1BCCG

Cytochrome bc1 complex from chicken
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
78
structure length
78
Chain Sequence
RQFGHLTRVRHLITYSLSPFEQRPFPHYFSKGVPNVWRRLRACILRVAPPFLAFYLLYTWGTQEFEKSKRKNPAAYVN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Electron transfer by domain movement in cytochrome bc1.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords UBIQUINOL CYTOCHROME C OXIDOREDUCTASE
total genus 13
structure length 78
sequence length 78
ec nomenclature
pdb deposition date 1998-03-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1bccG00
2A06G 1P84H 2FYUG 3H1HG 3H1LG 3H1IG 3L74G 3BCCG 1PP9G 3L73G 5KLVG 1NU1G 3CWBG 1EZVG 1KYOH 3CXHH 1PPJG 3L70G 2IBZG 3CX5H 1BGYG 3L75G 1BCCG 2BCCG 4PD4H 1NTMG 1BE3G 1L0NG 1SQXG 1SQVG 1L0LG 4D6TG 1KB9H 3L71G 1NTZG 3H1JG 3H1KG 1NTKG 1SQBG 3TGUG 3L72G 4U3FG 1SQQG 1SQPG
chains in the Genus database with same CATH superfamily
1ZP0C 5AVZB 2CPSA 2C9NY 1EDKA 1M57D 1LTGC 1JEKA 3IFMA 1N7LA 1SQBK 4R4LA 4U3FD 1YI2P 1Q81Q 2WSFJ 4EIJA 5APQA 5GTHH 3BCCJ 1NU1J 2B9BA 2YXQB 1IO4A 1YTZT 3L37A 3BASA 1PPJG 4R4MA 1JY3N 1S2EA 3SSUA 3L72D 3BRVB 3USSA 2E5TA 2G3AA 3H1LD 2N1TA 4DOJA 2YO3A 4H0LC 2Z5HA 4WBAA 3D71A 1ZR4A 3CL3D 1SQVD 4PJ0E 2B87B 1NTKK 2FYZA 3O8ZA 1L4AB 5CJ0A 2HODB 3RK3D 3TGUE 1H88A 3I55P 1J1DB 3L73D 3AE7C 1ZLLA 2KB7P 1HTLC 1PV3A 1SQQK 2E76C 2Y9YA 3H1JG 4W7ZA 1RF1A 5GTIE 2HYNA 3WUVA 5B66E 2MKVA 3EQ2A 1SQVK 3FGAD 4L75A 4LLHA 1SQPE 3KHUA 4QMAA 3TYYA 1SQPG 1MUUA 2FYUJ 3M0AA 4WWIA 4GOEA 3Q5RA 3P8CE 1IK9A 1VQOP 2FXPA 3VN0A 4I1LA 3VTPC 5KLVJ 2AXTH 2W27A 2HG5D 1AVYA 2JR8A 2XV5A 2ZYAA 1RF0C 5AVQB 2HPCA 3N4XA 1L0LJ 1BGYG 1GK6A 1BCCG 1SQBJ 3H1IE 3H32A 2C0WA 3KZIH 3M9BA 2QA4P 2QM7A 1HJBA 4WVZA 1YIJP 2JWDA 1NU1K 5AVVB 1HVVA 1X9VA 3AE8C 3H1KE 3CC7P 1CI6A 1DEBA 1YQ3C 2XDJA 1KC8Q 5TISE 3HD7A 1FOSF 3HE4A 1NTMD 4NPDA 4DT0A 1VF5B 3OA7A 4H13B 1SLQA 5H2FE 1X79B 4DZOA 3TF5A 1YJ9P 1S3JA 3CX5E 3PTZA 2P1JA 3EFGA 2P2UA 3PP5A 2LXBA 3RK3C 2JDIH 1AQTA 1S5LX 3I56P 1NTMJ 1A02F 4U3FE 4WY4B 1OW8A 1H0TB 1FZCC 4A7PA 3H25A 1KILE 1EZVD 2KNCB 2ZJSE 1BGYE 3H1IG 1N86A 2YMKA 3L71E 3Q1MA 1NWQA 1HH0A 4ASVA 2K37A 3B5NA 2LXCB 1OX3A 2KI7B 3L70G 1AV1A 1USEA 1FS0E 3TSIA 4PV1C 1NHLA 3HRNA 2YXRB 5CCGC 1RF1C 3E7KA 4HKZH 3TK1A 1IFJA 3C1LA 2FYUD 3B5NB 1QL2A 2XNXA 2IPPA 2KLUA 3LIEA 5TJHA 3H1JE 4IL6E 4H13D 1ZMEC 1H89A 3CC4P 2KNCA 2FYNB 1RQVA 2O1JA 3HD7C 2A45H 4PD4D 1KB9I 3MHVA 4XA4A 1KYOI 4WY4A 3RK3B 1FZAA 5KAFE 2JO1A 1R5LA 2JJLA 2YMYA 1FBMA 4UB6H 3TGUG 2OQQA 3V2PA 1FC2C 3WU2H 1S4XA 1OMIA 2W6JH 3GF7A 3ITKA 4AYCA 1GU4A 1BCCE 1AFOA 4KHXA 1K04A 2QJYB 3GHGC 1NVOA 1S5LE 1MZ9A 1NO4A 2KZJA 2IYOA 2PFXA 3H1LJ 3L36A 4GDOA 2HFED 2W8ZA 3A0HH 5APTA 5AW5B 1YHQP 1CI6B 1HGVA 3CXHI 4JF7A 3CCMP 3VMYA 1NTKD 1L0NE 4OVNF 1LWUC 1R8EA 2NPSB 3Q2YA 5AVWB 4OGQC 1G2CB 2HLOA 1BE3E 1VPCA 2AEJA 2M3BA 1LTBC 2OGUA 2YNYA 1JY3O 1Q2NA 1SQBE 2E75D 2QJPB 3AE2C 4GT1A 2QJYC 1T3UA 3GHGB 4HJGH 1QVGO 2RN0A 2YIUC 1BDCA 3L71G 5DJUB 1JTHB 1Q90D 2IFNA 2Q1KA 4C46A 3L75J 2XNDH 3LW5J 2C0XA 5CJ4A 2QEXP 3KZIE 2B88A 3MP7B 4U3FG 3SFDC 3H1HE 3IF4A 3U59A 1JTHA 2WSEH 3UIAA 5KJ7A 2Y9ZA 1M1JA 1Y47A 2IYPA 1GTWA 1U7MA 3BCCD 1QX8A 2P58A 3E1IA 5B5EH 1SFCC 3PHLA 3A3YB 2B87A 3VP9A 3GW6A 3GMAA 1PP9E 1AJYA 4Y99C 5AW0B 5KJ7C 4WY4D 1M7LA 2XKMA 2Y0DA 3A2AA 1IFPA 3H1ID 1S72P 2Q9IA 3PLNA 3PRJA 2OYHC 2OYOA 3FWLA 2QJPC 1LT9A 3R4YA 5CBNA 4W80A 2KSJA 1PP9J 2YKPA 3Q3DA 3M06A 1FDOA 2BEZF 4MN4C 2IZ1A 1VQLP 1YJNP 1G1IA 2GA1A 2L91A 3H1JJ 1SQPD 2GUSA 2WPSA 3L73E 1NU1D 2G8YA 2R32A 2YKQA 4W7YA 5KLVD 4BXLA 1L0LK 3Q5PA 1CZQA 1RHZB 4JYBA 5AW9B 1VQ4P 4RJTA 3KPEA 2V4HA 2QVAA 2E43A 2GM4A 2N9YB 5AVSB 4C7NA 3G6EP 1VQNP 3CCEP 1VQKP 1EZVE 3Q5SA 2UWJE 4PJ0H 2SPZA 4LGDE 3TNUB 1DEEG 1OXZA 1OW7A 5CCHA 3RL0g 1TU3F 4UB6E 4BWNA 2PAJA 2I1KA 1NTMG 3M91A 3VMXA 3RGUA 2JWAA 3G71P 1NYHA 3PH0A 5AVUB 5KAIE 2JEEA 1HGZA 3D70A 4ZKPA 5GTHE 1GD2E 1J1EB 1NKZB 3HTKB 4ZNCA 3H6PA 3JCUE 4H0LD 1OFCX 2D2CC 1NTZG 4PV1B 3MUDA 3V2NA 2WQYC 1VQMP 3AEDC 5C39A 5CMZA 3ABVC 4LC1A 1MFTA 1VQ9P 1IZNB 3CI9A 2FXMA 2AXCA 4WB4A 2B89A 5APXA 4L73A 5CCGA 1PGQA 3MTUE 4JBZA 4EOTA 3LW5H 4TT3H 2E74C 5APVA 5AW8B 2WSEJ 1T8ZA 3B5NC 3V5BA 4C7RA 2XZRA 3CWBG 1LT9C 4JQ0D 2OTLP 1Q7YQ 5KLVE 2NRGA 2O1KA 2R44A 1VQPP 2WSCH 2ZVOB 3P32A 2OYIB 1BCCJ 2W6AA 3T97B 2IBZD 3AE1C 1GL2A 1FDIA 1LJ2A 1EC5A 1MKMA 1M1JC 1UIXA 1RE3C 2KLVA 1P84I 3AE5C 3SWKA 2HPCB 1JY3P 1SQQD 2OARA 1L0LE 1SQXG 4OH8B 4PD4E 3SWYA 4ZKUA 3R2PA 1N73B 3TGUD 1FZEA 5CCGD 2H7HA 1GK4A 3H1JD 3AEBC 2BCCJ 3RL0D 1T2KC 1BGYJ 3H1KG 4AUWA 2QRXA 2K1AA 3ZDMA 2R5BA 2NPSC 1K73Q 1Z56A 1N73A 1L0NK 3HE5B 1JNMA 1JCDA 1EDLA 2E76D 3SFEC 2E74B 1KB9E 1EQ7A 1GL2B 2D2CD 3H1HD 4NPEA 3L74J 1AA0A 2WSSH 2YKOA 1NU1G 3MUDC 3P8CD 4PD4I 2WT7B 1K8AQ 1JY2P 2RH0A 2M5AB 1JCCA 1L0ND 2Q3EA 4Z1MH 2J59M 1NH4A 1EXIA 3V2QA 2QJKB 2PP6A 4PD4H 3B5ND 1IC2A 1T6AA 3MGNA 2WMMA 3CCQP 1J1DC 2CK3H 3GG2A 2BASA 1X0TA 3VMAA 5L8RJ 1M1KQ 2IBZE 3L73J 5BU5A 4N78E 1BSNA 3KXDA 4O9BA 3VMZA 4H44B 3CWBJ 5AW2B 1L0LD 1L4AD 1N7SD 2DW3A 3RK2D 2PRRA 4HH2A 1KQFB 1X22A 2KOGA 2Q7CA 3EFFK 2N1TC 3SWFA 5KKZC 1P84H 3CCLP 2WITA 3HD7D 3A0BE 3O6QB 2BEQD 2W6BA 3L73G 1YBKA 4H0LB 1MFZA 1VL2A 1FZCB 1HWTC 5K5GB 1VQ5P 1R5SA 2Z5IA 1KORA 1N73C 4GIFA 1T3JA 3V6IA 1FOSE 3KYQA 2A06E 3O6QA 4JPZB 1FE6A 1GDTA 5M1BA 2ZT9C 3B71A 3CWBD 3L75E 3W68A 1KFNA 1PIXA 3HUSB 3NXSA 3OJAB 3L35A 3WU2E 3L70J 3V4QA 1ZW0A 4M3LA 1N2DC 2I1JA 1IK7A 2KYVA 3CC2P 1VQ6P 3VP8A 1LP1B 1PPJD 1Q86Q 3L72G 2Y0EA 1Q82Q 5B5EE 3A7OA 4AQRD 1Y9BA 3AEEC 1KILD 1PL5A 1LT9B 1SQQG 5AVRB 2WWWA 3AEGC 1A02J 1FJKA 5DJTB 3L4FA 3AECC 1YYCA 3HUSC 1PP9D 3FWNA 1LTSC 4YXWH 1GW4A 2N1TD 2PGDA 1H0TA 1KZUB 3NMDA 1QL1A 3L74E 1GZLA 3L75G 4I6MC 4YTPC 2WT7A 3FXEA 2FYUE 3NFQA 1QLED 3AE6C 3L72J 1LNQA 1U7JA 4RESB 3WUTA 2C9LY 1NTKE 2BCCD 1K9MQ 1NJIQ 4UB8E 1BDDA 1AQ5A 1L0NG 1SS1A 1ZXGA 3HE5A 1BE3D 1ZR2A 1DH3A 1LWUB 1JY2N 1QVFO 1PGPA 3CX5I 4D6TG 1M90Q 3AE9C 3L71J 3TDKA 4CPGA 1BCCD 1YTZI 2K9YA 1BE3J 2QG4A 3GHGA 5AW7B 1FZGA 2ZAEB 3U1AA 1VQ8P 4BRYB 1AVOA 1SFCD 3U1CA 1KQSO 1BSHA 2FYUG 1HF9A 1G2CA 1FDMA 2YO2A 2R3SA 3L74G 1EZVI 2NPSA 3T97A 2OYIA 1PFIA 1KN7A 2WVRA 3I5CA 2FXOA 3BCCE 3RL0B 4DCKA 2K9JA 1URQB 3V2RA 4EI2A 2MJZA 3H1LE 3BVHA 2IBZG 4Y99B 1DD3A 2CPBA 1ZOYC 2J58A 2WPVB 1KQLA 3H1KJ 1ZRTD 3A0BH 1FAVA 4GODA 4K3AA 4KT0J 2YIUB 1RE3A 1SQQE 1GL2C 2A45I 3IAOA 2KSEA 1L0NJ 1LTJC 1LT1A 1KQGB 1OVUA 2K9JB 1N7SC 2KIKA 2N9BA 2R5DA 2W83C 3S9OA 1SQPK 3BRTB 2K3RA 3WMM0 3H1KD 1RF1B 3C8VA 5B66H 4N78D 2ZVNB 3KDPB 1L2PA 1URQC 1M8OB 3L70D 4IOIH 1NTKG 1X8YA 2KZIA 1W2BO 3CMEP 1PZQA 2WPRA 1VDFA 3HTKA 2QJKC 1RH5B 3N7NA 2D2CB 1LTAC 3AEFC 3B4SA 2A06G 1SFCB 2H89C 1IJDB 1OWAA 2WZ7A 4IFMA 2AEMA 4IFDK 1JO5A 1USDA 4HB1A 1LWUA 4XE5B 1PGJA 2ITAA 1OW6A 1S9KE 3RBZA 4B86A 1FJPA 3L71D 1E5WA 1NAYA 3CXHH 1N8RQ 2FFDA 1NOHA 2Z4EA 3CPWO 1KILA 3LIDA 1VF5C 3M9QA 4GOFA 4C7NB 5KAIH 1NAFA 4U3FJ 1S5LH 3L72E 3CCSP 1SVFA 1NTME 1N7SB 1IFMA 1QEXA 2NZ2A 2O01H 4H44D 5CCHC 1GMJA 1SQVE 3G3ZA 3MZWB 3CWBE 3IR9A 1SQXJ 3L75D 3RK3E 4DJGA 2WSCJ 1E79H 1NTZD 1KB9H 4U7JA 4D6TJ 2IFMA 1PGOA 4HYTB 5AVYB 1SQBG 3CLQA 1UIIA 1WRGA 1J1EC 1KB9D 1GW3A 3HD7B 1FZFA 3D6ZA 1MV8A 1OVVA 2R3CA 1RQUA 1HBWA 2Q3IA 2ZT9B 1KV4A 2KK7A 5APSA 1DIPA 1W2EA 3S1KA 1NTZK 1P84D 2FY8A 3IN6A 5AW4B 4EYYQ 3OW2O 1XTGB 1N7SA 1YITP 3F5HA 1JOCA 3RBXA 5APWA 2RKLA 2E75B 1KILB 3CXHD 1QGKB 4L76A 5CBOA 1JMMA 3L74D 1JMBA 1DD4A 4H13C 4N3YB 4ASWA 2KUBA 4KJMA 1KYOE 1FZCA 1M1JB 3B8EB 3E1RA 3S4RA 1SP4A 1RY3A 2Q5UA 3QWOC 1HJ0A 1SQXD 2E5YA 4K35A 2RMZA 4XFJA 2P7JA 1GU5A 2OYIC 3D6YA 4OGQB 3VYIA 1SQVG 1PPJE 1VF5D 2J5UA 2W90A 3M0DA 1K05A 5CHXA 5AW1B 3CCUP 1CW5A 1SFCA 3FX0A 2IZ0A 2ZT9D 2AXTE 5KTBA 4IL6H 2ZYGA 3A0HE 3CX5D 2P67A 1NTKJ 4H44C 1WT6A 1JY2O 2XU6A 5CCHD 1L4AA 1SQXK 3QH9A 1SQPJ 2ZFCA 3AE3C 2OTKE 2K88A 3K5BA 3RL0C 3H1HG 4OWFA 1HUCA 2GUVA 3A5TA 4YPCA 2M8RA 3CMAP 1S9KD 2FFDC 2N1TB 5KLVG 2H43A 5KAFH 2E42A 1KYOH 1SQVJ 1P84E 1RF0A 1GL2D 5APUA 2LKMA 2A06D 4JYCA 5AVTB 2BCCG 2E76B 5E79H 2E75C 5AW6B 3G9RA 2FFDB 1BE3G 1XTCC 1ZN5A 1JB0J 4IL6X 4YXDC 1URQA 2FYNC 2M5AA 2V7QJ 1L4AC 3GF3A 3II6A 3CXHE 2IDBA 1KMIZ 2I8DA 5KJ7D 3RK2C 1NTZE 1EXJA 1OZHA 3MIWA 1JM0A 4OGQD 3JSVC 1L0LG 1SQXE 1NGMB 1M56D 1W5CE 4UB8H 2QIWA 1FZBA 1D7MA 3V4WA 2OYHB 1LTJA 2M3EA 4Y28J 2POHA 3M0DC 4BRYA 2O01N 2IX7C 2KS1B 3H1HJ 2ZXXA 4I2LC 2QE7H 2AEFA 3CCJP 3H1LG 3BCCG 2V7QH 3PJSK 3RK2B 4WY4C 3VOPA 4RKUJ 1EZVG 1NTMK 1LGHB 2WSFH 3CX5H 3FXDA 2E74D 3TGUJ 3F89A 1OIPA 4NPFX 2KP8A 1KYOD 5H2FH 2IBZI 1SQQJ 3EWKA 1IFIA 2LR2A 1T2KD 2O3JA 2FBWC 1IFNA 1H8AA 2VRSA 2OTJP 2P10A 2WPQA 2NPSD 1EDJA 4D6TE 5AVXB 1CSBA 1J2JB 2L5GB 4TLFA 3L70E 1NU1E 5KKZB 2JKVA 1DX7A 2M0BA 2A45G 1YQ4C 3HE4B 3C9IA 1LP1A 3AE4C 1BGYD 1NKNA 3GLMA 3M9HA 3WUUA 1EDIA 3CD6P 1JUNA 2H88C 3G4SP 3H1IJ 1URQD 3KQGA 2HR3A 4I7ZB 1RE4C 1PP9G 1KILC 1ZV8A 5KLIC 3HUSA 3MD0A 3H32B 5BU8B 5GTIH 3P7KA 4EDFA 3BATA 5APYA 1ZRTE 2ZYDA 3CCRP 1KTMA 4N6JA 1RE4A 2QM8A 1YJWP 4L74A 5TISH 1KFMA 3TNUA 2KXPB 4RO0A 1LTIC 2Q6QA 1WMKA 3JCUH 4I7ZC 4PV1D 1FU1A 3OAKA 5AW3B 2ZXEB 2KS1A 2FKWB 4ZMDA 5KLIB 2BCCE 2QSIA 3W67A 5BVZA 1IFDA 2H8PD 1SQBD 3AEAC 5E79E 1S1CX 1LTJB 2FYUK 4D6TD 2O01J 5KLVK 1NTZJ 1Y8AA 5EFWB 1KD1Q 2OYHA 3P8MC 2JP3A 2Y0CA 1G1JA 1LTTC 1U57A 3JC22 4GKGA 4IFFA 2WTYA 3CCVP 1VQ7P 1OVRA 2HODA 3NTNA
chains in the Genus database with same CATH topology
2A06G 1P84H 2FYUG 3H1HG 3H1LG 3H1IG 3L74G 3BCCG 1PP9G 3L73G 5KLVG 1NU1G 3CWBG 1EZVG 1KYOH 3CXHH 1PPJG 3L70G 2IBZG 3CX5H 1BGYG 3L75G 1BCCG 2BCCG 4PD4H 1NTMG 1BE3G 1L0NG 1SQXG 1SQVG 1L0LG 4D6TG 1KB9H 3L71G 1NTZG 3H1JG 3H1KG 1NTKG 1SQBG 3TGUG 3L72G 4U3FG 1SQQG 1SQPG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2A06 G;  1P84 H;  2FYU G;  3H1H G;  3H1L G;  3H1I G;  3L74 G;  3BCC G;  1PP9 G;  3L73 G;  5KLV G;  1NU1 G;  3CWB G;  1EZV G;  1KYO H;  3CXH H;  1PPJ G;  3L70 G;  2IBZ G;  3CX5 H;  1BGY G;  3L75 G;  1BCC G;  2BCC G;  4PD4 H;  1NTM G;  1BE3 G;  1L0N G;  1SQX G;  1SQV G;  1L0L G;  4D6T G;  1KB9 H;  3L71 G;  1NTZ G;  3H1J G;  3H1K G;  1NTK G;  1SQB G;  3TGU G;  3L72 G;  4U3F G;  1SQQ G;  1SQP G; 
#chains in the Genus database with same CATH topology
 1ZP0 C;  5AVZ B;  2CPS A;  2C9N Y;  1EDK A;  1M57 D;  1LTG C;  1JEK A;  3IFM A;  1N7L A;  1SQB K;  4R4L A;  4U3F D;  1YI2 P;  1Q81 Q;  2WSF J;  4EIJ A;  5APQ A;  5GTH H;  3BCC J;  1NU1 J;  2B9B A;  2YXQ B;  1IO4 A;  1YTZ T;  3L37 A;  3BAS A;  1PPJ G;  4R4M A;  1JY3 N;  1S2E A;  3SSU A;  3L72 D;  3BRV B;  3USS A;  2E5T A;  2G3A A;  3H1L D;  2N1T A;  4DOJ A;  2YO3 A;  4H0L C;  2Z5H A;  4WBA A;  3D71 A;  1ZR4 A;  3CL3 D;  1SQV D;  4PJ0 E;  2B87 B;  1NTK K;  2FYZ A;  3O8Z A;  1L4A B;  5CJ0 A;  2HOD B;  3RK3 D;  3TGU E;  1H88 A;  3I55 P;  1J1D B;  3L73 D;  3AE7 C;  1ZLL A;  2KB7 P;  1HTL C;  1PV3 A;  1SQQ K;  2E76 C;  2Y9Y A;  3H1J G;  4W7Z A;  1RF1 A;  5GTI E;  2HYN A;  3WUV A;  5B66 E;  2MKV A;  3EQ2 A;  1SQV K;  3FGA D;  4L75 A;  4LLH A;  1SQP E;  3KHU A;  4QMA A;  3TYY A;  1SQP G;  1MUU A;  2FYU J;  3M0A A;  4WWI A;  4GOE A;  3Q5R A;  3P8C E;  1IK9 A;  1VQO P;  2FXP A;  3VN0 A;  4I1L A;  3VTP C;  5KLV J;  2AXT H;  2W27 A;  2HG5 D;  1AVY A;  2JR8 A;  2XV5 A;  2ZYA A;  1RF0 C;  5AVQ B;  2HPC A;  3N4X A;  1L0L J;  1BGY G;  1GK6 A;  1BCC G;  1SQB J;  3H1I E;  3H32 A;  2C0W A;  3KZI H;  3M9B A;  2QA4 P;  2QM7 A;  1HJB A;  4WVZ A;  1YIJ P;  2JWD A;  1NU1 K;  5AVV B;  1HVV A;  1X9V A;  3AE8 C;  3H1K E;  3CC7 P;  1CI6 A;  1DEB A;  1YQ3 C;  2XDJ A;  1KC8 Q;  5TIS E;  3HD7 A;  1FOS F;  3HE4 A;  1NTM D;  4NPD A;  4DT0 A;  1VF5 B;  3OA7 A;  4H13 B;  1SLQ A;  5H2F E;  1X79 B;  4DZO A;  3TF5 A;  1YJ9 P;  1S3J A;  3CX5 E;  3PTZ A;  2P1J A;  3EFG A;  2P2U A;  3PP5 A;  2LXB A;  3RK3 C;  2JDI H;  1AQT A;  1S5L X;  3I56 P;  1NTM J;  1A02 F;  4U3F E;  4WY4 B;  1OW8 A;  1H0T B;  1FZC C;  4A7P A;  3H25 A;  1KIL E;  1EZV D;  2KNC B;  2ZJS E;  1BGY E;  3H1I G;  1N86 A;  2YMK A;  3L71 E;  3Q1M A;  1NWQ A;  1HH0 A;  4ASV A;  2K37 A;  3B5N A;  2LXC B;  1OX3 A;  2KI7 B;  3L70 G;  1AV1 A;  1USE A;  1FS0 E;  3TSI A;  4PV1 C;  1NHL A;  3HRN A;  2YXR B;  5CCG C;  1RF1 C;  3E7K A;  4HKZ H;  3TK1 A;  1IFJ A;  3C1L A;  2FYU D;  3B5N B;  1QL2 A;  2XNX A;  2IPP A;  2KLU A;  3LIE A;  5TJH A;  3H1J E;  4IL6 E;  4H13 D;  1ZME C;  1H89 A;  3CC4 P;  2KNC A;  2FYN B;  1RQV A;  2O1J A;  3HD7 C;  2A45 H;  4PD4 D;  1KB9 I;  3MHV A;  4XA4 A;  1KYO I;  4WY4 A;  3RK3 B;  1FZA A;  5KAF E;  2JO1 A;  1R5L A;  2JJL A;  2YMY A;  1FBM A;  4UB6 H;  3TGU G;  2OQQ A;  3V2P A;  1FC2 C;  3WU2 H;  1S4X A;  1OMI A;  2W6J H;  3GF7 A;  3ITK A;  4AYC A;  1GU4 A;  1BCC E;  1AFO A;  4KHX A;  1K04 A;  2QJY B;  3GHG C;  1NVO A;  1S5L E;  1MZ9 A;  1NO4 A;  2KZJ A;  2IYO A;  2PFX A;  3H1L J;  3L36 A;  4GDO A;  2HFE D;  2W8Z A;  3A0H H;  5APT A;  5AW5 B;  1YHQ P;  1CI6 B;  1HGV A;  3CXH I;  4JF7 A;  3CCM P;  3VMY A;  1NTK D;  1L0N E;  4OVN F;  1LWU C;  1R8E A;  2NPS B;  3Q2Y A;  5AVW B;  4OGQ C;  1G2C B;  2HLO A;  1BE3 E;  1VPC A;  2AEJ A;  2M3B A;  1LTB C;  2OGU A;  2YNY A;  1JY3 O;  1Q2N A;  1SQB E;  2E75 D;  2QJP B;  3AE2 C;  4GT1 A;  2QJY C;  1T3U A;  3GHG B;  4HJG H;  1QVG O;  2RN0 A;  2YIU C;  1BDC A;  3L71 G;  5DJU B;  1JTH B;  1Q90 D;  2IFN A;  2Q1K A;  4C46 A;  3L75 J;  2XND H;  3LW5 J;  2C0X A;  5CJ4 A;  2QEX P;  3KZI E;  2B88 A;  3MP7 B;  4U3F G;  3SFD C;  3H1H E;  3IF4 A;  3U59 A;  1JTH A;  2WSE H;  3UIA A;  5KJ7 A;  2Y9Z A;  1M1J A;  1Y47 A;  2IYP A;  1GTW A;  1U7M A;  3BCC D;  1QX8 A;  2P58 A;  3E1I A;  5B5E H;  1SFC C;  3PHL A;  3A3Y B;  2B87 A;  3VP9 A;  3GW6 A;  3GMA A;  1PP9 E;  1AJY A;  4Y99 C;  5AW0 B;  5KJ7 C;  4WY4 D;  1M7L A;  2XKM A;  2Y0D A;  3A2A A;  1IFP A;  3H1I D;  1S72 P;  2Q9I A;  3PLN A;  3PRJ A;  2OYH C;  2OYO A;  3FWL A;  2QJP C;  1LT9 A;  3R4Y A;  5CBN A;  4W80 A;  2KSJ A;  1PP9 J;  2YKP A;  3Q3D A;  3M06 A;  1FDO A;  2BEZ F;  4MN4 C;  2IZ1 A;  1VQL P;  1YJN P;  1G1I A;  2GA1 A;  2L91 A;  3H1J J;  1SQP D;  2GUS A;  2WPS A;  3L73 E;  1NU1 D;  2G8Y A;  2R32 A;  2YKQ A;  4W7Y A;  5KLV D;  4BXL A;  1L0L K;  3Q5P A;  1CZQ A;  1RHZ B;  4JYB A;  5AW9 B;  1VQ4 P;  4RJT A;  3KPE A;  2V4H A;  2QVA A;  2E43 A;  2GM4 A;  2N9Y B;  5AVS B;  4C7N A;  3G6E P;  1VQN P;  3CCE P;  1VQK P;  1EZV E;  3Q5S A;  2UWJ E;  4PJ0 H;  2SPZ A;  4LGD E;  3TNU B;  1DEE G;  1OXZ A;  1OW7 A;  5CCH A;  3RL0 g;  1TU3 F;  4UB6 E;  4BWN A;  2PAJ A;  2I1K A;  1NTM G;  3M91 A;  3VMX A;  3RGU A;  2JWA A;  3G71 P;  1NYH A;  3PH0 A;  5AVU B;  5KAI E;  2JEE A;  1HGZ A;  3D70 A;  4ZKP A;  5GTH E;  1GD2 E;  1J1E B;  1NKZ B;  3HTK B;  4ZNC A;  3H6P A;  3JCU E;  4H0L D;  1OFC X;  2D2C C;  1NTZ G;  4PV1 B;  3MUD A;  3V2N A;  2WQY C;  1VQM P;  3AED C;  5C39 A;  5CMZ A;  3ABV C;  4LC1 A;  1MFT A;  1VQ9 P;  1IZN B;  3CI9 A;  2FXM A;  2AXC A;  4WB4 A;  2B89 A;  5APX A;  4L73 A;  5CCG A;  1PGQ A;  3MTU E;  4JBZ A;  4EOT A;  3LW5 H;  4TT3 H;  2E74 C;  5APV A;  5AW8 B;  2WSE J;  1T8Z A;  3B5N C;  3V5B A;  4C7R A;  2XZR A;  3CWB G;  1LT9 C;  4JQ0 D;  2OTL P;  1Q7Y Q;  5KLV E;  2NRG A;  2O1K A;  2R44 A;  1VQP P;  2WSC H;  2ZVO B;  3P32 A;  2OYI B;  1BCC J;  2W6A A;  3T97 B;  2IBZ D;  3AE1 C;  1GL2 A;  1FDI A;  1LJ2 A;  1EC5 A;  1MKM A;  1M1J C;  1UIX A;  1RE3 C;  2KLV A;  1P84 I;  3AE5 C;  3SWK A;  2HPC B;  1JY3 P;  1SQQ D;  2OAR A;  1L0L E;  1SQX G;  4OH8 B;  4PD4 E;  3SWY A;  4ZKU A;  3R2P A;  1N73 B;  3TGU D;  1FZE A;  5CCG D;  2H7H A;  1GK4 A;  3H1J D;  3AEB C;  2BCC J;  3RL0 D;  1T2K C;  1BGY J;  3H1K G;  4AUW A;  2QRX A;  2K1A A;  3ZDM A;  2R5B A;  2NPS C;  1K73 Q;  1Z56 A;  1N73 A;  1L0N K;  3HE5 B;  1JNM A;  1JCD A;  1EDL A;  2E76 D;  3SFE C;  2E74 B;  1KB9 E;  1EQ7 A;  1GL2 B;  2D2C D;  3H1H D;  4NPE A;  3L74 J;  1AA0 A;  2WSS H;  2YKO A;  1NU1 G;  3MUD C;  3P8C D;  4PD4 I;  2WT7 B;  1K8A Q;  1JY2 P;  2RH0 A;  2M5A B;  1JCC A;  1L0N D;  2Q3E A;  4Z1M H;  2J59 M;  1NH4 A;  1EXI A;  3V2Q A;  2QJK B;  2PP6 A;  4PD4 H;  3B5N D;  1IC2 A;  1T6A A;  3MGN A;  2WMM A;  3CCQ P;  1J1D C;  2CK3 H;  3GG2 A;  2BAS A;  1X0T A;  3VMA A;  5L8R J;  1M1K Q;  2IBZ E;  3L73 J;  5BU5 A;  4N78 E;  1BSN A;  3KXD A;  4O9B A;  3VMZ A;  4H44 B;  3CWB J;  5AW2 B;  1L0L D;  1L4A D;  1N7S D;  2DW3 A;  3RK2 D;  2PRR A;  4HH2 A;  1KQF B;  1X22 A;  2KOG A;  2Q7C A;  3EFF K;  2N1T C;  3SWF A;  5KKZ C;  1P84 H;  3CCL P;  2WIT A;  3HD7 D;  3A0B E;  3O6Q B;  2BEQ D;  2W6B A;  3L73 G;  1YBK A;  4H0L B;  1MFZ A;  1VL2 A;  1FZC B;  1HWT C;  5K5G B;  1VQ5 P;  1R5S A;  2Z5I A;  1KOR A;  1N73 C;  4GIF A;  1T3J A;  3V6I A;  1FOS E;  3KYQ A;  2A06 E;  3O6Q A;  4JPZ B;  1FE6 A;  1GDT A;  5M1B A;  2ZT9 C;  3B71 A;  3CWB D;  3L75 E;  3W68 A;  1KFN A;  1PIX A;  3HUS B;  3NXS A;  3OJA B;  3L35 A;  3WU2 E;  3L70 J;  3V4Q A;  1ZW0 A;  4M3L A;  1N2D C;  2I1J A;  1IK7 A;  2KYV A;  3CC2 P;  1VQ6 P;  3VP8 A;  1LP1 B;  1PPJ D;  1Q86 Q;  3L72 G;  2Y0E A;  1Q82 Q;  5B5E E;  3A7O A;  4AQR D;  1Y9B A;  3AEE C;  1KIL D;  1PL5 A;  1LT9 B;  1SQQ G;  5AVR B;  2WWW A;  3AEG C;  1A02 J;  1FJK A;  5DJT B;  3L4F A;  3AEC C;  1YYC A;  3HUS C;  1PP9 D;  3FWN A;  1LTS C;  4YXW H;  1GW4 A;  2N1T D;  2PGD A;  1H0T A;  1KZU B;  3NMD A;  1QL1 A;  3L74 E;  1GZL A;  3L75 G;  4I6M C;  4YTP C;  2WT7 A;  3FXE A;  2FYU E;  3NFQ A;  1QLE D;  3AE6 C;  3L72 J;  1LNQ A;  1U7J A;  4RES B;  3WUT A;  2C9L Y;  1NTK E;  2BCC D;  1K9M Q;  1NJI Q;  4UB8 E;  1BDD A;  1AQ5 A;  1L0N G;  1SS1 A;  1ZXG A;  3HE5 A;  1BE3 D;  1ZR2 A;  1DH3 A;  1LWU B;  1JY2 N;  1QVF O;  1PGP A;  3CX5 I;  4D6T G;  1M90 Q;  3AE9 C;  3L71 J;  3TDK A;  4CPG A;  1BCC D;  1YTZ I;  2K9Y A;  1BE3 J;  2QG4 A;  3GHG A;  5AW7 B;  1FZG A;  2ZAE B;  3U1A A;  1VQ8 P;  4BRY B;  1AVO A;  1SFC D;  3U1C A;  1KQS O;  1BSH A;  2FYU G;  1HF9 A;  1G2C A;  1FDM A;  2YO2 A;  2R3S A;  3L74 G;  1EZV I;  2NPS A;  3T97 A;  2OYI A;  1PFI A;  1KN7 A;  2WVR A;  3I5C A;  2FXO A;  3BCC E;  3RL0 B;  4DCK A;  2K9J A;  1URQ B;  3V2R A;  4EI2 A;  2MJZ A;  3H1L E;  3BVH A;  2IBZ G;  4Y99 B;  1DD3 A;  2CPB A;  1ZOY C;  2J58 A;  2WPV B;  1KQL A;  3H1K J;  1ZRT D;  3A0B H;  1FAV A;  4GOD A;  4K3A A;  4KT0 J;  2YIU B;  1RE3 A;  1SQQ E;  1GL2 C;  2A45 I;  3IAO A;  2KSE A;  1L0N J;  1LTJ C;  1LT1 A;  1KQG B;  1OVU A;  2K9J B;  1N7S C;  2KIK A;  2N9B A;  2R5D A;  2W83 C;  3S9O A;  1SQP K;  3BRT B;  2K3R A;  3WMM 0;  3H1K D;  1RF1 B;  3C8V A;  5B66 H;  4N78 D;  2ZVN B;  3KDP B;  1L2P A;  1URQ C;  1M8O B;  3L70 D;  4IOI H;  1NTK G;  1X8Y A;  2KZI A;  1W2B O;  3CME P;  1PZQ A;  2WPR A;  1VDF A;  3HTK A;  2QJK C;  1RH5 B;  3N7N A;  2D2C B;  1LTA C;  3AEF C;  3B4S A;  2A06 G;  1SFC B;  2H89 C;  1IJD B;  1OWA A;  2WZ7 A;  4IFM A;  2AEM A;  4IFD K;  1JO5 A;  1USD A;  4HB1 A;  1LWU A;  4XE5 B;  1PGJ A;  2ITA A;  1OW6 A;  1S9K E;  3RBZ A;  4B86 A;  1FJP A;  3L71 D;  1E5W A;  1NAY A;  3CXH H;  1N8R Q;  2FFD A;  1NOH A;  2Z4E A;  3CPW O;  1KIL A;  3LID A;  1VF5 C;  3M9Q A;  4GOF A;  4C7N B;  5KAI H;  1NAF A;  4U3F J;  1S5L H;  3L72 E;  3CCS P;  1SVF A;  1NTM E;  1N7S B;  1IFM A;  1QEX A;  2NZ2 A;  2O01 H;  4H44 D;  5CCH C;  1GMJ A;  1SQV E;  3G3Z A;  3MZW B;  3CWB E;  3IR9 A;  1SQX J;  3L75 D;  3RK3 E;  4DJG A;  2WSC J;  1E79 H;  1NTZ D;  1KB9 H;  4U7J A;  4D6T J;  2IFM A;  1PGO A;  4HYT B;  5AVY B;  1SQB G;  3CLQ A;  1UII A;  1WRG A;  1J1E C;  1KB9 D;  1GW3 A;  3HD7 B;  1FZF A;  3D6Z A;  1MV8 A;  1OVV A;  2R3C A;  1RQU A;  1HBW A;  2Q3I A;  2ZT9 B;  1KV4 A;  2KK7 A;  5APS A;  1DIP A;  1W2E A;  3S1K A;  1NTZ K;  1P84 D;  2FY8 A;  3IN6 A;  5AW4 B;  4EYY Q;  3OW2 O;  1XTG B;  1N7S A;  1YIT P;  3F5H A;  1JOC A;  3RBX A;  5APW A;  2RKL A;  2E75 B;  1KIL B;  3CXH D;  1QGK B;  4L76 A;  5CBO A;  1JMM A;  3L74 D;  1JMB A;  1DD4 A;  4H13 C;  4N3Y B;  4ASW A;  2KUB A;  4KJM A;  1KYO E;  1FZC A;  1M1J B;  3B8E B;  3E1R A;  3S4R A;  1SP4 A;  1RY3 A;  2Q5U A;  3QWO C;  1HJ0 A;  1SQX D;  2E5Y A;  4K35 A;  2RMZ A;  4XFJ A;  2P7J A;  1GU5 A;  2OYI C;  3D6Y A;  4OGQ B;  3VYI A;  1SQV G;  1PPJ E;  1VF5 D;  2J5U A;  2W90 A;  3M0D A;  1K05 A;  5CHX A;  5AW1 B;  3CCU P;  1CW5 A;  1SFC A;  3FX0 A;  2IZ0 A;  2ZT9 D;  2AXT E;  5KTB A;  4IL6 H;  2ZYG A;  3A0H E;  3CX5 D;  2P67 A;  1NTK J;  4H44 C;  1WT6 A;  1JY2 O;  2XU6 A;  5CCH D;  1L4A A;  1SQX K;  3QH9 A;  1SQP J;  2ZFC A;  3AE3 C;  2OTK E;  2K88 A;  3K5B A;  3RL0 C;  3H1H G;  4OWF A;  1HUC A;  2GUV A;  3A5T A;  4YPC A;  2M8R A;  3CMA P;  1S9K D;  2FFD C;  2N1T B;  5KLV G;  2H43 A;  5KAF H;  2E42 A;  1KYO H;  1SQV J;  1P84 E;  1RF0 A;  1GL2 D;  5APU A;  2LKM A;  2A06 D;  4JYC A;  5AVT B;  2BCC G;  2E76 B;  5E79 H;  2E75 C;  5AW6 B;  3G9R A;  2FFD B;  1BE3 G;  1XTC C;  1ZN5 A;  1JB0 J;  4IL6 X;  4YXD C;  1URQ A;  2FYN C;  2M5A A;  2V7Q J;  1L4A C;  3GF3 A;  3II6 A;  3CXH E;  2IDB A;  1KMI Z;  2I8D A;  5KJ7 D;  3RK2 C;  1NTZ E;  1EXJ A;  1OZH A;  3MIW A;  1JM0 A;  4OGQ D;  3JSV C;  1L0L G;  1SQX E;  1NGM B;  1M56 D;  1W5C E;  4UB8 H;  2QIW A;  1FZB A;  1D7M A;  3V4W A;  2OYH B;  1LTJ A;  2M3E A;  4Y28 J;  2POH A;  3M0D C;  4BRY A;  2O01 N;  2IX7 C;  2KS1 B;  3H1H J;  2ZXX A;  4I2L C;  2QE7 H;  2AEF A;  3CCJ P;  3H1L G;  3BCC G;  2V7Q H;  3PJS K;  3RK2 B;  4WY4 C;  3VOP A;  4RKU J;  1EZV G;  1NTM K;  1LGH B;  2WSF H;  3CX5 H;  3FXD A;  2E74 D;  3TGU J;  3F89 A;  1OIP A;  4NPF X;  2KP8 A;  1KYO D;  5H2F H;  2IBZ I;  1SQQ J;  3EWK A;  1IFI A;  2LR2 A;  1T2K D;  2O3J A;  2FBW C;  1IFN A;  1H8A A;  2VRS A;  2OTJ P;  2P10 A;  2WPQ A;  2NPS D;  1EDJ A;  4D6T E;  5AVX B;  1CSB A;  1J2J B;  2L5G B;  4TLF A;  3L70 E;  1NU1 E;  5KKZ B;  2JKV A;  1DX7 A;  2M0B A;  2A45 G;  1YQ4 C;  3HE4 B;  3C9I A;  1LP1 A;  3AE4 C;  1BGY D;  1NKN A;  3GLM A;  3M9H A;  3WUU A;  1EDI A;  3CD6 P;  1JUN A;  2H88 C;  3G4S P;  3H1I J;  1URQ D;  3KQG A;  2HR3 A;  4I7Z B;  1RE4 C;  1PP9 G;  1KIL C;  1ZV8 A;  5KLI C;  3HUS A;  3MD0 A;  3H32 B;  5BU8 B;  5GTI H;  3P7K A;  4EDF A;  3BAT A;  5APY A;  1ZRT E;  2ZYD A;  3CCR P;  1KTM A;  4N6J A;  1RE4 A;  2QM8 A;  1YJW P;  4L74 A;  5TIS H;  1KFM A;  3TNU A;  2KXP B;  4RO0 A;  1LTI C;  2Q6Q A;  1WMK A;  3JCU H;  4I7Z C;  4PV1 D;  1FU1 A;  3OAK A;  5AW3 B;  2ZXE B;  2KS1 A;  2FKW B;  4ZMD A;  5KLI B;  2BCC E;  2QSI A;  3W67 A;  5BVZ A;  1IFD A;  2H8P D;  1SQB D;  3AEA C;  5E79 E;  1S1C X;  1LTJ B;  2FYU K;  4D6T D;  2O01 J;  5KLV K;  1NTZ J;  1Y8A A;  5EFW B;  1KD1 Q;  2OYH A;  3P8M C;  2JP3 A;  2Y0C A;  1G1J A;  1LTT C;  1U57 A;  3JC2 2;  4GKG A;  4IFF A;  2WTY A;  3CCV P;  1VQ7 P;  1OVR A;  2HOD A;  3NTN A; 
#chains in the Genus database with same CATH homology
 2A06 G;  1P84 H;  2FYU G;  3H1H G;  3H1L G;  3H1I G;  3L74 G;  3BCC G;  1PP9 G;  3L73 G;  5KLV G;  1NU1 G;  3CWB G;  1EZV G;  1KYO H;  3CXH H;  1PPJ G;  3L70 G;  2IBZ G;  3CX5 H;  1BGY G;  3L75 G;  1BCC G;  2BCC G;  4PD4 H;  1NTM G;  1BE3 G;  1L0N G;  1SQX G;  1SQV G;  1L0L G;  4D6T G;  1KB9 H;  3L71 G;  1NTZ G;  3H1J G;  3H1K G;  1NTK G;  1SQB G;  3TGU G;  3L72 G;  4U3F G;  1SQQ G;  1SQP G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...