1LTAC

2.2 angstroms crystal structure of e. coli heat-labile enterotoxin (lt) with bound galactose
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
45
structure length
45
Chain Sequence
GDTCNEETQNLSTIYLREYQSKVKRQIFSDYQSEVDIYNRIRDEL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HEAT-LABILE ENTEROTOXIN, SUBUNIT B
publication title Galactose-binding site in Escherichia coli heat-labile enterotoxin (LT) and cholera toxin (CT).
pubmed doi rcsb
source organism Escherichia coli
molecule tags Enterotoxin
total genus 16
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 1993-09-15
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.240 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1ltaC00
1LTIC 1LTGC 1LTTC 1XTCC 1LTBC 1LTSC 1LTAC 1HTLC
chains in the Genus database with same CATH superfamily
1SP4A 3QH9A 3L71D 1BGYD 2IYOA 4WBAA 1U57A 1QL1A 3M0AA 3A0BE 1X79B 3I55P 2WSEJ 2H43A 4PJ0E 2W6JH 3P8MC 3O8ZA 1Q90D 4WY4A 1KQSO 5KLVE 3AE2C 3V6IA 1LJ2A 1NU1J 1RF1A 4YXWH 1SQBK 3VTPC 2NPSA 4D6TD 1RE3A 3TGUG 1IFIA 4ZKPA 1SQPG 3KPEA 3JCUH 2E76B 2SPZA 1T8ZA 1IK7A 4N78E 1RHZB 3B5NB 2CK3H 2E75C 1RH5B 2QEXP 2WT7B 1ZRTE 4H13B 1NTMJ 1S5LX 2FKWB 2KNCA 3L73D 4YXDC 1BCCE 1EDKA 1NU1G 2BEZF 1KC8Q 1LTJC 1Y8AA 2WSCH 3L74D 2ITAA 3L4FA 3HUSA 3U59A 1WRGA 3N7NA 3M0DA 2QJYC 4H0LC 4W80A 3PRJA 2R32A 1M57D 1HJ0A 2A06D 3BRVB 3RGUA 1TU3F 2VRSA 1D7MA 2IBZG 4QMAA 4I7ZC 2IDBA 2N9YB 5CBOA 2BASA 2E76D 1S5LH 1NVOA 1URQC 2IYPA 2Z4EA 3O6QB 5APYA 1ZXGA 4RKUJ 3B5ND 1SQVE 3JCUE 3TK1A 3H1JE 1FE6A 2V7QH 2XV5A 1L0LJ 1KMIZ 1LT9C 3L70E 3IAOA 4GT1A 4KT0J 5CHXA 3L71J 2E43A 4H13D 1FDMA 3ITKA 1BGYJ 2JJLA 2KIKA 1ZLLA 3AE8C 3V2RA 4I6MC 1OW6A 1FZGA 2C9LY 3RK3B 1VQ8P 4DT0A 2M3BA 3U1CA 4I1LA 1KILA 2JO1A 1JO5A 3CX5D 3GF7A 4LC1A 1JM0A 1IJDB 2RH0A 2PFXA 2W27A 1PV3A 3WUTA 4D6TJ 1YQ4C 2J58A 1M1JB 4EDFA 1FDIA 3H1HE 3SWFA 5CBNA 1OVUA 1L0LG 3L71G 2N9BA 2QJKB 2FYZA 1BGYG 1N7SC 5KAFH 3ZDMA 1S3JA 3SWKA 1G1IA 3CCLP 3PLNA 2FYNB 2UWJE 3L73J 1S5LE 4GKGA 4W7YA 3C9IA 1BSHA 1RF1B 1NAFA 2ZYAA 1L0ND 3OJAB 3L74J 1NAYA 1KFMA 3RK3D 1W2EA 1U7JA 3CX5I 5APVA 5CCHD 1OXZA 2OTKE 1PP9E 2XDJA 1P84H 2O3JA 2Q7CA 4PD4D 1H89A 3Q3DA 2B9BA 2Q9IA 3HD7B 1WT6A 2QSIA 3AEBC 1DD3A 1VQMP 1AVYA 1HWTC 2IZ1A 3HE5A 4DJGA 2FYUK 1MUUA 2L5GB 4UB8H 3KQGA 3L73G 1GDTA 1T3JA 1JUNA 2WSFH 5AVYB 4DOJA 1R5LA 3MUDA 3L74G 1MV8A 3AE4C 3CLQA 2IZ0A 3T97A 4L76A 1CSBA 5KAFE 2A06G 3QWOC 2WTYA 4JPZB 1MFZA 1RF0C 1JOCA 3L72D 4OWFA 1LTGC 1SQVG 1BE3E 2FBWC 1HUCA 2A45H 2OTLP 2E75B 2K1AA 3HTKA 3L70G 5CCGD 1CW5A 2OGUA 1HTLC 4IFMA 1KB9I 5AW0B 2YXRB 1PGOA 3HD7D 5AVZB 3PP5A 3L75E 3H1KD 1UIIA 1P84E 1AA0A 4O9BA 1YI2P 1LTJB 5M1BA 3TF5A 4DZOA 1ZP0C 4DCKA 4K3AA 2PGDA 3P8CD 2WQYC 4UB8E 1NU1K 2ZXXA 4H0LB 1GU4A 1GZLA 4Y99C 3TGUD 4B86A 4Z1MH 2KLVA 5KTBA 1L0NJ 1SQPD 1DH3A 3N4XA 2KI7B 3CXHI 2WITA 2K9YA 3B5NA 3L35A 1NTZE 2BCCE 1KZUB 1IO4A 2WT7A 1NOHA 2JWDA 5AVUB 1SQQE 1U7MA 2E75D 2JEEA 3A2AA 1NTKE 3MTUE 3ABVC 1J1DC 4KJMA 3GHGA 4JF7A 3M06A 3MP7B 1PGPA 2JWAA 2P2UA 3AE5C 4JYCA 3AE7C 1YTZT 3VOPA 4ZKUA 1N73C 2KS1B 1DEBA 1VQ9P 2J5UA 2IPPA 3RK2B 2M5AB 2QJPC 3W67A 2M8RA 1LNQA 4H0LD 3F89A 5AW7B 3NMDA 1EZVD 3FWLA 1SQXE 3L72J 2YMKA 3H1IE 3O6QA 2LXCB 3TYYA 3GMAA 1N7SB 1IFMA 1KTMA 1S9KD 2R44A 2P1JA 2G3AA 3H1KJ 1L0LK 3CCSP 2ZAEB 3RBXA 2R5BA 1EQ7A 3AEAC 4L74A 1GL2C 1QVGO 2E74C 4HH2A 1K9MQ 5CCHA 1OW7A 1IC2A 2Q5UA 5CJ0A 3CMAP 1NTME 1JY3P 1PL5A 2GM4A 2Q3EA 5AVSB 3L72G 5BU5A 1WMKA 1FAVA 1RE4A 1M1JA 2WWWA 1Q2NA 3TGUJ 2JDIH 3RK2D 1SQPJ 1L4AC 2XNDH 2KK7A 1FZBA 2H8PD 1EZVI 2NPSC 1RE3C 3E7KA 5KKZC 4PV1C 1KQLA 5KLVD 1HBWA 2W8ZA 1EXIA 3H1KG 3A3YB 1Q7YQ 1Z56A 3Q5RA 1ZMEC 4ASVA 3G4SP 1N7SD 2XNXA 5AVTB 2LXBA 3NXSA 3EFGA 3AE3C 1EDJA 2FXPA 5BU8B 1RQVA 2YIUC 1GU5A 3NTNA 3GW6A 2D2CB 4N78D 5DJUB 2KXPB 5APWA 5CCGA 3CWBE 1IFNA 4HJGH 1IFJA 3G9RA 1ZRTD 4OGQB 3Q5SA 3HD7A 4GIFA 4YTPC 3VMXA 1BCCD 3CCQP 1LWUC 5AW8B 1VQOP 3CC4P 1ZW0A 2KP8A 2KSJA 5TJHA 4WWIA 1LTIC 1GK4A 2B89A 1JY2P 4RO0A 2ZVOB 3GHGB 1G1JA 4BRYB 4IFFA 1PZQA 3RL0g 1JY3N 3H1LE 2KSEA 3D70A 4GDOA 3BATA 2OARA 3A0HH 1SVFA 3H1IG 2K9JB 4IOIH 2FFDC 3V5BA 1EDIA 3CCEP 1SFCC 2W6AA 3V2NA 1BDDA 2D2CD 2WPQA 1EZVG 2QA4P 1HJBA 1KV4A 2HPCA 1LTAC 2HYNA 1SQVD 5APUA 3H1JD 1SQBE 3KXDA 1T2KC 3L70D 4LLHA 3RL0B 1GD2E 3AEEC 3PTZA 4OGQD 2Z5HA 3S9OA 1MKMA 3BVHA 3F5HA 4L73A 2WSSH 1J1DB 3W68A 1LTJA 5KLVJ 5H2FH 4H44B 3B8EB 3FGAD 2WPVB 2Y0EA 2PAJA 1N73B 1EC5A 2Q1KA 3H1HD 2GUSA 4LGDE 2XKMA 2C0XA 4JQ0D 1L0NK 4U3FE 1NKNA 1Q86Q 5B66H 1URQA 1KFNA 2Y9YA 2AXTH 5KLIC 1JB0J 3A0HE 2YXQB 2QM7A 1KB9H 1HH0A 4MN4C 1BCCJ 5KLVG 1FZEA 2IFNA 1JY2N 3RL0D 2OYIC 1FBMA 2PP6A 1PIXA 2QE7H 3CPWO 1X0TA 1LTTC 3MIWA 2ZJSE 1OZHA 1NH4A 1PP9D 1YQ3C 3RBZA 4OVNF 1NKZB 2KS1A 4H44D 3MZWB 3V2PA 4JBZA 5CMZA 2M5AA 2L91A 3Q1MA 1SS1A 1FOSF 1SLQA 3K5BA 5H2FE 1A02F 3M91A 2KUBA 4C7NB 1H8AA 1L4AB 1UIXA 2RKLA 1PPJE 1BCCG 3I5CA 3GG2A 5KKZB 4PV1B 1SQVJ 1N7SA 2OYHC 2I1KA 3L70J 3TNUA 1FZCC 4K35A 5APQA 5KAIE 1GK6A 1LGHB 5B66E 1JCCA 3AEDC 2AXTE 3G71P 1ZOYC 1KB9E 1JMMA 2FY8A 3UIAA 2YIUB 3LW5H 1YITP 4IL6X 2Q6QA 2O01H 2GA1A 1J1EC 1BE3D 2WSCJ 5GTIH 3H1HJ 3BCCE 1BDCA 2V4HA 3G6EP 5AW5B 3L75D 1GW3A 3H1JG 3CCJP 2HPCB 1LWUB 1VQKP 1P84D 1SQPK 3U1AA 4PD4I 1X9VA 4HKZH 4BWNA 3MD0A 2HODA 1L4AD 1S4XA 3GF3A 2IFMA 1VF5C 1NO4A 3CCMP 4PV1D 3CXHE 2WSEH 4ASWA 2O1KA 4R4MA 3B5NC 4WVZA 4IL6H 1JCDA 2WPRA 2K37A 2FYUE 1M1KQ 1AQ5A 2YNYA 4H13C 2V7QJ 1N7LA 5AW9B 2QJYB 3VMAA 3H1HG 1GMJA 1YYCA 2O1JA 2FFDB 4ZNCA 5CJ4A 5BVZA 1Y9BA 1PP9J 5EFWB 4L75A 1NTZD 2BCCD 4RJTA 2ZT9C 3AEFC 4I7ZB 1SQQD 2P7JA 2NZ2A 1FDOA 3SWYA 1KYOH 1NTKD 1URQB 3H6PA 4U7JA 4NPEA 5TISH 1N2DC 1W2BO 1Q82Q 1FOSE 2KZIA 3WUUA 4EIJA 2KB7P 5GTIE 2HLOA 1LT9B 2HR3A 3SSUA 1USDA 3H32B 3M9QA 4KHXA 4BRYA 5E79H 1AV1A 2YKPA 1RY3A 3G3ZA 1ZN5A 4EOTA 1PP9G 3EWKA 3B4SA 1FU1A 1VQPP 5AW4B 3D6ZA 1SQXD 3CCRP 2ZVNB 2K9JA 4R4LA 3H1ID 1W5CE 2YO2A 2E42A 4IL6E 3PHLA 3RK3C 5KJ7C 1BE3J 1T3UA 2BEQD 5AVVB 3R4YA 1FS0E 1NU1E 2YO3A 5KLIB 1HVVA 1QLED 5K5GB 1JNMA 2KZJA 3L75J 1HGZA 1HGVA 1URQD 4EI2A 1ZR2A 4RESB 3KHUA 1RE4C 2OYIB 3TNUB 2A45I 3KYQA 2N1TC 1ZR4A 3VN0A 1KYOE 1NTMD 1PGJA 1FJKA 1K73Q 1KILE 5TISE 5KLVK 2IBZE 1S1CX 4XA4A 2ZYGA 3OW2O 1MFTA 3BCCG 5APSA 2QJKC 1N73A 2WSFJ 3KZIH 1BE3G 3IF4A 2FYNC 4GOEA 4WY4C 1T6AA 5E79E 3USSA 3WMM0 2P10A 4C7RA 1NTZJ 3L75G 1VDFA 2BCCJ 1RF1C 3CL3D 1IK9A 1SQQJ 1AFOA 3A7OA 4EYYQ 1LTSC 2CPSA 3IN6A 2OYHB 4JYBA 2HODB 1NTKJ 1FZCB 2C9NY 1JY3O 1IFPA 1JTHB 1KQFB 3FWNA 3GLMA 2M0BA 3HD7C 2LKMA 3H25A 3AECC 2C0WA 1LP1B 3CWBD 2J59M 1NYHA 2QM8A 3S4RA 1VQNP 1J1EB 1VQ7P 1L0LE 1NTZG 3L71E 2BCCG 1SQXJ 1BGYE 3TDKA 1SQQG 1AVOA 1OWAA 3H1IJ 4C7NA 1NHLA 1L4AA 4TLFA 3HUSC 1PGQA 1NTKG 3BRTB 3PH0A 3AE1C 3M0DC 4YPCA 3KZIE 2KOGA 2A45G 1VF5B 4CPGA 1SQVK 2POHA 3Q2YA 2ZXEB 1VQ6P 4D6TE 1OMIA 3H1LD 2W83C 1X8YA 2KLUA 3B71A 3EQ2A 1GTWA 3D6YA 2RN0A 1SQXG 3CI9A 4Y99B 1YJNP 1SQBD 1M7LA 3C1LA 3M9HA 2ZT9B 1G2CB 3CX5H 3L73E 5AW2B 1JY2O 2ZFCA 4AYCA 1QX8A 1LWUA 3VMZA 1KILC 2YKOA 3L74E 1DX7A 2P67A 2WVRA 1IFDA 1USEA 1VF5D 2A06E 2AEMA 1NTMG 3OA7A 2MJZA 3JSVC 3IR9A 1FZFA 3S1KA 1PFIA 1XTCC 3VP9A 4AQRD 5AVWB 5APTA 1L2PA 2QIWA 2B87A 1VQ5P 1CI6A 4HB1A 4U3FD 1N86A 2FFDA 2QJPB 3CWBJ 3OAKA 4XE5B 1SFCA 1M8OB 3P7KA 3V2QA 5KAIH 2R3SA 4ZMDA 1S72P 2ZT9D 3CCUP 1DIPA 2OYOA 2K88A 1KN7A 3RK2C 4PD4H 5B5EH 1NGMB 5AW6B 2Y0CA 1EDLA 3CX5E 1LT9A 3HRNA 2N1TB 1EXJA 1YBKA 3H32A 2H88C 2MKVA 2NRGA 3AEGC 2QRXA 4XFJA 3HE4A 3H1LJ 2DW3A 1GL2B 1K05A 2E74B 3CWBG 3CD6P 3CC7P 1FZAA 1FJPA 3P32A 3R2PA 2HG5D 3KDPB 5APXA 1HF9A 1PPJD 3Q5PA 3CC2P 1OVRA 3A5TA 4WY4B 4Y28J 3MUDC 1SQBJ 1LTBC 1H0TA 3SFDC 2AXCA 3CXHH 2B88A 3E1IA 4D6TG 2NPSB 5KJ7D 3WUVA 3FXEA 5GTHH 2GUVA 3H1JJ 3CMEP 2OYIA 1L0NE 2FXOA 2W6BA 4GOFA 1KB9D 3RK3E 4HYTB 3H1LG 1R8EA 2OTJP 4AUWA 1OFCX 1KQGB 2R5DA 4M3LA 1NJIQ 2N1TD 4PD4E 5B5EE 3BCCD 3MHVA 1Q81Q 4N6JA 3AE9C 2KNCB 1YHQP 1QVFO 3JC22 1SQBG 1GL2D 2E74D 1YIJP 3BASA 1VL2A 4U3FJ 2RMZA 4UB6H 4W7ZA 2Y9ZA 3HUSB 1RQUA 1Y47A 4WY4D 3TSIA 4A7PA 1LT1A 1NTZK 2D2CC 3VP8A 4C46A 3CXHD 1YJ9P 2OQQA 2OYHA 1E5WA 1H88A 1SQQK 1FZCA 2Z5IA 1ZV8A 2NPSD 1DD4A 2E76C 1JTHA 2FYUD 1NTKK 4OGQC 3V4QA 2R3CA 2H89C 2G8YA 3L72E 1KORA 1QGKB 5GTHE 1QL2A 1LP1A 5AVXB 3SFEC 5AVRB 1XTGB 3EFFK 4U3FG 1BSNA 1YJWP 2B87B 1CI6B 1RF0A 3I56P 1JMBA 1R5SA 1SFCB 3GHGC 1NWQA 2JP3A 3H1KE 2AEJA 2PRRA 1SQXK 1VQ4P 1KILB 1X22A 3WU2H 4IFDK 2HFED 3P8CE 1P84I 3FX0A 5C39A 3LIEA 3IFMA 2I8DA 1JEKA 4UB6E 1VQLP 3TGUE 1FC2C 1SQPE 1OVVA 2AEFA 1CZQA 4WB4A 3RL0C 4TT3H 3HE4B 1K04A 3L37A 1NTMK 3VMYA 1NU1D 1PPJG 2QVAA 3BCCJ 2E5YA 5AW3B 3PJSK 2JKVA 2P58A 2XU6A 1OW8A 1G2CA 3VYIA 4H44C 2CPBA 2IX7C 1L0NG 1H0TB 1SFCD 2E5TA 2YKQA 2XZRA 5CCHC 3V4WA 1J2JB 4NPFX 2W90A 1KYOD 2I1JA 1KILD 3C8VA 1T2KD 2IBZD 3A0BH 1M1JC 1OX3A 1KD1Q 4PJ0H 1AJYA 1M56D 2YMYA 1OIPA 2FYUJ 4BXLA 5DJTB 3M9BA 3AE6C 2Q3IA 2KYVA 2WPSA 3II6A 2Y0DA 3WU2E 3CCVP 3HE5B 1EZVE 1MZ9A 1S2EA 2QG4A 3LIDA 1E79H 2JR8A 2FXMA 2K3RA 4I2LC 1VPCA 5KJ7A 3D71A 1S9KE 4NPDA 2WMMA 2WZ7A 3LW5J 2O01J 1QEXA 3L36A 5AVQB 2M3EA 2O01N 1AQTA 3T97B 1M90Q 2LR2A 1A02J 3E1RA 1DEEG 2ZYDA 5L8RJ 4N3YB 2H7HA 3FXDA 1N8RQ 1K8AQ 2FYUG 4GODA 1YTZI 2N1TA 5CCGC 1KYOI 2IBZI 3MGNA 1IZNB 3HTKB 1GW4A 3NFQA 4OH8B 5AW1B 1L0LD 1GL2A
chains in the Genus database with same CATH topology
1SP4A 1LGHB 3A2AA 1FZFA 1JCCA 1PFIA 1XTCC 3MTUE 4WBAA 1J1DC 1QL1A 3M0AA 3GHGA 3VP9A 1X79B 4JF7A 4AQRD 5AVWB 2H43A 3P8MC 3O8ZA 5APTA 3M06A 1JMMA 1CI6A 4WY4A 1N86A 3UIAA 2FFDA 3LW5H 2P2UA 3OAKA 4XE5B 1SFCA 2O01H 4JYCA 1YTZT 3P7KA 3VOPA 1J1EC 1RF1A 4ZKUA 3V2QA 1N73C 1DEBA 1SQBK 2IPPA 3VTPC 2NPSA 3RK2B 1RE3A 2M8RA 1IFIA 4ZKPA 5AW7B 3NMDA 5AW5B 3KPEA 2HPCB 1GW3A 1LWUB 1T8ZA 3RK2C 1SQPK 3U1AA 1X9VA 3MD0A 2HODA 1L4AD 5AW6B 1LT9A 4N78E 3HRNA 2N1TB 2IFMA 3B5NB 3H32A 3TYYA 1NO4A 1N7SB 1IFMA 1S9KD 2WT7B 2WSEH 3HE4A 2P1JA 2O1KA 3B5NC 2FKWB 1JCDA 1GL2B 1FZAA 1FJPA 2WPRA 1L0LK 3P32A 3R2PA 1AQ5A 2HG5D 2YNYA 3KDPB 2R5BA 5APXA 1EQ7A 1N7LA 5AW9B 1LTJC 2WSCH 1GL2C 1YYCA 2O1JA 4HH2A 5CCHA 4WY4B 3A5TA 2FFDB 3L4FA 5CJ4A 3HUSA 5BVZA 1IC2A 2Q5UA 5CJ0A 3U59A 1WRGA 1JY3P 3N7NA 1LTBC 3M0DA 4W80A 2GM4A 5AVSB 3E1IA 5BU5A 2R32A 1FAVA 1RE4A 2P7JA 1M1JA 2WWWA 2NPSB 5KJ7D 3BRVB 3SWYA 2VRSA 3RK2D 1URQB 3H6PA 2GUVA 1N2DC 1L4AC 1FZBA 2H8PD 1FOSE 2OYIA 2NPSC 4EIJA 2W6BA 2BASA 1RE3C 2KB7P 4HYTB 2HLOA 1URQC 2Z4EA 1KQLA 5APYA 1LT9B 4AUWA 1HBWA 2R5DA 3A3YB 3H32B 3M9QA 4M3LA 4KHXA 2N1TD 3B5ND 3TK1A 1Z56A 2XV5A 1N7SD 2XNXA 5AVTB 5AW1B 1LT9C 4GT1A 4N6JA 5CHXA 2YKPA 1RY3A 2E43A 3G3ZA 3NXSA 1FDMA 1ZN5A 4EOTA 2JJLA 3EFGA 1FU1A 1ZLLA 1GL2D 3V2RA 4I6MC 5AW4B 1FZGA 2C9LY 3BASA 5BU8B 3RK3B 1GU5A 3NTNA 2M3BA 2YO2A 3U1CA 4I1LA 1KILA 2E42A 1JO5A 4W7ZA 4N78D 3HUSB 5APWA 4LC1A 4WY4D 3RK3C 5KJ7C 3TSIA 5CCGA 1T3UA 1IFNA 1IJDB 5AVVB 1IFJA 1NTZK 2YO3A 3VP8A 2W27A 4C46A 2J58A 1M1JB 2OYHA 1E5WA 1HVVA 1H88A 3HD7A 1SQQK 1FZCA 2Z5IA 1JNMA 4GIFA 3VMXA 1ZV8A 2NPSD 1LWUC 5AW8B 1HGZA 1HGVA 1JTHA 1NTKK 1URQD 1ZR2A 3SWFA 3V4QA 4RESB 1RE4C 2KP8A 2R3CA 2OYIB 3TNUB 2A45I 3KYQA 2N1TC 1ZR4A 2KSJA 1GL2A 3VN0A 2N9BA 2FYZA 1LTIC 1GK4A 1N7SC 1FJKA 1QL2A 5AVXB 5KLVK 1JY2P 5AVRB 4XA4A 3GHGB 1G1IA 1XTGB 1G1JA 5APSA 4IFFA 1N73A 1CI6B 1RF0A 1JY3N 4GKGA 1SFCB 3GHGC 4W7YA 3BATA 1NWQA 3C9IA 2OARA 1RF1B 1NAFA 1SVFA 3OJAB 4WY4C 2FFDC 1SQXK 1KFMA 3WMM0 3RK3D 3V5BA 1W2EA 1SFCC 1KILB 2W6AA 3V2NA 4C7RA 1VDFA 1RF1C 2WPQA 1HJBA 5APVA 5CCHD 1OXZA 2HPCA 4IFDK 1LTAC 3CL3D 2HYNA 1IK9A 2XDJA 5APUA 2HFED 1AFOA 3P8CE 3A7OA 2Q7CA 1LTSC 3LIEA 3IFMA 2CPSA 1H89A 1T2KC 2OYHB 4JYBA 4LLHA 2HODB 3RL0B 2Q9IA 1GD2E 3HD7B 1WT6A 2Z5HA 1FZCB 2C9NY 1JY3O 1HWTC 1JTHB 3BVHA 3HE5A 2FYUK 1CZQA 1MUUA 4WB4A 2L5GB 3RL0C 3KQGA 3HD7C 1J1DB 3HE4B 2LKMA 1GDTA 1LTJA 1T3JA 1JUNA 2WSFH 5AVYB 2C0WA 3L37A 1NTMK 2J59M 3B8EB 3VMYA 4DOJA 2QM8A 3MUDA 5AW3B 2XU6A 1J1EB 1MV8A 2PAJA 1N73B 1G2CA 3VYIA 3CLQA 2CPBA 2GUSA 4LGDE 2IX7C 3T97A 1CSBA 2XKMA 1SFCD 1OWAA 4C7NA 1NHLA 1L4AA 2YKQA 2XZRA 2WTYA 5CCHC 1MFZA 2C0XA 1RF0C 1JOCA 3HUSC 1L0NK 3V4WA 1J2JB 1NKNA 3BRTB 1URQA 2I1JA 1KFNA 3M0DC 1KILD 1LTGC 2KOGA 1T2KD 2A45G 1M1JC 1HUCA 2A45H 3HTKA 1SQVK 5CCGD 2POHA 2QM7A 2ZXEB 1CW5A 1HH0A 1HTLC 4IFMA 2YMYA 1FZEA 2IFNA 5AW0B 1JY2N 3M9BA 3RL0D 1X8YA 2Q3IA 3HD7D 2KYVA 2WPSA 3II6A 5AVZB 3PP5A 2OYIC 1FBMA 2PP6A 3HE5B 1MZ9A 3EQ2A 1GTWA 3LIDA 4O9BA 1LTJB 1LTTC 4DZOA 3MIWA 2FXMA 1NH4A 3CI9A 4Y99B 4I2LC 1VPCA 1NKZB 3P8CD 1M7LA 5KJ7A 3V2PA 1S9KE 1NU1K 5CMZA 2WZ7A 3M9HA 1GU4A 1GZLA 1G2CB 5AW2B 1FOSF 4Y99C 1JY2O 3L36A 4B86A 2ZFCA 5AVQB 1SLQA 4AYCA 2KLVA 5KTBA 1A02F 3M91A 1LWUA 3VMZA 1DH3A 1A02J 4C7NB 1H8AA 1L4AB 1KILC 3N4XA 2WITA 4N3YB 2H7HA 2YKOA 3I5CA 1DX7A 1YTZI 2N1TA 2P67A 5CCGC 3B5NA 3L35A 1N7SA 2OYHC 1KZUB 2I1KA 1IO4A 2WT7A 1IFDA 1NOHA 3MGNA 5AVUB 3TNUA 3HTKB 1FZCC 5APQA 1GW4A 3NFQA 4OH8B 1GK6A 3OA7A 2MJZA 2JEEA 3IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1LTI C;  1LTG C;  1LTT C;  1XTC C;  1LTB C;  1LTS C;  1LTA C;  1HTL C; 
#chains in the Genus database with same CATH topology
 1SP4 A;  3QH9 A;  3L71 D;  1BGY D;  2IYO A;  4WBA A;  1U57 A;  1QL1 A;  3M0A A;  3A0B E;  1X79 B;  3I55 P;  2WSE J;  2H43 A;  4PJ0 E;  2W6J H;  3P8M C;  3O8Z A;  1Q90 D;  4WY4 A;  1KQS O;  5KLV E;  3AE2 C;  3V6I A;  1LJ2 A;  1NU1 J;  1RF1 A;  4YXW H;  1SQB K;  3VTP C;  2NPS A;  4D6T D;  1RE3 A;  3TGU G;  1IFI A;  4ZKP A;  1SQP G;  3KPE A;  3JCU H;  2E76 B;  2SPZ A;  1T8Z A;  1IK7 A;  4N78 E;  1RHZ B;  3B5N B;  2CK3 H;  2E75 C;  1RH5 B;  2QEX P;  2WT7 B;  1ZRT E;  4H13 B;  1NTM J;  1S5L X;  2FKW B;  2KNC A;  3L73 D;  4YXD C;  1BCC E;  1EDK A;  1NU1 G;  2BEZ F;  1KC8 Q;  1LTJ C;  1Y8A A;  2WSC H;  3L74 D;  2ITA A;  3L4F A;  3HUS A;  3U59 A;  1WRG A;  3N7N A;  3M0D A;  2QJY C;  4H0L C;  4W80 A;  3PRJ A;  2R32 A;  1M57 D;  1HJ0 A;  2A06 D;  3BRV B;  3RGU A;  1TU3 F;  2VRS A;  1D7M A;  2IBZ G;  4QMA A;  4I7Z C;  2IDB A;  2N9Y B;  5CBO A;  2BAS A;  2E76 D;  1S5L H;  1NVO A;  1URQ C;  2IYP A;  2Z4E A;  3O6Q B;  5APY A;  1ZXG A;  4RKU J;  3B5N D;  1SQV E;  3JCU E;  3TK1 A;  3H1J E;  1FE6 A;  2V7Q H;  2XV5 A;  1L0L J;  1KMI Z;  1LT9 C;  3L70 E;  3IAO A;  4GT1 A;  4KT0 J;  5CHX A;  3L71 J;  2E43 A;  4H13 D;  1FDM A;  3ITK A;  1BGY J;  2JJL A;  2KIK A;  1ZLL A;  3AE8 C;  3V2R A;  4I6M C;  1OW6 A;  1FZG A;  2C9L Y;  3RK3 B;  1VQ8 P;  4DT0 A;  2M3B A;  3U1C A;  4I1L A;  1KIL A;  2JO1 A;  1JO5 A;  3CX5 D;  3GF7 A;  4LC1 A;  1JM0 A;  1IJD B;  2RH0 A;  2PFX A;  2W27 A;  1PV3 A;  3WUT A;  4D6T J;  1YQ4 C;  2J58 A;  1M1J B;  4EDF A;  1FDI A;  3H1H E;  3SWF A;  5CBN A;  1OVU A;  1L0L G;  3L71 G;  2N9B A;  2QJK B;  2FYZ A;  1BGY G;  1N7S C;  5KAF H;  3ZDM A;  1S3J A;  3SWK A;  1G1I A;  3CCL P;  3PLN A;  2FYN B;  2UWJ E;  3L73 J;  1S5L E;  4GKG A;  4W7Y A;  3C9I A;  1BSH A;  1RF1 B;  1NAF A;  2ZYA A;  1L0N D;  3OJA B;  3L74 J;  1NAY A;  1KFM A;  3RK3 D;  1W2E A;  1U7J A;  3CX5 I;  5APV A;  5CCH D;  1OXZ A;  2OTK E;  1PP9 E;  2XDJ A;  1P84 H;  2O3J A;  2Q7C A;  4PD4 D;  1H89 A;  3Q3D A;  2B9B A;  2Q9I A;  3HD7 B;  1WT6 A;  2QSI A;  3AEB C;  1DD3 A;  1VQM P;  1AVY A;  1HWT C;  2IZ1 A;  3HE5 A;  4DJG A;  2FYU K;  1MUU A;  2L5G B;  4UB8 H;  3KQG A;  3L73 G;  1GDT A;  1T3J A;  1JUN A;  2WSF H;  5AVY B;  4DOJ A;  1R5L A;  3MUD A;  3L74 G;  1MV8 A;  3AE4 C;  3CLQ A;  2IZ0 A;  3T97 A;  4L76 A;  1CSB A;  5KAF E;  2A06 G;  3QWO C;  2WTY A;  4JPZ B;  1MFZ A;  1RF0 C;  1JOC A;  3L72 D;  4OWF A;  1LTG C;  1SQV G;  1BE3 E;  2FBW C;  1HUC A;  2A45 H;  2OTL P;  2E75 B;  2K1A A;  3HTK A;  3L70 G;  5CCG D;  1CW5 A;  2OGU A;  1HTL C;  4IFM A;  1KB9 I;  5AW0 B;  2YXR B;  1PGO A;  3HD7 D;  5AVZ B;  3PP5 A;  3L75 E;  3H1K D;  1UII A;  1P84 E;  1AA0 A;  4O9B A;  1YI2 P;  1LTJ B;  5M1B A;  3TF5 A;  4DZO A;  1ZP0 C;  4DCK A;  4K3A A;  2PGD A;  3P8C D;  2WQY C;  4UB8 E;  1NU1 K;  2ZXX A;  4H0L B;  1GU4 A;  1GZL A;  4Y99 C;  3TGU D;  4B86 A;  4Z1M H;  2KLV A;  5KTB A;  1L0N J;  1SQP D;  1DH3 A;  3N4X A;  2KI7 B;  3CXH I;  2WIT A;  2K9Y A;  3B5N A;  3L35 A;  1NTZ E;  2BCC E;  1KZU B;  1IO4 A;  2WT7 A;  1NOH A;  2JWD A;  5AVU B;  1SQQ E;  1U7M A;  2E75 D;  2JEE A;  3A2A A;  1NTK E;  3MTU E;  3ABV C;  1J1D C;  4KJM A;  3GHG A;  4JF7 A;  3M06 A;  3MP7 B;  1PGP A;  2JWA A;  2P2U A;  3AE5 C;  4JYC A;  3AE7 C;  1YTZ T;  3VOP A;  4ZKU A;  1N73 C;  2KS1 B;  1DEB A;  1VQ9 P;  2J5U A;  2IPP A;  3RK2 B;  2M5A B;  2QJP C;  3W67 A;  2M8R A;  1LNQ A;  4H0L D;  3F89 A;  5AW7 B;  3NMD A;  1EZV D;  3FWL A;  1SQX E;  3L72 J;  2YMK A;  3H1I E;  3O6Q A;  2LXC B;  3TYY A;  3GMA A;  1N7S B;  1IFM A;  1KTM A;  1S9K D;  2R44 A;  2P1J A;  2G3A A;  3H1K J;  1L0L K;  3CCS P;  2ZAE B;  3RBX A;  2R5B A;  1EQ7 A;  3AEA C;  4L74 A;  1GL2 C;  1QVG O;  2E74 C;  4HH2 A;  1K9M Q;  5CCH A;  1OW7 A;  1IC2 A;  2Q5U A;  5CJ0 A;  3CMA P;  1NTM E;  1JY3 P;  1PL5 A;  2GM4 A;  2Q3E A;  5AVS B;  3L72 G;  5BU5 A;  1WMK A;  1FAV A;  1RE4 A;  1M1J A;  2WWW A;  1Q2N A;  3TGU J;  2JDI H;  3RK2 D;  1SQP J;  1L4A C;  2XND H;  2KK7 A;  1FZB A;  2H8P D;  1EZV I;  2NPS C;  1RE3 C;  3E7K A;  5KKZ C;  4PV1 C;  1KQL A;  5KLV D;  1HBW A;  2W8Z A;  1EXI A;  3H1K G;  3A3Y B;  1Q7Y Q;  1Z56 A;  3Q5R A;  1ZME C;  4ASV A;  3G4S P;  1N7S D;  2XNX A;  5AVT B;  2LXB A;  3NXS A;  3EFG A;  3AE3 C;  1EDJ A;  2FXP A;  5BU8 B;  1RQV A;  2YIU C;  1GU5 A;  3NTN A;  3GW6 A;  2D2C B;  4N78 D;  5DJU B;  2KXP B;  5APW A;  5CCG A;  3CWB E;  1IFN A;  4HJG H;  1IFJ A;  3G9R A;  1ZRT D;  4OGQ B;  3Q5S A;  3HD7 A;  4GIF A;  4YTP C;  3VMX A;  1BCC D;  3CCQ P;  1LWU C;  5AW8 B;  1VQO P;  3CC4 P;  1ZW0 A;  2KP8 A;  2KSJ A;  5TJH A;  4WWI A;  1LTI C;  1GK4 A;  2B89 A;  1JY2 P;  4RO0 A;  2ZVO B;  3GHG B;  1G1J A;  4BRY B;  4IFF A;  1PZQ A;  3RL0 g;  1JY3 N;  3H1L E;  2KSE A;  3D70 A;  4GDO A;  3BAT A;  2OAR A;  3A0H H;  1SVF A;  3H1I G;  2K9J B;  4IOI H;  2FFD C;  3V5B A;  1EDI A;  3CCE P;  1SFC C;  2W6A A;  3V2N A;  1BDD A;  2D2C D;  2WPQ A;  1EZV G;  2QA4 P;  1HJB A;  1KV4 A;  2HPC A;  1LTA C;  2HYN A;  1SQV D;  5APU A;  3H1J D;  1SQB E;  3KXD A;  1T2K C;  3L70 D;  4LLH A;  3RL0 B;  1GD2 E;  3AEE C;  3PTZ A;  4OGQ D;  2Z5H A;  3S9O A;  1MKM A;  3BVH A;  3F5H A;  4L73 A;  2WSS H;  1J1D B;  3W68 A;  1LTJ A;  5KLV J;  5H2F H;  4H44 B;  3B8E B;  3FGA D;  2WPV B;  2Y0E A;  2PAJ A;  1N73 B;  1EC5 A;  2Q1K A;  3H1H D;  2GUS A;  4LGD E;  2XKM A;  2C0X A;  4JQ0 D;  1L0N K;  4U3F E;  1NKN A;  1Q86 Q;  5B66 H;  1URQ A;  1KFN A;  2Y9Y A;  2AXT H;  5KLI C;  1JB0 J;  3A0H E;  2YXQ B;  2QM7 A;  1KB9 H;  1HH0 A;  4MN4 C;  1BCC J;  5KLV G;  1FZE A;  2IFN A;  1JY2 N;  3RL0 D;  2OYI C;  1FBM A;  2PP6 A;  1PIX A;  2QE7 H;  3CPW O;  1X0T A;  1LTT C;  3MIW A;  2ZJS E;  1OZH A;  1NH4 A;  1PP9 D;  1YQ3 C;  3RBZ A;  4OVN F;  1NKZ B;  2KS1 A;  4H44 D;  3MZW B;  3V2P A;  4JBZ A;  5CMZ A;  2M5A A;  2L91 A;  3Q1M A;  1SS1 A;  1FOS F;  1SLQ A;  3K5B A;  5H2F E;  1A02 F;  3M91 A;  2KUB A;  4C7N B;  1H8A A;  1L4A B;  1UIX A;  2RKL A;  1PPJ E;  1BCC G;  3I5C A;  3GG2 A;  5KKZ B;  4PV1 B;  1SQV J;  1N7S A;  2OYH C;  2I1K A;  3L70 J;  3TNU A;  1FZC C;  4K35 A;  5APQ A;  5KAI E;  1GK6 A;  1LGH B;  5B66 E;  1JCC A;  3AED C;  2AXT E;  3G71 P;  1ZOY C;  1KB9 E;  1JMM A;  2FY8 A;  3UIA A;  2YIU B;  3LW5 H;  1YIT P;  4IL6 X;  2Q6Q A;  2O01 H;  2GA1 A;  1J1E C;  1BE3 D;  2WSC J;  5GTI H;  3H1H J;  3BCC E;  1BDC A;  2V4H A;  3G6E P;  5AW5 B;  3L75 D;  1GW3 A;  3H1J G;  3CCJ P;  2HPC B;  1LWU B;  1VQK P;  1P84 D;  1SQP K;  3U1A A;  4PD4 I;  1X9V A;  4HKZ H;  4BWN A;  3MD0 A;  2HOD A;  1L4A D;  1S4X A;  3GF3 A;  2IFM A;  1VF5 C;  1NO4 A;  3CCM P;  4PV1 D;  3CXH E;  2WSE H;  4ASW A;  2O1K A;  4R4M A;  3B5N C;  4WVZ A;  4IL6 H;  1JCD A;  2WPR A;  2K37 A;  2FYU E;  1M1K Q;  1AQ5 A;  2YNY A;  4H13 C;  2V7Q J;  1N7L A;  5AW9 B;  2QJY B;  3VMA A;  3H1H G;  1GMJ A;  1YYC A;  2O1J A;  2FFD B;  4ZNC A;  5CJ4 A;  5BVZ A;  1Y9B A;  1PP9 J;  5EFW B;  4L75 A;  1NTZ D;  2BCC D;  4RJT A;  2ZT9 C;  3AEF C;  4I7Z B;  1SQQ D;  2P7J A;  2NZ2 A;  1FDO A;  3SWY A;  1KYO H;  1NTK D;  1URQ B;  3H6P A;  4U7J A;  4NPE A;  5TIS H;  1N2D C;  1W2B O;  1Q82 Q;  1FOS E;  2KZI A;  3WUU A;  4EIJ A;  2KB7 P;  5GTI E;  2HLO A;  1LT9 B;  2HR3 A;  3SSU A;  1USD A;  3H32 B;  3M9Q A;  4KHX A;  4BRY A;  5E79 H;  1AV1 A;  2YKP A;  1RY3 A;  3G3Z A;  1ZN5 A;  4EOT A;  1PP9 G;  3EWK A;  3B4S A;  1FU1 A;  1VQP P;  5AW4 B;  3D6Z A;  1SQX D;  3CCR P;  2ZVN B;  2K9J A;  4R4L A;  3H1I D;  1W5C E;  2YO2 A;  2E42 A;  4IL6 E;  3PHL A;  3RK3 C;  5KJ7 C;  1BE3 J;  1T3U A;  2BEQ D;  5AVV B;  3R4Y A;  1FS0 E;  1NU1 E;  2YO3 A;  5KLI B;  1HVV A;  1QLE D;  5K5G B;  1JNM A;  2KZJ A;  3L75 J;  1HGZ A;  1HGV A;  1URQ D;  4EI2 A;  1ZR2 A;  4RES B;  3KHU A;  1RE4 C;  2OYI B;  3TNU B;  2A45 I;  3KYQ A;  2N1T C;  1ZR4 A;  3VN0 A;  1KYO E;  1NTM D;  1PGJ A;  1FJK A;  1K73 Q;  1KIL E;  5TIS E;  5KLV K;  2IBZ E;  1S1C X;  4XA4 A;  2ZYG A;  3OW2 O;  1MFT A;  3BCC G;  5APS A;  2QJK C;  1N73 A;  2WSF J;  3KZI H;  1BE3 G;  3IF4 A;  2FYN C;  4GOE A;  4WY4 C;  1T6A A;  5E79 E;  3USS A;  3WMM 0;  2P10 A;  4C7R A;  1NTZ J;  3L75 G;  1VDF A;  2BCC J;  1RF1 C;  3CL3 D;  1IK9 A;  1SQQ J;  1AFO A;  3A7O A;  4EYY Q;  1LTS C;  2CPS A;  3IN6 A;  2OYH B;  4JYB A;  2HOD B;  1NTK J;  1FZC B;  2C9N Y;  1JY3 O;  1IFP A;  1JTH B;  1KQF B;  3FWN A;  3GLM A;  2M0B A;  3HD7 C;  2LKM A;  3H25 A;  3AEC C;  2C0W A;  1LP1 B;  3CWB D;  2J59 M;  1NYH A;  2QM8 A;  3S4R A;  1VQN P;  1J1E B;  1VQ7 P;  1L0L E;  1NTZ G;  3L71 E;  2BCC G;  1SQX J;  1BGY E;  3TDK A;  1SQQ G;  1AVO A;  1OWA A;  3H1I J;  4C7N A;  1NHL A;  1L4A A;  4TLF A;  3HUS C;  1PGQ A;  1NTK G;  3BRT B;  3PH0 A;  3AE1 C;  3M0D C;  4YPC A;  3KZI E;  2KOG A;  2A45 G;  1VF5 B;  4CPG A;  1SQV K;  2POH A;  3Q2Y A;  2ZXE B;  1VQ6 P;  4D6T E;  1OMI A;  3H1L D;  2W83 C;  1X8Y A;  2KLU A;  3B71 A;  3EQ2 A;  1GTW A;  3D6Y A;  2RN0 A;  1SQX G;  3CI9 A;  4Y99 B;  1YJN P;  1SQB D;  1M7L A;  3C1L A;  3M9H A;  2ZT9 B;  1G2C B;  3CX5 H;  3L73 E;  5AW2 B;  1JY2 O;  2ZFC A;  4AYC A;  1QX8 A;  1LWU A;  3VMZ A;  1KIL C;  2YKO A;  3L74 E;  1DX7 A;  2P67 A;  2WVR A;  1IFD A;  1USE A;  1VF5 D;  2A06 E;  2AEM A;  1NTM G;  3OA7 A;  2MJZ A;  3JSV C;  3IR9 A;  1FZF A;  3S1K A;  1PFI A;  1XTC C;  3VP9 A;  4AQR D;  5AVW B;  5APT A;  1L2P A;  2QIW A;  2B87 A;  1VQ5 P;  1CI6 A;  4HB1 A;  4U3F D;  1N86 A;  2FFD A;  2QJP B;  3CWB J;  3OAK A;  4XE5 B;  1SFC A;  1M8O B;  3P7K A;  3V2Q A;  5KAI H;  2R3S A;  4ZMD A;  1S72 P;  2ZT9 D;  3CCU P;  1DIP A;  2OYO A;  2K88 A;  1KN7 A;  3RK2 C;  4PD4 H;  5B5E H;  1NGM B;  5AW6 B;  2Y0C A;  1EDL A;  3CX5 E;  1LT9 A;  3HRN A;  2N1T B;  1EXJ A;  1YBK A;  3H32 A;  2H88 C;  2MKV A;  2NRG A;  3AEG C;  2QRX A;  4XFJ A;  3HE4 A;  3H1L J;  2DW3 A;  1GL2 B;  1K05 A;  2E74 B;  3CWB G;  3CD6 P;  3CC7 P;  1FZA A;  1FJP A;  3P32 A;  3R2P A;  2HG5 D;  3KDP B;  5APX A;  1HF9 A;  1PPJ D;  3Q5P A;  3CC2 P;  1OVR A;  3A5T A;  4WY4 B;  4Y28 J;  3MUD C;  1SQB J;  1LTB C;  1H0T A;  3SFD C;  2AXC A;  3CXH H;  2B88 A;  3E1I A;  4D6T G;  2NPS B;  5KJ7 D;  3WUV A;  3FXE A;  5GTH H;  2GUV A;  3H1J J;  3CME P;  2OYI A;  1L0N E;  2FXO A;  2W6B A;  4GOF A;  1KB9 D;  3RK3 E;  4HYT B;  3H1L G;  1R8E A;  2OTJ P;  4AUW A;  1OFC X;  1KQG B;  2R5D A;  4M3L A;  1NJI Q;  2N1T D;  4PD4 E;  5B5E E;  3BCC D;  3MHV A;  1Q81 Q;  4N6J A;  3AE9 C;  2KNC B;  1YHQ P;  1QVF O;  3JC2 2;  1SQB G;  1GL2 D;  2E74 D;  1YIJ P;  3BAS A;  1VL2 A;  4U3F J;  2RMZ A;  4UB6 H;  4W7Z A;  2Y9Z A;  3HUS B;  1RQU A;  1Y47 A;  4WY4 D;  3TSI A;  4A7P A;  1LT1 A;  1NTZ K;  2D2C C;  3VP8 A;  4C46 A;  3CXH D;  1YJ9 P;  2OQQ A;  2OYH A;  1E5W A;  1H88 A;  1SQQ K;  1FZC A;  2Z5I A;  1ZV8 A;  2NPS D;  1DD4 A;  2E76 C;  1JTH A;  2FYU D;  1NTK K;  4OGQ C;  3V4Q A;  2R3C A;  2H89 C;  2G8Y A;  3L72 E;  1KOR A;  1QGK B;  5GTH E;  1QL2 A;  1LP1 A;  5AVX B;  3SFE C;  5AVR B;  1XTG B;  3EFF K;  4U3F G;  1BSN A;  1YJW P;  2B87 B;  1CI6 B;  1RF0 A;  3I56 P;  1JMB A;  1R5S A;  1SFC B;  3GHG C;  1NWQ A;  2JP3 A;  3H1K E;  2AEJ A;  2PRR A;  1SQX K;  1VQ4 P;  1KIL B;  1X22 A;  3WU2 H;  4IFD K;  2HFE D;  3P8C E;  1P84 I;  3FX0 A;  5C39 A;  3LIE A;  3IFM A;  2I8D A;  1JEK A;  4UB6 E;  1VQL P;  3TGU E;  1FC2 C;  1SQP E;  1OVV A;  2AEF A;  1CZQ A;  4WB4 A;  3RL0 C;  4TT3 H;  3HE4 B;  1K04 A;  3L37 A;  1NTM K;  3VMY A;  1NU1 D;  1PPJ G;  2QVA A;  3BCC J;  2E5Y A;  5AW3 B;  3PJS K;  2JKV A;  2P58 A;  2XU6 A;  1OW8 A;  1G2C A;  3VYI A;  4H44 C;  2CPB A;  2IX7 C;  1L0N G;  1H0T B;  1SFC D;  2E5T A;  2YKQ A;  2XZR A;  5CCH C;  3V4W A;  1J2J B;  4NPF X;  2W90 A;  1KYO D;  2I1J A;  1KIL D;  3C8V A;  1T2K D;  2IBZ D;  3A0B H;  1M1J C;  1OX3 A;  1KD1 Q;  4PJ0 H;  1AJY A;  1M56 D;  2YMY A;  1OIP A;  2FYU J;  4BXL A;  5DJT B;  3M9B A;  3AE6 C;  2Q3I A;  2KYV A;  2WPS A;  3II6 A;  2Y0D A;  3WU2 E;  3CCV P;  3HE5 B;  1EZV E;  1MZ9 A;  1S2E A;  2QG4 A;  3LID A;  1E79 H;  2JR8 A;  2FXM A;  2K3R A;  4I2L C;  1VPC A;  5KJ7 A;  3D71 A;  1S9K E;  4NPD A;  2WMM A;  2WZ7 A;  3LW5 J;  2O01 J;  1QEX A;  3L36 A;  5AVQ B;  2M3E A;  2O01 N;  1AQT A;  3T97 B;  1M90 Q;  2LR2 A;  1A02 J;  3E1R A;  1DEE G;  2ZYD A;  5L8R J;  4N3Y B;  2H7H A;  3FXD A;  1N8R Q;  1K8A Q;  2FYU G;  4GOD A;  1YTZ I;  2N1T A;  5CCG C;  1KYO I;  2IBZ I;  3MGN A;  1IZN B;  3HTK B;  1GW4 A;  3NFQ A;  4OH8 B;  5AW1 B;  1L0L D;  1GL2 A; 
#chains in the Genus database with same CATH homology
 1SP4 A;  1LGH B;  3A2A A;  1FZF A;  1JCC A;  1PFI A;  1XTC C;  3MTU E;  4WBA A;  1J1D C;  1QL1 A;  3M0A A;  3GHG A;  3VP9 A;  1X79 B;  4JF7 A;  4AQR D;  5AVW B;  2H43 A;  3P8M C;  3O8Z A;  5APT A;  3M06 A;  1JMM A;  1CI6 A;  4WY4 A;  1N86 A;  3UIA A;  2FFD A;  3LW5 H;  2P2U A;  3OAK A;  4XE5 B;  1SFC A;  2O01 H;  4JYC A;  1YTZ T;  3P7K A;  3VOP A;  1J1E C;  1RF1 A;  4ZKU A;  3V2Q A;  1N73 C;  1DEB A;  1SQB K;  2IPP A;  3VTP C;  2NPS A;  3RK2 B;  1RE3 A;  2M8R A;  1IFI A;  4ZKP A;  5AW7 B;  3NMD A;  5AW5 B;  3KPE A;  2HPC B;  1GW3 A;  1LWU B;  1T8Z A;  3RK2 C;  1SQP K;  3U1A A;  1X9V A;  3MD0 A;  2HOD A;  1L4A D;  5AW6 B;  1LT9 A;  4N78 E;  3HRN A;  2N1T B;  2IFM A;  3B5N B;  3H32 A;  3TYY A;  1NO4 A;  1N7S B;  1IFM A;  1S9K D;  2WT7 B;  2WSE H;  3HE4 A;  2P1J A;  2O1K A;  3B5N C;  2FKW B;  1JCD A;  1GL2 B;  1FZA A;  1FJP A;  2WPR A;  1L0L K;  3P32 A;  3R2P A;  1AQ5 A;  2HG5 D;  2YNY A;  3KDP B;  2R5B A;  5APX A;  1EQ7 A;  1N7L A;  5AW9 B;  1LTJ C;  2WSC H;  1GL2 C;  1YYC A;  2O1J A;  4HH2 A;  5CCH A;  4WY4 B;  3A5T A;  2FFD B;  3L4F A;  5CJ4 A;  3HUS A;  5BVZ A;  1IC2 A;  2Q5U A;  5CJ0 A;  3U59 A;  1WRG A;  1JY3 P;  3N7N A;  1LTB C;  3M0D A;  4W80 A;  2GM4 A;  5AVS B;  3E1I A;  5BU5 A;  2R32 A;  1FAV A;  1RE4 A;  2P7J A;  1M1J A;  2WWW A;  2NPS B;  5KJ7 D;  3BRV B;  3SWY A;  2VRS A;  3RK2 D;  1URQ B;  3H6P A;  2GUV A;  1N2D C;  1L4A C;  1FZB A;  2H8P D;  1FOS E;  2OYI A;  2NPS C;  4EIJ A;  2W6B A;  2BAS A;  1RE3 C;  2KB7 P;  4HYT B;  2HLO A;  1URQ C;  2Z4E A;  1KQL A;  5APY A;  1LT9 B;  4AUW A;  1HBW A;  2R5D A;  3A3Y B;  3H32 B;  3M9Q A;  4M3L A;  4KHX A;  2N1T D;  3B5N D;  3TK1 A;  1Z56 A;  2XV5 A;  1N7S D;  2XNX A;  5AVT B;  5AW1 B;  1LT9 C;  4GT1 A;  4N6J A;  5CHX A;  2YKP A;  1RY3 A;  2E43 A;  3G3Z A;  3NXS A;  1FDM A;  1ZN5 A;  4EOT A;  2JJL A;  3EFG A;  1FU1 A;  1ZLL A;  1GL2 D;  3V2R A;  4I6M C;  5AW4 B;  1FZG A;  2C9L Y;  3BAS A;  5BU8 B;  3RK3 B;  1GU5 A;  3NTN A;  2M3B A;  2YO2 A;  3U1C A;  4I1L A;  1KIL A;  2E42 A;  1JO5 A;  4W7Z A;  4N78 D;  3HUS B;  5APW A;  4LC1 A;  4WY4 D;  3RK3 C;  5KJ7 C;  3TSI A;  5CCG A;  1T3U A;  1IFN A;  1IJD B;  5AVV B;  1IFJ A;  1NTZ K;  2YO3 A;  3VP8 A;  2W27 A;  4C46 A;  2J58 A;  1M1J B;  2OYH A;  1E5W A;  1HVV A;  1H88 A;  3HD7 A;  1SQQ K;  1FZC A;  2Z5I A;  1JNM A;  4GIF A;  3VMX A;  1ZV8 A;  2NPS D;  1LWU C;  5AW8 B;  1HGZ A;  1HGV A;  1JTH A;  1NTK K;  1URQ D;  1ZR2 A;  3SWF A;  3V4Q A;  4RES B;  1RE4 C;  2KP8 A;  2R3C A;  2OYI B;  3TNU B;  2A45 I;  3KYQ A;  2N1T C;  1ZR4 A;  2KSJ A;  1GL2 A;  3VN0 A;  2N9B A;  2FYZ A;  1LTI C;  1GK4 A;  1N7S C;  1FJK A;  1QL2 A;  5AVX B;  5KLV K;  1JY2 P;  5AVR B;  4XA4 A;  3GHG B;  1G1I A;  1XTG B;  1G1J A;  5APS A;  4IFF A;  1N73 A;  1CI6 B;  1RF0 A;  1JY3 N;  4GKG A;  1SFC B;  3GHG C;  4W7Y A;  3BAT A;  1NWQ A;  3C9I A;  2OAR A;  1RF1 B;  1NAF A;  1SVF A;  3OJA B;  4WY4 C;  2FFD C;  1SQX K;  1KFM A;  3WMM 0;  3RK3 D;  3V5B A;  1W2E A;  1SFC C;  1KIL B;  2W6A A;  3V2N A;  4C7R A;  1VDF A;  1RF1 C;  2WPQ A;  1HJB A;  5APV A;  5CCH D;  1OXZ A;  2HPC A;  4IFD K;  1LTA C;  3CL3 D;  2HYN A;  1IK9 A;  2XDJ A;  5APU A;  2HFE D;  1AFO A;  3P8C E;  3A7O A;  2Q7C A;  1LTS C;  3LIE A;  3IFM A;  2CPS A;  1H89 A;  1T2K C;  2OYH B;  4JYB A;  4LLH A;  2HOD B;  3RL0 B;  2Q9I A;  1GD2 E;  3HD7 B;  1WT6 A;  2Z5H A;  1FZC B;  2C9N Y;  1JY3 O;  1HWT C;  1JTH B;  3BVH A;  3HE5 A;  2FYU K;  1CZQ A;  1MUU A;  4WB4 A;  2L5G B;  3RL0 C;  3KQG A;  3HD7 C;  1J1D B;  3HE4 B;  2LKM A;  1GDT A;  1LTJ A;  1T3J A;  1JUN A;  2WSF H;  5AVY B;  2C0W A;  3L37 A;  1NTM K;  2J59 M;  3B8E B;  3VMY A;  4DOJ A;  2QM8 A;  3MUD A;  5AW3 B;  2XU6 A;  1J1E B;  1MV8 A;  2PAJ A;  1N73 B;  1G2C A;  3VYI A;  3CLQ A;  2CPB A;  2GUS A;  4LGD E;  2IX7 C;  3T97 A;  1CSB A;  2XKM A;  1SFC D;  1OWA A;  4C7N A;  1NHL A;  1L4A A;  2YKQ A;  2XZR A;  2WTY A;  5CCH C;  1MFZ A;  2C0X A;  1RF0 C;  1JOC A;  3HUS C;  1L0N K;  3V4W A;  1J2J B;  1NKN A;  3BRT B;  1URQ A;  2I1J A;  1KFN A;  3M0D C;  1KIL D;  1LTG C;  2KOG A;  1T2K D;  2A45 G;  1M1J C;  1HUC A;  2A45 H;  3HTK A;  1SQV K;  5CCG D;  2POH A;  2QM7 A;  2ZXE B;  1CW5 A;  1HH0 A;  1HTL C;  4IFM A;  2YMY A;  1FZE A;  2IFN A;  5AW0 B;  1JY2 N;  3M9B A;  3RL0 D;  1X8Y A;  2Q3I A;  3HD7 D;  2KYV A;  2WPS A;  3II6 A;  5AVZ B;  3PP5 A;  2OYI C;  1FBM A;  2PP6 A;  3HE5 B;  1MZ9 A;  3EQ2 A;  1GTW A;  3LID A;  4O9B A;  1LTJ B;  1LTT C;  4DZO A;  3MIW A;  2FXM A;  1NH4 A;  3CI9 A;  4Y99 B;  4I2L C;  1VPC A;  1NKZ B;  3P8C D;  1M7L A;  5KJ7 A;  3V2P A;  1S9K E;  1NU1 K;  5CMZ A;  2WZ7 A;  3M9H A;  1GU4 A;  1GZL A;  1G2C B;  5AW2 B;  1FOS F;  4Y99 C;  1JY2 O;  3L36 A;  4B86 A;  2ZFC A;  5AVQ B;  1SLQ A;  4AYC A;  2KLV A;  5KTB A;  1A02 F;  3M91 A;  1LWU A;  3VMZ A;  1DH3 A;  1A02 J;  4C7N B;  1H8A A;  1L4A B;  1KIL C;  3N4X A;  2WIT A;  4N3Y B;  2H7H A;  2YKO A;  3I5C A;  1DX7 A;  1YTZ I;  2N1T A;  2P67 A;  5CCG C;  3B5N A;  3L35 A;  1N7S A;  2OYH C;  1KZU B;  2I1K A;  1IO4 A;  2WT7 A;  1IFD A;  1NOH A;  3MGN A;  5AVU B;  3TNU A;  3HTK B;  1FZC C;  5APQ A;  1GW4 A;  3NFQ A;  4OH8 B;  1GK6 A;  3OA7 A;  2MJZ A;  2JEE A;  3IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...