1S5LX

Architecture of the photosynthetic oxygen evolving center
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
40
structure length
40
Chain Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
total genus 13
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s5lX00
4Y28J 4H0LB 4H13B 2K9YA 2QJKC 4RKUJ 2WSCJ 1Q90D 5KKZC 2E76B 2WSEJ 3C8VA 2O01J 1JB0J 1ZRTE 2E74B 2WSFJ 4IL6X 4KT0J 1S5LX 2E75B 1VF5B 4H44B 2FYNC 2QSIA 2D2CB 2QJYC 3LW5J 5KLIC 2WPVB 4PV1B 2QIWA 2QJPC 4OGQB 4I7ZB 2ZT9B 5L8RJ 2YIUC
chains in the Genus database with same CATH superfamily
3HRNA 3SWYA 3C9IA 2HG5D 2KZIA 1NTMD 3H1IE 1YBKA 1BE3G 1GW4A 3V2QA 3K5BA 2BCCD 1NWQA 1GZLA 2BCCE 4AUWA 3MTUE 1N73B 1NTKG 3M0DA 4IFDK 1JB0J 3D6YA 4WY4A 3HD7A 3VP8A 3SWFA 3L4FA 4CPGA 3G6EP 2QIWA 3QH9A 1KB9E 1SQPG 3SFEC 1VDFA 2FFDA 4ZKUA 3FWNA 3VTPC 3P8CE 3VMAA 1KB9H 2HODB 2JO1A 1GDTA 4MN4C 3TSIA 3CCLP 1SS1A 2VRSA 2E76D 1BGYG 4H13B 4R4LA 2AEMA 5KAIE 1NHLA 2QM7A 1VQMP 5BVZA 1FZBA 2IBZD 3Q5RA 1EZVG 1EDJA 1RY3A 2IBZE 2KI7B 4L74A 2E74C 2FYZA 1VF5C 4IFFA 2KB7P 1BE3J 4U3FE 3CXHE 4YXDC 2C9LY 2LR2A 4AYCA 1ZR2A 1DD3A 3SWKA 3CXHH 1YTZI 5GTIE 1HGVA 2P2UA 1JY3P 1ZXGA 2WQYC 2KK7A 1VL2A 2YKQA 5CCHC 2WSCH 1R5SA 5GTIH 2JR8A 1RHZB 5AVWB 1SQPJ 3N7NA 1FZCB 2BEZF 1YHQP 1SQXK 1SFCB 3CCRP 3V6IA 4PD4E 1E5WA 3AE7C 3MGNA 2P67A 1NU1E 2KP8A 1L4AA 3FGAD 4L75A 5AVVB 1N7SC 2WSFH 4PD4H 1BGYJ 1LTJB 1H0TB 4ZMDA 1NTZG 1NH4A 3CL3D 4UB6E 3CI9A 2AXCA 2Y0EA 2WWWA 2H7HA 1R5LA 5EFWB 3AE4C 4HYTB 3GHGC 3HUSA 3A2AA 1QEXA 1HWTC 1SP4A 2KXPB 3HD7B 1SQBD 2O1KA 1LP1A 1SQBE 1MUUA 1DD4A 2GA1A 3EFGA 1M1KQ 2V7QJ 1P84I 4I1LA 4OGQC 1YJWP 3BASA 2GUVA 2YMKA 1S4XA 3B5NB 1N73C 4ASVA 2ZAEB 4WB4A 4TT3H 4H13D 1HJBA 2D2CB 2Q1KA 4C7NA 4IL6E 4BRYA 1AQTA 1Q90D 1RF1C 5AVZB 1S9KD 1S9KE 1NTZJ 1L0LE 2LXCB 3RBZA 4M3LA 5GTHE 4PJ0E 1BSHA 2K88A 3IFMA 2QRXA 1EDLA 2ZT9B 1ZV8A 3L75J 2YO3A 4Y28J 3H1KG 5GTHH 2P58A 1PPJD 1KYOE 1YIJP 1DH3A 3L71G 3H1LD 1DX7A 1K73Q 1EXIA 5CBNA 1RQUA 1SVFA 1KYOH 4DCKA 1SFCD 4I7ZB 4EIJA 3B71A 3BCCG 1M57D 1RE4C 1SLQA 3HE5A 2FYUE 4DT0A 2WSEJ 2B89A 2AEJA 2B87A 4A7PA 3CX5D 1LWUB 3L72G 1HVVA 3LW5J 3L74E 3U1AA 3I55P 1VQNP 3PRJA 3MHVA 3O8ZA 2CPBA 1JO5A 1FZCC 2WTYA 1FDIA 1VQ4P 1J1DC 5KLIB 2Q3EA 3CCUP 2QJPC 3TGUE 4I2LC 1NTKK 2YMYA 3BATA 1W2EA 3L73D 2IYPA 3H1KJ 3H1HG 4YXWH 3L71J 3L70G 3CWBD 1SQPK 1IFMA 3B5ND 1FBMA 2W8ZA 2FXOA 1K8AQ 1CI6B 1JTHA 1AVOA 1IC2A 1OW6A 2K9YA 3BCCJ 1M56D 1OZHA 2ZYDA 2K9JB 3M0DC 1EXJA 4WY4C 1GU4A 1AVYA 3HD7C 4JBZA 2WPVB 1VQLP 3H1JD 1SQVD 3H1JE 1ZP0C 1U57A 1ZW0A 3CCSP 4D6TG 1SQVE 2JEEA 1Q82Q 3PLNA 1KV4A 1FAVA 2FFDC 1KC8Q 2OTKE 3CC4P 1GL2D 1X22A 1L0NE 1LTAC 1LTGC 3E1IA 2QG4A 1SQQE 1KB9I 4GDOA 2OYIB 2R5BA 2D2CC 4TLFA 4GKGA 2R3SA 5KKZB 1YQ3C 4WBAA 2KSJA 1N73A 1IZNB 5KLVG 1LT1A 1TU3F 4NPEA 1BCCD 3CCMP 4JYBA 3EQ2A 4WVZA 3L70J 4OVNF 3WUTA 2GM4A 2C9NY 1FOSF 3AE1C 2ZT9C 1JNMA 4RJTA 1W2BO 2R3CA 2O01J 1G1JA 1URQB 2HODA 3PJSK 4IL6X 3LIDA 1HUCA 1SQXJ 1IFIA 3CXHI 1NTZK 3CLQA 1X79B 1RH5B 4D6TJ 1YJ9P 1K04A 1VPCA 2M8RA 1AFOA 1U7JA 3AE8C 3BRVB 3KYQA 3NXSA 1K9MQ 5AW5B 2ZFCA 1NKZB 1VQOP 3OJAB 2FXMA 1W5CE 1L4AC 1M7LA 3ZDMA 1EQ7A 3S1KA 2PP6A 3CCQP 1UIXA 2JJLA 3PHLA 2YNYA 3A0BE 2PFXA 1QVGO 3CCVP 5KLVJ 2QJYB 2YXQB 4PD4I 3H32B 1NKNA 1CZQA 1BDCA 5KLIC 4C7RA 4BXLA 3A0BH 2IDBA 1T2KC 3RGUA 4HJGH 3R4YA 1FZCA 3HUSC 1FOSE 2Q7CA 4XA4A 3AEGC 3JSVC 1KZUB 1SFCA 4KJMA 2OQQA 2B88A 2OYOA 3Q5SA 3AEEC 5DJTB 3AECC 1PGJA 2XU6A 5AVQB 1T3UA 1LTJA 4WWIA 5AVSB 3RL0g 1H0TA 1PP9G 3L36A 1NTME 2E75B 3BVHA 4HKZH 1L0LK 1YTZT 3OW2O 2I8DA 3H1IG 2QVAA 4H0LC 2W90A 1FS0E 1X0TA 5C39A 1FU1A 2W83C 2BCCG 3RK2C 2I1KA 1AA0A 4O9BA 4ASWA 1KILB 1URQD 3C1LA 4Y99B 3CD6P 1SQPD 2OARA 4N78D 3D70A 3B5NA 4K3AA 1BDDA 1JUNA 3AE2C 2HLOA 2FYUK 3V2RA 2JWAA 1QL1A 2IX7C 2YIUC 2FXPA 2GUSA 5BU5A 1KYOI 1NAFA 3V2NA 2KUBA 1S2EA 1BGYD 5CJ0A 2YKPA 5AW0B 2Z4EA 2CK3H 1JY3N 1URQC 5E79E 1PP9J 2O01N 1EZVD 5KAIH 1LTSC 1OXZA 5CJ4A 2N9YB 2JKVA 5E79H 4RESB 2RMZA 2IBZG 3H1IJ 2FYNB 2E76C 1NTKJ 3M9BA 1N7LA 1S5LX 4U3FG 1WMKA 2QSIA 1QVFO 3RL0B 3D71A 2Q9IA 3AE6C 1HF9A 3MIWA 3SSUA 1NYHA 2XNXA 2Z5HA 2M5AB 1USDA 3C8VA 5AW7B 2J5UA 1JCDA 2OGUA 3AE3C 3I5CA 1LWUA 1KMIZ 2Q5UA 4YPCA 1RF0A 3RK3B 3M06A 1QLED 1JM0A 2E75D 1DIPA 4ZNCA 3B8EB 1RQVA 3PH0A 1NU1G 1CSBA 1NTZD 1VQPP 3FXEA 1D7MA 4GIFA 1KN7A 3GF7A 3GMAA 3LIEA 1L0NK 4UB6H 1OX3A 3L75D 5KLVK 1SQQK 3WMM0 5AW8B 3Q2YA 1IJDB 2QEXP 1KILD 1FZEA 2WVRA 4U3FJ 1JY2O 3GF3A 4HB1A 1CI6A 2IFNA 1IK9A 1G2CB 2WSCJ 2KS1B 1S3JA 1HBWA 1SQBG 1IFJA 2Y9ZA 2K9JA 1LJ2A 3KXDA 1GW3A 5AW3B 3VMXA 1EC5A 2QM8A 2NPSB 1VQ7P 4C46A 1Q81Q 4Y99C 2M3BA 4XFJA 2HPCB 2WSFJ 1OVUA 1NU1J 1WRGA 2AXTE 4IL6H 1YI2P 5KAFE 1OVVA 4Z1MH 2OYIA 1GL2B 5CBOA 3Q1MA 2FKWB 2Q6QA 1L0LG 4PJ0H 5KAFH 1X9VA 4H13C 3RL0D 1FJPA 3H1KD 1PGPA 1PPJE 1GK6A 3HE4B 3H1LE 3L71D 1USEA 5M1BA 1EDIA 5CHXA 2PAJA 3WUVA 2KSEA 5AW6B 3KHUA 1XTCC 1IFPA 2KLUA 2WITA 3BCCD 3IAOA 4N3YB 2WPSA 4GODA 2V4HA 3PTZA 1URQA 3RK3D 2N1TD 3RK3E 4IOIH 2OYHB 3CX5E 2A45H 3IR9A 2FYUG 4B86A 2KZJA 3CX5H 3VP9A 1JY2P 3L74G 3SFDC 3HTKB 1FJKA 1SFCC 1PL5A 3MUDA 4OWFA 1S72P 1NTMK 3FXDA 2A06D 3CMAP 2A06E 5APQA 3RK3C 1OW8A 4RKUJ 3L73E 1L0LJ 1LTJC 2Z5IA 1M1JB 5AW4B 3TGUG 4EDFA 4EI2A 1ZR4A 3H32A 1NGMB 3CWBE 3L70D 5KJ7D 2C0XA 2QJKB 2ITAA 1ZN5A 3NFQA 1J1EB 4LC1A 4PV1D 2RN0A 1X8YA 3F5HA 3CWBG 5CCGD 2QA4P 3GW6A 1FDOA 4DZOA 2P1JA 3OA7A 2NPSD 2BASA 4H44B 3AE9C 1N2DC 1SQXD 1SQXE 1Y9BA 3L72J 1LTBC 1IFNA 2IZ0A 2FYUJ 4D6TD 4QMAA 3A5TA 1HTLC 2ZJSE 3GLMA 1HJ0A 3B5NC 5KJ7C 2W6BA 3L74J 4YTPC 3H1JG 1OVRA 1SQVG 2N9BA 3M9QA 2LKMA 1FC2C 1YYCA 1P84D 4JYCA 2YXRB 3MZWB 3CCJP 3KPEA 1L0NG 1IFDA 1VQ6P 1SQQG 4L73A 5APTA 5KLVD 3H1HJ 1BCCE 1FE6A 3TGUJ 2W6JH 2Y9YA 1KILA 1GL2C 3H6PA 2RKLA 4JF7A 1S5LE 2E43A 2UWJE 4L76A 5K5GB 2IBZI 1IK7A 1S5LH 2FY8A 3A3YB 3U59A 3N4XA 2OTJP 2PGDA 2HFED 2E5YA 4I7ZC 5AVRB 1NU1K 3MD0A 2HYNA 1GD2E 3JC22 3CCEP 2G8YA 3P8MC 1NO4A 1U7MA 2ZVNB 1PIXA 1LWUC 1N86A 5BU8B 3USSA 3S4RA 1RF0C 3M91A 1YITP 1VQ8P 3TF5A 1L0NJ 1GU5A 1SQQJ 4JQ0D 2XZRA 4KHXA 2FBWC 3F89A 1CW5A 3O6QB 3FX0A 1GK4A 3TNUB 1SQBK 2IZ1A 5CMZA 4H44D 2M5AA 2WT7B 3CC7P 2WPQA 4BWNA 1KQSO 1EDKA 1VQ5P 5AVTB 1OMIA 1S1CX 1N7SB 3RBXA 4DJGA 1VQ9P 2W27A 1L2PA 3KZIE 2N1TA 2P7JA 1ZRTD 4K35A 1T6AA 3V4QA 1A02J 4ZKPA 1MFTA 2IPPA 2WPRA 1FZFA 1KQFB 5APYA 1PP9D 1H88A 3GHGB 1BE3D 2H43A 2C0WA 1BE3E 1AV1A 1JY3O 1FZGA 2MJZA 1NTMG 1PGQA 3M0AA 3NMDA 1KORA 3H1ID 1NTKD 4EYYQ 1VQKP 2MKVA 3IF4A 1NTKE 2NRGA 2ZYAA 2I1JA 3P32A 1T3JA 4OGQB 5AW1B 3AEAC 3M9HA 1BSNA 2OYIC 2IYOA 1JCCA 1Q2NA 1FZAA 2KLVA 1ZMEC 1G2CA 1SQPE 2KS1A 4N78E 5KKZC 5KJ7A 5B66E 2QE7H 4W7YA 1KB9D 1AJYA 1KQLA 2KNCB 5CCGA 2E74D 1XTGB 1VF5D 5B66H 1RF1B 3P8CD 2JWDA 5B5EE 2NPSA 3PP5A 1PV3A 1GTWA 1BGYE 2HPCA 3ABVC 1QX8A 5B5EH 3OAKA 4U7JA 1EZVE 1MV8A 1GL2A 5L8RJ 3AEBC 3UIAA 3CMEP 5CCHD 2A45I 4AQRD 1YJNP 1NTMJ 2H88C 2ZXEB 3HE4A 2Q3IA 2B9BA 3CX5I 2L5GB 3T97A 4U3FD 3CXHD 3H25A 2BCCJ 3MUDC 1Y47A 1T8ZA 1LT9B 1UIIA 3VOPA 1N7SD 3AEDC 3Q5PA 3V2PA 2V7QH 2OYHA 2QJYC 5AW9B 2R32A 1RE3A 3JCUE 1PGOA 2E42A 2P10A 3KQGA 2N1TB 1J1DB 2J58A 3JCUH 1SQVK 2Y0DA 2H8PD 4R4MA 3HTKA 4PD4D 1LTIC 3WU2E 1NU1D 1NTZE 2QJPB 4NPFX 3G9RA 1LTTC 2NZ2A 3WU2H 2R5DA 2M3EA 3L75E 2WMMA 4OGQD 3AE5C 4UB8E 1JMMA 1KILE 1OW7A 1M1JA 4GOEA 2K1AA 5KTBA 5AVXB 2J59M 3L37A 2E75C 3L75G 4UB8H 3U1CA 3BRTB 2JDIH 4OH8B 2ZYGA 2O1JA 1JMBA 2HR3A 1LGHB 3VYIA 4WY4B 1H89A 4NPDA 4PV1B 4DOJA 1KTMA 2WSEH 3A7OA 2FFDB 1KILC 2ZXXA 2E5TA 1JEKA 1MKMA 3LW5H 1NJIQ 3L35A 2SPZA 2AXTH 1QL2A 2CPSA 1L0LD 4JPZB 1K05A 3H1KE 3L71E 5APWA 3T97B 2WZ7A 1HH0A 3S9OA 3G4SP 1PPJG 1KYOD 3H1LG 1DEEG 1NAYA 2RH0A 3QWOC 1JY2N 4RO0A 3BCCE 1AQ5A 1E79H 2YO2A 1Y8AA 1SQBJ 2FYNC 2KYVA 1H8AA 2Y0CA 3L72D 2OTLP 3RL0C 2A45G 3L72E 3Q3DA 2KOGA 1LT9C 2FYUD 4GOFA 3EWKA 3D6ZA 5AVUB 1KFNA 4W80A 3L74D 4W7ZA 1ZLLA 1L4AB 2XDJA 1KQGB 1PZQA 3R2PA 2AEFA 1NVOA 2N1TC 1QGKB 3A0HE 3H1HD 5APUA 2H89C 2POHA 3H1HE 2A06G 5CCHA 3TGUD 1M90Q 3P7KA 2JP3A 2R44A 3O6QA 3L70E 4WY4D 3L73G 3HD7D 3TNUA 3A0HH 3HUSB 5APSA 1Q86Q 1FDMA 3H1LJ 2WT7A 5TISE 2G3AA 1OIPA 1LP1B 1R8EA 3V5BA 2PRRA 1N7SA 1HGZA 5TISH 5TJHA 3AEFC 2O01H 3II6A 4LLHA 2D2CD 1A02F 4D6TE 3G71P 2XNDH 1SQXG 2W6AA 3GG2A 2XV5A 2L91A 2YKOA 3KDPB 3GHGA 4PV1C 2WSSH 4C7NB 5CCGC 1P84E 4BRYB 4H0LB 3G3ZA 3W67A 3WUUA 3MP7B 2NPSC 4EOTA 1L0ND 2ZT9D 1KD1Q 3RK2B 1P84H 5APXA 1SQQD 5KLVE 1ZOYC 1DEBA 3NTNA 5H2FE 3VN0A 5APVA 3L73J 1WT6A 1Z56A 1BCCG 1NOHA 4KT0J 5H2FH 3CWBJ 5DJUB 3E7KA 3W68A 1EZVI 2YIUB 3TK1A 1N8RQ 2KNCA 4HH2A 1MZ9A 3V4WA 1RF1A 3VMZA 5AW2B 3HE5B 2ZVOB 1L4AD 3TDKA 2B87B 2E74B 2KIKA 1IO4A 1VF5B 4I6MC 1YQ4C 5AVYB 1LNQA 3H1JJ 3I56P 3FWLA 2OYHC 1SQVJ 1RE3C 1GMJA 2K37A 1M8OB 1T2KD 2E76B 2BEQD 1MFZA 2K3RA 1G1IA 3IN6A 3ITKA 2O3JA 4LGDE 1RE4A 1LT9A 3CPWO 1BCCJ 4N6JA 1OFCX 2DW3A 1M1JC 1KFMA 2M0BA 3TYYA 4IFMA 2LXBA 1JTHB 1PFIA 4XE5B 1OWAA 3E1RA 2XKMA 2QJKC 3VMYA 3CC2P 4GT1A 1J1EC 1ZRTE 3KZIH 2IFMA 4H0LD 3EFFK 3B4SA 1J2JB 1PP9E 1JOCA 4H44C 3RK2D 1Q7YQ
chains in the Genus database with same CATH topology
2P10A 1YQ3C 2YMKA 3R4YA 3Q2YA 1ZMEC 3IAOA 5KKZC 1DD3A 3GLMA 1HJ0A 1FDIA 3AEGC 1K05A 1TU3F 2G3AA 2E74B 4R4MA 2OQQA 4TT3H 4H13D 1VF5B 4YTPC 3RK3E 3Q5SA 1R8EA 1YQ4C 3AEEC 2WQYC 3T97B 2D2CB 1AJYA 3AECC 2FBWC 1VL2A 2QJPC 3G9RA 3GF3A 2E74D 3AEFC 3S9OA 2NZ2A 3AE1C 1VF5D 2ZT9C 1GMJA 4H44D 2D2CD 1PV3A 2BEZF 2WSCJ 1Q90D 3RL0g 2E76B 4OGQD 3AE5C 2O01J 2BEQD 1JB0J 3ABVC 3D6YA 3SFDC 1OW7A 1KILE 2E76C 4IL6X 1S5LX 2E75B 1PL5A 1OMIA 2FYNC 3AE7C 1WMKA 1S1CX 2QSIA 4U7JA 3IN6A 2E75C 3D71A 2QIWA 3AE6C 1HF9A 3FGAD 2ZT9B 4PV1C 5L8RJ 3SFEC 3Q3DA 3AEBC 1NYHA 4Y28J 1OW6A 4H0LB 2K9YA 1OW8A 1K04A 4RKUJ 3EWKA 4H0LC 4XFJA 3C8VA 2ZT9D 3D6ZA 2H88C 2J5UA 2WSFJ 2JO1A 1EXIA 1RQUA 3AE8C 1EXJA 1IK7A 3AE3C 1KQFB 1NGMB 1KMIZ 2WPVB 2E76D 4PV1B 3H25A 1ZOYC 4Z1MH 1KQGB 1KTMA 4I7ZB 3Q1MA 1ZP0C 1U57A 3B71A 3AE4C 2E75D 4H13B 4I7ZC 4R4LA 1DIPA 2QJKC 4PV1D 1UIXA 3D70A 1RQVA 3AEDC 4H13C 2WSEJ 1MKMA 1KORA 1ZRTE 3Q5PA 5M1BA 3Q5RA 4KT0J 3AE2C 1FDOA 2G8YA 2MKVA 4H0LD 2E74C 2H89C 4H44B 1DD4A 3AE9C 3GF7A 3GMAA 1VF5C 2QJYC 3LW5J 5KLIC 4GDOA 2JP3A 4OGQB 1PIXA 4H44C 2D2CC 2IDBA 3O6QA 1Y9BA 2V7QJ 3AEAC 4YXDC 2YIUC 2FXPA 4OGQC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y28 J;  4H0L B;  4H13 B;  2K9Y A;  2QJK C;  4RKU J;  2WSC J;  1Q90 D;  5KKZ C;  2E76 B;  2WSE J;  3C8V A;  2O01 J;  1JB0 J;  1ZRT E;  2E74 B;  2WSF J;  4IL6 X;  4KT0 J;  1S5L X;  2E75 B;  1VF5 B;  4H44 B;  2FYN C;  2QSI A;  2D2C B;  2QJY C;  3LW5 J;  5KLI C;  2WPV B;  4PV1 B;  2QIW A;  2QJP C;  4OGQ B;  4I7Z B;  2ZT9 B;  5L8R J;  2YIU C; 
#chains in the Genus database with same CATH topology
 3HRN A;  3SWY A;  3C9I A;  2HG5 D;  2KZI A;  1NTM D;  3H1I E;  1YBK A;  1BE3 G;  1GW4 A;  3V2Q A;  3K5B A;  2BCC D;  1NWQ A;  1GZL A;  2BCC E;  4AUW A;  3MTU E;  1N73 B;  1NTK G;  3M0D A;  4IFD K;  1JB0 J;  3D6Y A;  4WY4 A;  3HD7 A;  3VP8 A;  3SWF A;  3L4F A;  4CPG A;  3G6E P;  2QIW A;  3QH9 A;  1KB9 E;  1SQP G;  3SFE C;  1VDF A;  2FFD A;  4ZKU A;  3FWN A;  3VTP C;  3P8C E;  3VMA A;  1KB9 H;  2HOD B;  2JO1 A;  1GDT A;  4MN4 C;  3TSI A;  3CCL P;  1SS1 A;  2VRS A;  2E76 D;  1BGY G;  4H13 B;  4R4L A;  2AEM A;  5KAI E;  1NHL A;  2QM7 A;  1VQM P;  5BVZ A;  1FZB A;  2IBZ D;  3Q5R A;  1EZV G;  1EDJ A;  1RY3 A;  2IBZ E;  2KI7 B;  4L74 A;  2E74 C;  2FYZ A;  1VF5 C;  4IFF A;  2KB7 P;  1BE3 J;  4U3F E;  3CXH E;  4YXD C;  2C9L Y;  2LR2 A;  4AYC A;  1ZR2 A;  1DD3 A;  3SWK A;  3CXH H;  1YTZ I;  5GTI E;  1HGV A;  2P2U A;  1JY3 P;  1ZXG A;  2WQY C;  2KK7 A;  1VL2 A;  2YKQ A;  5CCH C;  2WSC H;  1R5S A;  5GTI H;  2JR8 A;  1RHZ B;  5AVW B;  1SQP J;  3N7N A;  1FZC B;  2BEZ F;  1YHQ P;  1SQX K;  1SFC B;  3CCR P;  3V6I A;  4PD4 E;  1E5W A;  3AE7 C;  3MGN A;  2P67 A;  1NU1 E;  2KP8 A;  1L4A A;  3FGA D;  4L75 A;  5AVV B;  1N7S C;  2WSF H;  4PD4 H;  1BGY J;  1LTJ B;  1H0T B;  4ZMD A;  1NTZ G;  1NH4 A;  3CL3 D;  4UB6 E;  3CI9 A;  2AXC A;  2Y0E A;  2WWW A;  2H7H A;  1R5L A;  5EFW B;  3AE4 C;  4HYT B;  3GHG C;  3HUS A;  3A2A A;  1QEX A;  1HWT C;  1SP4 A;  2KXP B;  3HD7 B;  1SQB D;  2O1K A;  1LP1 A;  1SQB E;  1MUU A;  1DD4 A;  2GA1 A;  3EFG A;  1M1K Q;  2V7Q J;  1P84 I;  4I1L A;  4OGQ C;  1YJW P;  3BAS A;  2GUV A;  2YMK A;  1S4X A;  3B5N B;  1N73 C;  4ASV A;  2ZAE B;  4WB4 A;  4TT3 H;  4H13 D;  1HJB A;  2D2C B;  2Q1K A;  4C7N A;  4IL6 E;  4BRY A;  1AQT A;  1Q90 D;  1RF1 C;  5AVZ B;  1S9K D;  1S9K E;  1NTZ J;  1L0L E;  2LXC B;  3RBZ A;  4M3L A;  5GTH E;  4PJ0 E;  1BSH A;  2K88 A;  3IFM A;  2QRX A;  1EDL A;  2ZT9 B;  1ZV8 A;  3L75 J;  2YO3 A;  4Y28 J;  3H1K G;  5GTH H;  2P58 A;  1PPJ D;  1KYO E;  1YIJ P;  1DH3 A;  3L71 G;  3H1L D;  1DX7 A;  1K73 Q;  1EXI A;  5CBN A;  1RQU A;  1SVF A;  1KYO H;  4DCK A;  1SFC D;  4I7Z B;  4EIJ A;  3B71 A;  3BCC G;  1M57 D;  1RE4 C;  1SLQ A;  3HE5 A;  2FYU E;  4DT0 A;  2WSE J;  2B89 A;  2AEJ A;  2B87 A;  4A7P A;  3CX5 D;  1LWU B;  3L72 G;  1HVV A;  3LW5 J;  3L74 E;  3U1A A;  3I55 P;  1VQN P;  3PRJ A;  3MHV A;  3O8Z A;  2CPB A;  1JO5 A;  1FZC C;  2WTY A;  1FDI A;  1VQ4 P;  1J1D C;  5KLI B;  2Q3E A;  3CCU P;  2QJP C;  3TGU E;  4I2L C;  1NTK K;  2YMY A;  3BAT A;  1W2E A;  3L73 D;  2IYP A;  3H1K J;  3H1H G;  4YXW H;  3L71 J;  3L70 G;  3CWB D;  1SQP K;  1IFM A;  3B5N D;  1FBM A;  2W8Z A;  2FXO A;  1K8A Q;  1CI6 B;  1JTH A;  1AVO A;  1IC2 A;  1OW6 A;  2K9Y A;  3BCC J;  1M56 D;  1OZH A;  2ZYD A;  2K9J B;  3M0D C;  1EXJ A;  4WY4 C;  1GU4 A;  1AVY A;  3HD7 C;  4JBZ A;  2WPV B;  1VQL P;  3H1J D;  1SQV D;  3H1J E;  1ZP0 C;  1U57 A;  1ZW0 A;  3CCS P;  4D6T G;  1SQV E;  2JEE A;  1Q82 Q;  3PLN A;  1KV4 A;  1FAV A;  2FFD C;  1KC8 Q;  2OTK E;  3CC4 P;  1GL2 D;  1X22 A;  1L0N E;  1LTA C;  1LTG C;  3E1I A;  2QG4 A;  1SQQ E;  1KB9 I;  4GDO A;  2OYI B;  2R5B A;  2D2C C;  4TLF A;  4GKG A;  2R3S A;  5KKZ B;  1YQ3 C;  4WBA A;  2KSJ A;  1N73 A;  1IZN B;  5KLV G;  1LT1 A;  1TU3 F;  4NPE A;  1BCC D;  3CCM P;  4JYB A;  3EQ2 A;  4WVZ A;  3L70 J;  4OVN F;  3WUT A;  2GM4 A;  2C9N Y;  1FOS F;  3AE1 C;  2ZT9 C;  1JNM A;  4RJT A;  1W2B O;  2R3C A;  2O01 J;  1G1J A;  1URQ B;  2HOD A;  3PJS K;  4IL6 X;  3LID A;  1HUC A;  1SQX J;  1IFI A;  3CXH I;  1NTZ K;  3CLQ A;  1X79 B;  1RH5 B;  4D6T J;  1YJ9 P;  1K04 A;  1VPC A;  2M8R A;  1AFO A;  1U7J A;  3AE8 C;  3BRV B;  3KYQ A;  3NXS A;  1K9M Q;  5AW5 B;  2ZFC A;  1NKZ B;  1VQO P;  3OJA B;  2FXM A;  1W5C E;  1L4A C;  1M7L A;  3ZDM A;  1EQ7 A;  3S1K A;  2PP6 A;  3CCQ P;  1UIX A;  2JJL A;  3PHL A;  2YNY A;  3A0B E;  2PFX A;  1QVG O;  3CCV P;  5KLV J;  2QJY B;  2YXQ B;  4PD4 I;  3H32 B;  1NKN A;  1CZQ A;  1BDC A;  5KLI C;  4C7R A;  4BXL A;  3A0B H;  2IDB A;  1T2K C;  3RGU A;  4HJG H;  3R4Y A;  1FZC A;  3HUS C;  1FOS E;  2Q7C A;  4XA4 A;  3AEG C;  3JSV C;  1KZU B;  1SFC A;  4KJM A;  2OQQ A;  2B88 A;  2OYO A;  3Q5S A;  3AEE C;  5DJT B;  3AEC C;  1PGJ A;  2XU6 A;  5AVQ B;  1T3U A;  1LTJ A;  4WWI A;  5AVS B;  3RL0 g;  1H0T A;  1PP9 G;  3L36 A;  1NTM E;  2E75 B;  3BVH A;  4HKZ H;  1L0L K;  1YTZ T;  3OW2 O;  2I8D A;  3H1I G;  2QVA A;  4H0L C;  2W90 A;  1FS0 E;  1X0T A;  5C39 A;  1FU1 A;  2W83 C;  2BCC G;  3RK2 C;  2I1K A;  1AA0 A;  4O9B A;  4ASW A;  1KIL B;  1URQ D;  3C1L A;  4Y99 B;  3CD6 P;  1SQP D;  2OAR A;  4N78 D;  3D70 A;  3B5N A;  4K3A A;  1BDD A;  1JUN A;  3AE2 C;  2HLO A;  2FYU K;  3V2R A;  2JWA A;  1QL1 A;  2IX7 C;  2YIU C;  2FXP A;  2GUS A;  5BU5 A;  1KYO I;  1NAF A;  3V2N A;  2KUB A;  1S2E A;  1BGY D;  5CJ0 A;  2YKP A;  5AW0 B;  2Z4E A;  2CK3 H;  1JY3 N;  1URQ C;  5E79 E;  1PP9 J;  2O01 N;  1EZV D;  5KAI H;  1LTS C;  1OXZ A;  5CJ4 A;  2N9Y B;  2JKV A;  5E79 H;  4RES B;  2RMZ A;  2IBZ G;  3H1I J;  2FYN B;  2E76 C;  1NTK J;  3M9B A;  1N7L A;  1S5L X;  4U3F G;  1WMK A;  2QSI A;  1QVF O;  3RL0 B;  3D71 A;  2Q9I A;  3AE6 C;  1HF9 A;  3MIW A;  3SSU A;  1NYH A;  2XNX A;  2Z5H A;  2M5A B;  1USD A;  3C8V A;  5AW7 B;  2J5U A;  1JCD A;  2OGU A;  3AE3 C;  3I5C A;  1LWU A;  1KMI Z;  2Q5U A;  4YPC A;  1RF0 A;  3RK3 B;  3M06 A;  1QLE D;  1JM0 A;  2E75 D;  1DIP A;  4ZNC A;  3B8E B;  1RQV A;  3PH0 A;  1NU1 G;  1CSB A;  1NTZ D;  1VQP P;  3FXE A;  1D7M A;  4GIF A;  1KN7 A;  3GF7 A;  3GMA A;  3LIE A;  1L0N K;  4UB6 H;  1OX3 A;  3L75 D;  5KLV K;  1SQQ K;  3WMM 0;  5AW8 B;  3Q2Y A;  1IJD B;  2QEX P;  1KIL D;  1FZE A;  2WVR A;  4U3F J;  1JY2 O;  3GF3 A;  4HB1 A;  1CI6 A;  2IFN A;  1IK9 A;  1G2C B;  2WSC J;  2KS1 B;  1S3J A;  1HBW A;  1SQB G;  1IFJ A;  2Y9Z A;  2K9J A;  1LJ2 A;  3KXD A;  1GW3 A;  5AW3 B;  3VMX A;  1EC5 A;  2QM8 A;  2NPS B;  1VQ7 P;  4C46 A;  1Q81 Q;  4Y99 C;  2M3B A;  4XFJ A;  2HPC B;  2WSF J;  1OVU A;  1NU1 J;  1WRG A;  2AXT E;  4IL6 H;  1YI2 P;  5KAF E;  1OVV A;  4Z1M H;  2OYI A;  1GL2 B;  5CBO A;  3Q1M A;  2FKW B;  2Q6Q A;  1L0L G;  4PJ0 H;  5KAF H;  1X9V A;  4H13 C;  3RL0 D;  1FJP A;  3H1K D;  1PGP A;  1PPJ E;  1GK6 A;  3HE4 B;  3H1L E;  3L71 D;  1USE A;  5M1B A;  1EDI A;  5CHX A;  2PAJ A;  3WUV A;  2KSE A;  5AW6 B;  3KHU A;  1XTC C;  1IFP A;  2KLU A;  2WIT A;  3BCC D;  3IAO A;  4N3Y B;  2WPS A;  4GOD A;  2V4H A;  3PTZ A;  1URQ A;  3RK3 D;  2N1T D;  3RK3 E;  4IOI H;  2OYH B;  3CX5 E;  2A45 H;  3IR9 A;  2FYU G;  4B86 A;  2KZJ A;  3CX5 H;  3VP9 A;  1JY2 P;  3L74 G;  3SFD C;  3HTK B;  1FJK A;  1SFC C;  1PL5 A;  3MUD A;  4OWF A;  1S72 P;  1NTM K;  3FXD A;  2A06 D;  3CMA P;  2A06 E;  5APQ A;  3RK3 C;  1OW8 A;  4RKU J;  3L73 E;  1L0L J;  1LTJ C;  2Z5I A;  1M1J B;  5AW4 B;  3TGU G;  4EDF A;  4EI2 A;  1ZR4 A;  3H32 A;  1NGM B;  3CWB E;  3L70 D;  5KJ7 D;  2C0X A;  2QJK B;  2ITA A;  1ZN5 A;  3NFQ A;  1J1E B;  4LC1 A;  4PV1 D;  2RN0 A;  1X8Y A;  3F5H A;  3CWB G;  5CCG D;  2QA4 P;  3GW6 A;  1FDO A;  4DZO A;  2P1J A;  3OA7 A;  2NPS D;  2BAS A;  4H44 B;  3AE9 C;  1N2D C;  1SQX D;  1SQX E;  1Y9B A;  3L72 J;  1LTB C;  1IFN A;  2IZ0 A;  2FYU J;  4D6T D;  4QMA A;  3A5T A;  1HTL C;  2ZJS E;  3GLM A;  1HJ0 A;  3B5N C;  5KJ7 C;  2W6B A;  3L74 J;  4YTP C;  3H1J G;  1OVR A;  1SQV G;  2N9B A;  3M9Q A;  2LKM A;  1FC2 C;  1YYC A;  1P84 D;  4JYC A;  2YXR B;  3MZW B;  3CCJ P;  3KPE A;  1L0N G;  1IFD A;  1VQ6 P;  1SQQ G;  4L73 A;  5APT A;  5KLV D;  3H1H J;  1BCC E;  1FE6 A;  3TGU J;  2W6J H;  2Y9Y A;  1KIL A;  1GL2 C;  3H6P A;  2RKL A;  4JF7 A;  1S5L E;  2E43 A;  2UWJ E;  4L76 A;  5K5G B;  2IBZ I;  1IK7 A;  1S5L H;  2FY8 A;  3A3Y B;  3U59 A;  3N4X A;  2OTJ P;  2PGD A;  2HFE D;  2E5Y A;  4I7Z C;  5AVR B;  1NU1 K;  3MD0 A;  2HYN A;  1GD2 E;  3JC2 2;  3CCE P;  2G8Y A;  3P8M C;  1NO4 A;  1U7M A;  2ZVN B;  1PIX A;  1LWU C;  1N86 A;  5BU8 B;  3USS A;  3S4R A;  1RF0 C;  3M91 A;  1YIT P;  1VQ8 P;  3TF5 A;  1L0N J;  1GU5 A;  1SQQ J;  4JQ0 D;  2XZR A;  4KHX A;  2FBW C;  3F89 A;  1CW5 A;  3O6Q B;  3FX0 A;  1GK4 A;  3TNU B;  1SQB K;  2IZ1 A;  5CMZ A;  4H44 D;  2M5A A;  2WT7 B;  3CC7 P;  2WPQ A;  4BWN A;  1KQS O;  1EDK A;  1VQ5 P;  5AVT B;  1OMI A;  1S1C X;  1N7S B;  3RBX A;  4DJG A;  1VQ9 P;  2W27 A;  1L2P A;  3KZI E;  2N1T A;  2P7J A;  1ZRT D;  4K35 A;  1T6A A;  3V4Q A;  1A02 J;  4ZKP A;  1MFT A;  2IPP A;  2WPR A;  1FZF A;  1KQF B;  5APY A;  1PP9 D;  1H88 A;  3GHG B;  1BE3 D;  2H43 A;  2C0W A;  1BE3 E;  1AV1 A;  1JY3 O;  1FZG A;  2MJZ A;  1NTM G;  1PGQ A;  3M0A A;  3NMD A;  1KOR A;  3H1I D;  1NTK D;  4EYY Q;  1VQK P;  2MKV A;  3IF4 A;  1NTK E;  2NRG A;  2ZYA A;  2I1J A;  3P32 A;  1T3J A;  4OGQ B;  5AW1 B;  3AEA C;  3M9H A;  1BSN A;  2OYI C;  2IYO A;  1JCC A;  1Q2N A;  1FZA A;  2KLV A;  1ZME C;  1G2C A;  1SQP E;  2KS1 A;  4N78 E;  5KKZ C;  5KJ7 A;  5B66 E;  2QE7 H;  4W7Y A;  1KB9 D;  1AJY A;  1KQL A;  2KNC B;  5CCG A;  2E74 D;  1XTG B;  1VF5 D;  5B66 H;  1RF1 B;  3P8C D;  2JWD A;  5B5E E;  2NPS A;  3PP5 A;  1PV3 A;  1GTW A;  1BGY E;  2HPC A;  3ABV C;  1QX8 A;  5B5E H;  3OAK A;  4U7J A;  1EZV E;  1MV8 A;  1GL2 A;  5L8R J;  3AEB C;  3UIA A;  3CME P;  5CCH D;  2A45 I;  4AQR D;  1YJN P;  1NTM J;  2H88 C;  2ZXE B;  3HE4 A;  2Q3I A;  2B9B A;  3CX5 I;  2L5G B;  3T97 A;  4U3F D;  3CXH D;  3H25 A;  2BCC J;  3MUD C;  1Y47 A;  1T8Z A;  1LT9 B;  1UII A;  3VOP A;  1N7S D;  3AED C;  3Q5P A;  3V2P A;  2V7Q H;  2OYH A;  2QJY C;  5AW9 B;  2R32 A;  1RE3 A;  3JCU E;  1PGO A;  2E42 A;  2P10 A;  3KQG A;  2N1T B;  1J1D B;  2J58 A;  3JCU H;  1SQV K;  2Y0D A;  2H8P D;  4R4M A;  3HTK A;  4PD4 D;  1LTI C;  3WU2 E;  1NU1 D;  1NTZ E;  2QJP B;  4NPF X;  3G9R A;  1LTT C;  2NZ2 A;  3WU2 H;  2R5D A;  2M3E A;  3L75 E;  2WMM A;  4OGQ D;  3AE5 C;  4UB8 E;  1JMM A;  1KIL E;  1OW7 A;  1M1J A;  4GOE A;  2K1A A;  5KTB A;  5AVX B;  2J59 M;  3L37 A;  2E75 C;  3L75 G;  4UB8 H;  3U1C A;  3BRT B;  2JDI H;  4OH8 B;  2ZYG A;  2O1J A;  1JMB A;  2HR3 A;  1LGH B;  3VYI A;  4WY4 B;  1H89 A;  4NPD A;  4PV1 B;  4DOJ A;  1KTM A;  2WSE H;  3A7O A;  2FFD B;  1KIL C;  2ZXX A;  2E5T A;  1JEK A;  1MKM A;  3LW5 H;  1NJI Q;  3L35 A;  2SPZ A;  2AXT H;  1QL2 A;  2CPS A;  1L0L D;  4JPZ B;  1K05 A;  3H1K E;  3L71 E;  5APW A;  3T97 B;  2WZ7 A;  1HH0 A;  3S9O A;  3G4S P;  1PPJ G;  1KYO D;  3H1L G;  1DEE G;  1NAY A;  2RH0 A;  3QWO C;  1JY2 N;  4RO0 A;  3BCC E;  1AQ5 A;  1E79 H;  2YO2 A;  1Y8A A;  1SQB J;  2FYN C;  2KYV A;  1H8A A;  2Y0C A;  3L72 D;  2OTL P;  3RL0 C;  2A45 G;  3L72 E;  3Q3D A;  2KOG A;  1LT9 C;  2FYU D;  4GOF A;  3EWK A;  3D6Z A;  5AVU B;  1KFN A;  4W80 A;  3L74 D;  4W7Z A;  1ZLL A;  1L4A B;  2XDJ A;  1KQG B;  1PZQ A;  3R2P A;  2AEF A;  1NVO A;  2N1T C;  1QGK B;  3A0H E;  3H1H D;  5APU A;  2H89 C;  2POH A;  3H1H E;  2A06 G;  5CCH A;  3TGU D;  1M90 Q;  3P7K A;  2JP3 A;  2R44 A;  3O6Q A;  3L70 E;  4WY4 D;  3L73 G;  3HD7 D;  3TNU A;  3A0H H;  3HUS B;  5APS A;  1Q86 Q;  1FDM A;  3H1L J;  2WT7 A;  5TIS E;  2G3A A;  1OIP A;  1LP1 B;  1R8E A;  3V5B A;  2PRR A;  1N7S A;  1HGZ A;  5TIS H;  5TJH A;  3AEF C;  2O01 H;  3II6 A;  4LLH A;  2D2C D;  1A02 F;  4D6T E;  3G71 P;  2XND H;  1SQX G;  2W6A A;  3GG2 A;  2XV5 A;  2L91 A;  2YKO A;  3KDP B;  3GHG A;  4PV1 C;  2WSS H;  4C7N B;  5CCG C;  1P84 E;  4BRY B;  4H0L B;  3G3Z A;  3W67 A;  3WUU A;  3MP7 B;  2NPS C;  4EOT A;  1L0N D;  2ZT9 D;  1KD1 Q;  3RK2 B;  1P84 H;  5APX A;  1SQQ D;  5KLV E;  1ZOY C;  1DEB A;  3NTN A;  5H2F E;  3VN0 A;  5APV A;  3L73 J;  1WT6 A;  1Z56 A;  1BCC G;  1NOH A;  4KT0 J;  5H2F H;  3CWB J;  5DJU B;  3E7K A;  3W68 A;  1EZV I;  2YIU B;  3TK1 A;  1N8R Q;  2KNC A;  4HH2 A;  1MZ9 A;  3V4W A;  1RF1 A;  3VMZ A;  5AW2 B;  3HE5 B;  2ZVO B;  1L4A D;  3TDK A;  2B87 B;  2E74 B;  2KIK A;  1IO4 A;  1VF5 B;  4I6M C;  1YQ4 C;  5AVY B;  1LNQ A;  3H1J J;  3I56 P;  3FWL A;  2OYH C;  1SQV J;  1RE3 C;  1GMJ A;  2K37 A;  1M8O B;  1T2K D;  2E76 B;  2BEQ D;  1MFZ A;  2K3R A;  1G1I A;  3IN6 A;  3ITK A;  2O3J A;  4LGD E;  1RE4 A;  1LT9 A;  3CPW O;  1BCC J;  4N6J A;  1OFC X;  2DW3 A;  1M1J C;  1KFM A;  2M0B A;  3TYY A;  4IFM A;  2LXB A;  1JTH B;  1PFI A;  4XE5 B;  1OWA A;  3E1R A;  2XKM A;  2QJK C;  3VMY A;  3CC2 P;  4GT1 A;  1J1E C;  1ZRT E;  3KZI H;  2IFM A;  4H0L D;  3EFF K;  3B4S A;  1J2J B;  1PP9 E;  1JOC A;  4H44 C;  3RK2 D;  1Q7Y Q; 
#chains in the Genus database with same CATH homology
 2P10 A;  1YQ3 C;  2YMK A;  3R4Y A;  3Q2Y A;  1ZME C;  3IAO A;  5KKZ C;  1DD3 A;  3GLM A;  1HJ0 A;  1FDI A;  3AEG C;  1K05 A;  1TU3 F;  2G3A A;  2E74 B;  4R4M A;  2OQQ A;  4TT3 H;  4H13 D;  1VF5 B;  4YTP C;  3RK3 E;  3Q5S A;  1R8E A;  1YQ4 C;  3AEE C;  2WQY C;  3T97 B;  2D2C B;  1AJY A;  3AEC C;  2FBW C;  1VL2 A;  2QJP C;  3G9R A;  3GF3 A;  2E74 D;  3AEF C;  3S9O A;  2NZ2 A;  3AE1 C;  1VF5 D;  2ZT9 C;  1GMJ A;  4H44 D;  2D2C D;  1PV3 A;  2BEZ F;  2WSC J;  1Q90 D;  3RL0 g;  2E76 B;  4OGQ D;  3AE5 C;  2O01 J;  2BEQ D;  1JB0 J;  3ABV C;  3D6Y A;  3SFD C;  1OW7 A;  1KIL E;  2E76 C;  4IL6 X;  1S5L X;  2E75 B;  1PL5 A;  1OMI A;  2FYN C;  3AE7 C;  1WMK A;  1S1C X;  2QSI A;  4U7J A;  3IN6 A;  2E75 C;  3D71 A;  2QIW A;  3AE6 C;  1HF9 A;  3FGA D;  2ZT9 B;  4PV1 C;  5L8R J;  3SFE C;  3Q3D A;  3AEB C;  1NYH A;  4Y28 J;  1OW6 A;  4H0L B;  2K9Y A;  1OW8 A;  1K04 A;  4RKU J;  3EWK A;  4H0L C;  4XFJ A;  3C8V A;  2ZT9 D;  3D6Z A;  2H88 C;  2J5U A;  2WSF J;  2JO1 A;  1EXI A;  1RQU A;  3AE8 C;  1EXJ A;  1IK7 A;  3AE3 C;  1KQF B;  1NGM B;  1KMI Z;  2WPV B;  2E76 D;  4PV1 B;  3H25 A;  1ZOY C;  4Z1M H;  1KQG B;  1KTM A;  4I7Z B;  3Q1M A;  1ZP0 C;  1U57 A;  3B71 A;  3AE4 C;  2E75 D;  4H13 B;  4I7Z C;  4R4L A;  1DIP A;  2QJK C;  4PV1 D;  1UIX A;  3D70 A;  1RQV A;  3AED C;  4H13 C;  2WSE J;  1MKM A;  1KOR A;  1ZRT E;  3Q5P A;  5M1B A;  3Q5R A;  4KT0 J;  3AE2 C;  1FDO A;  2G8Y A;  2MKV A;  4H0L D;  2E74 C;  2H89 C;  4H44 B;  1DD4 A;  3AE9 C;  3GF7 A;  3GMA A;  1VF5 C;  2QJY C;  3LW5 J;  5KLI C;  4GDO A;  2JP3 A;  4OGQ B;  1PIX A;  4H44 C;  2D2C C;  2IDB A;  3O6Q A;  1Y9B A;  2V7Q J;  3AEA C;  4YXD C;  2YIU C;  2FXP A;  4OGQ C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...