1BCCG

Cytochrome bc1 complex from chicken
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
total genus 13
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1bccG00
1NTZG 1SQVG 1KB9H 1BCCG 4D6TG 3CX5H 3L73G 3H1KG 3L75G 3BCCG 1PP9G 3L74G 1SQQG 3H1LG 3TGUG 1NTMG 1NU1G 1P84H 3L71G 1BE3G 4PD4H 4U3FG 3CXHH 1NTKG 2FYUG 1EZVG 1L0NG 1BGYG 3H1HG 1PPJG 2A06G 2BCCG 5KLVG 2IBZG 1SQPG 1KYOH 3L72G 3CWBG 3H1JG 3L70G 3H1IG 1SQBG 1L0LG 1SQXG
chains in the Genus database with same CATH superfamily
1NO4A 2WPVB 1MFZA 5KLVE 2E75B 2IBZE 2C0XA 1HH0A 2FFDC 1KILB 1R5SA 1H0TA 1OVUA 3HTKA 3U1CA 1Y9BA 1EZVD 4IFMA 2IPPA 2WPSA 2OYIA 3MGNA 4L76A 1KQLA 3WUVA 5TJHA 2IDBA 5AW4B 1HJ0A 2KZIA 1A02J 4W7YA 2ITAA 1YJWP 1USDA 3NMDA 2W6AA 1BE3D 4EOTA 1IK7A 2PGDA 2RN0A 3VMAA 2KI7B 3BCCG 1JCCA 3GW6A 2MJZA 2QA4P 1YHQP 5CJ4A 2JP3A 1P84E 2J59M 4WY4D 4GKGA 2E75C 2JO1A 4IOIH 2FXMA 1KILC 1S5LX 1RE3A 4UB6E 5KLIB 3EQ2A 2YXRB 3GMAA 1IFIA 3AE7C 3U1AA 1RY3A 2BCCG 1LTBC 3H1JG 1LT9B 4IL6X 4N78D 3OW2O 3AEEC 1KMIZ 3GF7A 1FZAA 3VOPA 1FZFA 3D6YA 1FJKA 2KUBA 1NU1J 4I6MC 1IZNB 1U57A 1FJPA 1GL2B 3WUUA 1T2KC 5KJ7C 3H1IJ 3H1KG 5H2FE 1VQKP 3BCCD 4NPDA 1KN7A 1IJDB 2K9JA 3TNUB 3AE3C 1L4AD 2KSEA 1N73B 1M56D 1SQBG 1Y8AA 3L70G 1IFNA 2WITA 1Q7YQ 1NOHA 1PP9J 1S5LE 1BCCE 4PJ0H 1LT9C 3H1HG 5APYA 3CX5I 2E74C 4D6TG 3G71P 3FXEA 1SQVJ 3H1JD 1SFCD 3CI9A 2QVAA 5AVTB 2V7QJ 1VF5D 1JTHA 4W80A 1K73Q 1GL2C 2YXQB 2ZYDA 1K05A 3B5NA 5AW8B 1BGYJ 1D7MA 2B89A 1L0LJ 1IFMA 3CCQP 1GZLA 4RESB 3L74J 1N73C 1L0NG 2FKWB 1CI6B 2FBWC 1HUCA 2FYUJ 1QL1A 3L72G 1YQ3C 1WT6A 4OGQD 1DD3A 4H13D 1W2BO 4OVNF 1SQBD 3L70D 3LIDA 3Q5PA 3PLNA 1W5CE 1NTZE 1RE4C 1JMMA 1M1JB 4EIJA 1LWUA 3F5HA 3HUSA 1NKNA 3H1HD 5CBOA 3M0AA 3ABVC 2XKMA 2B87B 3WU2H 3QH9A 2O01N 4D6TD 4KT0J 2K88A 3A0BE 3RGUA 1BE3J 3HE4A 3D70A 2KLVA 3HE5A 2R32A 3LW5J 1PL5A 4O9BA 3ITKA 5APTA 2E76C 1KB9E 1NVOA 3CXHI 1URQB 2KSJA 1TU3F 2C9LY 2YMYA 4DZOA 3TGUE 2KIKA 1L0ND 1SQXG 2JJLA 2BEQD 3CX5H 3FGAD 1FS0E 3L72D 5AW1B 3RK3E 1ZP0C 2W6BA 4YTPC 4RKUJ 5KAFH 1M1JC 3A0HH 5CCHC 1CW5A 5AVXB 3NTNA 3L71D 3P32A 2E5TA 1IFDA 1AVOA 3G6EP 5AW2B 1T3UA 3CWBD 3V4WA 4LGDE 1NU1G 1VQ6P 1EZVI 1N7SA 2SPZA 5APWA 3VP9A 2B88A 1XTCC 1EQ7A 2Q3IA 4KHXA 2CPBA 1S2EA 3H1IG 3N7NA 4U3FE 1PGOA 2M5AB 1URQC 1Q2NA 1R8EA 5E79H 1MKMA 1GK4A 2JR8A 1RF1B 3TYYA 2IYOA 4IL6H 3H1LE 1GU5A 1KILE 1JEKA 2QG4A 1S4XA 3OAKA 3A5TA 3CX5D 2PRRA 1SQXD 3NXSA 3L36A 1KZUB 3AE4C 3HD7A 1PGJA 4WB4A 1R5LA 3H32B 1M7LA 1SQVG 2AXTE 4H44B 5DJTB 1JO5A 1USEA 3F89A 3V4QA 1NAFA 1S3JA 3CCMP 2PP6A 3BCCE 1BGYG 3SSUA 3B5ND 1NU1D 5AVWB 1K8AQ 1L0LG 4YPCA 1ZLLA 2L5GB 2LR2A 4BRYB 3V2NA 1EDJA 4GOEA 5BU5A 1VQ9P 4H0LB 3L74G 2FXOA 3AEFC 1IO4A 2FYUG 1MV8A 1QX8A 3G3ZA 2A06G 2WSCJ 4EDFA 1ZXGA 2P67A 1NTZK 3HRNA 5M1BA 1SQBJ 3OA7A 2BCCE 3T97B 3WMM0 1RF0C 5TISE 2KK7A 2HPCA 1ZMEC 1EZVG 3CCUP 5CCGD 3H1HJ 1KYOE 1KQFB 3IF4A 1YBKA 2YO3A 1S9KE 2KNCB 1SQVD 2JDIH 5CJ0A 1BE3G 1LTTC 3H1KE 3L35A 5APUA 1SQPK 2Y9ZA 2ZT9C 1KORA 4H0LC 4L74A 2K3RA 3WUTA 1IFJA 4WY4B 3P8MC 2N9YB 3GHGA 1QVFO 1MUUA 1SQQE 1AVYA 1NGMB 3KXDA 1FBMA 3L72J 5EFWB 1K9MQ 2OGUA 1FZCC 1DH3A 3L75D 3AEDC 2I8DA 3RK3C 3L71J 2XNDH 5AVVB 1LTJB 1EDKA 3GLMA 3V6IA 2Q1KA 1DEEG 3CWBJ 1SQPD 1BSNA 4JYCA 1FZBA 2CPSA 1VQ4P 1N7LA 2B9BA 4EYYQ 5B5EE 1FE6A 3MUDC 1NTKK 1N7SD 2Q3EA 1J1EB 2HYNA 1OX3A 3I5CA 2UWJE 1OZHA 3B8EB 4M3LA 1KTMA 4WY4C 3ZDMA 1L4AB 1YYCA 1T8ZA 5C39A 3AEGC 3AE6C 3CC2P 4K3AA 3BRVB 4YXDC 3JCUE 4ZKUA 2KS1B 1OW8A 1ZRTE 2M0BA 2PFXA 1SQXJ 3AEBC 3K5BA 4BXLA 2XV5A 1NTMK 4C7RA 2HODA 3V2RA 4C7NA 1VQ8P 3HD7D 2Y0EA 2AEMA 2FYZA 1NTKD 4L73A 1SFCB 3O8ZA 3PH0A 1AJYA 3CPWO 3S1KA 1VF5B 1M90Q 2ZYAA 5B66E 1LJ2A 1Y47A 2O01H 2YIUB 1J1EC 1N8RQ 3Q5SA 2E75D 3L73E 3VTPC 2OTJP 1PZQA 3PHLA 2QJKB 5AW5B 1LNQA 1L4AC 4U7JA 1LP1A 3USSA 4GDOA 2WT7B 1VL2A 1YJ9P 4PD4H 1FZGA 1NYHA 1FZEA 4OGQB 1JY2P 4H13B 2R3SA 1NTMD 5GTIH 2WSCH 2G3AA 1FDIA 2CK3H 2H8PD 4L75A 3M0DC 2N9BA 1H0TB 5KLIC 3KHUA 3HTKB 3GG2A 4I7ZB 1NWQA 3KZIH 3SWKA 1SFCC 2OYIB 1LGHB 4DOJA 1VF5C 3FXDA 3RL0g 2AEJA 2YIUC 3UIAA 4TT3H 1VQ5P 3BVHA 1MFTA 1KFNA 3H1IE 3Q1MA 2Q5UA 3P8CD 2KP8A 4NPEA 3KQGA 2RH0A 2ZJSE 3CMEP 1EXIA 1AQ5A 3AE8C 2Q9IA 3M91A 3N4XA 2QEXP 1NTZJ 1PPJE 1N2DC 3M06A 1VQPP 1SQQK 2E42A 3EWKA 4OGQC 1M8OB 5KAIE 4H13C 1GTWA 5CBNA 4IFDK 4PD4D 1M57D 2E74D 5K5GB 1QGKB 5KLVK 1PP9E 2YKOA 3FWLA 1ZR2A 3MD0A 2N1TA 2WWWA 4I7ZC 2WMMA 2WQYC 3L75J 2P58A 2W6JH 2OYIC 4XFJA 3L71G 5KKZB 4DCKA 2QM8A 5CCGA 3CXHE 2ZAEB 3CWBG 1OVRA 1SQPJ 2KZJA 2E43A 1FOSF 3TDKA 1BGYE 3FX0A 1L0LE 1P84H 1EC5A 4OWFA 5L8RJ 2D2CD 1G1JA 4IFFA 4C46A 3CCSP 3L74E 2OYOA 3B71A 5KLVD 3CL3D 4UB6H 2FYUE 2IBZD 3O6QA 4HKZH 2A06E 2QIWA 2Z5IA 2K9JB 3PTZA 2Z5HA 1KFMA 1VPCA 3S4RA 1FU1A 2OYHA 2NPSA 2KB7P 1EDIA 1X79B 1PGPA 1RE3C 5AW0B 2HFED 3D71A 1BSHA 3V2QA 1EZVE 3CCRP 1E5WA 2KOGA 4JYBA 1OWAA 3GF3A 3AE2C 3EFGA 4CPGA 5BVZA 3JC22 2Y9YA 3RBZA 1NTKJ 2E76D 1BE3E 5AVYB 5H2FH 2OARA 3I55P 2P2UA 5AVUB 1JY2O 2Y0DA 4DJGA 3B5NB 1K04A 2R44A 3H1LJ 1P84D 4JBZA 2P1JA 1Q81Q 1GU4A 3NFQA 3SFDC 1ZW0A 1KB9I 1HBWA 4AYCA 2BEZF 4UB8E 3Q5RA 3II6A 3MHVA 2WSEJ 3TSIA 2FFDA 2YKQA 1FZCA 1QLED 2H7HA 1BCCG 2LXCB 3SFEC 1S5LH 1NTMJ 1Q86Q 2JEEA 1G2CA 1JB0J 4OH8B 1KC8Q 4AQRD 4ASVA 2WPQA 3E1IA 1NH4A 1LTSC 4N78E 3RK2D 1LWUB 3HUSB 1PFIA 3A2AA 4R4LA 1GK6A 2K37A 2JWAA 2IFMA 1HJBA 2G8YA 1YJNP 3B5NC 4N6JA 4Y99B 4I1LA 4BWNA 2V4HA 3HE4B 2O01J 2J58A 3HE5B 3Q3DA 1WMKA 2M3EA 3E7KA 4XE5B 1U7MA 1KILA 2A06D 3KYQA 1NTZG 1AA0A 1RQVA 4I2LC 4RO0A 3CMAP 4XA4A 2GM4A 3R4YA 1OIPA 3S9OA 2H88C 4LLHA 5AW7B 1BCCD 2XDJA 4ZNCA 1RF1C 3E1RA 5APXA 1HWTC 2N1TD 3L75G 4TLFA 2A45I 1LWUC 3HUSC 5AVSB 1J1DB 5APVA 3H1JE 3OJAB 1IK9A 5AVZB 5KJ7A 2QM7A 1KQGB 4LC1A 1SQPG 1GDTA 4H44C 5AVRB 1OW6A 2GA1A 4Y99C 1KB9H 1SVFA 1LTGC 2PAJA 2P7JA 1N7SB 2AEFA 1OMIA 3VP8A 3BASA 1SQQJ 3VMXA 3CCEP 3TK1A 4GIFA 1AQTA 2MKVA 5KLVJ 4HYTB 3MIWA 3H6PA 2QSIA 4HJGH 4N3YB 1LT9A 2WPRA 1NTZD 2H43A 1HTLC 1SQBE 3L70E 2NPSD 2NZ2A 1OFCX 2YKPA 2FYNB 3RL0D 3MTUE 4PJ0E 5AVQB 1Q82Q 2ZVNB 3PJSK 3H1HE 1GL2A 3QWOC 4YXWH 4PD4I 3HD7B 2ZT9D 2YO2A 2FY8A 4U3FG 1NTKG 2GUSA 2OTLP 4D6TE 2KLUA 2XZRA 1VQLP 4PV1D 3L4FA 1N7SC 3TNUA 1HVVA 1T6AA 1N73A 1KB9D 3JSVC 3MZWB 3PRJA 3VYIA 3H1LG 3W67A 5DJUB 1SLQA 1JY2N 3TGUD 1N86A 1FC2C 3U59A 4B86A 1SS1A 2WSEH 1RQUA 3G4SP 2NRGA 3RK3D 1L0NE 1RHZB 1RE4A 2A45G 1EDLA 3L72E 3FWNA 1NTMG 2A45H 3VN0A 5GTHH 2FYNC 3CC7P 1X22A 1PIXA 2AXTH 2IBZI 4R4MA 3CCLP 1JCDA 3L71E 2QRXA 2HPCB 2H89C 3HD7C 1HF9A 2AXCA 1ZOYC 1UIIA 3L73J 2OTKE 3CWBE 3I56P 1JM0A 1KQSO 3WU2E 1LTJC 4U3FD 4WBAA 3IFMA 3AE9C 1RH5B 4HH2A 1CI6A 2WSFH 4WVZA 1BDCA 2WVRA 2JKVA 2WSSH 3TF5A 3H1LD 1KILD 3CD6P 1LTAC 5TISH 1M1JA 2QE7H 3GHGB 5CCHA 2E74B 1YI2P 1GW3A 3RBXA 1P84I 1BCCJ 2I1JA 2HR3A 3CX5E 1SQXE 2C9NY 1YIJP 1UIXA 2B87A 3IAOA 5KAFE 3CCJP 1KYOH 3A0HE 5AW9B 1JY3O 3M9HA 2R5BA 4DT0A 3P7KA 1HGZA 3Q2YA 5APSA 1IC2A 1T2KD 4JPZB 5KJ7D 1H88A 1ZN5A 1URQA 2P10A 1NU1E 2O1KA 1LT1A 1MZ9A 2R3CA 2GUVA 4GOFA 2D2CB 1SQQG 1SP4A 3PP5A 3IN6A 2IFNA 2YNYA 3SWFA 5KLVG 1XTGB 2IBZG 2QJKC 2WTYA 5E79E 3CLQA 3R2PA 1SQBK 3GHGC 2BCCD 1H89A 3W68A 4IL6E 2ZVOB 1WRGA 2HLOA 1OXZA 2IZ0A 3B4SA 1KV4A 1JNMA 1T3JA 1YTZT 1KYOD 5B5EH 1S9KD 3H25A 2HODB 1GL2D 4C7NB 3M9QA 3H1KD 2IYPA 2E76B 1SQVE 2M5AA 3C1LA 3LIEA 3SWYA 2C0WA 3A7OA 3AEAC 2RKLA 1DX7A 3VMZA 3MP7B 1NJIQ 1RF1A 2D2CC 1AFOA 4ZMDA 1M1KQ 1AV1A 4GT1A 1VDFA 4MN4C 3JCUH 3TGUJ 1L0NK 1SQQD 1GMJA 2W8ZA 1LP1B 1RF0A 3BRTB 4HB1A 1FDOA 3V2PA 3H32A 4WWIA 2ZXEB 4GODA 1HGVA 1DEBA 4EI2A 3KDPB 3L75E 3L37A 4K35A 3RK2B 2O1JA 5KTBA 5B66H 2K9YA 1X9VA 2ZXXA 3L73G 2OQQA 1SQPE 2LKMA 5KKZC 2RMZA 5APQA 1PV3A 2Q6QA 4BRYA 5CMZA 2O3JA 1NHLA 1YQ4C 4U3FJ 5AW6B 1JOCA 1VQNP 1Z56A 2Z4EA 1JTHB 2J5UA 3EFFK 2KXPB 2FXPA 1IFPA 1X8YA 1OW7A 3T97A 2M3BA 1ZRTD 1VQMP 1QVGO 1SQXK 2POHA 1U7JA 4JQ0D 4W7ZA 5CCHD 1G1IA 3AE1C 1PGQA 2JWDA 2N1TB 4ASWA 3RK2C 2KNCA 1E79H 1NTKE 3MUDA 3C9IA 1S1CX 3V5BA 3D6ZA 1YITP 2E5YA 3BCCJ 1JY3N 1NU1K 2QJPB 2LXBA 3L73D 1VQOP 5CHXA 1GD2E 2KYVA 1PPJG 2R5DA 1URQD 1ZV8A 4WY4A 1FOSE 5KAIH 3CCVP 1PP9G 2W83C 4ZKPA 1CZQA 2WSFJ 1FAVA 2QJYB 3O6QB 5GTHE 4KJMA 1LTIC 2XNXA 2YMKA 1L2PA 2BCCJ 1NTME 1NKZB 3H1JJ 4JF7A 2OYHB 2ZFCA 2NPSB 1LTJA 3AE5C 3BATA 2N1TC 2V7QH 2IZ1A 3IR9A 3RL0B 3CXHH 4QMAA 1BDDA 2HG5D 3C8VA 3G9RA 1ZR4A 1W2EA 2W90A 1VQ7P 1YTZI 4NPFX 2XU6A 1SQVK 2ZT9B 2I1KA 5CCGC 3H1ID 2QJPC 2WZ7A 2VRSA 3H1KJ 3M9BA 3A0BH 3VMYA 5BU8B 4PV1B 2BASA 4Y28J 1H8AA 1NAYA 3P8CE 1L4AA 4RJTA 1L0LK 1X0TA 1PPJD 3L70J 1GW4A 2Q7CA 2KS1A 3A3YB 1QL2A 1FDMA 2QJYC 1JY3P 3TGUG 1OVVA 1PP9D 1CSBA 2FYUK 2FFDB 1FZCB 3M0DA 1A02F 3RK3B 4PD4E 4Z1MH 2OYHC 2NPSC 4A7PA 5GTIE 1JMBA 5AW3B 4AUWA 1KD1Q 1SFCA 3RL0C 4D6TJ 1QEXA 2W27A 1G2CB 4H44D 1S72P 2DW3A 3CXHD 2IX7C 3AECC 3KZIE 3CC4P 1BGYD 1J2JB 3LW5H 1J1DC 2ZYGA 1JUNA 1EXJA 3KPEA 1L0LD 2Y0CA 4PV1C 1Q90D 2K1AA 1DIPA 3L74D 4UB8H 1KYOI 4H0LD 1DD4A 2WT7A 2L91A 1L0NJ 2FYUD 2M8RA
chains in the Genus database with same CATH topology
1NTZG 1SQVG 1KB9H 1BCCG 4D6TG 3CX5H 3L73G 3H1KG 3L75G 3BCCG 1PP9G 3L74G 1SQQG 3H1LG 3TGUG 1NTMG 1NU1G 1P84H 3L71G 1BE3G 4PD4H 4U3FG 3CXHH 1NTKG 2FYUG 1EZVG 1L0NG 1BGYG 3H1HG 1PPJG 2A06G 2BCCG 5KLVG 2IBZG 1SQPG 1KYOH 3L72G 3CWBG 3H1JG 3L70G 3H1IG 1SQBG 1L0LG 1SQXG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NTZ G;  1SQV G;  1KB9 H;  1BCC G;  4D6T G;  3CX5 H;  3L73 G;  3H1K G;  3L75 G;  3BCC G;  1PP9 G;  3L74 G;  1SQQ G;  3H1L G;  3TGU G;  1NTM G;  1NU1 G;  1P84 H;  3L71 G;  1BE3 G;  4PD4 H;  4U3F G;  3CXH H;  1NTK G;  2FYU G;  1EZV G;  1L0N G;  1BGY G;  3H1H G;  1PPJ G;  2A06 G;  2BCC G;  5KLV G;  2IBZ G;  1SQP G;  1KYO H;  3L72 G;  3CWB G;  3H1J G;  3L70 G;  3H1I G;  1SQB G;  1L0L G;  1SQX G; 
#chains in the Genus database with same CATH topology
 1NO4 A;  2WPV B;  1MFZ A;  5KLV E;  2E75 B;  2IBZ E;  2C0X A;  1HH0 A;  2FFD C;  1KIL B;  1R5S A;  1H0T A;  1OVU A;  3HTK A;  3U1C A;  1Y9B A;  1EZV D;  4IFM A;  2IPP A;  2WPS A;  2OYI A;  3MGN A;  4L76 A;  1KQL A;  3WUV A;  5TJH A;  2IDB A;  5AW4 B;  1HJ0 A;  2KZI A;  1A02 J;  4W7Y A;  2ITA A;  1YJW P;  1USD A;  3NMD A;  2W6A A;  1BE3 D;  4EOT A;  1IK7 A;  2PGD A;  2RN0 A;  3VMA A;  2KI7 B;  3BCC G;  1JCC A;  3GW6 A;  2MJZ A;  2QA4 P;  1YHQ P;  5CJ4 A;  2JP3 A;  1P84 E;  2J59 M;  4WY4 D;  4GKG A;  2E75 C;  2JO1 A;  4IOI H;  2FXM A;  1KIL C;  1S5L X;  1RE3 A;  4UB6 E;  5KLI B;  3EQ2 A;  2YXR B;  3GMA A;  1IFI A;  3AE7 C;  3U1A A;  1RY3 A;  2BCC G;  1LTB C;  3H1J G;  1LT9 B;  4IL6 X;  4N78 D;  3OW2 O;  3AEE C;  1KMI Z;  3GF7 A;  1FZA A;  3VOP A;  1FZF A;  3D6Y A;  1FJK A;  2KUB A;  1NU1 J;  4I6M C;  1IZN B;  1U57 A;  1FJP A;  1GL2 B;  3WUU A;  1T2K C;  5KJ7 C;  3H1I J;  3H1K G;  5H2F E;  1VQK P;  3BCC D;  4NPD A;  1KN7 A;  1IJD B;  2K9J A;  3TNU B;  3AE3 C;  1L4A D;  2KSE A;  1N73 B;  1M56 D;  1SQB G;  1Y8A A;  3L70 G;  1IFN A;  2WIT A;  1Q7Y Q;  1NOH A;  1PP9 J;  1S5L E;  1BCC E;  4PJ0 H;  1LT9 C;  3H1H G;  5APY A;  3CX5 I;  2E74 C;  4D6T G;  3G71 P;  3FXE A;  1SQV J;  3H1J D;  1SFC D;  3CI9 A;  2QVA A;  5AVT B;  2V7Q J;  1VF5 D;  1JTH A;  4W80 A;  1K73 Q;  1GL2 C;  2YXQ B;  2ZYD A;  1K05 A;  3B5N A;  5AW8 B;  1BGY J;  1D7M A;  2B89 A;  1L0L J;  1IFM A;  3CCQ P;  1GZL A;  4RES B;  3L74 J;  1N73 C;  1L0N G;  2FKW B;  1CI6 B;  2FBW C;  1HUC A;  2FYU J;  1QL1 A;  3L72 G;  1YQ3 C;  1WT6 A;  4OGQ D;  1DD3 A;  4H13 D;  1W2B O;  4OVN F;  1SQB D;  3L70 D;  3LID A;  3Q5P A;  3PLN A;  1W5C E;  1NTZ E;  1RE4 C;  1JMM A;  1M1J B;  4EIJ A;  1LWU A;  3F5H A;  3HUS A;  1NKN A;  3H1H D;  5CBO A;  3M0A A;  3ABV C;  2XKM A;  2B87 B;  3WU2 H;  3QH9 A;  2O01 N;  4D6T D;  4KT0 J;  2K88 A;  3A0B E;  3RGU A;  1BE3 J;  3HE4 A;  3D70 A;  2KLV A;  3HE5 A;  2R32 A;  3LW5 J;  1PL5 A;  4O9B A;  3ITK A;  5APT A;  2E76 C;  1KB9 E;  1NVO A;  3CXH I;  1URQ B;  2KSJ A;  1TU3 F;  2C9L Y;  2YMY A;  4DZO A;  3TGU E;  2KIK A;  1L0N D;  1SQX G;  2JJL A;  2BEQ D;  3CX5 H;  3FGA D;  1FS0 E;  3L72 D;  5AW1 B;  3RK3 E;  1ZP0 C;  2W6B A;  4YTP C;  4RKU J;  5KAF H;  1M1J C;  3A0H H;  5CCH C;  1CW5 A;  5AVX B;  3NTN A;  3L71 D;  3P32 A;  2E5T A;  1IFD A;  1AVO A;  3G6E P;  5AW2 B;  1T3U A;  3CWB D;  3V4W A;  4LGD E;  1NU1 G;  1VQ6 P;  1EZV I;  1N7S A;  2SPZ A;  5APW A;  3VP9 A;  2B88 A;  1XTC C;  1EQ7 A;  2Q3I A;  4KHX A;  2CPB A;  1S2E A;  3H1I G;  3N7N A;  4U3F E;  1PGO A;  2M5A B;  1URQ C;  1Q2N A;  1R8E A;  5E79 H;  1MKM A;  1GK4 A;  2JR8 A;  1RF1 B;  3TYY A;  2IYO A;  4IL6 H;  3H1L E;  1GU5 A;  1KIL E;  1JEK A;  2QG4 A;  1S4X A;  3OAK A;  3A5T A;  3CX5 D;  2PRR A;  1SQX D;  3NXS A;  3L36 A;  1KZU B;  3AE4 C;  3HD7 A;  1PGJ A;  4WB4 A;  1R5L A;  3H32 B;  1M7L A;  1SQV G;  2AXT E;  4H44 B;  5DJT B;  1JO5 A;  1USE A;  3F89 A;  3V4Q A;  1NAF A;  1S3J A;  3CCM P;  2PP6 A;  3BCC E;  1BGY G;  3SSU A;  3B5N D;  1NU1 D;  5AVW B;  1K8A Q;  1L0L G;  4YPC A;  1ZLL A;  2L5G B;  2LR2 A;  4BRY B;  3V2N A;  1EDJ A;  4GOE A;  5BU5 A;  1VQ9 P;  4H0L B;  3L74 G;  2FXO A;  3AEF C;  1IO4 A;  2FYU G;  1MV8 A;  1QX8 A;  3G3Z A;  2A06 G;  2WSC J;  4EDF A;  1ZXG A;  2P67 A;  1NTZ K;  3HRN A;  5M1B A;  1SQB J;  3OA7 A;  2BCC E;  3T97 B;  3WMM 0;  1RF0 C;  5TIS E;  2KK7 A;  2HPC A;  1ZME C;  1EZV G;  3CCU P;  5CCG D;  3H1H J;  1KYO E;  1KQF B;  3IF4 A;  1YBK A;  2YO3 A;  1S9K E;  2KNC B;  1SQV D;  2JDI H;  5CJ0 A;  1BE3 G;  1LTT C;  3H1K E;  3L35 A;  5APU A;  1SQP K;  2Y9Z A;  2ZT9 C;  1KOR A;  4H0L C;  4L74 A;  2K3R A;  3WUT A;  1IFJ A;  4WY4 B;  3P8M C;  2N9Y B;  3GHG A;  1QVF O;  1MUU A;  1SQQ E;  1AVY A;  1NGM B;  3KXD A;  1FBM A;  3L72 J;  5EFW B;  1K9M Q;  2OGU A;  1FZC C;  1DH3 A;  3L75 D;  3AED C;  2I8D A;  3RK3 C;  3L71 J;  2XND H;  5AVV B;  1LTJ B;  1EDK A;  3GLM A;  3V6I A;  2Q1K A;  1DEE G;  3CWB J;  1SQP D;  1BSN A;  4JYC A;  1FZB A;  2CPS A;  1VQ4 P;  1N7L A;  2B9B A;  4EYY Q;  5B5E E;  1FE6 A;  3MUD C;  1NTK K;  1N7S D;  2Q3E A;  1J1E B;  2HYN A;  1OX3 A;  3I5C A;  2UWJ E;  1OZH A;  3B8E B;  4M3L A;  1KTM A;  4WY4 C;  3ZDM A;  1L4A B;  1YYC A;  1T8Z A;  5C39 A;  3AEG C;  3AE6 C;  3CC2 P;  4K3A A;  3BRV B;  4YXD C;  3JCU E;  4ZKU A;  2KS1 B;  1OW8 A;  1ZRT E;  2M0B A;  2PFX A;  1SQX J;  3AEB C;  3K5B A;  4BXL A;  2XV5 A;  1NTM K;  4C7R A;  2HOD A;  3V2R A;  4C7N A;  1VQ8 P;  3HD7 D;  2Y0E A;  2AEM A;  2FYZ A;  1NTK D;  4L73 A;  1SFC B;  3O8Z A;  3PH0 A;  1AJY A;  3CPW O;  3S1K A;  1VF5 B;  1M90 Q;  2ZYA A;  5B66 E;  1LJ2 A;  1Y47 A;  2O01 H;  2YIU B;  1J1E C;  1N8R Q;  3Q5S A;  2E75 D;  3L73 E;  3VTP C;  2OTJ P;  1PZQ A;  3PHL A;  2QJK B;  5AW5 B;  1LNQ A;  1L4A C;  4U7J A;  1LP1 A;  3USS A;  4GDO A;  2WT7 B;  1VL2 A;  1YJ9 P;  4PD4 H;  1FZG A;  1NYH A;  1FZE A;  4OGQ B;  1JY2 P;  4H13 B;  2R3S A;  1NTM D;  5GTI H;  2WSC H;  2G3A A;  1FDI A;  2CK3 H;  2H8P D;  4L75 A;  3M0D C;  2N9B A;  1H0T B;  5KLI C;  3KHU A;  3HTK B;  3GG2 A;  4I7Z B;  1NWQ A;  3KZI H;  3SWK A;  1SFC C;  2OYI B;  1LGH B;  4DOJ A;  1VF5 C;  3FXD A;  3RL0 g;  2AEJ A;  2YIU C;  3UIA A;  4TT3 H;  1VQ5 P;  3BVH A;  1MFT A;  1KFN A;  3H1I E;  3Q1M A;  2Q5U A;  3P8C D;  2KP8 A;  4NPE A;  3KQG A;  2RH0 A;  2ZJS E;  3CME P;  1EXI A;  1AQ5 A;  3AE8 C;  2Q9I A;  3M91 A;  3N4X A;  2QEX P;  1NTZ J;  1PPJ E;  1N2D C;  3M06 A;  1VQP P;  1SQQ K;  2E42 A;  3EWK A;  4OGQ C;  1M8O B;  5KAI E;  4H13 C;  1GTW A;  5CBN A;  4IFD K;  4PD4 D;  1M57 D;  2E74 D;  5K5G B;  1QGK B;  5KLV K;  1PP9 E;  2YKO A;  3FWL A;  1ZR2 A;  3MD0 A;  2N1T A;  2WWW A;  4I7Z C;  2WMM A;  2WQY C;  3L75 J;  2P58 A;  2W6J H;  2OYI C;  4XFJ A;  3L71 G;  5KKZ B;  4DCK A;  2QM8 A;  5CCG A;  3CXH E;  2ZAE B;  3CWB G;  1OVR A;  1SQP J;  2KZJ A;  2E43 A;  1FOS F;  3TDK A;  1BGY E;  3FX0 A;  1L0L E;  1P84 H;  1EC5 A;  4OWF A;  5L8R J;  2D2C D;  1G1J A;  4IFF A;  4C46 A;  3CCS P;  3L74 E;  2OYO A;  3B71 A;  5KLV D;  3CL3 D;  4UB6 H;  2FYU E;  2IBZ D;  3O6Q A;  4HKZ H;  2A06 E;  2QIW A;  2Z5I A;  2K9J B;  3PTZ A;  2Z5H A;  1KFM A;  1VPC A;  3S4R A;  1FU1 A;  2OYH A;  2NPS A;  2KB7 P;  1EDI A;  1X79 B;  1PGP A;  1RE3 C;  5AW0 B;  2HFE D;  3D71 A;  1BSH A;  3V2Q A;  1EZV E;  3CCR P;  1E5W A;  2KOG A;  4JYB A;  1OWA A;  3GF3 A;  3AE2 C;  3EFG A;  4CPG A;  5BVZ A;  3JC2 2;  2Y9Y A;  3RBZ A;  1NTK J;  2E76 D;  1BE3 E;  5AVY B;  5H2F H;  2OAR A;  3I55 P;  2P2U A;  5AVU B;  1JY2 O;  2Y0D A;  4DJG A;  3B5N B;  1K04 A;  2R44 A;  3H1L J;  1P84 D;  4JBZ A;  2P1J A;  1Q81 Q;  1GU4 A;  3NFQ A;  3SFD C;  1ZW0 A;  1KB9 I;  1HBW A;  4AYC A;  2BEZ F;  4UB8 E;  3Q5R A;  3II6 A;  3MHV A;  2WSE J;  3TSI A;  2FFD A;  2YKQ A;  1FZC A;  1QLE D;  2H7H A;  1BCC G;  2LXC B;  3SFE C;  1S5L H;  1NTM J;  1Q86 Q;  2JEE A;  1G2C A;  1JB0 J;  4OH8 B;  1KC8 Q;  4AQR D;  4ASV A;  2WPQ A;  3E1I A;  1NH4 A;  1LTS C;  4N78 E;  3RK2 D;  1LWU B;  3HUS B;  1PFI A;  3A2A A;  4R4L A;  1GK6 A;  2K37 A;  2JWA A;  2IFM A;  1HJB A;  2G8Y A;  1YJN P;  3B5N C;  4N6J A;  4Y99 B;  4I1L A;  4BWN A;  2V4H A;  3HE4 B;  2O01 J;  2J58 A;  3HE5 B;  3Q3D A;  1WMK A;  2M3E A;  3E7K A;  4XE5 B;  1U7M A;  1KIL A;  2A06 D;  3KYQ A;  1NTZ G;  1AA0 A;  1RQV A;  4I2L C;  4RO0 A;  3CMA P;  4XA4 A;  2GM4 A;  3R4Y A;  1OIP A;  3S9O A;  2H88 C;  4LLH A;  5AW7 B;  1BCC D;  2XDJ A;  4ZNC A;  1RF1 C;  3E1R A;  5APX A;  1HWT C;  2N1T D;  3L75 G;  4TLF A;  2A45 I;  1LWU C;  3HUS C;  5AVS B;  1J1D B;  5APV A;  3H1J E;  3OJA B;  1IK9 A;  5AVZ B;  5KJ7 A;  2QM7 A;  1KQG B;  4LC1 A;  1SQP G;  1GDT A;  4H44 C;  5AVR B;  1OW6 A;  2GA1 A;  4Y99 C;  1KB9 H;  1SVF A;  1LTG C;  2PAJ A;  2P7J A;  1N7S B;  2AEF A;  1OMI A;  3VP8 A;  3BAS A;  1SQQ J;  3VMX A;  3CCE P;  3TK1 A;  4GIF A;  1AQT A;  2MKV A;  5KLV J;  4HYT B;  3MIW A;  3H6P A;  2QSI A;  4HJG H;  4N3Y B;  1LT9 A;  2WPR A;  1NTZ D;  2H43 A;  1HTL C;  1SQB E;  3L70 E;  2NPS D;  2NZ2 A;  1OFC X;  2YKP A;  2FYN B;  3RL0 D;  3MTU E;  4PJ0 E;  5AVQ B;  1Q82 Q;  2ZVN B;  3PJS K;  3H1H E;  1GL2 A;  3QWO C;  4YXW H;  4PD4 I;  3HD7 B;  2ZT9 D;  2YO2 A;  2FY8 A;  4U3F G;  1NTK G;  2GUS A;  2OTL P;  4D6T E;  2KLU A;  2XZR A;  1VQL P;  4PV1 D;  3L4F A;  1N7S C;  3TNU A;  1HVV A;  1T6A A;  1N73 A;  1KB9 D;  3JSV C;  3MZW B;  3PRJ A;  3VYI A;  3H1L G;  3W67 A;  5DJU B;  1SLQ A;  1JY2 N;  3TGU D;  1N86 A;  1FC2 C;  3U59 A;  4B86 A;  1SS1 A;  2WSE H;  1RQU A;  3G4S P;  2NRG A;  3RK3 D;  1L0N E;  1RHZ B;  1RE4 A;  2A45 G;  1EDL A;  3L72 E;  3FWN A;  1NTM G;  2A45 H;  3VN0 A;  5GTH H;  2FYN C;  3CC7 P;  1X22 A;  1PIX A;  2AXT H;  2IBZ I;  4R4M A;  3CCL P;  1JCD A;  3L71 E;  2QRX A;  2HPC B;  2H89 C;  3HD7 C;  1HF9 A;  2AXC A;  1ZOY C;  1UII A;  3L73 J;  2OTK E;  3CWB E;  3I56 P;  1JM0 A;  1KQS O;  3WU2 E;  1LTJ C;  4U3F D;  4WBA A;  3IFM A;  3AE9 C;  1RH5 B;  4HH2 A;  1CI6 A;  2WSF H;  4WVZ A;  1BDC A;  2WVR A;  2JKV A;  2WSS H;  3TF5 A;  3H1L D;  1KIL D;  3CD6 P;  1LTA C;  5TIS H;  1M1J A;  2QE7 H;  3GHG B;  5CCH A;  2E74 B;  1YI2 P;  1GW3 A;  3RBX A;  1P84 I;  1BCC J;  2I1J A;  2HR3 A;  3CX5 E;  1SQX E;  2C9N Y;  1YIJ P;  1UIX A;  2B87 A;  3IAO A;  5KAF E;  3CCJ P;  1KYO H;  3A0H E;  5AW9 B;  1JY3 O;  3M9H A;  2R5B A;  4DT0 A;  3P7K A;  1HGZ A;  3Q2Y A;  5APS A;  1IC2 A;  1T2K D;  4JPZ B;  5KJ7 D;  1H88 A;  1ZN5 A;  1URQ A;  2P10 A;  1NU1 E;  2O1K A;  1LT1 A;  1MZ9 A;  2R3C A;  2GUV A;  4GOF A;  2D2C B;  1SQQ G;  1SP4 A;  3PP5 A;  3IN6 A;  2IFN A;  2YNY A;  3SWF A;  5KLV G;  1XTG B;  2IBZ G;  2QJK C;  2WTY A;  5E79 E;  3CLQ A;  3R2P A;  1SQB K;  3GHG C;  2BCC D;  1H89 A;  3W68 A;  4IL6 E;  2ZVO B;  1WRG A;  2HLO A;  1OXZ A;  2IZ0 A;  3B4S A;  1KV4 A;  1JNM A;  1T3J A;  1YTZ T;  1KYO D;  5B5E H;  1S9K D;  3H25 A;  2HOD B;  1GL2 D;  4C7N B;  3M9Q A;  3H1K D;  2IYP A;  2E76 B;  1SQV E;  2M5A A;  3C1L A;  3LIE A;  3SWY A;  2C0W A;  3A7O A;  3AEA C;  2RKL A;  1DX7 A;  3VMZ A;  3MP7 B;  1NJI Q;  1RF1 A;  2D2C C;  1AFO A;  4ZMD A;  1M1K Q;  1AV1 A;  4GT1 A;  1VDF A;  4MN4 C;  3JCU H;  3TGU J;  1L0N K;  1SQQ D;  1GMJ A;  2W8Z A;  1LP1 B;  1RF0 A;  3BRT B;  4HB1 A;  1FDO A;  3V2P A;  3H32 A;  4WWI A;  2ZXE B;  4GOD A;  1HGV A;  1DEB A;  4EI2 A;  3KDP B;  3L75 E;  3L37 A;  4K35 A;  3RK2 B;  2O1J A;  5KTB A;  5B66 H;  2K9Y A;  1X9V A;  2ZXX A;  3L73 G;  2OQQ A;  1SQP E;  2LKM A;  5KKZ C;  2RMZ A;  5APQ A;  1PV3 A;  2Q6Q A;  4BRY A;  5CMZ A;  2O3J A;  1NHL A;  1YQ4 C;  4U3F J;  5AW6 B;  1JOC A;  1VQN P;  1Z56 A;  2Z4E A;  1JTH B;  2J5U A;  3EFF K;  2KXP B;  2FXP A;  1IFP A;  1X8Y A;  1OW7 A;  3T97 A;  2M3B A;  1ZRT D;  1VQM P;  1QVG O;  1SQX K;  2POH A;  1U7J A;  4JQ0 D;  4W7Z A;  5CCH D;  1G1I A;  3AE1 C;  1PGQ A;  2JWD A;  2N1T B;  4ASW A;  3RK2 C;  2KNC A;  1E79 H;  1NTK E;  3MUD A;  3C9I A;  1S1C X;  3V5B A;  3D6Z A;  1YIT P;  2E5Y A;  3BCC J;  1JY3 N;  1NU1 K;  2QJP B;  2LXB A;  3L73 D;  1VQO P;  5CHX A;  1GD2 E;  2KYV A;  1PPJ G;  2R5D A;  1URQ D;  1ZV8 A;  4WY4 A;  1FOS E;  5KAI H;  3CCV P;  1PP9 G;  2W83 C;  4ZKP A;  1CZQ A;  2WSF J;  1FAV A;  2QJY B;  3O6Q B;  5GTH E;  4KJM A;  1LTI C;  2XNX A;  2YMK A;  1L2P A;  2BCC J;  1NTM E;  1NKZ B;  3H1J J;  4JF7 A;  2OYH B;  2ZFC A;  2NPS B;  1LTJ A;  3AE5 C;  3BAT A;  2N1T C;  2V7Q H;  2IZ1 A;  3IR9 A;  3RL0 B;  3CXH H;  4QMA A;  1BDD A;  2HG5 D;  3C8V A;  3G9R A;  1ZR4 A;  1W2E A;  2W90 A;  1VQ7 P;  1YTZ I;  4NPF X;  2XU6 A;  1SQV K;  2ZT9 B;  2I1K A;  5CCG C;  3H1I D;  2QJP C;  2WZ7 A;  2VRS A;  3H1K J;  3M9B A;  3A0B H;  3VMY A;  5BU8 B;  4PV1 B;  2BAS A;  4Y28 J;  1H8A A;  1NAY A;  3P8C E;  1L4A A;  4RJT A;  1L0L K;  1X0T A;  1PPJ D;  3L70 J;  1GW4 A;  2Q7C A;  2KS1 A;  3A3Y B;  1QL2 A;  1FDM A;  2QJY C;  1JY3 P;  3TGU G;  1OVV A;  1PP9 D;  1CSB A;  2FYU K;  2FFD B;  1FZC B;  3M0D A;  1A02 F;  3RK3 B;  4PD4 E;  4Z1M H;  2OYH C;  2NPS C;  4A7P A;  5GTI E;  1JMB A;  5AW3 B;  4AUW A;  1KD1 Q;  1SFC A;  3RL0 C;  4D6T J;  1QEX A;  2W27 A;  1G2C B;  4H44 D;  1S72 P;  2DW3 A;  3CXH D;  2IX7 C;  3AEC C;  3KZI E;  3CC4 P;  1BGY D;  1J2J B;  3LW5 H;  1J1D C;  2ZYG A;  1JUN A;  1EXJ A;  3KPE A;  1L0L D;  2Y0C A;  4PV1 C;  1Q90 D;  2K1A A;  1DIP A;  3L74 D;  4UB8 H;  1KYO I;  4H0L D;  1DD4 A;  2WT7 A;  2L91 A;  1L0N J;  2FYU D;  2M8R A; 
#chains in the Genus database with same CATH homology
 1NTZ G;  1SQV G;  1KB9 H;  1BCC G;  4D6T G;  3CX5 H;  3L73 G;  3H1K G;  3L75 G;  3BCC G;  1PP9 G;  3L74 G;  1SQQ G;  3H1L G;  3TGU G;  1NTM G;  1NU1 G;  1P84 H;  3L71 G;  1BE3 G;  4PD4 H;  4U3F G;  3CXH H;  1NTK G;  2FYU G;  1EZV G;  1L0N G;  1BGY G;  3H1H G;  1PPJ G;  2A06 G;  2BCC G;  5KLV G;  2IBZ G;  1SQP G;  1KYO H;  3L72 G;  3CWB G;  3H1J G;  3L70 G;  3H1I G;  1SQB G;  1L0L G;  1SQX G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...