1S5LX

Architecture of the photosynthetic oxygen evolving center
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
40
structure length
40
Chain Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 13
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s5lX00
2WSCJ 2WSEJ 4IL6X 2O01J 2E75B 4I7ZB 4RKUJ 1JB0J 5KLIC 2E74B 2ZT9B 4H44B 1ZRTE 2QJKC 2YIUC 2QJYC 2QIWA 3C8VA 2QSIA 3LW5J 4PV1B 1VF5B 4KT0J 2E76B 2WSFJ 2FYNC 2K9YA 1S5LX 5L8RJ 2WPVB 4OGQB 5KKZC 4Y28J 2D2CB 4H13B 1Q90D 4H0LB 2QJPC
chains in the Genus database with same CATH superfamily
2HODB 1PP9D 1HUCA 2KI7B 1ZOYC 2KS1B 2O1JA 3MGNA 4IOIH 4JPZB 2QJYB 1M8OB 3M9QA 1OVVA 5AW1B 1IFPA 5KTBA 4I2LC 5E79H 1LT9A 5KKZB 3KHUA 2XZRA 4OVNF 2M8RA 2N9BA 2O01N 1SLQA 2E74D 2M3BA 3V2NA 1NTZJ 4JF7A 1KTMA 4H44D 5AVZB 2ZXEB 3HE4A 4L75A 5CCGD 1KZUB 3H1LG 4LLHA 3F5HA 3M9HA 1LWUC 5KJ7A 1PGQA 3HE5B 1RF1C 3FWNA 1URQC 1JOCA 4HYTB 1S3JA 1Y47A 3IAOA 2BEQD 2J5UA 1NH4A 1L0LJ 2H8PD 3Q5RA 3HRNA 3L72E 4BRYB 1KQFB 1K04A 1FOSF 4ASVA 1LTJA 4Y99C 4AUWA 3RL0C 3D6YA 1MUUA 5KLVJ 3RK3D 4CPGA 2PFXA 3GHGA 3H1LE 2OYHB 1S4XA 1OW6A 3O8ZA 3M91A 1L0ND 1BGYE 1NU1D 1N7SB 1WT6A 1XTGB 3H1KG 4R4MA 4YXWH 1VQLP 3VMXA 3TGUD 1A02J 1JY2O 4WY4A 2KLVA 3KYQA 3V4WA 1KQGB 4AYCA 2ZT9B 1PL5A 1NTKG 2KIKA 3KQGA 2C9LY 3MIWA 3AEAC 1CI6A 2OGUA 2KYVA 1BCCD 3D71A 4H13D 1SQQG 2WSSH 2BCCD 2FFDA 2XV5A 2A06E 3BCCE 4NPEA 2WMMA 2K1AA 2LXBA 2QIWA 2H88C 3TSIA 1L4AC 1YIJP 1HTLC 1LJ2A 2ZVNB 1PP9E 1NTKE 1VQKP 2G3AA 1PGPA 2W6BA 2YMYA 1IFMA 4GKGA 1ZR2A 1K05A 4C46A 1BE3J 3TGUJ 3L37A 4JYBA 2C9NY 4I1LA 2NPSB 1PZQA 1R5LA 1IJDB 2O01H 3RK2D 4U3FJ 4D6TG 2HLOA 4JBZA 3NFQA 1J1EB 2OYIC 1FZFA 3EWKA 2V7QH 4IFMA 1H8AA 1S5LE 5GTHH 3CCSP 1LP1A 3TF5A 1NTMJ 3W68A 1HH0A 2IFNA 2M3EA 1M1JC 4H0LD 2JWDA 2IX7C 1IFDA 3O6QB 3P8CD 2A45H 1SQQK 1MV8A 2QE7H 1SQVJ 3GF7A 3RK3E 1DEBA 1GU5A 4PD4H 2FYUG 1PGJA 4D6TE 1SQXD 1EDJA 3QWOC 3Q5SA 1L0NE 1IZNB 2HFED 1NU1E 1EZVG 1SFCB 3CWBD 2Y9ZA 1NWQA 5AW3B 1N73A 1SQPG 5KJ7D 1LWUB 1J2JB 1BSHA 1MKMA 3H1JG 1RF1B 3AEDC 3L74D 1URQB 4EOTA 2B9BA 2Q3EA 1YTZT 2BEZF 3K5BA 4BWNA 2ZYGA 4KT0J 1JY3N 3GF3A 1S9KD 2WSFJ 2K9YA 1BDDA 2KLUA 1BCCE 3H25A 1LNQA 1AV1A 3L75D 3MP7B 1S1CX 3FX0A 2BCCE 4Y99B 2I1KA 5CJ4A 2PAJA 2QJKB 1SQPE 3WMM0 1RE3A 1T2KC 3CC4P 2KXPB 1QVGO 3G9RA 3CXHH 2W6JH 3H1JE 3V6IA 2IYOA 1ZN5A 1PPJG 3D70A 3L4FA 3HD7C 1Q7YQ 4RKUJ 3V2PA 2HODA 1SFCD 5CMZA 5AVUB 1YYCA 4RO0A 3L71G 1MFTA 1N8RQ 4LC1A 1RF0A 4WY4D 2FYUK 1FZCC 2JR8A 1YJ9P 2XDJA 2QEXP 1KILC 5CCHD 4HH2A 1M56D 3CX5H 1VQ6P 2G8YA 2IYPA 1SS1A 3AE6C 1NYHA 3M0AA 4C7NB 3LIEA 1SQPK 4EYYQ 1SQXG 2LKMA 4GT1A 1IFIA 2P1JA 2WVRA 1YHQP 3HE5A 2P67A 1NVOA 3NXSA 4I7ZC 1S5LH 3VYIA 1JTHA 3L75J 1EDKA 1JNMA 2Y0EA 3AE7C 2Y0CA 3U59A 2ITAA 1L4AB 1SVFA 1D7MA 3CI9A 4OH8B 1R8EA 2A45I 4BRYA 3KZIH 1RE4C 2OARA 5TISE 3R2PA 3S1KA 3I5CA 4HJGH 3L70J 4PD4I 1NAFA 1YQ3C 1RQVA 4ZNCA 1FDOA 5AVVB 3H1HG 1SQXE 1EQ7A 1JY2N 1KMIZ 2OYHA 3NTNA 1JEKA 3CCJP 1JB0J 3VMYA 2QM7A 3CWBE 3SFDC 1NAYA 1N7SA 2AXTH 3LW5J 3P7KA 1PGOA 2QM8A 1LTGC 2Y0DA 5H2FH 2N1TC 3BATA 1NTZD 4Y28J 2FKWB 2MJZA 3L74E 2KP8A 5B66H 2KB7P 3AEEC 1J1DC 3GG2A 2E43A 2AXCA 2WT7B 1XTCC 4HKZH 5AVYB 3H1IG 2VRSA 1LT9C 1FDMA 3H1HE 1T6AA 5TJHA 1Q90D 2QJPC 3E1IA 2E75B 1L0LD 1AA0A 5AW6B 1T8ZA 1SQBK 3CXHI 3FGAD 4N3YB 2L5GB 3WUTA 3A2AA 3CL3D 4M3LA 4TLFA 3II6A 1JY3O 3G4SP 4OGQD 3CXHD 2D2CD 5KLVD 2W27A 1OVRA 2LXCB 1CSBA 3H1IE 4GDOA 2XU6A 4L74A 5KAFH 1TU3F 3TK1A 4N78D 2AEFA 4PV1C 3B71A 1IFJA 2WWWA 3V4QA 4U7JA 1RHZB 3KPEA 1GL2C 3L72G 4Z1MH 3TNUB 2AEMA 3A0HE 3CX5I 3CMAP 3GHGC 1OXZA 4AQRD 3AE4C 2A45G 3A7OA 3CX5D 1QVFO 1VQPP 4K35A 3WU2H 1X9VA 4ZKUA 1W5CE 2E75D 4DCKA 2WSFH 5KLIC 2WTYA 1BGYG 2J58A 2CK3H 2IPPA 2P7JA 1FZEA 3MTUE 4YXDC 3TDKA 5GTHE 3AE8C 1IO4A 1G2CB 4W7ZA 5APSA 5TISH 1U7MA 1HGZA 4WBAA 3AECC 1DX7A 5CJ0A 3O6QA 3Q3DA 3H1KJ 4PD4E 4W7YA 1LTSC 1P84D 3U1AA 1FZCB 2R44A 3HUSB 1K73Q 1KILB 2WQYC 3S9OA 2O3JA 1X8YA 2A06G 3VOPA 3BCCG 1AFOA 1SFCA 3Q1MA 1OW8A 5APQA 1HBWA 1QLED 1BE3D 3V5BA 1DIPA 2CPBA 3G3ZA 1NTZE 1FDIA 3M9BA 2PP6A 1LWUA 1SQQJ 1OIPA 4I7ZB 1RF1A 2POHA 3EQ2A 1PP9G 4U3FD 2OYOA 5CCHA 2YKPA 1FE6A 4IL6H 4JYCA 3PP5A 1ZLLA 2RN0A 2E76C 2OTKE 2B87B 1L0LE 4N6JA 1NTMD 3HTKB 2ZYDA 2QSIA 2GUSA 1VF5C 3OA7A 3CCMP 1KQSO 1KB9D 3CXHE 4EDFA 5KLVE 1SQVD 2P58A 1ZMEC 1N7SD 2HPCB 1JCDA 1QL2A 2AEJA 2E42A 2RH0A 4N78E 1BSNA 2N1TB 1YTZI 3LW5H 3BASA 5BVZA 2OTLP 3A0HH 4GODA 3BRVB 2ZVOB 4L76A 3H6PA 2JDIH 3B4SA 2ZT9D 1VQMP 5C39A 3I55P 1T3UA 2W6AA 3CX5E 4XE5B 3V2RA 4C7NA 2Q3IA 2M5AB 1N73C 1L0NG 1K9MQ 1NU1G 2B88A 1JUNA 2IBZD 2FYUJ 1NTKK 3TGUG 2FXPA 2E5YA 1JY2P 3GW6A 3KZIE 2E74C 3AE5C 4XA4A 4H44C 3VN0A 4PV1B 3MD0A 1H89A 1N2DC 3OW2O 5CCGC 1GZLA 2YXQB 4DT0A 3RGUA 1GTWA 1GL2B 1P84E 2WSEJ 4EIJA 3H1JJ 1BCCG 3R4YA 4A7PA 3MUDA 2BCCG 1DEEG 1RE3C 2NPSD 1NTMG 1BDCA 2WPRA 1GU4A 3VP8A 3L73D 1IFNA 1M90Q 2H43A 2AXTE 1SQBD 1BE3E 3TGUE 3I56P 5H2FE 1ZR4A 5KLIB 1KYOD 1GK4A 5AVRB 5B66E 2C0XA 4DOJA 3PHLA 4U3FE 2QJYC 3RK3C 3F89A 2JKVA 1X79B 3CCLP 2HYNA 3JSVC 1NHLA 1LTAC 1S5LX 4XFJA 2SPZA 1FS0E 2B89A 5GTIE 1Q81Q 3D6ZA 4HB1A 4QMAA 1KFNA 4PJ0H 3RL0B 1NTME 2YKOA 5APUA 3V2QA 1Y8AA 2JJLA 2Z5IA 3FXEA 2I8DA 1L0NK 3PLNA 3L71J 1NU1K 3L70D 1Y9BA 3BVHA 5CBOA 2WSCJ 1SQVE 1W2EA 2K88A 3RBXA 1HVVA 2M0BA 2N9YB 5KAFE 5DJUB 2KS1A 5AW0B 3MZWB 5CHXA 3L73J 4H13C 5APXA 1URQD 1EDLA 1SQBJ 1VQOP 2Q1KA 2NZ2A 3P32A 1L2PA 2E76B 1AQ5A 2KUBA 1FZBA 1JMBA 1ZP0C 3AE1C 2FXMA 3AEFC 4IFDK 1LTTC 4UB6H 3WU2E 3PH0A 3RL0D 5CBNA 2JWAA 1ZW0A 1VF5B 3BRTB 4GIFA 1WMKA 2WZ7A 3CWBG 2FBWC 3H1HJ 1U7JA 5APVA 1G2CA 2RKLA 1Q2NA 3L74G 1LP1B 3P8CE 2Q6QA 3CCQP 1PV3A 4ZMDA 3RK2C 5BU8B 1FJPA 1P84H 3KDPB 2OQQA 2RMZA 4I6MC 5EFWB 5AW2B 1CW5A 3A0BH 2IZ1A 3B5NC 1N86A 3L75G 4GOFA 3HUSA 3VMAA 5AW9B 3LIDA 3AEBC 2FY8A 1CZQA 3SWFA 3H1LD 1VDFA 2C0WA 4DJGA 1VQ9P 3M0DA 1T3JA 4H0LC 2OYIB 3P8MC 1FU1A 1KYOE 2PRRA 3N4XA 2FYZA 4IL6E 1L4AD 5GTIH 1YITP 1S9KE 1M1JB 1VQ8P 2LR2A 1EXIA 3L75E 2O01J 2Z5HA 2J59M 2E74B 2B87A 3FXDA 5AVSB 1SQXK 3CLQA 5AVWB 4H44B 2NRGA 2CPSA 2YIUC 2MKVA 2QRXA 5BU5A 5KJ7C 3H32B 1KB9H 1JM0A 1YJNP 3L70E 1RY3A 2P2UA 3CCVP 1J1EC 3H1KD 3L72J 3E7KA 2P10A 3G71P 2KOGA 1M7LA 2YMKA 1IK9A 4UB8E 1JCCA 2QVAA 1LTJC 3H1LJ 2N1TA 2IZ0A 1HGVA 5KAIH 2KK7A 2L91A 3CC2P 1H88A 4GOEA 1X0TA 1NTKD 4WWIA 3RK3B 1A02F 3B8EB 1BGYJ 4MN4C 3IF4A 3W67A 3M06A 1GD2E 1IK7A 2YKQA 2NPSA 2R32A 1SQQD 2UWJE 2IDBA 1VQNP 5AW5B 4IL6X 3U1CA 2XKMA 1KC8Q 3A3YB 1YJWP 3A5TA 1SFCC 1M1KQ 3EFFK 3VTPC 2M5AA 1FAVA 2JEEA 4WY4C 5M1BA 2ZXXA 1JTHB 3HD7B 1NTZG 5CCHC 1WRGA 2WSCH 1FC2C 1P84I 3BCCJ 1HWTC 1G1JA 1USDA 5L8RJ 1RQUA 1LT1A 1VQ7P 2FFDC 5B5EH 4H13B 3T97B 2YO2A 1GL2A 2Z4EA 2W90A 3AE2C 2R5BA 1L0LG 2QJKC 1GMJA 1NKNA 2ZAEB 1PP9J 4D6TD 2KNCB 1NTKJ 3KXDA 4OWFA 1ZXGA 1KFMA 3G6EP 3JCUH 1JY3P 1KYOH 5KLVG 1X22A 1URQA 5APTA 2GA1A 3QH9A 1T2KD 4KHXA 2KSEA 3E1RA 2W8ZA 3HD7D 3AEGC 2FYUD 1ZRTD 2E5TA 2K9JB 4PJ0E 1ZV8A 4RESB 1KB9I 3NMDA 3RK2B 1EZVI 4RJTA 1EZVD 1HF9A 3B5NB 1KILD 3CCRP 3H1KE 2WPQA 1SQPD 1NTZK 3L36A 3WUUA 1H0TB 4UB8H 3H1JD 2R3CA 1W2BO 4B86A 4H0LB 1QL1A 4D6TJ 5APWA 1U57A 1J1DB 4R4LA 1L0NJ 1LT9B 1NU1J 2XNXA 1LTBC 1L0LK 1NO4A 1SQQE 2FYNC 2R3SA 2I1JA 4OGQC 2D2CC 2QJPB 1E79H 3MUDC 3CC7P 2H89C 2IBZI 1Q86Q 2KZJA 3HE4B 4UB6E 1YQ4C 2YIUB 3CCUP 2YO3A 5AW4B 5KLVK 1USEA 3WUVA 2PGDA 1PPJD 4EI2A 2XNDH 4W80A 1IC2A 1BE3G 1L4AA 3B5ND 1GW4A 1NGMB 1KN7A 3PRJA 1BCCJ 3ABVC 3L71D 2GM4A 3S4RA 3L35A 2BCCJ 1EC5A 4U3FG 3JC22 5AW7B 2N1TD 1SQPJ 1LTJB 1YBKA 2E75C 1FOSE 3GHGB 1Z56A 3A0BE 3MHVA 1S72P 3ITKA 1EDIA 3PTZA 1MZ9A 3CCEP 1OFCX 1OW7A 1Q82Q 1KYOI 1GK6A 2BASA 1JO5A 1FJKA 2K37A 1SQVG 2OYIA 2YNYA 2H7HA 2WT7A 1AVYA 1RF0C 3OJAB 1PFIA 4WY4B 5KKZC 2OTJP 2Y9YA 1M1JA 2FYUE 1ZRTE 2GUVA 3H1HD 1QEXA 2W83C 4PV1D 1CI6B 3IN6A 3UIAA 3IFMA 2FFDB 3VP9A 2WPVB 1GL2D 5CCGA 1YI2P 1KB9E 4DZOA 3H32A 1EZVE 1KILE 1AVOA 2Q9IA 1R5SA 3VMZA 1QGKB 2Q7CA 3CPWO 2HR3A 3Q5PA 4K3AA 1KORA 1QX8A 2IBZG 1VQ4P 2YXRB 2R5DA 1G1IA 3H1ID 1SQXJ 5KAIE 4TT3H 1MFZA 3TNUA 3C8VA 1DH3A 3CMEP 1KV4A 1OWAA 5AVTB 2OYHC 3USSA 1KQLA 1OVUA 3C1LA 3CWBJ 1NTMK 5E79E 3HUSC 1UIXA 2ZYAA 2QA4P 3GLMA 1N7SC 4YPCA 1DD4A 3L74J 1UIIA 3IR9A 1GW3A 1SQVK 3SSUA 2IBZE 1PPJE 3L73G 2Q5UA 3M0DC 2ZFCA 1SQBG 1FBMA 1NKZB 3RBZA 2QG4A 4C7RA 3PJSK 3L71E 2WPSA 3HD7A 1OX3A 2ZT9C 1VL2A 1OZHA 3EFGA 2V4HA 3SWYA 4KJMA 3L72D 1AQTA 3Q2YA 2KSJA 1M57D 5AVQB 4L73A 3ZDMA 1OMIA 5B5EE 1FZGA 1FZCA 3SFEC 3T97A 3FWLA 1KILA 3RL0g 2KZIA 3CD6P 1HJBA 3L73E 3H1IJ 4PD4D 2FYNB 1K8AQ 2E76D 3SWKA 1SQBE 4OGQB 2D2CB 2KNCA 4IFFA 1BGYD 3L70G 3JCUE 2IFMA 1HJ0A 1N73B 2ZJSE 1EXJA 2JP3A 1N7LA 1KD1Q 2K3RA 1VF5D 5DJTB 1PIXA 5APYA 2FXOA 5AW8B 3AE9C 1VQ5P 1LTIC 3GMAA 3OAKA 4YTPC 1VPCA 1GDTA 1JMMA 4NPFX 4WVZA 1AJYA 2WITA 4ZKPA 1RE4A 1S2EA 4ASWA 3AE3C 2NPSC 3HTKA 2JO1A 2K9JA 3TYYA 5AVXB 1DD3A 4JQ0D 2V7QJ 3N7NA 1LGHB 1FZAA 1NOHA 2HG5D 1NJIQ 4LGDE 4O9BA 2A06D 1SP4A 3BCCD 5K5GB 2O1KA 3B5NA 1RH5B 3C9IA 2WSEH 4BXLA 2HPCA 4NPDA 2DW3A 4WB4A 1E5WA 1H0TA
chains in the Genus database with same CATH topology
2WSEJ 4H13C 4H0LC 1K05A 4IL6X 1KILE 3AEGC 2E75B 1OMIA 3AECC 1NGMB 3SFEC 1ZMEC 3R4YA 4I7ZC 1ZOYC 3ABVC 2BEZF 3RL0g 3O6QA 4R4MA 3FGAD 3AE7C 4KT0J 3Q3DA 3GF3A 3Q5PA 2NZ2A 2E76B 2E76D 2WSFJ 2K9YA 1KORA 1ZP0C 4OGQB 3AE1C 4OGQD 5M1BA 2D2CB 3H25A 2D2CD 1R8EA 1EXIA 3AEFC 1S1CX 1HF9A 2WQYC 2O01J 3S9OA 2E75C 3EWKA 1KQGB 2E74B 4GDOA 2E74D 1HJ0A 4TT3H 2ZT9B 1EXJA 2ZT9D 2JP3A 1KTMA 4H44B 4H44D 1TU3F 1PL5A 2YIUC 1YQ3C 2QJYC 3C8VA 1RQVA 1VF5B 2MKVA 1VF5D 3Q1MA 1PIXA 4PV1C 3AE9C 1WMKA 1FDOA 1OW8A 1OW7A 3B71A 3G9RA 1DIPA 4U7JA 3AEAC 1S5LX 3GMAA 1RQUA 2FBWC 4XFJA 5L8RJ 1KMIZ 3D71A 4H13B 1FDIA 4H0LB 4H13D 4YTPC 4H0LD 4Z1MH 3D6ZA 3D70A 3T97B 1AJYA 1UIXA 2P10A 1U57A 4I7ZB 4RKUJ 1JB0J 3GLMA 3AE2C 3IAOA 1DD4A 2QJKC 1GMJA 3AE3C 2BEQD 3GF7A 4R4LA 2QIWA 1PV3A 3RK3E 3LW5J 2J5UA 2H88C 2YMKA 3AE4C 2JO1A 3Q5RA 3SFDC 1DD3A 2V7QJ 2FYNC 2E76C 1Y9BA 5KKZC 4Y28J 4OGQC 2OQQA 2D2CC 2FXPA 2WSCJ 1K04A 1KQFB 3Q5SA 2E75D 3AEEC 2H89C 5KLIC 3D6YA 2E74C 3AE5C 1YQ4C 2ZT9C 3AEBC 1VL2A 1ZRTE 4H44C 2QSIA 4PV1B 4PV1D 4YXDC 2G3AA 1IK7A 1VF5C 3IN6A 3AE8C 2G8YA 3AE6C 1NYHA 1OW6A 2WPVB 2IDBA 3Q2YA 1MKMA 1Q90D 3AEDC 2QJPC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WSC J;  2WSE J;  4IL6 X;  2O01 J;  2E75 B;  4I7Z B;  4RKU J;  1JB0 J;  5KLI C;  2E74 B;  2ZT9 B;  4H44 B;  1ZRT E;  2QJK C;  2YIU C;  2QJY C;  2QIW A;  3C8V A;  2QSI A;  3LW5 J;  4PV1 B;  1VF5 B;  4KT0 J;  2E76 B;  2WSF J;  2FYN C;  2K9Y A;  1S5L X;  5L8R J;  2WPV B;  4OGQ B;  5KKZ C;  4Y28 J;  2D2C B;  4H13 B;  1Q90 D;  4H0L B;  2QJP C; 
#chains in the Genus database with same CATH topology
 2HOD B;  1PP9 D;  1HUC A;  2KI7 B;  1ZOY C;  2KS1 B;  2O1J A;  3MGN A;  4IOI H;  4JPZ B;  2QJY B;  1M8O B;  3M9Q A;  1OVV A;  5AW1 B;  1IFP A;  5KTB A;  4I2L C;  5E79 H;  1LT9 A;  5KKZ B;  3KHU A;  2XZR A;  4OVN F;  2M8R A;  2N9B A;  2O01 N;  1SLQ A;  2E74 D;  2M3B A;  3V2N A;  1NTZ J;  4JF7 A;  1KTM A;  4H44 D;  5AVZ B;  2ZXE B;  3HE4 A;  4L75 A;  5CCG D;  1KZU B;  3H1L G;  4LLH A;  3F5H A;  3M9H A;  1LWU C;  5KJ7 A;  1PGQ A;  3HE5 B;  1RF1 C;  3FWN A;  1URQ C;  1JOC A;  4HYT B;  1S3J A;  1Y47 A;  3IAO A;  2BEQ D;  2J5U A;  1NH4 A;  1L0L J;  2H8P D;  3Q5R A;  3HRN A;  3L72 E;  4BRY B;  1KQF B;  1K04 A;  1FOS F;  4ASV A;  1LTJ A;  4Y99 C;  4AUW A;  3RL0 C;  3D6Y A;  1MUU A;  5KLV J;  3RK3 D;  4CPG A;  2PFX A;  3GHG A;  3H1L E;  2OYH B;  1S4X A;  1OW6 A;  3O8Z A;  3M91 A;  1L0N D;  1BGY E;  1NU1 D;  1N7S B;  1WT6 A;  1XTG B;  3H1K G;  4R4M A;  4YXW H;  1VQL P;  3VMX A;  3TGU D;  1A02 J;  1JY2 O;  4WY4 A;  2KLV A;  3KYQ A;  3V4W A;  1KQG B;  4AYC A;  2ZT9 B;  1PL5 A;  1NTK G;  2KIK A;  3KQG A;  2C9L Y;  3MIW A;  3AEA C;  1CI6 A;  2OGU A;  2KYV A;  1BCC D;  3D71 A;  4H13 D;  1SQQ G;  2WSS H;  2BCC D;  2FFD A;  2XV5 A;  2A06 E;  3BCC E;  4NPE A;  2WMM A;  2K1A A;  2LXB A;  2QIW A;  2H88 C;  3TSI A;  1L4A C;  1YIJ P;  1HTL C;  1LJ2 A;  2ZVN B;  1PP9 E;  1NTK E;  1VQK P;  2G3A A;  1PGP A;  2W6B A;  2YMY A;  1IFM A;  4GKG A;  1ZR2 A;  1K05 A;  4C46 A;  1BE3 J;  3TGU J;  3L37 A;  4JYB A;  2C9N Y;  4I1L A;  2NPS B;  1PZQ A;  1R5L A;  1IJD B;  2O01 H;  3RK2 D;  4U3F J;  4D6T G;  2HLO A;  4JBZ A;  3NFQ A;  1J1E B;  2OYI C;  1FZF A;  3EWK A;  2V7Q H;  4IFM A;  1H8A A;  1S5L E;  5GTH H;  3CCS P;  1LP1 A;  3TF5 A;  1NTM J;  3W68 A;  1HH0 A;  2IFN A;  2M3E A;  1M1J C;  4H0L D;  2JWD A;  2IX7 C;  1IFD A;  3O6Q B;  3P8C D;  2A45 H;  1SQQ K;  1MV8 A;  2QE7 H;  1SQV J;  3GF7 A;  3RK3 E;  1DEB A;  1GU5 A;  4PD4 H;  2FYU G;  1PGJ A;  4D6T E;  1SQX D;  1EDJ A;  3QWO C;  3Q5S A;  1L0N E;  1IZN B;  2HFE D;  1NU1 E;  1EZV G;  1SFC B;  3CWB D;  2Y9Z A;  1NWQ A;  5AW3 B;  1N73 A;  1SQP G;  5KJ7 D;  1LWU B;  1J2J B;  1BSH A;  1MKM A;  3H1J G;  1RF1 B;  3AED C;  3L74 D;  1URQ B;  4EOT A;  2B9B A;  2Q3E A;  1YTZ T;  2BEZ F;  3K5B A;  4BWN A;  2ZYG A;  4KT0 J;  1JY3 N;  3GF3 A;  1S9K D;  2WSF J;  2K9Y A;  1BDD A;  2KLU A;  1BCC E;  3H25 A;  1LNQ A;  1AV1 A;  3L75 D;  3MP7 B;  1S1C X;  3FX0 A;  2BCC E;  4Y99 B;  2I1K A;  5CJ4 A;  2PAJ A;  2QJK B;  1SQP E;  3WMM 0;  1RE3 A;  1T2K C;  3CC4 P;  2KXP B;  1QVG O;  3G9R A;  3CXH H;  2W6J H;  3H1J E;  3V6I A;  2IYO A;  1ZN5 A;  1PPJ G;  3D70 A;  3L4F A;  3HD7 C;  1Q7Y Q;  4RKU J;  3V2P A;  2HOD A;  1SFC D;  5CMZ A;  5AVU B;  1YYC A;  4RO0 A;  3L71 G;  1MFT A;  1N8R Q;  4LC1 A;  1RF0 A;  4WY4 D;  2FYU K;  1FZC C;  2JR8 A;  1YJ9 P;  2XDJ A;  2QEX P;  1KIL C;  5CCH D;  4HH2 A;  1M56 D;  3CX5 H;  1VQ6 P;  2G8Y A;  2IYP A;  1SS1 A;  3AE6 C;  1NYH A;  3M0A A;  4C7N B;  3LIE A;  1SQP K;  4EYY Q;  1SQX G;  2LKM A;  4GT1 A;  1IFI A;  2P1J A;  2WVR A;  1YHQ P;  3HE5 A;  2P67 A;  1NVO A;  3NXS A;  4I7Z C;  1S5L H;  3VYI A;  1JTH A;  3L75 J;  1EDK A;  1JNM A;  2Y0E A;  3AE7 C;  2Y0C A;  3U59 A;  2ITA A;  1L4A B;  1SVF A;  1D7M A;  3CI9 A;  4OH8 B;  1R8E A;  2A45 I;  4BRY A;  3KZI H;  1RE4 C;  2OAR A;  5TIS E;  3R2P A;  3S1K A;  3I5C A;  4HJG H;  3L70 J;  4PD4 I;  1NAF A;  1YQ3 C;  1RQV A;  4ZNC A;  1FDO A;  5AVV B;  3H1H G;  1SQX E;  1EQ7 A;  1JY2 N;  1KMI Z;  2OYH A;  3NTN A;  1JEK A;  3CCJ P;  1JB0 J;  3VMY A;  2QM7 A;  3CWB E;  3SFD C;  1NAY A;  1N7S A;  2AXT H;  3LW5 J;  3P7K A;  1PGO A;  2QM8 A;  1LTG C;  2Y0D A;  5H2F H;  2N1T C;  3BAT A;  1NTZ D;  4Y28 J;  2FKW B;  2MJZ A;  3L74 E;  2KP8 A;  5B66 H;  2KB7 P;  3AEE C;  1J1D C;  3GG2 A;  2E43 A;  2AXC A;  2WT7 B;  1XTC C;  4HKZ H;  5AVY B;  3H1I G;  2VRS A;  1LT9 C;  1FDM A;  3H1H E;  1T6A A;  5TJH A;  1Q90 D;  2QJP C;  3E1I A;  2E75 B;  1L0L D;  1AA0 A;  5AW6 B;  1T8Z A;  1SQB K;  3CXH I;  3FGA D;  4N3Y B;  2L5G B;  3WUT A;  3A2A A;  3CL3 D;  4M3L A;  4TLF A;  3II6 A;  1JY3 O;  3G4S P;  4OGQ D;  3CXH D;  2D2C D;  5KLV D;  2W27 A;  1OVR A;  2LXC B;  1CSB A;  3H1I E;  4GDO A;  2XU6 A;  4L74 A;  5KAF H;  1TU3 F;  3TK1 A;  4N78 D;  2AEF A;  4PV1 C;  3B71 A;  1IFJ A;  2WWW A;  3V4Q A;  4U7J A;  1RHZ B;  3KPE A;  1GL2 C;  3L72 G;  4Z1M H;  3TNU B;  2AEM A;  3A0H E;  3CX5 I;  3CMA P;  3GHG C;  1OXZ A;  4AQR D;  3AE4 C;  2A45 G;  3A7O A;  3CX5 D;  1QVF O;  1VQP P;  4K35 A;  3WU2 H;  1X9V A;  4ZKU A;  1W5C E;  2E75 D;  4DCK A;  2WSF H;  5KLI C;  2WTY A;  1BGY G;  2J58 A;  2CK3 H;  2IPP A;  2P7J A;  1FZE A;  3MTU E;  4YXD C;  3TDK A;  5GTH E;  3AE8 C;  1IO4 A;  1G2C B;  4W7Z A;  5APS A;  5TIS H;  1U7M A;  1HGZ A;  4WBA A;  3AEC C;  1DX7 A;  5CJ0 A;  3O6Q A;  3Q3D A;  3H1K J;  4PD4 E;  4W7Y A;  1LTS C;  1P84 D;  3U1A A;  1FZC B;  2R44 A;  3HUS B;  1K73 Q;  1KIL B;  2WQY C;  3S9O A;  2O3J A;  1X8Y A;  2A06 G;  3VOP A;  3BCC G;  1AFO A;  1SFC A;  3Q1M A;  1OW8 A;  5APQ A;  1HBW A;  1QLE D;  1BE3 D;  3V5B A;  1DIP A;  2CPB A;  3G3Z A;  1NTZ E;  1FDI A;  3M9B A;  2PP6 A;  1LWU A;  1SQQ J;  1OIP A;  4I7Z B;  1RF1 A;  2POH A;  3EQ2 A;  1PP9 G;  4U3F D;  2OYO A;  5CCH A;  2YKP A;  1FE6 A;  4IL6 H;  4JYC A;  3PP5 A;  1ZLL A;  2RN0 A;  2E76 C;  2OTK E;  2B87 B;  1L0L E;  4N6J A;  1NTM D;  3HTK B;  2ZYD A;  2QSI A;  2GUS A;  1VF5 C;  3OA7 A;  3CCM P;  1KQS O;  1KB9 D;  3CXH E;  4EDF A;  5KLV E;  1SQV D;  2P58 A;  1ZME C;  1N7S D;  2HPC B;  1JCD A;  1QL2 A;  2AEJ A;  2E42 A;  2RH0 A;  4N78 E;  1BSN A;  2N1T B;  1YTZ I;  3LW5 H;  3BAS A;  5BVZ A;  2OTL P;  3A0H H;  4GOD A;  3BRV B;  2ZVO B;  4L76 A;  3H6P A;  2JDI H;  3B4S A;  2ZT9 D;  1VQM P;  5C39 A;  3I55 P;  1T3U A;  2W6A A;  3CX5 E;  4XE5 B;  3V2R A;  4C7N A;  2Q3I A;  2M5A B;  1N73 C;  1L0N G;  1K9M Q;  1NU1 G;  2B88 A;  1JUN A;  2IBZ D;  2FYU J;  1NTK K;  3TGU G;  2FXP A;  2E5Y A;  1JY2 P;  3GW6 A;  3KZI E;  2E74 C;  3AE5 C;  4XA4 A;  4H44 C;  3VN0 A;  4PV1 B;  3MD0 A;  1H89 A;  1N2D C;  3OW2 O;  5CCG C;  1GZL A;  2YXQ B;  4DT0 A;  3RGU A;  1GTW A;  1GL2 B;  1P84 E;  2WSE J;  4EIJ A;  3H1J J;  1BCC G;  3R4Y A;  4A7P A;  3MUD A;  2BCC G;  1DEE G;  1RE3 C;  2NPS D;  1NTM G;  1BDC A;  2WPR A;  1GU4 A;  3VP8 A;  3L73 D;  1IFN A;  1M90 Q;  2H43 A;  2AXT E;  1SQB D;  1BE3 E;  3TGU E;  3I56 P;  5H2F E;  1ZR4 A;  5KLI B;  1KYO D;  1GK4 A;  5AVR B;  5B66 E;  2C0X A;  4DOJ A;  3PHL A;  4U3F E;  2QJY C;  3RK3 C;  3F89 A;  2JKV A;  1X79 B;  3CCL P;  2HYN A;  3JSV C;  1NHL A;  1LTA C;  1S5L X;  4XFJ A;  2SPZ A;  1FS0 E;  2B89 A;  5GTI E;  1Q81 Q;  3D6Z A;  4HB1 A;  4QMA A;  1KFN A;  4PJ0 H;  3RL0 B;  1NTM E;  2YKO A;  5APU A;  3V2Q A;  1Y8A A;  2JJL A;  2Z5I A;  3FXE A;  2I8D A;  1L0N K;  3PLN A;  3L71 J;  1NU1 K;  3L70 D;  1Y9B A;  3BVH A;  5CBO A;  2WSC J;  1SQV E;  1W2E A;  2K88 A;  3RBX A;  1HVV A;  2M0B A;  2N9Y B;  5KAF E;  5DJU B;  2KS1 A;  5AW0 B;  3MZW B;  5CHX A;  3L73 J;  4H13 C;  5APX A;  1URQ D;  1EDL A;  1SQB J;  1VQO P;  2Q1K A;  2NZ2 A;  3P32 A;  1L2P A;  2E76 B;  1AQ5 A;  2KUB A;  1FZB A;  1JMB A;  1ZP0 C;  3AE1 C;  2FXM A;  3AEF C;  4IFD K;  1LTT C;  4UB6 H;  3WU2 E;  3PH0 A;  3RL0 D;  5CBN A;  2JWA A;  1ZW0 A;  1VF5 B;  3BRT B;  4GIF A;  1WMK A;  2WZ7 A;  3CWB G;  2FBW C;  3H1H J;  1U7J A;  5APV A;  1G2C A;  2RKL A;  1Q2N A;  3L74 G;  1LP1 B;  3P8C E;  2Q6Q A;  3CCQ P;  1PV3 A;  4ZMD A;  3RK2 C;  5BU8 B;  1FJP A;  1P84 H;  3KDP B;  2OQQ A;  2RMZ A;  4I6M C;  5EFW B;  5AW2 B;  1CW5 A;  3A0B H;  2IZ1 A;  3B5N C;  1N86 A;  3L75 G;  4GOF A;  3HUS A;  3VMA A;  5AW9 B;  3LID A;  3AEB C;  2FY8 A;  1CZQ A;  3SWF A;  3H1L D;  1VDF A;  2C0W A;  4DJG A;  1VQ9 P;  3M0D A;  1T3J A;  4H0L C;  2OYI B;  3P8M C;  1FU1 A;  1KYO E;  2PRR A;  3N4X A;  2FYZ A;  4IL6 E;  1L4A D;  5GTI H;  1YIT P;  1S9K E;  1M1J B;  1VQ8 P;  2LR2 A;  1EXI A;  3L75 E;  2O01 J;  2Z5H A;  2J59 M;  2E74 B;  2B87 A;  3FXD A;  5AVS B;  1SQX K;  3CLQ A;  5AVW B;  4H44 B;  2NRG A;  2CPS A;  2YIU C;  2MKV A;  2QRX A;  5BU5 A;  5KJ7 C;  3H32 B;  1KB9 H;  1JM0 A;  1YJN P;  3L70 E;  1RY3 A;  2P2U A;  3CCV P;  1J1E C;  3H1K D;  3L72 J;  3E7K A;  2P10 A;  3G71 P;  2KOG A;  1M7L A;  2YMK A;  1IK9 A;  4UB8 E;  1JCC A;  2QVA A;  1LTJ C;  3H1L J;  2N1T A;  2IZ0 A;  1HGV A;  5KAI H;  2KK7 A;  2L91 A;  3CC2 P;  1H88 A;  4GOE A;  1X0T A;  1NTK D;  4WWI A;  3RK3 B;  1A02 F;  3B8E B;  1BGY J;  4MN4 C;  3IF4 A;  3W67 A;  3M06 A;  1GD2 E;  1IK7 A;  2YKQ A;  2NPS A;  2R32 A;  1SQQ D;  2UWJ E;  2IDB A;  1VQN P;  5AW5 B;  4IL6 X;  3U1C A;  2XKM A;  1KC8 Q;  3A3Y B;  1YJW P;  3A5T A;  1SFC C;  1M1K Q;  3EFF K;  3VTP C;  2M5A A;  1FAV A;  2JEE A;  4WY4 C;  5M1B A;  2ZXX A;  1JTH B;  3HD7 B;  1NTZ G;  5CCH C;  1WRG A;  2WSC H;  1FC2 C;  1P84 I;  3BCC J;  1HWT C;  1G1J A;  1USD A;  5L8R J;  1RQU A;  1LT1 A;  1VQ7 P;  2FFD C;  5B5E H;  4H13 B;  3T97 B;  2YO2 A;  1GL2 A;  2Z4E A;  2W90 A;  3AE2 C;  2R5B A;  1L0L G;  2QJK C;  1GMJ A;  1NKN A;  2ZAE B;  1PP9 J;  4D6T D;  2KNC B;  1NTK J;  3KXD A;  4OWF A;  1ZXG A;  1KFM A;  3G6E P;  3JCU H;  1JY3 P;  1KYO H;  5KLV G;  1X22 A;  1URQ A;  5APT A;  2GA1 A;  3QH9 A;  1T2K D;  4KHX A;  2KSE A;  3E1R A;  2W8Z A;  3HD7 D;  3AEG C;  2FYU D;  1ZRT D;  2E5T A;  2K9J B;  4PJ0 E;  1ZV8 A;  4RES B;  1KB9 I;  3NMD A;  3RK2 B;  1EZV I;  4RJT A;  1EZV D;  1HF9 A;  3B5N B;  1KIL D;  3CCR P;  3H1K E;  2WPQ A;  1SQP D;  1NTZ K;  3L36 A;  3WUU A;  1H0T B;  4UB8 H;  3H1J D;  2R3C A;  1W2B O;  4B86 A;  4H0L B;  1QL1 A;  4D6T J;  5APW A;  1U57 A;  1J1D B;  4R4L A;  1L0N J;  1LT9 B;  1NU1 J;  2XNX A;  1LTB C;  1L0L K;  1NO4 A;  1SQQ E;  2FYN C;  2R3S A;  2I1J A;  4OGQ C;  2D2C C;  2QJP B;  1E79 H;  3MUD C;  3CC7 P;  2H89 C;  2IBZ I;  1Q86 Q;  2KZJ A;  3HE4 B;  4UB6 E;  1YQ4 C;  2YIU B;  3CCU P;  2YO3 A;  5AW4 B;  5KLV K;  1USE A;  3WUV A;  2PGD A;  1PPJ D;  4EI2 A;  2XND H;  4W80 A;  1IC2 A;  1BE3 G;  1L4A A;  3B5N D;  1GW4 A;  1NGM B;  1KN7 A;  3PRJ A;  1BCC J;  3ABV C;  3L71 D;  2GM4 A;  3S4R A;  3L35 A;  2BCC J;  1EC5 A;  4U3F G;  3JC2 2;  5AW7 B;  2N1T D;  1SQP J;  1LTJ B;  1YBK A;  2E75 C;  1FOS E;  3GHG B;  1Z56 A;  3A0B E;  3MHV A;  1S72 P;  3ITK A;  1EDI A;  3PTZ A;  1MZ9 A;  3CCE P;  1OFC X;  1OW7 A;  1Q82 Q;  1KYO I;  1GK6 A;  2BAS A;  1JO5 A;  1FJK A;  2K37 A;  1SQV G;  2OYI A;  2YNY A;  2H7H A;  2WT7 A;  1AVY A;  1RF0 C;  3OJA B;  1PFI A;  4WY4 B;  5KKZ C;  2OTJ P;  2Y9Y A;  1M1J A;  2FYU E;  1ZRT E;  2GUV A;  3H1H D;  1QEX A;  2W83 C;  4PV1 D;  1CI6 B;  3IN6 A;  3UIA A;  3IFM A;  2FFD B;  3VP9 A;  2WPV B;  1GL2 D;  5CCG A;  1YI2 P;  1KB9 E;  4DZO A;  3H32 A;  1EZV E;  1KIL E;  1AVO A;  2Q9I A;  1R5S A;  3VMZ A;  1QGK B;  2Q7C A;  3CPW O;  2HR3 A;  3Q5P A;  4K3A A;  1KOR A;  1QX8 A;  2IBZ G;  1VQ4 P;  2YXR B;  2R5D A;  1G1I A;  3H1I D;  1SQX J;  5KAI E;  4TT3 H;  1MFZ A;  3TNU A;  3C8V A;  1DH3 A;  3CME P;  1KV4 A;  1OWA A;  5AVT B;  2OYH C;  3USS A;  1KQL A;  1OVU A;  3C1L A;  3CWB J;  1NTM K;  5E79 E;  3HUS C;  1UIX A;  2ZYA A;  2QA4 P;  3GLM A;  1N7S C;  4YPC A;  1DD4 A;  3L74 J;  1UII A;  3IR9 A;  1GW3 A;  1SQV K;  3SSU A;  2IBZ E;  1PPJ E;  3L73 G;  2Q5U A;  3M0D C;  2ZFC A;  1SQB G;  1FBM A;  1NKZ B;  3RBZ A;  2QG4 A;  4C7R A;  3PJS K;  3L71 E;  2WPS A;  3HD7 A;  1OX3 A;  2ZT9 C;  1VL2 A;  1OZH A;  3EFG A;  2V4H A;  3SWY A;  4KJM A;  3L72 D;  1AQT A;  3Q2Y A;  2KSJ A;  1M57 D;  5AVQ B;  4L73 A;  3ZDM A;  1OMI A;  5B5E E;  1FZG A;  1FZC A;  3SFE C;  3T97 A;  3FWL A;  1KIL A;  3RL0 g;  2KZI A;  3CD6 P;  1HJB A;  3L73 E;  3H1I J;  4PD4 D;  2FYN B;  1K8A Q;  2E76 D;  3SWK A;  1SQB E;  4OGQ B;  2D2C B;  2KNC A;  4IFF A;  1BGY D;  3L70 G;  3JCU E;  2IFM A;  1HJ0 A;  1N73 B;  2ZJS E;  1EXJ A;  2JP3 A;  1N7L A;  1KD1 Q;  2K3R A;  1VF5 D;  5DJT B;  1PIX A;  5APY A;  2FXO A;  5AW8 B;  3AE9 C;  1VQ5 P;  1LTI C;  3GMA A;  3OAK A;  4YTP C;  1VPC A;  1GDT A;  1JMM A;  4NPF X;  4WVZ A;  1AJY A;  2WIT A;  4ZKP A;  1RE4 A;  1S2E A;  4ASW A;  3AE3 C;  2NPS C;  3HTK A;  2JO1 A;  2K9J A;  3TYY A;  5AVX B;  1DD3 A;  4JQ0 D;  2V7Q J;  3N7N A;  1LGH B;  1FZA A;  1NOH A;  2HG5 D;  1NJI Q;  4LGD E;  4O9B A;  2A06 D;  1SP4 A;  3BCC D;  5K5G B;  2O1K A;  3B5N A;  1RH5 B;  3C9I A;  2WSE H;  4BXL A;  2HPC A;  4NPD A;  2DW3 A;  4WB4 A;  1E5W A;  1H0T A; 
#chains in the Genus database with same CATH homology
 2WSE J;  4H13 C;  4H0L C;  1K05 A;  4IL6 X;  1KIL E;  3AEG C;  2E75 B;  1OMI A;  3AEC C;  1NGM B;  3SFE C;  1ZME C;  3R4Y A;  4I7Z C;  1ZOY C;  3ABV C;  2BEZ F;  3RL0 g;  3O6Q A;  4R4M A;  3FGA D;  3AE7 C;  4KT0 J;  3Q3D A;  3GF3 A;  3Q5P A;  2NZ2 A;  2E76 B;  2E76 D;  2WSF J;  2K9Y A;  1KOR A;  1ZP0 C;  4OGQ B;  3AE1 C;  4OGQ D;  5M1B A;  2D2C B;  3H25 A;  2D2C D;  1R8E A;  1EXI A;  3AEF C;  1S1C X;  1HF9 A;  2WQY C;  2O01 J;  3S9O A;  2E75 C;  3EWK A;  1KQG B;  2E74 B;  4GDO A;  2E74 D;  1HJ0 A;  4TT3 H;  2ZT9 B;  1EXJ A;  2ZT9 D;  2JP3 A;  1KTM A;  4H44 B;  4H44 D;  1TU3 F;  1PL5 A;  2YIU C;  1YQ3 C;  2QJY C;  3C8V A;  1RQV A;  1VF5 B;  2MKV A;  1VF5 D;  3Q1M A;  1PIX A;  4PV1 C;  3AE9 C;  1WMK A;  1FDO A;  1OW8 A;  1OW7 A;  3B71 A;  3G9R A;  1DIP A;  4U7J A;  3AEA C;  1S5L X;  3GMA A;  1RQU A;  2FBW C;  4XFJ A;  5L8R J;  1KMI Z;  3D71 A;  4H13 B;  1FDI A;  4H0L B;  4H13 D;  4YTP C;  4H0L D;  4Z1M H;  3D6Z A;  3D70 A;  3T97 B;  1AJY A;  1UIX A;  2P10 A;  1U57 A;  4I7Z B;  4RKU J;  1JB0 J;  3GLM A;  3AE2 C;  3IAO A;  1DD4 A;  2QJK C;  1GMJ A;  3AE3 C;  2BEQ D;  3GF7 A;  4R4L A;  2QIW A;  1PV3 A;  3RK3 E;  3LW5 J;  2J5U A;  2H88 C;  2YMK A;  3AE4 C;  2JO1 A;  3Q5R A;  3SFD C;  1DD3 A;  2V7Q J;  2FYN C;  2E76 C;  1Y9B A;  5KKZ C;  4Y28 J;  4OGQ C;  2OQQ A;  2D2C C;  2FXP A;  2WSC J;  1K04 A;  1KQF B;  3Q5S A;  2E75 D;  3AEE C;  2H89 C;  5KLI C;  3D6Y A;  2E74 C;  3AE5 C;  1YQ4 C;  2ZT9 C;  3AEB C;  1VL2 A;  1ZRT E;  4H44 C;  2QSI A;  4PV1 B;  4PV1 D;  4YXD C;  2G3A A;  1IK7 A;  1VF5 C;  3IN6 A;  3AE8 C;  2G8Y A;  3AE6 C;  1NYH A;  1OW6 A;  2WPV B;  2IDB A;  3Q2Y A;  1MKM A;  1Q90 D;  3AED C;  2QJP C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...