1S5LX

Architecture of the photosynthetic oxygen evolving center
Total Genus 13
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
13
sequence length
40
structure length
40
Chain Sequence
b'TITPSLKGFFIGLLSGAVVLGLTFAVLIAISQIDKVQRSL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem Q(B) protein
publication title Architecture of the Photosynthetic Oxygen-Evolving Center
pubmed doi rcsb
molecule tags Photosynthesis
total genus 13
structure length 40
sequence length 40
chains with identical sequence x
ec nomenclature
pdb deposition date 2004-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
X PF06596 PsbX Photosystem II reaction centre X protein (PsbX)
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 1s5lX00
2O01J 2WSEJ 4PV1B 3LW5J 4I7ZB 4H44B 2D2CB 1VF5B 4KT0J 2ZT9B 2E74B 2K9YA 2QIWA 3C8VA 2WSCJ 4RKUJ 1ZRTE 2E76B 2WSFJ 2FYNC 1Q90D 5L8RJ 4H0LB 2QSIA 2QJYC 2WPVB 1JB0J 2E75B 1S5LX 5KKZC 2QJKC 4IL6X 4H13B 2QJPC 4Y28J 2YIUC 5KLIC 4OGQB
chains in the Genus database with same CATH superfamily
3E1RA 3JCUH 3CX5D 3A5TA 3I56P 1SQPG 1BE3J 3HUSB 3SFEC 3E7KA 4RO0A 3H1JD 1M57D 2O3JA 3L74J 2XV5A 4XFJA 2JO1A 3L73E 1OW7A 4YTPC 5AW6B 2Q3EA 5AVYB 3HUSA 3B8EB 1UIIA 4U7JA 2YKPA 3G9RA 3USSA 1LTAC 3KZIH 1W2EA 1SQVJ 2YIUC 2MJZA 3CPWO 2W6JH 3HD7B 1IFNA 1KTMA 4ZNCA 1SQXG 4DT0A 1X0TA 4XE5B 1NU1D 1G1IA 3B4SA 1LT9B 1FJPA 3EWKA 3HD7A 2D2CB 4WB4A 3SWFA 3FWLA 3AEAC 3WUTA 3FX0A 1IK9A 3FWNA 1SQPD 1M1JB 2NRGA 1HBWA 1LT9A 1RE3A 3M0DC 5KKZC 4IFDK 3SFDC 4EOTA 2HODB 5GTIH 2A06E 1BDCA 2V7QJ 4YXDC 4H44B 2WTYA 2QM8A 3TDKA 3QH9A 2XU6A 1S2EA 2E76B 1SQBG 2V4HA 1NTME 5CJ0A 1M1JA 3GHGC 1RF1B 4PD4H 2UWJE 1D7MA 2HODA 2WSCH 2KLUA 1FZGA 2WITA 3VYIA 2KZIA 1OVRA 2JWDA 3CWBJ 1QVGO 2ZYAA 1DEBA 2N1TB 1ZMEC 1H88A 1L0NE 1KILC 5AVXB 2WMMA 2QJKC 1RF1A 3W68A 4OH8B 5B5EH 2WPSA 4K35A 4JBZA 1L4AC 1NTKG 3H1IE 3TNUB 1KB9I 3Q1MA 4PV1C 2POHA 2QRXA 2GUVA 1N8RQ 2JP3A 4OGQB 1SQPK 2KNCB 5APYA 4WY4B 1PL5A 1GL2B 3B5NB 2KLVA 4NPFX 3TYYA 1S1CX 1KYOI 2Q9IA 3TNUA 4OVNF 1SQQE 1FZCB 2A45I 1AVYA 2C9NY 3SWKA 2FXPA 1YQ3C 2KNCA 2O01J 2ZVOB 3CCJP 3LW5J 3MP7B 3HD7D 2Y9ZA 4WY4A 1GL2A 5K5GB 3CCRP 2FKWB 1BCCD 1FZCA 2IYPA 2LXBA 3M9HA 2OQQA 2PAJA 5KJ7C 3KZIE 3L73G 1HGZA 2IBZE 1KZUB 1RF0C 3V4QA 1R8EA 3IF4A 1J1DB 4U3FE 2NPSC 1FDMA 3M91A 5CHXA 3RL0D 2FFDC 1NTKD 3H1HJ 2YMYA 4HYTB 1EDIA 1SP4A 4GOEA 1A02J 4H44D 1YHQP 3ZDMA 3HTKB 2W83C 3PRJA 1LTBC 4DCKA 2ZJSE 1PP9D 1RQVA 5AW1B 1SQBK 5H2FH 1T6AA 3L75E 2M0BA 1CZQA 3H1KJ 1VQKP 1LTTC 1YJWP 3HTKA 2RN0A 1KB9H 1DD4A 1JB0J 1CW5A 2G3AA 1IFDA 3TGUE 2WSFH 5M1BA 1K05A 1LTJC 2B88A 3AEBC 1LGHB 1VF5B 2A06G 1NU1E 3HRNA 3L70E 2E74B 2FXMA 1KYOH 1OIPA 3L73D 2ZXEB 2BCCE 3U59A 2A45H 1NTMG 3L72J 4AUWA 2IPPA 4EIJA 4I1LA 5BU5A 4JYCA 1P84I 4N6JA 2DW3A 4IFFA 1NTKK 4OGQD 1YITP 3P8MC 4WY4D 1GL2D 1M1KQ 1KV4A 1BE3E 3PHLA 1KQFB 1S5LE 1GTWA 2KP8A 4B86A 3K5BA 3KPEA 1L0NG 1X79B 3L74E 4UB6E 3CXHI 1DX7A 2ZFCA 1IC2A 4I6MC 3H1LG 1WMKA 3H32B 3U1AA 3P8CE 4O9BA 3BCCG 3H1IG 4JF7A 4IL6X 1SQVE 1Y8AA 1URQB 3H32A 1NTZJ 3M9QA 1G2CB 1NKNA 1OX3A 4JPZB 1Z56A 1JMBA 1DD3A 2OTKE 1N73B 3D71A 1SQQG 4I2LC 1NTMD 5KLVD 4R4LA 1URQA 1H0TA 4KT0J 1S4XA 1GMJA 3II6A 2YKOA 3M0AA 1OVVA 1PZQA 5AW8B 3D6ZA 1HH0A 2PRRA 3RL0C 2HPCB 1IO4A 1FU1A 1JY2O 4L74A 3CCMP 1NAFA 4D6TJ 4CPGA 2IBZG 4H44C 5APWA 1P84H 4DZOA 1VQ5P 3H1ID 1FS0E 3GF7A 2HPCA 1BCCE 2SPZA 3CWBE 2FYUJ 3H1JG 4HJGH 1NTZD 2KYVA 3OW2O 2QJYC 2NZ2A 2E5TA 3W67A 2YNYA 3CXHH 5TISE 3IN6A 2AXTE 2FXOA 3VOPA 4H13D 3G4SP 1JY3O 1QVFO 1NTMK 3WU2H 3CX5I 5BU8B 1EQ7A 1OW8A 2ZYGA 2WVRA 3RK3B 3I5CA 1ZOYC 3GW6A 5GTHE 3TGUG 3WUVA 4MN4C 3Q5RA 5AW0B 1OXZA 1EC5A 1MZ9A 3MGNA 2WSCJ 1L0NK 5E79E 1NU1G 3AE3C 3L70G 4K3AA 2BEZF 2WQYC 2IBZD 1NOHA 1EXIA 2BCCG 4U3FD 2K3RA 2YMKA 3FGAD 1IZNB 1URQD 2JWAA 2YO3A 1NVOA 1YTZT 1YJNP 1RE4A 2W6BA 3OJAB 2WPVB 5B66E 3KQGA 4KJMA 1W2BO 1RQUA 1L2PA 2B9BA 2JR8A 2M3EA 2PGDA 3A0BE 3L74G 1L0LJ 4IL6H 3AEGC 3IAOA 2E75C 1SQQK 1YI2P 3RK2C 3L75D 3H1HE 2P7JA 1GU4A 4Y99C 1SFCB 4EI2A 3MIWA 1SQVG 3VMAA 1J1EB 2K1AA 3TGUD 5CBOA 1JCDA 4TLFA 5AVQB 2OGUA 1GW4A 2IZ0A 3L70D 1JO5A 3KXDA 1KQGB 1X9VA 2BCCD 2O1JA 1SQXJ 4GDOA 3CX5H 4KHXA 5CJ4A 3H1KE 2E5YA 2Y9YA 4RJTA 1ZV8A 4H0LB 1EDLA 3MZWB 1YIJP 2HR3A 3AECC 4A7PA 1BE3D 3VMYA 2ZAEB 3Q3DA 2PP6A 2O1KA 1IFMA 3L74D 3L37A 3CI9A 1FZEA 2Q1KA 5AVZB 1AJYA 1GU5A 5KLVE 1QGKB 3P8CD 3L72E 5KAFH 3MD0A 2ZT9C 1JUNA 2HFED 3RL0g 1LWUB 1E5WA 1GK4A 3O6QB 1T2KD 4Z1MH 1ZR4A 2KOGA 2K37A 3PP5A 1FOSF 1SQVD 1BCCG 2GA1A 4LC1A 4H13C 1N7SC 1NHLA 3V6IA 3H6PA 2W8ZA 1YBKA 2LXCB 1LNQA 3Q2YA 1GW3A 1NU1K 3AE9C 1Q81Q 1HUCA 1HF9A 1SLQA 3V4WA 2J58A 1MFTA 2WSFJ 2OYIC 2I1KA 2N1TA 1NJIQ 3RBZA 2XNDH 2Z4EA 1AFOA 5AW4B 5KTBA 1JY2P 2WPRA 2LR2A 2QEXP 1MFZA 2R44A 3BVHA 1X22A 2B89A 1RH5B 1NTZE 2OTLP 3JCUE 1GK6A 1IJDB 2N9BA 3OAKA 1A02F 3LIDA 3VP9A 1PP9G 3F89A 3CD6P 4UB8H 5CMZA 2QA4P 2OARA 5KLIC 2E43A 4IOIH 2QIWA 3B5NA 4WWIA 2R32A 1KC8Q 4ZKUA 2FYZA 1YTZI 1Q2NA 2KK7A 1JY3P 2ZXXA 1SQVK 1JMMA 3CWBD 1M7LA 5CCHA 2QE7H 2KUBA 3EFFK 3D70A 1TU3F 3QWOC 1M90Q 3V5BA 1NWQA 5APSA 2G8YA 2D2CD 4D6TE 3M06A 4H0LD 1YYCA 2M8RA 3A0HH 1HGVA 3H1HG 4JQ0D 2YKQA 1KORA 1SVFA 3KHUA 2YIUB 2FYUE 4ASWA 3AE5C 2E76D 3ITKA 4N78E 2WWWA 2GUSA 3NXSA 2OTJP 5AW9B 2WT7B 5GTIE 4RKUJ 4YPCA 2OYHC 5L8RJ 3H1KG 2N1TD 1JY2N 4I7ZC 3BRVB 3CLQA 3R4YA 1OFCX 2WT7A 1EZVE 5KKZB 1MKMA 1T3UA 4PD4E 4W7YA 3KDPB 2K9JB 3L35A 1S9KE 2IFMA 2FYNC 1ZP0C 2AEMA 3G3ZA 3CMEP 1JM0A 5KLVG 2W90A 2QJPC 3L72G 1FAVA 1FE6A 1ZW0A 2HLOA 3S1KA 3H1HD 2OYOA 3M0DA 3GHGB 5AVVB 2L5GB 5B5EE 2K9JA 2HG5D 3HE5B 3B5ND 3RBXA 2O01N 1JY3N 2K88A 1EDJA 4C46A 1ZN5A 3MUDA 5CCHD 2MKVA 1ZR2A 2HYNA 1KILB 3HUSC 3BATA 3VMZA 2GM4A 1L0LE 2QJKB 3AE2C 2QM7A 3GHGA 3RK3E 1EDKA 3HE5A 5KAIH 1LT1A 3IR9A 1L0NJ 4GT1A 1PGOA 1QL2A 1L4AB 3H1LJ 3H1KD 2RMZA 2KS1B 1WRGA 1FC2C 3CCEP 3VP8A 1KILA 4ZMDA 4PV1B 1VQMP 4QMAA 2RKLA 3BCCJ 5AVUB 1NTZG 1LTIC 3NFQA 1Y47A 3HD7C 2KS1A 2P58A 2YO2A 5APXA 1N7LA 1HJ0A 1BGYJ 3L72D 1IFJA 1SQXE 1OZHA 1LT9C 1RE3C 3V2PA 2XDJA 4GOFA 3G71P 1FZBA 3AEFC 1G2CA 3FXDA 2P2UA 3MHVA 3GG2A 4DOJA 3AE1C 4NPEA 2D2CC 1N73A 3CC4P 4H0LC 4M3LA 1KQSO 2VRSA 1FDIA 1M1JC 1KFMA 1USDA 3C8VA 3L71J 3AEDC 1VQOP 4D6TG 4U3FG 1Y9BA 3N7NA 1CSBA 1YQ4C 2NPSB 2E76C 2FFDB 4NPDA 3RGUA 2LKMA 2BEQD 1RHZB 2PFXA 3IFMA 3P7KA 1T3JA 1VF5D 5H2FE 1ZLLA 2E74D 3H25A 1RF1C 1QL1A 1LTSC 5KJ7A 2FYUG 1PGPA 2M5AB 1NYHA 1RF0A 3E1IA 2NPSA 1KB9E 2IBZI 4Y28J 3CL3D 2N1TC 2FFDA 3H1JJ 1NAYA 5AW5B 5KLVK 3L75G 1K8AQ 2IZ1A 1BGYD 4R4MA 2M5AA 1KYOE 2J5UA 2WSSH 1VQ4P 5AVRB 1FDOA 3WUUA 1LTJB 4OGQC 1W5CE 4L73A 3L36A 4WY4C 1GL2C 2Y0DA 3B5NC 1JCCA 4D6TD 1IFPA 1FOSE 4RESB 1NU1J 1FZCC 5CCHC 1M56D 2JJLA 1LTJA 3NTNA 1U57A 5AVSB 1BE3G 5KAIE 2FYUD 5CCGA 1NTZK 4N78D 2Q6QA 1SQPJ 3R2PA 1L0LG 3TF5A 1Q90D 3I55P 2AEFA 1ZRTD 1J1DC 1AQ5A 1AQTA 1LP1B 2RH0A 2Q3IA 2R5BA 1NH4A 5KJ7D 1EZVD 2YXRB 1PGJA 4PD4D 3V2QA 1S9KD 1BSHA 2N9YB 2BASA 2R5DA 2NPSD 2I1JA 1SFCA 3LIEA 1K73Q 2Z5HA 3GLMA 1BSNA 1LP1A 4LGDE 1JEKA 2WSEH 1R5LA 1HWTC 3P32A 4HB1A 4C7NB 2FYUK 1M8OB 1P84E 1K9MQ 2C9LY 2E42A 3M9BA 1FZAA 3S4RA 1VQ7P 3RL0B 2W27A 4WVZA 3CC7P 1AVOA 4C7RA 1L0LD 1VF5C 3RK3D 2E74C 1J2JB 4PJ0H 1FJKA 4EDFA 1UIXA 1JTHB 3WMM0 4N3YB 3CXHE 4C7NA 1SQBJ 2B87B 2R3SA 3MUDC 4L75A 4GKGA 3VTPC 2ITAA 3L4FA 1HTLC 2IDBA 3CWBG 3WU2E 4EYYQ 3S9OA 4JYBA 4L76A 1PPJE 4TT3H 2AEJA 2FBWC 5CCGD 1LWUA 1QX8A 2QJYB 1BCCJ 1JTHA 3O6QA 2Y0CA 1VQNP 2B87A 3CCUP 3CCSP 3BASA 1YJ9P 4AYCA 2M3BA 1PGQA 3PLNA 4W7ZA 1SQXD 1DIPA 3H1LE 1S3JA 3JC22 3Q5PA 1S5LH 3SSUA 2A45G 1NTKJ 4WBAA 2FY8A 3BCCE 4UB6H 2H8PD 1URQC 2QG4A 1VQ9P 2R3CA 3VN0A 1L0LK 1BDDA 1FBMA 1BGYE 1SFCD 3SWYA 3A2AA 5AW2B 3PJSK 2ZVNB 4ASVA 1N73C 1PP9J 1LTGC 4IL6E 1SQBD 1KILE 1NKZB 2H43A 1MUUA 1Q82Q 2CPSA 3PTZA 1HJBA 1KB9D 1U7JA 3L71E 1H89A 1OMIA 1VL2A 3CCLP 5AW7B 2E75B 3B71A 1VQ6P 3RK2B 5CBNA 3L73J 1SQXK 3OA7A 2XZRA 1IK7A 2JEEA 1KYOD 3EQ2A 2H7HA 4Y99B 3AEEC 3JSVC 3CX5E 1KN7A 2I8DA 2V7QH 1VQPP 2KSJA 1ZXGA 1EXJA 1JOCA 5APUA 3H1JE 1VDFA 1QLED 3C9IA 1ZRTE 4HKZH 3AE7C 1MV8A 3V2RA 4W80A 1RY3A 4ZKPA 3NMDA 1KFNA 1KQLA 4XA4A 5KAFE 1U7MA 4PJ0E 3RK3C 5DJTB 2Y0EA 2KSEA 3GMAA 1Q7YQ 5TISH 2AXTH 1T2KC 2H89C 5C39A 1E79H 5AVTB 3T97B 1RE4C 3A7OA 4HH2A 4AQRD 2ZT9B 3G6EP 2KB7P 5CCGC 2WZ7A 1NTMJ 5KLVJ 1VQ8P 5GTHH 4DJGA 4H13B 1N7SB 1PPJG 1PV3A 5E79H 1KMIZ 3T97A 1PFIA 3TK1A 1X8YA 1SQPE 1GD2E 1AV1A 1G1JA 2O01H 5APTA 3LW5H 2P67A 2C0WA 2OYIB 3HE4B 1N7SA 3N4XA 4OWFA 4UB8E 5AW3B 2J59M 2XKMA 2H88C 3EFGA 5B66H 3TSIA 2KZJA 3H1IJ 4BRYB 1SFCC 3A0BH 1NO4A 1P84D 1L4AA 2JDIH 1J1EC 2E75D 4BXLA 2OYIA 3C1LA 2CPBA 3HE4A 1VPCA 3BRTB 1T8ZA 2KI7B 3RK2D 1H0TB 2JKVA 1PIXA 2IYOA 3CMAP 3AE6C 1DEEG 5KLIB 3CCQP 1BGYG 2IFNA 2A06D 1Q86Q 4BRYA 1SQQJ 3CXHD 1GZLA 1JNMA 4BWNA 1USEA 1HVVA 1KD1Q 1K04A 5BVZA 1IFIA 1S72P 3A0HE 1PPJD 1SS1A 2QVAA 2AXCA 1VQLP 2KXPB 4LLHA 2QSIA 3L71G 2Z5IA 1L0ND 4GODA 1H8AA 3U1CA 1DH3A 3F5HA 3H1LD 1SQBE 4GIFA 1FZFA 4IFMA 4U3FJ 5DJUB 1LWUC 3AE8C 1CI6B 2C0XA 5AVWB 3Q5SA 3BCCD 1GDTA 5APVA 5APQA 1LJ2A 2P1JA 2KIKA 2P10A 1XTCC 2WSEJ 3V2NA 2ZT9D 2Q7CA 2WPQA 3AE4C 1CI6A 1NGMB 1WT6A 3PH0A 2OYHB 2W6AA 1OWAA 1N7SD 1SQQD 3FXEA 4I7ZB 1KILD 3O8ZA 3L75J 1N2DC 1NTKE 2K9YA 3KYQA 4YXWH 1EZVG 2ZYDA 5EFWB 2CK3H 3A3YB 1N86A 2YXQB 2IX7C 1QEXA 1S5LX 2FYNB 3CCVP 1L4AD 2OYHA 3CC2P 3L71D 1R5SA 3TGUJ 1OVUA 4PV1D 3L70J 5TJHA 2QJPB 3UIAA 2L91A 1PP9E 3ABVC 3VMXA 2Q5UA 2XNXA 3D6YA 2BCCJ 1XTGB 3MTUE 3GF3A 1AA0A 1EZVI 4PD4I 1OW6A
chains in the Genus database with same CATH topology
4R4LA 1KQGB 2V7QJ 1PV3A 1YQ3C 2O01J 1IK7A 4PV1B 1K05A 1KMIZ 3LW5J 5M1BA 3O6QA 4YXDC 4H44B 3AEBC 1VF5B 4GDOA 4KT0J 3Q5RA 2E74B 1GMJA 2WSCJ 3AEEC 4RKUJ 2E76B 5L8RJ 3AE3C 4H0LB 3SFEC 3AE8C 4R4MA 2BEZF 1DIPA 3AECC 2WQYC 3D6ZA 4I7ZC 3Q5SA 1EXIA 3R4YA 3Q5PA 1EXJA 4XFJA 5KLIC 2JO1A 2P10A 1OW7A 4YTPC 1HJ0A 2YMKA 2J5UA 2WSEJ 3FGAD 4OGQD 2OQQA 3Q3DA 1MKMA 3GLMA 2QIWA 1R8EA 2ZT9D 2H88C 1ZRTE 2FYNC 1ZP0C 3AE7C 1KQFB 1FDOA 1ZMEC 3AE4C 3AEFC 1AJYA 4OGQC 2WPVB 3AE1C 4H44C 4U7JA 1NGMB 3G9RA 2D2CC 1RQUA 2QJKC 2ZT9C 2E75D 2QJPC 3RL0g 3D70A 2YIUC 1TU3F 1WMKA 4H0LC 3GF7A 4I7ZB 4Z1MH 1PIXA 1KTMA 1FDIA 2G8YA 3AE6C 4H44D 2K9YA 3AEGC 2D2CD 3C8VA 3IAOA 2E75C 4H13C 3GMAA 3AEDC 4H0LD 1U57A 2QJYC 2H89C 2NZ2A 1KILE 4PV1C 3Q1MA 1Y9BA 1S5LX 1VF5C 1YQ4C 4IL6X 1K04A 3EWKA 2E74C 1RQVA 2JP3A 2MKVA 3IN6A 4OGQB 2E76C 3Q2YA 1KORA 4H13D 1UIXA 3T97B 3AE9C 2BEQD 2D2CB 1PL5A 4PV1D 2ZT9B 3AE2C 1HF9A 3AEAC 1VF5D 1S1CX 3RK3E 2WSFJ 1OW8A 2E74D 1Q90D 3AE5C 3ABVC 3H25A 2E76D 2IDBA 2QSIA 3D6YA 1OMIA 1NYHA 1DD3A 1DD4A 3S9OA 1VL2A 1JB0J 2E75B 3GF3A 3B71A 3D71A 5KKZC 3SFDC 1ZOYC 4TT3H 4H13B 2G3AA 2FXPA 2FBWC 4Y28J 1OW6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2O01 J;  2WSE J;  4PV1 B;  3LW5 J;  4I7Z B;  4H44 B;  2D2C B;  1VF5 B;  4KT0 J;  2ZT9 B;  2E74 B;  2K9Y A;  2QIW A;  3C8V A;  2WSC J;  4RKU J;  1ZRT E;  2E76 B;  2WSF J;  2FYN C;  1Q90 D;  5L8R J;  4H0L B;  2QSI A;  2QJY C;  2WPV B;  1JB0 J;  2E75 B;  1S5L X;  5KKZ C;  2QJK C;  4IL6 X;  4H13 B;  2QJP C;  4Y28 J;  2YIU C;  5KLI C;  4OGQ B; 
#chains in the Genus database with same CATH topology
 3E1R A;  3JCU H;  3CX5 D;  3A5T A;  3I56 P;  1SQP G;  1BE3 J;  3HUS B;  3SFE C;  3E7K A;  4RO0 A;  3H1J D;  1M57 D;  2O3J A;  3L74 J;  2XV5 A;  4XFJ A;  2JO1 A;  3L73 E;  1OW7 A;  4YTP C;  5AW6 B;  2Q3E A;  5AVY B;  3HUS A;  3B8E B;  1UII A;  4U7J A;  2YKP A;  3G9R A;  3USS A;  1LTA C;  3KZI H;  1W2E A;  1SQV J;  2YIU C;  2MJZ A;  3CPW O;  2W6J H;  3HD7 B;  1IFN A;  1KTM A;  4ZNC A;  1SQX G;  4DT0 A;  1X0T A;  4XE5 B;  1NU1 D;  1G1I A;  3B4S A;  1LT9 B;  1FJP A;  3EWK A;  3HD7 A;  2D2C B;  4WB4 A;  3SWF A;  3FWL A;  3AEA C;  3WUT A;  3FX0 A;  1IK9 A;  3FWN A;  1SQP D;  1M1J B;  2NRG A;  1HBW A;  1LT9 A;  1RE3 A;  3M0D C;  5KKZ C;  4IFD K;  3SFD C;  4EOT A;  2HOD B;  5GTI H;  2A06 E;  1BDC A;  2V7Q J;  4YXD C;  4H44 B;  2WTY A;  2QM8 A;  3TDK A;  3QH9 A;  2XU6 A;  1S2E A;  2E76 B;  1SQB G;  2V4H A;  1NTM E;  5CJ0 A;  1M1J A;  3GHG C;  1RF1 B;  4PD4 H;  2UWJ E;  1D7M A;  2HOD A;  2WSC H;  2KLU A;  1FZG A;  2WIT A;  3VYI A;  2KZI A;  1OVR A;  2JWD A;  3CWB J;  1QVG O;  2ZYA A;  1DEB A;  2N1T B;  1ZME C;  1H88 A;  1L0N E;  1KIL C;  5AVX B;  2WMM A;  2QJK C;  1RF1 A;  3W68 A;  4OH8 B;  5B5E H;  2WPS A;  4K35 A;  4JBZ A;  1L4A C;  1NTK G;  3H1I E;  3TNU B;  1KB9 I;  3Q1M A;  4PV1 C;  2POH A;  2QRX A;  2GUV A;  1N8R Q;  2JP3 A;  4OGQ B;  1SQP K;  2KNC B;  5APY A;  4WY4 B;  1PL5 A;  1GL2 B;  3B5N B;  2KLV A;  4NPF X;  3TYY A;  1S1C X;  1KYO I;  2Q9I A;  3TNU A;  4OVN F;  1SQQ E;  1FZC B;  2A45 I;  1AVY A;  2C9N Y;  3SWK A;  2FXP A;  1YQ3 C;  2KNC A;  2O01 J;  2ZVO B;  3CCJ P;  3LW5 J;  3MP7 B;  3HD7 D;  2Y9Z A;  4WY4 A;  1GL2 A;  5K5G B;  3CCR P;  2FKW B;  1BCC D;  1FZC A;  2IYP A;  2LXB A;  3M9H A;  2OQQ A;  2PAJ A;  5KJ7 C;  3KZI E;  3L73 G;  1HGZ A;  2IBZ E;  1KZU B;  1RF0 C;  3V4Q A;  1R8E A;  3IF4 A;  1J1D B;  4U3F E;  2NPS C;  1FDM A;  3M91 A;  5CHX A;  3RL0 D;  2FFD C;  1NTK D;  3H1H J;  2YMY A;  4HYT B;  1EDI A;  1SP4 A;  4GOE A;  1A02 J;  4H44 D;  1YHQ P;  3ZDM A;  3HTK B;  2W83 C;  3PRJ A;  1LTB C;  4DCK A;  2ZJS E;  1PP9 D;  1RQV A;  5AW1 B;  1SQB K;  5H2F H;  1T6A A;  3L75 E;  2M0B A;  1CZQ A;  3H1K J;  1VQK P;  1LTT C;  1YJW P;  3HTK A;  2RN0 A;  1KB9 H;  1DD4 A;  1JB0 J;  1CW5 A;  2G3A A;  1IFD A;  3TGU E;  2WSF H;  5M1B A;  1K05 A;  1LTJ C;  2B88 A;  3AEB C;  1LGH B;  1VF5 B;  2A06 G;  1NU1 E;  3HRN A;  3L70 E;  2E74 B;  2FXM A;  1KYO H;  1OIP A;  3L73 D;  2ZXE B;  2BCC E;  3U59 A;  2A45 H;  1NTM G;  3L72 J;  4AUW A;  2IPP A;  4EIJ A;  4I1L A;  5BU5 A;  4JYC A;  1P84 I;  4N6J A;  2DW3 A;  4IFF A;  1NTK K;  4OGQ D;  1YIT P;  3P8M C;  4WY4 D;  1GL2 D;  1M1K Q;  1KV4 A;  1BE3 E;  3PHL A;  1KQF B;  1S5L E;  1GTW A;  2KP8 A;  4B86 A;  3K5B A;  3KPE A;  1L0N G;  1X79 B;  3L74 E;  4UB6 E;  3CXH I;  1DX7 A;  2ZFC A;  1IC2 A;  4I6M C;  3H1L G;  1WMK A;  3H32 B;  3U1A A;  3P8C E;  4O9B A;  3BCC G;  3H1I G;  4JF7 A;  4IL6 X;  1SQV E;  1Y8A A;  1URQ B;  3H32 A;  1NTZ J;  3M9Q A;  1G2C B;  1NKN A;  1OX3 A;  4JPZ B;  1Z56 A;  1JMB A;  1DD3 A;  2OTK E;  1N73 B;  3D71 A;  1SQQ G;  4I2L C;  1NTM D;  5KLV D;  4R4L A;  1URQ A;  1H0T A;  4KT0 J;  1S4X A;  1GMJ A;  3II6 A;  2YKO A;  3M0A A;  1OVV A;  1PZQ A;  5AW8 B;  3D6Z A;  1HH0 A;  2PRR A;  3RL0 C;  2HPC B;  1IO4 A;  1FU1 A;  1JY2 O;  4L74 A;  3CCM P;  1NAF A;  4D6T J;  4CPG A;  2IBZ G;  4H44 C;  5APW A;  1P84 H;  4DZO A;  1VQ5 P;  3H1I D;  1FS0 E;  3GF7 A;  2HPC A;  1BCC E;  2SPZ A;  3CWB E;  2FYU J;  3H1J G;  4HJG H;  1NTZ D;  2KYV A;  3OW2 O;  2QJY C;  2NZ2 A;  2E5T A;  3W67 A;  2YNY A;  3CXH H;  5TIS E;  3IN6 A;  2AXT E;  2FXO A;  3VOP A;  4H13 D;  3G4S P;  1JY3 O;  1QVF O;  1NTM K;  3WU2 H;  3CX5 I;  5BU8 B;  1EQ7 A;  1OW8 A;  2ZYG A;  2WVR A;  3RK3 B;  3I5C A;  1ZOY C;  3GW6 A;  5GTH E;  3TGU G;  3WUV A;  4MN4 C;  3Q5R A;  5AW0 B;  1OXZ A;  1EC5 A;  1MZ9 A;  3MGN A;  2WSC J;  1L0N K;  5E79 E;  1NU1 G;  3AE3 C;  3L70 G;  4K3A A;  2BEZ F;  2WQY C;  2IBZ D;  1NOH A;  1EXI A;  2BCC G;  4U3F D;  2K3R A;  2YMK A;  3FGA D;  1IZN B;  1URQ D;  2JWA A;  2YO3 A;  1NVO A;  1YTZ T;  1YJN P;  1RE4 A;  2W6B A;  3OJA B;  2WPV B;  5B66 E;  3KQG A;  4KJM A;  1W2B O;  1RQU A;  1L2P A;  2B9B A;  2JR8 A;  2M3E A;  2PGD A;  3A0B E;  3L74 G;  1L0L J;  4IL6 H;  3AEG C;  3IAO A;  2E75 C;  1SQQ K;  1YI2 P;  3RK2 C;  3L75 D;  3H1H E;  2P7J A;  1GU4 A;  4Y99 C;  1SFC B;  4EI2 A;  3MIW A;  1SQV G;  3VMA A;  1J1E B;  2K1A A;  3TGU D;  5CBO A;  1JCD A;  4TLF A;  5AVQ B;  2OGU A;  1GW4 A;  2IZ0 A;  3L70 D;  1JO5 A;  3KXD A;  1KQG B;  1X9V A;  2BCC D;  2O1J A;  1SQX J;  4GDO A;  3CX5 H;  4KHX A;  5CJ4 A;  3H1K E;  2E5Y A;  2Y9Y A;  4RJT A;  1ZV8 A;  4H0L B;  1EDL A;  3MZW B;  1YIJ P;  2HR3 A;  3AEC C;  4A7P A;  1BE3 D;  3VMY A;  2ZAE B;  3Q3D A;  2PP6 A;  2O1K A;  1IFM A;  3L74 D;  3L37 A;  3CI9 A;  1FZE A;  2Q1K A;  5AVZ B;  1AJY A;  1GU5 A;  5KLV E;  1QGK B;  3P8C D;  3L72 E;  5KAF H;  3MD0 A;  2ZT9 C;  1JUN A;  2HFE D;  3RL0 g;  1LWU B;  1E5W A;  1GK4 A;  3O6Q B;  1T2K D;  4Z1M H;  1ZR4 A;  2KOG A;  2K37 A;  3PP5 A;  1FOS F;  1SQV D;  1BCC G;  2GA1 A;  4LC1 A;  4H13 C;  1N7S C;  1NHL A;  3V6I A;  3H6P A;  2W8Z A;  1YBK A;  2LXC B;  1LNQ A;  3Q2Y A;  1GW3 A;  1NU1 K;  3AE9 C;  1Q81 Q;  1HUC A;  1HF9 A;  1SLQ A;  3V4W A;  2J58 A;  1MFT A;  2WSF J;  2OYI C;  2I1K A;  2N1T A;  1NJI Q;  3RBZ A;  2XND H;  2Z4E A;  1AFO A;  5AW4 B;  5KTB A;  1JY2 P;  2WPR A;  2LR2 A;  2QEX P;  1MFZ A;  2R44 A;  3BVH A;  1X22 A;  2B89 A;  1RH5 B;  1NTZ E;  2OTL P;  3JCU E;  1GK6 A;  1IJD B;  2N9B A;  3OAK A;  1A02 F;  3LID A;  3VP9 A;  1PP9 G;  3F89 A;  3CD6 P;  4UB8 H;  5CMZ A;  2QA4 P;  2OAR A;  5KLI C;  2E43 A;  4IOI H;  2QIW A;  3B5N A;  4WWI A;  2R32 A;  1KC8 Q;  4ZKU A;  2FYZ A;  1YTZ I;  1Q2N A;  2KK7 A;  1JY3 P;  2ZXX A;  1SQV K;  1JMM A;  3CWB D;  1M7L A;  5CCH A;  2QE7 H;  2KUB A;  3EFF K;  3D70 A;  1TU3 F;  3QWO C;  1M90 Q;  3V5B A;  1NWQ A;  5APS A;  2G8Y A;  2D2C D;  4D6T E;  3M06 A;  4H0L D;  1YYC A;  2M8R A;  3A0H H;  1HGV A;  3H1H G;  4JQ0 D;  2YKQ A;  1KOR A;  1SVF A;  3KHU A;  2YIU B;  2FYU E;  4ASW A;  3AE5 C;  2E76 D;  3ITK A;  4N78 E;  2WWW A;  2GUS A;  3NXS A;  2OTJ P;  5AW9 B;  2WT7 B;  5GTI E;  4RKU J;  4YPC A;  2OYH C;  5L8R J;  3H1K G;  2N1T D;  1JY2 N;  4I7Z C;  3BRV B;  3CLQ A;  3R4Y A;  1OFC X;  2WT7 A;  1EZV E;  5KKZ B;  1MKM A;  1T3U A;  4PD4 E;  4W7Y A;  3KDP B;  2K9J B;  3L35 A;  1S9K E;  2IFM A;  2FYN C;  1ZP0 C;  2AEM A;  3G3Z A;  3CME P;  1JM0 A;  5KLV G;  2W90 A;  2QJP C;  3L72 G;  1FAV A;  1FE6 A;  1ZW0 A;  2HLO A;  3S1K A;  3H1H D;  2OYO A;  3M0D A;  3GHG B;  5AVV B;  2L5G B;  5B5E E;  2K9J A;  2HG5 D;  3HE5 B;  3B5N D;  3RBX A;  2O01 N;  1JY3 N;  2K88 A;  1EDJ A;  4C46 A;  1ZN5 A;  3MUD A;  5CCH D;  2MKV A;  1ZR2 A;  2HYN A;  1KIL B;  3HUS C;  3BAT A;  3VMZ A;  2GM4 A;  1L0L E;  2QJK B;  3AE2 C;  2QM7 A;  3GHG A;  3RK3 E;  1EDK A;  3HE5 A;  5KAI H;  1LT1 A;  3IR9 A;  1L0N J;  4GT1 A;  1PGO A;  1QL2 A;  1L4A B;  3H1L J;  3H1K D;  2RMZ A;  2KS1 B;  1WRG A;  1FC2 C;  3CCE P;  3VP8 A;  1KIL A;  4ZMD A;  4PV1 B;  1VQM P;  4QMA A;  2RKL A;  3BCC J;  5AVU B;  1NTZ G;  1LTI C;  3NFQ A;  1Y47 A;  3HD7 C;  2KS1 A;  2P58 A;  2YO2 A;  5APX A;  1N7L A;  1HJ0 A;  1BGY J;  3L72 D;  1IFJ A;  1SQX E;  1OZH A;  1LT9 C;  1RE3 C;  3V2P A;  2XDJ A;  4GOF A;  3G71 P;  1FZB A;  3AEF C;  1G2C A;  3FXD A;  2P2U A;  3MHV A;  3GG2 A;  4DOJ A;  3AE1 C;  4NPE A;  2D2C C;  1N73 A;  3CC4 P;  4H0L C;  4M3L A;  1KQS O;  2VRS A;  1FDI A;  1M1J C;  1KFM A;  1USD A;  3C8V A;  3L71 J;  3AED C;  1VQO P;  4D6T G;  4U3F G;  1Y9B A;  3N7N A;  1CSB A;  1YQ4 C;  2NPS B;  2E76 C;  2FFD B;  4NPD A;  3RGU A;  2LKM A;  2BEQ D;  1RHZ B;  2PFX A;  3IFM A;  3P7K A;  1T3J A;  1VF5 D;  5H2F E;  1ZLL A;  2E74 D;  3H25 A;  1RF1 C;  1QL1 A;  1LTS C;  5KJ7 A;  2FYU G;  1PGP A;  2M5A B;  1NYH A;  1RF0 A;  3E1I A;  2NPS A;  1KB9 E;  2IBZ I;  4Y28 J;  3CL3 D;  2N1T C;  2FFD A;  3H1J J;  1NAY A;  5AW5 B;  5KLV K;  3L75 G;  1K8A Q;  2IZ1 A;  1BGY D;  4R4M A;  2M5A A;  1KYO E;  2J5U A;  2WSS H;  1VQ4 P;  5AVR B;  1FDO A;  3WUU A;  1LTJ B;  4OGQ C;  1W5C E;  4L73 A;  3L36 A;  4WY4 C;  1GL2 C;  2Y0D A;  3B5N C;  1JCC A;  4D6T D;  1IFP A;  1FOS E;  4RES B;  1NU1 J;  1FZC C;  5CCH C;  1M56 D;  2JJL A;  1LTJ A;  3NTN A;  1U57 A;  5AVS B;  1BE3 G;  5KAI E;  2FYU D;  5CCG A;  1NTZ K;  4N78 D;  2Q6Q A;  1SQP J;  3R2P A;  1L0L G;  3TF5 A;  1Q90 D;  3I55 P;  2AEF A;  1ZRT D;  1J1D C;  1AQ5 A;  1AQT A;  1LP1 B;  2RH0 A;  2Q3I A;  2R5B A;  1NH4 A;  5KJ7 D;  1EZV D;  2YXR B;  1PGJ A;  4PD4 D;  3V2Q A;  1S9K D;  1BSH A;  2N9Y B;  2BAS A;  2R5D A;  2NPS D;  2I1J A;  1SFC A;  3LIE A;  1K73 Q;  2Z5H A;  3GLM A;  1BSN A;  1LP1 A;  4LGD E;  1JEK A;  2WSE H;  1R5L A;  1HWT C;  3P32 A;  4HB1 A;  4C7N B;  2FYU K;  1M8O B;  1P84 E;  1K9M Q;  2C9L Y;  2E42 A;  3M9B A;  1FZA A;  3S4R A;  1VQ7 P;  3RL0 B;  2W27 A;  4WVZ A;  3CC7 P;  1AVO A;  4C7R A;  1L0L D;  1VF5 C;  3RK3 D;  2E74 C;  1J2J B;  4PJ0 H;  1FJK A;  4EDF A;  1UIX A;  1JTH B;  3WMM 0;  4N3Y B;  3CXH E;  4C7N A;  1SQB J;  2B87 B;  2R3S A;  3MUD C;  4L75 A;  4GKG A;  3VTP C;  2ITA A;  3L4F A;  1HTL C;  2IDB A;  3CWB G;  3WU2 E;  4EYY Q;  3S9O A;  4JYB A;  4L76 A;  1PPJ E;  4TT3 H;  2AEJ A;  2FBW C;  5CCG D;  1LWU A;  1QX8 A;  2QJY B;  1BCC J;  1JTH A;  3O6Q A;  2Y0C A;  1VQN P;  2B87 A;  3CCU P;  3CCS P;  3BAS A;  1YJ9 P;  4AYC A;  2M3B A;  1PGQ A;  3PLN A;  4W7Z A;  1SQX D;  1DIP A;  3H1L E;  1S3J A;  3JC2 2;  3Q5P A;  1S5L H;  3SSU A;  2A45 G;  1NTK J;  4WBA A;  2FY8 A;  3BCC E;  4UB6 H;  2H8P D;  1URQ C;  2QG4 A;  1VQ9 P;  2R3C A;  3VN0 A;  1L0L K;  1BDD A;  1FBM A;  1BGY E;  1SFC D;  3SWY A;  3A2A A;  5AW2 B;  3PJS K;  2ZVN B;  4ASV A;  1N73 C;  1PP9 J;  1LTG C;  4IL6 E;  1SQB D;  1KIL E;  1NKZ B;  2H43 A;  1MUU A;  1Q82 Q;  2CPS A;  3PTZ A;  1HJB A;  1KB9 D;  1U7J A;  3L71 E;  1H89 A;  1OMI A;  1VL2 A;  3CCL P;  5AW7 B;  2E75 B;  3B71 A;  1VQ6 P;  3RK2 B;  5CBN A;  3L73 J;  1SQX K;  3OA7 A;  2XZR A;  1IK7 A;  2JEE A;  1KYO D;  3EQ2 A;  2H7H A;  4Y99 B;  3AEE C;  3JSV C;  3CX5 E;  1KN7 A;  2I8D A;  2V7Q H;  1VQP P;  2KSJ A;  1ZXG A;  1EXJ A;  1JOC A;  5APU A;  3H1J E;  1VDF A;  1QLE D;  3C9I A;  1ZRT E;  4HKZ H;  3AE7 C;  1MV8 A;  3V2R A;  4W80 A;  1RY3 A;  4ZKP A;  3NMD A;  1KFN A;  1KQL A;  4XA4 A;  5KAF E;  1U7M A;  4PJ0 E;  3RK3 C;  5DJT B;  2Y0E A;  2KSE A;  3GMA A;  1Q7Y Q;  5TIS H;  2AXT H;  1T2K C;  2H89 C;  5C39 A;  1E79 H;  5AVT B;  3T97 B;  1RE4 C;  3A7O A;  4HH2 A;  4AQR D;  2ZT9 B;  3G6E P;  2KB7 P;  5CCG C;  2WZ7 A;  1NTM J;  5KLV J;  1VQ8 P;  5GTH H;  4DJG A;  4H13 B;  1N7S B;  1PPJ G;  1PV3 A;  5E79 H;  1KMI Z;  3T97 A;  1PFI A;  3TK1 A;  1X8Y A;  1SQP E;  1GD2 E;  1AV1 A;  1G1J A;  2O01 H;  5APT A;  3LW5 H;  2P67 A;  2C0W A;  2OYI B;  3HE4 B;  1N7S A;  3N4X A;  4OWF A;  4UB8 E;  5AW3 B;  2J59 M;  2XKM A;  2H88 C;  3EFG A;  5B66 H;  3TSI A;  2KZJ A;  3H1I J;  4BRY B;  1SFC C;  3A0B H;  1NO4 A;  1P84 D;  1L4A A;  2JDI H;  1J1E C;  2E75 D;  4BXL A;  2OYI A;  3C1L A;  2CPB A;  3HE4 A;  1VPC A;  3BRT B;  1T8Z A;  2KI7 B;  3RK2 D;  1H0T B;  2JKV A;  1PIX A;  2IYO A;  3CMA P;  3AE6 C;  1DEE G;  5KLI B;  3CCQ P;  1BGY G;  2IFN A;  2A06 D;  1Q86 Q;  4BRY A;  1SQQ J;  3CXH D;  1GZL A;  1JNM A;  4BWN A;  1USE A;  1HVV A;  1KD1 Q;  1K04 A;  5BVZ A;  1IFI A;  1S72 P;  3A0H E;  1PPJ D;  1SS1 A;  2QVA A;  2AXC A;  1VQL P;  2KXP B;  4LLH A;  2QSI A;  3L71 G;  2Z5I A;  1L0N D;  4GOD A;  1H8A A;  3U1C A;  1DH3 A;  3F5H A;  3H1L D;  1SQB E;  4GIF A;  1FZF A;  4IFM A;  4U3F J;  5DJU B;  1LWU C;  3AE8 C;  1CI6 B;  2C0X A;  5AVW B;  3Q5S A;  3BCC D;  1GDT A;  5APV A;  5APQ A;  1LJ2 A;  2P1J A;  2KIK A;  2P10 A;  1XTC C;  2WSE J;  3V2N A;  2ZT9 D;  2Q7C A;  2WPQ A;  3AE4 C;  1CI6 A;  1NGM B;  1WT6 A;  3PH0 A;  2OYH B;  2W6A A;  1OWA A;  1N7S D;  1SQQ D;  3FXE A;  4I7Z B;  1KIL D;  3O8Z A;  3L75 J;  1N2D C;  1NTK E;  2K9Y A;  3KYQ A;  4YXW H;  1EZV G;  2ZYD A;  5EFW B;  2CK3 H;  3A3Y B;  1N86 A;  2YXQ B;  2IX7 C;  1QEX A;  1S5L X;  2FYN B;  3CCV P;  1L4A D;  2OYH A;  3CC2 P;  3L71 D;  1R5S A;  3TGU J;  1OVU A;  4PV1 D;  3L70 J;  5TJH A;  2QJP B;  3UIA A;  2L91 A;  1PP9 E;  3ABV C;  3VMX A;  2Q5U A;  2XNX A;  3D6Y A;  2BCC J;  1XTG B;  3MTU E;  3GF3 A;  1AA0 A;  1EZV I;  4PD4 I;  1OW6 A; 
#chains in the Genus database with same CATH homology
 4R4L A;  1KQG B;  2V7Q J;  1PV3 A;  1YQ3 C;  2O01 J;  1IK7 A;  4PV1 B;  1K05 A;  1KMI Z;  3LW5 J;  5M1B A;  3O6Q A;  4YXD C;  4H44 B;  3AEB C;  1VF5 B;  4GDO A;  4KT0 J;  3Q5R A;  2E74 B;  1GMJ A;  2WSC J;  3AEE C;  4RKU J;  2E76 B;  5L8R J;  3AE3 C;  4H0L B;  3SFE C;  3AE8 C;  4R4M A;  2BEZ F;  1DIP A;  3AEC C;  2WQY C;  3D6Z A;  4I7Z C;  3Q5S A;  1EXI A;  3R4Y A;  3Q5P A;  1EXJ A;  4XFJ A;  5KLI C;  2JO1 A;  2P10 A;  1OW7 A;  4YTP C;  1HJ0 A;  2YMK A;  2J5U A;  2WSE J;  3FGA D;  4OGQ D;  2OQQ A;  3Q3D A;  1MKM A;  3GLM A;  2QIW A;  1R8E A;  2ZT9 D;  2H88 C;  1ZRT E;  2FYN C;  1ZP0 C;  3AE7 C;  1KQF B;  1FDO A;  1ZME C;  3AE4 C;  3AEF C;  1AJY A;  4OGQ C;  2WPV B;  3AE1 C;  4H44 C;  4U7J A;  1NGM B;  3G9R A;  2D2C C;  1RQU A;  2QJK C;  2ZT9 C;  2E75 D;  2QJP C;  3RL0 g;  3D70 A;  2YIU C;  1TU3 F;  1WMK A;  4H0L C;  3GF7 A;  4I7Z B;  4Z1M H;  1PIX A;  1KTM A;  1FDI A;  2G8Y A;  3AE6 C;  4H44 D;  2K9Y A;  3AEG C;  2D2C D;  3C8V A;  3IAO A;  2E75 C;  4H13 C;  3GMA A;  3AED C;  4H0L D;  1U57 A;  2QJY C;  2H89 C;  2NZ2 A;  1KIL E;  4PV1 C;  3Q1M A;  1Y9B A;  1S5L X;  1VF5 C;  1YQ4 C;  4IL6 X;  1K04 A;  3EWK A;  2E74 C;  1RQV A;  2JP3 A;  2MKV A;  3IN6 A;  4OGQ B;  2E76 C;  3Q2Y A;  1KOR A;  4H13 D;  1UIX A;  3T97 B;  3AE9 C;  2BEQ D;  2D2C B;  1PL5 A;  4PV1 D;  2ZT9 B;  3AE2 C;  1HF9 A;  3AEA C;  1VF5 D;  1S1C X;  3RK3 E;  2WSF J;  1OW8 A;  2E74 D;  1Q90 D;  3AE5 C;  3ABV C;  3H25 A;  2E76 D;  2IDB A;  2QSI A;  3D6Y A;  1OMI A;  1NYH A;  1DD3 A;  1DD4 A;  3S9O A;  1VL2 A;  1JB0 J;  2E75 B;  3GF3 A;  3B71 A;  3D71 A;  5KKZ C;  3SFD C;  1ZOY C;  4TT3 H;  4H13 B;  2G3A A;  2FXP A;  2FBW C;  4Y28 J;  1OW6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...