4TLFA

Crystal structure of thiol dioxygenase from pseudomonas aeruginosa
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
194
structure length
194
Chain Sequence
LRLDRLRQFIGELATLLDSRPDESTLLAQAHPLLAELVHQDDWLPEDCARPDPQRYQQYLLHVDSRQRFSVVSFVWGPGQITPVHDHRVWGLIGMLRGAEYSQPYAFDAGGRPHPSGARRRLEPGEVEALSPRIGDVHQVSNAFSDRTSISIHVYGANIGAVRRAVFSAEGEEKPFISGYSNSRLPNIWDLSKE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Thiol dioxygenase
publication title The Cysteine Dioxygenase Homologue from Pseudomonas aeruginosa Is a 3-Mercaptopropionate Dioxygenase.
pubmed doi rcsb
source organism Pseudomonas aeruginosa
total genus 49
structure length 194
sequence length 194
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2014-05-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05995 CDO_I Cysteine dioxygenase type I
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.440 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces ATP synthase delta/epsilon subunit, C-terminal domain 4tlfA01
2.60.120.10 Mainly Beta Sandwich Jelly Rolls Jelly Rolls 4tlfA02
4AQ6A 4QXKA 3H3ZA 5K8SA 2MPFA 3RZZA 1Q43A 4X6QB 1O3TA 4Q29A 3EQEA 4Q0UA 3EFFK 2UY8A 1BSHA 3SCFA 4WBBA 5I8TA 2EAAA 3FHIB 2GC3A 4AQ2A 4YRDA 3CLPA 4LTAA 3LOIA 1YFXA 2OZ6A 5LEJA 2O1QA 4IEWA 3NL1A 5FPXA 2CK3H 2F4PA 4HVRA 1LRHA 3EHKA 3B02A 4IEPA 1JEKA 3SCGA 3E97A 3NVCA 5I8YA 3QOPA 4QM9A 1ZX5A 1CAWA 4IEUA 2XL7A 4LA2A 2DCTA 1O3RA 4BYYA 1AQTA 2XGXA 3SCHA 1J1LA 3JZVA 2GC2A 4PJYA 2D93A 2IXJA 3D0JA 4HMZA 4JV4A 4PIZA 1QXRA 1CAUB 3QACA 1H1MA 5KHIA 3KGZA 3L2HA 4IEYA 3H1MA 1X8EA 3ELNA 3PJSK 3LA2A 3H1WA 5KHJA 4R52A 4KWLA 1PMIA 4LUMA 3WW3A 2ETEA 3LZZA 1VP6A 4IEZA 4XFCA 1G6NA 4EWEA 2GC1A 2QVSB 5CVRA 3HT1A 4ORFA 3UKTA 4E2QA 2BNOA 3G7DA 4QX5A 1EP0A 4WZCA 1O7FA 4A2UA 5I93A 2XKPA 4IEVA 3IDCB 1Y9QA 4IERA 3H3UA 5LEKA 1TQ5A 4XF4A 5EZWA 5JSOA 1NYWA 1NZCA 5KHKA 2PHLA 4F7ZA 4N9HA 3FWEA 4HLTA 1DZRA 1XE7A 4MGIE 3NKTA 4FAHA 4H7LA 3HQXA 4PIYA 4FAGA 1UPIA 3BB6A 5EFUA 1ZRFA 3DKWA 2FMYA 2E5YA 2ZCWA 3LWCA 4R8HA 1CAVB 5KHHA 1ZZCA 3TNQA 4UBGA 4FBFA 3MDPA 4HVQA 4MGKE 1OI6A 3PLQA 5BPXA 1LR5A 2XKOA 1RUNA 3RPQA 4TLFA 5FLIA 4MX3A 1ZRRA 3IIAA 1LKNA 4XFIA 1FT9A 5FQ0B 3RYKA 1SQ4A 4OLLA 5AVPA 3HT2A 4ZU7A 2PYTA 4ZU5A 1CAXB 4CYDA 1YUDA 1UCXA 3H8UA 2GZWA 3E6DA 4MV2A 2OYZA 1DZTA 3M70A 4HSLA 2HKXA 1J3RA 3ES4A 1U12A 1IPJA 1YWKA 4XF1A 3WW4A 3D82A 2IXLA 3PVBB 3GYDA 4YYOA 3UKNA 2OPKA 4BH9A 5HI0A 3H50A 4NVPA 1X82A 5CADA 4XFAA 3SHRA 4Q0VA 4X6RB 4DINB 4QMAA 4QM8A 5T3NA 2XHKA 5BV6A 2MNGA 5JR7B 3KMHA 4EWAA 2QE7H 3WW2A 1EY2A 1UW8A 4O9GA 3CJXA 4AXOA 2XL9A 1CAUA 5C8WA 4QGMA 1X7NA 1DGRA 2PHDA 2VPVA 1I6XA 1O4TA 5BUVA 1ZRCA 2EA7A 2W6JH 4I01A 4BHPA 2E9QA 4IEQA 2O8QA 1Y3TA 2V7QH 3OD0A 3S7IA 2PA7A 2I45A 5JAXA 4J1XA 3H1YA 3U0ZA 4DJGA 3NJZA 1J58A 2XLAA 1EPZA 2PAMA 3DN7A 1XRUA 1YFWA 4KU8A 2GC0A 4UBHA 4E2SA 1GQHA 3IWZA 2Q30A 3NW4A 4F8AA 2IC1A 4P9GA 3FZ3A 2ET7A 1V70A 2CGPA 2D5HA 2D40A 2Z2SB 3OGJA 4D7TA 4O9EA 2BEOA 3ES1A 2PQQA 3E5QA 3LA3A 5J48A 4I2OA 1O3SA 4AVAA 4KU7A 3FJSA 3I59B 5KHGA 4LUKA 1O5LA 2GU9A 4L2NA 1WGPA 1NXMA 1ZZ7A 2B9UA 2UYBA 2IXKA 3FE5A 4LLOA 3BPZA 4N9IA 4E2GA 5C6CA 1CAWB 4IESA 1QY4A 1RL3A 5JSPA 4GULA 2PTMA 3N4MA 2MHFA 2XLFA 3D0SA 1RC6A 3C3VA 4EWDA 2IXIA 2QCSB 4QGLA 4YNIA 3LA7A 4D7SA 3H9AA 3BALA 3BCWA 4XEZA 5J7MA 1EYBA 1UIJA 3HIFA 1GQGA 2Z69A 5I8SA 4I0AA 3ZDSA 1QWRA 3MYXA 1J59A 3E5XA 4AVBA 4EV0A 4HSJA 2UYAA 2QNKA 3RNSA 1CX4A 4KWKA 1NE4A 2H6CA 1LB2A 1VR3A 1ZZBA 3EBRA 4LA3A 2WC2A 5J3UA 1Q5OA 2PAKA 2BYVE 4ONUA 3OF1A 1RTVA 5I0TA 1FXZA 4LEJA 3SMHA 5I0RA 5LRRA 3TNPB 1L3JA 1ZZ6A 2VECA 3CL1A 5I0SA 5FDBA 1J3PA 1IPKA 4XETA 1YHFA 5KBFA 4HBNA 3RYPA 3VHRA 3KSCA 4KL1A 4HVOA 4META 1J3QA 3EJKA 4MGYE 4QGNA 1JUHA 3GBFA 3H7JA 2GH2A 3I54A 3RDIA 3S7EA 1OD5A 1X8MA 3DV8A 3E6BA 1ZRDA 4KWJA 1I5ZA 4XFFA 2B5HA 4EROA 4OFGA 2BNNA 2WSSH 2EVXA 1E79H 2OA2A 4L11A 4Z07A 4JTOA 3H7YA 4J1WA 3KGLA 4WVZA 3MPBA 3CF6E 1ZVFA 4MH0E 2V09A 2FQPA 4YSFA 3I59A 3IDBB 1YFYA 4Q0SA 2KXLA 1PM7A 5LRSA 4I3PA 2CAUA 2BNMA 1RUOA 1ZNPA 3RYRA 2K9ZA 4HZFA 1OFNA 4HN1A 5I0UA 1BSNA 2HJIA 5F1RA 4Q0QA 4Q0PA 5FCCA 2N7GA 1CAVA 2UY9A 3BU7A 4XF0A 2C0ZA 1DGWA 4HN0A 3EO6A 4XFGA 4ZU4A 3FX3A 3U10A 5FQ0A 4IETA 2IXHA 2ET1A 1CAXA 1YFUA 2Q4SA 1VJ2A 3ACLA 2XLGA 3CEWA 3FFQA 4B29A 2GAUA 3ROUA 1XE8A 3OTFA 4IEOA 3LAGA 4MUVA 3E5UA 5BXXA 3I7DA 3MZHA 2QJVA 5E1RA 4LULA 2P17A 2ZKLA 4I0BA 1ZREA 1WA4A 1OMIA 3PNAA 1SEFA 1FS0E 1ZZ8A 4XF9A 3ST7A 2D5FA 4MZUA 1IFPA 3M3IA 5FLJA 1ZZ9A 2PFWA 4AVCA 2WFPA 5BY5A 2CV6A 1O5UA 2XNDH 2BGCA 2H6BA 4XFBA 4FT8A 1UD1A 4XFHA 4JTNA 4K8FA 4XF3A 5CU1A 3ETQA 3KCCA 2K0GA 5I91A 2E5TA 1H1IA 2OZJA 4IEXA 3USSA 4YARA 2Q1ZB 1CGPA 3UKVA 5E16A 1YLLA 4BIFA 5JSRA 1HW5A 2VQAA 1Q3EA 2IXCA 4JVAA 3U11A 2H0VA 4I02A 2CAVA 4RD7A 1WLTA 4MGZE 1QXJA 2Q0AA 2Y0OA 3CO2A 1UIKA 4PIXA 3OCPA 3S0MA 3O14A 2JDIH 3E6CC 3IBMA 2ATFA 1RGSA 2B8MA 3SXWA 2QDRA 3DL3A 5FPZA 5FLHA 2PAEA 1O3QA 5JCTA 4I09A 1NE6A 1SFNA 4UXAA 3R6SA 1FI2A 3WW1A 5D1IA 4Z82A 3NSTA 4YXWH
chains in the Genus database with same CATH superfamily
3R4DB 4AEMA 4GOEA 2RS11 5CJ0A 2G19A 2ZAHA 1VDFA 2Z5WA 2M5AB 4M3CF 4Q8KA 3AXDA 3N7NA 3FHIB 3BOWA 4BQXA 5IATA 2J1EA 1YFXA 1AX0A 4NHYA 4AE2A 3WU2H 5CIRA 4PDWC 2YMKA 4K20A 1JW6A 3E97A 1W3XA 3ZXEA 1RUI2 2W2IA 4EZHA 4C46A 1CONA 1W9SA 5JIAA 1SQPK 4CXXA 2IDBA 4JV4A 3LIGA 4Y99C 1FYUA 3AKQA 1W5CE 4XCBA 1WLCA 2J58A 3WW3A 3A7QA 2JDMA 4YW2A 4PV1D 2IUWA 1QEXA 1NTMJ 1WBLA 2BNOA 1MFTA 2C9AA 1IO4A 1RUI1 2XH6A 1SQPG 1ENQA 3DF0A 2YGMA 2A6XA 5ABJC 1DZRA 3VDBA 4Q4V1 4UB8H 2PLV2 2WWUA 4RESB 1DQ5A 5F3EA 2SBAA 1DEEG 2EIEA 5KHHA 1WBFA 1DF0A 5E89A 3RPQA 4LK6A 4YM3A 4H14A 4IE4A 5A7WB 1ND2A 4LE4A 2FFDA 3FMGA 4ZXEA 5FKBA 4BRYB 3H1JG 1QOOA 3I2FA 2XBO2 2OYZA 3DUIA 2RN0A 2J7MA 4LIVA 4S2FA 1XJAA 3N7MA 2PLV1 3TSIA 1IPJA 4XF1A 1HRI2 1UXXX 2BV4A 3ZFEA 3IAQA 1VBD1 2KK7A 3CKHA 5ACA3 4X6RB 4DINB 1KC8Q 4RQPA 3CCQP 3OBTA 1LTIC 1OH4A 1UYPA 1OPMA 1H88A 4QDSA 3H1IJ 3P8MC 2MEV3 2YROA 2XBO1 4UFMA 1HLCA 2Y60A 5FK7A 1ZRCA 5CFDC 1H8TC 3I49A 4CDUC 4R4MA 2ZZJA 1IG0A 2FYUK 3BCCG 2R072 4BQWA 3H8OA 5C8CC 2WS91 3KQRA 2BWCA 3WCSA 4N3YB 3DN7A 2AXTE 4UBHA 3ZOIA 4XURA 1KILC 1HWTC 1FDIA 1VB4A 4U7JA 1H1AA 3Q3DA 1LT1A 1M1JA 2E7QA 3HN1A 1CQ9A 3WXPA 4Z92B 2JDKA 4QU1A 1W8WA 2HODB 4LUKA 4U3FJ 2R071 1ZRTD 4AK3A 1FATA 2K9JB 4XQWA 1RUH2 1UOGA 1MVQA 3A2AA 1BEV2 1VB2A 3IN9A 1YI2P 4JQRA 5JSPA 1NVOA 5GZEA 3C3VA 4GODA 4FPEA 2G1MA 5EYYA 4XE5B 1LJ2A 4QB2A 3TAYA 3LA7A 2YXRB 3HD7D 2JXAA 2CPBA 5F32A 4XEZA 1WA6X 2WR9A 1T3UA 4R9AA 1KILE 3A3YB 1Q8SA 5AVRB 2GDFA 1RUH1 1L0NE 1BEV1 1QH7A 3GHGB 3MIHA 3UL2A 3KZ4C 2VMGA 2R16A 4MADA 1SS1A 1GZLA 3HD8B 4D94A 1LNQA 1ND3B 1YTZI 2AEZA 2VECA 2N9BA 3FLRA 1W8TA 3SH5A 2WNOA 3VHRA 4QPGA 2ZKNA 3THPA 3WINE 1J1DC 2WA4A 5FYZA 3DV8A 4LBQD 1OIPA 3RMXA 5CZKA 4XBNA 5DZEA 2BBVA 3VBRA 1SQQG 3MPBA 4NRMA 4UFLA 1KYOE 1RMU3 2ARBA 1RUE2 3P8CE 1MS0A 2LW8A 5C4WB 3VBSA 4NAMA 2NPSD 3ZXFA 1BSNA 1W6PA 1MS1A 2ZGQA 5D2AA 1EUTA 1WMXA 2UY9A 5J96B 1WCDJ 1U7JA 2E31A 4HN0A 2D2CB 4PT6A 3KT7A 2JKVA 2DUOA 3M2MA 5FZIA 1H9WA 4NHKA 2Y34A 1RUE1 4AEDA 4GWIA 2OYIA 2DCKA 4FSJA 3D6ZA 4CP9A 1OOPC 1K45A 1MACA 1VAKA 2YC0A 3MGNA 2LTNA 3HE4A 2LRPA 3CCJP 4Q27A 3FLPA 1NY72 1EZVE 1IG3A 5BNPB 3F95A 5B5EE 3KHCA 1H1IA 2AXCA 1C3HA 1GFF2 3Q8FA 3NAPC 3L74D 1PM4A 2ZXXA 4JAAA 3VTPC 2JEMA 1JMUB 2AACA 1JBCA 1IFNA 3WVJA 3O1TA 2C9KA 1FMD2 1NY71 3AKRA 4QXKA 5KLVD 1OWAA 2AYHA 2WABA 2NMNA 2K1AA 3MLKA 3POJA 1YI9A 5FMOS 2M3BA 2BEQD 3TN93 4IXLA 1QVGO 1ZA7A 4XDQA 3E1F1 4HVRA 5IVEA 3I56P 4LORA 3RJRA 2RKLA 2N1TB 2HEWF 3J8F2 3QH7A 2VMFA 1FMD1 4SBVA 5FYIA 5I8YA 2XV5A 1NTMK 3GCXA 4I3GA 1Y9MA 3AFKA 3NJXA 4PQ9A 3I2KA 3A22A 3LEGA 3K4AA 4LUMA 1VP6A 2WZEA 5CVRA 1SQXE 2FDJA 2A3XA 2W08A 5C33A 3IDCB 4B4QA 5CG8A 5DUWA 4LNVA 5DPNA 1AR83 2W95A 1JY3P 3DPRC 4N43A 1LWUC 1JNMA 3BUCA 4AR2A 4HK9A 3E1IA 1POQA 5FPUA 2B4KA 1KFNA 1VLNA 4BQ4A 2YU2A 3HT2A 3WQ1A 2PYTA 3PDQA 1UCXA 1SQPD 2GZWA 4WVVA 3O1MA 5BVZA 4ZNCA 1WMEA 3FUOA 2WTYA 2PELA 1VE0A 2JDZA 1T2XA 1CZSA 1DDLA 3KMHA 3M3QA 1L0LG 5C8WA 5LASA 4DXTA 1JZ6A 1X7NA 5AC91 1ACCA 3ZN4A 1O4TA 2V4HA 2VU9A 1IK9A 1AL22 2PHFA 2C6SA 1JZ8A 2GC0A 5KJ7D 1S2BA 1SFCC 3WOGA 1MV8A 3QH6A 4HETA 3LIEA 2X09A 1W6QA 2NN8A 4D7TA 3R2PA 1VBC3 2ZABA 3PVEA 3OY8B 3BCCD 1GSLA 5B5EH 3ALQA 2B9UA 3GF6A 2OUJA 4MG2A 1H0TA 4M01A 1CZTA 1XOYA 2PTMA 1R5SA 5FPLA 5LBBA 3W21A 2IFMA 1F8VA 1U5ZA 1IS5A 1CI6B 4NPEA 3UT0A 1XTGB 2KS1A 2BERA 4Q4W3 4PD4E 2FYUD 1ZBA1 3WNMA 2ZT9B 2OS2A 2B89A 2JD9A 2Z4FA 1QQP2 2DWRA 4JPZB 2BP6A 3A0BE 3I3EA 2KSEA 1RQVA 2CNAA 5AFBA 2D2CD 1V00A 3J7HA 3H1HG 4LEJA 4HYTB 3Q5SA 4DT0A 4XETA 2E7AA 2RM23 3AE7C 4A7KA 5A33A 2XJRA 3I2JA 2QM8A 3AP5A 5FYVA 2VZRA 3CXHE 1G9DA 3H7JA 1AYN2 3A0KA 3S7EA 3WP6A 1LODA 5FOJB 1F35A 1C8M3 3JBG2 1AV1A 4O7XA 1QQP1 3JB4C 2WSSH 1M1KQ 3CCLP 2PQSA 4J1WA 5J1XA 4AGGA 1YCIA 2V09A 4C7NA 5A32A 2HH9A 3K4ZA 5FZCA 5FR3A 1J1EB 1TU3F 1IS6A 4PI0A 3WT3A 1CJPA 3HQRA 3U4SA 5E8AA 4XF0A 1FZCA 1FOD3 5GTIH 2OT7A 1SQQD 3WMM0 3VBUC 1PPJE 3A21A 3VD5A 2Q4SA 4DUVA 3OEAA 5A70A 3L73D 1G8WA 1AQ5A 3L70E 3JUUA 2JD4A 4URTA 2O3JA 1NTZE 3MZHA 2P7JA 3M0DA 4IOIH 1MZEA 4BXLA 1OA2A 4WM8B 3M9BA 4QQOA 1WCUA 2N1TD 3L37A 4IEXA 4LOTA 3U11A 1ULEA 2P6HA 3OSDA 2UWJE 5IWFA 2Y6LA 3CC4P 5J98B 1N2DC 5CYYA 1QVFO 1XYOA 2B7YA 2C5DA 4KT0J 4D6TJ 1KS4A 5JI7A 4Q29A 4Q0UA 3EFFK 1OKQA 2Y38A 4K1YA 1MZ5A 3OJBA 5FZAA 3C7EA 5FXWA 2KXPB 3ZFFA 2OZ6A 3SWYA 4IEWA 1HRV3 3NL1A 3ZXKA 1OLQA 5FZEA 4YXDC 5ACA2 1BMV2 3MIGA 4DRRA 3SWKA 5IVCA 3NVCA 1SDWA 4FTEA 3OBRA 2YPDA 4UW6A 2MEV2 5CFCC 2GH8A 3D8CA 5FPBA 2FCVA 4JC1A 3F2ZA 1ND2C 4P9LA 3Q8AA 1BHGA 1YYNA 3ELNA 2FFDC 4KWLA 2R32A 2YPJA 1MS5A 1RUG3 5K7PA 5ACA1 3I2IA 1MR5A 1GU5A 1O7FA 5FFOC 3ZFEC 3O0XA 3JSVC 2PHLA 2B39A 1JZ7A 4N9HA 2E6VA 2JDAA 4OHZA 2YFZA 3CIHA 1SLTA 5ISLA 3PP5A 2NYYA 2WVRA 4FAGA 4A7ZA 4FFHA 2VXJA 4R8HA 1RHI3 1GLHA 1WWYA 2W90A 5CCHD 4HL0A 1PMHX 1NTMD 3RYKA 4OLLA 5EPAA 3T97B 1UZZA 3CPWO 2X8KA 4FPKA 1Q7YQ 2XHNA 3HD7A 3T0AA 3C7FA 4P9YA 1BJQA 5G04L 1RE4A 5AW7B 1QJX2 3H50A 4PQQA 2RE9A 4U36A 4CP2A 1ALYA 5T3NA 1M1JC 1KQFB 3HJRA 5L7OA 4O9GA 3LD8A 2NPIA 5L73A 3V0BB 5LBCA 1R5LA 1NOHA 5DAVA 5LATA 2VBBA 5F3IA 4FTBA 2VPVA 1I6XA 1RXFA 4BHPA 3S5QA 2F6BA 2ENRA 2ZT9D 2I45A 2B87A 3B5NB 4J1XA 1QJX1 3O1RA 1GZWB 2P3JA 1QH6A 5CJ4A 4LBQA 1PNFA 2TEPA 3KM5A 1NG0A 1L0LD 3WF0A 1ONAA 1DYKA 5LBFA 5E79E 2DCYA 1UMIA 2KM2A 1NU1G 5FUPA 2DU1A 1J2JB 1WGPA 2NPSA 3OPZA 2R063 1CAWB 2V4VA 1VQ8P 4QPGC 3NNJA 1S0IA 5AW3B 4COUA 1GTWA 3RK2C 4EN0A 3C8XA 4WWIA 2M5AA 5KXBA 3VBRC 5J7MA 4ITCA 2Z69A 2CGOA 4EOTA 3LEKA 3IN6A 4HSJA 2WSUA 3T2PA 3TOJA 2P2UA 1CX4A 1MVEA 3VBSC 2WN3A 1OQDA 1E5RA 1UYXA 5I0TA 5HCBA 2PAJA 3MGUA 2X29A 3TNPB 4N78E 2D6KA 4W6XA 1GOHA 1ZA4A 3GALA 2QJKC 4K3UA 4YPCA 1OW6A 3CCEP 4I7ZC 1OD5A 1F31A 4AEDC 2BNNA 1HB4A 2OX0A 2BVVA 3HBZA 1RUF3 2GNMA 4Z07A 3H7YA 4H13C 4ISRA 5FP7A 4AI1A 1DG6A 3H1HD 3GHMA 2EXJA 4E4DX 3RZLA 3TN92 1APNA 1LJ7A 4G3YC 4FTSA 2XONA 3P5BA 3APBA 2N7GA 3BU7A 1IFDA 1LEMA 1VPCA 3FBYA 5A7WA 2P58A 2P3IA 4BRYA 2A5ZA 1AL0G 4I0WB 4MUVA 1X8YA 1YHQP 1YO8A 3HNMA 5E1RA 3TN91 4P14A 2O1JA 1NA1B 1P8JA 2FYNB 5EJ3A 3J7MA 5FZKA 4M0NA 2ORZA 3VL9A 4NHLA 2BGCA 4AF9A 2VMEA 3NV2A 2W94A 1IJDB 3ETQA 1HJ0A 5AFEA 2KR2A 1LCLA 2Q1ZB 1AR82 4DZGA 5BNOC 1LOCA 3WX5A 2IX7C 5EJZB 1WLDA 4L8QA 2ZEZA 2W1QA 2B46X 5C9AC 2OGUA 3HNBM 1NTKE 3D70A 3H1LJ 3R4UA 2Y0DA 4RFT0 4Z82A 2WT7B 3BU0A 4YM2A 5HCHA 2HLOA 4IV1B 5CB7A 2RDNA 3NFQA 4HKLA 4Z2WA 1KQGB 4W8JA 4YRDA 1W9YA 2BOJA 5C5TA 4Y1XA 5LEJA 5J36A 3MF6A 2JEEA 3INAA 1S2EA 4N43C 1D4M2 1UZVA 3SCHA 3DGTA 3AKTA 1IS4A 5IFTA 1CAUB 1S72P 5KHIA 1RB8G 1D0HA 5A6QA 1CPMA 3MW4A 5K5GB 1W6MB 3EMRA 3NMDA 4RHV2 2G9FA 4IEVA 4NROA 2DBNA 1D4M1 4XJAA 1H2MA 5EZWA 3GHGA 5KJ7A 2GN7A 1HJFA 3FWEA 3FFZA 1W0PA 2WNVC 3JXSA 3A7OA 1VBC2 3WEZA 1RF0A 2F17A 1VQ4P 1T2KD 3PU3A 4ASWA 3LDRA 3B5ND 5JZGB 2WZPP 3LW5J 1ZV8A 5FZHA 2H8PD 3KXDA 4YPJA 1JZ5A 1ZRRA 1LKNA 4RHV1 1VAMA 3VMAA 3U75A 2JR8A 2BCCG 4KMQA 5BU8B 1BGYE 3P3NA 4Q4W2 1VBC1 3JCUE 1IQAA 5FZGA 5C4WA 5HI0A 1GUIA 3UGGA 2AGSA 2VZSA 1X82A 1BVP1 1EV13 3NNFA 2LXCB 2NLRA 3UYJA 4KGQA 1HB3A 3MIWA 3CJXA 4DCKA 3ASIA 2XL9A 1S55A 4EN6B 4DUWA 4UFJA 1C57A 2RM22 5FOBB 2JECA 1CSBA 3CZUA 1RUD3 3U0ZA 1TG7A 5APVA 3I3DA 3MV01 1E5IA 2PAMA 3U14A 2OTLP 4BLIA 3VHNA 4CEYC 4IGQA 2CGPA 3H42B 2D40A 5LW9A 3OGJA 2HWE3 3CJIB 2PQQA 2RM21 2LUWA 3MD0A 4AVAA 1JOBA 3FC0A 1Q81Q 1O5LA 3U78A 2GU9A 1R083 4QDQA 3MUDA 4OUSA 1FOD2 4LO4B 4YG3A 4HK8A 2E42A 4EWDA 2PHRA 1DP0A 4ZZ8A 3BALA 1LTJB 2QBXA 2XVLA 1GQGA 4YGEA 1NU1D 3WCRA 3TEYA 4NAOA 3VGIA 3CHXA 4AVBA 4Q4X3 1WCQA 4QWNA 1UYZA 4KWKA 1NE4A 1FOD1 2N1TA 3EBRA 2IZ0A 2WC2A 3MLLA 2BYVE 4ONUA 1FXZA 1LHWA 3VBFA 3N35A 3GZEA 1FZCC 1IPKA 4YZ2A 1K5JA 2NZ2A 4LHNA 3UGFA 3QWOC 2UWCA 1I5ZA 4QAWA 3RL0g 1TVGA 4OI1A 2WQYC 3DYOA 5EP9A 1QJZA 3M0DC 4JTOA 5LK5A 2QIWA 3CF6E 1VBA3 3TGUJ 2FQPA 4CCMA 5EXOA 4JQ0D 1YFYA 2W3JA 4XAAA 1A34A 3A0NA 2WITA 3NWKA 4JKKA 2FD8A 2GNTA 5AVUB 1HRV2 2RMU3 2HJIA 4OCTA 3V5BA 1LOFC 4BIOA 1E5SA 4ZPIA 3EO6A 4ES8A 1W99A 2VVDA 3ZYIB 1YFUA 2B42B 3NRUA 3ACLA 3OTFA 3LAGA 1HV1A 1PV3A 3A23A 2C26A 2TBVA 4AEKA 5F3CA 3MIFA 1HRV1 2ES3A 3WNOA 5F7UA 2GMEA 2J1VA 1WT6A 2CV6A 1O5UA 1YXWA 5FZLA 2WLPA 3ZSMA 2KOGA 1N3OA 1QDCA 3JCUH 4FFGA 4YARA 2WNUA 1S0EA 3SNMA 2I74A 2VTXJ 1HQWA 5GZFA 3D6EA 1JYVA 3ZXAC 1JUNA 4FQ4A 4RD7A 2AEMA 3PHLA 5FJKA 1KB9D 2OW4A 2HWB3 2ATFA 4IE5A 3LOBA 1USEA 3NSTA 5CCHA 1JOJA 1MKMA 3ZYGA 1QHDA 3DKQA 4COVA 4P9XA 1GW4A 1RH5B 1GL2B 1FV3A 4P9WA 5CEHA 4LTAA 4GD4A 3N9LA 2XUMA 3VKOA 1DGLA 3MZWB 3OY8A 2WWJA 5K0UC 3TB0A 4QU2A 3G71P 2IVIB 1JEKA 3ACGA 3RZHA 4W6YA 2QDNA 1WCSA 1AR92 5A7SA 4TZDA 1P84D 2W1SA 3RSJA 1L0NJ 1VBB1 2KZIA 2XDVA 3AMNA 4GIFA 4D6TD 2A6VA 3OA7A 5J37A 1QXRA 3QACA 1CI6A 1TE1B 3S57A 2PHXA 1H4HA 1QLED 4XFCA 2QVSB 3HD7C 4NIGA 4DXRA 4CP0A 5IVVA 1RE4C 1VPHA 4A2UA 1AR91 4NRPA 1NHLA 2XOMA 1W8UA 1LHOA 1HGZA 5DABA 1DCSA 2X5IB 5GTHE 4JGZC 5C3SA 5CCGD 3IDAA 5JXGA 1UPIA 3LWCA 5IK7A 4FBFA 1ZRTE 4UYBA 3W5MA 1AXZA 1QX8A 3WUTA 4MX3A 3MICA 1CW5A 2EXIA 4AGVA 5EFWB 3L36A 4M3CB 2ZX4A 3P32A 4HSLA 4BWNA 3WG3A 1J3RA 1IKQA 3ES4A 4IV3B 3AYEA 3GYDA 4EN9B 1JUIA 3SQOA 5FZ1A 3JC22 1DU3D 4FCAA 4QM8A 4M3LA 3G9RA 3ZM8A 3WY6A 2WBKA 1OXZA 2J22A 3PL0A 2ZXQA 1KJRA 4WM7B 1OFSA 1FOSF 4ET7A 3TYYA 4QGMA 2BCCD 2W83C 2VNVA 2W6BA 2V7QH 4S2GA 5EWSA 3S7IA 4KBBA 4GZ9A 3NJZA 4N53B 1XNBA 3KF5A 1EC5A 1RUF2 3TF5A 3O7OA 4WM8A 3KB5A 5HCFA 1GK4A 4HT1T 2P4EA 4OGQB 1AUYA 3GBWA 3K3NA 1LU1A 5AVZB 1DIWA 3VOPA 4UFIA 4Z1VA 3I59B 4DOUA 2YIUB 4XHBA 1RXGA 2UYBA 1NT0A 5C6CA 1RUF1 2Y8KA 5EV7A 3D0SA 1VBE2 3VKFC 5K9YA 2ZYAA 5I8SA 3BIEA 2K88A 1WCKA 1JOCA 1EPWA 4LBMA 3RNSA 1VF5B 2GP5A 4L97A 2WPSA 3UV9A 1VR3A 2JG9C 3AVRA 1B35B 4KGGA 1L3JA 4RFRB 3L74E 2EIBA 1VBE1 2J1RA 5CA6A 1NAYA 3BTXA 1CZVA 3G4SP 3NNLA 1HKDA 1Y4WA 4OQ8A 2WRAA 4IL6E 2EVXA 1LECA 3NTNA 5DXDA 5KLVE 2V5YA 2PHTA 4PLMA 3GZTB 2XB6C 3GLMA 4JRAA 2YNYA 4LKDA 1N8RQ 2KD7A 2VCBA 4XJ8A 2LALA 1W03A 5A3TA 2E75B 4JRLA 1JB0J 3VV1A 4QX0A 2DF7A 4K3AA 4BWOA 2SPZA 3WP4A 1FAVA 5A3OA 3PTRB 5A7NA 3PVNA 3T97A 4G9SB 3CEWA 3FFQA 4B29A 5A3LA 1BLZA 1E5HA 1ZR2A 5A6XA 1W8NA 1GL2D 3NNGA 4Y5SA 2KP8A 2RS13 1OLME 3L4FA 1JU4A 2ZKLA 5DDJ2 3MFAA 3PNAA 1W6NB 5FLJA 2A6ZA 2WZ7A 1YJNP 1LENA 2P2KA 2K0GA 2A45H 2E5TA 3AXEA 3USSA 1A8DA 3KV6A 4BK5A 3P3PA 3V0BA 3UKVA 3CZJA 3WDTA 3OD4A 5AW9B 2HFED 1IS3A 5A3PA 2PFXA 4R4ZA 3TEXA 1S1CX 2Z5HA 4ZS3A 1V9U3 5DDJ1 1TZOA 3B5NA 3FHAA 3K4DA 1PX3A 3W68A 1US2A 2Q3IA 1GZWA 1HXS3 3F89A 4AQ6A 1ZR4A 4LBOA 3KQGA 3H25A 4CEWC 4X6QB 5IAXA 3WUDA 1SQPE 2PP6A 5BYNA 4Y99B 1UZYA 2W9XA 3OOXA 5B4XA 4E8DA 1L0NK 3N9QA 1PO11 1FZFA 1RUI3 1CIYA 5FY4A 4JKLA 1QKQA 1EV12 1LRHA 1LTAC 1QL2A 3FBMA 4LR4A 4Q4V3 3T2OA 3IMNA 1RF0C 4YLZA 1BK0A 1CAWA 3CU7A 5KLIC 2VW1A 1L7LA 2GC2A 2Q3EA 4FXGB 2V73A 2ZPXA 3VP8A 1GU3A 1FZGA 5A7OA 4HXCA 3FL7A 1X9VA 3PJSK 2HWC3 3SLIA 1RUD2 1JXNA 4IEZA 4NRQA 4GH4B 3V65A 4ORFA 3G7DA 1W6OA 4HONA 2BBAA 2WAOA 4LITA 2P3YA 2DVGA 5GLWA 5C4WC 4H0LC 3IF4A 2QFEA 5T5PA 4IE6A 4ZKTB 4EYUA 1UMHA 1SZBA 1VBD3 3B3QE 2NQYA 1R082 1ENSA 2D2CC 3BCCE 1RUD1 2D6LX 4AWDA 4HVQA 2JO1A 4CU8A 1OI6A 5J09A 2XBO3 3T1MA 2FDHA 4AI2A 2A3WA 1GOFA 1FT9A 1DZQA 3L71J 4OGQD 2ZJSE 4ZU5A 1YUDA 4MV2A 3H1KG 5CFDB 1QJFA 2WS93 5TSWA 4CDUB 3L75G 1K9MQ 1O91A 4Y33A 1JH5A 2FYUE 5C8CB 2OTKE 3H8XA 3BKZA 4I6MC 4Q4X2 3ATGA 1ZBE3 1HH0A 3IT8A 1NTZJ 4K6BA 2IYOA 4QMAA 3N9PA 1NXD1 5FPVA 1MZ9A 4MGTA 5HBAA 2J1SA 1E57A 3BOPA 2R073 4V1PA 3THTA 1OA3A 2W5FA 2E9QA 3AE6C 1W8ZA 1Y3TA 2BUKA 2JWPA 2VXRA 4QPIA 3V0AB 1KD7A 4Y20A 1MPXA 1NA1A 3E1RA 1VF5D 4DXSA 3AYCA 4GB33 5LCWL 3SH3A 3CBNA 3AVSA 4DXZA 4AVTA 3CCSP 4F8AA 1VBA2 4M00A 5LA1A 3B9CA 1ASJ3 4XXPA 2CU5A 3PURA 3WF4A 5IK5A 5J48A 1RUH3 1K42A 2N1TC 1GWLA 1IZ3A 1BEV3 2RMU2 1YI7A 3ZFGA 3VBFC 4TYSA 1OX3A 1LTGC 4IESA 3M3OA 5F6KA 3S4RA 1SQQE 2WT7A 1VBA1 4IV1A 1SDDB 5KAFE 3L73E 1SQXK 1W2NA 2YC2A 2YBSA 1DYPA 1L2PA 4XUTA 1KRIA 1J1DB 2MJZA 2ADEA 2RMU1 2Y6FA 2XVGA 3M3EA 5FY7A 2E75D 2QQOA 3MW2A 4N78D 2P1BA 1SLQA 1HN0A 2XQXA 3ACFA 4RSUA 1US3A 4RL7A 1Q8QA 1NX9A 5FTTC 3SMHA 3VUOA 3G3ZA 1YHFA 3B93A 4FI9A 1S5LE 1Y47A 4QGNA 3GBFA 2HWB2 1MFZA 3RDIA 1AJKA 4XFFA 2HR3A 1OVPA 1W6MA 2JDNA 2LS6A 4XVHA 3POSA 3MHVA 2WMMA 3PTZA 2DVDA 5GKAC 1OOPB 1ZNPA 3AP7A 3VBHB 1UY3A 2WNUC 3MEPA 2A73B 1JYXA 3T1LA 3AE1C 1H6XA 1DQ2A 5JZGA 5LA0A 5FZ4A 1JTHB 5DUUA 1DGWA 2C24A 3M91A 4ZU4A 5T52A 1O8PA 4BQ5A 3KF3A 4E4SA 5BXXA 4AYCA 5CCHC 4XJWA 4OVEA 3AZVA 5IUQA 4AVSA 4MZUA 2RS52 3NXSA 5AW0B 1KDMA 2XNDH 2BEZF 5CU1A 4CU6A 3VZOA 1NAFA 1YQ8A 4XQDA 2YUEA 5APAA 3ZXDA 2HWD1 4BIFA 2M8RA 3D3AA 5APYA 1FMD3 4GDOA 2HLEA 3VZLA 2QM7A 2Q0AA 3CO2A 1IFJA 5FBJA 4HB1A 4HH2A 1PIXA 1KFUL 1JN2P 4QX1A 4RGKA 3M8LA 2RS51 3C2UA 3PUAA 2W27A 4B7KA 2C1FA 1PK6B 3NO8A 2H0BA 1NTME 5K8SA 3T2TA 1KS5A 1ZXGA 4OH8B 2IVJA 5FWJA 2WKKA 2ZX3A 2QQMA 5C3PA 2EAAA 2GC3A 1AVBA 2R30A 1SFPA 2O1QA 1KD1Q 1LHNA 2YBPA 4RR3C 5FYTA 3QD6A 1SBEA 2R7EB 4YW4A 3AE5C 2ZGNA 2Y26A 2C4XA 5TJHA 2IXJA 3WDVA 4CUGA 3D0JA 2VRSA 4QX3A 5AW8B 4H2AA 1TMF2 3IM0A 3KGZA 2RS32 1MZFA 3F5HA 1LTJA 1H6YA 3WU2E 4RO0A 1OVUA 4CP1A 4FFIA 1G9CA 1UKGA 1G6NA 2VO5A 2A7AA 2A45G 3UKTA 4QX5A 2XZRA 5KAFH 3RMYA 1ZM1A 3AE8C 2XKPA 1E5WA 5LEKA 2YKOA 3AEEC 1OT5A 1J1EC 1L0LE 2QVAA 4WY4B 5IK4A 2Y9YA 3NKTA 1TMF1 1QOSA 3H1IE 2A06G 1UY4A 2RS31 1OPOA 4D8MA 4GXLA 1G9AA 3PLQA 5AC93 1JY3O 2Y6HA 4EQVA 3VMZA 1AX1A 3VD3A 1PP9J 3Q8BA 5H9PA 1NTZK 3L71G 3H8UA 1S5LH 1V6IA 1VMJA 3E6DA 5KTBA 2WT0A 4CDQA 4UB8E 3M70A 2AREA 4WM8C 1QNWA 4KH9A 2ZHNA 1W2BO 5FYHA 3K48A 3H32B 4N7IA 4F83A 1KITA 3HNYM 4FOQA 2R043 4U3FE 4AI8A 1EY2A 4B7EA 3QBQA 1R1ZA 3TYJA 3ZSJA 2O0OA 3AP9A 3H1KD 3L75D 5BNNA 1N86A 3M1HA 2ZBJA 2DTWA 1S4XA 2UU8A 2AUYA 2ZHKA 2CY6A 5C39A 1N1YA 3VZMA 5FYBA 3DYPA 3CC2P 1HB1A 1Q90D 5AW6B 1H2NA 4E2SA 2Q7CA 1GP6A 1IKPA 1ZBA3 2OKXA 1GQHA 2Q30A 1NTKJ 2H7HA 3M4FA 1GMJA 2RJLA 3P1IA 3H1HE 2J42A 2YB7A 4P00B 3RI9A 3FJSA 5KHGA 2CYFA 1NQDA 3ZSKA 1SQBJ 2R0HA 1WW6A 5EQUA 3CC7P 5AW5B 1EAH3 2O14A 2IFNA 4OMDA 1UPSA 3BGAA 2XUEA 3LB9A 1JZ3A 3OPWA 4XDOA 1YIPA 1EYBA 2BW8A 1POV1 5KLVG 2RS12 4WV8A 5AVAA 1GL2A 3UESA 4LO8A 1WD3A 3H8RA 2UYAA 5ANNA 4AEJA 2QQLA 3ZYJB 3TRSB 2W47A 2CDPA 4P08A 2PAKA 4K8RB 1KTMA 4OHXA 4CUCA 4EDFA 1XSRA 1O59A 3POFA 1V9U2 2D98A 5CBNA 3GNEA 1EDLA 4LQRA 1HXS2 2X10A 2N9YB 4TTGA 4WVZA 5GLUA 2RHPA 1BE3J 1W90A 4QB1A 3ZLIA 3B01A 5AVTB 3TNUB 2EXHA 5LRSA 4A7PA 1X9PA 5IYYA 3HMYA 2X5IA 1XNKA 4MN4C 1VQ7P 5F1RA 4O65A 3ITQA 1V9U1 1JYNA 4Q4V2 1S0JA 1HXS1 4PF1A 2IFRA 4LBJA 2ZGMA 3FX3A 2WZR1 3U10A 2WWSA 4IETA 2PHWA 3B5NC 4UW3A 4M3CA 2HWC2 2B88A 2RDRA 4IV3A 1DFQA 4LHLA 2GSYA 3BYWA 3HN3A 4J25A 3KHUA 2RMZA 4GMP1 4QKNA 3S6PA 2VMDA 5JMCA 3OAKA 4JKMA 1BDCA 4OMCA 1VBD2 2QQJA 4WM7A 5E16A 3PMEA 2VOWA 4CU7A 1RJ8A 1WLTA 2HWC1 3WG4A 3O6QB 4CSWA 3O14A 4GIQA 4ZS2A 5FPZA 5JCTA 4GQ7A 4N53A 5APXA 4YXWH 1KZUB 5CFCB 2PHUA 1Q43A 2JG8B 2WS92 4WY4D 3EQEA 2IZ1A 5KC5A 4EZ4A 4G4FA 3IDEA 4BM8A 2RH0A 3CLPA 4COYA 2XNXA 1ZBE2 4EJRA 1DQ0A 4L75A 2W87A 1PVXA 3WG1A 3RWNA 3B02A 4YVSC 5FO8B 5HV0A 2GUVA 3V56A 3QOPA 4QM9A 2VUCA 1ZOYC 3URFA 4JX0A 1YQ3C 1VQNP 2QUOA 3VDDA 2O8OA 3FUQA 1LHVA 1H2LA 3ZKYA 2CDOA 1ZBE1 5AW4B 2VH9A 4R4XA 2GC1A 4GB32 4YZ1A 2FYUG 5I93A 1SCSA 1PVC2 2DVFA 1TQ5A 1ASJ2 2EICA 1W3VA 1B35A 1QJY1 3RQ0A 3LKJA 3I55P 3KYQA 1LAJA 2K3RA 2QE3A 4PCRA 4Y24A 1WKYA 3AE9C 4MGKE 1G9FA 3CWBJ 1YQ4C 1XQNA 1XSQA 4HG6B 4AQTA 1URQC 4GB31 1RE3A 3ACHA 5FLIA 3HQUA 5FY0A 2O01H 3W20A 1W0OA 5FZ8A 4P02B 2R49A 4QPIC 1PVC1 2ZYDA 1ASJ1 3RBZA 3AEFC 1QJX3 3I3QA 2A45I 1FBMA 1RJ7A 2A06D 1NU1E 5A3MA 4BH9A 4DB5A 4IFMA 4NVPA 4IGPA 5CADA 1W0NA 3AMPA 1CIWA 2CTVA 5FZMA 1LGNA 5BV6A 1JO5A 5DAPA 3WW2A 1UW8A 2K9YA 5DAXA 1PL5A 3LDKA 3VBOC 3ZFGC 3L71D 2PHDA 4XJUA 1NTKK 3LPFA 2DW3A 4IEQA 3SC7X 1NO4A 1LU2A 3LFMA 3PH0A 4IV1C 4XW3A 1BCCJ 2MKVA 4BZ4A 1W8FA 4JHZA 3L73G 5F6LB 1C5IA 3JCIA 4BLJA 1JY2P 1YFWA 1W6NA 5GJ6A 1SQBK 2HBTA 4C0BA 1IK7A 2HWF2 5HCAA 3VBRB 4LPLA 3E7KA 2YYOA 4WBAA 2Q8CA 2DU0A 2WSVA 2O01J 4NWWA 4DRVA 5IFPA 3WQ7A 2R1DA 3BTAA 4LK7A 2ZJCA 4GULA 1GWKA 3CX5E 2HYNA 4GOFA 4HKZH 1BK1A 2Z79A 3I3BA 1V0AA 4JDNA 2HWF1 1U5IA 4EN7B 2VMIA 4CTEA 2QJYB 5FXXA 5IK8A 4NIIA 4AEDB 3E5XA 4DQAA 2OTJP 2JENA 2QNKA 5DG1A 1JZ2A 1NQJA 4RJTA 4DO0A 5ERLA 3AE4C 2WSFJ 2JWDA 1UIIA 4YGCA 1RTVA 1AXYA 5JZGC 1G1JA 4GKXA 4XUPA 4HBNA 2WQZC 3PVOA 4Z2AA 3GZAA 4KQ7A 3GXUA 3ZSLA 1KB9E 2POHA 1L4AA 3LE0A 2VQ0A 4GH4A 4AFDA 3EQ2A 4OQ9A 5C3QA 1ZVFA 2KA3A 1T6GC 2KXLA 3ZPOA 1HUCA 1WRGA 4SLIA 1ZLLA 3RYRA 2K9ZA 2XXZA 4HN1A 3USUA 1DQ4A 3NQHA 3TEZA 4GA9A 4AL9A 4Q0PA 5F9TA 1OF4A 2LXBA 2IZWA 2D3SA 3CCVP 4GAZA 1G9BA 1J83A 2D43A 4W7YA 3VMYA 2IFWA 5AW1B 5FZ6A 1P84E 1W2TA 5BNOB 2RVAA 1M57D 1VJ2A 4D6TE 4FOWA 5DZGA 5CFDA 1NTMG 1VQLP 4CDUA 2QJVA 4XZUG 2D3RA 3IMMA 4CCNA 5C9AB 2P17A 2ZX2A 5C8CA 1WA4A 1IZNB 1ZZ8A 4XF9A 1FDMA 1ZZ9A 2PFWA 4AVCA 5AW2B 5BY5A 1BVVA 5F39A 1XC6A 1SLBA 2I2SA 5GTIE 1G2CB 1PZ7A 2IBZG 1R64A 4K8FA 1PMJX 4DZOA 2OZJA 4A44A 2J1TA 1CGPA 3CQOA 2VZUA 1RITA 4W65A 3CI9A 1W9TA 3VP9A 3POWA 3CCRP 2Z42A 2ZX0A 3E6CC 5AC92 2VW0A 4NPRA 5FLHA 3V0AA 2ZEWA 1SPPB 3KDPB 3KV9A 2GMPA 1WZXA 2RG4A 4DUXA 5TISE 4AGRA 4XILA 1ULOA 1Q56A 1ULCA 5KR7A 3L72J 3KVAA 1NOVA 3POEA 5DJTB 1D4M3 3J4UH 2R042 3EHKA 2FXMA 3H1IG 4QXBA 3PRJA 3SCGA 1NCQA 3LF7A 4FFFA 5GZDA 3D71A 4DIQA 2WNVB 1OZHA 3G6JB 2BCCE 4LBLA 4C1XA 4ASVA 3RZKA 1H30A 4A6OA 1T3JA 1FJPA 3FX0A 3H1MA 4RHV3 3L74J 1PMIA 4CDQC 3CX5H 2R041 1POV0 3AE2C 1N7LA 2ZGOA 1ZBA2 5A1FA 1K8AQ 2IWGB 2W91A 3B9IA 4X8NA 2GA1A 1UU5A 4XF4A 3EYPA 5L9RA 1KDKA 4U3FG 3VDCA 4YG0A 1Z7S2 1NJIQ 2FMYA 1HQNA 1NH4A 3KV5A 2FCTA 1RUNA 1Y9GA 4A45A 3CWBG 3IIAA 5BNNC 1EAH2 2YKQA 1NKNA 3UJQA 3A0HH 3V2PA 1DZTA 4C0HA 1KB9H 4DOJA 1Z7S1 3WW4A 1EXIA 1OOPA 1CN1A 1RUJ1 3VBHA 1GK6A 4H44B 5FPAA 3AP4A 2KS1B 3Q9OA 4C90A 1LT9B 1SQVJ 5I0DA 3UK9A 2XU6A 1DQ6A 4CEYB 1EAH1 1JTHA 1HTLC 5KKZB 1MS3A 1V6NA 2VR4A 4LHKA 2EA7A 3WSOA 4LGDE 3OD0A 4P5YA 1Q8PA 4JGYA 5JAXA 3HOBA 1P84H 3DXTA 1SLLA 1BCCG 3K46A 1UNBA 1Z78A 1GL2C 2J1AA 3IWZA 5A3WA 1H89A 2WO7A 5FP8A 4Y4RA 2ARCA 1GOGA 4Q1PA 4I2OA 2W6AA 1O3SA 4GMP0 1RF1C 1YNAA 1I1EA 2ZZQA 3JD71 3OEBA 5AVSB 1O4YA 1Q2NA 4L2NA 2AZ5A 1QMJA 2AENA 5D8AB 3BVCA 1CR7A 1CWPA 4D69A 3ECQA 2MHFA 1DIPA 1PK6A 4E4HA 2IXIA 5GZCA 2QCSB 2ADDA 4BXSV 3VKMA 3MUZ1 1Y7BA 3BCWA 5DMYA 4I0AA 1YITP 3H1JJ 1J59A 5TISH 1SLCA 3OG2A 1IGOA 2JE9A 1OLRA 4NPMA 4W7ZA 1AR63 1NCRA 3TDKA 3PIJA 1M90Q 2J59M 1PFIA 2GMMA 1UX6A 3PJYA 2QQIA 5IJRA 4HKOA 4XMIA 1DBNA 3RYPA 2VD7A 2VW2A 2DYCA 4MGYE 3PUHA 1MQTB 2ZGKA 2EALA 4P5HA 4LT5A 3BODA 1W06A 3A4UA 1N73A 1NAEA 3IPVB 2KLUA 4IL7A 4AI0A 2DFCA 4IV3C 2VZQA 1KORA 4RS5B 4KI5M 5FYUA 4WY4A 2NMOA 4I3PA 4UB6H 2A6YA 2BNMA 4ZONA 4COWA 3VZKA 2G8YA 2KNCA 4ZHNA 1DD4A 3ZO0B 4YW5A 3KD4A 5FZ7A 4Y26A 4H55A 1L7QA 1Q8VA 4WM7C 3ON7A 2ZGRA 2E32A 2BU9A 1OUXA 1R1A2 1SG3A 5CHXA 4XFGA 1K04A 1FPN1 3H1LE 1DHKB 1G86A 5FKCA 2OYHB 2W1UA 2BASA 1U0AA 3L9JT 4M3CE 2KSJA 1BE3D 3N7JA 4N53C 3E5UA 4OGQC 5A3NA 1RUC1 4BA6A 4MHRA 2D5FA 3H32A 4CCEA 4L74A 4RQPC 2D3PA 5F37A 1W9WA 1R1A1 4XFHA 5I91A 4S2HA 2WSCJ 1X50A 2YIUC 4QQLA 1OURA 2JICA 1QJU3 3OPTA 4UF0B 2LR2A 3WNXA 2IXCA 4JVAA 4GJZA 1OVRA 5FIXA 1KFMA 3OCPA 2Q8OA 2ERFA 5K0UB 3S0MA 1GP4A 5T5OA 1VBB3 2VVEA 1O3QA 4L76A 1AHSA 1UMZA 3VDDC 1SFNA 4HFSA 3J7NA 2DTYA 2WT1A 1GD2E 2IBZD 4QQ2A 3DEMA 1KXGA 3GJBA 2WINB 1S0BA 2ITAA 5CKNA 2J5UA 5FJHA 1SQQJ 3HUSA 1MEC2 3LOIA 2IBZI 1FZBA 5H9SA 4XFJA 1AR93 5FYSA 2VZOA 1NUKA 3S1KA 4NPDA 2DUQA 1B35C 1S0CA 5HPOA 1LULA 2GUSA 1GMMA 5FO7B 1ZX5A 4IEUA 3L35A 5AVVB 1AQTA 2E76B 5B4NA 2B9BA 1ENXA 3AMHA 4QHZA 4IW3A 4JGZB 4R9CA 1XU2A 1PO21 1RE3C 2ZGTA 4CXYA 1H1MA 1CX1A 4YGBA 1MEC1 4DNYA 5FYYA 1FNYA 1F4HA 2RDQA 4AYUA 4H44D 2M3EA 4NJ4A 4IL6X 3OBZA 3OGGA 1ZYBA 3NKGA 1EDKA 3H1ID 3OGVA 5A7PA 5APQA 5APSA 4AI3A 5IVYA 1T6BX 3BTYA 2E51A 5JSOA 1NZCA 1QJEA 2R5DA 4CPBD 1IFIA 4A3XA 2SLIA 1T6AA 1CAVB 2WFF3 4CPGA 5FMOL 2W1WA 1WUVA 5CKQA 2FDKA 4ZKUA 4CYDA 1SQVK 4CCCA 2CWSA 3R0RA 5KXDA 1I5PA 5GLZA 4YFZA 4U3FD 3TNUA 3VD9A 1VRH1 4C7RA 4TWTA 3HE5B 2IXLA 4UFHA 4URAA 1L7RA 5IVJA 1ST8A 4Q0VA 4GKYA 4AHXA 1SQVG 3CWBD 4JDOA 3M3CA 4NHMA 5JXJA 3LFIA 2D6NA 4OHVA 2AEYA 2W6JH 2OYIC 2JDUA 2R0FA 1OVSA 5CBLA 3OJAB 1M8OB 3THCA 3ZN6B 3OGSA 1RIRA 1GWMA 3HTKB 1UU6A 4JBZA 3FHQA 2VQUA 4X8PA 4O9EA 1GR3A 3OUHA 1Q8OA 3UGHA 2E74C 4N90A 5E88A 4FP3A 1TME3 1WD4A 2DV9A 3O6QA 2Y0CA 1MUUA 3FE5A 1JM0A 2VZ1A 4W50A 2GM4A 2Y9ZA 2JG9B 1BCCD 1VBE3 3O0WA 4XABA 3WF3A 3D5OA 2XLFA 1ZW0A 5FREA 5CFCA 4QGLA 1OLMA 2WSEH 1L4AC 3H9AA 2JG8A 4GH4C 4PBOA 3TGUE 2YHJA 3AFGA 4WZFA 2I1JA 2FCUA 3Q5PA 4OHWA 4AOCA 4EYYQ 2Q8EA 1PZ8A 1GANA 1D7PM 4FP2A 5L19A 1ZZBA 4XUOA 3M9HA 3ZDVA 3O1UA 2JX9A 3O1OA 5JWPA 1KGYA 2DUPA 3WUCA 1ZZ6A 5FDBA 1L0LJ 3WNPA 2VZ3A 1NGMB 1YBKA 3LW5H 3EJKA 2XJQA 2FDGA 5GALA 1OHFA 4MXWB 4D6TG 2OIIA 2B5HA 4EROA 1YQCA 2Y6JA 1HRI1 4LKSA 1YRZA 4GWNA 5DQ0A 2HODA 1JU3A 5F5QA 1JCCA 5F2SA 2K9JA 2P1JA 1ULFA 1VMHA 1FC2C 2KYVA 4INDA 2BOIA 2KB7P 4AAXA 4AFBA 2JE7A 3LIHA 2WSEJ 1KQSO 5JXIA 2ZX1A 5JOZA 4ATEA 2R3CA 3WHTA 2NRGA 2QZ3A 1UN1A 5DDJ3 3S30A 2L9LA 5DUVA 2QQWA 3T0DA 4Z8BA 5B2GB 4XJZA 3TWIA 2UWAA 4XQ4A 1M4WA 2YKPA 3J26N 2VM9A 1SEFA 1FS0E 4ASMB 3OBAA 3VD7A 1HDKA 4CEWB 1ND3A 4I1LA 3KCCA 1PO13 2E76D 1OVVA 2VNGA 4UWDA 4L9BA 2XQRA 3T0BA 5FO9B 3BRVB 4FOVA 1NCQC 2P37A 3VDAA 3H1HJ 1SQQK 3ZPYA 4K1ZA 1ODNA 4YM1A 2EF6A 4ZZ5A 3KVBA 1OA4A 4I09A 1DH3A 2W0XA 1BBT2 3PMSA 2Y64A 1GNYA 5KLIB 3TK1A 3AMQA 3TEWA 5SV8A 5C3RA 2J1UA 2WYFA 2G9GA 3LIDA 1WMDA 2QJPB 2OARA 5FPXA 2WO1A 4OUEA 2P67A 4LOSA 1XE0A 4OI4A 4WVMB 1HX6A 4NWVA 1BBT1 4H0LB 1LTSC 4LA2A 2V4AA 5FZOB 5AVWB 2VC9A 2WLQA 3JZVA 3PHMA 5AVQB 4PIZA 3H1KE 1LOGA 3WF2A 1S5LX 1IC2A 3L75E 3L72D 3LA2A 3H1WA 4R52A 1LOAA 2P5BA 5BNPA 1D7MA 1N3PA 4YZ3A 4EWEA 1F15A 3WF1A 4HJGH 4XA4A 3AB0A 3AECC 4E2QA 5A6ZA 5DZFA 2Y6GA 2A3YA 1VQOP 2QTWB 1AVYA 2R6QA 4XCAA 3VBHC 4YM0A 5KHKA 1JYTA 4ASKA 3KWVA 1W39A 3WV6A 2FXOA 3IKWA 1AR73 3WDUA 5JOYA 3DKWA 4EE2A 5SV5A 5JI9A 3MDPA 4CCDA 3B00A 2AEFA 4IFFA 1HIXA 2VZPA 1VQ9P 4CUAA 5AVXB 2AH2A 4ATFA 5KXEA 4FOYA 4ZU7A 1CAXB 4LKFA 4JGYC 3CCMP 4NIHA 5HXVA 1UWWA 4Y3OA 4B1LA 5L9VA 4TSVA 4BJ0A 1FV2A 3PVBB 3WDYA 4YYOA 3RI8A 3SEEA 4FPLA 2H43A 1FAYA 4XFAA 4LC1A 4U2AA 3I5CA 2XHKA 1AR62 2XPJA 5JR7B 2QE7H 2AXTH 4DS0A 4M4PA 1H8VA 4E8CA 3HPNA 1A8MA 5BNOA 4Z1MH 1UL9A 4PBPA 1VQPP 1PK6C 4AHWA 1WMFA 3VBFB 3WDXA 3H1YA 3GM8A 2BVBA 5C9AA 4CDWB 4DJGA 4PV1C 3UJOA 4LMFA 1AR61 1JODA 4KU8A 3C9IA 1GQPA 1SQVD 1G2CA 4DEQA 3WDWA 5T5LA 2IC1A 1Y8AA 3HVDA 3MI8A 3C1LA 3RBXA 4LE3A 3ABVC 3WZ1A 2BEOA 1DX7A 3J8F1 1HV0A 3B8EB 1DLLA 1NCRC 4KU7A 3CX5D 3C7HA 2Q6QA 1NXMA 1U5YA 1VMFA 4LIUA 4E2GA 4BQYA 4MYEA 2XKMA 4R9BA 3I2HA 1SPPA 3CX5I 2FBWC 2YU1A 3N4MA 2A75A 4QX7A 4TT3H 4YNIA 5APTA 4BE3A 1N73C 3ABZA 3LCPA 3ZFFC 3D6YA 3ZIXA 1QWRA 4LBKA 1VL2A 1L0LK 4WVWA 4YW6A 4IE7A 2AC1A 4WY4C 1Q82Q 2IPPA 1R093 2G3AA 2ZMLA 3BN6A 2KZJA 1GNZA 2HYXA 2R1BA 4ZXKA 1QJU2 1QGLA 5LRRA 4XACA 1KYOH 2WNVA 3CL1A 2ZHLA 4OULA 1JZ4A 4BISA 1HQLA 4XIKA 2WNUB 3H1LG 3KT4A 5F5CA 1GBGA 1JUHA 2DVBA 1KB9I 1VBB2 3H1JD 1OKOA 1X8MA 4QPWA 4Y1VA 3WQBA 1ZRDA 1N1TA 4A42A 2VMHA 4NPLA 1XNCA 1N47A 2WNEA 2PXJA 4XJ9A 2JDYA 2O1KA 2DDUA 4YSFA 1XB9A 3ME2A 5ANQA 3WNNA 1QJU1 1UY2A 2AR6A 4YZ4A 1OFNA 5LK7B 1KQLA 2CHHA 2DCJA 3Q8CA 3RG0A 4H3WA 3ZKUA 2ILMA 4DMIA 4D6RA 1NU1J 2HWD3 2Y0EA 5JIUA 4LBNA 5M0TA 2VMCA 1P84I 4A4AA 3RL0B 5BU5A 1AL21 2XLGA 3DXUA 2GAUA 3ROUA 2RS53 4A3ZA 2BJSA 4A7YA 1JMMA 4GJYA 3MTUE 1ULPA 1S0GA 4D3WA 1IFPA 5HXMA 3HUSC 3WHUA 1WLWA 1LT9A 5L7OC 4Y28J 1KQRA 4H0LD 1UAIA 4JTNA 4XZPA 3K51A 2A1XA 2D6PA 4CEYA 1GNHA 5F2WA 3O1PA 5C7GA 1Q3EA 2CSGA 4YW7A 1DEBA 4RGAA 1LOBA 2NP0A 3PUQA 4CPBA 4RR3B 3JU9A 1J1TA 5FY8A 4UAPA 3DL3A 2VBDA 2PAEA 5F3GA 2WFF2 1H2KA 5FAXA 5FK8A 3ENRA 1WW5A 3RZZA 5JR2A 1COV2 5I8TA 3AZWA 4Q2FA 4AQ2A 4W6WA 1EQ7A 1RHZB 5IT6A 1K5MB 4YG6A 4YTPC 2A06E 3O0VA 4CZSA 2NPSC 1LTBC 1K73Q 2CK3H 1YEWA 5CG9A 4CDXB 1ULDA 2WFF1 1TMF3 5D8AA 4BQ1A 3M06A 1S2KA 2XL7A 3I97A 4BYYA 2RS33 1AYN1 3L71E 1V6OA 3JBG1 2D97A 1COV1 4OZXA 4UW4A 4BPZA 2R5BA 2VE1A 5GLVA 2VUJA 1RQUA 5EYXA 1PGL2 3KLSA 2YV8A 4XE9A 3ZYPA 3GF7A 2ETEA 4Y1YA 5DAWA 3MO4A 1MS4A 4IDZA 4WZCA 1W05A 2BQPA 4OUMA 4V2WA 4CXWA 3MFCA 2VVFA 2WUHA 1JHJA 1XE7A 4MGIE 2Y6KA 2XG3A 4RGGA 5DJUB 1T8ZA 1TME2 3RK3B 3BB6A 1ZRFA 1PGL1 2CPSA 2ZCWA 4YVWB 2C0WA 1ZZCA 3TNQA 2YMYA 1LNSA 4QHBA 1D0GA 3OYWB 1LOFA 1MQTA 4DY3A 4XFIA 5FQ0B 1REDA 1YC61 3IPVA 2PMWB 4XOGA 3VN0A 1CD3G 4N6JA 2HKXA 4RS5A 3II6A 1TNFA 3ZXJA 1H0BA 5H9QA 3ZSEA 1YWKA 3N9MA 1TME1 1AVOA 4NPFX 1SQXJ 3THDA 1XNDA 3SHRA 2MNGA 2HG5D 3HRNA 3HBKA 3FXEA 3HAGA 4TXWA 3BRTB 3RRDA 2WQ4A 2B45X 1AYM3 3RWKX 3WD5A 2XJPA 4EN8B 2OYHA 1N7SB 1IOAA 3B69A 2R3SA 3MUY1 4JYBA 1FZAA 2ZOEB 2WZ8A 2FDIA 4TN7A 2JG8C 3TGUG 5HV4A 1PGJA 4N7UA 1POV3 3S5AA 3NW4A 1V6MA 4IUGA 1W2UA 4KBZA 2Q5TA 3FZ3A 2Z2SB 1BMV1 5LB6A 4UF0A 5JOXA 5EJ1B 2C0XA 4PD4H 2VCMA 4IE0A 2MEV1 3MPPG 5K0UA 2VNRA 4N9IA 5AVYB 1QY4A 2VQTA 2WJSA 3A0BH 5C70A 5FYCA 3IFMA 4CUBA 4OVNF 2FBEA 5EIYB 1SP4A 3ACIA 1X33A 2E74B 1DGRN 3WR0A 3HIFA 2RJKA 1SBDA 1EUUA 2BCCJ 1UKRA 3ZDSA 1G1IA 4EV0A 3CXHH 3M0AA 2X53S 1W9FA 2WT2A 5JPMB 2H88C 1PIV3 4XAEA 1PO12 3RL0D 3HEIA 3N3HA 4PDWB 5KWRA 5FY1A 3OF1A 5G05L 1A3KA 2D7FA 3G6EP 1RY3A 1B09A 3EB7A 5FXZA 4JGZA 2ZEYA 1IQDC 3O12A 4Q8LA 4B8EA 4KL1A 3W9AA 2C9LY 2EIGA 2WZR3 3PUIA 4GKGA 1KEXA 1OW8A 4KWJA 3P7KA 4P9IA 3ZR6A 5LY2A 3VKLA 1VRBA 2K46A 5JVVA 1QDOA 1EXJA 1V6KA 1NU1K 3GHGC 1PZQA 5CMZA 5KJ7C 1KJLA 4LO7A 3QCWA 1MZ6A 4B86A 3PIGA 5L36A 5LBEA 1ND3C 4M4RA 4UOJA 3WP3A 4BOWA 3H1LD 3S9OA 3BTZA 4GMP3 1RMU2 5ABJB 5FP4A 5FP9A 1KV4A 2BFUS 1L0NG 1CAVA 4YWAA 1D4VB 4KG8A 4NUBA 3N7KA 4QB6A 1WW4A 4IEOA 3ZN5A 1SMVA 1AX2A 3I7DA 2BRTA 2JKBA 3HE5A 1RMU1 1QNYA 3ST7A 4F3JA 1HGVA 3BI3A 1YIJP 2P6CA 5DG2A 4GALA 3VL8A 4FT8A 2ZTNA 3RS6A 3M9QA 4D6QA 3PU8A 1W6OB 3J9SA 3V6IA 1HW5A 1AR72 4E4ZA 5FY9A 4ARYA 5C71A 3NMBA 1NYHA 4KJMA 1HF9A 3CMEP 1FDOA 2QDRA 4YVSB 1H8TB 4MXVA 2ZFCA 1QOTA 3AP6A 1NE6A 3R6SA 2VUAA 3WW1A 3H3ZA 2MPFA 3ZN6A 2QZ2A 3BASA 2QJYC 5BNPC 3HTKA 1O3TA 3L70J 2ARAA 1UQXA 2UY8A 1BSHA 4XIOA 4XTMA 3SCFA 1AR71 4DEVA 2ZVNB 3Q5RA 3QH9A 1KILB 3RK3D 3HR9A 4Q1RA 3B5LB 1OBNA 4HOOA 3MUDC 3CMGA 1EZVG 1QJY3 2JG9A 2XGXA 1ZN5A 2A6WA 1PP9E 4PJYA 3I8TA 3MF9A 3SSUA 2OVUA 3T4HB 4IEYA 4V2VA 2K2SA 4E27A 1NZIA 1PVC3 4DPNA 4MGQA 4IQPA 3LZZA 1URQB 4C8DA 1ZP0C 1CJDA 3ZX7A 3KCXA 1S9KD 2YMZA 1XXNA 1BXHA 4QPIB 5T5JA 1Y9QA 3MIDA 3V2NA 4P9JA 4Y20B 1C8NA 3PTYA 3VB9A 3DYMA 4F7ZA 5F5AA 1S0FA 3MV11 3OUJA 4HLTA 2JP3A 1N7SD 4FAHA 4CCKA 3HWJA 4C1WA 3HQXA 2P10A 2ZXEB 1DLCA 1OD3A 5DAQA 4BMBA 3KCYA 1OW7A 5EHDA 5E6HA 5FXVA 1DGWX 2E53A 4MXWA 1UX7A 4COZA 3VBOB 3ZFGB 3MLJA 1REFA 1F5FA 1F4AA 1IHMA 5FMBA 1JYIA 1M56D 5FZDA 4CA9A 2LM3A 3D82A 3ZVXA 3V64A 4ARXA 1SQXG 1AR81 2FDFA 3CDZB 1GKBA 1R092 2VOKA 1SQBE 4Q4Y3 4K40A 1CAUA 5F8PA 3T30A 4O61A 1YIFA 2E74D 3AJZA 2O8QA 5E79H 1LTTC 2Z5IA 3CCUP 4AHYA 1GICA 5FMCA 1XPWA 2HWF3 5A80A 3AYDA 1R091 3KV4A 1KMIZ 3P6BA 4CEWA 3L2YA 3BPSA 2D5HA 5APUA 2YG0A 3LA3A 3SISA 1JY2O 2VL4A 1SBFA 3NAPB 3LEIA 1AXKA 2QRXA 1ZZ7A 5LZ6A 4LLOA 3BPZA 1CZQA 2HWD2 1GP5A 1JY2N 3TGUD 4R9DA 4BDVB 5GZGA 4XPVA 1IPSA 1RC6A 4PLNA 5T54A 2JKXA 2VGDA 4XUNA 3UIAA 1BE3E 4QDRA 4AW7A 1SCRA 2A70A 2K37A 1W28A 5CKMA 3MYXA 2C9NY 1X9TA 2UWBA 1D2QA 4AI9A 1V6JA 1LTEA 2D44A 5CCGA 4WVMA 2YO3A 1Q5OA 5FZOA 3CMAP 2JDHA 5I0SA 3VKNA 2WWWA 1EDIA 3U07A 3KSCA 4HVOA 2VY0A 2ZT9C 3E6BA 3FN9A 2PN5A 4Q4W1 3DCQA 4IFDK 1MS8A 3CJIA 2IBZE 5FZFA 4OHYA 3EXUA 2DURA 3AK0A 4JQTA 4MH0E 1C8M2 2FKWB 4R4LA 4H44C 4XYXA 4QKFA 1PM7A 1A02F 4NIAA 1LT9C 2CAUA 2VBPA 1RUOA 4HZFA 3LQCA 5KKZC 4KWUA 1ODMA 3DPRB 3N4XA 1LWUB 2C0ZA 2E7TA 1USDA 1AJYA 1YQ6A 4QX2A 2R44A 2IXHA 1C8M1 2ET1A 1CAXA 2VCAA 3CD6P 1ENRA 1O8SA 1OF3A 2HPCB 2TUNA 2AEJA 1CVNA 2FHRA 1KILD 2QSIA 5L9BA 1ZREA 1UYYA 4PJ0E 3VHPA 2WFPA 1L0ND 2ZGSA 3LEMA 2RJ2A 1YTZT 2RV9A 4K7JA 3TBDA 3T3YA 1ZMEC 2VCCA 3GF3A 4M0HA 1J84A 4AVVA 3WNLA 3NV4A 5FZ9A 4XBLA 2I07B 5D8AC 4A6SA 2XWJB 2RR13 2JDIH 4Y5Z0 1W04A 1URQD 2B8MA 2W92A 3SXWA 4LHSA 2PGDA 2JE8A 1JY3N 1VQKP 2DFBA 4UXAA 1FI2A 1C4RA 5D1IA 4XMAA 4CDWA 2Q8DA 1PPJG 4KHXA 1FZEA 1KYOD 2DBIA 2VG9A 1WMKA 2E63A 3P8CD 3L70G 4WBBA 4LO6B 1NTZG 1FNZA 1SFCB 2YBKA 1BDDA 4CDQB 5H9RA 1KYOI 1LGCA 3WG2A 3BIWE 5FMDA 4IEPA 1XU1A 4XXAA 2ZYGA 3CWBE 2BDRA 5GLTA 2ZEXA 3IZOA 1AYM2 5CAZA 2QQKA 2D93A 4FO9A 4HMZA 5JLVA 1MQTC 3AM2A 3AEGC 2OXBA 4Y1UA 1YJ9P 3L2HA 1NLQA 3BATA 5KHJA 3R05A 4NHXA 4LXLA 4AUWA 3O8ZA 5BNNB 4RS5C 4YW3A 4QT6A 3HT1A 3SH4A 2OQ7A 1EP0A 1EZVD 1UOBA 1Z7S3 4PI2A 1NLSA 4IERA 5M1BA 1FOSE 2BGOA 1RUG2 1AYM1 1RUJ3 3Q1MA 1PHMA 4HPKB 2XR4A 5A1LA 2JJ6A 1ULGA 1S4CA 1EZVI 4KNCA 2E26A 1QF3A 1IFMA 3ZMNA 5EFUA 3VMXA 4K35A 2OYHC 1LR5A 2ZS6B 4RA0A 3I2OA 1W8OA 4Y22B 1CPNA 2FXPA 1BCCE 3GGLA 4D7YA 2XDJA 1RHI2 1UY0A 4BK4A 1RUG1 3R4SA 5A3UA 1LP1B 2QQUA 2QKDA 2YXQB 5LA2A 2ZGPA 4J6GA 2TNFA 1U12A 1LHUA 4MLOA 5L8RJ 1G7YA 3I2DA 2G4IA 4XBQA 2BFUL 1PIV2 1PGW2 1SVFA 1S1AA 1RHI1 3JD73 1OFCX 3MW3A 4BXFA 3Q2YA 1F5JA 1RF1B 5BUVA 3R4YA 1Y9BA 3SITA 4ASLA 3VBUB 2BPA2 3IAOA 1OQ1A 2WZR2 3RFRA 3LPGA 2ZVOB 1SQXD 1J58A 1I3HA 3K75B 1PIV1 1PGW1 3C7OA 3ORJA 1BGYJ 3VD4A 3RZJA 4CCJA 1GU4A 2ET7A 3VZJA 1UU4A 3U1XA 3ZXGA 4PJ0H 1K05A 4I2LC 1Q86Q 1JCDA 2E76C 1T2KC 2ZGUA 1NLRA 2XJSA 4RR3A 1S3JA 4OI0A 2EIDA 2P34A 2CL2A 1QGKB 1R8EA 2VOTA 3B71A 1XNAA 2WPVB 2R062 4YGDA 3AEBC 5IAVA 1K12A 4BB3A 4UT5A 3ZR5A 2E43A 4DY5A 1RVF3 3H1KJ 2KIKA 3ITKA 1K5MA 4GT1A 1AZDA 3L75J 3K5BA 1OH3A 4CDXA 2PRRA 1LB2A 5JUVA 2VZTA 1JYWA 4HKWA 2EXKA 4FPFA 3H6PA 3AKPA 3DECA 4NO4A 2VJXA 3LGRA 2R061 4FPHA 4AG4A 2DVAA 4D6SA 3GG2A 1O4ZA 2P3KA 4BU2A 2VULA 4META 1FPN3 1F9KA 4AHZA 3AJYA 4XDPA 1QIQA 3B4SA 1HBWA 4OFGA 1ND2B 1E79H 2FFDB 2ORXA 4L11A 3K2OA 3C7GA 4BMEA 2W46A 4NIDA 1K3IA 3I59A 1RUC3 3IDBB 2JIGA 2LKMA 3GBGA 4BQ2A 1JI6A 4D0QA 2GNBA 3ZFEB 1R1A3 4LLHA 1LGBA 5I0UA 1JOPA 4CCOA 4Q0QA 3U4XA 4RQPB 4YVWA 4KG0A 2NZ9A 1QJY2 5FP3A 5B66E 3OYWA 2LROA 1OC1A 1PNGA 5FQ0A 1QXPA 1BYHA 4RKUJ 1U5XA 4MO3M 4LJHA 1GW3A 4PD4D 1UO9A 1SFCD 2VTFA 4YFWA 3L72E 3I3MA 1N1VA 2WPQA 5A1AA 4MHUA 4I0BA 2OQQA 5CISA 1LESA 1OMIA 3VDDB 3VLBB 1PGQA 2ID4A 3T09A 2YXSA 4EIJA 5FBZA 3O1VA 4PD4I 1TEIA 2Q1FA 1JTZX 1UD1A 5JPNB 3OW2O 4NOTA 3N9NA 5IVBA 4ZY9A 1XBFA 1Z0HA 2ZGLA 5T55A 1FX5A 4Y5TA 5FZBA 1M1JB 4AZZA 2H0VA 2ZAEB 3CNAA 1N7SA 2Q1KA 2CAVA 2Y0OA 3VHOA 3CXHD 1PP9G 2V7QJ 3IBMA 4QQHA 1MS9A 5LA9A 1NA1C 2FYNC 1PO23 5FUNA 4FVVA 1O6UA 1MEC3 1V6LA 2EAKA 3CXHI 2QEXP 2YGLA 4L99A 1VQMP 3AE3C 5APWA 2JB4A 3AEDC 3FGAD 1CESA 4UI9L 1JHNA 4AQRD 3MIBA 2QA4P 3H0OA 3GCWA 3ILNA 1VAVA 1URXA 2BWAA 2D6OX 2FZ1A 4Q4Y2 2WSFH 2WN2A 4YZ5A 4TLGA 2DCTA 1O3RA 2UURA 1PPJD 2ZACA 1J1LA 3FWLA 4JHTA 5FRAA 3GDBA 3L70D 4L73A 3A5TA 1SLAA 1NTZD 5DN2A 4JYCA 4QPGB 5GTHH 1X8EA 1PGPA 1VALA 1NTKG 3RK2B 4BCUA 4ZKPA 3K77A 3IB3A 4Q4Y1 4LLFA 1VRH3 1SQVE 4AFCA 1NYWA 3J7LA 2Y0IA 1XYNA 2VAUA 4PDWA 3VBSB 1SQBG 4H7LA 5C5UA 4PHZA 1W6PB 2BGPA 3FLTA 4UBGA 2Q9IA 5BPXA 4AFAA 2XKOA 4E9KA 2QJKB 1YJKA 1SQ4A 4I7ZB 1XNTA 3MIEA 1LEDA 3ZDMA 3WUVA 2OYIB 2VOXA 1PZ9A 4CP9B 2L5GB 2OYOA 4H13B 1X0TA 1FU1A 3UKNA 2OPKA 1BKZA 3HE4B 3KHBA 1GYKA 4QD2A 1HN1A 1DQ1A 1X79B 2D6MA 2FZ2A 5ABJA 2NM1A 3NJVA 4UFKA 4BQ3A 4QHOA 3RZMA 1UXZA 2HBUA 3U59A 3GJAA 3A0HE 3T08A 5K4LA 1DGRA 4XTPA 3H3LA 4QKDA 4I01A 4FPOB 3AEAC 5B66H 2ZAAA 3W59A 1U57A 3ETPA 2JJLA 5FYMA 3ILFA 3V4QA 3AL5A 3H1JE 1BE3G 2XLAA 1XRUA 1U7MA 2V5DA 2RDSA 4JCKA 1H9PA 1AFOA 1SLIA 2V72A 5CNAA 3LSEA 2FYZA 5FZ0A 3GW6A 1UIXA 2VTXA 2QJPC 1BGYG 1V70A 1L4AB 1EV11 4EI2A 3E5QA 4O9BA 3IAPA 4QX8A 1JS9A 2PLV3 5CCGC 3MHZA 4K21A 4OZOA 3N36A 3WNKA 4PF5A 3RGUA 2HWE2 2IXKA 1PGOA 1GZCA 3MBWA 2KUBA 4K9SA 2ARXA 4CRQA 3MP7B 3NV3A 4QQPA 4YVSA 3USUB 1H8TA 1RL3A 3GHNA 5KXCA 5IHRA 4I30A 1YYCA 2YO2A 5LY1A 4Y1ZA 1A78A 3AX4A 1JYCA 1HJGA 2B9VA 4CVUA 1QU0A 3AZXA 3CJIC 4CU9A 1SFYA 4QKBA 1HRI3 2QQVA 2GALA 1GZTA 1KFXL 5IW0A 5CBOA 1KILA 2GNDA 2HWE1 2YFUA 1VQ6P 4CCLA 2ZMKA 3KQ4B 5FY5A 2XMLA 1XTCC 4IL6H 4LA3A 1Z56A 2W68A 5J3UA 1R081 2FY8A 3OB8A 4N43B 4OYUA 1OQEA 5JOWA 1TNRA 3AC0A 5LWBA 1LTJC 2W52A 2RR12 1J3QA 2OQ6A 3W5NA 1C1FA 1H4GA 3I2GA 3K3OA 2HEYF 1URQA 2OA2A 3JQXA 3KGLA 5FZ3A 4Q4X1 4A41A 1HJBA 4RN5A 4NMIA 2WO2A 3U1AA 4JDMA 4XC9A 1RYYA 3SFEC 2RR11 5FV3A 1I9RA 2L91A 3V2QA 4JF7A 3POIA 3VBOA 3AYAA 4N8MA 3POYA 1NCQB 2M0BA 4UB6E 3ZYBA 1XE8A 3AZYA 4CDWC 3T4VA 2OPWA 3M3IA 4XHXA 5KLVJ 5H2FE 4Y4YA 1DD3A 2WO3A 4LO5B 4XF3A 1W6QB 1RUJ2 3RJ2X 3VZNA 1NKZB 3NJYA 4Q26A 1UF2C 4ISQA 1YLLA 4NE9A 1OSGA 5GM0A 2VQAA 2HEVF 3JQWA 3N9OA 1X36A 3BVHA 1BBT3 4MGZE 1QXJA 4YW1A 1UIKA 4FPCA 1H0TB 1A6CA 3RK2D 2WPRA 2XVKA 3D4KA 4PIXA 4OWFA 2W39A 4W4ZA 4PLOA 1KN7A 1S0DA 1UY1A 2VZVA 3VN4A 4L92A 1RUE3 2IYPA 1SACA 3IR9A 3WUUA 2WAAA 1FE6A 3Q8EA 4B3NA 1PP9D 5C3OA 3GZUC 2F4PA 3NAPA 2YZ4A 4UW5A 1W2AX 1C1LA 1M7LA 5DUXA 1X22A 3JD72 4ES9A 2HWB1 2H89C 5A33B 3ZYRA 4B4PA 3V2RA 1C28A 4H13D 3UNPA 2Q5UA 3UETA 2CGNA 1UZWA 2A71A 3OGRA 1N3QA 1VQ5P 2YC4A 1D2SA 3W67A 4JGYB 1SQPJ 3H3UA 4DFSA 4C7NB 3RVHA 5A32B 1AA0A 1UOFA 3VYIA 1M06G 2GN3A 1PGSA 1N1SA 4AFMA 4PIYA 4Q5OA 5KAIE 2O01N 2E5YA 3X29B 1GZ9A 2YDEA 3RL0C 4CE8A 1NTKD 1Y43B 4H7MA 1FZCB 3POBA 4WB4A 4B4RA 3RZGA 3JB8A 4TLFA 1XYPA 2XWBB 4IGOA 1GV9A 1RINA 5AVPA 3SKVA 3IIIA 2FMDA 3KZIE 3ZXLA 3O1SA 1L4AD 3B7MA 1YJWP 1HB2A 5A7QA 4NN0A 1SQBD 3M7AA 2X5IC 1RVF2 3PLNA 2WA3A 3CLQA 2Y33A 4AQSA 5KC6A 4L0PA 2G9ZA 4HANA 1LOEA 4PV1B 3J8F3 4EWAA 2JWAA 3DPRA 2WSCH 4W80A 1LWUA 4AXOA 4AAPA 1PX4A 4XUQA 4RYDA 2WQ8A 1NCRB 2VUDA 4QPYA 5JDBA 5BNQA 3BCCJ 2HPCA 3KPEA 1RVF1 1FPN2 2PA7A 3ZIWA 2Q1MA 3KS7A 3QLQA 2F4LA 4OI2A 3LSDA 1W8HA 2I8DA 2W8ZA 1EPZA 3EFGA 2BZDA 3NV1A 4FPGA 2XJTA 1K5MC 1RUC2 4P9GA 1W2EA 1N73B 1F2NA 2ZHMA 1FJKA 2DCZA 2FYUJ 3ZFFB 4CDXC 3ES1A 2QG4A 4JZRA 5H2FH 3FWNA 3NNMA 3N7LA 3I4IA 4MOAA 5D21A 1SHWB 2KNCB 3AZZA 3C8VA 5FWEA 1EDJA 1HVVA 4FQZA 4C91A 5T50A 2XJVA 3V4WA 4NR1A 4D7SA 1BGYD 2VNOA 1UIJA 1SFCA 1DYOA 3WQ0A 2H6CA 3ZYFA 1AF9A 3OUIA 1H8AA 2WYSA 1W2OA 5JXHA 3RK3C 1YQ2A 1BQPA 4YVWC 5I0RA 1BZWA 1BCXA 1AJOA 4FPJA 3LDBA 4S2DA 3ZYHA 1J3PA 1WW7A 3AKSA 5KBFA 3GMAA 3SWFA 2CWMA 2GH2A 3I54A 1OXCA 1NWQA 3T2QA 1AL23 1PO22 1OUSA 1VF5C 3L72G 2VOVA 3AL6A 1A02J 2BTVC 2I1KA 3L73J 1NKGA 2HYKA 5IVFA 3HD7B 4Q0SA 3W58A 5A6YA 2ZMNA 4HPKA 3ILRA 4B1MA 3SKJE 2YY1A 3SFDC 3RK3E 2WIIB 2JIJA 1GDTA 3HUSB 3PJQA 5FCCA 3U37A 4GWJA 5L7OB 1C5HA 3SEPA 4QXHA 2KI7B 1STMA 1N7SC 2KLVA 4Y22A 1UZ0A 5KLVK 3WP5A 3FXDA 5KAIH 3L74G 4FXKB 4QXCA 4LKEA 2JDPA 1REEA 3O5SA 1LP1A 4GWMA 2B87B 2GP3A 2E33A 1YJLA 4LULA 2QQPA 2OUHA 2E75C 4LBQB 3KZIH 2QQNA 1QQP3 2H6BA 2WDBA 4XFBA 1VRH2 1S9KE 1ZRIA 2JB8A 5JMOA 3AMMA 1LGHB 3CL3D 2XJUA 3RGBA 2ZA9A 1JMBA 2X05A 3WLUA 2Z4EA 4ZMDA 1YQ5A 5JSRA 4MVTA 5F5IA 3POGA 4FPYA 4I02A 1RF1A 2NPSB 3U1CA 3ZMOA 3B94A 1UOJA 3EWKA 3VBUA 1AYN3 1RGSA 1VIWB 4MSVA 3PUSA 2WL1A 3JBG3 1QL1A 3KT1A 5FUIA 1COV3 4MGSA
chains in the Genus database with same CATH topology
3R4DB 4AEMA 2RS11 3H3ZA 1JOJA 2MPFA 2QZ2A 3ZN6A 5BNPC 2ZAHA 1O3TA 4XILA 2Z5WA 3ZYGA 1Q56A 2UY8A 1QHDA 1BSHA 1ULCA 4M3CF 4XIOA 3AXDA 4XTMA 3SCFA 4COVA 4Q8KA 4P9XA 1AR71 3FHIB 3BOWA 1FV3A 4P9WA 1NOVA 4LTAA 1YFXA 1D4M3 2XUMA 3HR9A 3VKOA 1DGLA 3J4UH 1AX0A 3OY8A 4AE2A 4Q1RA 2R042 3B5LB 5CIRA 4PDWC 5K0UC 3TB0A 4QU2A 3EHKA 4K20A 1JEKA 1QJY3 3SCGA 1JW6A 3E97A 1NCQA 3ZXEA 4W6YA 2JG9A 1RUI2 2QDNA 1WCSA 1AR92 2XGXA 4TZDA 5GZDA 3RSJA 1CONA 2A6WA 2WNVB 1VBB1 4PJYA 3I8TA 5JIAA 3AMNA 3G6JB 2A6VA 4JV4A 4LBLA 4C1XA 5J37A 3MF9A 1QXRA 1H30A 3QACA 1FYUA 3AKQA 2OVUA 4IEYA 3H1MA 4RHV3 1TE1B 1WLCA 2K2SA 4E27A 1PMIA 1PVC3 4DPNA 2PHXA 4IQPA 3WW3A 4CDQC 1H4HA 3LZZA 4XFCA 2R041 4YW2A 1POV0 1CJDA 2QVSB 3ZX7A 1WBLA 2BNOA 2C9AA 3KCXA 4CP0A 2ZGOA 2YMZA 1XXNA 1BXHA 4QPIB 1ZBA2 4A2UA 5T5JA 1Y9QA 2IWGB 1RUI1 2XH6A 3B9IA 4X8NA 3MIDA 1AR91 1UU5A 1ENQA 4XF4A 4P9JA 4Y20B 1C8NA 3PTYA 1KDKA 4F7ZA 1S0FA 3DF0A 2YGMA 1LHOA 2A6XA 5ABJC 4HLTA 1DZRA 4Q4V1 2X5IB 4YG0A 4JGZC 1Z7S2 4FAHA 2PLV2 3HWJA 4C1WA 3HQXA 1UPIA 1DQ5A 2SBAA 4BMBA 2FMYA 3LWCA 5IK7A 1HQNA 3KCYA 5KHHA 4FBFA 1WBFA 1DF0A 5E89A 1DGWX 1AXZA 1RUNA 3RPQA 2E53A 4MXWA 4MX3A 3IIAA 5BNNC 4YM3A 3MICA 1EAH2 2EXIA 4H14A 4COZA 3VBOB 3ZFGB 1ND2A 3MLJA 3UJQA 4LE4A 4AGVA 3FMGA 4M3CB 1QOOA 1REFA 1F5FA 2ZX4A 2XBO2 1IHMA 2OYZA 1JYIA 1DZTA 3DUIA 4HSLA 3WG3A 4C0HA 1J3RA 1IKQA 3ES4A 4S2FA 1Z7S1 3N7MA 2PLV1 1IPJA 4IV3B 4XF1A 1HRI2 2LM3A 3AYEA 3D82A 3WW4A 3ZVXA 3GYDA 4EN9B 3V64A 1JUIA 1OOPA 3ZFEA 1CN1A 1RUJ1 3VBHA 3AP4A 3Q9OA 1VBD1 4C90A 1AR81 1DU3D 4FCAA 5ACA3 4X6RB 4DINB 4QM8A 4RQPA 1GKBA 1R092 2VOKA 3OBTA 3UK9A 1DQ6A 4Q4Y3 4CEYB 1EAH1 4K40A 1CAUA 3WY6A 1MS3A 1OPMA 1V6NA 1KJRA 4WM7B <