 4WBBA 5J7MA 2PYTA 5BPXA 3OF1A 3SCGA 4FT8A 1AQTA 1UIJA 4MH0E 5FLHA 4MZUA 2IXHA 3ZDSA 4E2QA 1ZNPA 5BUVA 3KGZA 1LKNA 2QNKA 5CVRA 3OTFA 2CGPA 3MPBA 4IEWA 1PMIA 4XFGA 4R8HA 3S7EA 1CAXB 1OD5A 3U10A 4IEQA 1IPJA 3TNQA 3PVBB 3LZZA 2EAAA 3EJKA 1EPZA 1NYWA 4JVAA 4EROA 4HN0A 2K0GA 4KWKA 3E6DA 3CL1A 1NE6A 4XFAA 4YRDA 1CAUA 4Q0UA 2XNDH 2UYAA 5LEKA 5C8WA 5F1RA 3DL3A 1J3QA 2Q4SA 3ST7A 1ZVFA 2XGXA 4XFHA 2OYZA 2B9UA 1EY2A 2XL7A 3EBRA 4KU8A 3FZ3A 2K9ZA 4XF9A 1PM7A 3I59B 4CYDA 4D7SA 2UY9A 1SFNA 5D1IA 1Q5OA 3ES4A 5I0SA 3TNPB 2PAMA 3O14A 4Q0QA 3SCFA 3PJSK 3H7YA 4KU7A 3IIAA 4XETA 4MGKE 3UKNA 5I91A 1Y9QA 4LUMA 4IETA 4AQ2A 1LRHA 4BYYA 3LAGA 3U11A 5T3NA 4IEXA 4Z07A 3WW4A 4IEVA 4GULA 1GQHA 3FJSA 3M70A 2B8MA 2MPFA 3FHIB 3H7JA 2PHDA 2GC0A 3KGLA 1O3RA 3H3UA 5BV6A 1TQ5A 1I5ZA 4KWLA 1DGWA 3KSCA 1RGSA 2PFWA 3E5XA 4IEPA 1IPKA 3M3IA 4I0BA 5KHHA 1RUOA 3C3VA 3PLQA 3EQEA 3SXWA 1FXZA 2PQQA 2VPVA 4QGLA 1J3RA 4FAHA 1IFPA 3VHRA 2PA7A 4UBHA 2E5TA 2HJIA 4LA2A 4MX3A 4LEJA 5EZWA 1X7NA 4H7LA 4DINB 3B02A 4XEZA 1H1MA 4X6QB 1WA4A 2IXIA 1BSNA 1SEFA 1CAUB 3CLPA 3PNAA 1J59A 2BYVE 2OPKA 2ZKLA 1XRUA 2C0ZA 3NVCA 3JZVA 4XFBA 2W6JH 1EYBA 4BH9A 1CAXA 4X6RB 5E1RA 4Z82A 4L2NA 3BB6A 1EP0A 4J1XA 4YNIA 1CAWA 4IESA 4XF0A 1OI6A 2F4PA 2Q30A 1CAVB 2V09A 3IWZA 3IDCB 4IERA 3IDBB 4AQ6A 1G6NA 3LA2A 4JTNA 2CV6A 2HKXA 1ZRDA 3LOIA 2WSSH 3NL1A 4EWEA 4LLOA 1ZX5A 2IXCA 1OMIA 3RYKA 3LWCA 2OZJA 5FPXA 1VJ2A 1ZZ8A 1HW5A
chains in the Genus database with same CATH superfamily
3ZMOA 5LA0A 2ARBA 3L9JT 3WZ1A 3AJZA 1HUCA 2WLPA 4QQ2A 1H2LA 2W87A 2MJZA 1PO11 4GXLA 5F32A 3ZO0B 1S0GA 3MEPA 5IVCA 2OA2A 1Q7YQ 4BOWA 1XNDA 3EHKA 4YW5A 5CG9A 4MG2A 3CZJA 4YXWH 2ET1A 3QOPA 2JR8A 4UW4A 2JIJA 1BDDA 1P84D 1SQQG 4XIKA 4DNYA 1OOPC 1L0LK 3H1JE 1EXJA 4W7YA 1URXA 5K8SA 3ZXJA 1IOAA 2BW8A 5IVYA 2EXIA 3G4SP 3T0AA 4WM7C 1U7JA 3ZN6B 1H89A 2E26A 2K37A 1POQA 4U36A 4OHWA 1X8EA 1XU1A 2PHWA 3CEWA 5F3GA 4PD4E 3PURA 2K9JB 2HWD2 4KHXA 4OFGA 1ONAA 3VBUA 3NAPA 4CZSA 5C71A 1WLDA 3ZFGB 4CEYB 2Q7CA 2OPWA 4NIHA 3RRDA 2CK3H 2RR13 1NA1A 3OGRA 4C7NA 2YO3A 1HRV1 5KWRA 4DT0A 5SV5A 3OGGA 4FSJA 1YJWP 4I6MC 2NPSA 4PV1D 2NQYA 1W6MA 3MFAA 1A34A 4JQRA 1N7SC 1VF5B 2K9JA 2VVFA 4HBNA 5I8YA 4HKLA 4YVWA 4ISQA 5FO8B 1DQ0A 1YBKA 3OJBA 4OZXA 1W8HA 3I2OA 4L75A 1UL9A 1PGQA 3PTZA 2QDNA 4HH2A 4E4ZA 4LITA 3OJAB 3CPWO 2OW4A 3A7QA 4K8RB 4PQ9A 3SNMA 2C4XA 1KC8Q 2NMNA 2KLVA 1HV1A 1K5MC 1QY4A 2W52A 2ZJCA 2BTVC 5LW9A 1OFCX 1RMU2 2WKKA 1Q82Q 2XL9A 1J1LA 1JY3N 1RF1C 1NCQB 1WMEA 2I45A 2VMCA 2QA4P 1X8MA 3T4VA 3O0VA 3TEYA 2XBO1 1NTME 2VTFA 4ZU4A 5FKCA 5DABA 5FZ8A 4KT0J 3L37A 5CKMA 3NV1A 4KG0A 5IK7A 3ACHA 4WVZA 1ASJ1 4GZ9A 3AE3C 4AE2A 1WMFA 3L72J 2EA7A 2F4LA 1VQ6P 3QD6A 4FXGB 2WSEH 4N9IA 5DDJ3 1MS8A 2OYHB 1TME1 1WLTA 2GNMA 2A06G 4AEJA 5AVZB 1SVFA 2ARXA 4KBZA 3ZXEA 2BEZF 4AAXA 2ADEA 5AW5B 4EWAA 1LOFA 1GUIA 1IFJA 5KLIC 1WWYA 4LIUA 3HR9A 4Y99C 4HN1A 2YNYA 4XJWA 5GLZA 3WUUA 5FXXA 2NPIA 4LKFA 5CIRA 3RZZA 5A32A 3CCVP 3E6CC 1RB8G 4L0PA 5BU5A 3NO8A 1QEXA 2XDVA 1K42A 1AX1A 3HQXA 2P1JA 1KDMA 2D6PA 3NKTA 2ZYAA 3OGJA 4IL6E 3POFA 3JC22 3A0HH 4ONUA 2OGUA 4Q2FA 4CUCA 2WT0A 5D8AA 1GP4A 3M4FA 4NRPA 4Z2WA 1KQLA 3B4SA 3H1JJ 1ENXA 1LU2A 1ZRIA 1IZ3A 1YI9A 2HG5D 2AREA 1RUF3 3HNMA 4YM2A 4FAGA 2G3AA 3S4RA 5GJ6A 4Q0PA 2TEPA 5IJRA 3VZKA 3BTAA 2WRAA 3UJQA 3WCSA 1WW6A 5EQUA 1VR3A 1FU1A 2IZ0A 2J1RA 2WNUC 3B5ND 2V5DA 5AVVB 1GICA 3AFKA 1AR81 4HMZA 2PHTA 4NN0A 1UMHA 1FMD1 1EPWA 4C0BA 5KXCA 3FGAD 3MIHA 4UFJA 5FO7B 1D2QA 3PUAA 3FL7A 3TAYA 3V5BA 2QJYC 3PRJA 4X8PA 2DF7A 3ROUA 3WW3A 4AFMA 1OD3A 3IMMA 4ZKTB 5EP9A 2OARA 1RVF1 2W6BA 5IUQA 5C4WB 2RS52 3HE4B 5J3UA 3P6BA 5H9SA 1K3IA 2ZGTA 4PJ0E 5TISH 1SQPK 2WT2A 1UZ0A 3MLKA 4M0HA 4Q4V1 5JZGA 1PPJG 2OX0A 3JXSA 3T4HB 2ZYDA 1UZWA 4BB3A 4DO0A 2XVGA 5IAXA 2YY1A 1VQ4P 3CMEP 4DXRA 3K4DA 1CJDA 2V72A 1T6AA 1PZ7A 4I02A 3J26N 2FY8A 3VD5A 1CAVA 2YGLA 4DB5A 1UMIA 2A6YA 1SQVG 3M9QA 2FFDB 2PTMA 2B9BA 2WZEA 3RI8A 4F3JA 3ENRA 4JGZC 3T09A 4AXOA 1QWRA 2A1XA 1LJ2A 2JG9B 1PHMA 1OT5A 1S5LH 3WDTA 1F31A 1HQWA 5DAVA 3WEZA 1QDCA 1LTEA 3POGA 5FV3A 2E7TA 2VQUA 5CFDB 3RZKA 1MS1A 1XXNA 2JX9A 2WL1A 3B01A 1USEA 1VBB2 3R4YA 1N73B 2G4IA 4Q26A 1UCXA 1JW6A 5IAVA 4GKYA 5ACA3 4CSWA 4XUTA 2GZWA 4YPJA 2QCSB 4BE3A 4FCAA 3FXDA 1UY2A 3E1F1 3G7DA 2WO7A 1ND2A 3KQ4B 4M3CB 4XF1A 5GM0A 4JKLA 4BQ3A 2RR11 3QH6A 2VGDA 4EDFA 2YC0A 3BTXA 4AEKA 3KF5A 1HRV3 3HRNA 3ETQA 3H8RA 1O3TA 3CZUA 4MGZE 3H3ZA 4RR3B 5LRSA 2Z42A 1ASJ2 1N3QA 5DAPA 3L4FA 1VALA 4URAA 4A4AA 3ZXLA 1RUJ2 4PLNA 5DQ0A 2KUBA 4RN5A 4GOEA 3KHUA 2KZIA 5FPAA 1KEXA 1S0IA 1VRH1 3H50A 3I54A 3OGSA 4LK7A 5FYHA 2DFBA 4FOWA 3VBRC 4A6OA 1NCRA 4BQ5A 3BIWE 2I8DA 2YBSA 2WYSA 1T2KC 5L36A 3CWBE 3RWKX 5LEJA 5HV0A 2GMMA 3ILNA 5KAFE 4W6YA 5FYCA 3L75E 3E97A 1FOD1 1W8NA 1UYZA 2WS93 1DZRA 5KAFH 3P3NA 1LGBA 1AXZA 1UZZA 1DZTA 3B94A 3FLPA 2CAVA 3VBSC 1QJY1 3RL0B 4OUMA 3WF4A 1SFYA 3OCPA 2ZX1A 4MO3M 5LA1A 3UK9A 1DHKB 3K77A 4SBVA 1KILD 2AC1A 1OURA 5AC93 1ND2C 1W2OA 1PNGA 1W5CE 3N35A 3MICA 2FYZA 1LOAA 2RHPA 1KYOE 2P3JA 4FPGA 3WNOA 2M3EA 3I2FA 3CX5E 3AKPA 1Q43A 2FYUD 2ILMA 3LIHA 3OB8A 5DUVA 4V2VA 4DXSA 1G9DA 4A44A 2E76D 1PIV1 3L74G 1KYOD 4C7RA 2QTWB 3MF6A 4GQ7A 1STMA 1HGZA 2LKMA 3CJXA 1WGPA 2GM4A 2X10A 3H8UA 2A3YA 2R061 4Y5Z0 4D6TJ 4CCMA 1N1VA 3V0BA 2ORZA 3NWKA 1LHNA 2VUAA 3PUSA 5H9PA 3ZSLA 4GMP1 1JTHA 5AVAA 2D5HA 2W1WA 2E75D 2YBPA 3PHMA 3VKNA 5BNNC 2YMZA 4IOIH 2JDNA 4I0WB 1G7YA 3WDVA 2YZ4A 4J1WA 1C57A 3ZYJB 5C3OA 3ILFA 1XNTA 1WZXA 2G9ZA 2X8KA 4Q1PA 1FZAA 4B4RA 3U78A 2IDBA 3NQHA 1REDA 3H9AA 1NKGA 4IV3A 4J25A 5HBAA 5I93A 2HODB 4MHUA 5FYMA 3AP9A 4YYOA 1RUC1 1PO21 2QM8A 1EDJA 4DXZA 4DCKA 4M00A 4BLJA 2MHFA 4IE7A 3UKVA 4XW3A 5C6CA 3TOJA 5J37A 1YQCA 3E5QA 3JD73 4QX2A 5JVVA 2ZGPA 1AQ5A 3VV1A 1GMMA 1H1IA 4CP9A 1TVGA 1J58A 1H8TC 1ZREA 2OTKE 3WF0A 2XDJA 2VZSA 2JG8B 1DP0A 2YXSA 4W7ZA 1GD2E 4MHRA 4OHVA 2VOVA 1RUNA 2DUQA 3EFFK 3T0BA 2VMDA 4QPYA 4M3CF 1LOEA 1JMMA 4MYEA 4RA0A 5D8AB 3TK1A 1UOFA 1FPN2 4FP3A 4OI4A 3O1UA 2XONA 4ASKA 5AVWB 4A42A 5AVRB 4UAPA 3P8CE 2GU9A 2X05A 1URQC 2VM9A 4LBQD 4LLHA 2R3CA 4QU1A 2AEJA 4XBNA 1LWUB 2VZOA 3VHOA 5DZEA 4AI1A 2FDGA 3M0AA 4Y33A 2PFXA 1YJNP 1VQ8P 3ACLA 1W3XA 4RYDA 1KMIZ 5T52A 4CEYA 4Q4Y3 2N9BA 1NU1J 5IK4A 5LWBA 3L71J 3M91A 4AYCA 1GWLA 3B9CA 3THTA 1OWAA 2YYOA 5JSPA 1BK0A 1W3VA 4P9WA 1FT9A 4H13B 3VD4A 1NXMA 4M4PA 4QQHA 5A7NA 3JQWA 3POSA 2KLUA 1L7RA 3K46A 2OQ7A 3HBKA 2JDKA 2L5GB 1YEWA 2WFF2 4B4PA 1VBE3 2D2CD 4BK5A 4H3WA 1FAYA 4W65A 4TN7A 2A06E 1HRV2 1NUKA 1W0NA 4CA9A 3FXEA 2XJTA 3DXTA 5AVSB 3NNGA 3CXHD 5FXWA 1OLMA 2D44A 3FLTA 3KT1A 1W8OA 1BCCG 4EE2A 5I0DA 3O1PA 5CG8A 1R8EA 3L73G 1OQEA 1RTVA 1VBC2 4MGSA 3CWBG 3PUHA 1XE7A 4SLIA 4XUOA 2WNUB 5FP3A 2K88A 3RVHA 3V2PA 3RWNA 3CXHE 1OX3A 1AYN3 1LTSC 3T97B 1DCSA 3R2PA 1LTJC 2Y6GA 3LEIA 4QB2A 5FK7A 5A6XA 5ISLA 1DIPA 1EUTA 2DU1A 4UI9L 5JCTA 2O14A 1JY2N 2E76C 1YLLA 4E8DA 4JGYA 4YVWC 3ZIWA 3FHAA 2WS91 3WG3A 1DQ1A 3U1AA 4QKFA 2NPSC 1W05A 1NX9A 2E32A 3VDBA 1V9U1 1EC5A 2JE7A 1SQPJ 3KPEA 4LLFA 1S5LX 2BBAA 2FCVA 4FXKB 5A3OA 5BPXA 2Q8EA 3SCGA 4FT8A 1AQTA 1RQVA 3O5SA 3KHBA 4LBMA 2W5FA 1PO12 2DCJA 4P9YA 4CUGA 3WU2H 3WP3A 3RK3C 5FTTC 2C5DA 1RUD3 4S2HA 1DG6A 4YG0A 1NTKK 1ZRTE 5FZGA 2DYCA 4V2WA 3WNPA 4RJTA 2Q1KA 1YI7A 3H1JD 1ZNPA 4GB32 1AL22 4Q4W3 5A6ZA 5A33B 2Q3IA 2Z79A 2GN7A 4D8MA 2CGPA 5T5PA 1MFTA 1CZSA 1OXCA 1JS9A 5DDJ1 4AF9A 1GK6A 4UF0A 1PMIA 5J36A 1NTZJ 4P9IA 4XFGA 1BJQA 1LHUA 2WSCH 4R8HA 4O61A 3S7EA 4CCNA 1OD5A 3U10A 1FNYA 5FYIA 1S1CX 1GV9A 1RUE1 3V2NA 1XYNA 2QQNA 3LFIA 4A7PA 4IEQA 3WHUA 5F2WA 4A3ZA 1OSGA 2VCCA 2YROA 3EJKA 2Y0EA 3RK3D 1NYWA 3LZZA 3Q8BA 2A6XA 2XJRA 2JJ6A 3QLQA 2VE1A 5CCHA 1UOJA 2D3RA 2GSYA 1JZ5A 2WWSA 2K0GA 4HN0A 1CONA 3CL1A 2W83C 2CHHA 2QQIA 3E6DA 4KWKA 2FFDA 3VBSA 2UYAA 4L74A 3VDDA 5LEKA 1JYCA 5E89A 2WIIB 3TN92 1QJX2 4LMFA 2JDYA 1BEV2 1RUI2 1VDFA 2RM21 2WABA 3BCCD 5A7SA 1SPPA 1WCKA 1NLQA 1UQXA 5AVXB 1PP9G 4JRLA 1A8MA 1RUC2 2BDRA 2LUWA 1ZVFA 3CKHA 3VBRB 1ZP0C 5CJ0A 3JD72 2VQTA 2VC9A 4DXTA 1MUUA 2XG3A 2WZ7A 3AEBC 2VNGA 3HEIA 2XL7A 3EBRA 4CU9A 5CFCB 4KU8A 2MKVA 4CYDA 1PM7A 2LROA 4D7SA 5DG1A 1KFUL 1WCDJ 2NZ9A 1X9PA 1SQPG 4CXXA 5FUNA 2XHNA 1PGSA 4EOTA 1AUYA 1ZBA2 3VBOB 4PV1B 1C8M1 2HLEA 3O14A 2Y0IA 4Q0QA 1FDIA 3WHTA 3PJSK 3VBSB 3SH4A 3RL0C 1AYM1 4GOFA 4FPJA 1H0TB 4XETA 2HWE1 4FO9A 1ENSA 5FRAA 3IN9A 1C28A 1ND2B 5A1LA 5JSRA 1ENQA 2NN8A 3K75B 1XPWA 4BK4A 2M3BA 1L0LE 4S2FA 4AFAA 1UY0A 2DVAA 4GDOA 4BYYA 1LODA 1QJZA 1GK4A 1AR62 5HV4A 5T3NA 2SPZA 2LTNA 4BZ4A 1Q8OA 1OHFA 3H1HG 4GJZA 1KQFB 1DIWA 4AGVA 4RS5B 4QPIB 4G4FA 2YGMA 4PD4H 2P3YA 3AMHA 3AMNA 2GDFA 4AZZA 5C9AB 3POIA 2PHDA 3H3UA 1EZVI 2AXTE 1JO5A 1J1TA 1COV2 1UNBA 1W0OA 2J1AA 4ES8A 1OW7A 3H25A 1DGWA 2PFWA 3E5XA 1NYHA 1QMJA 3OUHA 1WT6A 4IEPA 4KNCA 1AR93 5G05L 2KR2A 4IE4A 1W9TA 2ZHKA 3BODA 1UPSA 5JZGC 1SMVA 3M3IA 5C8CC 3KCYA 2WTYA 2RDQA 3WUCA 3UT0A 3ZX7A 1H0BA 1V00A 4M3CA 5LBEA 4IW3A 5IWFA 3D70A 1FXZA 2W47A 3CWBJ 1UU4A 2R30A 5CYYA 3L73J 4OGQB 1RHI1 2W6AA 2JJLA 5GTIH 4QGLA 4FAHA 1S0DA 3MIFA 2W68A 2RDRA 2Y6LA 3M1HA 3R4DB 2RMU1 1NTMK 3ZN6A 5FYVA 2P67A 2E31A 1KFMA 2KSEA 4GJYA 2XXZA 1RXGA 1SS1A 2JG8C 2WSVA 4LEJA 1PFIA 1QQP3 1PGPA 1X7NA 3EWKA 2JD9A 4NHMA 4ZONA 4COYA 4EN0A 1XTGB 1C8M2 3D71A 5CBNA 1H9PA 2IXIA 3Q8EA 3CLPA 4IUGA 5D2AA 5D8AC 2OUJA 3B3QE 3W20A 5HPOA 4COVA 3AEEC 1W9FA 3NJVA 4AL9A 2RR12 2VO5A 2XUEA 2ZKLA 3L71G 4QX0A 5A80A 4AGGA 5KC5A 3RZGA 1UZVA 1N7LA 3PTRB 5FMCA 1URQB 2WQ4A 2BFUS 5K9YA 1YQ3C 3H1KJ 2W6JH 1XYPA 3AYCA 3ZFFC 5FOBB 4FTSA 5APYA 1ULPA 1LWUC 4DEQA 5JXIA 1AL23 2EAKA 1U57A 1SQBJ 2HYKA 4YNIA 4XF0A 3LFMA 5K0UA 1OI6A 3T30A 4XJ8A 1MEC3 1U7MA 4CPGA 4KI5M 1FMD2 3HJRA 5DZGA 3UGGA 3IWZA 4YZ2A 1W2BO 1VE0A 3URFA 3PVOA 4IERA 4FTEA 2R1BA 4CUAA 3IDBB 1DQ4A 1XTCC 2VVEA 4ZNCA 3PUIA 1PK6A 1OW6A 2CV6A 4NHLA 5C4WA 2JE8A 3LOIA 2B88A 1R1A3 3PTYA 1HH0A 2HBTA 2RS51 3AKSA 3JBG1 3OBTA 4XZPA 3VBHC 2WSSH 1PZ8A 1RJ8A 1UY3A 2CSGA 1ZX5A 3A0NA 1EZVE 4UB8H 2VZ1A 4ASMB 4Q4V2 4O7XA 5C3RA 3LD8A 3B5NA 2C6SA 2HWB1 2XR4A 3WDWA 1C5HA 4IV1B 3Q1MA 2OZJA 5F9TA 2ZX0A 3VN0A 4UYBA 2A45G 5EYYA 2PHUA 1NTKE 3HUSA 3VGIA 2XJUA 2BEQD 2D2CB 5AC91 1CPNA 4L11A 4UFMA 1GQGA 2OQ6A 3NV2A 4JCKA 5F3IA 1N8RQ 1UOGA 1BMV2 1NY72 2AXCA 1POV0 4XC9A 1ZYBA 1ZRFA 4I2LC 1ZZ9A 3LDKA 2EXKA 2P58A 5FZHA 4ES9A 3J8F1 4Q0SA 1D4M1 2YC4A 5DMYA 2QQMA 3C8XA 1QL1A 4QU2A 3H1LG 2A06D 4D94A 1JU3A 3I2KA 3AP6A 4RS5A 2JWAA 2GC2A 2N7GA 1NXD1 4N90A 4UW5A 3L70D 5KAIH 2RS13 3J7NA 3ES1A 4RD7A 1VQ5P 2D40A 4PI2A 3AKTA 3CX5D 2WNVC 1QDOA 1SFPA 3U14A 1WLWA 5EV7A 1XQNA 1ASJ3 1DBNA 1OPMA 1PIV3 3TEWA 3VHNA 2QEXP 3TNUA 3IM0A 5FKBA 4YVSC 1MS4A 1R5LA 1OKOA 4DUXA 4C1WA 3HD7C 2V7QH 1HRI3 1LR5A 2UWCA 4Y1YA 5T5JA 4UXAA 2J7MA 3DECA 4LT5A 1FV3A 5ACA2 2E63A 2IBZG 2NYYA 3JB4C 4LR4A 3C1LA 1O4TA 4FP2A 4GMP3 1YI2P 3H1IJ 2D5FA 5FY7A 3WG1A 4LQRA 4CP0A 3MIGA 2QZ2A 3RZLA 2KM2A 4JHZA 1L0NK 4C46A 5G04L 1LTAC 1OVRA 3M06A 1FZCB 3ZYPA 1F8VA 1M1JB 3L72D 4PT6A 4A3XA 4CDWA 5K7PA 1JHJA 1RE4A 5FZAA 5FMOL 5SV8A 2FDFA 3SHRA 4I2OA 2CYFA 2K46A 3RBZA 5GLTA 2XJQA 2H89C 4LO4B 1RUF1 5APSA 1BVVA 2WITA 2I07B 5I0RA 4YGCA 5IFTA 4NHXA 1NU1G 3HTKB 3FUQA 3MUDC 2O3JA 4LNVA 1GL2A 2JDIH 4AAPA 3GALA 2TUNA 2YMKA 1A8DA 3L2HA 2NLRA 3PLNA 1LCLA 2W94A 1RC6A 3N7MA 2D6OX 1WMDA 1DGLA 1KN7A 2VNRA 2FCTA 1FV2A 1ST8A 4KGGA 1VAVA 2WT7B 3WV6A 3ZYIB 5CFCC 4LBNA 1SQVD 4MGQA 1YTZT 1VL2A 5CCGC 1YIJP 3HE5A 3M0DA 4HG6B 3WF2A 3AMPA 4HLTA 3D6YA 1P8JA 3VBFA 4A45A 3SWYA 1M4WA 2IFNA 5BNPB 4OHXA 2BOIA 2V73A 4CDXA 2PRRA 4XAEA 1PM4A 5M1BA 3H1IE 4UB8E 4CCCA 4EJRA 1IS3A 5M0TA 5HXVA 1LP1B 3C9IA 2VZ3A 1HJ0A 4GAZA 4AI3A 2N1TB 1X82A 3RK2D 1AL21 1K12A 2XWJB 5FQ0B 5FLJA 1KILB 2WWWA 3JCUH 1QH7A 4L8QA 4H0LB 1XC6A 4WM8A 2WINB 3GHNA 3CC2P 4Q4W1 4W4ZA 2W95A 4XJUA 5LK5A 1Z0HA 1VMHA 5KKZC 4YARA 3AE1C 4AQTA 2IBZE 2P10A 1KD1Q 4LBOA 2YPJA 4DOJA 3VYIA 2HWC2 1SQPE 4NOTA 2BRTA 1UD1A 2CTVA 3RS6A 2VUDA 1HWTC 1HB1A 1LTGC 2VAUA 4XE5B 4LHNA 1NAYA 1LNSA 3A0BE 1RUE3 4HSLA 1SLTA 1E5SA 4B4QA 4C1XA 5JZGB 5LBFA 1IKQA 3MHZA 4QHZA 1BE3J 1L4AC 1O59A 1ZBE2 3QH9A 4I7ZC 3QH7A 4Q4V3 3NAPB 4BIFA 5C8CB 4EYUA 2Q3EA 1BE3G 4W80A 1HN1A 2WO2A 4GKGA 1AYN1 4CP1A 3IMNA 1UY1A 3AX4A 2HWB2 2FXPA 5F37A 4PF1A 4OI0A 2R072 1OXZA 5FPBA 4OI1A 1BDCA 1H0TA 1ULEA 1X36A 4K1ZA 1HBWA 4CTEA 4GODA 3LSEA 3C7GA 3DN7A 3OBRA 4LKEA 1JYWA 1KB9I 1TMF2 2YFUA 2Q5UA 1RXFA 3AYAA 4XDOA 1W9YA 3HMYA 2LW8A 2WT7A 2AYHA 2DUOA 3RQ0A 5CCGA 1FJPA 1QU0A 1ENRA 2A71A 4YM0A 1BGYG 1ZA7A 1HDKA 1D4M2 5CFCA 1P84H 5FAXA 4N7UA 5LA2A 4GKXA 1DF0A 1S4XA 2PMWB 1J83A 4FI9A 2FDIA 3Q8CA 5LY1A 1EUUA 4KWJA 3O12A 3ASIA 2ZHMA 5FY9A 5F7UA 3Q8FA 5C39A 1JI6A 1JBCA 2WSCJ 1C1LA 1RL3A 2DV9A 5A7OA 2P3KA 5E79H 4FFGA 3BTZA 1W6QA 1U5ZA 4RHV1 1SP4A 3L74E 1RUJ1 2QVSB 2WFPA 4LUKA 3T3YA 3WSOA 2R042 4FPCA 4QMAA 3NKGA 1NTKD 5E79E 2P6HA 2A6VA 3L72G 3EB7A 1KV4A 3H1HE 2YXQB 4XQDA 4YW2A 2P3IA 2B89A 3VMAA 3A21A 4O9GA 4QM8A 3SKVA 2JWPA 4BU2A 5BNOC 4JX0A 5L7OA 3BCWA 2OYHA 2ZAAA 2QRXA 5T50A 3O1TA 4IL6H 2H88C 3MGNA 4NIIA 5FY1A 1RMU3 3ZDSA 4E2QA 2JB4A 1MZ5A 4I30A 1H9WA 3VKMA 1Z7S3 3M3EA 4WM8C 1SFCB 1KZUB 4QHBA 2EXJA 3F2ZA 2N1TA 1E5IA 5GZDA 3FN9A 2ZGQA 3T0DA 3ZFEB 4IEOA 2ZGUA 3PU8A 4OLLA 5KLVD 5JUVA 1BSHA 3ON7A 1HN0A 5FY5A 4D7TA 1GNHA 2Z5WA 2GP5A 2ETEA 3BU0A 1ODMA 1S0JA 3OYWA 3PHLA 1AYN2 2HEYF 1RUF2 4HK8A 4HKWA 3L74D 5APWA 1LJ7A 1W2EA 2WNVA 2PQSA 4LIVA 4QPGB 2OYOA 2R32A 5LBBA 1ULFA 1ZZ7A 4K7JA 1AVBA 3Q5RA 1DGRA 2XLAA 4ZMDA 3VBFC 3S0MA 2D7FA 4HVRA 3D8CA 4AEMA 3CJIA 3UV9A 3H8XA 3HQRA 1FE6A 3B8EB 4H44C 1HRI2 2RS32 2ZPXA 5KLVG 1N3PA 3VD9A 2E43A 1GL2B 1ZOYC 4N78E 1R091 2XJPA 4CU7A 1V6NA 3HD7D 4LXLA 4COZA 1YC61 3H1HJ 1VQ9P 1JOBA 3WDUA 1K5JA 1AJOA 1DEEG 1Y9BA 1L0NE 4DMIA 5B2GB 1NZCA 1GTWA 4MGTA 5B4NA 3AEAC 3GZAA 4OH8B 4IV1A 3I59A 1SQBE 4BIOA 4L76A 2HLOA 4IEZA 1LNQA 2ZVOB 3BRTB 2E51A 4OUEA 4XYXA 5CU1A 3UL2A 5HXMA 3A23A 4XFIA 3GNEA 4GA9A 2J1SA 4BPZA 1T8ZA 4PI0A 1S2EA 1VBC3 2H8PD 1O5LA 3HVDA 2YV8A 4YVSB 2ZJSE 1YYNA 3HD7B 4KMQA 2PP6A 2ZGLA 4P5YA 1BLZA 4EN6B 1NLRA 1O7FA 1RUC3 4QB6A 2ZBJA 3FX3A 1BCCE 2O01J 4NWVA 5FQ0A 2R5BA 2GC1A 5H2FH 1F9KA 4FTBA 3CMAP 5I0UA 2VMEA 2R3SA 5CHXA 4R4LA 2CAUA 4H44D 4LHKA 4CCLA 3POBA 3DF0A 1X50A 2JDUA 2W46A 2R062 2LR2A 1GZLA 1LOGA 1WW5A 3FBMA 1R1ZA 5GLWA 3L35A 1IPSA 1LULA 4E4SA 4KL1A 5FZ3A 5C3QA 2C0WA 4IXLA 4YVSA 1M1JC 3ZN5A 3NMDA 3GBWA 3ZYFA 1VBE1 5F3EA 3R6SA 2E75B 3TWIA 1T2KD 3UYJA 1GWMA 4EWDA 4QX8A 3JBG3 2A6ZA 4LE4A 1AF9A 2H6BA 2E33A 5KTBA 1DYOA 3HIFA 3LA7A 4K9SA 4LORA 5FFOC 5CEHA 1FAVA 2E74C 1UKGA 2M5AB 3N9OA 3CLQA 3GBFA 4LTAA 4RR3A 3ZDVA 1WCSA 2BEOA 3SC7X 4BHPA 5FREA 4HJGH 1BBT1 3PP5A 3USSA 5FP9A 3ZXDA 5HCHA 4DPNA 1NQJA 1OKQA 2JECA 3B69A 5JLVA 1FZCA 2V7QJ 1T2XA 2WNEA 2PAKA 2IFMA 1A02F 3E7KA 1GZWB 1OLME 1W6PA 1Y4WA 3OA7A 2JG8A 4OI2A 5F5AA 2XQRA 5IHRA 3N4MA 1PV3A 3DEMA 4D6QA 1YFUA 4D6RA 5K5GB 4E2GA 1FDMA 1CVNA 2IUWA 3ZLIA 3F89A 3HUSC 3OG2A 2ZEWA 3CX5H 1DLLA 4U3FE 4R4ZA 4E2SA 4AVAA 1LT9C 1QKQA 2A70A 2HODA 2OZ6A 4EN8B 4OYUA 4TTGA 5KJ7C 1NKNA 2N1TC 5FYTA 3AE2C 3KXDA 3VP9A 3HE5B 1EDLA 1AJYA 2XJVA 3VBHA 3G9RA 3FLRA 4JDMA 3VLBB 5CJ4A 3O1MA 3VZOA 4WY4C 4J6GA 1KILC 1D2SA 2D6KA 2HPCB 2HWB3 2ZGRA 4ZU7A 4Y1XA 1H6YA 5KXEA 2VOWA 3OD4A 1IS6A 3KLSA 4BXLA 1HRI1 3K3OA 3CNAA 2WDBA 3ZVXA 1A02J 2KK7A 5GTHE 1JTZX 4TT3H 2CDPA 1JZ4A 1LESA 4FPYA 1JZ3A 1D7PM 3WDXA 3L70G 3DGTA 3E6BA 1RUG3 3ZXGA 4QGNA 2VD7A 2BV4A 1VBA2 2VNOA 1L4AB 4IFFA 3AZZA 3LEGA 3WF1A 5EWSA 3E5UA 3H1LD 2CWMA 2XWBB 5FBZA 3KMHA 4HVOA 4AR2A 2VQ0A 1OBNA 3M9HA 2BNMA 5DJTB 1E5RA 2H0VA 4CXWA 4YZ5A 1MVEA 2XB6C 1QNWA 2KB7P 1FI2A 1GZCA 2XKOA 4WBBA 4R9DA 3UGHA 4AVSA 1JZ7A 1OOPB 4AFBA 2KD7A 3IKWA 1HV0A 1MEC2 3AECC 3NNJA 3N4XA 1OVPA 5FLHA 5FZIA 1OA2A 4MZUA 3CD6P 2KIKA 1CESA 3RJ2X 5AVTB 2WS92 4ZS3A 1VQMP 1JMBA 1LKNA 4XIOA 1EAH2 2O8OA 4QXHA 4AYUA 2QJKC 3L75G 3AL5A 3AYEA 1L4AA 2OTLP 5C8CA 4CEWC 2WSUA 3L71E 3AE5C 2HWE3 4KH9A 1GWKA 5AVQB 2Y0CA 3ACGA 3IAOA 1IC2A 1N7SD 3P8MC 1H8VA 1CAXB 2OYIA 2VL4A 3RZJA 3B9IA 2BP6A 4Y5TA 2VTXJ 4YM1A 1MS0A 3AZYA 4P9LA 1MZEA 1NJIQ 2VZQA 2EAAA 4FPLA 2E42A 1EPZA 5FYSA 3LEMA 1UIXA 4MOAA 4XJZA 1IZNB 1SQQE 5F39A 1BYHA 4EROA 1PZQA 3NNMA 1NCQA 1Q56A 4HFSA 4WV8A 5C3PA 3VB9A 2I74A 3N7LA 4D7YA 5JMCA 5F6LB 2H43A 2ZX2A 5C8WA 2XUMA 1IHMA 1VMFA 4CP9B 2UURA 1I3HA 4YLZA 2PXJA 3SEPA 1RVF2 2DBNA 2Q4SA 3ZFEC 2DCZA 4PD4I 3LQCA 2XGXA 2VZTA 1RITA 2D6MA 1VBE2 2VUCA 2OYZA 2B9UA 2O01H 1JZ6A 3VP8A 3MUZ1 1AYM3 2VMFA 5JWPA 3JB8A 3MI8A 4XF9A 3I59B 4GWIA 3IFMA 5D1IA 4M3LA 1V6LA 1SCSA 3A0HE 4XUQA 1ND3B 1SFCA 3V0AB 3ABVC 3SWKA 5L9BA 3U37A 2EXHA 4ZY9A 3VBFB 1NH4A 3QWOC 1HJBA 1BK1A 2B9VA 5IYYA 1KS4A 4KU7A 2BCCD 3A0BH 3FFZA 4NPEA 2QSIA 1SDWA 5GLUA 4Q8LA 3I2IA 2EIDA 2RDNA 4Y99B 2WO3A 3HN1A 1C3HA 3P1IA 4MGKE 4XILA 1Y9QA 1GL2C 3ILRA 4GALA 5IW0A 5LA9A 5I91A 3MUDA 4RESB 4AQ2A 3FWLA 2W8ZA 1LECA 3K48A 3OBZA 4P14A 1CX1A 3LAGA 1O8SA 1J84A 3V6IA 2HYNA 3TGUD 4FPEA 1ALYA 1HXS2 2LRPA 4Y1VA 1EAH1 1UN1A 5T54A 1VBA1 1X9VA 1SDDB 2ENRA 2VH9A 3FMGA 2KXPB 2W9XA 3LSDA 4IEVA 5GTIE 4GULA 5FP7A 3FJSA 4W6WA 2B8MA 1ZBE1 3H7JA 3K3NA 5KLVJ 4HETA 1O3RA 1RUH3 2B87A 3M3CA 3I97A 1I5ZA 1XNKA 2G19A 5IATA 2NPSD 1TNFA 3KVBA 3KT7A 5FZFA 3SLIA 4DY3A 1P84I 3PVNA 3BCCG 1IJDB 2YUEA 1RHI3 2Y8KA 5FZDA 3KB5A 1RUOA 1ZR4A 1W39A 1KTMA 2ES3A 4COUA 1PX4A 2QJYB 4Y1ZA 2YFZA 2J1TA 4K21A 3EQEA 2UWBA 4G3YC 4XURA 5F6KA 1DU3D 2VPVA 1RMU1 4PQQA 3H6PA 1DQ5A 1RUG1 4QX1A 5A3NA 1G9FA 2RS53 1Z7S1 2C26A 1J3RA 4ZPIA 1IFPA 2AEFA 1HB3A 1RUD2 3AZWA 3WNNA 5FZ7A 1CIWA 4DOUA 1RINA 1M8OB 1SQQD 4RO0A 2HJIA 1SQXJ 2ZAEB 2ZXQA 2AUYA 1URQA 2P37A 4MX3A 3WCRA 2I1KA 1O4YA 3A22A 3TN93 2E74B 3ZXFA 4RFRB 3W68A 2YIUB 3B02A 4FOYA 4PBOA 4XEZA 1W99A 2QE3A 3WUVA 2A45H 3AXEA 3ME2A 4X6QB 4COWA 4IL7A 2XPJA 2HFED 5AW2B 2CDOA 5CZKA 3GF3A 4EIJA 4RHV3 5F5CA 2BYVE 4Q4W2 2JDPA 1YHQP 4DRRA 5KJ7D 5CFDC 3JZVA 3VD3A 1VAMA 2JP3A 2Y64A 3W67A 2ZHLA 1LTJA 1L0LJ 1KYOH 4XFBA 3ZN4A 3CCEP 2YB7A 2BQPA 3PUQA 3Q8AA 4NAMA 4X6RB 4Y20A 1W8TA 4L2NA 4Z82A 4J1XA 4NRMA 5J1XA 1CPMA 2JDMA 1X9TA 1OVVA 1UMZA 1L0LG 2Q30A 1XE0A 3THDA 1BGYJ 1FNZA 4B7KA 1BE3D 1UIIA 2V09A 4Y5SA 4JF7A 3IDCB 2HR3A 1FZEA 4FVVA 3FC0A 1AVOA 3LKJA 5ABJB 2J58A 1VBD2 4LBJA 1NA1B 1BKZA 2WR9A 2KOGA 1G6NA 3AEDC 1JYXA 3L72E 4XVHA 1V6MA 5BNNA 5FZ6A 1BMV1 2QQLA 1BCCD 3NL1A 2IFRA 1WKYA 1M56D 3OW2O 2MEV3 4YG3A 5LK7B 2FDHA 4UFIA 2W08A 3L75J 1RUE2 2BUKA 4QQPA 2NP0A 3J9SA 3MO4A 3LWCA 4DRVA 1LGHB 1LTTC 5CMZA 3L73E 1NOHA 3GDBA 1AX0A 1D4M3 3NV3A 5JR7B 1PVC1 5FBJA 4BXSV 1F5JA 3JCUE 3BOWA 2PLV1 1ZN5A 3LDBA 1W6OA 1I1EA 4N6JA 1RY3A 1RYYA 4HANA 1FZBA 1MS9A 3USUA 4HB1A 1F4HA 1OQDA 1PNFA 2GN3A 4OULA 2DVBA 3WD5A 1IKPA 1WBFA 1TMF3 1JM0A 4K40A 3H1JG 4AI8A 5FO9B 1JB0J 1OA3A 1ZM1A 2PHRA 3AP4A 4IE6A 4MV2A 2R16A 5DN2A 1DQ2A 1M06G 3EFGA 1SBFA 5JXGA 5IT6A 3KM5A 2DDUA 5FZ4A 2R041 5FMDA 2FDJA 2PHFA 4L97A 2GAUA 2ZACA 4QHOA 5LY2A 3H0OA 1F5FA 4I3PA 1GQPA 5DDJ2 3N7NA 4NPLA 2WPSA 1DGWX 4CCKA 4Z8BA 4A7KA 2ZGKA 3DPRB 5KHIA 3K4ZA 2HWC3 3BVCA 4ASLA 1OUSA 2ET7A 4XABA 5DUXA 3WQ7A 1QHDA 4IV3B 5FCCA 2WBKA 1JOPA 1ZBA3 1WUVA 1EAH3 3D82A 3VUOA 5GALA 4CDUC 2IXKA 2QJKB 4YW1A 1O5UA 2HWE2 4CEWB 1ZZ6A 1G9BA 1YFYA 1WMXA 3ACIA 2IXLA 2X53S 4JYCA 2YC2A 2KNCA 2HWF2 1ND3A 4LJHA 3V0AA 1DDLA 2ZX3A 4BISA 1UYPA 2VOXA 5T5LA 1VBD1 1UPIA 4Y4YA 4RKUJ 5CCHC 1N3OA 3MFCA 5AVPA 5FIXA 2FMDA 4OQ9A 3SFDC 4TZDA 4YGEA 1SQVK 5FPVA 4ORFA 2PAJA 3ZM8A 1LENA 3GJBA 4UFLA 5C3SA 1ZV8A 1QNYA 1UOBA 3CDZB 2NZ2A 3H1ID 3NTNA 1Y7BA 3FWEA 3PIJA 4Y20B 1H8TB 1W6NA 5BU8B 4PDWB 4AVBA 4PF5A 4R4XA 1Y9MA 2UWJE 1R083 4I1LA 3U1CA 3O6QA 4L9BA 4QDSA 4AWDA 4JQTA 3TGUE 3NW4A 3GHGC 4BRYB 5EJZB 1HF9A 5FPLA 5BXXA 1Q2NA 2WSFH 3I55P 1AYM2 2O1QA 3THPA 4QXKA 1NT0A 2VXRA 1QJY3 1BGYD 1WW7A 2AEYA 2OVUA 2WLQA 2RVAA 1YIPA 2XHKA 4FPHA 2PHLA 4QPWA 1ZRTD 1VF5D 3CCRP 3CC4P 2QIWA 1ND3C 1KXGA 1HB2A 1MZFA 3P8CD 1QXPA 1XSRA 1NU1E 4CPBA 1OUXA 3KHCA 4AQSA 2Y9ZA 1JYVA 4CDUA 1CZQA 1KB9H 2VW0A 1X0TA 1QOSA 5K0UB 5FOJB 5DUWA 4QGMA 1RIRA 3P5BA 4R9CA 1XNAA 4DJGA 3A7OA 3T1LA 1Y43B 3V2QA 3T97A 3IF4A 3UETA 1B35B 4JAAA 3NRUA 2D43A 4O9BA 2KA3A 1XU2A 1Q3EA 4Y3OA 2B39A 2VECA 1AL0G 1LGNA 1XYOA 1SQ4A 4N8MA 4P9XA 2QQPA 1RQUA 1LHOA 2DVDA 3BTYA 2ZT9B 2WO1A 4ATFA 4CXYA 5AW9B 4UOJA 3GMAA 1S2BA 4JPZB 1QVGO 2YBKA 4XBLA 5APAA 2VNVA 5AW4B 4WZFA 5HI0A 1Q8VA 1S72P 1IFMA 2J42A 3FE5A 5BYNA 5CAZA 5L9VA 2AGSA 4BCUA 3TGUG 1UKRA 3WG2A 1LTJB 2K3RA 1D7MA 2VOTA 2Z69A 1KYOI 3WQ0A 1R082 4AGRA 1YNAA 4BQWA 1NTKJ 1G9AA 1OLRA 4ARXA 4G9SB 4EN7B 1F15A 2W27A 4R4MA 2AR6A 2R49A 2M0BA 3BALA 4AG4A 3GG2A 1ULGA 1GP6A 2RS12 2AZ5A 2YU2A 1W8UA 3AC0A 3ABZA 1B09A 3H1LE 1JODA 5A33A 4HXCA 3G71P 2ERFA 1NVOA 1MR5A 4I09A 2JDHA 2XVKA 4I0AA 4L92A 3Q2YA 3C7OA 3G6EP 4EV0A 2D97A 4GIQA 5A3PA 1LB2A 4OVNF 4QX5A 1BVP1 2BWCA 3JUUA 2P6CA 3WF3A 2ZABA 3U0ZA 3BYWA 2FYUG 4FPFA 3RK3B 1GR3A 3DUIA 1MV8A 2DVFA 5FZLA 4MN4C 5FZEA 4O9EA 4C91A 2ADDA 1KJLA 2J1VA 3DXUA 3S9OA 1E79H 4P02B 5FUIA 5AW8B 1K04A 3VZMA 4XMIA 5F2SA 3A4UA 1QLED 4WBAA 1GKBA 4UFHA 4DZOA 1AR61 1NY71 2RMU2 2YG0A 3F95A 2C9NY 1PIV2 4NO4A 4TSVA 5KHKA 5LZ6A 4QPIA 5C9AA 4I01A 4OCTA 4UB6E 2PHXA 3KWVA 3RNSA 5JOZA 1HQNA 1R093 2BCCJ 3CIHA 3QBQA 4Q29A 1EZVG 2YU1A 3W5NA 3A2AA 3SKJE 1JUIA 1NLSA 3L73D 4IE0A 4PCRA 4KWUA 1BQPA 5CFDA 3ZXAC 1NKZB 3HT2A 1BGYE 3AKRA 3L2YA 2FQPA 4ZXKA 1IGOA 4KBBA 2ZTNA 4XPVA 1OA4A 3BIEA 1PGL2 2XKMA 4LO8A 4AK3A 3B71A 2Y38A 1VPHA 3ZDMA 1JEKA 3EO6A 5GLVA 4EQVA 5BNPA 1YFWA 2AH2A 1V70A 2HWF3 1ODNA 2IZWA 1PVXA 3JCIA 4WWIA 1YQ8A 2M5AA 4YW4A 5ABJC 2IWGB 1NA1C 4QM9A 2Q1ZB 2IVIB 4NHYA 5H2FE 5FXVA 1S9KD 2CU5A 2DCTA 1LOCA 1JUHA 4NIAA 1RUH1 3VBOA 3MUY1 4B3NA 5APXA 3SWFA 4BQ2A 1KB9E 3PMSA 3AMQA 5APUA 1W04A 4E9KA 1JUNA 4ZZ5A 5AW1B 2DFCA 3ECQA 4Q1RA 3WLUA 2O0OA 1S9KE 4XHXA 5HCBA 2GP3A 4QX3A 2BCCG 2L9LA 1VRBA 4ZU5A 2E53A 4CVUA 4LHSA 4N53B 3NSTA 2FXOA 1Y9GA 2WAAA 4GH4C 1D4VB 5LRRA 4K6BA 3VBOC 1CIYA 4PV1C 4P5HA 2XBO3 3K5BA 1ZRCA 5C70A 5AW0B 3VKFC 1K73Q 5E88A 3RPQA 5ABJA 3Q5PA 2VBDA 3I4IA 3IPVA 2PELA 4OMDA 5EJ1B 3HT1A 3T2TA 3WNKA 4TYSA 3KZIE 4WY4D 1RHZB 3PH0A 1JU4A 2E7QA 4JKMA 4K8FA 1RE3C 4ASVA 4ZS2A 1GANA 4XMAA 3O6QB 1BXHA 1L0NG 1JCCA 1UXZA 1VBA3 2RG4A 3PL0A 5AW6B 2WNOA 2QJPB 3AFGA 1YRZA 2R073 1OLQA 3NJYA 4N9HA 1CN1A 2QJVA 1BBT3 1OH4A 3ATGA 1SLBA 3AXDA 5A3LA 1K5MA 3UGFA 4FBFA 2BGPA 4D6TG 1O8PA 1IK7A 1NTZG 3EYPA 4IDZA 1US3A 4M0NA 4OVEA 4QPIC 5C9AC 5FZBA 4CDQA 2ZYGA 3DKWA 4WM7B 4BWOA 1V0AA 4IFDK 4NROA 4META 4IGPA 3C7FA 4KQ7A 2DURA 2ITAA 1C4RA 2VJXA 4IV3C 3POYA 1GU5A 2KP8A 1HQLA 1AZDA 2VOKA 4YFWA 1M90Q 1N7SA 3DYMA 5A6QA 3APBA 3PDQA 4O65A 4WVWA 1S3JA 4MLOA 1XE8A 3ETPA 1V9U2 3ZFGC 2CNAA 4CDUB 3RZHA 2V4AA 4CCEA 3BPSA 4UW3A 1FBMA 5JXJA 3MIWA 2Y6JA 2A75A 2CL2A 3AJYA 1GW3A 5E16A 1HX6A 2WFF3 1G8WA 2WJSA 1QJX3 4UW6A 2W2IA 1I6XA 1SQXE 5AW7B 1BEV3 2DBIA 3H1MA 1DD4A 1S0EA 3I3MA 3TSIA 2ZMKA 2FD8A 1QOOA 1AXYA 1Q90D 1WLCA 2FYUE 1N7SB 3GHGA 1PP9J 2D98A 3ALQA 1VQ7P 3RMXA 4AVCA 2Z5IA 5B5EH 3O1SA 2FBWC 1CW5A 5A7WA 4YFZA 2BJSA 3MLLA 3PIGA 1UF2C 1W06A 5C33A 2HBUA 1NTZD 4WM7A 4LC1A 1H8AA 1RVF3 4PDWC 4AOCA 4CE8A 1GZWA 4EI2A 3D3AA 1K5MB 1S1AA 1KFXL 1LU1A 1SBDA 3HD8B 3KZ4C 4CU8A 1GZTA 2BVVA 4B7EA 3GHGB 4BQ4A 1O91A 2ZEXA 5EFUA 5JIAA 5L7OB 1NCQC 1XSQA 4XQWA 2GH2A 3SISA 2BGCA 2W0XA 2WZ8A 3J7HA 4W6XA 1ULCA 2W1UA 2ZEZA 4RGGA 3OAKA 1ZZCA 2RE9A 5J48A 4OGQD 2JO1A 1G86A 1MZ6A 4MUVA 2B5HA 1NAEA 1W8FA 1SQPD 3R0RA 5FY8A 3ZFFB 3RGBA 3MV11 2KNCB 1TMF1 3CCLP 2AEMA 1AR63 1UW8A 4RL7A 2QQWA 5FYYA 3V56A 4QQOA 4XJAA 3MLJA 1CR7A 4CEWA 2JE9A 1CD3G 2KZJA 2R043 3AK0A 3PJQA 5KLIB 4UFKA 3VBRA 1BCXA 3N7KA 2H6CA 2YPDA 3B7MA 2O1JA 3FFQA 3DYPA 4U3FD 2ZGNA 1SLQA 4KG8A 4RFT0 2FHRA 3V4WA 3AE6C 1A78A 1Q8PA 1XOYA 3LOBA 1I5PA 1B35C 2CPBA 3H1IG 3VBHB 5LBCA 2QQUA 3R05A 1S55A 3SQOA 2HWF1 1FC2C 3UNPA 4YG6A 3VKOA 4OUSA 1BHGA 1POV3 1X33A 2J1EA 2ZZQA 3AVRA 3TEZA 2ZA9A 3KV6A 3RK2B 2HH9A 2ZT9C 1NTMG 5APVA 2ID4A 2UY8A 2WYFA 2WZR1 2ZHNA 1LTBC 1KJRA 3H1WA 3X29B 4BQYA 1YFXA 1R64A 3WP4A 2D6LX 4EZ4A 1UXXX 4XFFA 1S0BA 2FXMA 3JD71 3TDKA 1VRH2 1ZZBA 3L71D 4BMEA 1QX8A 5FP4A 4IFMA 3ZOIA 4F7ZA 3I3QA 5A3MA 1REEA 1RJ7A 2GNTA 4N3YB 2OUHA 2XKPA 2RMU3 4LULA 4JDNA 5DAXA 4JGZA 5LASA 5LB6A 3S5QA 2IX7C 1AR73 3AVSA 5FYUA 2WPVB 1L7LA 2D93A 3S30A 4A6SA 3RK3E 1HXS3 2VG9A 1QQP1 1C8M3 5FR3A 2PYTA 1FX5A 1VIWB 3ZFGA 3OF1A 4Z1VA 1TNRA 2Y6FA 1I9RA 3H3LA 1WCUA 1KILA 3IDAA 2Q6QA 1UIJA 2WNVB 3OSDA 4GMP0 4MH0E 3S1KA 4K1YA 2NRGA 2IXHA 4WVVA 1RF1A 3PJYA 3VD7A 4B8EA 2R071 5FPUA 3TF5A 1NHLA 4Q4Y2 2JG9C 1SBEA 5BUVA 2IYPA 1KB9D 1UX7A 1LT9A 1RHI2 3GZUC 2PGDA 4U3FJ 3MPBA 3OTFA 3MGUA 1JYTA 4BLIA 2R063 3T2QA 4XAAA 4PD4D 2DTYA 1ZXGA 2WQYC 2P7JA 3KQGA 2WNUA 2J5UA 3BKZA 1PGW2 3CWBD 2V5YA 1VBB3 3GZTB 1IFNA 3RI9A 4EN9B 4Q4X1 1IPJA 3CCJP 1N73C 3TNQA 3ZMNA 4W8JA 4BJ0A 1N1SA 1RE3A 2J1UA 1NTMD 2VCBA 1FZCC 1C8NA 4KJMA 3N9PA 1MZ9A 3JBG2 1FPN1 1S2KA 4XFAA 1AX2A 2EALA 1W2TA 1PMHX 1CAUA 2XMLA 5GZCA 1W6MB 4D0QA 1HTLC 3LE0A 3FX0A 2WA4A 1LOBA 2XBO2 3IPVB 5FUPA 1GSLA 3AEGC 3INAA 1TEIA 3TYYA 2A3XA 4GH4A 4RR3C 1CSBA 1DQ6A 1LEDA 2D6NA 4U3FG 5F1RA 1JOJA 4D6SA 3G6JB 5A7QA 4FFIA 3QCWA 3H1KG 3ZYRA 4CCOA 5AC92 1J3QA 2TNFA 4S2GA 3H8OA 3BUCA 3ST7A 1LOFC 3GM8A 4PJ0H 5TISE 1R081 4LBQB 5CBOA 2H7HA 4HOOA 1EY2A 2J59M 4GIFA 1WD3A 1N1YA 5F3CA 5TSWA 2LALA 3CCSP 2K9ZA 3AZVA 4EZHA 3VZNA 3DPRA 3U4XA 2EIBA 3A0KA 5C7GA 5I0SA 3TNPB 2QVAA 1QQP2 5BNPC 2JENA 5APQA 1DLCA 3H7YA 3RJRA 5A3TA 2E74D 1GU3A 4LGDE 3KCXA 1UWWA 2KI7B 2ZMNA 4WB4A 1IS5A 2ZXEB 3IIAA 4JV4A 5JPMB 2E7AA 1IG3A 4AQRD 3OOXA 4GD4A 2Y33A 3UKNA 4LUMA 3U07A 5FY0A 5J96B 1JOCA 2Q1FA 3KQRA 1LRHA 4YXDC 2QJPC 2W1SA 1AFOA 4K3UA 4GB31 5FZ0A 4OHZA 3U11A 5ERLA 3UESA 4Q4Y1 4NPMA 4UF0B 4UT5A 2BZDA 3M2MA 1X79B 4IEXA 4Y1UA 2XV5A 1H4HA 2ZVNB 3KVAA 4N53A 3WW4A 2G8YA 4AW7A 2GALA 1PIXA 2Y60A 5A7WB 3M70A 5KKZB 5TJHA 4I3GA 4DZGA 4DQAA 1MVQA 3BCCJ 2GC0A 2BVBA 2IZ1A 3WINE 1DH3A 1H2MA 2J22A 1TQ5A 5BV6A 2KSJA 3WMM0 2WPRA 1RGSA 3ZKUA 1OVUA 2HYXA 4IQPA 4YW6A 4AHWA 4HYTB 4JYBA 3CJIC 3H1LJ 5BNNB 2WN2A 2WUHA 3AE9C 3LPGA 4I0BA 5KHHA 3SITA 1JY2P 3IIIA 2RJLA 2WQ8A 4OMCA 3F5HA 3WUDA 3NAPC 3O1RA 3HWJA 3VBUC 1FOSE 3PLQA 2RJKA 3CHXA 5KXDA 4DIQA 3SXWA 3ZR6A 1W90A 1DYPA 3IR9A 1M1KQ 2JKBA 3T2PA 3LCPA 2C9LY 1KORA 3M9BA 1W9SA 2CGNA 3M3QA 3VHRA 4Z2AA 2ZX4A 3OEAA 4BA6A 4YM3A 2PA7A 4P00B 4UBHA 1FOSF 2VVDA 4F83A 3AL6A 2E5TA 1OOPA 2EIGA 5DPNA 1J2JB 2VZPA 3GZEA 2O01N 3N7JA 3VDCA 1W03A 4Y28J 5EZWA 5E6HA 1SQBK 4H7LA 4DINB 5C5TA 3L75D 3VOPA 3VZJA 2B7YA 4U2AA 3AEFC 1TE1B 1QJY2 4Q8KA 1VQNP 1U5XA 2P2UA 1SEFA 3HAGA 5L7OC 4CCDA 1JHNA 2Q1MA 1J59A 2YKOA 1QGLA 1RUD1 1UZYA 3BCCE 3KD4A 1PMJX 2C0ZA 3C7HA 3OEBA 2P2KA 4CPBD 2JD4A 2WT1A 1O4ZA 1SHWB 4CRQA 1EYBA 4AUWA 4MVTA 1AXKA 2C9KA 2ARCA 1CAXA 2Y34A 3FHQA 3NNFA 5FY4A 5E1RA 4AVVA 4P08A 5L19A 1AJKA 1EP0A 1NZIA 1H2NA 2HEWF 4MXWA 1YTZI 2BWAA 4IESA 1JMUB 3I2DA 4TWTA 2R7EB 1E5HA 1W8ZA 3GXUA 4W50A 2F4PA 1SQVJ 3LPFA 4HPKA 4AI0A 2OXBA 1ULOA 2MEV1 3LDRA 1OF4A 4RQPC 3CCQP 4R9BA 4H13C 4XTPA 5L73A 1ZBA1 4WM8B 1SFCC 5CA6A 2R44A 4NPDA 1GLHA 1US2A 3LA2A 1FDOA 5CCHD 2HKXA 2OS2A 4GWMA 4QD2A 1QF3A 4LBKA 4FOVA 1W2AX 5FZOA 1TU3F 3S5AA 1YQ6A 4EWEA 2A3WA 1ULDA 1NWQA 2PLV3 2ZAHA 1QJFA 2X5IB 2IXCA 1Q81Q 1VQKP 2P4EA 3NJXA 4BQXA 1K05A 1AHSA 3I8TA 3RK2C 3RYKA 2Z4FA 3ZFEA 1CWPA 1QJU1 1U0AA 2A7AA 1SQXD 4K3AA 5AW3B 5FPXA 4TXWA 2FYUK 1EZVD 1CJPA 1VJ2A 4QPGC 1G2CA 2UU8A 2VRSA 2RM22 4NIDA 1KFNA 4LO6B 4X8NA 4FFFA 1FATA 4ZHNA 1T6GC 2ZGOA 3DCQA 3KCCA 1CGPA 3Q5SA 1UYYA 1YCIA 2V4HA 3CX5I 4HSJA 4JDOA 5DXDA 5IVJA 3W5MA 2E76B 5IVVA 2ZXXA 1JXNA 2VQAA 4YVWB 1TG7A 5CCGD 3MYXA 1WCQA 3GLMA 3G3ZA 2OYIB 1OC1A 2HWC1 1VQPP 2RH0A 1W2UA 2NPSB 2E9QA 2E6VA 2JEMA 1ZMEC 3ZSMA 3RL0g 1CZVA 2X09A 4JHTA 4M4RA 2WC2A 2JB8A 4XHBA 5FZKA 4IEYA 3CI9A 2WWUA 1PO13 1MQTB 5FDBA 3EQ2A 1EV11 3W9AA 2Z4EA 4Q0VA 2BU9A 2EICA 4E27A 5KJ7A 2KXLA 2YKPA 4HL0A 1V6IA 2WSEJ 3L70J 1YUDA 1L4AD 1Y3TA 2XOMA 1G1IA 2HEVF 3M7AA 4BRYA 4LE3A 2PN5A 4LO7A 1HLCA 2VBPA 3IBMA 2GNDA 4QB1A 1CAWB 3RZMA 3ITKA 1FZGA 4LOTA 3VMYA 4Q5OA 3WG4A 2IYOA 4E4DX 4XQ4A 1RUH2 3LW5J 4UWDA 2BASA 1RUI3 3OBAA 1Z56A 3U59A 4QDQA 1MEC1 1QXRA 5ANQA 4ET7A 4XXPA 1NTMJ 4JC1A 1QOTA 5GZFA 5KLVK 2Y6HA 1AR91 2WPQA 1GOGA 4IGOA 2Y0OA 3HNBM 4QKDA 1COV1 4IL6X 2CWSA 3B00A 5K4LA 1OFSA 2WFF1 2Y26A 3WW1A 4M3CE 2LXCB 3UJOA 4ARYA 2QM7A 2E75C 3ZYGA 1GW4A 3CXHH 4ZKUA 4H7MA 2BNOA 1T3UA 3OUIA 4YWAA 5F8PA 1J3PA 3CXHI 4U7JA 3WP5A 3WR0A 1SG3A 3R4UA 1DFQA 4PIYA 2P34A 4RHV2 3WVJA 4LHLA 2OT7A 5A32B 4B1LA 4XE9A 1PO22 5JOYA 1PX3A 1LHVA 1U12A 2FZ1A 2V4VA 1M1JA 3SCHA 1VMJA 3RGUA 4C8DA 4CDWB 3VTPC 4CUBA 1KRIA 3CCMP 5JI9A 1J1EB 1G1JA 4NPFX 1RE4C 1Q8QA 3KZIH 2RS31 1DX7A 2JKXA 3VMZA 2IVJA 2PAEA 2XLFA 2FYUJ 1Q86Q 3WW2A 3WQ1A 2AXTH 1R092 1IK9A 5CNAA 5JXHA 3J8F3 4ATEA 1NTZK 1W9WA 3POWA 5EHDA 2LM3A 1L3JA 2OIIA 2F17A 2WZPP 3BU7A 3V4QA 5IK8A 4WY4A 2ZCWA 3POJA 4D69A 5GTHH 4FQ4A 1PPJD 3MIEA 4XFCA 1UY4A 1N47A 3HBZA 2QDRA 2ZKNA 3K4AA 3MHVA 2K2SA 2QUOA 3N9LA 4INDA 3DKQA 1RH5B 2O1KA 5H9RA 5KBFA 4RGAA 2E5YA 1H1AA 3GYDA 2DCKA 5F5QA 1U5IA 1YHFA 2IPPA 3ZPOA 4F8AA 2Y6KA 3ELNA 1EQ7A 1IFDA 3D6ZA 4MXVA 4CDXB 3HN3A 3BVHA 2JXAA 1LAJA 4XA4A 4QKNA 1O3QA 3SSUA 1SQXK 4WY4B 1VB2A 2EVXA 3CQOA 3K51A 3P7KA 3Q9OA 3II6A 1W6NB 1JY3P 2QFEA 2YHJA 3JQXA 4AHXA 5BY5A 2YO2A 5L8RJ 2W90A 1GNZA 3GBGA 4UBGA 4P9GA 1PZ9A 2BNNA 3MIDA 2RV9A 4RS5C 4GWJA 4HONA 3TBDA 3W58A 3CBNA 2W39A 1YQ2A 2C9AA 4Z92B 5DJUB 3VHPA 3GW6A 4HPKB 4N43C 5I0TA 5J98B 1MS5A 2OQQA 3L70E 3Q3DA 1QVFO 1YITP 1C5IA 2FMYA 3RYRA 4MXWB 3OPWA 3S57A 3LW5H 1POV1 1WD4A 1ZRRA 2VULA 2KS1B 1MFZA 5AVYB 2GMPA 2IXJA 3CJIB 4H2AA 4Q4X3 3KT4A 3V65A 3GF6A 4C90A 2WZR3 1H30A 5JDBA 5E8AA 5HCAA 1SLIA 3V0BB 2JIGA 2QQOA 1AR71 3IT8A 2A6WA 3O0WA 4LO5B 1EXIA 3OPTA 1QJU3 3AYDA 5LATA 3VBUB 4XDQA 5J09A 1RF0A 4QWNA 5EYXA 3CL3D 2XVLA 3OYWB 4OZOA 2GC3A 1UAIA 5FZOB 1OIPA 4OGQC 2CPSA 2OTJP 5APTA 1N2DC 4OWFA 4ASWA 4TLFA 3HPNA 4JKKA 2YXRB 3UKTA 5LCWL 3ACFA 2MNGA 5I8TA 2ARAA 2VU9A 2VMGA 4IEUA 3S7IA 4MADA 2HWD3 1S4CA 5CISA 4N78D 4V1PA 1SLLA 1YO8A 2Z2SB 1MKMA 3LB9A 1KGYA 4PBPA 2WN3A 2RS11 1PGL1 2CY6A 4K35A 2B87B 3HTKA 2NMOA 1W8WA 5B5EE 4B29A 2B4KA 4BDVB 3SMHA 5AFEA 2LXBA 4JBZA 4YZ3A 1SPPB 2GA1A 1M7LA 5EIYB 3CO2A 4GWNA 5FP8A 1EV12 5L9RA 1DD3A 1LWUA 1NAFA 1CZTA 1FPN3 1BZWA 1VP6A 4PIZA 2Q5TA 1SQQK 2VCAA 1L2PA 3WP6A 2RKLA 3W59A 1IQDC 3GCWA 4A7YA 1C1FA 4HVQA 1SQVE 1K45A 3NFQA 3H1KE 4Y22A 1YJ9P 2K9YA 1XNCA 3AE8C 1YXWA 1Z78A 3H42B 4PHZA 3FBYA 4QAWA 2QE7H 2VTXA 5T55A 2VW1A 1FMD3 4QQLA 3AP7A 4N43A 4XDPA 3VL8A 4AVTA 1UIKA 5GZGA 5CBLA 1GOFA 1PPJE 3PMEA 1YQ4C 4QT6A 3T1MA 3CC7P 2R0HA 3ZSKA 4YTPC 4RQPB 2ZMLA 3WNXA 1GDTA 4XF3A 1IQAA 2HPCA 1SZBA 2RN0A 4HT1T 5IVEA 3H32B 3RDIA 4LA3A 4AEDA 4D3WA 3C7EA 3L36A 2XLGA 3VKLA 1RUG2 2PLV2 1ZRDA 3B5NB 5FWJA 1NQDA 4Z1MH 2ATFA 2B46X 1FJKA 2X5IC 2ZGSA 3P32A 3O0XA 4NPRA 5FJKA 4E4HA 1HJGA 2VUJA 1MQTA 2RJ2A 1QJX1 2WWJA 5JSOA 4PIXA 3CU7A 1HIXA 4NJ4A 3CF6E 1JZ8A 1DGRN 4FQZA 1PK6B 3BASA 2ZFCA 4URTA 4ZKPA 1VLNA 2XJSA 3D0SA 3N36A 2R5DA 3OD0A 3O8ZA 2D2CC 1LEMA 3WOGA 4CCJA 2GH8A 3BN6A 5JOXA 4RGKA 1GU4A 1XNBA 4Y22B 3MZWB 1NG0A 1CQ9A 2KS1A 3NXSA 3KF3A 1P84E 4NVPA 1N1TA 1Q8SA 4R52A 3HQUA 2BOJA 3A3YB 1WBLA 4WZCA 4JTOA 1FS0E 4LBLA 1VB4A 2OYIC 2VZUA 4LKDA 3EXUA 5EXOA 1F35A 2ZOEB 3WXPA 2G9GA 1J1DC 1G2CB 1OQ1A 5I8SA 4AHZA 5AVUB 1H4GA 1WW4A 2Q0AA 3TYJA 5KLVE 1Y47A 1AR72 2Y0DA 1V6KA 2UWAA 1MQTC 1NE4A 2YDEA 3BGAA 3D0JA 1HKDA 1VQLP 4FOQA 4GB33 5FLIA 3LA3A 2Y9YA 3RYPA 1CI6B 2QQKA 3N9QA 4LPLA 3JSVC 2K1AA 3U4SA 1USDA 4BMBA 5EFWB 3K2OA 3PVEA 1TME2 4QDRA 1O3SA 3TGUJ 4MGIE 1JY3O 1BEV1 1YJLA 4AEDC 2BBVA 2DTWA 2DWRA 5CADA 3T2OA 4YW3A 5CKNA 3MP7B 3TB0A 1HJFA 1VRH3 2VCMA 1FZFA 1JH5A 1WA6X 5D21A 3WQBA 4A2UA 5JAXA 2VMHA 3B93A 4NWWA 1QXJA 3FUOA 5C5UA 2LS6A 1M57D 1MS3A 1KITA 3H1YA 3M3OA 3MW2A 3NNLA 4HZFA 1GP5A 3ZKYA 1GNYA 5F5IA 4XTMA 5A7PA 1FOD3 1DEBA 1SQBG 2DW3A 3E1IA 1F4AA 1MPXA 3AKQA 3I2GA 3I3EA 4L99A 4M01A 1NCRB 1W6OB 3IAQA 4ITCA 3DV8A 1GZ9A 3MDPA 3LIGA 4BXFA 1QJU2 2SBAA 4MSVA 2AENA 3L74J 5B66H 3ZIXA 1E5WA 2WVRA 4FPOB 3ZR5A 2IC1A 3ITQA 5FZ1A 4Y26A 3RG0A 3VDDB 3RFRA 3RL0D 2A45I 5JR2A 2YIUC 3KS7A 1BE3E 1SFCD 1AR82 5B4XA 4CDWC 1QL2A 2WSFJ 3RBXA 3QACA 2IBZI 1J1EC 1DYKA 1L7QA 3I2HA 5FXZA 3W21A 4XUNA 1KQSO 1U5YA 4PLOA 5KC6A 3J8F2 3SH5A 1UU6A 1NU1D 2FYNB 3OUJA 5CB7A 4AI9A 1OH3A 1CX4A 4JRAA 2Q8OA 1OW8A 4YSFA 5JOWA 1NGMB 2XZRA 1LT1A 5IK5A 1IS4A 1PP9E 2D3PA 1UX6A 1HB4A 3MTUE 4XOGA 4A7ZA 4DEVA 1MACA 1V6JA 3FWNA 1AA0A 2EIEA 2X5IA 3J7MA 1H2KA 2VBBA 1RF0C 2VZRA 4FPKA 3LIEA 5BVZA 5FPZA 4HKZH 4BQ1A 1RUJ3 5KHGA 1JYNA 1TME3 1LGCA 3P3PA 1CI6A 1F2NA 4MGYE 4R9AA 2A73B 2WZR2 4BWNA 2AACA 2QKDA 5EJ3A 4CDXC 2P17A 5A3WA 1VBC1 1XBFA 1V6OA 4XF4A 3MW4A 4S2DA 3ZPYA 3NJZA 2IBZD 3MD0A 4PJYA 5KHJA 4H0LC 2DCYA 3I7DA 5A3UA 1SQXG 2P5BA 2VXJA 3I5CA 2MEV2 1QIQA 2UYBA 1JNMA 1AR92 2P1BA 3E1RA 4ISRA 4JGYB 4N43B 5FZMA 1OFNA 3RMYA 2BPA2 4XUPA 3AP5A 2RDSA 4CDQB 2QZ3A 2O8QA 2FDKA 2N1TD 2A5ZA 2R1DA 4UB6H 5IVFA 2H0BA 2JKVA 4HKOA 4LKSA 2GUVA 1SCRA 3OGVA 4NIGA 1HXS1 2GUSA 1WMKA 5KR7A 3GCXA 4XFJA 4AFDA 4I7ZB 4EYYQ 3A5TA 1O6UA 3GJAA 4DS0A 1NTZE 1SLAA 5FMBA 4NHKA 1AR83 1AVYA 5JIUA 1G9CA 4YPCA 1URQD 1S0FA 3LF7A 3UIAA 5JI7A 1JYIA 2N9YB 1YWKA 3I2JA 4JQ0D 2WMMA 1EV13 2DVGA 3BPZA 1JCDA 1UU5A 5FWEA 2QG4A 1KD7A 2TBVA 2I1JA 4D6TD 1WRGA 1OVSA 2W3JA 2WA3A 3VDAA 3VL9A 3WNLA 2L91A 1PGW1 4K20A 4E8CA 3MIBA 1AV1A 3CMGA 3DPRC 2ZGMA 2C0XA 2GNBA 3LIDA 3HD7A 3AM2A 1VBB1 4HK9A 5DZFA 1PP9D 3V2RA 3KGZA 5FZ9A 1S5LE 2QNKA 2EF6A 2RMZA 5CVRA 4XJ9A 1Z7S2 3C2UA 4IEWA 5FYBA 3IZOA 1D0GA 4CEYC 4YGBA 3VZLA 5IVBA 1W6QB 3ZSEA 5B66E 3MV01 1GFF2 3C8VA 1RUI1 2W1QA 2KYVA 5HCFA 1QGKB 3PVBB 4XXAA 5FK8A 2R0FA 2XH6A 4JVAA 4NAOA 3RSJA 1NU1K 1BBT2 4KGQA 4TLGA 4CU6A 1VF5C 3NMBA 2VMIA 1HVVA 4Y4RA 1NE6A 5ACA1 5BNOB 2W91A 4YRDA 1HGVA 4Q0UA 2XNDH 3O1VA 5KAIE 4IGQA 3N9MA 3V64A 1KILE 3O7OA 2G1MA 5FMOS 1VPCA 3PU3A 4H14A 3KV5A 3AZXA 3SH3A 1T6BX 2DUPA 4BM8A 4N7IA 2YKQA 3MF9A 2RS33 1EDIA 1FOD2 3DL3A 2Q8CA 1UO9A 1H8TA 2BERA 2AEZA 1A6CA 1KQGB 1L0ND 1IO4A 3D6EA 1XB9A 1V9U3 2B45X 5A70A 4OHYA 1RF1B 2NM1A 3B5NC 1KDKA 1QJEA 4XFHA 1IFIA 4OQ8A 1H88A 1PVC3 3DYOA 3N3HA 3N9NA 4QXCA 5EPAA 3IDEA 3O1OA 1LP1A 3FZ3A 2CGOA 3S6PA 1D0HA 2FBEA 3M8LA 5FJHA 1NOVA 2UY9A 1SFNA 3TN91 5CKQA 2VZVA 1Q5OA 2I2SA 4YGDA 1PK6C 3ES4A 2XNXA 4C7NB 1JN2P 3AE7C 2PAMA 2M8RA 3ZYBA 1PL5A 2OYHC 3SCFA 1JTHB 5KXBA 2WQZC 5BNOA 4JZRA 1YYCA 2YMYA 4H0LD 4D6TE 5A1FA 3KDPB 4IV1C 1LTIC 1K9MQ 4LBQA 3VMXA 3OPZA 4H44B 5K0UC 5FYZA 4IE5A 3MW3A 3TEXA 2VY0A 3BI3A 4IETA 3SEEA 1A3KA 2FZ2A 4AFCA 2BFUL 1PGOA 2HWD1 1OZHA 2ORXA 4ZZ8A 1J1DB 2VW2A 1R1A2 4NE9A 2D3SA 4QPGA 3WT3A 3ZFFA 5A6YA 1VAKA 2ZEYA 3HNYM 1BCCJ 4Z07A 2F6BA 2WAOA 1NO4A 3D4KA 3MPPG 4CP2A 1GBGA 3D5OA 1GQHA 1L0NJ 2MPFA 3FHIB 4XACA 1T3JA 3AMMA 3KGLA 5GZEA 5JPNB 2C24A 1GMJA 1KS5A 2QQVA 1X8YA 2QQJA 4NR1A 4KWLA 4AHYA 3KSCA 2RM23 3I3BA 3WUTA 4YZ1A 1JZ2A 3H32A 3KYQA 1UYXA 1YIFA 4QKBA 2C1FA 4AEDB 3H1HD 1VBD3 1IPKA 3AB0A 3TRSB 4NRQA 3USUB 1VQOP 2ZS6B 5BNQA 1N73A 5H9QA 1PGJA 5T5OA 2XU6A 1JY2O 3C3VA 3IB3A 3WNMA 1YQ5A 4L73A 1KQRA 1L0LD 1OF3A 1N86A 1EDKA 2SLIA 1R5SA 2PQQA 3I3DA 5GKAC 5C4WC 5ANNA 2JG9A 4YW7A 1PVC2 3TNUB 1ZR2A 2VR4A 3AE4C 1NCRC 4GT1A 4DUWA 2ZT9D 2X29A 2R6QA 1W28A 4A41A 4P9JA 4LOSA 5AFBA 3I49A 5DAQA 3MZHA 1SLCA 1PO23 2FCUA 3EMRA 4LA2A 4XZUG 3I56P 3VN4A 3KV9A 4LK6A 3LGRA 3GHMA 3VDDC 5IFPA 1W0PA 2FFDC 3OY8A 4WVMA 3IAPA 2G9FA 2JDZA 1SACA 1SQQJ 4AI2A 4JGZB 3BOPA 4DFSA 4XBQA 1H1MA 2BGOA 5JMOA 1WA4A 1S0CA 4YZ4A 1BSNA 1ACCA 1CAUB 5DAWA 4ZXEA 2JDAA 1FYUA 2JEEA 4H13D 2JICA 3PNAA 3WX5A 2BCCE 4QXBA 1YJKA 1TZOA 1GYKA 2OPKA 2Q8DA 1LHWA 1XRUA 1ZA4A 1ZLLA 3NVCA 3THCA 2FYNC 4XCBA 2POHA 2OKXA 3WU2E 1E57A 2FKWB 4Y24A 1W2NA 1IG0A 4PDWA 4Q27A 4BH9A 3CCUP 1XJAA 3BRVB 4DUVA 1REFA 1ZW0A 3B5LB 1GOHA 4PLMA 3HUSB 3BB6A 4B86A 1Y8AA 1CAWA 3BATA 2QBXA 1X22A 3ZSJA 4DY5A 3U75A 1LT9B 1SQBD 1QH6A 3GGLA 3NV4A 1ZBE3 3WDYA 4FFHA 1CAVB 1OPOA 5DG2A 3H1KD 2Z5HA 3MBWA 4QX7A 3WY6A 5A1AA 3OY8B 2Q9IA 3M0DC 4WVMB 3J7LA 1W6PB 4NUBA 5FZCA 1B35A 4AQ6A 5DUUA 4H55A 4JTNA 4RQPA 2GMEA 3LEKA 2DU0A 3HE4A 4B1MA 1H6XA 2IFWA 4XCAA 4NMIA 1K8AQ 4RSUA 4C0HA 2ZZJA 3R4SA 3SFEC 1DZQA 2W92A 4LLOA 3U1XA 3IN6A 3JU9A 3HOBA 4JGYC 4Q4X2 1OMIA 3ORJA 3ZYHA 3ZXKA 1NTKG 3KV4A 4N53C 1APNA 2B42B 1COV3 4GH4B 3GF7A 4CDQC 1GL2D 1R1A1 3POEA 5J7MA 1ZZ8A 2JWDA 2XQXA 1HW5A 3T08A 3J4UH
chains in the Genus database with same CATH topology
3ZMOA 2ARBA 3L9JT 3WZ1A 3AJZA 2WLPA 4QQ2A 1H2LA 1PO11 4GXLA 1S0GA 3MEPA 2OA2A 4BOWA 1XNDA 3EHKA 4YW5A 5CG9A 4YXWH 2ET1A 3QOPA 4UW4A 4DNYA 4XIKA 1OOPC 1URXA 5K8SA 3ZXJA 1IOAA 2BW8A 2EXIA 4WM7C 3ZN6B 4U36A 4OHWA 1X8EA 1XU1A 2PHWA 3CEWA 2HWD2 4OFGA 1ONAA 3VBUA 3NAPA 4CZSA 1WLDA 3ZFGB 4CEYB 3RRDA 2CK3H 2RR13 1NA1A 1HRV1 5SV5A 3OGGA 4FSJA 2NQYA 3MFAA 1W6MA 4JQRA 4HBNA 2VVFA 5I8YA 4HKLA 4YVWA 4ISQA 5FO8B 1DQ0A 3OJBA 4OZXA 1UL9A 2QDNA 4E4ZA 2OW4A 4PQ9A 3SNMA 2NMNA 1K5MC 1HV1A 1QY4A 2W52A 2ZJCA 2BTVC 1RMU2 2WKKA 2XL9A 1J1LA 1NCQB 1WMEA 2I45A 1X8MA 3O0VA 2XBO1 4ZU4A 3NV1A 4KG0A 5IK7A 4WVZA 1ASJ1 4AE2A 1WMFA 2EA7A 3QD6A 4FXGB 5DDJ3 4N9IA 1MS8A 1WLTA 1TME1 2GNMA 4AEJA 2ARXA 3ZXEA 4EWAA 1LOFA 3HR9A 4HN1A 4XJWA 5GLZA 2NPIA 5CIRA 3RZZA 5A32A 3E6CC 1RB8G 3NO8A 1AX1A 3HQXA 1KDMA 2D6PA 3NKTA 3OGJA 4ONUA 4Q2FA 2WT0A 5D8AA 4Z2WA 3M4FA 4JV4A 1ENXA 2AREA 1LU2A 1IZ3A 1YI9A 4FAGA 1RUF3 4YM2A 5GJ6A 4Q0PA 2TEPA 3VZKA 3BTAA 3UJQA 3WCSA 1WW6A 1VR3A 2WNUC 3AFKA 4HMZA 1GICA 1AR81 4NN0A 2PHTA 1FMD1 1EPWA 4C0BA 5KXCA 5FO7B 3MIHA 1D2QA 3TAYA 4X8PA 2DF7A 3ROUA 3WW3A 4AFMA 4ZKTB 1RVF1 5IUQA 5C4WB 2RS52 5J3UA 5H9SA 2ZGTA 2WT2A 3MLKA 4M0HA 4Q4V1 5JZGA 2XVGA 2YY1A 1CJDA 4DB5A 1PZ7A 4I02A 3J26N 1CAVA 2YGLA 2A6YA 3RI8A 2PTMA 4F3JA 3ENRA 4JGZC 4AXOA 1QWRA 2JG9B 1PHMA 3WDTA 1F31A 1HQWA 1QDCA 1LTEA 2E7TA 5CFDB 1MS1A 1XXNA 2JX9A 2WL1A 3B01A 1VBB2 2G4IA 4Q26A 1UCXA 1JW6A 5ACA3 4GKYA 4BE3A 2GZWA 2QCSB 4FCAA 3G7DA 4XF1A 5GM0A 1ND2A 4M3CB 2RR11 3QH6A 2VGDA 2YC0A 4AEKA 1HRV3 3ETQA 1O3TA 4MGZE 3H3ZA 4RR3B 5LRSA 2Z42A 1ASJ2 1N3QA 1VALA 3ZXLA 1RUJ2 4PLNA 1S0IA 1VRH1 3H50A 3I54A 3VBRC 2DFBA 4FOWA 1NCRA 3BIWE 5L36A 5LEJA 2GMMA 3ILNA