1BCCG

Cytochrome bc1 complex from chicken
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 13
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1bccG00
1NTMG 3L72G 3L75G 3H1IG 4U3FG 3TGUG 3H1JG 1PP9G 1NTKG 3L73G 3H1HG 4D6TG 1BCCG 1SQPG 1NTZG 3L70G 3L71G 1L0LG 1PPJG 3H1KG 1SQVG 3CXHH 3H1LG 2IBZG 1KYOH 1BGYG 2BCCG 1NU1G 1EZVG 1SQBG 3BCCG 2A06G 5KLVG 1L0NG 3L74G 3CWBG 2FYUG 1SQXG 1BE3G 4PD4H 1P84H 3CX5H 1SQQG 1KB9H
chains in the Genus database with same CATH superfamily
5B66H 1NTMG 1N73A 1RQVA 2ZT9C 1N73B 2I1KA 2R32A 1DEEG 2QSIA 1M1JC 1Q2NA 1NO4A 2Z5HA 3L75E 2H88C 3E1IA 1ZLLA 1LTJC 1XTGB 5AVXB 3NTNA 5GTHH 3TNUA 1VQOP 3N7NA 3RBXA 3TNUB 2IDBA 2L91A 3E7KA 3AEBC 1L0NE 2OTJP 2WPRA 5APUA 2M3BA 1KYOH 1SFCA 1SFCB 3I56P 4HB1A 2K1AA 1SQVJ 2Y9ZA 2D2CC 2J59M 3CC7P 3SWFA 2G8YA 1MKMA 1VF5B 2NRGA 2N1TC 4N78D 3C9IA 4YXWH 2OGUA 1MZ9A 1NKNA 2PP6A 1IFDA 1UIXA 2KNCA 3KQGA 5AVWB 2KNCB 5KJ7C 1Y9BA 2WSFH 1S5LX 3CCRP 2WMMA 1PP9E 3WMM0 3SFEC 1RHZB 5KLVK 3TGUG 1Q86Q 3USSA 3CWBJ 1EC5A 4H44D 4H13C 1SQQD 1EZVG 1NTKJ 4KT0J 1BCCJ 3Q5PA 4WY4A 4WY4B 2AEMA 1L0LE 1OMIA 1GW3A 3EWKA 2Z5IA 3H1HG 3L71D 3VP9A 1VQNP 2WSSH 2O3JA 4XFJA 1ZP0C 3H1LG 1YHQP 1YYCA 1SQXD 2MKVA 5KLVG 1HVVA 1J1EB 2WVRA 4H0LD 2V7QH 3L72G 3IAOA 3NXSA 3CCMP 2WSEH 3MGNA 3QWOC 1BGYE 1KQLA 1FDIA 1BE3E 4GOEA 1R5LA 5AW2B 4DJGA 2KXPB 1YBKA 1IFPA 4RO0A 2W8ZA 2IZ0A 1S9KD 2HPCA 5CCGA 4GKGA 4IFDK 2HPCB 5E79E 4UB6E 1K8AQ 2FXMA 3PH0A 1IFIA 1P84E 3O6QA 3KHUA 1RH5B 1TU3F 2IFMA 2JDIH 3O6QB 1NU1J 1RY3A 5AVTB 3D70A 3RK3D 2BEZF 2JP3A 5CJ0A 2UWJE 1GK4A 1E5WA 1GL2D 1SQPK 3EFFK 1PGQA 2JJLA 1MFTA 2IYOA 2PRRA 1L4AC 1K05A 2M0BA 3CX5D 5KKZC 5GTHE 3C1LA 4OGQC 5CBNA 1URQC 1AQTA 3HUSC 5AVUB 4PJ0E 1NWQA 2KZIA 4H44C 3R4YA 2QM7A 1W2EA 1LTGC 3H1KE 2IBZI 1L0NJ 3AEFC 3MUDA 2A06E 1SQVD 3HE4A 4WWIA 1SQPG 4A7PA 1M90Q 1PGJA 3HE4B 4I2LC 4IFFA 2O01J 1LT9C 2LR2A 3AE3C 1YJNP 3RBZA 1OVRA 2QG4A 2NPSD 1YITP 3V2PA 5AVRB 1PPJE 2AEFA 4NPEA 3BCCE 2QIWA 3O8ZA 2ZAEB 3HD7B 1RE4C 4XE5B 3AEEC 2ZFCA 5BU5A 5AW6B 1NTME 3GG2A 2H7HA 1JTHA 1U7JA 1JTHB 2XNXA 2KLVA 1PGOA 3KZIH 4IL6X 1BDCA 3GMAA 2WT7A 1YQ4C 5BU8B 1N7SD 3CWBD 1L2PA 2H8PD 2Q3EA 2YXRB 3P8MC 1M1KQ 1PP9J 2ZYGA 4Z1MH 1KB9H 3CMEP 2K88A 3H1ID 1NTKD 4HJGH 1BCCD 2G3AA 3H1JG 3RK2C 4M3LA 2FYUK 2Y9YA 1JCCA 2C0WA 4D6TG 1T2KD 1FZCC 2GM4A 2E76B 3CXHI 2WQYC 1DD3A 2P1JA 2WSCH 5AW5B 3EFGA 3Q5SA 2E74B 1G2CA 1AV1A 2GUVA 3Q1MA 2YO2A 1G2CB 4YTPC 1T3JA 3NFQA 3D71A 1KILD 2FYUG 5KAFE 3M0DA 1M57D 2HYNA 2OYHB 2A45I 2JEEA 4PD4D 4UB8E 1BE3J 3Q3DA 1W2BO 3SWYA 3M91A 1QVGO 1N7LA 1Q7YQ 3JCUE 1M7LA 3L74G 2M5AA 2ZT9D 2M5AB 1NTZJ 2I8DA 2OQQA 4RKUJ 3P8CE 1VQKP 1SQBK 3PJSK 1DH3A 1EZVE 4PV1C 2E5YA 3AEDC 3A3YB 1PFIA 1NU1D 1KQGB 4DCKA 1N86A 1FU1A 3AE1C 1GZLA 3H1HE 1K04A 1BDDA 1H89A 2W6AA 1RF1C 3ABVC 3H1LE 1NAFA 4Y28J 1KC8Q 3KPEA 3QH9A 2KSEA 5CJ4A 3AE5C 2ZVNB 3G9RA 3L72E 3GF7A 1SQBG 1WRGA 1RF0A 4K3AA 2D2CD 1OFCX 3L75D 3AEAC 4RJTA 5GTIE 2POHA 3VMZA 4EOTA 1Y8AA 1SQXK 1OW6A 1EDLA 2L5GB 4JBZA 1L0ND 1D7MA 3KXDA 5EFWB 3CC2P 3FXDA 1T2KC 3V2QA 3L37A 3B5NA 1S5LH 4KHXA 2PGDA 3B5NB 5KJ7D 3H1KJ 3CPWO 1LTTC 1KFMA 2QE7H 1JEKA 1JMBA 1FS0E 1VQ8P 1SQXG 2O1JA 2WZ7A 2WTYA 1X0TA 1KV4A 4H13D 4TT3H 1NAYA 2OYIC 1NTMJ 1GK6A 2JKVA 1AFOA 2E43A 4I7ZC 1MV8A 1PP9D 3LW5J 3OAKA 2QVAA 3AECC 5AVSB 1YTZT 2KB7P 2LKMA 2P7JA 3CC4P 4ZKUA 3VMXA 1GD2E 3SWKA 3B4SA 1VDFA 5APYA 1VQLP 5AW4B 4H0LB 1JY3P 1SQPE 1FZGA 2E75C 1UIIA 1JOCA 1L0LD 3L70G 1EXIA 2Q6QA 2Q9IA 5KAIH 1S3JA 5CCHC 1VQ5P 2YXQB 3B8EB 3HD7C 1KN7A 1R5SA 3A0BH 3WUTA 3IR9A 1S72P 2JWDA 4JQ0D 2V7QJ 2XDJA 2Q5UA 2FKWB 1BGYD 1BE3D 2FY8A 3N4XA 5TISE 4OVNF 2GUSA 1OXZA 3OA7A 2Z4EA 3RK3B 2JR8A 4ZMDA 1AJYA 3RL0B 1GL2A 3AE8C 3TGUJ 1L4AD 4AQRD 3H1JE 4D6TE 1JY2N 3CX5I 4ASVA 4OGQD 1OW8A 2R3SA 4LGDE 1JUNA 1URQD 1Y47A 1P84D 3CCQP 1CI6A 1CI6B 2OTKE 1QLED 1ZMEC 2KI7B 3V2NA 3G4SP 2XNDH 3VTPC 4HH2A 3H1HJ 4WB4A 1JCDA 1J2JB 3H1LJ 1K9MQ 2WPSA 3W67A 3VYIA 5KLVJ 1G1JA 1X9VA 2OYHC 1HTLC 2FYUE 2KYVA 4EIJA 3L72J 3C8VA 3M9QA 2NPSA 2NPSB 2B88A 2W6JH 3VMYA 2ZXEB 2XU6A 3H1IG 1LTIC 3H1KD 3L74E 4IL6H 1HUCA 4ASWA 3JSVC 3U1CA 1X22A 2A06D 3FWNA 1NOHA 3IF4A 3VMAA 5B5EH 1J1DC 3GF3A 4JYBA 1NTZE 3M9BA 3L73G 2QJPC 1PPJD 1N7SA 1N7SB 3BCCD 2Q3IA 2PFXA 2K9YA 2P10A 1NTMD 3RK2D 3CLQA 4OWFA 3WU2H 2R5DA 1JY2O 2FFDC 1T3UA 3WUUA 5B66E 1SQBE 3I55P 5APSA 1FOSE 2M3EA 2IBZG 4GODA 2Y0DA 5KTBA 1FDOA 2KK7A 1PL5A 3CCEP 1RE3A 3BRTB 3CCSP 2M8RA 1Q90D 3KDPB 1GTWA 1Q82Q 5AW8B 1KILA 2E42A 2OARA 2QJKB 1KILB 2B87A 5KAIE 2B87B 1SQPJ 1KYOE 2WITA 1M56D 4GT1A 2IPPA 4PD4I 1L0NK 5H2FH 3A0HH 1JB0J 2Y0CA 2ZT9B 4I1LA 1CSBA 4PV1D 1HGVA 1M1JA 3L75G 4U3FG 2ITAA 4IOIH 1HGZA 2PAJA 1CZQA 2RN0A 1LTJA 3AE2C 1EDKA 1LTJB 3II6A 1KD1Q 1N73C 1ZW0A 1BSHA 3TYYA 1Z56A 3L36A 4PD4H 5AVQB 2RH0A 4DOJA 4AUWA 1IK7A 4N6JA 3P8CD 3Q2YA 3W68A 3BATA 3VP8A 1EZVD 2WT7B 3RL0g 1KORA 3H1JJ 4GOFA 4D6TJ 2KOGA 4L75A 4L74A 3L70E 3V5BA 2K9JA 3H1HD 3GLMA 2K9JB 1E79H 1SFCC 3V4QA 3NMDA 2ZVOB 2N1TA 5CBOA 1MFZA 2N1TB 3CCLP 3H1LD 3A5TA 2AEJA 2A45G 2BCCG 2FYNB 3CD6P 3L72D 5KJ7A 1L0LK 2H43A 1SP4A 1VF5C 4AYCA 3MIWA 3HE5A 2FYUJ 1FZAA 3HE5B 1IFMA 1YJ9P 1FZBA 4DT0A 1YJWP 2OYOA 1H0TA 3RL0C 5BVZA 5B5EE 1HJ0A 3L74J 1XTCC 3F89A 2R3CA 2O01H 1L0LG 3TDKA 3CXHH 1QVFO 3M06A 2YKOA 2XZRA 3VOPA 3TGUE 1ZV8A 2BASA 3WU2E 5KLIB 2W27A 1NGMB 3K5BA 4L76A 4WY4C 1QGKB 1YQ3C 2E75D 1BGYG 2YO3A 2IYPA 2WPQA 3P32A 3V6IA 3H25A 2A45H 2JO1A 1W5CE 2HG5D 1J1EC 1SQBJ 1SQQK 1AVOA 4ZKPA 3MZWB 5CCHD 5KLVE 2Q1KA 3HD7D 4R4LA 3S9OA 4GIFA 2Y0EA 4I6MC 3CCJP 3HRNA 1N2DC 2V4HA 3D6ZA 1LT1A 2E5TA 4IFMA 2ZYDA 5AVVB 2YIUB 1ZRTE 5AW7B 2Q7CA 3RGUA 1OVUA 1SQQG 2KLUA 2AXCA 3L73E 5CCGC 4DZOA 3TK1A 3LIDA 1KQFB 1OX3A 3Q5RA 1SQXJ 4LLHA 2KS1A 3CL3D 1EXJA 1Q81Q 2FYZA 3L71G 1ZR2A 2KS1B 2FXOA 3EQ2A 2AXTH 1L4AA 3B71A 4K35A 4L73A 1GMJA 2HLOA 1U57A 1S4XA 5KKZB 2I1JA 1P84I 4OGQB 4YPCA 5AW3B 2ZYAA 1URQA 2E74D 1NYHA 1URQB 1PIXA 3HUSA 3HUSB 3KZIE 2IBZE 3PTZA 4W7ZA 3P7KA 3HTKA 4H44B 3HTKB 3OW2O 1KFNA 2WSFJ 1A02F 2N9BA 3I5CA 3CCVP 1JMMA 2WPVB 1LGHB 3H1JD 4D6TD 1FC2C 1KB9E 1LT9A 5E79H 1LT9B 4UB6H 1A02J 1DX7A 1PPJG 4W7YA 3E1RA 2P2UA 4HYTB 4N3YB 1VL2A 3BCCG 3MUDC 1DIPA 1USDA 3L70J 2CPBA 1RE4A 4QMAA 3L4FA 1QX8A 4JF7A 4WVZA 2LXCB 2O01N 3A7OA 3GHGA 3GHGB 4NPFX 3AE6C 3FX0A 2YMKA 2FYUD 4U3FE 4BXLA 3L35A 1YIJP 1FZEA 1SQVK 2N9YB 2R44A 4C7NA 1FAVA 2MJZA 4C7NB 1NVOA 4OH8B 1FE6A 2WSEJ 2BEQD 4PJ0H 1AVYA 3L74D 4CPGA 3M9HA 2WWWA 3CXHE 3RK2B 1FZCA 4C46A 1FZCB 1OW7A 1FJKA 1NTZD 1LTAC 3MP7B 2QJYB 3WUVA 1SQVG 1ZXGA 4LC1A 1JNMA 2K3RA 1N8RQ 1GL2B 3B5ND 2E76C 2RMZA 2FYNC 2KUBA 3JC22 2BCCE 2IZ1A 3ITKA 1SLQA 1U7MA 2E74C 3SFDC 1SQBD 1VQ9P 1SS1A 2J58A 3A2AA 1NTKK 3G6EP 2W83C 3LW5H 1HWTC 4GDOA 1OZHA 4TLFA 1LTSC 4NPDA 2YMYA 3M0DC 3UIAA 1BSNA 1LP1A 1JY3N 3H1IJ 4BRYA 3CCUP 1LP1B 3CWBG 4BRYB 4Y99B 3CX5H 4PV1B 2B9BA 3TSIA 5APXA 5K5GB 3FWLA 2HR3A 1KYOD 1IZNB 1S5LE 3CMAP 3AEGC 1NTKG 1GDTA 1KZUB 3AE7C 1BCCG 5KLIC 1HH0A 1S2EA 1RF1A 1VQ6P 2AXTE 1RF1B 3L73J 4W80A 1OWAA 5DJTB 4JYCA 1FJPA 5APVA 5C39A 3OJAB 4B86A 1R8EA 1QL2A 5L8RJ 1KQSO 1EZVI 2H89C 1KMIZ 1G1IA 1LNQA 1IC2A 4N78E 2IX7C 5KAFH 3PP5A 1K73Q 1SFCD 2QEXP 4UB8H 1NU1K 1JM0A 1RF0C 2FBWC 5APWA 3D6YA 3JCUH 2HODA 2R5BA 2HODB 2YIUC 5DJUB 5CHXA 1VF5D 1IO4A 4EYYQ 1IK9A 3H6PA 2YKPA 3ZDMA 3TF5A 1LWUA 1ZOYC 2DW3A 1GW4A 1LWUB 4ZNCA 3L70D 1VPCA 3B5NC 1IFNA 1PZQA 1SQQE 3RL0D 1H88A 1NU1G 1NJIQ 2CK3H 3AE4C 1JY3O 2GA1A 4RESB 1DD4A 5AVYB 2OYIA 1IFJA 2WSCJ 1GU4A 2OYIB 3L71E 4WBAA 1T6AA 3A0BE 4JPZB 1WT6A 2QA4P 1SQXE 4I7ZB 1FDMA 3L75J 4U3FJ 5GTIH 2J5UA 1PGPA 1AQ5A 3FGAD 4WY4D 1X79B 1FBMA 1M1JB 2QM8A 1ZN5A 2E75B 1YI2P 4R4MA 1L0NG 2KP8A 3S4RA 1DEBA 1HJBA 1FZFA 2SPZA 1KB9I 4XA4A 3TGUD 1S9KE 5CCHA 4YXDC 3V2RA 3HD7A 2O1KA 4H0LC 3MHVA 3KYQA 5M1BA 3GHGC 2D2CB 3VN0A 1NH4A 3CI9A 2CPSA 3MD0A 2C9NY 2BCCJ 3RK3E 3BASA 1VQPP 5CCGD 5KLVD 4BWNA 1X8YA 1PV3A 2JWAA 1VQMP 3CX5E 1MUUA 2NZ2A 1PP9G 2ZXXA 1EDIA 2K37A 1T8ZA 1ZRTD 2LXBA 1SVFA 4IL6E 1QEXA 2KIKA 3F5HA 1USEA 3RK3C 2QJYC 2YKQA 2W90A 1JO5A 1H0TB 3SSUA 2KZJA 1L0LJ 1AA0A 3L73D 1GL2C 1SQVE 1M8OB 4H13B 1WMKA 2P58A 2OTLP 1NHLA 3M0AA 2XV5A 2RKLA 1LJ2A 5APTA 1IJDB 1KTMA 1NTZK 5AW1B 2OYHA 1HF9A 1YTZI 3S1KA 1BGYJ 5AW9B 2P67A 3R2PA 3MTUE 3PRJA 2IBZD 4C7RA 1RQUA 1NKZB 5TISH 2QRXA 3G71P 3H32A 3H32B 1BE3G 1H8AA 4Y99C 5AVZB 2C9LY 1KB9D 5TJHA 2NPSC 3CWBE 1NTZG 1J1DB 5AW0B 1FOSF 4MN4C 2B89A 3H1IE 1NTKE 2QJPB 1BCCE 2HFED 1EQ7A 3IN6A 1SQPD 3PLNA 1SQQJ 1LTBC 5H2FE 2FFDA 3BRVB 3A0HE 2FFDB 1GU5A 1N7SC 4U3FD 3L71J 2XKMA 1ZR4A 4EDFA 2N1TD 2FXPA 3IFMA 3FXEA 5CMZA 1KILE 2E76D 2W6BA 1L4AB 1CW5A 1OIPA 3CXHD 3G3ZA 2VRSA 4HKZH 3T97A 4PD4E 1VQ7P 1S1CX 3PHLA 3T97B 3BVHA 1EDJA 1QL1A 1LWUC 1RE3C 1NTMK 3LIEA 2IFNA 3H1KG 1OVVA 3U59A 2A06G 1VQ4P 4KJMA 4U7JA 3AE9C 2YNYA 2QJKC 1KILC 3BCCJ 3V4WA 3GW6A 1JY2P 1NU1E 2BCCD 5APQA 4O9BA 2KSJA 1HBWA 3U1AA 4EI2A 1KYOI 1P84H 2C0XA 2ZJSE
chains in the Genus database with same CATH topology
1NTMG 3L72G 3L75G 3H1IG 4U3FG 3TGUG 3H1JG 1PP9G 1NTKG 3L73G 3H1HG 4D6TG 1BCCG 1SQPG 1NTZG 3L70G 3L71G 1L0LG 1PPJG 3H1KG 1SQVG 3CXHH 3H1LG 2IBZG 1KYOH 1BGYG 2BCCG 1NU1G 1EZVG 1SQBG 3BCCG 2A06G 5KLVG 1L0NG 3L74G 3CWBG 2FYUG 1SQXG 1BE3G 4PD4H 1P84H 3CX5H 1SQQG 1KB9H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTM G;  3L72 G;  3L75 G;  3H1I G;  4U3F G;  3TGU G;  3H1J G;  1PP9 G;  1NTK G;  3L73 G;  3H1H G;  4D6T G;  1BCC G;  1SQP G;  1NTZ G;  3L70 G;  3L71 G;  1L0L G;  1PPJ G;  3H1K G;  1SQV G;  3CXH H;  3H1L G;  2IBZ G;  1KYO H;  1BGY G;  2BCC G;  1NU1 G;  1EZV G;  1SQB G;  3BCC G;  2A06 G;  5KLV G;  1L0N G;  3L74 G;  3CWB G;  2FYU G;  1SQX G;  1BE3 G;  4PD4 H;  1P84 H;  3CX5 H;  1SQQ G;  1KB9 H; 
#chains in the Genus database with same CATH topology
 5B66 H;  1NTM G;  1N73 A;  1RQV A;  2ZT9 C;  1N73 B;  2I1K A;  2R32 A;  1DEE G;  2QSI A;  1M1J C;  1Q2N A;  1NO4 A;  2Z5H A;  3L75 E;  2H88 C;  3E1I A;  1ZLL A;  1LTJ C;  1XTG B;  5AVX B;  3NTN A;  5GTH H;  3TNU A;  1VQO P;  3N7N A;  3RBX A;  3TNU B;  2IDB A;  2L91 A;  3E7K A;  3AEB C;  1L0N E;  2OTJ P;  2WPR A;  5APU A;  2M3B A;  1KYO H;  1SFC A;  1SFC B;  3I56 P;  4HB1 A;  2K1A A;  1SQV J;  2Y9Z A;  2D2C C;  2J59 M;  3CC7 P;  3SWF A;  2G8Y A;  1MKM A;  1VF5 B;  2NRG A;  2N1T C;  4N78 D;  3C9I A;  4YXW H;  2OGU A;  1MZ9 A;  1NKN A;  2PP6 A;  1IFD A;  1UIX A;  2KNC A;  3KQG A;  5AVW B;  2KNC B;  5KJ7 C;  1Y9B A;  2WSF H;  1S5L X;  3CCR P;  2WMM A;  1PP9 E;  3WMM 0;  3SFE C;  1RHZ B;  5KLV K;  3TGU G;  1Q86 Q;  3USS A;  3CWB J;  1EC5 A;  4H44 D;  4H13 C;  1SQQ D;  1EZV G;  1NTK J;  4KT0 J;  1BCC J;  3Q5P A;  4WY4 A;  4WY4 B;  2AEM A;  1L0L E;  1OMI A;  1GW3 A;  3EWK A;  2Z5I A;  3H1H G;  3L71 D;  3VP9 A;  1VQN P;  2WSS H;  2O3J A;  4XFJ A;  1ZP0 C;  3H1L G;  1YHQ P;  1YYC A;  1SQX D;  2MKV A;  5KLV G;  1HVV A;  1J1E B;  2WVR A;  4H0L D;  2V7Q H;  3L72 G;  3IAO A;  3NXS A;  3CCM P;  2WSE H;  3MGN A;  3QWO C;  1BGY E;  1KQL A;  1FDI A;  1BE3 E;  4GOE A;  1R5L A;  5AW2 B;  4DJG A;  2KXP B;  1YBK A;  1IFP A;  4RO0 A;  2W8Z A;  2IZ0 A;  1S9K D;  2HPC A;  5CCG A;  4GKG A;  4IFD K;  2HPC B;  5E79 E;  4UB6 E;  1K8A Q;  2FXM A;  3PH0 A;  1IFI A;  1P84 E;  3O6Q A;  3KHU A;  1RH5 B;  1TU3 F;  2IFM A;  2JDI H;  3O6Q B;  1NU1 J;  1RY3 A;  5AVT B;  3D70 A;  3RK3 D;  2BEZ F;  2JP3 A;  5CJ0 A;  2UWJ E;  1GK4 A;  1E5W A;  1GL2 D;  1SQP K;  3EFF K;  1PGQ A;  2JJL A;  1MFT A;  2IYO A;  2PRR A;  1L4A C;  1K05 A;  2M0B A;  3CX5 D;  5KKZ C;  5GTH E;  3C1L A;  4OGQ C;  5CBN A;  1URQ C;  1AQT A;  3HUS C;  5AVU B;  4PJ0 E;  1NWQ A;  2KZI A;  4H44 C;  3R4Y A;  2QM7 A;  1W2E A;  1LTG C;  3H1K E;  2IBZ I;  1L0N J;  3AEF C;  3MUD A;  2A06 E;  1SQV D;  3HE4 A;  4WWI A;  1SQP G;  4A7P A;  1M90 Q;  1PGJ A;  3HE4 B;  4I2L C;  4IFF A;  2O01 J;  1LT9 C;  2LR2 A;  3AE3 C;  1YJN P;  3RBZ A;  1OVR A;  2QG4 A;  2NPS D;  1YIT P;  3V2P A;  5AVR B;  1PPJ E;  2AEF A;  4NPE A;  3BCC E;  2QIW A;  3O8Z A;  2ZAE B;  3HD7 B;  1RE4 C;  4XE5 B;  3AEE C;  2ZFC A;  5BU5 A;  5AW6 B;  1NTM E;  3GG2 A;  2H7H A;  1JTH A;  1U7J A;  1JTH B;  2XNX A;  2KLV A;  1PGO A;  3KZI H;  4IL6 X;  1BDC A;  3GMA A;  2WT7 A;  1YQ4 C;  5BU8 B;  1N7S D;  3CWB D;  1L2P A;  2H8P D;  2Q3E A;  2YXR B;  3P8M C;  1M1K Q;  1PP9 J;  2ZYG A;  4Z1M H;  1KB9 H;  3CME P;  2K88 A;  3H1I D;  1NTK D;  4HJG H;  1BCC D;  2G3A A;  3H1J G;  3RK2 C;  4M3L A;  2FYU K;  2Y9Y A;  1JCC A;  2C0W A;  4D6T G;  1T2K D;  1FZC C;  2GM4 A;  2E76 B;  3CXH I;  2WQY C;  1DD3 A;  2P1J A;  2WSC H;  5AW5 B;  3EFG A;  3Q5S A;  2E74 B;  1G2C A;  1AV1 A;  2GUV A;  3Q1M A;  2YO2 A;  1G2C B;  4YTP C;  1T3J A;  3NFQ A;  3D71 A;  1KIL D;  2FYU G;  5KAF E;  3M0D A;  1M57 D;  2HYN A;  2OYH B;  2A45 I;  2JEE A;  4PD4 D;  4UB8 E;  1BE3 J;  3Q3D A;  1W2B O;  3SWY A;  3M91 A;  1QVG O;  1N7L A;  1Q7Y Q;  3JCU E;  1M7L A;  3L74 G;  2M5A A;  2ZT9 D;  2M5A B;  1NTZ J;  2I8D A;  2OQQ A;  4RKU J;  3P8C E;  1VQK P;  1SQB K;  3PJS K;  1DH3 A;  1EZV E;  4PV1 C;  2E5Y A;  3AED C;  3A3Y B;  1PFI A;  1NU1 D;  1KQG B;  4DCK A;  1N86 A;  1FU1 A;  3AE1 C;  1GZL A;  3H1H E;  1K04 A;  1BDD A;  1H89 A;  2W6A A;  1RF1 C;  3ABV C;  3H1L E;  1NAF A;  4Y28 J;  1KC8 Q;  3KPE A;  3QH9 A;  2KSE A;  5CJ4 A;  3AE5 C;  2ZVN B;  3G9R A;  3L72 E;  3GF7 A;  1SQB G;  1WRG A;  1RF0 A;  4K3A A;  2D2C D;  1OFC X;  3L75 D;  3AEA C;  4RJT A;  5GTI E;  2POH A;  3VMZ A;  4EOT A;  1Y8A A;  1SQX K;  1OW6 A;  1EDL A;  2L5G B;  4JBZ A;  1L0N D;  1D7M A;  3KXD A;  5EFW B;  3CC2 P;  3FXD A;  1T2K C;  3V2Q A;  3L37 A;  3B5N A;  1S5L H;  4KHX A;  2PGD A;  3B5N B;  5KJ7 D;  3H1K J;  3CPW O;  1LTT C;  1KFM A;  2QE7 H;  1JEK A;  1JMB A;  1FS0 E;  1VQ8 P;  1SQX G;  2O1J A;  2WZ7 A;  2WTY A;  1X0T A;  1KV4 A;  4H13 D;  4TT3 H;  1NAY A;  2OYI C;  1NTM J;  1GK6 A;  2JKV A;  1AFO A;  2E43 A;  4I7Z C;  1MV8 A;  1PP9 D;  3LW5 J;  3OAK A;  2QVA A;  3AEC C;  5AVS B;  1YTZ T;  2KB7 P;  2LKM A;  2P7J A;  3CC4 P;  4ZKU A;  3VMX A;  1GD2 E;  3SWK A;  3B4S A;  1VDF A;  5APY A;  1VQL P;  5AW4 B;  4H0L B;  1JY3 P;  1SQP E;  1FZG A;  2E75 C;  1UII A;  1JOC A;  1L0L D;  3L70 G;  1EXI A;  2Q6Q A;  2Q9I A;  5KAI H;  1S3J A;  5CCH C;  1VQ5 P;  2YXQ B;  3B8E B;  3HD7 C;  1KN7 A;  1R5S A;  3A0B H;  3WUT A;  3IR9 A;  1S72 P;  2JWD A;  4JQ0 D;  2V7Q J;  2XDJ A;  2Q5U A;  2FKW B;  1BGY D;  1BE3 D;  2FY8 A;  3N4X A;  5TIS E;  4OVN F;  2GUS A;  1OXZ A;  3OA7 A;  2Z4E A;  3RK3 B;  2JR8 A;  4ZMD A;  1AJY A;  3RL0 B;  1GL2 A;  3AE8 C;  3TGU J;  1L4A D;  4AQR D;  3H1J E;  4D6T E;  1JY2 N;  3CX5 I;  4ASV A;  4OGQ D;  1OW8 A;  2R3S A;  4LGD E;  1JUN A;  1URQ D;  1Y47 A;  1P84 D;  3CCQ P;  1CI6 A;  1CI6 B;  2OTK E;  1QLE D;  1ZME C;  2KI7 B;  3V2N A;  3G4S P;  2XND H;  3VTP C;  4HH2 A;  3H1H J;  4WB4 A;  1JCD A;  1J2J B;  3H1L J;  1K9M Q;  2WPS A;  3W67 A;  3VYI A;  5KLV J;  1G1J A;  1X9V A;  2OYH C;  1HTL C;  2FYU E;  2KYV A;  4EIJ A;  3L72 J;  3C8V A;  3M9Q A;  2NPS A;  2NPS B;  2B88 A;  2W6J H;  3VMY A;  2ZXE B;  2XU6 A;  3H1I G;  1LTI C;  3H1K D;  3L74 E;  4IL6 H;  1HUC A;  4ASW A;  3JSV C;  3U1C A;  1X22 A;  2A06 D;  3FWN A;  1NOH A;  3IF4 A;  3VMA A;  5B5E H;  1J1D C;  3GF3 A;  4JYB A;  1NTZ E;  3M9B A;  3L73 G;  2QJP C;  1PPJ D;  1N7S A;  1N7S B;  3BCC D;  2Q3I A;  2PFX A;  2K9Y A;  2P10 A;  1NTM D;  3RK2 D;  3CLQ A;  4OWF A;  3WU2 H;  2R5D A;  1JY2 O;  2FFD C;  1T3U A;  3WUU A;  5B66 E;  1SQB E;  3I55 P;  5APS A;  1FOS E;  2M3E A;  2IBZ G;  4GOD A;  2Y0D A;  5KTB A;  1FDO A;  2KK7 A;  1PL5 A;  3CCE P;  1RE3 A;  3BRT B;  3CCS P;  2M8R A;  1Q90 D;  3KDP B;  1GTW A;  1Q82 Q;  5AW8 B;  1KIL A;  2E42 A;  2OAR A;  2QJK B;  1KIL B;  2B87 A;  5KAI E;  2B87 B;  1SQP J;  1KYO E;  2WIT A;  1M56 D;  4GT1 A;  2IPP A;  4PD4 I;  1L0N K;  5H2F H;  3A0H H;  1JB0 J;  2Y0C A;  2ZT9 B;  4I1L A;  1CSB A;  4PV1 D;  1HGV A;  1M1J A;  3L75 G;  4U3F G;  2ITA A;  4IOI H;  1HGZ A;  2PAJ A;  1CZQ A;  2RN0 A;  1LTJ A;  3AE2 C;  1EDK A;  1LTJ B;  3II6 A;  1KD1 Q;  1N73 C;  1ZW0 A;  1BSH A;  3TYY A;  1Z56 A;  3L36 A;  4PD4 H;  5AVQ B;  2RH0 A;  4DOJ A;  4AUW A;  1IK7 A;  4N6J A;  3P8C D;  3Q2Y A;  3W68 A;  3BAT A;  3VP8 A;  1EZV D;  2WT7 B;  3RL0 g;  1KOR A;  3H1J J;  4GOF A;  4D6T J;  2KOG A;  4L75 A;  4L74 A;  3L70 E;  3V5B A;  2K9J A;  3H1H D;  3GLM A;  2K9J B;  1E79 H;  1SFC C;  3V4Q A;  3NMD A;  2ZVO B;  2N1T A;  5CBO A;  1MFZ A;  2N1T B;  3CCL P;  3H1L D;  3A5T A;  2AEJ A;  2A45 G;  2BCC G;  2FYN B;  3CD6 P;  3L72 D;  5KJ7 A;  1L0L K;  2H43 A;  1SP4 A;  1VF5 C;  4AYC A;  3MIW A;  3HE5 A;  2FYU J;  1FZA A;  3HE5 B;  1IFM A;  1YJ9 P;  1FZB A;  4DT0 A;  1YJW P;  2OYO A;  1H0T A;  3RL0 C;  5BVZ A;  5B5E E;  1HJ0 A;  3L74 J;  1XTC C;  3F89 A;  2R3C A;  2O01 H;  1L0L G;  3TDK A;  3CXH H;  1QVF O;  3M06 A;  2YKO A;  2XZR A;  3VOP A;  3TGU E;  1ZV8 A;  2BAS A;  3WU2 E;  5KLI B;  2W27 A;  1NGM B;  3K5B A;  4L76 A;  4WY4 C;  1QGK B;  1YQ3 C;  2E75 D;  1BGY G;  2YO3 A;  2IYP A;  2WPQ A;  3P32 A;  3V6I A;  3H25 A;  2A45 H;  2JO1 A;  1W5C E;  2HG5 D;  1J1E C;  1SQB J;  1SQQ K;  1AVO A;  4ZKP A;  3MZW B;  5CCH D;  5KLV E;  2Q1K A;  3HD7 D;  4R4L A;  3S9O A;  4GIF A;  2Y0E A;  4I6M C;  3CCJ P;  3HRN A;  1N2D C;  2V4H A;  3D6Z A;  1LT1 A;  2E5T A;  4IFM A;  2ZYD A;  5AVV B;  2YIU B;  1ZRT E;  5AW7 B;  2Q7C A;  3RGU A;  1OVU A;  1SQQ G;  2KLU A;  2AXC A;  3L73 E;  5CCG C;  4DZO A;  3TK1 A;  3LID A;  1KQF B;  1OX3 A;  3Q5R A;  1SQX J;  4LLH A;  2KS1 A;  3CL3 D;  1EXJ A;  1Q81 Q;  2FYZ A;  3L71 G;  1ZR2 A;  2KS1 B;  2FXO A;  3EQ2 A;  2AXT H;  1L4A A;  3B71 A;  4K35 A;  4L73 A;  1GMJ A;  2HLO A;  1U57 A;  1S4X A;  5KKZ B;  2I1J A;  1P84 I;  4OGQ B;  4YPC A;  5AW3 B;  2ZYA A;  1URQ A;  2E74 D;  1NYH A;  1URQ B;  1PIX A;  3HUS A;  3HUS B;  3KZI E;  2IBZ E;  3PTZ A;  4W7Z A;  3P7K A;  3HTK A;  4H44 B;  3HTK B;  3OW2 O;  1KFN A;  2WSF J;  1A02 F;  2N9B A;  3I5C A;  3CCV P;  1JMM A;  2WPV B;  1LGH B;  3H1J D;  4D6T D;  1FC2 C;  1KB9 E;  1LT9 A;  5E79 H;  1LT9 B;  4UB6 H;  1A02 J;  1DX7 A;  1PPJ G;  4W7Y A;  3E1R A;  2P2U A;  4HYT B;  4N3Y B;  1VL2 A;  3BCC G;  3MUD C;  1DIP A;  1USD A;  3L70 J;  2CPB A;  1RE4 A;  4QMA A;  3L4F A;  1QX8 A;  4JF7 A;  4WVZ A;  2LXC B;  2O01 N;  3A7O A;  3GHG A;  3GHG B;  4NPF X;  3AE6 C;  3FX0 A;  2YMK A;  2FYU D;  4U3F E;  4BXL A;  3L35 A;  1YIJ P;  1FZE A;  1SQV K;  2N9Y B;  2R44 A;  4C7N A;  1FAV A;  2MJZ A;  4C7N B;  1NVO A;  4OH8 B;  1FE6 A;  2WSE J;  2BEQ D;  4PJ0 H;  1AVY A;  3L74 D;  4CPG A;  3M9H A;  2WWW A;  3CXH E;  3RK2 B;  1FZC A;  4C46 A;  1FZC B;  1OW7 A;  1FJK A;  1NTZ D;  1LTA C;  3MP7 B;  2QJY B;  3WUV A;  1SQV G;  1ZXG A;  4LC1 A;  1JNM A;  2K3R A;  1N8R Q;  1GL2 B;  3B5N D;  2E76 C;  2RMZ A;  2FYN C;  2KUB A;  3JC2 2;  2BCC E;  2IZ1 A;  3ITK A;  1SLQ A;  1U7M A;  2E74 C;  3SFD C;  1SQB D;  1VQ9 P;  1SS1 A;  2J58 A;  3A2A A;  1NTK K;  3G6E P;  2W83 C;  3LW5 H;  1HWT C;  4GDO A;  1OZH A;  4TLF A;  1LTS C;  4NPD A;  2YMY A;  3M0D C;  3UIA A;  1BSN A;  1LP1 A;  1JY3 N;  3H1I J;  4BRY A;  3CCU P;  1LP1 B;  3CWB G;  4BRY B;  4Y99 B;  3CX5 H;  4PV1 B;  2B9B A;  3TSI A;  5APX A;  5K5G B;  3FWL A;  2HR3 A;  1KYO D;  1IZN B;  1S5L E;  3CMA P;  3AEG C;  1NTK G;  1GDT A;  1KZU B;  3AE7 C;  1BCC G;  5KLI C;  1HH0 A;  1S2E A;  1RF1 A;  1VQ6 P;  2AXT E;  1RF1 B;  3L73 J;  4W80 A;  1OWA A;  5DJT B;  4JYC A;  1FJP A;  5APV A;  5C39 A;  3OJA B;  4B86 A;  1R8E A;  1QL2 A;  5L8R J;  1KQS O;  1EZV I;  2H89 C;  1KMI Z;  1G1I A;  1LNQ A;  1IC2 A;  4N78 E;  2IX7 C;  5KAF H;  3PP5 A;  1K73 Q;  1SFC D;  2QEX P;  4UB8 H;  1NU1 K;  1JM0 A;  1RF0 C;  2FBW C;  5APW A;  3D6Y A;  3JCU H;  2HOD A;  2R5B A;  2HOD B;  2YIU C;  5DJU B;  5CHX A;  1VF5 D;  1IO4 A;  4EYY Q;  1IK9 A;  3H6P A;  2YKP A;  3ZDM A;  3TF5 A;  1LWU A;  1ZOY C;  2DW3 A;  1GW4 A;  1LWU B;  4ZNC A;  3L70 D;  1VPC A;  3B5N C;  1IFN A;  1PZQ A;  1SQQ E;  3RL0 D;  1H88 A;  1NU1 G;  1NJI Q;  2CK3 H;  3AE4 C;  1JY3 O;  2GA1 A;  4RES B;  1DD4 A;  5AVY B;  2OYI A;  1IFJ A;  2WSC J;  1GU4 A;  2OYI B;  3L71 E;  4WBA A;  1T6A A;  3A0B E;  4JPZ B;  1WT6 A;  2QA4 P;  1SQX E;  4I7Z B;  1FDM A;  3L75 J;  4U3F J;  5GTI H;  2J5U A;  1PGP A;  1AQ5 A;  3FGA D;  4WY4 D;  1X79 B;  1FBM A;  1M1J B;  2QM8 A;  1ZN5 A;  2E75 B;  1YI2 P;  4R4M A;  1L0N G;  2KP8 A;  3S4R A;  1DEB A;  1HJB A;  1FZF A;  2SPZ A;  1KB9 I;  4XA4 A;  3TGU D;  1S9K E;  5CCH A;  4YXD C;  3V2R A;  3HD7 A;  2O1K A;  4H0L C;  3MHV A;  3KYQ A;  5M1B A;  3GHG C;  2D2C B;  3VN0 A;  1NH4 A;  3CI9 A;  2CPS A;  3MD0 A;  2C9N Y;  2BCC J;  3RK3 E;  3BAS A;  1VQP P;  5CCG D;  5KLV D;  4BWN A;  1X8Y A;  1PV3 A;  2JWA A;  1VQM P;  3CX5 E;  1MUU A;  2NZ2 A;  1PP9 G;  2ZXX A;  1EDI A;  2K37 A;  1T8Z A;  1ZRT D;  2LXB A;  1SVF A;  4IL6 E;  1QEX A;  2KIK A;  3F5H A;  1USE A;  3RK3 C;  2QJY C;  2YKQ A;  2W90 A;  1JO5 A;  1H0T B;  3SSU A;  2KZJ A;  1L0L J;  1AA0 A;  3L73 D;  1GL2 C;  1SQV E;  1M8O B;  4H13 B;  1WMK A;  2P58 A;  2OTL P;  1NHL A;  3M0A A;  2XV5 A;  2RKL A;  1LJ2 A;  5APT A;  1IJD B;  1KTM A;  1NTZ K;  5AW1 B;  2OYH A;  1HF9 A;  1YTZ I;  3S1K A;  1BGY J;  5AW9 B;  2P67 A;  3R2P A;  3MTU E;  3PRJ A;  2IBZ D;  4C7R A;  1RQU A;  1NKZ B;  5TIS H;  2QRX A;  3G71 P;  3H32 A;  3H32 B;  1BE3 G;  1H8A A;  4Y99 C;  5AVZ B;  2C9L Y;  1KB9 D;  5TJH A;  2NPS C;  3CWB E;  1NTZ G;  1J1D B;  5AW0 B;  1FOS F;  4MN4 C;  2B89 A;  3H1I E;  1NTK E;  2QJP B;  1BCC E;  2HFE D;  1EQ7 A;  3IN6 A;  1SQP D;  3PLN A;  1SQQ J;  1LTB C;  5H2F E;  2FFD A;  3BRV B;  3A0H E;  2FFD B;  1GU5 A;  1N7S C;  4U3F D;  3L71 J;  2XKM A;  1ZR4 A;  4EDF A;  2N1T D;  2FXP A;  3IFM A;  3FXE A;  5CMZ A;  1KIL E;  2E76 D;  2W6B A;  1L4A B;  1CW5 A;  1OIP A;  3CXH D;  3G3Z A;  2VRS A;  4HKZ H;  3T97 A;  4PD4 E;  1VQ7 P;  1S1C X;  3PHL A;  3T97 B;  3BVH A;  1EDJ A;  1QL1 A;  1LWU C;  1RE3 C;  1NTM K;  3LIE A;  2IFN A;  3H1K G;  1OVV A;  3U59 A;  2A06 G;  1VQ4 P;  4KJM A;  4U7J A;  3AE9 C;  2YNY A;  2QJK C;  1KIL C;  3BCC J;  3V4W A;  3GW6 A;  1JY2 P;  1NU1 E;  2BCC D;  5APQ A;  4O9B A;  2KSJ A;  1HBW A;  3U1A A;  4EI2 A;  1KYO I;  1P84 H;  2C0X A;  2ZJS E; 
#chains in the Genus database with same CATH homology
 1NTM G;  3L72 G;  3L75 G;  3H1I G;  4U3F G;  3TGU G;  3H1J G;  1PP9 G;  1NTK G;  3L73 G;  3H1H G;  4D6T G;  1BCC G;  1SQP G;  1NTZ G;  3L70 G;  3L71 G;  1L0L G;  1PPJ G;  3H1K G;  1SQV G;  3CXH H;  3H1L G;  2IBZ G;  1KYO H;  1BGY G;  2BCC G;  1NU1 G;  1EZV G;  1SQB G;  3BCC G;  2A06 G;  5KLV G;  1L0N G;  3L74 G;  3CWB G;  2FYU G;  1SQX G;  1BE3 G;  4PD4 H;  1P84 H;  3CX5 H;  1SQQ G;  1KB9 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...