4TLFA

Crystal structure of thiol dioxygenase from pseudomonas aeruginosa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
194
Chain Sequence
LRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Thiol dioxygenase
publication title The Cysteine Dioxygenase Homologue from Pseudomonas aeruginosa Is a 3-Mercaptopropionate Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
molecule tags Oxidoreductase
total genus 49
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4tlfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tlfA02
1RC6A 1WGPA 3ROUA 1SQ4A 2GZWA 1EPZA 2Q0AA 4Z07A 2UYBA 4EROA 1XE8A 4HN0A 4LA2A 1LB2A 5KHHA 4BHPA 4ZU5A 2E5TA 3KGLA 1OI6A 4PIYA 1VR3A 3WW2A 4LA3A 1UCXA 4I09A 4MGYE 1J59A 1J3QA 2EAAA 2OA2A 2XNDH 3IIAA 3DN7A 1SEFA 1YHFA 4GULA 4JV4A 2UY9A 1YFYA 2HKXA 1YFXA 4IEUA 3LAGA 3FJSA 2QJVA 4MGKE 3IDBB 4HBNA 4RD7A 1IPJA 4I02A 3SCHA 1EYBA 4Q29A 1WLTA 4QGLA 4XFIA 1CAWB 1CAUA 3EO6A 3U0ZA 2BNMA 4QX5A 1O3TA 5E1RA 4O9GA 4FT8A 4AQ2A 1ZZ9A 2PYTA 2QCSB 2XLAA 1IFPA 3FE5A 2FMYA 3CLPA 1X8EA 4XFHA 3LA2A 4BIFA 1PM7A 1LR5A 2GAUA 2OYZA 1NZCA 3EHKA 4HMZA 5LEJA 4MGIE 4HN1A 2HJIA 2CGPA 2GC1A 3PLQA 4KWJA 2E5YA 1OFNA 3O14A 4XETA 2CAVA 2CK3H 2PQQA 3LA7A 1EY2A 1NE4A 3BU7A 1ZZCA 2IXHA 3HIFA 4MZUA 2WC2A 1J3PA 2P17A 4DJGA 4HZFA 2WFPA 3N4MA 2UYAA 1YWKA 2F4PA 4YYOA 1O3RA 2WSSH 1DGRA 1YFWA 4KL1A 4KU8A 4MX3A 1Q3EA 2D40A 3PVBB 3H1YA 2H0VA 1V70A 3ELNA 5FPZA 2JDIH 2E9QA 4UBHA 2ET7A 2ET1A 3NJZA 1Q43A 4E2QA 3S0MA 2Q30A 3MZHA 5CVRA 2IXLA 3H3ZA 3HQXA 3IWZA 4J1XA 4LEJA 2OZJA 4IEVA 4IEYA 4R52A 1XE7A 3H7JA 3IBMA 3SHRA 2GH2A 1DZTA 1CAWA 4I0AA 3RDIA 4QM9A 4E2GA 4HLTA 3OCPA 3U10A 4I3PA 5I8SA 1LRHA 1H1IA 1FI2A 3BCWA 4ZU4A 4Q0VA 3UKVA 2ATFA 3S7EA 1QXRA 2PA7A 2Q1ZB 4MH0E 4XF1A 3RYKA 1BSNA 2OPKA 3M70A 4XFFA 4NVPA 4XF9A 4EWEA 4KU7A 2O1QA 2VPVA 1ZZBA 4A2UA 1HW5A 2EA7A 3BPZA 3FZ3A 4QGMA 2BGCA 5LEKA 5KHJA 3C3VA 2VECA 4N9IA 5KHIA 2IXJA 4L2NA 1QXJA 5FQ0B 2K9ZA 4E2SA 4YSFA 5JSPA 2C0ZA 1VJ2A 5J7MA 1BSHA 5JAXA 3CEWA 1J3RA 1CAXB 1RGSA 1ZNPA 1OMIA 5JSOA 3GYDA 4HVQA 5AVPA 3I59B 4HVRA 3WW1A 1NXMA 4BYYA 1UW8A 3JZVA 1QY4A 3OD0A 5CU1A 5JR7B 3ACLA 4EWAA 1YUDA 3E5QA 2Q4SA 2XKOA 4HSLA 3FX3A 2B9UA 3MPBA 1ZRRA 4N9HA 1I6XA 3FFQA 3SCGA 1CGPA 1WA4A 3U11A 5KHKA 1O7FA 1X8MA 2MPFA 1NE6A 4Q0QA 3D82A 1LKNA 3UKNA 3ES1A 5I0RA 4I01A 4UXAA 5KBFA 5FPXA 4FAHA 4YRDA 1I5ZA 1ZVFA 4J1WA 4AVBA 5BUVA 1EP0A 4XFCA 3RYPA 4XFAA 3CO2A 1Y3TA 4LUKA 1QWRA 4HSJA 5LRRA 3SCFA 1J58A 1FS0E 2MNGA 1GQGA 1RL3A 1YFUA 3UKTA 5LRSA 2KXLA 2XLFA 3FHIB 3H7YA 3E5UA 2VQAA 4IERA 5I0SA 4YXWH 1JEKA 4L11A 1NYWA 1UD1A 3EJKA 1ZRCA 3OTFA 5I91A 4XFBA 5FQ0A 4WVZA 3MYXA 1X82A 2H6BA 3H1MA 1CAVB 1TQ5A 3SXWA 4Q0PA 1CAXA 1O5LA 3E6CC 3S7IA 3E5XA 2EVXA 3I59A 3QACA 4XFGA 4YNIA 4D7SA 3RNSA 3H3UA 4Z82A 5JSRA 5FLIA 5I93A 4HVOA 3G7DA 3TNPB 4EV0A 4PJYA 5JCTA 2D5HA 4QGNA 3RPQA 4IEWA 2V7QH 1FXZA 5FDBA 5KHGA 2H6CA 3WW3A 2V09A 2D93A 2CAUA 4JVAA 3H8UA 4WZCA 3H50A 3CF6E 5FCCA 3VHRA 1O5UA 3M3IA 2PHLA 4LTAA 1UIJA 3KGZA 4EWDA 3E6BA 3ES4A 1OD5A 2PHDA 2K0GA 2GC0A 4XEZA 1CX4A 2Y0OA 5K8SA 1X7NA 3PNAA 3R6SA 3L2HA 2PTMA 2W6JH 1RTVA 4X6QB 2XL7A 2CV6A 4F8AA 4R8HA 1YLLA 3NVCA 2BYVE 1O4TA 5CADA 4IEXA 2QDRA 5I8YA 2Z69A 3I54A 2XKPA 4OFGA 2PAEA 4MUVA 4XF4A 2BNNA 1JUHA 4PIZA 1AQTA 1DGWA 3B02A 2N7GA 4LUMA 1RUNA 4QM8A 2DCTA 3MDPA 4XF0A 4LULA 4B29A 2QE7H 2B8MA 5BY5A 1SFNA 2XLGA 1ZRDA 3RYRA 2UY8A 2PAKA 1G6NA 2ETEA 1U12A 5J48A 1L3JA 2PFWA 3HT1A 3D0JA 5FLJA 2GC2A 4AVCA 3EBRA 1CAVA 5I8TA 2QVSB 2XHKA 3IDCB 3LA3A 2Z2SB 3KMHA 3EFFK 5I0TA 3FWEA 3KCCA 1VP6A 4LLOA 3DV8A 3OGJA 4H7LA 2IXKA 4AXOA 3E6DA 4I2OA 2D5FA 5T3NA 3KSCA 4PIXA 4Q0SA 4F7ZA 5EZWA 4IEQA 5C6CA 2I45A 1J1LA 3BB6A 3BALA 1GQHA 4MV2A 3GBFA 4IEPA 2PAMA 4ORFA 3E97A 1ZZ6A 2XL9A 1RUOA 4ZU7A 3ZDSA 3PJSK 3H1WA 2GC3A 4MGZE 3RZZA 1E79H 4KWKA 4AVAA 1Q5OA 2IXIA 2GU9A 3H9AA 3SMHA 1O3QA 4IETA 1UIKA 3NW4A 4KWLA 4TLFA 3LWCA 4AQ6A 5BPXA 3QOPA 5EFUA 1CAUB 3I7DA 3ST7A 3USSA 1H1MA 1ZZ8A 2OZ6A 3ETQA 4P9GA 1ZREA 4QMAA 4XF3A 5D1IA 1ZRFA 4I0BA 1FT9A 4JTOA 3NSTA 2BEOA 3LOIA 4X6RB 2MHFA 4YARA 3CJXA 1PMIA 4QXKA 3NL1A 4OLLA 2XGXA 4FAGA 4O9EA 2ZCWA 5FLHA 1Y9QA 3DKWA 5BV6A 4BH9A 4META 5BXXA 2IC1A 2BNOA 3EQEA 3HT2A 1ZZ7A 4K8FA 3LZZA 5E16A 5J3UA 5HI0A 4CYDA 1ZX5A 1DZRA 2O8QA 3D0SA 5I0UA 5F1RA 3CL1A 2IXCA 1O3SA 4IEOA 1UPIA 4IEZA 4JTNA 3OF1A 5C8WA 1IPKA 4DINB 3DL3A 3NKTA 3WW4A 4FBFA 3TNQA 4UBGA 4WBBA 4Q0UA 2ZKLA 4ONUA 2QNKA 1XRUA 2B5HA 4D7TA 4IESA 2FQPA
chains in the Genus database with same CATH superfamily
5C9AA 2ZGTA 3C2UA 3N9MA 1RJ8A 3JBG2 1JY3O 3POIA 5D8AA 1ZLLA 1JYXA 4PJ0E 1DGWX 3J7MA 2GA1A 1KD1Q 3DN7A 3R4UA 1WKYA 1JNMA 1YJLA 5J09A 4S2HA 2VMIA 1CESA 4EYUA 1IPJA 2BJSA 1XTCC 1CAUA 1GWKA 1ZZ9A 2HBUA 1RB8G 1R1A1 2AEZA 4CUGA 3VZKA 3L74J 3NJYA 4XFHA 3LA2A 3CJIC 3NV1A 1CI6B 3IZOA 2WSEH 3PLQA 3NRUA 1JTHB 3LA7A 3P3PA 1CW5A 2DCZA 3CX5I 3CI9A 1HB4A 3CCRP 4UFLA 1AR71 2WN2A 4FOYA 4KBZA 5FBJA 1HLCA 1V6JA 4QT6A 3WG1A 3ZM8A 5IK7A 1GZ9A 2YPJA 4Y1ZA 1MQTA 2ZVNB 3ELNA 3V2RA 3AYEA 1JN2P 1OT5A 3MZHA 1V00A 4V2WA 3WUDA 2R5BA 4IEVA 3TYYA 4BQ5A 1S72P 3IBMA 1HDKA 1LTEA 4AVVA 1UWWA 2FBWC 2UWJE 1V6LA 1TE1B 4I3PA 1JZ4A 5ACA2 2GMMA 4LBJA 4ZU4A 1DCSA 3DYMA 1DGLA 5CMZA 4EWEA 2WT7A 5KC6A 2R1DA 1HW5A 4AQRD 2VOWA 4YZ2A 3ZSMA 4AFBA 1GZLA 4HG6B 1QNYA 1UNBA 1LHNA 2BW8A 5LBFA 5FXVA 2FYUG 3O12A 5JSOA 3I2OA 4RR3C 2QJPB 4CP2A 3WW1A 3H1IJ 4D6TG 1N7SB 5K0UC 1D0GA 4CDXC 5JR7B 3MBWA 3IAOA 5GTHH 4XA4A 4YZ3A 3ZXGA 1RMU1 4KJMA 1D0HA 3UKNA 3NV2A 1Z0HA 5KKZC 1GW4A 2A06E 3QCWA 1FDOA 4LUKA 4G4FA 3HUSA 4GH4A 3VHOA 5LY1A 5APUA 2OYIC 2FDHA 2WNVC 1ULPA 2YO3A 3RMXA 4YXWH 1DH3A 3D6YA 1U7MA 2MJZA 3MYXA 4E4HA 2ZPXA 3I2JA 2BASA 3M0DA 2WT0A 3ZPYA 5FR3A 1MEC2 3L75G 4QD2A 1IZ3A 1S5LH 3CMGA 5FZ6A 1VQ4P 3C7EA 1IJDB 3PMSA 5ERLA 1NU1E 5CKMA 5FZHA 5K8SA 2K9YA 1R64A 2XWJB 2W1WA 3VB9A 4Q4X3 2W83C 2FFDC 2B46X 1OBNA 4AR2A 2RJ2A 3QH6A 1SQPJ 4BCUA 5JR2A 1OKQA 3I54A 1F8VA 1U5IA 4OFGA 4QKFA 3E1IA 1USEA 2YXQB 2P58A 1PNGA 4UFHA 2OYHC 1E57A 2DCTA 5FZLA 2ORXA 2R49A 1VBA2 1DIWA 1BE3D 1U12A 4CP1A 3PJQA 2Q3IA 1LWUC 4OCTA 2N1TD 4CEWC 4NIDA 3MP7B 5E89A 4YZ4A 4IV1B 5GALA 3WNMA 1M1KQ 4AI9A 3A0BH 3H6PA 3H8RA 1KITA 1UU6A 3HBKA 3RZZA 1WW6A 4ET7A 1G2CA 1ND2C 2DV9A 4LBLA 3ETQA 3C8XA 3ZYPA 4O9EA 4BQ4A 4PV1B 3T30A 2B7YA 2EXIA 2IC1A 1NKGA 3C7OA 4IL7A 3HOBA 5C3RA 2ZGOA 4COVA 4QX1A 1B35A 1F2NA 3E1F1 2VJXA 5TSWA 1R1A2 1RUD1 3OEBA 5C9AC 5C8WA 2BWAA 3OGGA 3AMMA 4LR4A 5D8AC 1WMEA 5CKQA 5IYYA 4Y5Z0 2QNKA 3PUSA 3ZYBA 3I49A 2IWGB 1S55A 4SBVA 1RINA 3Q8EA 5FZDA 1NU1K 2VH9A 4AEDB 1X79B 3WW2A 4U3FE 1IZNB 1HKDA 5A3TA 1C8M3 2R3CA 2UY9A 3AZXA 5TISH 4GAZA 3AFGA 1BKZA 4Q4W2 4CSWA 4LK6A 1EYBA 4TZDA 1ZRTD 1CZVA 4OYUA 5FUPA 1A78A 2NQYA 1GP6A 4CUBA 2R063 4P9YA 1JZ2A 3I3EA 3U1XA 2P7JA 3N9OA 1IFPA 3UT0A 3RK3C 4XABA 4BIFA 2OYZA 2EF6A 4LT5A 4KNCA 5FZCA 2Q3EA 1XC6A 1W0PA 2GC1A 5LA0A 1OFNA 1IO4A 4H0LD 2FYUJ 5J96B 2R071 1AVBA 4D6TJ 4L75A 1YQ4C 1MQTC 1JOPA 1KD7A 4U2AA 2Q5TA 5C8CA 4AFCA 1NGMB 3SWKA 4YYOA 4KU8A 2FFDB 1SQBJ 1BEV2 3FX0A 3FUOA 1V70A 2DUQA 5FYIA 2D6NA 3H1JJ 3NJZA 1Q43A 5L36A 4Y99C 1H0BA 3SEPA 4Q27A 4MXVA 5CVRA 5KXCA 2YMKA 1Y9MA 4QXCA 4XAAA 3S6PA 1H0TA 4NHLA 5FO9B 1RUJ1 2BGOA 5DJTB 4QM9A 1YXWA 3UKVA 1GOHA 4P9LA 1QXRA 2BTVC 5CAZA 2D6MA 1XU2A 3E7KA 2BVVA 3VHPA 4GQ7A 1L0NG 1JMMA 1SS1A 4DB5A 1DYKA 2XMLA 5CNAA 4LO6B 3V2NA 4MVTA 3KVAA 2BBVA 4JQRA 3L75J 1J3RA 4EN8B 1ZNPA 4AI1A 1ND2B 5AVPA 5AC91 2C26A 5D2AA 3C9IA 1NXMA 1HRV2 1HJBA 2W2IA 3M1HA 5FYHA 1JZ5A 2KSJA 2E7TA 4QPGC 4I0WB 2VRSA 2XJVA 2Q1MA 3KYQA 2RS51 5DN2A 3SCGA 1PK6A 1X8MA 5IUQA 2JE8A 3HUSC 4GH4C 1SQVK 4J1WA 4XFCA 1GL2A 1VRH3 3ZR5A 2VBBA 2ZGUA 4B4RA 2YB7A 1C1LA 4MG2A 4IXLA 3G6EP 1X33A 3CL3D 4HT1T 3ABZA 1RUF3 2WQYC 2Z4EA 4L11A 2E74B 1K12A 3BCCD 3MV11 3M0DC 1NA1A 1W6OA 4AYUA 3L71G 2WS93 3OPWA 1OIPA 1YJ9P 1X82A 3M06A 5CCHD 2JDAA 2XJTA 5FZIA 1YI7A 1G7YA 2B42B 1BGYE 1PZQA 3GF3A 2PMWB 1R082 1RXGA 4Z82A 5JSRA 1CZQA 4M00A 4BB3A 3OD4A 2QQMA 3H8OA 3ME2A 1K5MB 1HB3A 4P00B 2XB6C 2DCKA 2LXBA 2Q6QA 3FBYA 1JUNA 2AXTH 4W7YA 3CX5D 4C1WA 3R4DB 4XTPA 2Y33A 2Y64A 4OGQD 2QZ3A 4D6QA 4XJWA 2J5UA 5LATA 4L0PA 4XDQA 3MFAA 4XF4A 4QPYA 1S0GA 4PIZA 2N7GA 2E43A 3M3QA 4RGGA 1NAFA 1RITA 5FRAA 3MDPA 3AMQA 2HWB1 5K9YA 1H2MA 5A32B 1NXD1 1IFDA 3CCJP 3EBRA 1H1AA 1WMKA 1YQ5A 3KMHA 5I0TA 3FWEA 4M3CF 3N35A 3DV8A 4H7LA 1FZCB 3AK0A 1AR61 5T3NA 1O59A 2G3AA 5KJ7A 3L70G 1AR82 2WT7B 1PPJE 4FFIA 1V9U2 2AYHA 3K5BA 2RDNA 5LY2A 1W05A 4JDNA 2ZGLA 4A6OA 4HK9A 2ZEWA 3O1TA 2P1BA 3CXHE 1SFCA 3PVEA 5BNPA 4CCMA 2BOJA 2O14A 1MFZA 4LC1A 1FOSE 3GNEA 2G19A 2NLRA 1B35C 1F31A 3EB7A 4I7ZC 4IL6X 3CJXA 3DKWA 2YKPA 2CTVA 1W6MB 1ZXGA 1PZ7A 4UFKA 5FYYA 4A3XA 1HXS2 2G9ZA 5APXA 1X0TA 4MXWB 4NRMA 1N73A 1RUH3 1A8DA 3T4HB 4YVSA 1GU4A 2D7FA 3HUSB 2WFF1 2V73A 2XPJA 4PLMA 4BIOA 5G04L 4RQPA 2R072 2UYBA 5A6YA 2ZT9B 4A44A 5KAFH 2Z5HA 3MW2A 1ALYA 2VZQA 2XNDH 5EQUA 3HWJA 3C1LA 1CJDA 1COV2 2ZX1A 3FLTA 3MLLA 4JQTA 3L2YA 3VZOA 4CPBA 4KGGA 2F4LA 3PDQA 4QGLA 1NTMD 3HMYA 1SQXD 1O3TA 1KILE 5F32A 1URQD 3MIEA 4GWJA 3VBSA 4QB1A 1X8EA 1DD3A 3POSA 1GV9A 1NCQB 3OOXA 3VBRA 3HD7D 1GK6A 2D2CB 2CGPA 2YKOA 4TWTA 1RY3A 5C8CC 2DWRA 3QWOC 3KB5A 4U36A 3BODA 2VZVA 4N43A 2IXHA 1OUSA 2BV4A 1BCCE 4BLJA 3ILFA 1H8VA 1JY2O 3Q8CA 1UL9A 5BNQA 3L72G 1YFWA 1AR73 3PVBB 1YRZA 2JDUA 3NMBA 5A3MA 2Q9IA 4UBHA 2ET1A 5IT6A 3CCSP 4D3WA 3Q1MA 2QG4A 1V6NA 3AP5A 2OX0A 1UX7A 4AQSA 2JG9A 1PVC1 3MO4A 5HV0A 1AJKA 4TT3H 4D94A 3FMGA 4C0BA 4H13C 4QQLA 2A6XA 3PUHA 4HLTA 3P5BA 2DU1A 3I4IA 4CZSA 3TSIA 3AB0A 1W2AX 4FPJA 1WBFA 2FCUA 4EJRA 2OW4A 5F8PA 2VPVA 4CVUA 4K6BA 1VF5C 3FZ3A 4QGMA 4YW1A 4L2NA 3L73E 5BNNB 5FMOL 2YUEA 4NHXA 1LECA 5FQ0B 5J7MA 4AAXA 4BXFA 5BU5A 2GUVA 1IKQA 1REDA 1FZBA 1B09A 1QKQA 1IFNA 1UW8A 1PK6C 4Y1VA 1DGRN 1GLHA 5EJ3A 5F6LB 1KILB 2ZYDA 4L9BA 4RS5B 4YW7A 3AX4A 1I6XA 1RHZB 5JOYA 1NH4A 1GL2C 2ZYAA 1W6PB 1KZUB 1RMU3 2ZVOB 3BOPA 4BXSV 4ZS2A 1LJ2A 4QX2A 1SBEA 1UF2C 3DYPA 3GCXA 5FXXA 4BMBA 3MIWA 2NYYA 1OSGA 1NA1C 1GQGA 2J59M 3UKTA 2IBZG 2P6HA 4YGCA 3DPRB 5A7QA 3VD3A 1JEKA 1DF0A 4CU7A 1ULCA 4N78D 3MFCA 3DCQA 2XNXA 3D6ZA 1PM4A 1TQ5A 3ACHA 3SXWA 4QPWA 1P84I 2HFED 2Y6GA 1TEIA 2HWB2 4PBPA 3WOGA 2UWCA 4Z2AA 4PJYA 5DG1A 3W58A 3G71P 2ZX4A 2JD4A 2CAUA 5CHXA 3Q5PA 3ZMOA 5FCCA 2PELA 2PHDA 2R3SA 2VOXA 2DDUA 5IAXA 1UZVA 5C8CB 3UGFA 3WUVA 4S2DA 2BYVE 1LEDA 4EZHA 5I8YA 1IGOA 2PAEA 3LCPA 2RG4A 1N7SD 1AX1A 3A4UA 3UYJA 5JDBA 3MIHA 3BUCA 1H0TB 4DEVA 3AP7A 1CX1A 3B94A 1OW7A 3HBZA 2PAKA 1NWQA 5KJ7C 1EDIA 3FHQA 3WNXA 3LGRA 1LP1A 4AXOA 2H8PD 1KORA 2D5FA 1GOFA 4ISQA 4PIXA 4XQWA 3IPVA 5EZWA 3NV4A 1AYN3 3BB6A 4Q26A 1LCLA 4DOJA 1SFCC 4XZUG 4JGYA 3CCQP 3MUZ1 1A34A 4N53A 2WPQA 2ZXQA 3ACFA 3JCUE 1W2TA 2GU9A 4NPMA 1GFF2 1G9BA 4IETA 4ZNCA 2XJQA 3VL9A 1H8AA 1IS3A 4WY4B 3TGUG 2JEMA 1ZZ8A 2VO5A 5GLTA 2W1UA 1W8OA 3TEXA 2FDIA 1RVF1 1Y9QA 1ZP0C 1ZZ7A 4K40A 5E16A 1N73C 2E53A 5F1RA 4YVSC 2IXCA 5DG2A 5AVSB 3Q3DA 2VZ1A 4TSVA 3VMZA 1CPMA 1I1EA 4RQPC 2A6ZA 1ULDA 4Q0UA 5LA9A 1RUD3 1XRUA 2B5HA 1G86A 1SQ4A 2PRRA 4UFJA 3WMM0 1VAKA 4BHPA 4ZU5A 2E5TA 2WL1A 5DDJ3 4Q4Y2 3GF6A 1L0LG 1JY2N 4LA3A 4I09A 4CU8A 2ZHMA 1ZM1A 1UXXX 2EIEA 1YHFA 3WZ1A 1WA6X 3T1MA 3VBSC 3CCVP 1DP0A 5BNOA 2VY0A 1W2OA 1NTKJ 1MZ5A 3BPSA 2R30A 5FKBA 2YMYA 3VBRC 3WXPA 2D6PA 3LSEA 1FAVA 1UMZA 2QJKB 1DU3D 3RWNA 4XUQA 4JGZB 2ADEA 1V0AA 1PVC2 5FP4A 2YBPA 4MHRA 4N43C 1QDCA 2HWE1 1ZBA1 3AEFC 2A06D 2OKXA 4NHMA 3F5HA 3KQGA 1DEEG 1FZGA 5GJ6A 1F9KA 2JECA 4DQAA 3ON7A 4YGBA 2XVKA 3KT4A 3AYDA 3BI3A 2JJLA 4I3GA 1POV1 2H0VA 1RIRA 1U7JA 5FOBB 1ZR4A 4PV1D 2OUHA 2Q30A 3JQXA 4YW3A 3V56A 3K3OA 4IEYA 2YYOA 1WLWA 4BU2A 1ZV8A 1BCXA 4XJ9A 2WABA 5FO7B 4CDUB 1OOPA 2VG9A 1GW3A 4C1XA 2R043 3T2TA 1DD4A 3WDVA 1W5CE 1SBDA 1RUJ3 1NU1D 1AVOA 1PVXA 2XKMA 1C3HA 4C46A 4OZOA 4XFFA 3T0AA 3CCMP 1QJEA 4BPZA 1GWMA 2P3JA 3WP6A 5IFPA 3AKQA 1DQ0A 1NQDA 2ZGQA 5BNPB 1JU3A 3IR9A 2GP5A 1J2JB 1PP9E 3LDBA 4K7JA 4NPEA 4BRYA 1E5IA 4MYEA 3WDYA 4UB8H 1OFSA 3CCLP 2J1TA 2X8KA 3OPZA 3WNOA 4EWAA 4EI2A 3E5QA 5AC93 2JDMA 1YQ6A 2E32A 1LOBA 1VBC1 4CU6A 5ANQA 2WVRA 1DBNA 3T08A 3V2PA 1LKNA 3AE4C 3VKFC 5DAQA 2RS53 2A3WA 1RUI3 3MEPA 3TEZA 3LB9A 4JDOA 3V5BA 4YFWA 2DVAA 3NAPA 4AHWA 2FZ1A 3ZFEA 1WMXA 4RESB 2WSUA 1D4M3 1XXNA 1YFUA 3KXDA 1UMHA 3MLJA 3VBUA 1XYNA 3BGAA 2HWF3 4Q4V3 4Z2WA 1BBT1 4KH9A 4XFBA 2QM8A 1J1EB 4H44B 1OXCA 3ZMNA 1HIXA 4RHV3 4XJAA 3M2MA 3P8CE 5ABJB 3PTRB 3I59A 2YU1A 4XFGA 2LRPA 1XU1A 5C4WA 3M91A 5JCTA 2LALA 2KM2A 2V7QH 1YQ2A 3OW2O 2XJSA 1O8PA 3CF6E 1O5UA 4TXWA 3KF3A 3ZFFB 2OTKE 3OUJA 3E6BA 2BERA 1RQUA 3TGUJ 5A33A 1CX4A 3FXEA 3H1HJ 1PGW1 1T6GC 3S57A 2N1TA 1EDLA 4M3CA 4U3FD 2CV6A 4GZ9A 3H1LE 4NIAA 2OS2A 2YIUB 4N3YB 3SC7X 3WVJA 4A7KA 2YG0A 3I2DA 1Y4WA 1RUNA 3B5LB 1BLZA 4A42A 3CPWO 1PIV3 1YJWP 4FPCA 2JG9B 5CFCA 4IL6H 3HE4B 5J48A 1SQVD 3B4SA 4LORA 1CAVA 1QU0A 2VMDA 2A73B 3KQ4B 4JGYC 1A6CA 1K42A 1DYOA 3Q8BA 5FYTA 4N53C 4CDQA 3I5CA 3FHAA 2WWWA 1AR63 4JDMA 1U0AA 1M57D 1U5ZA 1FJKA 3PP5A 2HYXA 2RS31 1RUG2 1OQEA 4LE4A 2E74D 3LWCA 1HBWA 4W80A 4RL7A 5EFUA 4CP9A 5F3IA 5IVJA 1NY71 3VV1A 4DZOA 1UY4A 2LUWA 4FTEA 5FTTC 2BGPA 3MIFA 5GLZA 3RFRA 4FP2A 2NN8A 3O6QB 2O3JA 1KGYA 3VDDB 5FP3A 4OHWA 4BK4A 4YPJA 4NROA 2PLV1 3VN4A 2OQQA 4FP3A 2PHUA 2HWE2 1ZBA2 1W6NB 2V4VA 1VBE1 4HL0A 1EPZA 2Q0AA 3WNNA 2WFF3 4HN0A 4XZPA 2Y0DA 1OLME 1UCXA 5BNOC 2RE9A 2EAAA 2OA2A 3IIAA 2CGOA 3B01A 1OA2A 2CU5A 4E8DA 5C3PA 4AE2A 2WZPP 2P5BA 4MHUA 1W6QA 5JMOA 3QD6A 4R9BA 2D44A 4RD7A 1IS4A 4Q29A 2VL4A 1NO4A 3EO6A 1JYNA 1IK9A 2QQOA 2QCSB 3MTUE 1AL0G 1P84H 3FLPA 1JZ7A 4UWDA 4NR1A 1FOD1 3PL0A 4KMQA 1AQ5A 2CK3H 1K3IA 2PHXA 4CDWB 2WRAA 4V1PA 3ZR6A 4F3JA 1QJX1 1ODNA 1Q56A 2JXAA 1JOBA 2GM4A 2CWSA 2JDKA 2IDBA 4BK5A 2PFXA 2SBAA 4YG3A 3PRJA 3AE9C 3UETA 4XYXA 3HNBM 3R05A 1PV3A 2RKLA 1Z56A 5JZGA 1IFMA 3THCA 4OHXA 2CYFA 3SSUA 1BGYD 1RHI1 1OOPC 1ENXA 3AE8C 2KB7P 3MIDA 4J1XA 1RE4A 4GB32 4OI2A 2YBSA 1EQ7A 3LEKA 4HYTB 1CAWA 2VW1A 4DUVA 1VBC2 3ASIA 3IAPA 1OQ1A 1XJAA 4YM2A 2J58A 1BSNA 2JP3A 1W9FA 4JAAA 4GJYA 1C57A 2C9NY 5DAVA 3VZJA 4KU7A 3T2OA 1L0NE 2VVEA 1VRBA 5LBEA 4A2UA 3BASA 2ZT9D 3LDKA 1REEA 2BGCA 1VPCA 2JIJA 2KD7A 2DF7A 1YITP 4YVWB 2GNDA 4K1ZA 5FFOC 1SDDB 1FZEA 1HX6A 5AW8B 3GLMA 1LGCA 3WLUA 2V72A 1KS5A 3JZVA 5GTHE 5JI7A 3RMYA 3HTKA 1AL23 2WBKA 1MS5A 1QL2A 2Y0CA 3NAPC 1CSBA 3ZFEC 2D2CD 2FDJA 5FPXA 5AVTB 2WWJA 2XVLA 1DLLA 3UESA 1I5ZA 1ZVFA 1PPJD 1OC1A 1L7QA 2O01J 3M9HA 1MZEA 3VBUC 1TNRA 1FS0E 4GWIA 3S4RA 1RL3A 1PGW2 4CUCA 4AFAA 3CXHD 3FHIB 4R4ZA 4IERA 2B9VA 1QH7A 4K3AA 3L71E 1VBA3 1ZBE2 3J26N 3AJZA 4UYBA 3CMEP 5C4WC 5GZCA 3SQOA 3TEWA 5FMDA 5A3LA 1IK7A 1S5LE 3JC22 1JODA 3GHGA 1LHVA 2XU6A 4AGVA 4JVAA 4FXGB 3H50A 1VBD1 2N1TC 1NAYA 3JB8A 1JCDA 1KQGB 3TNUA 4UW4A 5F39A 2Y0OA 1A3KA 1RTVA 4ZS3A 3WF0A 3AP6A 1L0NK 4Y33A 2C5DA 5A6XA 1XYOA 4AEKA 2WO7A 5B4XA 5CFCC 1DGWA 1GP4A 4LHLA 3TF5A 4QDQA 2BEQD 2ZGNA 4LULA 2V5YA 1N3PA 1KILD 2XXZA 2G8YA 3JQWA 3CIHA 2RVAA 3RYRA 3OYWA 1RE3C 2ETEA 3AYCA 3AKPA 1VE0A 3FC0A 3GALA 3A7OA 4CDQC 5FLJA 4RA0A 1YIJP 2WT1A 2F17A 5FY7A 1OW6A 1W99A 3L70E 3NNLA 4JRLA 4Q0SA 4F7ZA 1NG0A 3IMMA 1EC5A 4NIGA 1WMFA 3MPPG 4O61A 2A5ZA 1BCCD 3NJXA 1S0BA 4PQQA 1HB1A 1Q5OA 1YEWA 4QX3A 1UIKA 4LKFA 4LXLA 3VKLA 5EYXA 2ZX0A 5FJHA 1O91A 2VOKA 1H1MA 3UIAA 3D4KA 5J36A 4YZ1A 5ISLA 2MHFA 5FZOA 1BZWA 1Z7S2 3CC4P 2DVFA 1DQ1A 1RVF3 2L9LA 2HEWF 4COWA 4R9AA 2AH2A 2E33A 5L7OA 1YQ3C 2R5DA 4BMEA 3MF6A 3W68A 2E31A 3JCIA 1HF9A 4Z1MH 1JMBA 4Y20B 2VC9A 1FOD2 1X50A 4H0LC 3TWIA 3WINE 2FBEA 3W20A 3AZYA 4LBQB 1OLRA 3HD7A 3MHVA 2JDPA 3L73D 5KHHA 1QJX2 4JHZA 1VR3A 1BEV3 3AZWA 5TISE 5FY9A 4O9BA 2GN7A 4JC1A 1VQMP 2I07B 1W03A 3HR9A 2FCVA 3LAGA 2HYNA 1PGL2 1LJ7A 3ZOIA 5E8AA 1XB9A 1OX3A 4ZKUA 3HJRA 2BNMA 3RBXA 2W90A 2QQNA 3VN0A 1CPNA 4FPLA 4YW5A 3MZWB 1GICA 2XDVA 4FPKA 3AKSA 3JD71 2ARCA 3BU0A 2JB8A 5FPUA 4XETA 4AZZA 3NNMA 2QE3A 5HV4A 4WM8B 2POHA 1LT9A 5JZGC 5LZ6A 2DUOA 1BE3J 3L72E 1D4VB 3BN6A 4WY4D 1HRV3 2VMEA 1RE4C 3T3YA 1L7RA 2E9QA 4XDOA 2KR2A 2B88A 2VMHA 3PHMA 4HJGH 1XNAA 1TMF1 1BYHA 3HQXA 5LA1A 2VVFA 1PGQA 4C7NB 4R52A 1GK4A 4URTA 1Q8VA 1ASJ1 1UMIA 5G05L 4XJUA 2E51A 1M1JB 2XQXA 4K8RB 1EDJA 1KRIA 5FWJA 5LCWL 5T5OA 2RR12 4FSJA 1FE6A 3RL0B 4BZ4A 4NAMA 4NVPA 2MEV2 1FPN2 2FDFA 1CI6A 3DEMA 4Q4X1 1N1VA 3AP9A 2D3SA 4RFT0 2AGSA 2VECA 2WZR3 1JTHA 4HK8A 1XBFA 3CC2P 3WF4A 2OTJP 2PAJA 3CEWA 1AV1A 2ZGKA 3DKQA 1REFA 4ATFA 1NKNA 5CBLA 2QQIA 2PGDA 1RJ7A 1MV8A 3G9RA 2I8DA 5CCHC 3CWBG 5JI9A 2KUBA 3D8CA 4Y24A 5CFDC 5CIRA 3ZXKA 4NUBA 3VOPA 4PT6A 1S5LX 1YCIA 1OPMA 2LXCB 3HPNA 2Q5UA 3VZLA 1CWPA 1U5XA 2FHRA 2FDKA 1Y3TA 2GNTA 2BRTA 1W2EA 2PHWA 2ZAAA 4ZHNA 4BQYA 4OGQC 4K35A 1FOSF 2JDHA 2JDZA 3H7YA 4UF0B 3W9AA 1JOCA 2M5AB 1BMV1 1NUKA 3EJKA 1PO13 3DECA 2W94A 4HETA 3O0XA 4Y22A 3GHGC 3ZYJB 4WM7B 1XSQA 4GMP1 5L9RA 3E5XA 2EVXA 1AX0A 1BBT3 4CCDA 1N7SA 2WPSA 2ZEYA 3RPQA 4IEWA 1EV12 1QJY3 1AR83 1KYOH 2A45I 4C8DA 2UWAA 3M3IA 1V9U3 1VLNA 1UIJA 4LO5B 3S5AA 3FFZA 1DIPA 4XFJA 1Z78A 1QVGO 4MLOA 5DUWA 3MUY1 5F5AA 2PTMA 5IHRA 2QKDA 5I0DA 4W6XA 1AR93 4UB6H 1QLED 3G3ZA 3I3MA 5CADA 1C8M1 2Z69A 4KG0A 4QPIB 2BNNA 4K9SA 3ZXAC 1QIQA 1OH4A 1AA0A 1UOBA 3W67A 4XCAA 1VQOP 1NTMG 1OVVA 4DUXA 4B29A 1SQXG 4R9CA 3KZIH 1JH5A 5FBZA 5J37A 2RV9A 3HT1A 5KLIC 2BCCG 2W52A 3LA3A 3KCCA 4YPCA 5E79H 4I2OA 1AF9A 1LOAA 3OBZA 4EQVA 1JTZX 4UW3A 4IEPA 3F95A 2YC4A 4FQ4A 4UW6A 5IAVA 2ARAA 3KS7A 3H1WA 2BEZF 3SH4A 1COV3 5JWPA 4XTMA 1LTAC 5FY5A 5F9TA 4Y5SA 1L4AB 3I7DA 3ST7A 2FXPA 3VBHB 4IV3B 2RS33 2QQVA 5HCBA 3WUUA 4H44D 3VZMA 4I0BA 4YARA 3LOIA 3CMAP 1PMIA 1KTMA 3SNMA 3O1MA 3HAGA 4BH9A 1LTJB 5IW0A 5L7OC 4K8FA 1F5FA 3B9IA 4WBAA 3MLKA 5FP8A 4DXSA 4CP0A 1LTBC 1OVUA 3OF1A 1S4CA 1JMUB 4DINB 4ZZ8A 2KLUA 3HD7C 4FBFA 5GLUA 3BCCJ 4AK3A 4H14A 1KS4A 4H2AA 4ONUA 1VMHA 3VYIA 1CR7A 1RC6A 5FMBA 1ONAA 2PLV3 5KAFE 1RF1B 4LA2A 4IV1A 1PP9D 1L0LE 1H2KA 1J3QA 3FUQA 1R091 2W39A 1HJ0A 5C70A 5A1LA 3F2ZA 3NTNA 2EXKA 3SKJE 3IN9A 4YG0A 4MGKE 3IDBB 4HBNA 4E4DX 5FREA 4QU1A 4UFMA 4N90A 3NFQA 2L91A 5E1RA 1OA3A 3GHGB 3U1AA 2IYOA 3WR0A 1YYNA 2VW0A 2K37A 5EP9A 1O8SA 5FAXA 2V4AA 4LBOA 1K04A 2BOIA 2LTNA 2R6QA 2H43A 3LEGA 2CY6A 4NPLA 1W28A 4CCKA 5H9PA 1QVFO 1VRH1 2WNUB 2VZRA 1LT9C 4P5YA 5CCGD 3VTPC 3C7FA 1ND3A 1Q82Q 3RK2B 3UNPA 1W0NA 1DLCA 5FYMA 4JX0A 1ZA7A 4ASVA 1WCQA 2ZMKA 3A7QA 2CSGA 4DJGA 1RUF1 1AXKA 2FYNB 4YW4A 4OVNF 4TLGA 2Q1KA 4CEYB 3SWYA 5EJ1B 3VMYA 4URAA 4AEDA 1UAIA 1FZFA 4JZRA 5CEHA 3P8CD 5FZ0A 3U14A 3EMRA 1UYYA 3H3ZA 4IDZA 3IWZA 1YTZI 3P1IA 5DQ0A 1XE7A 2B87B 5JIUA 1TU3F 3N7KA 5L19A 3T4VA 4DRVA 2W46A 5GZGA 1W3XA 2YGMA 3AYAA 4R4MA 5AVUB 3V0AB 3I3BA 3WF2A 2W9XA 3H1LD 2RH0A 1XE0A 5KLVE 3DF0A 5JSPA 5FPAA 1C28A 2C0ZA 1VJ2A 1BSHA 1CAXB 2A3YA 1L0LK 1WLDA 1BMV2 2VXJA 2ARXA 3MF9A 1QY4A 4WB4A 4JQ0D 2ZA9A 3MD0A 5T5LA 4AQTA 1FV3A 2AEMA 3FL7A 4OI4A 1F5JA 3U37A 1D7MA 4A6SA 3KCXA 5IATA 5IK4A 1NE6A 2W68A 3GZAA 4IQPA 2XUMA 3ES1A 2VOVA 1STMA 2E7AA 3KCYA 3SEEA 2QFEA 3I2HA 4JRAA 4QKDA 2ZS6B 3I2FA 1KN7A 4NJ4A 4J6GA 5EYYA 1NTMJ 3GCWA 1SQXJ 5CG8A 3ILNA 2E75B 1FJPA 1FDMA 4QHZA 5LBBA 2AEYA 4XQDA 1C8M2 2FYZA 3B5NB 2QJPC 4NO4A 1HB2A 2H88C 1N7SC 4GODA 1ST8A 4C0HA 5IVBA 2IFNA 3AXEA 3RNSA 2R062 3V0BB 4HVOA 1S0CA 1OQDA 1SQPG 4EZ4A 1JCCA 4QDRA 4DT0A 3SH3A 1RUH1 3SKVA 4WZCA 4JHTA 3IB3A 4XHXA 1FZAA 2K0GA 5GKAC 2C6SA 3ZFGB 1N86A 1VBD3 2IBZI 3H0OA 3OB8A 5GM0A 3GJBA 2G4IA 2ZYGA 2GMEA 3LEMA 3WG2A 5KLVK 4CU9A 5J98B 3ITQA 2B8MA 4PDWB 1AYM2 4P08A 3LOBA 3POWA 4LBKA 5FZMA 4ZY9A 4AWDA 1WZXA 5E88A 1KB9H 1MACA 2SPZA 5AW0B 5FUNA 4AVCA 2P67A 4LLOA 1GBGA 5IK5A 1UYZA 2A06G 3G4SP 2FXMA 2NPSB 3N9NA 3GMAA 5LW9A 3U07A 2W91A 1K5MA 5AVRB 4Q4Y3 3P6BA 2HWC3 2YHJA 1XOYA 1H6XA 4JF7A 2GC3A 4AVAA 1MS1A 3H9AA 5FO8B 3BTYA 3ZSLA 1UOGA 4AQ6A 3X29B 2HWD1 2K9JA 1VB4A 2HPCB 2XR4A 2WSCJ 4IGPA 4P9GA 4GXLA 3NL1A 2EXHA 1UX6A 5DUVA 3THPA 3LW5J 5A3PA 1EZVG 2X5IB 3SLIA 5EPAA 5A32A 2M0BA 2WZ7A 3WG3A 1NHLA 4YW2A 4FOVA 4IV1C 1MKMA 1L0ND 2WMMA 1VRH2 1FZCA 3VD4A 4NHKA 5JXHA 2Y6LA 4RYDA 3BVCA 3EWKA 4AL9A 2E26A 4W7ZA 1RH5B 3II6A 2JKBA 4CA9A 3LIGA 4MGYE 1J59A 4E4SA 2K46A 1YO8A 4QHOA 1MS0A 1RUF2 3LDRA 4Y22B 2WS92 3B8EB 2WUHA 3J8F2 4OZXA 3ITKA 3RZGA 4PV1C 4XCBA 1VBB3 2P1JA 2VW2A 4QX5A 4QXHA 4FT8A 1BQPA 4AQ2A 5AW1B 1I9RA 2PYTA 4FO9A 2QSIA 1SQQE 2RS11 3AJYA 1SQBG 1W6MA 1Q2NA 2RMU3 2LR2A 3H1JG 1PMJX 4G3YC 2HYKA 1JZ6A 1LULA 4LPLA 4OUEA 4MXWA 3JD73 2A45H 4PD4H 3HIFA 4AEDC 2WC2A 4NIIA 2QQWA 2ZGSA 5JOZA 4NHYA 5FPBA 1ULFA 1YI2P 4KL1A 2D40A 3L71D 4XOGA 2WIIB 3LKJA 1T3JA 4JKKA 2PHRA 4OMCA 1ZR2A 3LFMA 5F5QA 3KV4A 3C7HA 1WCSA 2YV8A 2VNVA 2VXRA 1DDLA 3THTA 4XC9A 5B66H 4MO3M 1IFJA 4CE8A 1UYPA 1OA4A 1G9DA 4XPVA 3OY8B 1TMF3 2WAOA 3IF4A 3H7JA 2DCJA 3M8LA 2XONA 3OEAA 3OGRA 2C0WA 5HBAA 2KSEA 2WWSA 1ASJ3 2NPIA 1TZOA 3BTAA 2JB4A 5FZGA 4DMIA 3H1KE 1NCQA 4LBQD 2VAUA 4JCKA 3OJAB 4U3FG 2XZRA 1F4HA 4P9JA 1LNQA 4E2SA 4FFFA 1VAMA 4WVVA 1LGBA 1AHSA 2XBO3 3POFA 5LK5A 4BXLA 3KQRA 2VQUA 2KOGA 4D6RA 1CONA 4HSLA 4Q1RA 2BU9A 4PI2A 1X36A 1WW7A 4ATEA 2WTYA 5KHKA 2GNMA 2Z42A 4Q0QA 4QU2A 3WNKA 2RM23 3O0VA 3L70D 4I6MC 5IVEA 2IFWA 3Q9OA 1AYN1 1SQQK 2GDFA 4AI0A 1RUH2 4LIUA 3B7MA 2DU0A 2R44A 3L4FA 4L73A 3CHXA 2ZXXA 3GW6A 1YTZT 1Y47A 5FP9A 4Y1YA 5LRSA 1SP4A 1JY3N 4KG8A 1GQPA 4AAPA 3TN93 1GKBA 4MGQA 4IFDK 1AUYA 5BNNA 3O1PA 2E42A 5FQ0A 4WVMA 3BIWE 1NX9A 1WW4A 2QVAA 4GMP3 1FXZA 5FDBA 5KHGA 2P37A 1KILA 5L8RJ 1PHMA 5DXDA 4RS5A 1ND3B 1UQXA 1UN1A 3RL0D 2H7HA 5L9BA 5FYZA 2R1BA 1UPSA 4R9DA 3VUOA 1KXGA 1W6PA 2PXJA 4XEZA 1VQKP 1GNHA 1W8UA 4IE7A 1UY1A 3R6SA 5DDJ1 4BOWA 2I74A 3ZKYA 4DXZA 2XJPA 2YFUA 4R8HA 4YW6A 2WWUA 4IEXA 2K2SA 2BVBA 2E74C 2J1EA 2BFUS 1AR72 2YGLA 1LHUA 5L9VA 4IUGA 3DPRA 4WWIA 3ZN6B 1NU1J 5DAPA 4IL6E 1N47A 1G6NA 2VUJA 3ZXFA 1G1IA 1HQNA 1S2KA 1K5MC 1MS4A 2D6OX 1GSLA 1SQVE 2Z4FA 2PHTA 2OYOA 3K77A 1J1LA 4EOTA 4DXTA 2OQ7A 2YKQA 4GIFA 2DTWA 2PAMA 3E97A 2XL9A 1PX3A 3ZDSA 3A21A 5J1XA 1CD3G 3L72D 1LODA 2A1XA 4KWLA 3VMAA 2JENA 2EXJA 1PX4A 4A7PA 1J1DB 4LLHA 1DX7A 3TDKA 1EUUA 4BQ2A 2E76B 2WR9A 4QMAA 2JIGA 1BGYG 1S0IA 2W6AA 4JTOA 2V5DA 1HVVA 3AE3C 1T3UA 3PTYA 2J1VA 3U78A 1GZWB 3S9OA 2YPDA 4META 4XW3A 5BXXA 3JU9A 4IGQA 2BNOA 3EQEA 5J3UA 1TME3 1LHOA 2R041 2ZEXA 1FZCC 1RMU2 1SDWA 1HGVA 1VDFA 1S0JA 2W3JA 3POBA 3EXUA 2FQPA 4P5HA 1VQ8P 3N9QA 1HH0A 5DZFA 4Z07A 1S3JA 3KD4A 4ZXKA 4PIYA 1MUUA 2M3EA 4JBZA 2VUCA 2YXRB 1Q90D 3EYPA 1UO9A 4YWAA 4MOAA 2ADDA 2JKXA 3VGIA 1R093 2Y9YA 4GB33 1N3QA 2ZBJA 4WY4A 3CU7A 1W8FA 3R2PA 1RUC1 3ZXLA 1P84E 2ZHNA 4U3FJ 1RUI1 1NZCA 4LKSA 4XIKA 1H8TB 5LEJA 5CBOA 5APTA 2QJYB 3AMNA 5JPNB 2HLEA 2CAVA 3FLRA 5EV7A 1D4M1 3AXDA 5AVXB 2A45G 2O1KA 3VBOB 3D70A 3B9CA 1S2BA 4Y5TA 2ZT9C 2VMFA 4EIJA 4GT1A 5B2GB 4QXBA 5A7WB 3JXSA 2HWF1 2WSSH 1DGRA 1L4AD 4MX3A 1SQVJ 1Q3EA 4Q4V1 2ZMNA 5IVFA 4NPRA 4NWWA 1TNFA 4RHV1 4QX8A 3M9QA 3Q8FA 2BZDA 2QQKA 2A75A 4L8QA 1RUE1 3AEGC 3SHRA 3SITA 1NCQC 4E2GA 1JU4A 1LU2A 3OCPA 2D2CC 2KZIA 4LJHA 1H1IA 1FI2A 4JGZA 1AYN2 3V2QA 3AP4A 3RYKA 1HRI3 5F5CA 1LAJA 1T8ZA 1SLIA 2ZAHA 5FYUA 1FMD3 2K9JB 4LHSA 2K9ZA 3UV9A 4ASKA 2W6BA 4OUSA 1PIV1 4FVVA 3S5QA 2W27A 3L37A 5CU1A 5A7OA 5C3OA 1QJU3 3CWBE 3M4FA 2Q4SA 3W21A 3FX3A 2JWPA 1GWLA 2AXCA 5C5UA 1GD2E 1RYYA 1OFCX 3IM0A 1IQAA 2MPFA 1GMJA 5I0RA 2XWBB 4C91A 3RK2D 4AVBA 3AEAC 4CDUA 3VD5A 1RUD2 4RJTA 1VQ5P 1J58A 3A5TA 3PVOA 3QBQA 5BNNC 1S0DA 5DDJ2 2GMPA 2VMGA 1KJRA 2UURA 1C8NA 1PIXA 2JG8B 5AW4B 4W4ZA 1KILC 4YM3A 1IQDC 4RS5C 2V4HA 2D3PA 3I3DA 3ECQA 2H6CA 1HTLC 4GMP0 4GWNA 2CDPA 1OLQA 4Q5OA 1VQLP 3O0WA 2WJSA 3KHUA 4DO0A 5IVVA 1HUCA 1VQ9P 1LU1A 3OPTA 1A02F 1BGYJ 3L73G 5DJUB 1L0LD 1WWYA 2W08A 3NVCA 5IVCA 4YM0A 2Y6HA 1D2QA 3DPRC 2WO2A 3VP8A 2HLOA 1GMMA 2D6KA 2QUOA 2VNOA 3SFDC 2X29A 1IHMA 2P6CA 1ACCA 4QM8A 1UY3A 1N1TA 4ZMDA 3TBDA 1NTZE 2PFWA 3A0NA 1KQSO 2BCCE 5ACA1 1I3HA 2VVDA 3OG2A 5ABJA 1DQ2A 2WYSA 5LB6A 4CCNA 4BQ3A 1RUJ2 1W9TA 2WYFA 5KAIH 2CHHA 3BATA 4XUTA 1LT1A 2RHPA 2YZ4A 2ZX3A 1ZZ6A 3ZFFA 2WT2A 2UWBA 2VZPA 3PHLA 3Q5RA 1F15A 1NCRB 1E79H 2E75D 3I2IA 2DYCA 2QRXA 3CZUA 3HEIA 4TLFA 2OYIA 2WNVA 2FDGA 3B5ND 4DOUA 3ZYHA 5FZEA 1MFTA 5JXIA 3OA7A 1ZRFA 1UY2A 2HWD3 4X6RB 1SFPA 1DEBA 1LTSC 4FAGA 2P3KA 5BV6A 3VD9A 3IDEA 1YIFA 4YFZA 5AC92 2WZ8A 2WPRA 1IFIA 5I0UA 4FI9A 3FGAD 1C5IA 4IEZA 3K3NA 3HE4A 2RS52 3WNLA 1RUI2 1H4HA 1SG3A 1QQP3 4XVHA 1NTKG 1W8TA 2FMDA 4PF1A 4IESA 3K46A 1W2UA 1FV2A 3AFKA 3MICA 1D4M2 1O4YA 2ENRA 2FY8A 3L74E 5KLVD 5CCGA 4P9IA 4WVWA 4B7EA 5FIXA 3PTZA 1S9KE 2RDRA 2AEFA 4Z1VA 3T2PA 4JV4A 4WY4C 1YFYA 3MW4A 2C1FA 2HWF2 1MZFA 4Q4V2 4WVMB 4XDPA 1G9FA 1MEC1 4YG6A 4AF9A 5APAA 4ES9A 1CN1A 1AL21 4RHV2 4IFFA 3M9BA 2AREA 1XNTA 4OULA 5K4LA 2WPVB 3O6QA 1NTZK 3EHKA 4ARYA 1Q7YQ 2NPSD 4MGIE 1PL5A 3VDDA 2MEV3 4KWJA 2E5YA 4IW3A 2RS13 1FPN3 4M4PA 1ENRA 3H8XA 5DAWA 3PU3A 1M06G 4ZPIA 1W6NA 3PH0A 1SLCA 3NV3A 3VP9A 4G9SB 1OURA 2EIBA 1VBA1 3CD6P 3A23A 2XG3A 1QL1A 2VULA 4E2QA 2GNBA 1PIV2 3OUHA 1LOFA 1EAH3 3ZXDA 1PO23 4BWOA 3VBFB 1QHDA 2QJKC 3ZN4A 1BCCJ 4JGZC 3IN6A 3KPEA 4L99A 3H1IE 1KC8Q 1QGLA 5F5IA 1H6YA 4Q0VA 3RZHA 4MH0E 2Q1ZB 4HKWA 5APSA 3U59A 3N9PA 1AR62 4A7YA 4FCAA 4ASMB 4QX7A 1FC2C 1H4GA 3ACGA 4HFSA 2MKVA 4N9IA 4CDWA 3MGNA 3OGSA 1OMIA 4KWUA 3RWKX 5T5JA 3GF7A 4AEJA 1MS3A 1E5HA 3T97B 2A7AA 2O01H 2FD8A 4DY5A 1JYCA 2XUEA 1HV0A 3POEA 1EV13 3HN3A 2R0FA 3A3YB 4CDUC 1T2KD 3L73J 4NMIA 2WITA 2JO1A 3I55P 5KBFA 4KGQA 5AVQB 4YRDA 1JI6A 2ZHLA 2WSFJ 1BDCA 4AOCA 4AGGA 2WFF2 5BNPC 2VCAA 4Q4W1 2VQAA 4FPOB 1NYWA 5CB7A 1W8NA 1OLMA 3O1OA 3J9SA 2QM7A 5GTIH 1NZIA 3H1HG 4YVWA 4IOIH 2HODB 3QACA 4EV0A 2VBPA 1SQPE 3T09A 1KYOE 3N7LA 3AE7C 4YLZA 5KR7A 1NOHA 3KGZA 1OD5A 3ZKUA 4CCLA 1ULGA 1POQA 4DRRA 1LESA 1BEV1 1PP9G 1T6AA 4UB6E 1CJPA 3NXSA 3RS6A 4A7ZA 5KTBA 2XKPA 3FBMA 4BA6A 1JXNA 2WA4A 3JUUA 2YXSA 3W5NA 1YHQP 2J1RA 1J1EC 4H44C 2VZSA 3KZIE 4HONA 1Q81Q 5BY5A 2HH9A 5ABJC 4FTBA 3N7MA 2R7EB 4BJ0A 3A0KA 1SQQD 4QPGA 5L73A 2GC2A 5E79E 1SHWB 1PGSA 5LK7B 3P7KA 1QGKB 2DBIA 1WMDA 3UJQA 2OVUA 3ZFFC 1VQPP 1W0OA 1JBCA 2G1MA 2ZZJA 5CKNA 3RZJA 2ZACA 2Y38A 3AM2A 1UOJA 4FPFA 3PJSK 4FTSA 1G9CA 3VKMA 2YIUC 2ZOEB 1HRV1 5FZ8A 5A7NA 3OBRA 4LBNA 4R4LA 5AW3B 1ODMA 2YROA 1OVPA 2BEOA 5FZ3A 2ZCWA 1EZVE 2JG9C 4YM1A 3ZLIA 2LS6A 1SPPB 4PI0A 1USDA 1AL22 2YC2A 3L36A 2DFCA 3CL1A 4XBQA 3K51A 3CJIB 2I2SA 2TBVA 1QMJA 2B89A 2N9YB 4IFMA 1SQPK 4XE9A 4WBBA 2WKKA 5CCGC 3H1KD 3LF7A 1MR5A 1GUIA 2W5FA 1WGPA 3FN9A 1JYTA 3POJA 3H1LG 1MS9A 2WZR1 5AVYB 4EROA 3AE2C 3KHBA 3VLBB 1Q8SA 1OF4A 5DMYA 2BBAA 2KK7A 5A3NA 4CXYA 2D3RA 3AKTA 3WF3A 1R081 3T2QA 1N8RQ 1W9WA 3H42B 3KV5A 2FYUE 2AZ5A 2GSYA 1WLTA 4D6TE 3SH5A 1JZ3A 3WV6A 1CVNA 4ISRA 3VDDC 4EDFA 3RZLA 2RJLA 1SQBE 2Z79A 4DNYA 1RUC3 1X9TA 5CYYA 2C9KA 4KHXA 2WNOA 4HN1A 3H1JE 4HKZH 1TG7A 1NVOA 2CPBA 3O14A 5HXVA 2Y34A 1AVYA 2PQQA 3OBAA 3H3LA 1JZ8A 4OHVA 3O5SA 1GR3A 4Y20A 4QWNA 1OW8A 4Q1PA 1PO11 4LBQA 2E76D 5GZFA 1LOFC 4B3NA 1GNZA 5FPZA 4RR3B 1N1YA 4BISA 2P3IA 4Y4RA 5FUIA 5K0UB 4CDXB 4LEJA 1QOOA 1UZ0A 3P3NA 1QJY1 1H9WA 1AR81 1NAEA 2AC1A 3HD8B 2QDNA 3L75E 4QQ2A 1YJKA 5KC5A 1PMHX 1V9U1 3TEYA 3PLNA 1RUE3 4HPKB 1D2SA 4Z8BA 3S7EA 3N4XA 3MI8A 4CDWC 5KKZB 1QJFA 5C5TA 1P8JA 3AL6A 1AR91 3PURA 4YGEA 1R8EA 1SLBA 3H32B 2R16A 2C4XA 2OYIB 2WLPA 2WNVB 2IXJA 3N7NA 2DFBA 4CCOA 1S1CX 4WM8A 5FZ9A 3MHZA 1R5SA 3GXUA 1RGSA 2JD9A 1US2A 1IS6A 4QB6A 5K5GB 1HXS1 3BKZA 4XILA 3ACLA 2BFUL 4N9HA 2FYUK 4YGDA 3P32A 1CGPA 3HE5B 1CIYA 1O7FA 1RVF2 1PP9J 3ILRA 5H2FH 4I01A 1R5LA 4C7NA 4SLIA 2NZ2A 1SQBK 4XFAA 3CO2A 4Y28J 1M1JA 4QQHA 2J22A 3GDBA 1QWRA 2Y6FA 2VCBA 5FMCA 4OMDA 2DVGA 3AMPA 3KT7A 1S0EA 3JBG3 1COV1 2VNGA 1UZYA 5KXDA 1U5YA 2R0HA 3A0HE 1S1AA 3ORJA 2DUPA 1VMFA 4YVWC 1FAYA 5A7PA 3WEZA 3OTFA 1AYM3 2ZZQA 4AFDA 2CDOA 2OYHB 4C7RA 2BPA2 1J83A 3WU2H 3IFMA 1V6KA 3RK3E 4S2FA 3URFA 3WW3A 1LTTC 1CQ9A 1LWUB 4ITCA 2J1AA 4CEWB 3W5MA 1ENQA 3ZYRA 2GC0A 3KLSA 5K7PA 3JSVC 5FK8A 2VCCA 1R1ZA 2WNEA 5EJZB 2YC0A 4PLNA 2A6WA 1SZBA 5DUUA 5CG9A 3RZMA 4LUMA 3APBA 5CJ0A 4UFIA 2D6LX 4UF0A 4I2LC 2JR8A 2M5AA 1KB9E 4B7KA 5LASA 5GZDA 1KYOI 1OHFA 4P14A 1P84D 3D0JA 4WM7A 3ZSKA 2XJRA 4IE0A 1HN1A 1S4XA 1NYHA 3H1LJ 3UGGA 4NWVA 5B5EH 3E6DA 2KP8A 5C9AB 5ACA3 2TEPA 4PLOA 5D8AB 4IEQA 2VTXA 2X09A 3OGVA 3AE1C 4CTEA 1UKRA 5BVZA 4YTPC 2LROA 2Y6KA 2VQ0A 3POYA 2WZR2 4MGTA 1MZ6A 3NW4A 4XBNA 1XSRA 1HWTC 5BPXA 3WQ7A 1CAUB 3AC0A 3J8F3 4OI1A 2OZ6A 2BUKA 2JKVA 4XF3A 4JPZB 1H2LA 4Y26A 2ZFCA 4QPIA 2O1JA 2HR3A 4LK7A 1BVP1 2OPWA 1ZOYC 1W8WA 3WDUA 1ZX5A 1LENA 3RK3B 2O0OA 4UAPA 4IE4A 2M3BA 4NPDA 3WW4A 2IZWA 2WINB 2ZKLA 3I2GA 1Q86Q 2OTLP 1FNZA 3FXDA 4N7IA 5C7GA 3ROUA 1MQTB 4B1LA 3CX5H 1M4WA 4EN0A 4BDVB 4TTGA 2IFRA 1YFXA 5DZEA 1PO12 3FJSA 3RSJA 1SFYA 3ZSEA 1EZVI 3CWBD 2A71A 5AFEA 4Y99B 5APQA 1L4AA 3FWNA 2PN5A 5FPVA 3VBHA 4AHZA 2WQZC 4IV3A 1BBT2 4LLFA 4U7JA 1MEC3 2OUJA 1BE3G 1FNYA 2KS1A 1LTJA 1QJY2 1PM7A 4FOQA 3WHUA 4HMZA 1BK0A 1D7PM 5FPLA 5EIYB 1EY2A 3USUA 4K21A 4PD4E 1WCDJ 5DZGA 4LITA 3ZO0B 1PZ8A 3OSDA 4MZUA 1RQVA 1AR92 4P9XA 1WT6A 3ZSJA 2IYPA 4BWNA 1RF1A 4ASWA 1EPWA 4K1YA 2YFZA 3RJ2X 2WSEJ 5FZKA 2AENA 5B66E 5F3GA 2RMZA 1GZCA 5APVA 1UU5A 3S1KA 4QPGB 2OZJA 3WF1A 4W65A 1URXA 2KNCA 5KXBA 3KHCA 3PUAA 3PIJA 5A3UA 2P2KA 4D69A 4HH2A 4F83A 3U10A 1LTIC 5I8SA 4GH4B 2ATFA 2A6YA 2Q8EA 1ENSA 4WM8C 2O1QA 1ZZBA 2WNUA 4DZGA 5KHJA 3C3VA 4NE9A 3WDWA 3NKGA 4XJ8A 5A3OA 3C7GA 2QIWA 4AG4A 1VMJA 3GYDA 1G8WA 4OWFA 1VQ6P 1OVSA 2RS32 3KWVA 4D7YA 5FYVA 4XHBA 3OD0A 3DXUA 4CEYA 1YUDA 1NY72 1NTZD 2BDRA 1L0NJ 2BCCD 4DY3A 1WBLA 2B39A 2ERFA 5FYBA 3ZPOA 4O65A 1NOVA 1JHNA 5BYNA 1M1JC 1R1A3 5A3WA 5F3CA 1UOFA 4UXAA 3TYJA 2B87A 2NMNA 2EAKA 2I1JA 4CXWA 4ZZ5A 3RL0C 3B93A 4Q4Y1 5CZKA 2HWC1 2ES3A 1QOSA 3A0BE 2PLV2 5HXMA 2O8OA 1JO5A 3DXTA 3O8ZA 4H3WA 1N3OA 4HB1A 1HQLA 1ZYBA 1VBE2 5JOXA 3V0AA 3E5UA 2QQJA 5A1FA 1YJNP 3PIGA 4Q4W3 2AUYA 2WSVA 2VOTA 4AFMA 2VE1A 1CAXA 3ZDVA 1AJYA 3VL8A 1XYPA 4Y1XA 4GWMA 2RDSA 4D8MA 3TNPB 3ZN5A 4QGNA 2ORZA 2IZ0A 1PGJA 4JKMA 2PHLA 3L71J 3ES4A 5CISA 4HKOA 1G2CB 1SBFA 1HQWA 4XXPA 2W6JH 3L74D 1VQNP 4QKBA 1DQ5A 1KFXL 1YLLA 1S9KD 5CJ4A 4KBBA 4K20A 2KI7B 3DGTA 1BJQA 3O1RA 3B00A 3F89A 1IS5A 1ZA4A 1SCRA 5FJKA 5AVAA 2R32A 4WM7C 4EN6B 1VBB1 1B35B 2QE7H 4I7ZB 3B5NA 2PHFA 3VKNA 5FXZA 1RHI2 4NRQA 2QVSB 2XHKA 2OIIA 2K1AA 2RMU1 1K8AQ 3EQ2A 3KSCA 3V0BA 2WSCH 3KVBA 1WCKA 4ZKPA 5M1BA 3AMHA 1GQHA 2WDBA 1DQ4A 4BQWA 3LW5H 1RUOA 3ZX7A 1W2BO 5AW7B 2B4KA 1GYKA 2IXIA 3ZFGA 4QKNA 1J1TA 1HJGA 3SMHA 1O3QA 4QPIC 1EUTA 1GU3A 1FBMA 4B8EA 4DFSA 3GBGA 3WCSA 3BCCG 1X9PA 3WQ1A 4WV8A 3L70J 3AZVA 1KB9I 2P34A 2IVJA 1XNBA 2QQUA 1JW6A 5HI0A 4QHBA 4PDWA 4XUOA 5A70A 4B86A 1UYXA 5DAXA 3H1ID 4JTNA 4R4XA 2D98A 1UY0A 4YZ5A 2NZ9A 1G1JA 2W8ZA 3C8VA 2ZEZA 1NTKE 1DYPA 3BVHA 1PGPA 5F6KA 5FY0A 2NPSA 1QNWA 4GKXA 1OXZA 1S0FA 4PJ0H 2CWMA 3H25A 4FFGA 1S2EA 1L4AC 2XBO1 4H7MA 4BQ1A 3VBHC 4IV3C 5JOWA 5HCHA 1XQNA 3J7LA 3GZUC 4XBLA 1JY3P 3V65A 1OVRA 4XFIA 4FPGA 5AW5B 1LTJC 2HPCA 1R083 1X9VA 1OH3A 2XLAA 2RM21 5FOJB 2J42A 3MIGA 4I30A 4XURA 4FFHA 1A02J 4LIVA 1ZN5A 2AEJA 4H13B 5APYA 2A3XA 3WX5A 2D43A 2JEEA 5AVVB 2X5IA 5DPNA 2ZX2A 5JMCA 2C9LY 4EYYQ 4A45A 4ARXA 1OUXA 3MV01 5SV8A 1AJOA 1NE4A 2QQPA 1ZZCA 5T5PA 1VBD2 1RF1C 2CPSA 1VF5B 4ZXEA 5AVZB 3AZZA 3TN91 2WFPA 1CZSA 2IBZE 5GLWA 3IKWA 2VUAA 3B69A 2Y6JA 5E6HA 1PK6B 2IXLA 3PUQA 5C33A 5KXEA 1SQPD 1C1FA 4MADA 1KYOD 1NLRA 4JKLA 1GL2B 3GBWA 3RDIA 4XUNA 3L72J 2ZKNA 1Y9GA 2WNUC 1IOAA 2W92A 2HEYF 3BCWA 2KZJA 4BQXA 4PD4I 3RK2C 4XF1A 4DUWA 2Z5IA 5FZ1A 4DEQA 2XQRA 1RUG1 2YO2A 3CXHI 2AXTE 2X05A 2EA7A 2VMCA 1LEMA 2HWC2 1NTKK 1NA1B 1W6OB 2JE9A 3NQHA 2WQ4A 3ZYFA 3HQRA 2FYNC 4CEYC 4I1LA 5FZFA 4XJZA 2VTXJ 4HVQA 3NNFA 5F2SA 3WHTA 3NWKA 3GGLA 4FPEA 5DABA 4FXKB 2XKOA 2B9UA 3MPBA 3I56P 3AECC 2ZABA 1CIWA 1HXS3 2H0BA 3SFEC 3N3HA 5FXWA 1GDTA 2QZ2A 3HRNA 2HBTA 1VALA 3OY8A 4RSUA 2WN3A 1G9AA 5BUVA 3BRVB 1OF3A 4HXCA 1O6UA 3KM5A 2LM3A 2OQ6A 1XTGB 3QH9A 3U4XA 3BTZA 2YBKA 2R073 2MNGA 2GUSA 4KT0J 1W8ZA 2DVDA 3D6EA 4ES8A 1ZRCA 3J7HA 4GKGA 3D5OA 1VL2A 5I91A 3TGUE 3H1HE 2H6BA 1EZVD 3GHNA 5M0TA 4Q0PA 1O5LA 1VBB2 1TME1 3LIEA 1UXZA 4YNIA 2KS1B 3G7DA 3IIIA 1DFQA 1T2XA 5JUVA 2JDNA 3CLQA 1YYCA 1U57A 5A7SA 5FY1A 3KZ4C 3VHRA 3USUB 2RMU2 4LTAA 3VDAA 3WT3A 1M8OB 1SFCB 3JD72 3L2HA 5C39A 3RBZA 4X6QB 5KLVG 2XL7A 4F8AA 4GOEA 2E75C 4L76A 2XDJA 2VM9A 5LA2A 2DURA 1K5JA 4W8JA 3ACIA 4INDA 3B5NC 1RF0A 2FYUD 4GB31 3SISA 3KF5A 4D6TD 1ZW0A 1HN0A 2KNCB 2XLGA 2Q8OA 2HG5D 2XVGA 4HOOA 4LGDE 5C71A 1N73B 1RXFA 3E1RA 3INAA 1TMF2 1SQBD 4YVSB 3IDCB 4NN0A 3EFFK 1KDMA 2D97A 3OGJA 2IXKA 3H1JD 4RQPB 1HGZA 2WO1A 2WZEA 5FYCA 4BM8A 1ASJ2 2Y26A 3Q8AA 1PGOA 5KAIE 3ZFGC 2VBDA 3GZEA 1KQRA 1QH6A 1QOTA 4GDOA 2AACA 4ZU7A 1GU5A 4X8PA 4XE5B 2BP6A 3A22A 1K45A 1N2DC 3HNYM 1W39A 1AX2A 4CXXA 3AEBC 4Q4X2 2DVBA 2JICA 3KDPB 1XNCA 3VBSB 2XBO2 2M8RA 1KFMA 3NSTA 2FCTA 4PDWC 3WP5A 2XGXA 3AVRA 5T55A 1EXJA 1OD3A 2E6VA 3HT2A 3VBRB 1DZRA 4AHYA 3M3EA 3ZN6A 3L75D 4LO8A 3WUCA 5FY8A 2RM22 1LOCA 5AFBA 4N43B 2NPSC 1F4AA 3TNQA 2KLVA 4LO7A 1HRI1 4D7TA 2UU8A 2XOMA 2IPPA 3WP3A 4GOFA 1DQ6A 2ZTNA 4EN9B 1FMD1 1XE8A 3KGLA 2RJKA 1ZBE1 2ZMLA 5JIAA 4MGSA 1SEFA 3TN92 4ZONA 4RKUJ 2P10A 3LD8A 3TK1A 3LFIA 4RGAA 2SLIA 1QJU1 2Y60A 1GP5A 1BHGA 4XMIA 3U0ZA 2Y8KA 2HWB3 2X5IC 4XQ4A 3FE5A 5EXOA 1KFNA 3LPFA 1L0LJ 1RE3A 4XMAA 1ZMEC 1GZWA 1W2NA 1AZDA 2WAAA 2C9AA 2WQ8A 5A80A 2HJIA 2VNRA 1WW5A 2G9FA 2O01N 3LSDA 4RFRB 1X8YA 2W0XA 2DBNA 1W9SA 4NAOA 2NMOA 1BXHA 1WCUA 4A4AA 1J3PA 2P17A 3J4UH 1E5SA 3M3CA 3N4MA 2UYAA 4MN4C 2PP6A 2IVIB 4GA9A 3H1YA 3HN1A 3I8TA 3KV6A 3Q5SA 1AXYA 2C0XA 3I2KA 4JYCA 3GG2A 1O4ZA 4PF5A 4LO4B 3MUDA 4LOSA 3RK3D 1FYUA 2GH2A 4I0AA 1T2KC 1W9YA 2ZGPA 3RRDA 3FWLA 3M70A 4XF9A 1NLSA 1CZTA 4GD4A 2G9GA 1H8TA 3T0BA 4W6YA 3OAKA 5JPMB 3OJBA 1QXJA 1PNFA 1KQLA 4YSFA 4K3UA 3VBOA 1DG6A 3BYWA 4ASLA 5F3EA 4XXAA 2LKMA 2IUWA 4QX0A 3R4YA 1Z7S1 4LE3A 4AYCA 5A7WA 2ZJCA 3IT8A 4D0QA 1KB9D 2P4EA 3NNGA 3OUIA 5FYSA 1SQQG 5HCAA 1WA4A 1TME2 5H9RA 3U11A 3CNAA 4LHKA 1H89A 4JYBA 5KLVJ 1IPSA 1E5RA 4HANA 1OZHA 2NM1A 4YXDC 5GZEA 4MSVA 3RYPA 4DXRA 2GH8A 3N36A 4HSJA 3ABVC 1KDKA 2JX9A 4COZA 4Z92B 5FK7A 3VD7A 2ID4A 2VZUA 2FKWB 2N9BA 2YMZA 5FY4A 3D71A 2ZGMA 1PGL1 1W3VA 5T52A 2VTFA 1PFIA 4M0NA 2YY1A 5GTIE 5ANNA 2F6BA 3L9JT 5FWEA 1R092 2EIGA 3H1MA 5IVYA 2KA3A 3OBTA 1WRGA 1LP1B 4P02B 3V6IA 3H3UA 3K48A 4UW5A 2P2UA 2D5HA 2GP3A 3IPVB 4FQZA 3VHNA 1PVC3 2OARA 5AW9B 2YU2A 4LQRA 3TAYA 1QQP1 1IKPA 4JGYB 2J7MA 1YNAA 2W1QA 3CDZB 3H1KG 4N53B 1NU1G 4GIQA 2NP0A 1X7NA 3PNAA 4UT5A 4LNVA 3GM8A 1RF0C 3UGHA 5FKCA 1M90Q 3DYOA 1O4TA 3RQ0A 4QQPA 3T0DA 1KFUL 4MUVA 3AEDC 4PBOA 1V6OA 3QH7A 4NOTA 3SWFA 4AUWA 1JUHA 3LIHA 3B02A 4M3LA 2YNYA 4QDSA 1MZ9A 3RL0g 1SFNA 4IE5A 1L3JA 5CCHA 2ZXEB 3V4QA 2RR11 4NPFX 3NMDA 4RO0A 2JG8A 2Z2SB 2X53S 5CFDA 1UZWA 3WD5A 1H9PA 1ND3C 3AKRA 5IWFA 2MEV1 2WLQA 2IX7C 1FPN1 3WDTA 3RGUA 2P3YA 1XNKA 5C6CA 4PCRA 4PD4D 4XUPA 1XNDA 4MV2A 2QQLA 3GBFA 4EN7B 5A6ZA 3MW3A 3TRSB 1UZZA 1HRI2 1JHJA 2FZ2A 1KJLA 4UI9L 4KWKA 4RN5A 4NIHA 2EIDA 1APNA 1FMD2 5BNOB 3LIDA 4L92A 1HV1A 4W6WA 3QOPA 3CXHH 4AI8A 3B3QE 2VZOA 3ZIWA 4GALA 1EAH1 5HCFA 1PO21 2DW3A 1QJU2 3QLQA 4OHZA 4CCJA 4J25A 3M0AA 1SMVA 2I1KA 1ULEA 4CYDA 3V4WA 2J1UA 4DS0A 3UL2A 1UPIA 4FPYA 3WSOA 2WO3A 4P9WA 4RGKA 2A6VA 2GZWA 2WA3A 3MGUA 4L74A 1E5WA 1X22A 1J1DC 2J1SA 2E76C 4IEUA 4UB8E 5AW6B 1NCRA 4E8CA 3K2OA 3KT1A 3U4SA 3IDAA 4BE3A 1EV11 4FPHA 1OOPB 1SLQA 4O9GA 1US3A 3ETPA 2BQPA 4E9KA 2Q8CA 1BE3E 1GOGA 2FMYA 3CLPA 1SQVG 4LHNA 1LR5A 2GAUA 3BOWA 2LW8A 2IZ1A 2JDYA 3UK9A 5D21A 1JB0J 4M3CE 5IJRA 1QX8A 2GALA 1C4RA 3BU7A 2Q7CA 4BRYB 4KI5M 4Q8KA 3WP4A 4D6SA 4L97A 1MS8A 3MIBA 1O3RA 1TVGA 1SQQJ 2ZGRA 3BRTB 4OH8B 3NO8A 3PU8A 1LOEA 3AVSA 3IMNA 3MUDC 4TN7A 3GZTB 3CKHA 5LWBA 1JY2P 3VDCA 1BVVA 2PQSA 2EICA 4IE6A 1WD3A 4LOTA 5C3SA 3ZXJA 4PQ9A 2E63A 1DZTA 1URQA 1KEXA 4Q2FA 3NAPB 1BDDA 3ZFEB 1H8TC 4Y4YA 4AI3A 5EFWB 1F35A 2QJYC 3O1UA 5EWSA 5KWRA 3VBUB 3VBOC 3RI8A 2A70A 5H9QA 3BPZA 1LTGC 3IAQA 5KHIA 1RUG3 1GZTA 2VZ3A 5JAXA 1LGNA 1JOJA 1J84A 3I59B 4HVRA 3K75B 2B45X 5C4WB 2WSFH 3RVHA 2W47A 2HWD2 1Q8QA 4BLIA 3NJVA 1ZRTE 3H1KJ 5IK8A 1ZRRA 3J7NA 2B9BA 2VR4A 2KXPB 5H2FE 2VD7A 2NRGA 1Y8AA 4H13D 4AVSA 5A33B 3VDBA 3VBFA 4QQOA 2QTWB 1MVQA 1QDOA 1QEXA 1L7LA 1UKGA 3HVDA 2CL2A 2N1TB 1EP0A 1ZBA3 2HWE3 4M3CB 3Q2YA 1YQCA 2C24A 1QQP2 2W87A 5F7UA 1VF5D 4WZFA 3WG4A 3ZYGA 2ILMA 4M4RA 2KXLA 2VGDA 2XLFA 1FATA 3K4DA 4XIOA 4COYA 1N1SA 1IG0A 3V64A 4DPNA 5CFCB 4N7UA 1GNYA 1POV3 2Q8DA 1M7LA 4HKLA 1Y43B 4WVZA 1CAVB 3WU2E 1JUIA 1C5HA 3ATGA 3EFGA 2L5GB 4D7SA 3T97A 1LNSA 5I93A 4W50A 1GL2D 3BIEA 4CDQB 2JJ6A 3JB4C 4AGRA 3U1CA 3VMXA 5F2WA 1IC2A 1EXIA 3H8UA 3WY6A 1NTKD 2ARBA 4EWDA 1H30A 2RS12 2DTYA 5DUXA 5CA6A 3HQUA 3LQCA 4Q8LA 3DUIA 4CP9B 1JYVA 4OUMA 2V7QJ 1GANA 1KQFB 2QDRA 2OT7A 2JWDA 4O7XA 4E27A 3RI9A 1AQTA 3WDXA 1W06A 4X8NA 2JG8C 5GLVA 4A41A 1EAH2 1PO22 3GJAA 3M7AA 1M56D 1DHKB 1QJZA 5I8TA 5B5EE 1NJIQ 2HODA 5JVVA 1VBC3 3A2AA 4H55A 3CCUP 1FDIA 3N7JA 4CUAA 1OWAA 1PPJG 1WD4A 1JM0A 4E4ZA 4H0LB 1K9MQ 1SVFA 4ORFA 2Z5WA 1VB2A 1IG3A 4NRPA 1W6QB 3CQOA 5FZBA 3WCRA 3RZKA 1W90A 3N9LA 3JCUH 2IBZD 3O1SA 5CBNA 4EE2A 2GN3A 1YC61 1QXPA 3BCCE 2VCMA 1ZREA 3R0RA 3AL5A 1FT9A 1LOGA 4OLLA 5FLHA 5SV5A 2W95A 2ZJSE 3W59A 2EALA 5KJ7D 5JXJA 3LZZA 4GJZA 5JXGA 2O8QA 3D0SA 4DCKA 5A1AA 4IEOA 5IFTA 1H88A 5JLVA 3DL3A 3NKTA 4QB2A 3VZNA 1MPXA 4UBGA 2YDEA 1QF3A 5T54A 1SFCD 4OQ9A 3WQBA 4LBMA 4OQ8A 1L2PA 1Y9BA 3CZJA 4C90A 1Q8OA 2QA4P 5APWA 3G6JB 4LKEA 3CX5E 1LB2A 1NCRC 4CCCA 5JZGB 1OI6A 1XPWA 1SLTA 3WNPA 4GULA 2HKXA 1JYIA 1NQJA 2QJVA 1NLQA 1ZBE3 2R061 2RN0A 4I02A 3SCHA 1I5PA 1CAWB 2X10A 1NTZG 1PZ9A 3RJRA 5BU8B 3CC7P 1W04A 1ZRIA 4LMFA 5FP7A 1GTWA 1UU4A 1SPPA 2TNFA 1WUVA 2QEXP 1DZQA 5C3QA 1NKZB 3O1VA 5HPOA 1WLCA 3CJIA 3JBG1 1KMIZ 3VKOA 4AEMA 5AW2B 4N8MA 4XAEA 2K88A 3THDA 1BCCG 3PMEA 4CPBD 2K3RA 4HZFA 2KIKA 4B4PA 1YWKA 2F4PA 3TB0A 2BWCA 3AEEC 4S2GA 1AYM1 5F37A 1YI9A 2IFMA 2E7QA 5H9SA 3TGUD 4N6JA 2JDIH 2XJUA 3HTKB 3H1HD 2ET7A 1NT0A 4CRQA 2CNAA 1LGHB 3S0MA 2AR6A 1URQC 1YBKA 5A6QA 5CFDB 1Y7BA 3ZYIB 3I97A 1Q8PA 1LRHA 4AW7A 2PA7A 2OPKA 5T50A 3UJOA 4DIQA 3L74G 1VBE3 5FV3A 5LEKA 4OHYA 4AI2A 3B71A 1SLLA 4OGQB 2XHNA 4UOJA 1VQ7P 4CCEA 3KV9A 4BYYA 1K05A 1SACA 2OGUA 1NTME 2Y0EA 2ZAEB 1Z7S3 5LBCA 3ZDMA 4RR3A 1SQXE 3VBFC 3LEIA 3FFQA 1YQ8A 5K0UA 4CDXA 3AE5C 3PJYA 3D82A 2VZTA 1H2NA 1VAVA 3TNUB 2JWAA 2FXOA 2OXBA 4FAHA 4FOWA 2XV5A 3WQ0A 1V6MA 2R042 1FOD3 3D3AA 5LRRA 2CGNA 3POGA 3SCFA 4HPKA 1SCSA 3CWBJ 1QJX3 1JS9A 2Q1FA 3CCEP 1AFOA 2WS91 2ITAA 3K4AA 3NNJA 1VPHA 5I0SA 3J8F1 3PUIA 1K73Q 1UD1A 4Y3OA 4TYSA 3H32A 1UIXA 4B1MA 3OYWB 3RGBA 4M0HA 4CPGA 2H89C 3LPGA 1VIWB 3BTXA 2HEVF 3ZIXA 1POV0 1HJFA 2JE7A 1EDKA 3E6CC 3S7IA 1RHI3 5FLIA 5AVWB 1W8HA 3S30A 5KLIB 3U75A 2VQTA 3H1IG 2V09A 2TUNA 2D93A 2DCYA 1JYWA 2XH6A 4PHZA 1RUC2 3HNMA 3HE5A 1V6IA 3WUTA 1LHWA 5FMOS 2VUDA 4V2VA 5FZAA 5FZ4A 2VU9A 3L35A 3ALQA 2W1SA 5FZOB 4M01A 4AVTA 2FFDA 2Y9ZA 4XF0A 3R4SA 4COUA 3CBNA 3ZVXA 2Y0IA 1ZRDA 3ZXEA 2UY8A 5L7OB 1URQB 2RDQA 2ZHKA 3P8MC 2OYHA 1FU1A 1NTMK 4Y1UA 1VP6A 4IGOA 5TJHA 4QAWA 4XACA 1SQXK 4A3ZA 1AXZA 3K4ZA 4KQ7A 1OKOA 1RUE2 2RR13 3O7OA 3HD7B 2I45A 3BALA 2QBXA 1LWUA 3T1LA 1YIPA 1OPOA 4CEWA 5B4NA 1SLAA 4GKYA 4MGZE 3A0HH 1NTZJ 3TOJA 4AHXA 2BCCJ 4ZKTB 1UIIA 1ULOA 3AE6C 3USSA 3I3QA 3RG0A 1T6BX 4N78E 5D1IA 3LE0A 1ND2A 4QXKA 1FX5A 4OI0A 2KYVA 3GHMA 4LKDA 1O3SA 4OVEA 3ENRA 3PVNA 4B4QA 1IPKA 5FZ7A 5EHDA 1LT9B 1A8MA 1MVEA 1N7LA 1BK1A 3M3OA 1KV4A
chains in the Genus database with same CATH topology
1VBE1 4P5HA 5C9AA 2ZGTA 3C2UA 4HL0A 1RJ8A 5DZFA 5F6KA 3JBG2 1EPZA 2Q0AA 1QNWA 2WFF3 5D8AA 4HN0A 4XZPA 4GKXA 4Z07A 3KD4A 4ZXKA 1DGWX 4PIYA 1S0FA 1UCXA 5BNOC 2CWMA 2RE9A 2EAAA 2OA2A 3IIAA 3DN7A 2CGOA 3B01A 1OA2A 4AE2A 2WZPP 3R4UA 2XBO1 4H7MA 4BQ1A 1W6QA 1YJLA 3VBHC 4IV3C 5JOWA 5J09A 3QD6A 4S2HA 2VMIA 1CESA 4R9BA 2D44A 4RD7A 1IS4A 3VGIA 1IPJA 1R093 1XQNA 4GB33 1N3QA 3GZUC 4Q29A 4XBLA 3V65A 4XFIA 2ZBJA 4FPGA 1CAUA 3EO6A 1R083 3CU7A 1RUC1 1ZZ9A 3ZXLA 1RB8G 1R1A1 2QCSB 2XLAA 2RM21 3VZKA 5FOJB 4XFHA 3LA2A 1AL0G 2ZHNA 3MIGA 4I30A 3CJIC 3NV1A 1RUI1 1NZCA 2A3XA 4XIKA 3FLPA 3WX5A 2D43A 4NR1A 1H8TB 5LEJA 1FOD1 2X5IA 3PLQA 2ZX2A 3AMNA 5JPNB 5JMCA 2CAVA 2CK3H 2PHXA 4CDWB 5SV8A 3LA7A 3P3PA 3FLRA 1AJOA 2DCZA 1NE4A 5EV7A 1D4M1 3AXDA 4V1PA 4F3JA 2QQPA 1ZZCA 1QJX1 3VBOB 5T5PA 1VBD2 3B9CA 1S2BA 1Q56A 2JXAA 1AR71 2CWSA 4FOYA 1HLCA 2SBAA 3AZZA 5B2GB 4YG3A 3TN91 1V6JA 4QT6A 2WFPA 3WG1A 5IK7A 1GZ9A 2WSSH 1DGRA 2HWF1 2YPJA 4XYXA 4MX3A 4Y1ZA 1MQTA 1Q3EA 5GLWA 4Q4V1 3IKWA 3R05A 3ELNA 2VUAA 2ZMNA 3B69A 5JZGA 4NPRA 4NWWA 4OHXA 1TNFA 2CYFA 4RHV1 3AYEA 1JN2P 1RHI1 3MZHA 1V00A 1OOPC 1ENXA 1PK6B 2IXLA 3WUDA 3MIDA 4J1XA 4GB32 2A75A 4IEVA 5C33A 5KXEA 4OI2A 4L8QA 1C1FA 1RUE1 3IBMA 3SHRA 1HDKA 1NLRA 1LTEA 1CAWA 4AVVA 3SITA 3GBWA 3RDIA 2VW1A 1NCQC 1VBC2 4E2GA 1LU2A 3OCPA 2ZKNA 1V6LA 1TE1B 4I3PA 3ASIA 2WNUC 1IOAA 2HEYF 1H1IA 1FI2A 2GMMA 3BCWA 4LBJA 1OQ1A 4ZU4A 1DGLA 5ACA2 4JGZA 4YM2A 4XF1A 1AYN2 3AP4A 3RYKA 1BSNA 4JAAA 1C57A 4EWEA 1RUG1 3VZJA 4KU7A 2VVEA 4A2UA 1HRI3 5KC6A 2R1DA 1HW5A 2EA7A 1LEMA 2VOWA 4YZ2A 2HWC2 1REEA 2BGCA 3ZSMA 4AFBA 1NA1B 1W6OB 1SLIA 2ZAHA 2DF7A 2JE9A 1FMD3 1QNYA 2WQ4A 1LHNA 2K9ZA 4YVWB 2GNDA 4CEYC