1LTAC

2.2 angstroms crystal structure of e. coli heat-labile enterotoxin (lt) with bound galactose
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Enterotoxin
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Galactose-binding site in Escherichia coli heat-labile enterotoxin (LT) and cholera toxin (CT).
pubmed doi rcsb
source organism Escherichia coli
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1993-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltaC00
1LTBC 1HTLC 1XTCC 1LTTC 1LTGC 1LTAC 1LTSC 1LTIC
chains in the Genus database with same CATH superfamily
1OWAA 2W6BA 3AEAC 3H1LG 2HPCA 3KQGA 2P67A 3GF7A 1HF9A 3K5BA 3TGUE 1RF1C 3S1KA 1AVOA 3P8CD 1GU4A 5KJ7D 1N73C 1KMIZ 4DJGA 1KC8Q 1NTZJ 2OYIC 2LKMA 1PP9E 1T2KC 3L4FA 1JY3P 4ASWA 2QM7A 3JCUE 4JQ0D 1NKNA 3II6A 5AW4B 4GOFA 4IOIH 3NMDA 1DH3A 3MUDA 1KILA 5C39A 3VMAA 1UIIA 3WU2H 1FZGA 1EXIA 1S5LE 3EFFK 5B5EE 5AW3B 5KAIE 4PV1C 2KSJA 4PJ0E 1ZP0C 3L74G 1LTIC 4EDFA 3CC7P 1S4XA 1SQPJ 4LGDE 3L36A 3B71A 3MIWA 1L0LD 1JM0A 3JC22 5AVSB 2BEZF 2FFDB 4RO0A 3O8ZA 1K9MQ 2KB7P 4H44C 2JP3A 5CBNA 2WVRA 1HVVA 2IFNA 4JBZA 3GW6A 3N7NA 1DD3A 3AE9C 1FZEA 3CXHE 2PGDA 3LIDA 4JYBA 1GL2A 3RK2C 3Q5RA 3L70D 1OFCX 3M0DA 1KB9H 2ITAA 1RF0A 2I8DA 1LNQA 2RN0A 3L73D 5KAFE 1L0NG 2IBZI 1GMJA 1KYOD 1VF5B 4C46A 2N1TD 2B87B 1QL2A 4H13D 3VN0A 1VQOP 2QEXP 3HRNA 1X22A 2WITA 2RMZA 3A0HH 4IFMA 1NTMD 3BRTB 3CCMP 1QGKB 1IK7A 5KLVD 1QL1A 1IZNB 4Y28J 2FBWC 1JMBA 4L75A 1LWUA 1XTGB 1HGZA 2P1JA 3CXHI 2E76B 2IZ0A 1IFJA 1NTKG 2AEJA 3SFDC 3BCCJ 3PRJA 1CI6A 2YIUC 5GTHH 3CMAP 1URQB 2WSEJ 2Q3IA 3B5ND 2QJKC 1DIPA 3GHGB 3LW5J 1DD4A 3RBXA 1BGYE 4D6TE 2IZ1A 4GDOA 2JKVA 2PP6A 3H1KG 3RGUA 3ABVC 2J5UA 1VPCA 3NXSA 2FYUD 1M1JA 3H1HE 5CHXA 2P2UA 2KNCA 1P84E 4BXLA 3ITKA 3CX5D 2E42A 1SQVD 4L74A 4CPGA 3TDKA 4RJTA 2YKOA 1LGHB 1NWQA 4EYYQ 1UIXA 1BE3G 2Q5UA 2XZRA 3T97A 3HUSB 5CCHC 4UB8E 1NTZE 1SQBJ 2GUSA 2YKPA 2YO3A 1MFZA 2IX7C 4U3FJ 3VP8A 3AE1C 1NOHA 3KZIE 4PD4E 2WTYA 4IL6E 3Q3DA 1Q2NA 3TF5A 1E5WA 2Q7CA 1T3JA 2KOGA 3H1LJ 1ZRTD 1N8RQ 2D2CB 1FZBA 2M3EA 4EIJA 4L76A 2OYHB 4H0LB 3RK3B 1AQ5A 3HD7B 3M9HA 1DEBA 2O01N 1H0TA 1PGOA 3GMAA 1WRGA 1P84I 1RE4C 1QVGO 3A3YB 2A45I 3PTZA 3CCVP 2ZAEB 2FFDC 2KSEA 4DOJA 4WY4D 1JO5A 4AYCA 1N7SD 1JTHB 3AE2C 5M1BA 1JY2O 4BRYA 1L4AB 3V2NA 2QIWA 1RH5B 1L0LG 2OYOA 2NPSD 1SFCD 3SWKA 4PD4I 2NZ2A 1FDOA 4HJGH 2GA1A 4KT0J 1IFMA 4U7JA 1YITP 1VF5C 3H1JD 3ZDMA 1ZN5A 1S5LX 4DZOA 3L70G 4GT1A 2WPQA 1WMKA 5AW5B 2E74B 2ZJSE 1BCCG 3L73G 2QM8A 1IFIA 1K73Q 3I55P 5EFWB 3VTPC 3BRVB 4JYCA 2FKWB 2E76C 1KILD 2ZXXA 1JOCA 3S4RA 4OGQB 1NTMG 2IBZD 3CCRP 3BCCE 2O1JA 1IFPA 3M06A 4N3YB 1NTZK 1URQC 1K05A 1L0ND 1OIPA 2QJPB 3HTKA 2ZT9B 2W90A 3GHGC 2A06E 3HE4A 1QLED 4NPFX 4UB6H 2PAJA 2M5AB 1YJNP 2OTJP 2YMYA 3PJSK 1NTKJ 2HG5D 5CBOA 1AVYA 3FWNA 2SPZA 3V2RA 1SQXD 2CK3H 4KJMA 3CCSP 3KDPB 3L72E 2KS1A 2C9LY 1GL2D 5AVVB 1ZR2A 1SQPK 4BWNA 2WZ7A 1NKZB 3V4WA 3D6YA 3UIAA 2AEMA 1YI2P 3Q2YA 5L8RJ 1GZLA 1H89A 2L91A 3HUSC 2FYUG 4IFFA 3M9QA 2QSIA 3PP5A 3WMM0 2KZJA 3JCUH 4R4MA 1SQBE 1NU1D 3I5CA 4U3FE 1FZCA 2VRSA 1YJ9P 2NPSC 5KLIB 2R44A 3O6QB 1PPJD 1HTLC 3H1KD 1S3JA 3FXDA 2Y9YA 1S5LH 4WY4A 2D2CC 2N9BA 1ZR4A 5B5EH 1JEKA 3H1LE 5KAIH 2WSFJ 4PJ0H 1BE3J 1BGYJ 2QJKB 2OYHC 4H0LC 3RK3C 2R5DA 1SS1A 2XU6A 3A2AA 1S9KE 3HD7C 3H32B 1EZVD 1OMIA 3BASA 1W2EA 3V5BA 2H8PD 1HJBA 3FXEA 4TT3H 1E79H 3E1IA 2YXRB 2AEFA 3CD6P 3CXHH 4C7RA 1Z56A 1GW3A 1L4AC 5APUA 1KB9D 3MUDC 1GU5A 3RL0g 3L74E 2C0WA 3AEBC 3RK3E 5KAFH 2BCCD 3TK1A 4IL6X 4WBAA 2FYNB 4YTPC 4LC1A 5CCGC 1NVOA 1T6AA 1HH0A 2C9NY 5APVA 3L75G 1AA0A 3TNUB 2R32A 2AXCA 2E74C 1L0LJ 1M90Q 1RF1A 2JR8A 1NJIQ 3KHUA 1N73A 1AFOA 2N1TB 2YNYA 1HWTC 4H13B 2OYIA 3H1JG 1OX3A 2V7QJ 1SQQD 3SFEC 2JWDA 4N6JA 1GTWA 2DW3A 3EFGA 4OGQC 3G9RA 2E75D 2Y0CA 5E79E 1USEA 2QJPC 5AVRB 5KKZB 1SQBK 4OWFA 1KFMA 2ZT9C 3L73J 1SQPD 4I7ZB 4A7PA 3LIEA 4K35A 4QMAA 5APSA 4HB1A 2IBZG 2V4HA 1FDIA 1BCCD 1PFIA 3CL3D 3WUTA 3WUVA 2K1AA 1PL5A 3SWFA 3B5NB 4GKGA 4EOTA 1NTKE 1NTMJ 1P84H 2A45H 2QA4P 5KLVJ 3IAOA 2FXMA 1LTJA 2KLVA 3P32A 1LT9B 4HYTB 1Q82Q 4I6MC 4HKZH 4UB8H 3HE5A 3V6IA 1FE6A 1SQXG 1X0TA 2C0XA 1VQMP 2J59M 1KQFB 1X79B 3VOPA 1W2BO 4GIFA 3KZIH 3MTUE 4PD4H 2WT7A 3CC4P 5AW6B 4IL6H 1Q86Q 1EC5A 1RQVA 3S9OA 2KUBA 5KLIC 3AEFC 5KJ7C 5DJTB 1PIXA 2J58A 2QVAA 1FOSF 2E5TA 2P10A 1G2CB 1BE3E 2FYUJ 1NU1G 2BEQD 3G4SP 2KS1B 1LP1B 2POHA 2O01J 1PPJG 2V7QH 2LXCB 1SQVJ 1N2DC 4C7NA 1YIJP 1W5CE 4N78D 3L72J 2R3CA 2OTLP 3P8CE 3CC2P 1EZVG 3CWBD 2E5YA 3USSA 1ZMEC 3L71J 3MP7B 2YO2A 4WY4B 1A02F 1N7SB 2K9JA 1S1CX 1GDTA 1WT6A 2H89C 1KORA 4D6TG 2FYNC 1EDJA 2NPSB 1SFCB 1JY3N 2B9BA 3H1ID 3AE5C 1GD2E 3EWKA 2XDJA 1IJDB 2KK7A 2XNXA 3N4XA 5APXA 4ZKUA 2CPBA 1SP4A 5CJ4A 2BCCG 1L0LE 1NTKK 2HPCB 2N1TC 2AXTE 4H13C 5CCHA 2CPSA 5AW2B 2P58A 3AEEC 5CMZA 4W7YA 4I2LC 2K9YA 3A0BE 1EDLA 3SWYA 1VQNP 1K8AQ 3OA7A 1AJYA 2WSEH 5KKZC 3M9BA 2W83C 1H88A 1FC2C 3KXDA 1KILB 1VQ6P 1SQQG 2WPRA 3L74J 3L75D 4I7ZC 5DJUB 1QVFO 3LW5H 3L73E 1VQPP 1J2JB 1U7MA 2WSSH 3H1JJ 4RKUJ 1VQ4P 1KYOE 1RE4A 2JEEA 3OJAB 5BVZA 3B5NC 2FFDA 1JY2P 1OW7A 3TGUD 2Z4EA 1NTME 3CI9A 1SQPG 2QJYB 3G3ZA 5AW1B 5KLVE 1PP9D 3P8MC 1KQGB 1LT9C 1MFTA 3V2PA 2NRGA 1KN7A 2Q6QA 1X9VA 3GG2A 1EXJA 1DX7A 2ZVOB 1EQ7A 1S72P 1GL2B 1NYHA 1YJWP 1L0NJ 1Y8AA 1RY3A 3TSIA 1OW8A 3F89A 3QWOC 2XNDH 1RE3A 1G1JA 3D70A 1S2EA 2JJLA 1RQUA 1JMMA 5APWA 3V2QA 1KYOI 2W6JH 2UWJE 1T2KD 1JCCA 2FYUE 2JO1A 5B66E 1SQXJ 1LTJB 1G1IA 1R8EA 1T3UA 3CMEP 2IYOA 2O1KA 3AE7C 1FU1A 3CX5E 3CXHD 4YXWH 4W7ZA 3CCLP 2HYNA 1L0LK 1SQVE 1BSHA 1LWUB 4K3AA 1IC2A 1FJPA 2IDBA 1QEXA 2E43A 2R3SA 1LT1A 1URQA 5GTIE 4PV1D 2L5GB 1J1EB 3BCCG 3FGAD 2PFXA 2Z5HA 5AVTB 1HUCA 1NU1J 3GHGA 1CI6B 2K88A 4WY4C 2QG4A 1N7SC 3L71E 1KTMA 1YTZT 1OZHA 2H7HA 4TLFA 3H1KJ 1YBKA 4H44D 3OW2O 2JDIH 2K3RA 1ZRTE 4RESB 1SFCC 3IR9A 3CWBG 3AE4C 4L73A 1LTGC 4C7NB 1ZLLA 1M1JB 2KNCB 2QE7H 1A02J 5AVXB 2Y0EA 1MKMA 3D6ZA 1LTAC 1RHZB 3HUSA 1NTMK 2PRRA 4OH8B 1PZQA 3H1IG 1VQ9P 1NAYA 3CPWO 2GM4A 5KLVK 3T97B 2ZYGA 5BU8B 2WPSA 5E79H 1XTCC 3CLQA 2HODA 1BGYD 4D6TD 2OTKE 5TISE 1VQ8P 5H2FE 1LTTC 2BCCJ 1JY3O 1KILC 1GK4A 1QX8A 4HH2A 2OYHA 1ZOYC 5AVUB 2WQYC 3HD7A 3RL0D 2E75B 4AQRD 3H1HD 3CCUP 3EQ2A 1SLQA 3H1JE 2YKQA 3JSVC 1P84D 1FS0E 2XV5A 1H0TB 4WVZA 2FYZA 2IPPA 2FYUK 2I1KA 2QJYC 1JTHA 1CSBA 1JY2N 1L4AA 1PGQA 1NTZD 1BDDA 2RH0A 1R5LA 1USDA 3IN6A 5APTA 1SQQJ 1SQVK 2WPVB 3G71P 1NGMB 1OXZA 1FZAA 1HBWA 4PD4D 1KILE 1NHLA 4BRYB 3TGUG 2WMMA 2IBZE 1GL2C 1OVRA 2OGUA 3KYQA 1L0NE 1PP9G 3M0DC 1Q7YQ 1NH4A 3MHVA 2ZXEB 4DT0A 1RF0C 5CCGA 3D71A 1M7LA 3L70J 1JUNA 2P7JA 2I1JA 3AE6C 1BCCJ 2WSFH 1K04A 1AQTA 2W8ZA 5CCHD 1J1DB 1Q90D 2QRXA 1LTJC 1FDMA 5AVZB 1SQXE 1ZW0A 1VQLP 3TYYA 3M0AA 3U59A 5AVQB 2JWAA 2M8RA 1LWUC 4M3LA 4OVNF 2Q9IA 3FWLA 3U1AA 1FOSE 2YMKA 2Y9ZA 1J1EC 2MJZA 2OQQA 3IF4A 3NFQA 4JPZB 2WWWA 1EDKA 3CCQP 1NU1E 2M5AA 3MZWB 3B8EB 3WU2E 2KIKA 3HTKB 4XA4A 3L37A 5AVYB 2HR3A 5BU5A 3Q5SA 4GODA 1PPJE 3H1KE 3HE4B 1CZQA 1MV8A 1KV4A 2FXPA 2FY8A 1IK9A 3W68A 1VQ5P 3KPEA 3B4SA 3RL0C 3AE3C 1M1KQ 3VMYA 3E1RA 4KHXA 1M1JC 1M56D 1EZVE 1ZXGA 2HLOA 2G8YA 2AXTH 1YQ3C 3C8VA 3MGNA 2H88C 4ASVA 1JCDA 2G3AA 2B88A 4MN4C 3BCCD 5APYA 1AV1A 2K37A 1MUUA 3A0BH 1VF5D 1IFNA 5KTBA 3CWBJ 5KJ7A 1KB9E 3O6QA 2A06D 2HFED 1MZ9A 3E7KA 1YTZI 1FZCB 3BVHA 1KFNA 3G6EP 1JB0J 1L0NK 3C1LA 2BCCE 3PH0A 3QH9A 4B86A 4ZMDA 4YXDC 1VL2A 3H32A 2E75C 5AW0B 4XE5B 1KYOH 3H1IJ 3L35A 2E76D 3L72D 1KQLA 4ZNCA 3A0HE 3VMZA 1BGYG 5AVWB 1IO4A 1BSNA 3RBZA 3CCEP 1GW4A 3MD0A 5APQA 3WUUA 2BASA 1EZVI 4GOEA 2LXBA 1URQD 1T8ZA 2KP8A 2Q1KA 4Y99B 1HGVA 3OAKA 1SQXK 3PLNA 2ZFCA 3H1HG 1FBMA 3L71D 1HJ0A 1EDIA 3A5TA 1L2PA 1SQBD 2A45G 1SQQE 3VP9A 2HODB 1LTBC 2OARA 1KD1Q 4WWIA 4U3FD 2ZVNB 1U57A 5GTHE 1KB9I 3AE8C 1PGJA 4XFJA 3H1LD 3W67A 1NTZG 1PGPA 3AEGC 1U7JA 2Y0DA 1Y47A 3L75J 1NU1K 1SQPE 3TNUA 1S9KD 4W80A 1PV3A 3L70E 4JF7A 2XKMA 3VMXA 2R5BA 4WB4A 1BCCE 1J1DC 5B66H 1N86A 1H8AA 4ZKPA 2N1TA 3TGUJ 1CW5A 1VDFA 2O01H 1RF1B 4I1LA 2WSCJ 4EI2A 3Q1MA 3CX5H 1YQ4C 2KZIA 3CCJP 1N73B 1PP9J 2OYIB 2D2CD 1FAVA 1YYCA 5GTIH 2Z5IA 1NO4A 3L74D 2ZYDA 2B89A 4H0LD 3RK3D 4IFDK 3BATA 3HD7D 1KQSO 1X8YA 2KI7B 4NPDA 1RE3C 1FJKA 1IFDA 5AW9B 4NPEA 4PV1B 3Q5PA 2O3JA 2YXQB 1YHQP 3F5HA 4LLHA 3AECC 1DEEG 3B5NA 2KXPB 1VQKP 3M91A 5AW7B 2B87A 1L4AD 1Q81Q 3AEDC 4YPCA 1ZV8A 1TU3F 4DCKA 1OVUA 2Q3EA 4H44B 1LT9A 1M8OB 2M0BA 1BDCA 1GK6A 4Z1MH 5KLVG 1OW6A 4N78E 1JNMA 1LTSC 3FX0A 4R4LA 5CCGD 5TJHA 1N7LA 1OVVA 3SSUA 2IYPA 2N9YB 5AW8B 1KZUB 3RK2B 2M3BA 3HE5B 1SQQK 3CWBE 5TISH 3NTNA 5H2FH 2WT7B 2E74D 2H43A 1FZCC 1FZFA 3R4YA 2IFMA 4O9BA 1G2CA 2LR2A 1LP1A 2MKVA 1NTKD 1D7MA 3IFMA 3H1IE 2A06G 2WSCH 1LJ2A 3U1CA 4OGQD 3GF3A 5CJ0A 1Y9BA 2W27A 1M57D 2KLUA 4AUWA 1VQ7P 3RL0B 3I56P 4Y99C 3P7KA 2FXOA 3A7OA 1SQVG 2ZT9D 3PHLA 2ZYAA 3V4QA 3RK2D 5K5GB 3L72G 2GUVA 3CX5I 1R5SA 1SVFA 2YIUB 3H6PA 1N7SA 2KYVA 4D6TJ 2RKLA 3L71G 2K9JB 2NPSA 1SFCA 4UB6E 2W6AA 3VYIA 1SQBG 1NAFA 3GLMA 1BE3D 3C9IA 3L75E 4U3FG 3H25A 3H1HJ 3R2PA
chains in the Genus database with same CATH topology
5APXA 2O1JA 4ZKUA 1OWAA 3M06A 4N3YB 2CPBA 1NTZK 1SP4A 1URQC 1J1EC 2MJZA 2W6BA 3NFQA 5CJ4A 2HPCA 3HTKA 2WWWA 3KQGA 2P67A 1NTKK 3B8EB 1RF1C 2HPCB 2N1TC 3GHGC 3HTKB 4XA4A 3HE4A 3L37A 5AVYB 5BU5A 3P8CD 1GU4A 5CCHA 2PAJA 5KJ7D 1N73C 2CPSA 5AW2B 3HE4B 5CMZA 2OYIC 1CZQA 4W7YA 2LKMA 2YMYA 1MV8A 4I2LC 1T2KC 3L4FA 1IK9A 1JY3P 3KPEA 3SWYA 2QM7A 2HG5D 3RL0C 1NKNA 3II6A 3V2RA 3VMYA 5AW4B 4KHXA 3KDPB 1M1JC 3NMDA 1DH3A 3MUDA 3OA7A 1KILA 2WSEH 3M9BA 2C9LY 1H88A 2HLOA 1GL2D 1FZGA 5AVVB 1ZR2A 1SQPK 2WZ7A 1KILB 3MGNA 1NKZB 3V4WA 3UIAA 2WPRA 1JCDA 3LW5H 5AW3B 1GZLA 1H89A 1J2JB 2KSJA 3HUSC 4IFFA 5APYA 3M9QA 3PP5A 1LTIC 3WMM0 1MUUA 1RE4A 2JEEA 1IFNA 3OJAB 5KTBA 5BVZA 4LGDE 3L36A 3B5NC 3MIWA 2FFDA 1JY2P 5KJ7A 5AVSB 3I5CA 2Z4EA 1FZCA 2VRSA 2HFED 2NPSC 1MZ9A 2FFDB 3CI9A 3O8ZA 2KB7P 3G3ZA 1YTZI 1HVVA 1HTLC 1FZCB 5AW1B 3BVHA 1KFNA 4WY4A 2N9BA 1ZR4A 2IFNA 3P8MC 1L0NK 1LT9C 3N7NA 4B86A 3V2PA 1FZEA 3H32A 1X9VA 5AW0B 4XE5B 2OYHC 3LIDA 3RK3C 3L35A 2R5DA 4JYBA 2XU6A 3A2AA 1GL2A 1S9KE 1DX7A 3HD7C 1KQLA 3H32B 3RK2C 3VMZA 5AVWB 1EQ7A 3BASA 1W2EA 3V5BA 1GL2B 1IO4A 2H8PD 3M0DA 1GW4A 3MD0A 1RF0A 5APQA 1HJBA 2BASA 1RY3A 3TSIA 1URQD 1T8ZA 3E1IA 2KP8A 4Y99B 1HGVA 3OAKA 1SQXK 2ZFCA 1RE3A 1G1JA 1FBMA 2JJLA 1JMMA 5APWA 4C46A 4C7RA 2N1TD 1QL2A 3VN0A 1Z56A 3V2QA 1GW3A 3A5TA 1L4AC 5APUA 3HRNA 2A45G 3VP9A 2WITA 2HODB 1LTBC 2OARA 1GU5A 1T2KD 4IFMA 1JCCA 3BRTB 1LTJB 2C0WA 1G1IA 1T3UA 1QL1A 2O1KA 1FU1A 3TK1A 1LWUA 4W7ZA 2HYNA 1L0LK 1HGZA 1XTGB 4WBAA 2P1JA 1NU1K 4LC1A 5CCGC 1LWUB 1HH0A 3TNUA 1S9KD 4W80A 1IC2A 1IFJA 1FJPA 2C9NY 5APVA 4JF7A 2E43A 2XKMA 3VMXA 1URQA 3TNUB 2R5BA 2R32A 4WB4A 1FOSE 1CI6A 2L5GB 1J1DC 1URQB 1J1EB 1N86A 1H8AA 2Z5HA 1RF1A 5AVTB 4ZKPA 1HUCA 3GHGA 2N1TA 1CI6B 2Q3IA 4WY4C 3B5ND 1N7SC 1CW5A 1VDFA 1YTZT 2O01H 1N73A 1RF1B 4I1LA 1AFOA 3GHGB 2YNYA 2N1TB 1HWTC 2H7HA 2OYIA 1N73B 2OYIB 2PP6A 4N6JA 1GTWA 4RESB 1SFCC 3IR9A 1FAVA 3EFGA 1VPCA 3NXSA 1YYCA 2Z5IA 1NO4A 1M1JA 5CHXA 2P2UA 1LTGC 3RK3D 4C7NB 4IFDK 1ZLLA 3BATA 1M1JB 3HD7D 5AVRB 1X8YA 1SQBK 2E42A 1RE3C 1FJKA 1A02J 1KFMA 5AVXB 1LTAC 1IFDA 1LGHB 2YKOA 1NWQA 3HUSA 2Q5UA 2XZRA 5AW9B 1NTMK 4OH8B 3T97A 3LIEA 3HUSB 2GM4A 5APSA 4LLHA 5KLVK 1PFIA 5CCHC 3B5NA 3CL3D 3M91A 2GUSA 5AW7B 2YKPA 2YO3A 5BU8B 3SWFA 1MFZA 3B5NB 2IX7C 1L4AD 2WPSA 4GKGA 3VP8A 1XTCC 1NOHA 4EOTA 2WTYA 1ZV8A 3CLQA 2HODA 2A45H 1LT9A 2FXMA 1LTJA 1E5WA 1LTTC 1T3JA 2KOGA 2KLVA 2Q7CA 1KILC 1JY3O 1GK4A 4HH2A 1FZBA 3P32A 1LT9B 1GK6A 2OYHA 4EIJA 5AVUB 4HYTB 4N78E 3HD7A 3RL0D 4I6MC 4AQRD 1JNMA 2OYHB 1LTSC 3RK3B 3EQ2A 3HE5A 1SLQA 2YKQA 5CCGD 1AQ5A 3HD7B 2C0XA 1N7LA 3M9HA 1DEBA 5AW8B 2J59M 1X79B 1KZUB 3VOPA 3RK2B 4GIFA 2M3BA 3HE5B 1WRGA 3MTUE 1SQQK 2WT7A 1RE4C 3A3YB 2XV5A 5AW6B 2A45I 2FYZA 2IPPA 3NTNA 2WT7B 2FFDC 2FYUK 2H43A 2I1KA 5KJ7C 4DOJA 1JTHA 1FZCC 4WY4D 1CSBA 1JO5A 1FZFA 2J58A 4AYCA 1JY2N 1N7SD 1L4AA 2IFMA 1JTHB 4O9BA 1G2CA 5APTA 1FOSF 1JY2O 1L4AB 1SQVK 3V2NA 1G2CB 1OXZA 1FZAA 1HBWA 1NHLA 3IFMA 2NPSD 1SFCD 2WSCH 3U1CA 2POHA 5CJ0A 1GL2C 2W27A 3KYQA 4AUWA 1N2DC 3M0DC 1NH4A 4C7NA 2ZXEB 1RF0C 5CCGA 3RL0B 4N78D 4Y99C 3P7KA 1IFMA 3A7OA 1M7LA 2R3CA 1JUNA 2P7JA 3P8CE 3V4QA 3RK2D 2I1JA 1ZN5A 4DZOA 2WSFH 2GUVA 1SVFA 4GT1A 2WPQA 5CCHD 1J1DB 3H6PA 5AW5B 1N7SA 1LTJC 2YO2A 2KYVA 1FDMA 4WY4B 1A02F 5AVZB 1N7SB 2QM8A 1IFIA 1GDTA 1WT6A 3TYYA 2NPSA 1SFCA 3M0AA 3U59A 5AVQB 3VTPC 2W6AA 3VYIA 3BRVB 4JYCA 1NAFA 2FKWB 2M8RA 1LWUC 3C9IA 1KILD 4M3LA 2NPSB 1SFCB 1JY3N 2Q9IA 1JOCA 1GD2E 2XDJA 1IJDB 3U1AA 2XNXA 3N4XA 3R2PA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTB C;  1HTL C;  1XTC C;  1LTT C;  1LTG C;  1LTA C;  1LTS C;  1LTI C; 
#chains in the Genus database with same CATH topology
 1OWA A;  2W6B A;  3AEA C;  3H1L G;  2HPC A;  3KQG A;  2P67 A;  3GF7 A;  1HF9 A;  3K5B A;  3TGU E;  1RF1 C;  3S1K A;  1AVO A;  3P8C D;  1GU4 A;  5KJ7 D;  1N73 C;  1KMI Z;  4DJG A;  1KC8 Q;  1NTZ J;  2OYI C;  2LKM A;  1PP9 E;  1T2K C;  3L4F A;  1JY3 P;  4ASW A;  2QM7 A;  3JCU E;  4JQ0 D;  1NKN A;  3II6 A;  5AW4 B;  4GOF A;  4IOI H;  3NMD A;  1DH3 A;  3MUD A;  1KIL A;  5C39 A;  3VMA A;  1UII A;  3WU2 H;  1FZG A;  1EXI A;  1S5L E;  3EFF K;  5B5E E;  5AW3 B;  5KAI E;  4PV1 C;  2KSJ A;  4PJ0 E;  1ZP0 C;  3L74 G;  1LTI C;  4EDF A;  3CC7 P;  1S4X A;  1SQP J;  4LGD E;  3L36 A;  3B71 A;  3MIW A;  1L0L D;  1JM0 A;  3JC2 2;  5AVS B;  2BEZ F;  2FFD B;  4RO0 A;  3O8Z A;  1K9M Q;  2KB7 P;  4H44 C;  2JP3 A;  5CBN A;  2WVR A;  1HVV A;  2IFN A;  4JBZ A;  3GW6 A;  3N7N A;  1DD3 A;  3AE9 C;  1FZE A;  3CXH E;  2PGD A;  3LID A;  4JYB A;  1GL2 A;  3RK2 C;  3Q5R A;  3L70 D;  1OFC X;  3M0D A;  1KB9 H;  2ITA A;  1RF0 A;  2I8D A;  1LNQ A;  2RN0 A;  3L73 D;  5KAF E;  1L0N G;  2IBZ I;  1GMJ A;  1KYO D;  1VF5 B;  4C46 A;  2N1T D;  2B87 B;  1QL2 A;  4H13 D;  3VN0 A;  1VQO P;  2QEX P;  3HRN A;  1X22 A;  2WIT A;  2RMZ A;  3A0H H;  4IFM A;  1NTM D;  3BRT B;  3CCM P;  1QGK B;  1IK7 A;  5KLV D;  1QL1 A;  1IZN B;  4Y28 J;  2FBW C;  1JMB A;  4L75 A;  1LWU A;  1XTG B;  1HGZ A;  2P1J A;  3CXH I;  2E76 B;  2IZ0 A;  1IFJ A;  1NTK G;  2AEJ A;  3SFD C;  3BCC J;  3PRJ A;  1CI6 A;  2YIU C;  5GTH H;  3CMA P;  1URQ B;  2WSE J;  2Q3I A;  3B5N D;  2QJK C;  1DIP A;  3GHG B;  3LW5 J;  1DD4 A;  3RBX A;  1BGY E;  4D6T E;  2IZ1 A;  4GDO A;  2JKV A;  2PP6 A;  3H1K G;  3RGU A;  3ABV C;  2J5U A;  1VPC A;  3NXS A;  2FYU D;  1M1J A;  3H1H E;  5CHX A;  2P2U A;  2KNC A;  1P84 E;  4BXL A;  3ITK A;  3CX5 D;  2E42 A;  1SQV D;  4L74 A;  4CPG A;  3TDK A;  4RJT A;  2YKO A;  1LGH B;  1NWQ A;  4EYY Q;  1UIX A;  1BE3 G;  2Q5U A;  2XZR A;  3T97 A;  3HUS B;  5CCH C;  4UB8 E;  1NTZ E;  1SQB J;  2GUS A;  2YKP A;  2YO3 A;  1MFZ A;  2IX7 C;  4U3F J;  3VP8 A;  3AE1 C;  1NOH A;  3KZI E;  4PD4 E;  2WTY A;  4IL6 E;  3Q3D A;  1Q2N A;  3TF5 A;  1E5W A;  2Q7C A;  1T3J A;  2KOG A;  3H1L J;  1ZRT D;  1N8R Q;  2D2C B;  1FZB A;  2M3E A;  4EIJ A;  4L76 A;  2OYH B;  4H0L B;  3RK3 B;  1AQ5 A;  3HD7 B;  3M9H A;  1DEB A;  2O01 N;  1H0T A;  1PGO A;  3GMA A;  1WRG A;  1P84 I;  1RE4 C;  1QVG O;  3A3Y B;  2A45 I;  3PTZ A;  3CCV P;  2ZAE B;  2FFD C;  2KSE A;  4DOJ A;  4WY4 D;  1JO5 A;  4AYC A;  1N7S D;  1JTH B;  3AE2 C;  5M1B A;  1JY2 O;  4BRY A;  1L4A B;  3V2N A;  2QIW A;  1RH5 B;  1L0L G;  2OYO A;  2NPS D;  1SFC D;  3SWK A;  4PD4 I;  2NZ2 A;  1FDO A;  4HJG H;  2GA1 A;  4KT0 J;  1IFM A;  4U7J A;  1YIT P;  1VF5 C;  3H1J D;  3ZDM A;  1ZN5 A;  1S5L X;  4DZO A;  3L70 G;  4GT1 A;  2WPQ A;  1WMK A;  5AW5 B;  2E74 B;  2ZJS E;  1BCC G;  3L73 G;  2QM8 A;  1IFI A;  1K73 Q;  3I55 P;  5EFW B;  3VTP C;  3BRV B;  4JYC A;  2FKW B;  2E76 C;  1KIL D;  2ZXX A;  1JOC A;  3S4R A;  4OGQ B;  1NTM G;  2IBZ D;  3CCR P;  3BCC E;  2O1J A;  1IFP A;  3M06 A;  4N3Y B;  1NTZ K;  1URQ C;  1K05 A;  1L0N D;  1OIP A;  2QJP B;  3HTK A;  2ZT9 B;  2W90 A;  3GHG C;  2A06 E;  3HE4 A;  1QLE D;  4NPF X;  4UB6 H;  2PAJ A;  2M5A B;  1YJN P;  2OTJ P;  2YMY A;  3PJS K;  1NTK J;  2HG5 D;  5CBO A;  1AVY A;  3FWN A;  2SPZ A;  3V2R A;  1SQX D;  2CK3 H;  4KJM A;  3CCS P;  3KDP B;  3L72 E;  2KS1 A;  2C9L Y;  1GL2 D;  5AVV B;  1ZR2 A;  1SQP K;  4BWN A;  2WZ7 A;  1NKZ B;  3V4W A;  3D6Y A;  3UIA A;  2AEM A;  1YI2 P;  3Q2Y A;  5L8R J;  1GZL A;  1H89 A;  2L91 A;  3HUS C;  2FYU G;  4IFF A;  3M9Q A;  2QSI A;  3PP5 A;  3WMM 0;  2KZJ A;  3JCU H;  4R4M A;  1SQB E;  1NU1 D;  3I5C A;  4U3F E;  1FZC A;  2VRS A;  1YJ9 P;  2NPS C;  5KLI B;  2R44 A;  3O6Q B;  1PPJ D;  1HTL C;  3H1K D;  1S3J A;  3FXD A;  2Y9Y A;  1S5L H;  4WY4 A;  2D2C C;  2N9B A;  1ZR4 A;  5B5E H;  1JEK A;  3H1L E;  5KAI H;  2WSF J;  4PJ0 H;  1BE3 J;  1BGY J;  2QJK B;  2OYH C;  4H0L C;  3RK3 C;  2R5D A;  1SS1 A;  2XU6 A;  3A2A A;  1S9K E;  3HD7 C;  3H32 B;  1EZV D;  1OMI A;  3BAS A;  1W2E A;  3V5B A;  2H8P D;  1HJB A;  3FXE A;  4TT3 H;  1E79 H;  3E1I A;  2YXR B;  2AEF A;  3CD6 P;  3CXH H;  4C7R A;  1Z56 A;  1GW3 A;  1L4A C;  5APU A;  1KB9 D;  3MUD C;  1GU5 A;  3RL0 g;  3L74 E;  2C0W A;  3AEB C;  3RK3 E;  5KAF H;  2BCC D;  3TK1 A;  4IL6 X;  4WBA A;  2FYN B;  4YTP C;  4LC1 A;  5CCG C;  1NVO A;  1T6A A;  1HH0 A;  2C9N Y;  5APV A;  3L75 G;  1AA0 A;  3TNU B;  2R32 A;  2AXC A;  2E74 C;  1L0L J;  1M90 Q;  1RF1 A;  2JR8 A;  1NJI Q;  3KHU A;  1N73 A;  1AFO A;  2N1T B;  2YNY A;  1HWT C;  4H13 B;  2OYI A;  3H1J G;  1OX3 A;  2V7Q J;  1SQQ D;  3SFE C;  2JWD A;  4N6J A;  1GTW A;  2DW3 A;  3EFG A;  4OGQ C;  3G9R A;  2E75 D;  2Y0C A;  5E79 E;  1USE A;  2QJP C;  5AVR B;  5KKZ B;  1SQB K;  4OWF A;  1KFM A;  2ZT9 C;  3L73 J;  1SQP D;  4I7Z B;  4A7P A;  3LIE A;  4K35 A;  4QMA A;  5APS A;  4HB1 A;  2IBZ G;  2V4H A;  1FDI A;  1BCC D;  1PFI A;  3CL3 D;  3WUT A;  3WUV A;  2K1A A;  1PL5 A;  3SWF A;  3B5N B;  4GKG A;  4EOT A;  1NTK E;  1NTM J;  1P84 H;  2A45 H;  2QA4 P;  5KLV J;  3IAO A;  2FXM A;  1LTJ A;  2KLV A;  3P32 A;  1LT9 B;  4HYT B;  1Q82 Q;  4I6M C;  4HKZ H;  4UB8 H;  3HE5 A;  3V6I A;  1FE6 A;  1SQX G;  1X0T A;  2C0X A;  1VQM P;  2J59 M;  1KQF B;  1X79 B;  3VOP A;  1W2B O;  4GIF A;  3KZI H;  3MTU E;  4PD4 H;  2WT7 A;  3CC4 P;  5AW6 B;  4IL6 H;  1Q86 Q;  1EC5 A;  1RQV A;  3S9O A;  2KUB A;  5KLI C;  3AEF C;  5KJ7 C;  5DJT B;  1PIX A;  2J58 A;  2QVA A;  1FOS F;  2E5T A;  2P10 A;  1G2C B;  1BE3 E;  2FYU J;  1NU1 G;  2BEQ D;  3G4S P;  2KS1 B;  1LP1 B;  2POH A;  2O01 J;  1PPJ G;  2V7Q H;  2LXC B;  1SQV J;  1N2D C;  4C7N A;  1YIJ P;  1W5C E;  4N78 D;  3L72 J;  2R3C A;  2OTL P;  3P8C E;  3CC2 P;  1EZV G;  3CWB D;  2E5Y A;  3USS A;  1ZME C;  3L71 J;  3MP7 B;  2YO2 A;  4WY4 B;  1A02 F;  1N7S B;  2K9J A;  1S1C X;  1GDT A;  1WT6 A;  2H89 C;  1KOR A;  4D6T G;  2FYN C;  1EDJ A;  2NPS B;  1SFC B;  1JY3 N;  2B9B A;  3H1I D;  3AE5 C;  1GD2 E;  3EWK A;  2XDJ A;  1IJD B;  2KK7 A;  2XNX A;  3N4X A;  5APX A;  4ZKU A;  2CPB A;  1SP4 A;  5CJ4 A;  2BCC G;  1L0L E;  1NTK K;  2HPC B;  2N1T C;  2AXT E;  4H13 C;  5CCH A;  2CPS A;  5AW2 B;  2P58 A;  3AEE C;  5CMZ A;  4W7Y A;  4I2L C;  2K9Y A;  3A0B E;  1EDL A;  3SWY A;  1VQN P;  1K8A Q;  3OA7 A;  1AJY A;  2WSE H;  5KKZ C;  3M9B A;  2W83 C;  1H88 A;  1FC2 C;  3KXD A;  1KIL B;  1VQ6 P;  1SQQ G;  2WPR A;  3L74 J;  3L75 D;  4I7Z C;  5DJU B;  1QVF O;  3LW5 H;  3L73 E;  1VQP P;  1J2J B;  1U7M A;  2WSS H;  3H1J J;  4RKU J;  1VQ4 P;  1KYO E;  1RE4 A;  2JEE A;  3OJA B;  5BVZ A;  3B5N C;  2FFD A;  1JY2 P;  1OW7 A;  3TGU D;  2Z4E A;  1NTM E;  3CI9 A;  1SQP G;  2QJY B;  3G3Z A;  5AW1 B;  5KLV E;  1PP9 D;  3P8M C;  1KQG B;  1LT9 C;  1MFT A;  3V2P A;  2NRG A;  1KN7 A;  2Q6Q A;  1X9V A;  3GG2 A;  1EXJ A;  1DX7 A;  2ZVO B;  1EQ7 A;  1S72 P;  1GL2 B;  1NYH A;  1YJW P;  1L0N J;  1Y8A A;  1RY3 A;  3TSI A;  1OW8 A;  3F89 A;  3QWO C;  2XND H;  1RE3 A;  1G1J A;  3D70 A;  1S2E A;  2JJL A;  1RQU A;  1JMM A;  5APW A;  3V2Q A;  1KYO I;  2W6J H;  2UWJ E;  1T2K D;  1JCC A;  2FYU E;  2JO1 A;  5B66 E;  1SQX J;  1LTJ B;  1G1I A;  1R8E A;  1T3U A;  3CME P;  2IYO A;  2O1K A;  3AE7 C;  1FU1 A;  3CX5 E;  3CXH D;  4YXW H;  4W7Z A;  3CCL P;  2HYN A;  1L0L K;  1SQV E;  1BSH A;  1LWU B;  4K3A A;  1IC2 A;  1FJP A;  2IDB A;  1QEX A;  2E43 A;  2R3S A;  1LT1 A;  1URQ A;  5GTI E;  4PV1 D;  2L5G B;  1J1E B;  3BCC G;  3FGA D;  2PFX A;  2Z5H A;  5AVT B;  1HUC A;  1NU1 J;  3GHG A;  1CI6 B;  2K88 A;  4WY4 C;  2QG4 A;  1N7S C;  3L71 E;  1KTM A;  1YTZ T;  1OZH A;  2H7H A;  4TLF A;  3H1K J;  1YBK A;  4H44 D;  3OW2 O;  2JDI H;  2K3R A;  1ZRT E;  4RES B;  1SFC C;  3IR9 A;  3CWB G;  3AE4 C;  4L73 A;  1LTG C;  4C7N B;  1ZLL A;  1M1J B;  2KNC B;  2QE7 H;  1A02 J;  5AVX B;  2Y0E A;  1MKM A;  3D6Z A;  1LTA C;  1RHZ B;  3HUS A;  1NTM K;  2PRR A;  4OH8 B;  1PZQ A;  3H1I G;  1VQ9 P;  1NAY A;  3CPW O;  2GM4 A;  5KLV K;  3T97 B;  2ZYG A;  5BU8 B;  2WPS A;  5E79 H;  1XTC C;  3CLQ A;  2HOD A;  1BGY D;  4D6T D;  2OTK E;  5TIS E;  1VQ8 P;  5H2F E;  1LTT C;  2BCC J;  1JY3 O;  1KIL C;  1GK4 A;  1QX8 A;  4HH2 A;  2OYH A;  1ZOY C;  5AVU B;  2WQY C;  3HD7 A;  3RL0 D;  2E75 B;  4AQR D;  3H1H D;  3CCU P;  3EQ2 A;  1SLQ A;  3H1J E;  2YKQ A;  3JSV C;  1P84 D;  1FS0 E;  2XV5 A;  1H0T B;  4WVZ A;  2FYZ A;  2IPP A;  2FYU K;  2I1K A;  2QJY C;  1JTH A;  1CSB A;  1JY2 N;  1L4A A;  1PGQ A;  1NTZ D;  1BDD A;  2RH0 A;  1R5L A;  1USD A;  3IN6 A;  5APT A;  1SQQ J;  1SQV K;  2WPV B;  3G71 P;  1NGM B;  1OXZ A;  1FZA A;  1HBW A;  4PD4 D;  1KIL E;  1NHL A;  4BRY B;  3TGU G;  2WMM A;  2IBZ E;  1GL2 C;  1OVR A;  2OGU A;  3KYQ A;  1L0N E;  1PP9 G;  3M0D C;  1Q7Y Q;  1NH4 A;  3MHV A;  2ZXE B;  4DT0 A;  1RF0 C;  5CCG A;  3D71 A;  1M7L A;  3L70 J;  1JUN A;  2P7J A;  2I1J A;  3AE6 C;  1BCC J;  2WSF H;  1K04 A;  1AQT A;  2W8Z A;  5CCH D;  1J1D B;  1Q90 D;  2QRX A;  1LTJ C;  1FDM A;  5AVZ B;  1SQX E;  1ZW0 A;  1VQL P;  3TYY A;  3M0A A;  3U59 A;  5AVQ B;  2JWA A;  2M8R A;  1LWU C;  4M3L A;  4OVN F;  2Q9I A;  3FWL A;  3U1A A;  1FOS E;  2YMK A;  2Y9Z A;  1J1E C;  2MJZ A;  2OQQ A;  3IF4 A;  3NFQ A;  4JPZ B;  2WWW A;  1EDK A;  3CCQ P;  1NU1 E;  2M5A A;  3MZW B;  3B8E B;  3WU2 E;  2KIK A;  3HTK B;  4XA4 A;  3L37 A;  5AVY B;  2HR3 A;  5BU5 A;  3Q5S A;  4GOD A;  1PPJ E;  3H1K E;  3HE4 B;  1CZQ A;  1MV8 A;  1KV4 A;  2FXP A;  2FY8 A;  1IK9 A;  3W68 A;  1VQ5 P;  3KPE A;  3B4S A;  3RL0 C;  3AE3 C;  1M1K Q;  3VMY A;  3E1R A;  4KHX A;  1M1J C;  1M56 D;  1EZV E;  1ZXG A;  2HLO A;  2G8Y A;  2AXT H;  1YQ3 C;  3C8V A;  3MGN A;  2H88 C;  4ASV A;  1JCD A;  2G3A A;  2B88 A;  4MN4 C;  3BCC D;  5APY A;  1AV1 A;  2K37 A;  1MUU A;  3A0B H;  1VF5 D;  1IFN A;  5KTB A;  3CWB J;  5KJ7 A;  1KB9 E;  3O6Q A;  2A06 D;  2HFE D;  1MZ9 A;  3E7K A;  1YTZ I;  1FZC B;  3BVH A;  1KFN A;  3G6E P;  1JB0 J;  1L0N K;  3C1L A;  2BCC E;  3PH0 A;  3QH9 A;  4B86 A;  4ZMD A;  4YXD C;  1VL2 A;  3H32 A;  2E75 C;  5AW0 B;  4XE5 B;  1KYO H;  3H1I J;  3L35 A;  2E76 D;  3L72 D;  1KQL A;  4ZNC A;  3A0H E;  3VMZ A;  1BGY G;  5AVW B;  1IO4 A;  1BSN A;  3RBZ A;  3CCE P;  1GW4 A;  3MD0 A;  5APQ A;  3WUU A;  2BAS A;  1EZV I;  4GOE A;  2LXB A;  1URQ D;  1T8Z A;  2KP8 A;  2Q1K A;  4Y99 B;  1HGV A;  3OAK A;  1SQX K;  3PLN A;  2ZFC A;  3H1H G;  1FBM A;  3L71 D;  1HJ0 A;  1EDI A;  3A5T A;  1L2P A;  1SQB D;  2A45 G;  1SQQ E;  3VP9 A;  2HOD B;  1LTB C;  2OAR A;  1KD1 Q;  4WWI A;  4U3F D;  2ZVN B;  1U57 A;  5GTH E;  1KB9 I;  3AE8 C;  1PGJ A;  4XFJ A;  3H1L D;  3W67 A;  1NTZ G;  1PGP A;  3AEG C;  1U7J A;  2Y0D A;  1Y47 A;  3L75 J;  1NU1 K;  1SQP E;  3TNU A;  1S9K D;  4W80 A;  1PV3 A;  3L70 E;  4JF7 A;  2XKM A;  3VMX A;  2R5B A;  4WB4 A;  1BCC E;  1J1D C;  5B66 H;  1N86 A;  1H8A A;  4ZKP A;  2N1T A;  3TGU J;  1CW5 A;  1VDF A;  2O01 H;  1RF1 B;  4I1L A;  2WSC J;  4EI2 A;  3Q1M A;  3CX5 H;  1YQ4 C;  2KZI A;  3CCJ P;  1N73 B;  1PP9 J;  2OYI B;  2D2C D;  1FAV A;  1YYC A;  5GTI H;  2Z5I A;  1NO4 A;  3L74 D;  2ZYD A;  2B89 A;  4H0L D;  3RK3 D;  4IFD K;  3BAT A;  3HD7 D;  1KQS O;  1X8Y A;  2KI7 B;  4NPD A;  1RE3 C;  1FJK A;  1IFD A;  5AW9 B;  4NPE A;  4PV1 B;  3Q5P A;  2O3J A;  2YXQ B;  1YHQ P;  3F5H A;  4LLH A;  3AEC C;  1DEE G;  3B5N A;  2KXP B;  1VQK P;  3M91 A;  5AW7 B;  2B87 A;  1L4A D;  1Q81 Q;  3AED C;  4YPC A;  1ZV8 A;  1TU3 F;  4DCK A;  1OVU A;  2Q3E A;  4H44 B;  1LT9 A;  1M8O B;  2M0B A;  1BDC A;  1GK6 A;  4Z1M H;  5KLV G;  1OW6 A;  4N78 E;  1JNM A;  1LTS C;  3FX0 A;  4R4L A;  5CCG D;  5TJH A;  1N7L A;  1OVV A;  3SSU A;  2IYP A;  2N9Y B;  5AW8 B;  1KZU B;  3RK2 B;  2M3B A;  3HE5 B;  1SQQ K;  3CWB E;  5TIS H;  3NTN A;  5H2F H;  2WT7 B;  2E74 D;  2H43 A;  1FZC C;  1FZF A;  3R4Y A;  2IFM A;  4O9B A;  1G2C A;  2LR2 A;  1LP1 A;  2MKV A;  1NTK D;  1D7M A;  3IFM A;  3H1I E;  2A06 G;  2WSC H;  1LJ2 A;  3U1C A;  4OGQ D;  3GF3 A;  5CJ0 A;  1Y9B A;  2W27 A;  1M57 D;  2KLU A;  4AUW A;  1VQ7 P;  3RL0 B;  3I56 P;  4Y99 C;  3P7K A;  2FXO A;  3A7O A;  1SQV G;  2ZT9 D;  3PHL A;  2ZYA A;  3V4Q A;  3RK2 D;  5K5G B;  3L72 G;  2GUV A;  3CX5 I;  1R5S A;  1SVF A;  2YIU B;  3H6P A;  1N7S A;  2KYV A;  4D6T J;  2RKL A;  3L71 G;  2K9J B;  2NPS A;  1SFC A;  4UB6 E;  2W6A A;  3VYI A;  1SQB G;  1NAF A;  3GLM A;  1BE3 D;  3C9I A;  3L75 E;  4U3F G;  3H25 A;  3H1H J;  3R2P A; 
#chains in the Genus database with same CATH homology
 5APX A;  2O1J A;  4ZKU A;  1OWA A;  3M06 A;  4N3Y B;  2CPB A;  1NTZ K;  1SP4 A;  1URQ C;  1J1E C;  2MJZ A;  2W6B A;  3NFQ A;  5CJ4 A;  2HPC A;  3HTK A;  2WWW A;  3KQG A;  2P67 A;  1NTK K;  3B8E B;  1RF1 C;  2HPC B;  2N1T C;  3GHG C;  3HTK B;  4XA4 A;  3HE4 A;  3L37 A;  5AVY B;  5BU5 A;  3P8C D;  1GU4 A;  5CCH A;  2PAJ A;  5KJ7 D;  1N73 C;  2CPS A;  5AW2 B;  3HE4 B;  5CMZ A;  2OYI C;  1CZQ A;  4W7Y A;  2LKM A;  2YMY A;  1MV8 A;  4I2L C;  1T2K C;  3L4F A;  1IK9 A;  1JY3 P;  3KPE A;  3SWY A;  2QM7 A;  2HG5 D;  3RL0 C;  1NKN A;  3II6 A;  3V2R A;  3VMY A;  5AW4 B;  4KHX A;  3KDP B;  1M1J C;  3NMD A;  1DH3 A;  3MUD A;  3OA7 A;  1KIL A;  2WSE H;  3M9B A;  2C9L Y;  1H88 A;  2HLO A;  1GL2 D;  1FZG A;  5AVV B;  1ZR2 A;  1SQP K;  2WZ7 A;  1KIL B;  3MGN A;  1NKZ B;  3V4W A;  3UIA A;  2WPR A;  1JCD A;  3LW5 H;  5AW3 B;  1GZL A;  1H89 A;  1J2J B;  2KSJ A;  3HUS C;  4IFF A;  5APY A;  3M9Q A;  3PP5 A;  1LTI C;  3WMM 0;  1MUU A;  1RE4 A;  2JEE A;  1IFN A;  3OJA B;  5KTB A;  5BVZ A;  4LGD E;  3L36 A;  3B5N C;  3MIW A;  2FFD A;  1JY2 P;  5KJ7 A;  5AVS B;  3I5C A;  2Z4E A;  1FZC A;  2VRS A;  2HFE D;  2NPS C;  1MZ9 A;  2FFD B;  3CI9 A;  3O8Z A;  2KB7 P;  3G3Z A;  1YTZ I;  1HVV A;  1HTL C;  1FZC B;  5AW1 B;  3BVH A;  1KFN A;  4WY4 A;  2N9B A;  1ZR4 A;  2IFN A;  3P8M C;  1L0N K;  1LT9 C;  3N7N A;  4B86 A;  3V2P A;  1FZE A;  3H32 A;  1X9V A;  5AW0 B;  4XE5 B;  2OYH C;  3LID A;  3RK3 C;  3L35 A;  2R5D A;  4JYB A;  2XU6 A;  3A2A A;  1GL2 A;  1S9K E;  1DX7 A;  3HD7 C;  1KQL A;  3H32 B;  3RK2 C;  3VMZ A;  5AVW B;  1EQ7 A;  3BAS A;  1W2E A;  3V5B A;  1GL2 B;  1IO4 A;  2H8P D;  3M0D A;  1GW4 A;  3MD0 A;  1RF0 A;  5APQ A;  1HJB A;  2BAS A;  1RY3 A;  3TSI A;  1URQ D;  1T8Z A;  3E1I A;  2KP8 A;  4Y99 B;  1HGV A;  3OAK A;  1SQX K;  2ZFC A;  1RE3 A;  1G1J A;  1FBM A;  2JJL A;  1JMM A;  5APW A;  4C46 A;  4C7R A;  2N1T D;  1QL2 A;  3VN0 A;  1Z56 A;  3V2Q A;  1GW3 A;  3A5T A;  1L4A C;  5APU A;  3HRN A;  2A45 G;  3VP9 A;  2WIT A;  2HOD B;  1LTB C;  2OAR A;  1GU5 A;  1T2K D;  4IFM A;  1JCC A;  3BRT B;  1LTJ B;  2C0W A;  1G1I A;  1T3U A;  1QL1 A;  2O1K A;  1FU1 A;  3TK1 A;  1LWU A;  4W7Z A;  2HYN A;  1L0L K;  1HGZ A;  1XTG B;  4WBA A;  2P1J A;  1NU1 K;  4LC1 A;  5CCG C;  1LWU B;  1HH0 A;  3TNU A;  1S9K D;  4W80 A;  1IC2 A;  1IFJ A;  1FJP A;  2C9N Y;  5APV A;  4JF7 A;  2E43 A;  2XKM A;  3VMX A;  1URQ A;  3TNU B;  2R5B A;  2R32 A;  4WB4 A;  1FOS E;  1CI6 A;  2L5G B;  1J1D C;  1URQ B;  1J1E B;  1N86 A;  1H8A A;  2Z5H A;  1RF1 A;  5AVT B;  4ZKP A;  1HUC A;  3GHG A;  2N1T A;  1CI6 B;  2Q3I A;  4WY4 C;  3B5N D;  1N7S C;  1CW5 A;  1VDF A;  1YTZ T;  2O01 H;  1N73 A;  1RF1 B;  4I1L A;  1AFO A;  3GHG B;  2YNY A;  2N1T B;  1HWT C;  2H7H A;  2OYI A;  1N73 B;  2OYI B;  2PP6 A;  4N6J A;  1GTW A;  4RES B;  1SFC C;  3IR9 A;  1FAV A;  3EFG A;  1VPC A;  3NXS A;  1YYC A;  2Z5I A;  1NO4 A;  1M1J A;  5CHX A;  2P2U A;  1LTG C;  3RK3 D;  4C7N B;  4IFD K;  1ZLL A;  3BAT A;  1M1J B;  3HD7 D;  5AVR B;  1X8Y A;  1SQB K;  2E42 A;  1RE3 C;  1FJK A;  1A02 J;  1KFM A;  5AVX B;  1LTA C;  1IFD A;  1LGH B;  2YKO A;  1NWQ A;  3HUS A;  2Q5U A;  2XZR A;  5AW9 B;  1NTM K;  4OH8 B;  3T97 A;  3LIE A;  3HUS B;  2GM4 A;  5APS A;  4LLH A;  5KLV K;  1PFI A;  5CCH C;  3B5N A;  3CL3 D;  3M91 A;  2GUS A;  5AW7 B;  2YKP A;  2YO3 A;  5BU8 B;  3SWF A;  1MFZ A;  3B5N B;  2IX7 C;  1L4A D;  2WPS A;  4GKG A;  3VP8 A;  1XTC C;  1NOH A;  4EOT A;  2WTY A;  1ZV8 A;  3CLQ A;  2HOD A;  2A45 H;  1LT9 A;  2FXM A;  1LTJ A;  1E5W A;  1LTT C;  1T3J A;  2KOG A;  2KLV A;  2Q7C A;  1KIL C;  1JY3 O;  1GK4 A;  4HH2 A;  1FZB A;  3P32 A;  1LT9 B;  1GK6 A;  2OYH A;  4EIJ A;  5AVU B;  4HYT B;  4N78 E;  3HD7 A;  3RL0 D;  4I6M C;  4AQR D;  1JNM A;  2OYH B;  1LTS C;  3RK3 B;  3EQ2 A;  3HE5 A;  1SLQ A;  2YKQ A;  5CCG D;  1AQ5 A;  3HD7 B;  2C0X A;  1N7L A;  3M9H A;  1DEB A;  5AW8 B;  2J59 M;  1X79 B;  1KZU B;  3VOP A;  3RK2 B;  4GIF A;  2M3B A;  3HE5 B;  1WRG A;  3MTU E;  1SQQ K;  2WT7 A;  1RE4 C;  3A3Y B;  2XV5 A;  5AW6 B;  2A45 I;  2FYZ A;  2IPP A;  3NTN A;  2WT7 B;  2FFD C;  2FYU K;  2H43 A;  2I1K A;  5KJ7 C;  4DOJ A;  1JTH A;  1FZC C;  4WY4 D;  1CSB A;  1JO5 A;  1FZF A;  2J58 A;  4AYC A;  1JY2 N;  1N7S D;  1L4A A;  2IFM A;  1JTH B;  4O9B A;  1G2C A;  5APT A;  1FOS F;  1JY2 O;  1L4A B;  1SQV K;  3V2N A;  1G2C B;  1OXZ A;  1FZA A;  1HBW A;  1NHL A;  3IFM A;  2NPS D;  1SFC D;  2WSC H;  3U1C A;  2POH A;  5CJ0 A;  1GL2 C;  2W27 A;  3KYQ A;  4AUW A;  1N2D C;  3M0D C;  1NH4 A;  4C7N A;  2ZXE B;  1RF0 C;  5CCG A;  3RL0 B;  4N78 D;  4Y99 C;  3P7K A;  1IFM A;  3A7O A;  1M7L A;  2R3C A;  1JUN A;  2P7J A;  3P8C E;  3V4Q A;  3RK2 D;  2I1J A;  1ZN5 A;  4DZO A;  2WSF H;  2GUV A;  1SVF A;  4GT1 A;  2WPQ A;  5CCH D;  1J1D B;  3H6P A;  5AW5 B;  1N7S A;  1LTJ C;  2YO2 A;  2KYV A;  1FDM A;  4WY4 B;  1A02 F;  5AVZ B;  1N7S B;  2QM8 A;  1IFI A;  1GDT A;  1WT6 A;  3TYY A;  2NPS A;  1SFC A;  3M0A A;  3U59 A;  5AVQ B;  3VTP C;  2W6A A;  3VYI A;  3BRV B;  4JYC A;  1NAF A;  2FKW B;  2M8R A;  1LWU C;  3C9I A;  1KIL D;  4M3L A;  2NPS B;  1SFC B;  1JY3 N;  2Q9I A;  1JOC A;  1GD2 E;  2XDJ A;  1IJD B;  3U1A A;  2XNX A;  3N4X A;  3R2P A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...