1S5LX

Architecture of the photosynthetic oxygen evolving center
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
40
structure length
40
Chain Sequence
TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem Q(B) protein
total genus 13
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s5lX00
1ZRTE 4OGQB 5L8RJ 2WPVB 2QSIA 1Q90D 2QJPC 4H0LB 4KT0J 5KKZC 4RKUJ 3C8VA 2FYNC 4PV1B 3LW5J 2QIWA 2K9YA 2ZT9B 4H13B 4Y28J 1JB0J 4H44B 2WSCJ 2E74B 2QJKC 2WSEJ 2WSFJ 1VF5B 2E76B 2QJYC 5KLIC 2D2CB 2O01J 2E75B 4I7ZB 1S5LX 2YIUC 4IL6X
chains in the Genus database with same CATH superfamily
3OAKA 1JTHB 4PV1D 5CHXA 1CW5A 1SQPK 1U57A 1LP1B 5APSA 2A45H 2AEFA 3CXHD 3F5HA 1YI2P 2RH0A 1HGZA 1NKNA 3EQ2A 2FFDC 4RKUJ 3VP8A 2JWDA 2XNDH 2B88A 3CPWO 3H1KG 1R5SA 3AE6C 1VPCA 3CXHH 3L75J 3M0AA 1PPJE 2Q1KA 4W7YA 2YNYA 1HF9A 1BDDA 1QEXA 2WTYA 2E43A 2H7HA 3A2AA 1JUNA 2DW3A 3V4QA 1PZQA 5TISH 4HH2A 2L5GB 4DZOA 1VF5D 2Q6QA 1BDCA 1N7SA 1SQQE 2NZ2A 2LXBA 2WQYC 2ZYGA 3RBXA 1BGYG 2B89A 1P84D 2G8YA 3WUVA 5B66H 1ZLLA 1ZXGA 2Q3EA 1FDOA 3RL0D 1K8AQ 3L73J 4ASVA 1ZR4A 4AUWA 1M1JA 1QL1A 3FX0A 5APTA 1KILB 3ABVC 3L75E 1G1JA 1Q2NA 3P8CD 3A0BH 4H13C 5TJHA 1H0TB 4WY4C 4LLHA 1KQFB 1IFPA 4JPZB 1Q90D 2KSEA 1S5LE 1NOHA 2Z5IA 2V7QJ 2ZYAA 1VQ6P 3H1LD 4GOEA 1DEEG 4MN4C 1QX8A 5KLVK 1JM0A 5KKZB 1FU1A 2IFNA 5APVA 1QVFO 1SQPD 5AW4B 1FDMA 3H1HE 3KQGA 1ZOYC 3KDPB 2RN0A 3L74J 3GHGA 1YHQP 3GLMA 1SQBJ 1DH3A 1PGOA 4HYTB 1H88A 2H88C 1VQKP 1P84H 1PGQA 1SQVK 2KIKA 4JQ0D 1NHLA 3U59A 5GTIH 5AW1B 2WSFJ 3L73E 3I56P 2AEMA 3L73D 2OYHA 1L4AB 5APUA 4IL6X 1DEBA 4NPFX 3L73G 5B66E 3H1JD 2HPCA 3AE4C 3HD7D 1QLED 1OX3A 1BGYJ 1PGPA 3L72J 2R3SA 1Q86Q 3AE3C 3LIDA 3V2NA 1OW7A 3OW2O 2YXRB 3ITKA 2WPRA 4Y99B 1KC8Q 2E75C 1JY2P 1LTAC 2KB7P 2Y0EA 1WRGA 2JJLA 1SQVD 1EXIA 4L76A 1IK7A 1HGVA 3CWBJ 3H1ID 3IR9A 1LTJB 3CXHI 3L74D 1SQBE 1JOCA 2V7QH 4IFFA 2MJZA 3B5NC 4WVZA 3BCCG 3H1KJ 4D6TE 3CCEP 2IYPA 2K9JB 1WT6A 2C0XA 5KLVD 2IBZG 1S2EA 1BCCE 2KXPB 3H25A 1FDIA 3MUDC 2KK7A 3VMYA 3Q1MA 4H44B 1N86A 1LTBC 2E74B 4JYBA 1IFNA 2KI7B 2YKQA 3L35A 4NPDA 1X9VA 3H1IG 4IOIH 2IZ1A 2KSJA 1KFNA 2M3BA 2WSFH 3CWBE 3HTKB 2R44A 3L70E 3L71G 1ZRTD 1BGYE 3GF3A 1X8YA 3HE4B 1N7LA 1EDIA 4XA4A 4Y99C 5AVUB 2BEZF 3G6EP 2ZXXA 2LXCB 2JWAA 2BEQD 1BCCJ 1LTTC 2E76C 3L71D 4HJGH 4WWIA 3HE5A 3VYIA 3H6PA 1KILD 4JF7A 4N3YB 2QJPB 5CCHA 1OWAA 1LP1A 3CX5I 1LWUC 1RF0C 3HD7A 5AW3B 3G9RA 1MZ9A 3RL0B 3CCVP 1R8EA 4OGQD 2Y9ZA 3H1KE 5AW0B 4D6TJ 5CBNA 5M1BA 1BSHA 5AW5B 1CI6B 1FS0E 2FYNB 5KJ7D 2KNCB 1RQVA 1OZHA 2M8RA 2P58A 3BRTB 2OTLP 1HBWA 2LR2A 2PFXA 3K5BA 1DIPA 2ZXEB 3BCCD 1GL2C 2QJKC 3MIWA 4RO0A 1EC5A 2Z5HA 4EDFA 3G4SP 1SQPG 1S5LX 3V2PA 1SQVG 1KN7A 2CPSA 2N1TD 2W6AA 4W80A 1S5LH 3JCUE 5APYA 4UB8H 2ZFCA 3VP9A 1N73A 2BASA 1EZVG 3AEAC 1U7MA 3O8ZA 5BVZA 3B5NB 2QSIA 3M9BA 3GHGC 2FXOA 1OXZA 4M3LA 5BU5A 1L2PA 4U3FE 2CK3H 1VQNP 3VTPC 1GD2E 4WY4A 4ZKPA 2E74C 1YQ4C 1PPJD 3I55P 3C9IA 2B87A 2UWJE 1D7MA 1ZW0A 2K9YA 2M5AB 5AVWB 1T6AA 2N1TC 1NTZG 3AEBC 3G3ZA 3GF7A 3BCCJ 3H1LJ 2Y9YA 4IL6E 2BCCE 1IFDA 1PP9G 1ZV8A 5AVVB 2SPZA 1P84E 3VMAA 2P67A 1KILE 3AEDC 1JMMA 3CWBG 3FXDA 1JY2O 3L71E 2XV5A 3H1IE 3MP7B 3WU2E 2Q9IA 4C46A 1NTZE 4RESB 1L4AA 3M0DC 2NPSD 1KILA 4N78D 3P8CE 2WZ7A 4LGDE 3L75D 3N4XA 2N9YB 4OVNF 4BWNA 2KS1B 1KYOD 1DD3A 1LNQA 2RKLA 3PHLA 3PTZA 3SWYA 1VQ7P 1N7SD 2IBZD 3QWOC 4PJ0E 2IBZE 5KLVG 3A5TA 1QGKB 1L0LK 4OGQC 4C7NA 3VOPA 3Q5RA 2C9LY 3A0BE 3EFFK 5KTBA 2R5DA 2ZYDA 1SFCC 2BCCJ 1M1KQ 1L0ND 3CCUP 3H1HD 2W90A 3H1JJ 1M90Q 1JY2N 2FBWC 2A06D 1BGYD 1T2KD 1N73C 1N73B 5AW9B 1GTWA 2O1JA 1MFZA 3AE7C 3M0DA 2Z4EA 2NPSC 1T3UA 5GTHE 1IJDB 1JB0J 1NTME 5C39A 2WWWA 2R3CA 3MZWB 1LT9A 5AVTB 1YJ9P 1S72P 2WSEJ 3H1IJ 1R5LA 1KILC 4CPGA 2FFDB 1GMJA 2J5UA 2HLOA 2O01J 1KORA 4H44C 1NTKD 1KQGB 3N7NA 3NTNA 3H1KD 4PV1C 2O01H 2E5TA 3L70J 3RBZA 1M1JC 2YIUB 4WY4D 3RK3C 1USDA 1Q81Q 2JP3A 2OQQA 1BE3G 3B5ND 3FWLA 4B86A 2I1KA 3TGUD 3JC22 2H89C 3SWFA 1Z56A 1NTMJ 3V2QA 3V6IA 2N1TB 1YYCA 2B9BA 3W68A 5APXA 3Q5PA 4XE5B 2QE7H 4C7RA 1LWUB 4HKZH 1AQ5A 1SQXD 2AXCA 4GDOA 1X79B 2QG4A 2ZT9B 4I1LA 1FAVA 1OVVA 2WMMA 3L72E 1IFJA 3CCLP 2R5BA 1M56D 2WSSH 2KS1A 2O3JA 4WB4A 3VMZA 1RQUA 1NKZB 1YIJP 1HJBA 1L0NE 1NTKJ 1AV1A 1RHZB 1YBKA 2WSCH 3AEEC 3L72G 2RMZA 4DJGA 5B5EE 2PP6A 2Y0CA 1Q7YQ 1PL5A 1SQBK 3MHVA 2WVRA 3TNUA 3V4WA 1NTZK 2ZVOB 3QH9A 1AVOA 1FZCA 2IDBA 4O9BA 1VQPP 2OYHC 4H0LB 1S3JA 1SQQK 1EQ7A 2IYOA 4KT0J 3HE5B 2QA4P 1KFMA 4NPEA 3CCRP 2L91A 3S9OA 3D71A 2E76D 2NRGA 4PJ0H 4WY4B 4DT0A 1BE3E 3TNUB 3Q5SA 1LT1A 4PV1B 1AQTA 4U3FG 1L0LG 4IFMA 2ZVNB 2P7JA 1J1EC 3WU2H 2P1JA 1OFCX 1ZP0C 2GA1A 5DJUB 3P7KA 3H1LE 2V4HA 4L75A 3G71P 2FY8A 3HUSB 1MFTA 1CSBA 1USEA 3R2PA 2QJYC 1JY3N 1CI6A 1NU1E 3L36A 2JEEA 5CJ4A 1OIPA 2H43A 2AXTE 3CCMP 4U7JA 1BE3J 2OYIA 1LWUA 1NU1K 2A06G 1J2JB 3V5BA 1S9KD 2O1KA 2QJPC 3CX5D 1RH5B 3A7OA 4GOFA 3IF4A 2KZJA 1AA0A 2KLVA 3H32B 4W7ZA 3RL0C 3IFMA 3WUUA 4EI2A 2E75D 4H44D 2CPBA 3AECC 5AVXB 3TDKA 2FYUD 1GW3A 1HTLC 1JY3O 1NU1J 1S1CX 1OMIA 2IPPA 2NPSA 2YKPA 2I1JA 3L75G 1LJ2A 2C0WA 4OH8B 2KP8A 1RF0A 3HD7C 2BCCD 1NYHA 1FBMA 3I5CA 1HUCA 2LKMA 3HE4A 1OW8A 4GIFA 4GT1A 5AW8B 1LT9B 1VF5C 1X0TA 5AVRB 3RK2B 1PP9E 2HPCB 2BCCG 1MV8A 4I7ZB 3MD0A 5AVYB 1EDJA 2M5AA 3JSVC 1SFCD 3T97A 2OYOA 1BE3D 2D2CC 4PD4E 2GUSA 3CX5H 1KYOE 3FGAD 1GU5A 1VQ9P 3CC2P 2KLUA 2FFDA 1TU3F 2P2UA 1BCCG 2ZJSE 3AEFC 3B8EB 3AEGC 1RE3C 3BATA 3FWNA 1IFIA 3L72D 3M9HA 3PH0A 5CBOA 5AW2B 5B5EH 1JCCA 3BCCE 1FZEA 3HRNA 3CCSP 2KZIA 1SQBG 5AVSB 3HUSC 3L71J 1PP9J 1NU1D 1W2EA 3L70D 1NTZJ 2HFED 5APWA 1N2DC 2N1TA 4YTPC 1EZVD 2IFMA 2KUBA 2QEXP 5KAFH 3PP5A 4H13D 2O01N 1T3JA 5APQA 4C7NB 1NTMD 1MUUA 3CX5E 4AYCA 3D6YA 3GMAA 3B5NA 5KLIC 4Z1MH 1EXJA 1LGHB 2D2CB 4TLFA 1X22A 1E5WA 4H0LD 5EFWB 5KJ7A 1L0NJ 1NTKE 2FYZA 1KMIZ 2FYUE 1GZLA 1VDFA 3H1JE 2C9NY 3Q3DA 3AE8C 4L74A 1H8AA 4ZNCA 4OGQB 3OJAB 1K73Q 1PFIA 1DD4A 1AFOA 3VN0A 1IK9A 5KAIH 4LC1A 3TF5A 1RE4A 1JO5A 4R4LA 1SQQD 1NTMK 5AW6B 3MGNA 5KKZC 1LTIC 3F89A 1G2CB 1NVOA 1URQD 1FZCB 1MKMA 1BSNA 2B87B 2Q3IA 1FJPA 4H0LC 1PP9D 1YJNP 1K05A 1XTCC 1GL2A 1NTZD 4EIJA 2E42A 4D6TD 3AE9C 3AE1C 3L37A 4K3AA 2W6BA 2Q7CA 1SQXE 1VQ4P 3RK3D 2GUVA 4XFJA 2MKVA 1SFCA 2W83C 1N8RQ 5KLVE 2Q5UA 4H13B 1SLQA 1AVYA 1JCDA 4YXDC 1IC2A 1L0NG 1VQ8P 2AXTH 3KZIH 4PD4H 3E7KA 4K35A 3WMM0 1QL2A 1U7JA 3NXSA 3CC4P 3EWKA 3OA7A 5L8RJ 1A02J 2HYNA 1HH0A 1S4XA 3SFEC 1SQXG 1YTZT 1GU4A 1ZRTE 1PV3A 2WPQA 1SQQG 3B71A 3EFGA 1VL2A 1FOSE 1SQXJ 2I8DA 3TK1A 2PGDA 1NAYA 2D2CD 4I7ZC 5K5GB 1SQVJ 1RE4C 2YMYA 4UB6E 1L0LJ 3KHUA 5E79H 3RGUA 5AVZB 3BVHA 4KHXA 4HB1A 1YITP 1NAFA 2QRXA 2KOGA 1M8OB 2FYUK 3AE2C 3KZIE 3RL0g 2WT7A 4QMAA 1QVGO 3H32A 1FZFA 3KPEA 5KLVJ 4JYCA 3H1JG 1T2KC 5CCGA 3CD6P 1RF1B 3RK3B 1NTKG 2HODB 1YTZI 1NO4A 1NWQA 1KD1Q 1JTHA 1FZBA 2ZAEB 1ZN5A 2K88A 1JY3P 1SQPE 2E75B 1NU1G 1GK6A 3CCJP 5TISE 3KYQA 3PLNA 4EOTA 2A45I 1Q82Q 1FZAA 2QM7A 2Y0DA 1N7SC 4DCKA 2M3EA 2J59M 2WPSA 2YXQB 2E5YA 3HUSA 2R32A 4AQRD 1OVRA 2QVAA 4L73A 5H2FH 1S9KE 3H1HG 3P8MC 1VQLP 1CZQA 3V2RA 2W6JH 1EZVI 1G2CA 1L0LE 1L0LD 1L4AC 1PGJA 1RE3A 2M0BA 1GW4A 2YMKA 4GKGA 4YPCA 3RK2D 3D70A 3LW5H 3NMDA 3L4FA 5CCHC 3C1LA 3ZDMA 2FYNC 4IFDK 1DX7A 4TT3H 3CI9A 3SSUA 4RJTA 2YKOA 3SWKA 2OARA 2XNXA 3L74G 4Y28J 5BU8B 5CCHD 1AJYA 1SS1A 1KQLA 3E1RA 1NJIQ 3GG2A 5KAFE 1VQMP 1LTJC 1SQPJ 3L70G 1URQC 1VF5B 2E76B 3PJSK 1GL2D 4OWFA 4PD4I 1H0TA 3MTUE 1KV4A 1JMBA 3L74E 1SQBD 1H89A 5GTHH 3T97B 2XZRA 4PD4D 3S4RA 5DJTB 1IFMA 2FYUJ 4BRYB 2FXMA 5KJ7C 3GHGB 2YO3A 2GM4A 2HG5D 4I6MC 4R4MA 3CMAP 2H8PD 1FZGA 1KB9I 5AW7B 1JEKA 3TGUJ 1KYOH 2ZT9D 4D6TG 1PIXA 1IO4A 3PRJA 1ZR2A 1ZMEC 1T8ZA 3C8VA 1SQXK 1GL2B 3R4YA 3CMEP 2JO1A 2QJKB 4EYYQ 3AE5C 4BRYA 2A06E 2FXPA 1EZVE 1Y8AA 2OYIB 2OYHB 1SVFA 3D6ZA 4UB6H 1SQQJ 1EDKA 1W5CE 3TGUG 1A02F 2N9BA 1HWTC 2IBZI 1OW6A 3W67A 1K04A 1RY3A 2WSCJ 1KYOI 2FYUG 2K3RA 5H2FE 3H1LG 3A0HH 2JR8A 3FXEA 1J1DC 1Y9BA 2G3AA 2KNCA 2YO2A 2KYVA 3BASA 1URQA 1M57D 3CL3D 3IN6A 4IL6H 1K9MQ 1NTKK 2K37A 1RF1C 1EDLA 1FC2C 1P84I 1SP4A 3M06A 1NTMG 2J58A 1FJKA 3TYYA 3UIAA 3VMXA 4KJMA 1FOSF 1FE6A 3TGUE 2WPVB 1OVUA 1VQ5P 4I2LC 1YQ3C 4GODA 2E74D 3BRVB 1L4AD 3H1HJ 4JBZA 1KB9D 4WBAA 1FZCC 1LT9C 2JDIH 2W8ZA 3A3YB 2HR3A 3RK2C 2PRRA 2OTKE 4N78E 2OTJP 2ITAA 2XKMA 2W27A 3LIEA 1L0NK 2VRSA 2XU6A 3A0HE 3CXHE 3RK3E 3U1AA 3CCQP 1BCCD 1HJ0A 5E79E 1GK4A 1KQSO 1J1EB 5CJ0A 5KLIB 2IZ0A 4UB8E 5KAIE 4U3FD 2HODA 5AVQB 1J1DB 3S1KA 1LTGC 3E1IA 1RF1A 2PAJA 1M1JB 1SFCB 2YIUC 2WSEH 3M91A 2QJYB 5CMZA 3CWBD 5CCGC 3U1CA 4YXWH 1KTMA 3WUTA 2XDJA 1GDTA 2K1AA 2QM8A 3HD7B 2AEJA 1N7SB 2WITA 2OYIC 3O6QB 3SFDC 2JKVA 3P32A 1G1IA 1KB9H 4N6JA 4BXLA 3NFQA 4ASWA 2NPSB 2P10A 1LTSC 5CCGD 1YJWP 1PPJG 1HVVA 2FKWB 2K9JA 3MUDA 1VQOP 3GW6A 3CC7P 3CLQA 1NGMB 1XTGB 4A7PA 2A45G 1UIXA 1LTJA 3B4SA 2ZT9C 3LW5J 3M9QA 1W2BO 1JNMA 4ZKUA 1M7LA 1E79H 2IX7C 1KZUB 2QIWA 3KXDA 2OGUA 3USSA 3O6QA 4DOJA 3TSIA 3Q2YA 4U3FJ 1NH4A 5GTIE 1UIIA 3JCUH 4ZMDA 1SQVE 1IZNB 3HTKA 2POHA 3IAOA 1KB9E 1WMKA 3II6A 2WT7B 1URQB 1Y47A
chains in the Genus database with same CATH topology
4PV1D 4U7JA 3AEAC 1U57A 2QSIA 2QJPC 4RKUJ 2YMKA 3AE6C 3D70A 2E75D 4H44D 3AECC 2E74C 1YQ4C 2FYNC 1HF9A 1S1CX 1OMIA 4TT3H 2K9YA 1VF5D 3AEBC 3GF7A 4Y28J 2NZ2A 2WQYC 1NYHA 1AJYA 2G8YA 1OW8A 1KILE 3AEDC 1VF5B 2E76B 1FDOA 4I7ZB 3ABVC 3T97B 2D2CC 3FGAD 4H13C 1DD3A 1KQFB 4R4MA 1TU3F 4PV1C 3AEFC 3AEGC 3Q5RA 1Q90D 4OGQC 2V7QJ 2ZT9D 1PIXA 1ZMEC 3C8VA 3R4YA 2JO1A 1ZOYC 2FBWC 3AE5C 3GLMA 2FXPA 4YTPC 2H88C 4H13D 3D6ZA 3AE7C 1OW6A 1JB0J 1K04A 2WSCJ 3D6YA 3GMAA 2WSFJ 2WSEJ 5KLIC 4Z1MH 1EXJA 1GMJA 2J5UA 2D2CB 2O01J 1KORA 4H0LD 4H44C 1KQGB 1Y9BA 2G3AA 3IN6A 1KMIZ 4IL6X 3Q3DA 3AE8C 3AE4C 4OGQB 1DD4A 2JP3A 2OQQA 3AE3C 2WPVB 1OW7A 2H89C 4R4LA 5KKZC 2E75C 1EXIA 1YQ3C 1MKMA 2E74D 4H0LC 1IK7A 3Q5PA 1K05A 3AE9C 3AE1C 4GDOA 4XFJA 2MKVA 3RK3E 2ZT9B 1HJ0A 4H13B 3H25A 3Q1MA 1FDIA 4YXDC 4H44B 2E74B 1RQUA 3AEEC 2YIUC 3EWKA 5L8RJ 1KTMA 1PL5A 3SFEC 1ZRTE 1PV3A 3GF3A 3B71A 1VL2A 2IDBA 2BEZF 3SFDC 2BEQD 2E76C 4H0LB 4KT0J 2D2CD 4I7ZC 2P10A 3S9OA 3D71A 3G9RA 2E76D 1NGMB 1R8EA 4OGQD 3Q5SA 1UIXA 3AE2C 4PV1B 5M1BA 2ZT9C 3LW5J 3RL0g 2QIWA 1RQVA 3O6QA 3Q2YA 1ZP0C 1DIPA 2QJKC 2QJYC 2E75B 3IAOA 1S5LX 1WMKA 1VF5C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZRT E;  4OGQ B;  5L8R J;  2WPV B;  2QSI A;  1Q90 D;  2QJP C;  4H0L B;  4KT0 J;  5KKZ C;  4RKU J;  3C8V A;  2FYN C;  4PV1 B;  3LW5 J;  2QIW A;  2K9Y A;  2ZT9 B;  4H13 B;  4Y28 J;  1JB0 J;  4H44 B;  2WSC J;  2E74 B;  2QJK C;  2WSE J;  2WSF J;  1VF5 B;  2E76 B;  2QJY C;  5KLI C;  2D2C B;  2O01 J;  2E75 B;  4I7Z B;  1S5L X;  2YIU C;  4IL6 X; 
#chains in the Genus database with same CATH topology
 3OAK A;  1JTH B;  4PV1 D;  5CHX A;  1CW5 A;  1SQP K;  1U57 A;  1LP1 B;  5APS A;  2A45 H;  2AEF A;  3CXH D;  3F5H A;  1YI2 P;  2RH0 A;  1HGZ A;  1NKN A;  3EQ2 A;  2FFD C;  4RKU J;  3VP8 A;  2JWD A;  2XND H;  2B88 A;  3CPW O;  3H1K G;  1R5S A;  3AE6 C;  1VPC A;  3CXH H;  3L75 J;  3M0A A;  1PPJ E;  2Q1K A;  4W7Y A;  2YNY A;  1HF9 A;  1BDD A;  1QEX A;  2WTY A;  2E43 A;  2H7H A;  3A2A A;  1JUN A;  2DW3 A;  3V4Q A;  1PZQ A;  5TIS H;  4HH2 A;  2L5G B;  4DZO A;  1VF5 D;  2Q6Q A;  1BDC A;  1N7S A;  1SQQ E;  2NZ2 A;  2LXB A;  2WQY C;  2ZYG A;  3RBX A;  1BGY G;  2B89 A;  1P84 D;  2G8Y A;  3WUV A;  5B66 H;  1ZLL A;  1ZXG A;  2Q3E A;  1FDO A;  3RL0 D;  1K8A Q;  3L73 J;  4ASV A;  1ZR4 A;  4AUW A;  1M1J A;  1QL1 A;  3FX0 A;  5APT A;  1KIL B;  3ABV C;  3L75 E;  1G1J A;  1Q2N A;  3P8C D;  3A0B H;  4H13 C;  5TJH A;  1H0T B;  4WY4 C;  4LLH A;  1KQF B;  1IFP A;  4JPZ B;  1Q90 D;  2KSE A;  1S5L E;  1NOH A;  2Z5I A;  2V7Q J;  2ZYA A;  1VQ6 P;  3H1L D;  4GOE A;  1DEE G;  4MN4 C;  1QX8 A;  5KLV K;  1JM0 A;  5KKZ B;  1FU1 A;  2IFN A;  5APV A;  1QVF O;  1SQP D;  5AW4 B;  1FDM A;  3H1H E;  3KQG A;  1ZOY C;  3KDP B;  2RN0 A;  3L74 J;  3GHG A;  1YHQ P;  3GLM A;  1SQB J;  1DH3 A;  1PGO A;  4HYT B;  1H88 A;  2H88 C;  1VQK P;  1P84 H;  1PGQ A;  1SQV K;  2KIK A;  4JQ0 D;  1NHL A;  3U59 A;  5GTI H;  5AW1 B;  2WSF J;  3L73 E;  3I56 P;  2AEM A;  3L73 D;  2OYH A;  1L4A B;  5APU A;  4IL6 X;  1DEB A;  4NPF X;  3L73 G;  5B66 E;  3H1J D;  2HPC A;  3AE4 C;  3HD7 D;  1QLE D;  1OX3 A;  1BGY J;  1PGP A;  3L72 J;  2R3S A;  1Q86 Q;  3AE3 C;  3LID A;  3V2N A;  1OW7 A;  3OW2 O;  2YXR B;  3ITK A;  2WPR A;  4Y99 B;  1KC8 Q;  2E75 C;  1JY2 P;  1LTA C;  2KB7 P;  2Y0E A;  1WRG A;  2JJL A;  1SQV D;  1EXI A;  4L76 A;  1IK7 A;  1HGV A;  3CWB J;  3H1I D;  3IR9 A;  1LTJ B;  3CXH I;  3L74 D;  1SQB E;  1JOC A;  2V7Q H;  4IFF A;  2MJZ A;  3B5N C;  4WVZ A;  3BCC G;  3H1K J;  4D6T E;  3CCE P;  2IYP A;  2K9J B;  1WT6 A;  2C0X A;  5KLV D;  2IBZ G;  1S2E A;  1BCC E;  2KXP B;  3H25 A;  1FDI A;  3MUD C;  2KK7 A;  3VMY A;  3Q1M A;  4H44 B;  1N86 A;  1LTB C;  2E74 B;  4JYB A;  1IFN A;  2KI7 B;  2YKQ A;  3L35 A;  4NPD A;  1X9V A;  3H1I G;  4IOI H;  2IZ1 A;  2KSJ A;  1KFN A;  2M3B A;  2WSF H;  3CWB E;  3HTK B;  2R44 A;  3L70 E;  3L71 G;  1ZRT D;  1BGY E;  3GF3 A;  1X8Y A;  3HE4 B;  1N7L A;  1EDI A;  4XA4 A;  4Y99 C;  5AVU B;  2BEZ F;  3G6E P;  2ZXX A;  2LXC B;  2JWA A;  2BEQ D;  1BCC J;  1LTT C;  2E76 C;  3L71 D;  4HJG H;  4WWI A;  3HE5 A;  3VYI A;  3H6P A;  1KIL D;  4JF7 A;  4N3Y B;  2QJP B;  5CCH A;  1OWA A;  1LP1 A;  3CX5 I;  1LWU C;  1RF0 C;  3HD7 A;  5AW3 B;  3G9R A;  1MZ9 A;  3RL0 B;  3CCV P;  1R8E A;  4OGQ D;  2Y9Z A;  3H1K E;  5AW0 B;  4D6T J;  5CBN A;  5M1B A;  1BSH A;  5AW5 B;  1CI6 B;  1FS0 E;  2FYN B;  5KJ7 D;  2KNC B;  1RQV A;  1OZH A;  2M8R A;  2P58 A;  3BRT B;  2OTL P;  1HBW A;  2LR2 A;  2PFX A;  3K5B A;  1DIP A;  2ZXE B;  3BCC D;  1GL2 C;  2QJK C;  3MIW A;  4RO0 A;  1EC5 A;  2Z5H A;  4EDF A;  3G4S P;  1SQP G;  1S5L X;  3V2P A;  1SQV G;  1KN7 A;  2CPS A;  2N1T D;  2W6A A;  4W80 A;  1S5L H;  3JCU E;  5APY A;  4UB8 H;  2ZFC A;  3VP9 A;  1N73 A;  2BAS A;  1EZV G;  3AEA C;  1U7M A;  3O8Z A;  5BVZ A;  3B5N B;  2QSI A;  3M9B A;  3GHG C;  2FXO A;  1OXZ A;  4M3L A;  5BU5 A;  1L2P A;  4U3F E;  2CK3 H;  1VQN P;  3VTP C;  1GD2 E;  4WY4 A;  4ZKP A;  2E74 C;  1YQ4 C;  1PPJ D;  3I55 P;  3C9I A;  2B87 A;  2UWJ E;  1D7M A;  1ZW0 A;  2K9Y A;  2M5A B;  5AVW B;  1T6A A;  2N1T C;  1NTZ G;  3AEB C;  3G3Z A;  3GF7 A;  3BCC J;  3H1L J;  2Y9Y A;  4IL6 E;  2BCC E;  1IFD A;  1PP9 G;  1ZV8 A;  5AVV B;  2SPZ A;  1P84 E;  3VMA A;  2P67 A;  1KIL E;  3AED C;  1JMM A;  3CWB G;  3FXD A;  1JY2 O;  3L71 E;  2XV5 A;  3H1I E;  3MP7 B;  3WU2 E;  2Q9I A;  4C46 A;  1NTZ E;  4RES B;  1L4A A;  3M0D C;  2NPS D;  1KIL A;  4N78 D;  3P8C E;  2WZ7 A;  4LGD E;  3L75 D;  3N4X A;  2N9Y B;  4OVN F;  4BWN A;  2KS1 B;  1KYO D;  1DD3 A;  1LNQ A;  2RKL A;  3PHL A;  3PTZ A;  3SWY A;  1VQ7 P;  1N7S D;  2IBZ D;  3QWO C;  4PJ0 E;  2IBZ E;  5KLV G;  3A5T A;  1QGK B;  1L0L K;  4OGQ C;  4C7N A;  3VOP A;  3Q5R A;  2C9L Y;  3A0B E;  3EFF K;  5KTB A;  2R5D A;  2ZYD A;  1SFC C;  2BCC J;  1M1K Q;  1L0N D;  3CCU P;  3H1H D;  2W90 A;  3H1J J;  1M90 Q;  1JY2 N;  2FBW C;  2A06 D;  1BGY D;  1T2K D;  1N73 C;  1N73 B;  5AW9 B;  1GTW A;  2O1J A;  1MFZ A;  3AE7 C;  3M0D A;  2Z4E A;  2NPS C;  1T3U A;  5GTH E;  1IJD B;  1JB0 J;  1NTM E;  5C39 A;  2WWW A;  2R3C A;  3MZW B;  1LT9 A;  5AVT B;  1YJ9 P;  1S72 P;  2WSE J;  3H1I J;  1R5L A;  1KIL C;  4CPG A;  2FFD B;  1GMJ A;  2J5U A;  2HLO A;  2O01 J;  1KOR A;  4H44 C;  1NTK D;  1KQG B;  3N7N A;  3NTN A;  3H1K D;  4PV1 C;  2O01 H;  2E5T A;  3L70 J;  3RBZ A;  1M1J C;  2YIU B;  4WY4 D;  3RK3 C;  1USD A;  1Q81 Q;  2JP3 A;  2OQQ A;  1BE3 G;  3B5N D;  3FWL A;  4B86 A;  2I1K A;  3TGU D;  3JC2 2;  2H89 C;  3SWF A;  1Z56 A;  1NTM J;  3V2Q A;  3V6I A;  2N1T B;  1YYC A;  2B9B A;  3W68 A;  5APX A;  3Q5P A;  4XE5 B;  2QE7 H;  4C7R A;  1LWU B;  4HKZ H;  1AQ5 A;  1SQX D;  2AXC A;  4GDO A;  1X79 B;  2QG4 A;  2ZT9 B;  4I1L A;  1FAV A;  1OVV A;  2WMM A;  3L72 E;  1IFJ A;  3CCL P;  2R5B A;  1M56 D;  2WSS H;  2KS1 A;  2O3J A;  4WB4 A;  3VMZ A;  1RQU A;  1NKZ B;  1YIJ P;  1HJB A;  1L0N E;  1NTK J;  1AV1 A;  1RHZ B;  1YBK A;  2WSC H;  3AEE C;  3L72 G;  2RMZ A;  4DJG A;  5B5E E;  2PP6 A;  2Y0C A;  1Q7Y Q;  1PL5 A;  1SQB K;  3MHV A;  2WVR A;  3TNU A;  3V4W A;  1NTZ K;  2ZVO B;  3QH9 A;  1AVO A;  1FZC A;  2IDB A;  4O9B A;  1VQP P;  2OYH C;  4H0L B;  1S3J A;  1SQQ K;  1EQ7 A;  2IYO A;  4KT0 J;  3HE5 B;  2QA4 P;  1KFM A;  4NPE A;  3CCR P;  2L91 A;  3S9O A;  3D71 A;  2E76 D;  2NRG A;  4PJ0 H;  4WY4 B;  4DT0 A;  1BE3 E;  3TNU B;  3Q5S A;  1LT1 A;  4PV1 B;  1AQT A;  4U3F G;  1L0L G;  4IFM A;  2ZVN B;  2P7J A;  1J1E C;  3WU2 H;  2P1J A;  1OFC X;  1ZP0 C;  2GA1 A;  5DJU B;  3P7K A;  3H1L E;  2V4H A;  4L75 A;  3G71 P;  2FY8 A;  3HUS B;  1MFT A;  1CSB A;  1USE A;  3R2P A;  2QJY C;  1JY3 N;  1CI6 A;  1NU1 E;  3L36 A;  2JEE A;  5CJ4 A;  1OIP A;  2H43 A;  2AXT E;  3CCM P;  4U7J A;  1BE3 J;  2OYI A;  1LWU A;  1NU1 K;  2A06 G;  1J2J B;  3V5B A;  1S9K D;  2O1K A;  2QJP C;  3CX5 D;  1RH5 B;  3A7O A;  4GOF A;  3IF4 A;  2KZJ A;  1AA0 A;  2KLV A;  3H32 B;  4W7Z A;  3RL0 C;  3IFM A;  3WUU A;  4EI2 A;  2E75 D;  4H44 D;  2CPB A;  3AEC C;  5AVX B;  3TDK A;  2FYU D;  1GW3 A;  1HTL C;  1JY3 O;  1NU1 J;  1S1C X;  1OMI A;  2IPP A;  2NPS A;  2YKP A;  2I1J A;  3L75 G;  1LJ2 A;  2C0W A;  4OH8 B;  2KP8 A;  1RF0 A;  3HD7 C;  2BCC D;  1NYH A;  1FBM A;  3I5C A;  1HUC A;  2LKM A;  3HE4 A;  1OW8 A;  4GIF A;  4GT1 A;  5AW8 B;  1LT9 B;  1VF5 C;  1X0T A;  5AVR B;  3RK2 B;  1PP9 E;  2HPC B;  2BCC G;  1MV8 A;  4I7Z B;  3MD0 A;  5AVY B;  1EDJ A;  2M5A A;  3JSV C;  1SFC D;  3T97 A;  2OYO A;  1BE3 D;  2D2C C;  4PD4 E;  2GUS A;  3CX5 H;  1KYO E;  3FGA D;  1GU5 A;  1VQ9 P;  3CC2 P;  2KLU A;  2FFD A;  1TU3 F;  2P2U A;  1BCC G;  2ZJS E;  3AEF C;  3B8E B;  3AEG C;  1RE3 C;  3BAT A;  3FWN A;  1IFI A;  3L72 D;  3M9H A;  3PH0 A;  5CBO A;  5AW2 B;  5B5E H;  1JCC A;  3BCC E;  1FZE A;  3HRN A;  3CCS P;  2KZI A;  1SQB G;  5AVS B;  3HUS C;  3L71 J;  1PP9 J;  1NU1 D;  1W2E A;  3L70 D;  1NTZ J;  2HFE D;  5APW A;  1N2D C;  2N1T A;  4YTP C;  1EZV D;  2IFM A;  2KUB A;  2QEX P;  5KAF H;  3PP5 A;  4H13 D;  2O01 N;  1T3J A;  5APQ A;  4C7N B;  1NTM D;  1MUU A;  3CX5 E;  4AYC A;  3D6Y A;  3GMA A;  3B5N A;  5KLI C;  4Z1M H;  1EXJ A;  1LGH B;  2D2C B;  4TLF A;  1X22 A;  1E5W A;  4H0L D;  5EFW B;  5KJ7 A;  1L0N J;  1NTK E;  2FYZ A;  1KMI Z;  2FYU E;  1GZL A;  1VDF A;  3H1J E;  2C9N Y;  3Q3D A;  3AE8 C;  4L74 A;  1H8A A;  4ZNC A;  4OGQ B;  3OJA B;  1K73 Q;  1PFI A;  1DD4 A;  1AFO A;  3VN0 A;  1IK9 A;  5KAI H;  4LC1 A;  3TF5 A;  1RE4 A;  1JO5 A;  4R4L A;  1SQQ D;  1NTM K;  5AW6 B;  3MGN A;  5KKZ C;  1LTI C;  3F89 A;  1G2C B;  1NVO A;  1URQ D;  1FZC B;  1MKM A;  1BSN A;  2B87 B;  2Q3I A;  1FJP A;  4H0L C;  1PP9 D;  1YJN P;  1K05 A;  1XTC C;  1GL2 A;  1NTZ D;  4EIJ A;  2E42 A;  4D6T D;  3AE9 C;  3AE1 C;  3L37 A;  4K3A A;  2W6B A;  2Q7C A;  1SQX E;  1VQ4 P;  3RK3 D;  2GUV A;  4XFJ A;  2MKV A;  1SFC A;  2W83 C;  1N8R Q;  5KLV E;  2Q5U A;  4H13 B;  1SLQ A;  1AVY A;  1JCD A;  4YXD C;  1IC2 A;  1L0N G;  1VQ8 P;  2AXT H;  3KZI H;  4PD4 H;  3E7K A;  4K35 A;  3WMM 0;  1QL2 A;  1U7J A;  3NXS A;  3CC4 P;  3EWK A;  3OA7 A;  5L8R J;  1A02 J;  2HYN A;  1HH0 A;  1S4X A;  3SFE C;  1SQX G;  1YTZ T;  1GU4 A;  1ZRT E;  1PV3 A;  2WPQ A;  1SQQ G;  3B71 A;  3EFG A;  1VL2 A;  1FOS E;  1SQX J;  2I8D A;  3TK1 A;  2PGD A;  1NAY A;  2D2C D;  4I7Z C;  5K5G B;  1SQV J;  1RE4 C;  2YMY A;  4UB6 E;  1L0L J;  3KHU A;  5E79 H;  3RGU A;  5AVZ B;  3BVH A;  4KHX A;  4HB1 A;  1YIT P;  1NAF A;  2QRX A;  2KOG A;  1M8O B;  2FYU K;  3AE2 C;  3KZI E;  3RL0 g;  2WT7 A;  4QMA A;  1QVG O;  3H32 A;  1FZF A;  3KPE A;  5KLV J;  4JYC A;  3H1J G;  1T2K C;  5CCG A;  3CD6 P;  1RF1 B;  3RK3 B;  1NTK G;  2HOD B;  1YTZ I;  1NO4 A;  1NWQ A;  1KD1 Q;  1JTH A;  1FZB A;  2ZAE B;  1ZN5 A;  2K88 A;  1JY3 P;  1SQP E;  2E75 B;  1NU1 G;  1GK6 A;  3CCJ P;  5TIS E;  3KYQ A;  3PLN A;  4EOT A;  2A45 I;  1Q82 Q;  1FZA A;  2QM7 A;  2Y0D A;  1N7S C;  4DCK A;  2M3E A;  2J59 M;  2WPS A;  2YXQ B;  2E5Y A;  3HUS A;  2R32 A;  4AQR D;  1OVR A;  2QVA A;  4L73 A;  5H2F H;  1S9K E;  3H1H G;  3P8M C;  1VQL P;  1CZQ A;  3V2R A;  2W6J H;  1EZV I;  1G2C A;  1L0L E;  1L0L D;  1L4A C;  1PGJ A;  1RE3 A;  2M0B A;  1GW4 A;  2YMK A;  4GKG A;  4YPC A;  3RK2 D;  3D70 A;  3LW5 H;  3NMD A;  3L4F A;  5CCH C;  3C1L A;  3ZDM A;  2FYN C;  4IFD K;  1DX7 A;  4TT3 H;  3CI9 A;  3SSU A;  4RJT A;  2YKO A;  3SWK A;  2OAR A;  2XNX A;  3L74 G;  4Y28 J;  5BU8 B;  5CCH D;  1AJY A;  1SS1 A;  1KQL A;  3E1R A;  1NJI Q;  3GG2 A;  5KAF E;  1VQM P;  1LTJ C;  1SQP J;  3L70 G;  1URQ C;  1VF5 B;  2E76 B;  3PJS K;  1GL2 D;  4OWF A;  4PD4 I;  1H0T A;  3MTU E;  1KV4 A;  1JMB A;  3L74 E;  1SQB D;  1H89 A;  5GTH H;  3T97 B;  2XZR A;  4PD4 D;  3S4R A;  5DJT B;  1IFM A;  2FYU J;  4BRY B;  2FXM A;  5KJ7 C;  3GHG B;  2YO3 A;  2GM4 A;  2HG5 D;  4I6M C;  4R4M A;  3CMA P;  2H8P D;  1FZG A;  1KB9 I;  5AW7 B;  1JEK A;  3TGU J;  1KYO H;  2ZT9 D;  4D6T G;  1PIX A;  1IO4 A;  3PRJ A;  1ZR2 A;  1ZME C;  1T8Z A;  3C8V A;  1SQX K;  1GL2 B;  3R4Y A;  3CME P;  2JO1 A;  2QJK B;  4EYY Q;  3AE5 C;  4BRY A;  2A06 E;  2FXP A;  1EZV E;  1Y8A A;  2OYI B;  2OYH B;  1SVF A;  3D6Z A;  4UB6 H;  1SQQ J;  1EDK A;  1W5C E;  3TGU G;  1A02 F;  2N9B A;  1HWT C;  2IBZ I;  1OW6 A;  3W67 A;  1K04 A;  1RY3 A;  2WSC J;  1KYO I;  2FYU G;  2K3R A;  5H2F E;  3H1L G;  3A0H H;  2JR8 A;  3FXE A;  1J1D C;  1Y9B A;  2G3A A;  2KNC A;  2YO2 A;  2KYV A;  3BAS A;  1URQ A;  1M57 D;  3CL3 D;  3IN6 A;  4IL6 H;  1K9M Q;  1NTK K;  2K37 A;  1RF1 C;  1EDL A;  1FC2 C;  1P84 I;  1SP4 A;  3M06 A;  1NTM G;  2J58 A;  1FJK A;  3TYY A;  3UIA A;  3VMX A;  4KJM A;  1FOS F;  1FE6 A;  3TGU E;  2WPV B;  1OVU A;  1VQ5 P;  4I2L C;  1YQ3 C;  4GOD A;  2E74 D;  3BRV B;  1L4A D;  3H1H J;  4JBZ A;  1KB9 D;  4WBA A;  1FZC C;  1LT9 C;  2JDI H;  2W8Z A;  3A3Y B;  2HR3 A;  3RK2 C;  2PRR A;  2OTK E;  4N78 E;  2OTJ P;  2ITA A;  2XKM A;  2W27 A;  3LIE A;  1L0N K;  2VRS A;  2XU6 A;  3A0H E;  3CXH E;  3RK3 E;  3U1A A;  3CCQ P;  1BCC D;  1HJ0 A;  5E79 E;  1GK4 A;  1KQS O;  1J1E B;  5CJ0 A;  5KLI B;  2IZ0 A;  4UB8 E;  5KAI E;  4U3F D;  2HOD A;  5AVQ B;  1J1D B;  3S1K A;  1LTG C;  3E1I A;  1RF1 A;  2PAJ A;  1M1J B;  1SFC B;  2YIU C;  2WSE H;  3M91 A;  2QJY B;  5CMZ A;  3CWB D;  5CCG C;  3U1C A;  4YXW H;  1KTM A;  3WUT A;  2XDJ A;  1GDT A;  2K1A A;  2QM8 A;  3HD7 B;  2AEJ A;  1N7S B;  2WIT A;  2OYI C;  3O6Q B;  3SFD C;  2JKV A;  3P32 A;  1G1I A;  1KB9 H;  4N6J A;  4BXL A;  3NFQ A;  4ASW A;  2NPS B;  2P10 A;  1LTS C;  5CCG D;  1YJW P;  1PPJ G;  1HVV A;  2FKW B;  2K9J A;  3MUD A;  1VQO P;  3GW6 A;  3CC7 P;  3CLQ A;  1NGM B;  1XTG B;  4A7P A;  2A45 G;  1UIX A;  1LTJ A;  3B4S A;  2ZT9 C;  3LW5 J;  3M9Q A;  1W2B O;  1JNM A;  4ZKU A;  1M7L A;  1E79 H;  2IX7 C;  1KZU B;  2QIW A;  3KXD A;  2OGU A;  3USS A;  3O6Q A;  4DOJ A;  3TSI A;  3Q2Y A;  4U3F J;  1NH4 A;  5GTI E;  1UII A;  3JCU H;  4ZMD A;  1SQV E;  1IZN B;  3HTK A;  2POH A;  3IAO A;  1KB9 E;  1WMK A;  3II6 A;  2WT7 B;  1URQ B;  1Y47 A; 
#chains in the Genus database with same CATH homology
 4PV1 D;  4U7J A;  3AEA C;  1U57 A;  2QSI A;  2QJP C;  4RKU J;  2YMK A;  3AE6 C;  3D70 A;  2E75 D;  4H44 D;  3AEC C;  2E74 C;  1YQ4 C;  2FYN C;  1HF9 A;  1S1C X;  1OMI A;  4TT3 H;  2K9Y A;  1VF5 D;  3AEB C;  3GF7 A;  4Y28 J;  2NZ2 A;  2WQY C;  1NYH A;  1AJY A;  2G8Y A;  1OW8 A;  1KIL E;  3AED C;  1VF5 B;  2E76 B;  1FDO A;  4I7Z B;  3ABV C;  3T97 B;  2D2C C;  3FGA D;  4H13 C;  1DD3 A;  1KQF B;  4R4M A;  1TU3 F;  4PV1 C;  3AEF C;  3AEG C;  3Q5R A;  1Q90 D;  4OGQ C;  2V7Q J;  2ZT9 D;  1PIX A;  1ZME C;  3C8V A;  3R4Y A;  2JO1 A;  1ZOY C;  2FBW C;  3AE5 C;  3GLM A;  2FXP A;  4YTP C;  2H88 C;  4H13 D;  3D6Z A;  3AE7 C;  1OW6 A;  1JB0 J;  1K04 A;  2WSC J;  3D6Y A;  3GMA A;  2WSF J;  2WSE J;  5KLI C;  4Z1M H;  1EXJ A;  1GMJ A;  2J5U A;  2D2C B;  2O01 J;  1KOR A;  4H0L D;  4H44 C;  1KQG B;  1Y9B A;  2G3A A;  3IN6 A;  1KMI Z;  4IL6 X;  3Q3D A;  3AE8 C;  3AE4 C;  4OGQ B;  1DD4 A;  2JP3 A;  2OQQ A;  3AE3 C;  2WPV B;  1OW7 A;  2H89 C;  4R4L A;  5KKZ C;  2E75 C;  1EXI A;  1YQ3 C;  1MKM A;  2E74 D;  4H0L C;  1IK7 A;  3Q5P A;  1K05 A;  3AE9 C;  3AE1 C;  4GDO A;  4XFJ A;  2MKV A;  3RK3 E;  2ZT9 B;  1HJ0 A;  4H13 B;  3H25 A;  3Q1M A;  1FDI A;  4YXD C;  4H44 B;  2E74 B;  1RQU A;  3AEE C;  2YIU C;  3EWK A;  5L8R J;  1KTM A;  1PL5 A;  3SFE C;  1ZRT E;  1PV3 A;  3GF3 A;  3B71 A;  1VL2 A;  2IDB A;  2BEZ F;  3SFD C;  2BEQ D;  2E76 C;  4H0L B;  4KT0 J;  2D2C D;  4I7Z C;  2P10 A;  3S9O A;  3D71 A;  3G9R A;  2E76 D;  1NGM B;  1R8E A;  4OGQ D;  3Q5S A;  1UIX A;  3AE2 C;  4PV1 B;  5M1B A;  2ZT9 C;  3LW5 J;  3RL0 g;  2QIW A;  1RQV A;  3O6Q A;  3Q2Y A;  1ZP0 C;  1DIP A;  2QJK C;  2QJY C;  2E75 B;  3IAO A;  1S5L X;  1WMK A;  1VF5 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...