2N1TA

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
NLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
molecule tags Exocytosis
total genus 30
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tA00
4W7ZA 2HG5D 3PP5A 3M0DC 4W80A 3HD7B 5CCHD 5CCHA 1JTHA 1JTHB 2NPSD 3RK2D 2NPSB 3B5NC 2PP6A 3RK2B 1NHLA 1URQC 1KILC 1N7SD 5CCGC 1N7SA 1N7SB 3KYQA 3RK3C 1L4AD 1L4AA 3RL0C 1L4AB 3HTKB 1GL2C 4OH8B 2HFED 1GL2A 1T3JA 3HD7C 3P8CE 1SFCC 2XDJA 4N78E 3B5ND 3B5NA 1URQD 5KJ7C 1KILD 1URQA 1KILA 5CCGD 4WY4C 1URQB 5CCGA 1KILB 1SFCA 2NPSC 3RK3D 2YMYA 2H8PD 3RL0D 2KOGA 2N1TC 1GL2D 1HVVA 1GL2B 1XTGB 4LGDE 5CCHC 2M8RA 3HD7D 3HD7A 3B5NB 1SFCD 4JF7A 1SFCB 5KJ7D 3RK2C 5KJ7A 4WY4D 4WY4A 3RK3B 1N7SC 4WY4B 2NPSA 3RL0B 3TSIA 4W7YA 2WZ7A 1L4AC 2N1TD 3VOPA 2N1TA 2N1TB
chains in the Genus database with same CATH superfamily
3TF5A 2HG5D 1NTMJ 3L71G 3H1LJ 1KC8Q 1Y9BA 4I7ZB 1NTKD 1OW6A 1VF5C 1LT9A 5APQA 2C9LY 1PV3A 1X79B 1EZVE 2AXTH 4C7NB 2QA4P 3C9IA 3L72E 1S2EA 1N8RQ 2YKOA 1L4AA 1J1DB 3WU2H 4C46A 1OW8A 4M3LA 2J59M 2Q7CA 3G3ZA 2H89C 1HJ0A 1FS0E 3VYIA 4HH2A 4O9BA 1NTME 2KLUA 2E75C 1SQVG 3H1LE 4YPCA 2PRRA 3EFGA 2QM8A 5GTHH 1JEKA 4EDFA 2IDBA 1IFNA 3Q5RA 4I7ZC 3H1HE 5H2FH 3A0BH 1MUUA 3M9QA 4LGDE 2O01H 1JO5A 3B5NB 1L0NJ 1E79H 5E79H 2K88A 2AEFA 5KKZB 2KI7B 3E1IA 4WY4B 5B5EE 1HF9A 1PGPA 1KYOI 2FXOA 2L5GB 1LTBC 1J1DC 1KYOD 3PJSK 1S3JA 3TGUE 1RF1A 1WT6A 3P8CD 2Q3EA 4H13B 2Q5UA 3MZWB 3LIEA 2D2CC 4JYBA 5APWA 2ZFCA 3BASA 1NTZG 3S4RA 1JTHA 2WTYA 3A5TA 2BCCD 3MD0A 3RK2D 2NPSB 3L71D 2ZXXA 5KLVJ 1BGYG 3PRJA 1L0NE 3NMDA 2FXMA 1OXZA 3V4QA 1EDJA 1BCCD 4H0LB 1PGQA 3EFFK 2K37A 2IYPA 2QG4A 1S9KE 3H1IJ 2E5YA 3M91A 2LKMA 2HYNA 4WY4C 4XA4A 2C9NY 2B87A 2PFXA 4WWIA 3CL3D 2KK7A 1GU5A 4BRYA 4H13C 1GL2D 5BU5A 3L75G 1PP9J 3AE1C 1SQVD 1M90Q 1HTLC 2OYHB 1PIXA 5C39A 5CCHC 3AECC 2IBZG 1SP4A 4H44D 2K1AA 2FYNB 4KT0J 1FZBA 3Q5SA 3RK3B 3CCQP 3BCCG 1U7JA 1PPJD 3AEEC 3H1IE 1LTJB 3CXHH 2O1KA 5AVRB 1T6AA 3CCUP 1QX8A 1Q2NA 1BE3G 2L91A 3CCJP 1YBKA 1G1IA 2FY8A 4H0LC 1KN7A 3CMAP 3M0DC 3KZIH 1IFPA 3ABVC 3H32B 2FYUJ 1PP9E 1QEXA 3VTPC 5KTBA 3CI9A 1VQOP 1J1EB 3SWKA 1ZR2A 3W67A 3TYYA 2XKMA 1N7LA 1MZ9A 1LT1A 1QVGO 2W83C 3LW5H 2OYHC 1SQXG 5GTIE 2CK3H 1SQBJ 4JPZB 2FYNC 1NU1K 3L37A 5K5GB 4EI2A 5AW8B 4N3YB 3L70D 1N2DC 2OQQA 1YQ4C 1NTMK 1HBWA 1LTJC 2RH0A 1RH5B 3E1RA 1PGJA 3EQ2A 3LIDA 1CI6A 4TLFA 1E5WA 2H43A 1YQ3C 1NOHA 2WPVB 1T8ZA 1N73B 5TISE 2FKWB 1ZN5A 2K9JA 2QVAA 1J1EC 3RL0B 1P84D 5AVQB 2IBZI 3CXHI 1SVFA 1HUCA 3CXHD 4JBZA 4I6MC 1IFIA 1ZRTE 4QMAA 1OVVA 3CCRP 5CJ0A 2MKVA 2ZT9D 4I2LC 1SQQE 2Q1KA 3H1KG 5APYA 2WT7A 3OAKA 3HTKB 3IAOA 2JO1A 1L2PA 1EDIA 1L0NK 3IF4A 3AEAC 2R5BA 5DJUB 1PGOA 1KQFB 3SWFA 2FFDA 3WU2E 1URQB 4OGQD 1SFCA 1L0LG 2YMYA 2H8PD 1VQKP 3RL0g 1NU1D 2KLVA 3O8ZA 3A2AA 1KFNA 2UWJE 1IFJA 2I1KA 4WB4A 1NYHA 1YTZI 3HD7D 3I5CA 5KLVK 3BVHA 2E43A 2QSIA 2G3AA 4R4MA 3VMXA 4L75A 4ASVA 5H2FE 2E76D 4PV1B 2HODB 3L74D 5BVZA 1K04A 2N9BA 3PP5A 1NTZJ 3D6ZA 1GMJA 1MFZA 3L73G 1KB9D 1YJNP 3CWBG 1VQLP 5E79E 2WVRA 3FGAD 1RE3A 1Y8AA 1JB0J 1ZOYC 3GLMA 5EFWB 1LT9B 1NTKG 1ZW0A 1BGYJ 2ZXEB 4HB1A 1URQC 1N7SD 4GDOA 1L4AB 4KJMA 1LTGC 5AW1B 4GIFA 1FJKA 3CX5D 2P2UA 1S5LH 1NAYA 4UB8H 1KD1Q 1NTZE 4N78E 1VL2A 1M1JA 3AE4C 3R4YA 1T2KC 1H88A 2KS1A 1BDDA 3L75J 2QEXP 1BGYE 1S72P 3BRTB 2ZAEB 2FYUK 1Z56A 3AEFC 4IL6H 5AW2B 1Q90D 1LT9C 3HD7A 3FX0A 2E74B 3Q2YA 1Q82Q 3PTZA 3L35A 3AEDC 2B89A 1BE3J 4JQ0D 1JY3O 1L4AC 4HKZH 3CPWO 1JOCA 3H1JJ 4LLHA 5KLVD 1RF1B 1SQBK 3C8VA 3V5BA 1OX3A 2Y0DA 3L75E 1SQPJ 3PH0A 2WPSA 2P67A 3MP7B 2R32A 1JTHB 1LJ2A 1HGVA 3JCUH 3AE2C 2IBZE 4UB6E 1N7SA 2BCCG 3L73D 1TU3F 4D6TJ 1YHQP 3BCCE 4I1LA 4AUWA 1SQXJ 3MIWA 2WSFH 1DIPA 1JCCA 1OVRA 2IZ1A 1HGZA 1BE3E 3V6IA 1FZEA 4L73A 3D6YA 3H1JE 4PD4H 2WWWA 1BCCG 1RHZB 4R4LA 1FZCA 3H1HJ 2E74C 3HE5A 3R2PA 4ZMDA 2JR8A 5CCGD 1SQPE 2B87B 3HRNA 3AE3C 2JEEA 2WSCJ 2P10A 2M5AA 5AVZB 1RF1C 4BRYB 2D2CB 1DH3A 5APSA 1OFCX 4Z1MH 4D6TE 1CSBA 4AYCA 1VQMP 1SQXE 3MHVA 1JMBA 3TGUJ 1G2CB 2WMMA 2P1JA 3OA7A 3RBXA 3KHUA 1LNQA 1PL5A 4EIJA 2FYUD 3A3YB 3MUDA 2HPCB 2N1TD 4RJTA 1PPJG 2Y9YA 1VDFA 1SLQA 1VQ7P 2XNXA 1JNMA 3S9OA 2M3BA 1OIPA 3FWNA 2WPRA 3SFEC 2FBWC 2OGUA 1SQBD 3RK2B 3TNUA 3A0HH 1FE6A 1UIIA 2XZRA 1DD4A 4TT3H 1AQ5A 4YXWH 3CC4P 1R5LA 3GG2A 3NFQA 1YTZT 3L4FA 1IK7A 3I56P 3JC22 4PD4I 5M1BA 4ZKPA 2FXPA 4PD4D 1KQSO 1Q81Q 3B5ND 1KILD 3II6A 5CCGA 1WMKA 2LXCB 2NZ2A 1NTZK 3L36A 3L70G 2YXRB 2W6AA 2GA1A 2O3JA 1GL2B 2QJYB 2YIUC 2WITA 3CLQA 3K5BA 5TJHA 1LP1A 1MKMA 4GOEA 1OVUA 3V2PA 4H44B 3RK2C 2KYVA 1H0TB 1NVOA 1R8EA 2K9JB 2KB7P 3TSIA 3P7KA 2N1TA 3S1KA 3CWBJ 2CPSA 3B8EB 4U3FG 1P84H 1GW4A 3QWOC 3VP8A 5CJ4A 5L8RJ 2WT7B 2A06D 1GL2C 2QJYC 2WSEJ 3HE4A 1RE4A 3CCSP 3Q3DA 1T3JA 2K9YA 3CWBE 2SPZA 3IR9A 4H44C 5AW4B 3B5NA 4BWNA 1JY3N 1KILA 2FFDB 1NTKE 1AA0A 1S4XA 3RK3D 1EXIA 3L72G 1NKZB 1J2JB 3GMAA 1SQPK 1DX7A 1W2EA 3GHGA 2GM4A 1NU1G 1D7MA 2H88C 5APUA 2R44A 1SFCD 1NTMG 2IFMA 2N9YB 3FXDA 4XE5B 3WUVA 1KQLA 4YXDC 4A7PA 2NPSA 2WPQA 4K35A 2V7QJ 1Y47A 4L76A 4PJ0E 1SQQJ 1LTIC 4OVNF 3L74G 4W80A 1RF0A 2M0BA 3TDKA 3V4WA 1YIJP 3HUSA 3H25A 2BCCJ 1P84I 3D70A 3CD6P 2FFDC 2ZT9B 1M56D 3L71J 3D71A 4DCKA 4HYTB 1K8AQ 1KB9H 2BEQD 4U3FD 3ITKA 3NTNA 1YJ9P 3JCUE 1BCCJ 2YKPA 5B5EH 1KYOE 1KZUB 2OYHA 5KLIB 3P8CE 3T97A 3OJAB 3G4SP 1RQUA 5AVSB 2KXPB 2QRXA 1M1JB 5AVYB 2P7JA 4OGQB 2KS1B 1ZMEC 2BCCE 3RL0D 5AVVB 4B86A 1FJPA 1EZVI 2AXTE 3CX5H 5KAFH 1EXJA 1BSNA 4Y28J 1EZVD 1SQVJ 2YO2A 3L71E 5KAIH 3U1CA 3CC7P 1IO4A 3VMZA 2C0WA 1XTGB 1FDOA 2Z5HA 1RE3C 3AE6C 3JSVC 2O01J 3L72D 2B9BA 1SQPD 2AEJA 1QGKB 2ZT9C 1BCCE 2OTKE 4RO0A 4W7YA 1X22A 3KXDA 3ZDMA 3TK1A 3VOPA 2E76B 2LR2A 4D6TD 2RN0A 1NTMD 1JCDA 1AVYA 2OTJP 3H1LD 2RKLA 2MJZA 1U7MA 5KLVG 5GTHE 2KSJA 5KLIC 3N4XA 1SQVE 2JWDA 1M1JC 2YXQB 1IFMA 3A0BE 4OGQC 3F5HA 1N7SB 4RKUJ 3H1HD 5CBOA 2M3EA 1KB9I 3CMEP 1IK9A 3A7OA 2VRSA 1R5SA 2W8ZA 1PPJE 4DT0A 2OYIA 2Q9IA 1T3UA 3WUTA 3HD7C 2R3CA 3FXEA 3NXSA 1CZQA 2JKVA 1MFTA 3O6QA 3TGUD 1PFIA 3L70J 3HE5B 1DD3A 4N6JA 1N73A 2O1JA 2PGDA 2OYOA 3PHLA 2E76C 2M5AB 1N86A 3CX5I 4PV1D 2JDIH 2E42A 3Q5PA 1AVOA 2J5UA 1SS1A 5AVUB 2IPPA 2IZ0A 1L0ND 5KJ7D 3M9BA 1RQVA 1NO4A 1N7SC 2V4HA 4DJGA 1W5CE 5GTIH 3CC2P 3VN0A 2FYUG 2IYOA 1S9KD 3L70E 3WMM0 4IFMA 1JY2O 2YO3A 2J58A 4U7JA 3BCCJ 2ZJSE 3WUUA 1AQTA 1DEBA 3B4SA 3AE9C 1FZCC 2Q6QA 1GD2E 1IJDB 4DZOA 1VQ4P 3TNUB 1SQBG 5APTA 2KP8A 2Y0CA 1VQNP 2GUVA 4NPEA 5AW9B 1M8OB 4LC1A 3LW5J 1P84E 1USEA 5AVXB 1VF5D 3CXHE 3H1ID 1M57D 5APVA 2KIKA 3KZIE 1SQQK 1FZFA 2QJKB 3MUDC 2H7HA 1ZLLA 2W90A 1PP9D 1AJYA 1BDCA 1LP1B 2E75D 1NAFA 5CMZA 1K05A 1MV8A 1VPCA 5KJ7A 3MGNA 1VQ5P 2ZYAA 1EDLA 2I8DA 1FC2C 3BRVB 3L74J 2N1TB 2KUBA 1LWUA 1FOSF 3AEGC 5AW3B 1NU1E 2R5DA 1NKNA 1UIXA 4WBAA 2W6JH 3P32A 4XFJA 2YMKA 2O01N 5CCGC 2HLOA 2QJKC 1SQVK 3N7NA 1ZXGA 3G9RA 2YIUB 2KNCA 2RMZA 3CCLP 3HE4B 2D2CD 5AW7B 2A06G 2KSEA 2W27A 2Y0EA 1BSHA 3H1KJ 3L74E 3M9HA 1KB9E 2AEMA 3VMYA 1KILB 4MN4C 1X8YA 1ZRTD 2Q3IA 4EOTA 1ZV8A 2N1TC 4GT1A 2ZVOB 3GF3A 3GHGB 3FWLA 4AQRD 1HJBA 4GKGA 1SQQD 4DOJA 3AEBC 1L0LJ 1FOSE 5B66H 2NRGA 1QL1A 4WY4D 2GUSA 1H8AA 3CX5E 5KAFE 3H1KE 5KAIE 1K73Q 4H13D 4W7ZA 1HH0A 1CI6B 3AE5C 4NPDA 3U59A 1RE4C 5CCHD 3HUSB 2IX7C 4C7RA 2NPSD 4C7NA 3B5NC 1NWQA 2PP6A 1VQ9P 1HWTC 1KILC 3EWKA 1L0LE 4YTPC 3B71A 3L73J 2ITAA 5KKZC 3QH9A 1NTKJ 3GHGC 4H0LD 3Q1MA 4OH8B 3UIAA 3H6PA 1KV4A 5KLVE 1FBMA 1EC5A 3T97B 1G2CA 5AW6B 2DW3A 1OWAA 2NPSC 3GF7A 1JMMA 1JY2N 1GTWA 2BASA 5AW5B 2HPCA 4UB6H 3L73E 4IOIH 2BEZF 2AXCA 2XU6A 1RF0C 1EZVG 1VQ6P 2M8RA 4JYCA 3HUSC 3M06A 3H1JG 2I1JA 3P8MC 1SFCB 3C1LA 1NH4A 2Z5IA 4WY4A 2XV5A 1YJWP 1SQPG 1LTTC 4IFDK 1S5LE 4HJGH 3AE8C 2YNYA 2K3RA 4UB8E 3F89A 1WRGA 1NTZD 4N78D 2CPBA 1JM0A 4D6TG 3KDPB 5CCHA 4OWFA 3H1LG 4KHXA 1SQXK 1A02F 1K9MQ 1BGYD 2XNDH 1RY3A 1IFDA 4IL6E 1OMIA 3RK3C 2JJLA 1H89A 3RBZA 2ZYDA 4L74A 4ZNCA 3H1HG 4CPGA 2FYUE 2WSFJ 3AE7C 1QLED 2E5TA 3M0DA 2OYIB 1A02J 1GL2A 1FU1A 1Q7YQ 2KZJA 5CBNA 1SFCC 1FDMA 1JUNA 1LTAC 1OW7A 3O6QB 4Y99B 2Y9ZA 3CCMP 2WSCH 1Q86Q 1H0TA 1IZNB 3L75D 3TGUG 3OW2O 1DEEG 1PZQA 2KOGA 1SQBE 3MTUE 1KQGB 2HR3A 1EDKA 2IBZD 4NPFX 3GW6A 1GZLA 4BXLA 4EYYQ 2QJPB 3BCCD 3SFDC 2LXBA 5APXA 2A45G 2IFNA 1L0NG 1BE3D 1LTJA 4PD4E 3V2RA 1M1KQ 3H1JD 1KILE 3VMAA 1EQ7A 1FZAA 1M7LA 1GU4A 2P58A 3VP9A 1VQPP 2OYIC 2PAJA 1ZP0C 3HD7B 2A45H 3H32A 3USSA 2JP3A 4Y99C 3W68A 5AVTB 4IFFA 1N73C 3SSUA 3RGUA 2KZIA 1FZGA 1X9VA 3RL0C 1SQXD 1L0LK 5CHXA 2C0XA 1YYCA 3KQGA 1G1JA 2OARA 2QJPC 4GODA 1FDIA 1URQD 2R3SA 2YKQA 1S1CX 1XTCC 3H1IG 2FYZA 1VQ8P 1NGMB 1HVVA 4K3AA 1GK4A 1GK6A 2WQYC 3A0HE 1KORA 1PP9G 1LGHB 2A06E 1FZCB 1KMIZ 1T2KD 5AVWB 1NTKK 3PLNA 2POHA 1LWUB 5B66E 2B88A 3RK3E 2A45I 3IN6A 1S5LX 4ZKUA 1ZR4A 1W2BO 3H1KD 1NHLA 2W6BA 3V2QA 2QE7H 2OTLP 3KYQA 4WVZA 1L4AD 3HTKA 1USDA 3CCVP 2WSEH 4U3FJ 1FAVA 4PV1C 1LTSC 2KNCB 1YITP 3I55P 3CCEP 3G71P 2HFED 4IL6X 3V2NA 3G6EP 1QVFO 1VF5B 1X0TA 4PJ0H 3KPEA 1L0LD 2WSSH 2XDJA 1JY2P 1CW5A 5KJ7C 1URQA 1KFMA 5BU8B 3U1AA 5DJTB 1U57A 1AV1A 2ZYGA 4GOFA 2ZVNB 1IC2A 5TISH 1KTMA 4ASWA 5AW0B 1GW3A 1LWUC 1QL2A 3SWYA 1JY3P 2QIWA 3E7KA 3IFMA 2Z4EA 3L72J 1AFOA 4U3FE 1SQQG 4JF7A 2E74D 2E75B 4RESB 2QM7A 1YI2P 2JWAA 1OZHA 1NU1J 2V7QH 1GDTA 3M0AA 3BATA 1NJIQ 1KYOH 2WZ7A 2HODA 2G8YA 3CWBD
chains in the Genus database with same CATH topology
4W7ZA 1HH0A 2HG5D 1CI6B 2N9BA 1LTIC 3PP5A 3U59A 1MFZA 4W80A 1RE4C 1RF0A 5CCHD 1RE3A 3V4WA 3HUSA 1LT9A 5APQA 3HUSB 1LT9B 2IX7C 2C9LY 4C7RA 1X79B 2NPSD 4C7NA 4C7NB 2ZXEB 3B5NC 1NWQA 2FFDC 2PP6A 1URQC 1HWTC 1KILC 1N7SD 3C9IA 2YKOA 1L4AA 4HYTB 1J1DB 1L4AB 4C46A 3GHGC 3NTNA 1LTGC 5AW1B 4M3LA 2J59M 4OH8B 2Q7CA 3G3ZA 3H6PA 2YKPA 4GIFA 3UIAA 1FJKA 2P2UA 3VYIA 1KZUB 2OYHA 4HH2A 3P8CE 1FBMA 4O9BA 3T97A 3OJAB 5AVSB 4N78E 1M1JA 1G2CA 5AW6B 1M1JB 5AVYB 1T2KC 1OWAA 2P7JA 3EFGA 2NPSC 1H88A 2QM8A 1JMMA 1JY2N 3RL0D 1GTWA 5AVVB 2BASA 4B86A 1FJPA 3BRTB 5AW5B 1IFNA 2HPCA 3U1CA 2YO2A 1IO4A 3VMZA 2C0WA 1MUUA 1XTGB 2FYUK 2XU6A 1RF0C 3M9QA 4LGDE 2Z5HA 1Z56A 2O01H 1RE3C 1JO5A 5AW2B 2M8RA 4JYCA 3HUSC 1LT9C 3M06A 3HD7A 3B5NB 2I1JA 3P8MC 1SFCB 1NH4A 2Z5IA 4WY4A 2XV5A 3E1IA 4WY4B 3L35A 1LTTC 4W7YA 4IFDK 2L5GB 1LTBC 1J1DC 1JY3O 2YNYA 1L4AC 3TK1A 3VOPA 1JOCA 4LLHA 1WRGA 1RF1A 1WT6A 3P8CD 1RF1B 1SQBK 2Q5UA 3V5BA 1JCDA 4N78D 3LIEA 2CPBA 2MJZA 2KSJA 4JYBA 5APWA 2ZFCA 3KDPB 5CCHA 2WPSA 3BASA 2P67A 3N4XA 2R32A 1JTHA 4KHXA 2WTYA 3A5TA 1SQXK 1JTHB 1A02F 1HGVA 3MD0A 3RK2D 1M1JC 2NPSB 1IFMA 1RY3A 1N7SA 1IFDA 1N7SB 3RK3C 2JJLA 1H89A 4I1LA 4AUWA 3MIWA 1IK9A 3A7OA 2WSFH 2VRSA 3NMDA 2FXMA 1JCCA 1OXZA 3V4QA 3M0DA 1HGZA 2OYIA 2OYIB 1A02J 1GL2A 2Q9IA 1FZEA 1T3UA 1FU1A 1S9KE 3HD7C 2WWWA 2R3CA 3NXSA 1CZQA 1SFCC 3M91A 1FDMA 1JUNA 1FZCA 1LTAC 2LKMA 3HE5A 2HYNA 3R2PA 1PFIA 3HE5B 4Y99B 5CCGD 4WY4C 4XA4A 2C9NY 4N6JA 1N73A 2O1JA 2WSCH 3HRNA 2JEEA 3CL3D 2KOGA 3MTUE 1GU5A 5AVZB 1RF1C 1N86A 1GL2D 5BU5A 1DH3A 2E42A 5APSA 1HTLC 2OYHB 1CSBA 4AYCA 5CCHC 5AVUB 2IPPA 1G2CB 1SP4A 1GZLA 2P1JA 3OA7A 5KJ7D 3M9BA 1FZBA 4EIJA 3RK3B 1NO4A 1N7SC 5APXA 3A3YB 2A45G 2IFNA 3MUDA 1LTJA 3V2RA 3VN0A 2HPCB 1LTJB 2N1TD 2O1KA 1S9KD 5AVRB 3WMM0 4IFMA 1VDFA 1EQ7A 1SLQA 1G1IA 1JY2O 1FZAA 2YO3A 2XNXA 1M7LA 2J58A 1JNMA 2M3BA 3VP9A 1GU4A 3M0DC 2OYIC 2PAJA 3HD7B 2A45H 2WPRA 3H32A 3H32B 1DEBA 1FZCC 3VTPC 4Y99C 5KTBA 1GD2E 3RK2B 3TNUA 1IJDB 4DZOA 3TNUB 5AVTB 3CI9A 4IFFA 1N73C 2XZRA 1J1EB 1ZR2A 3TYYA 5APTA 1AQ5A 2KP8A 2XKMA 1FZGA 1X9VA 3RL0C 2GUVA 1N7LA 1MZ9A 1L0LK 5CHXA 5AW9B 3LW5H 4LC1A 2OYHC 3NFQA 2C0XA 1YYCA 1YTZT 3L4FA 3KQGA 5AVXB 1G1JA 2OARA 4ZKPA 1NU1K 3L37A 3B5ND 5AW8B 5APVA 1URQD 1KILD 4N3YB 2YKQA 3II6A 5CCGA 1XTCC 1N2DC 1SQQK 1FZFA 1NTMK 2FYZA 1HBWA 1LTJC 1NTZK 3L36A 2W6AA 2H7HA 1HVVA 1ZLLA 1GK4A 3EQ2A 1GK6A 1GL2B 2WITA 3CLQA 3LIDA 1CI6A 1E5WA 1LGHB 2H43A 1FZCB 1NOHA 1T8ZA 3V2PA 1NAFA 5CMZA 3RK2C 1MV8A 1VPCA 1N73B 2KYVA 5KJ7A 1T2KD 3MGNA 2FKWB 1ZN5A 5AVWB 1J1EC 3RL0B 2KB7P 3TSIA 1NTKK 3P7KA 5AVQB 3BRVB 1SVFA 2N1TA 2POHA 1HUCA 2N1TB 1LWUA 4I6MC 1FOSF 1LWUB 1IFIA 5AW3B 2A45I 4ZKUA 1ZR4A 2R5DA 1NKNA 5CJ0A 2CPSA 3B8EB 4WBAA 3P32A 1GW4A 1NHLA 4I2LC 2W6BA 3V2QA 5CCGC 2HLOA 3KYQA 3VP8A 5CJ4A 5APYA 1SQVK 3N7NA 1L4AD 2WT7A 2WT7B 3HTKA 2WSEH 3OAKA 1FAVA 3HTKB 1GL2C 1LTSC 3HE4A 3HE4B 5AW7B 1RE4A 2HFED 2W27A 1L0NK 1T3JA 3V2NA 2R5BA 3IR9A 5AW4B 3KPEA 3M9HA 2XDJA 1JY2P 3SWFA 1CW5A 3B5NA 5KJ7C 2FFDA 3VMYA 1JY3N 1URQA 1KILA 2FFDB 1URQB 1KILB 1KFMA 1SFCA 5BU8B 3U1AA 1X8YA 3RK3D 2YMYA 1NKZB 2Q3IA 1J2JB 2H8PD 4EOTA 1IC2A 2KLVA 1ZV8A 2N1TC 1SQPK 4GT1A 5AW0B 1DX7A 3O8ZA 1GW3A 1LWUC 1QL2A 1W2EA 3A2AA 1JY3P 3SWYA 3GHGA 3GHGB 1KFNA 2GM4A 4AQRD 1HJBA 1IFJA 3IFMA 4GKGA 4DOJA 2Z4EA 1FOSE 2I1KA 4WB4A 1YTZI 3HD7D 3I5CA 5APUA 1AFOA 1SFCD 5KLVK 4JF7A 2IFMA 4RESB 1QL1A 2QM7A 3BVHA 2E43A 4XE5B 4WY4D 2GUSA 1KQLA 1H8AA 1GDTA 2NPSA 3VMXA 2WPQA 3M0AA 3BATA 2WZ7A 2HODA 2HODB 5BVZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4W7Z A;  2HG5 D;  3PP5 A;  3M0D C;  4W80 A;  3HD7 B;  5CCH D;  5CCH A;  1JTH A;  1JTH B;  2NPS D;  3RK2 D;  2NPS B;  3B5N C;  2PP6 A;  3RK2 B;  1NHL A;  1URQ C;  1KIL C;  1N7S D;  5CCG C;  1N7S A;  1N7S B;  3KYQ A;  3RK3 C;  1L4A D;  1L4A A;  3RL0 C;  1L4A B;  3HTK B;  1GL2 C;  4OH8 B;  2HFE D;  1GL2 A;  1T3J A;  3HD7 C;  3P8C E;  1SFC C;  2XDJ A;  4N78 E;  3B5N D;  3B5N A;  1URQ D;  5KJ7 C;  1KIL D;  1URQ A;  1KIL A;  5CCG D;  4WY4 C;  1URQ B;  5CCG A;  1KIL B;  1SFC A;  2NPS C;  3RK3 D;  2YMY A;  2H8P D;  3RL0 D;  2KOG A;  2N1T C;  1GL2 D;  1HVV A;  1GL2 B;  1XTG B;  4LGD E;  5CCH C;  2M8R A;  3HD7 D;  3HD7 A;  3B5N B;  1SFC D;  4JF7 A;  1SFC B;  5KJ7 D;  3RK2 C;  5KJ7 A;  4WY4 D;  4WY4 A;  3RK3 B;  1N7S C;  4WY4 B;  2NPS A;  3RL0 B;  3TSI A;  4W7Y A;  2WZ7 A;  1L4A C;  2N1T D;  3VOP A;  2N1T A;  2N1T B; 
#chains in the Genus database with same CATH topology
 3TF5 A;  2HG5 D;  1NTM J;  3L71 G;  3H1L J;  1KC8 Q;  1Y9B A;  4I7Z B;  1NTK D;  1OW6 A;  1VF5 C;  1LT9 A;  5APQ A;  2C9L Y;  1PV3 A;  1X79 B;  1EZV E;  2AXT H;  4C7N B;  2QA4 P;  3C9I A;  3L72 E;  1S2E A;  1N8R Q;  2YKO A;  1L4A A;  1J1D B;  3WU2 H;  4C46 A;  1OW8 A;  4M3L A;  2J59 M;  2Q7C A;  3G3Z A;  2H89 C;  1HJ0 A;  1FS0 E;  3VYI A;  4HH2 A;  4O9B A;  1NTM E;  2KLU A;  2E75 C;  1SQV G;  3H1L E;  4YPC A;  2PRR A;  3EFG A;  2QM8 A;  5GTH H;  1JEK A;  4EDF A;  2IDB A;  1IFN A;  3Q5R A;  4I7Z C;  3H1H E;  5H2F H;  3A0B H;  1MUU A;  3M9Q A;  4LGD E;  2O01 H;  1JO5 A;  3B5N B;  1L0N J;  1E79 H;  5E79 H;  2K88 A;  2AEF A;  5KKZ B;  2KI7 B;  3E1I A;  4WY4 B;  5B5E E;  1HF9 A;  1PGP A;  1KYO I;  2FXO A;  2L5G B;  1LTB C;  1J1D C;  1KYO D;  3PJS K;  1S3J A;  3TGU E;  1RF1 A;  1WT6 A;  3P8C D;  2Q3E A;  4H13 B;  2Q5U A;  3MZW B;  3LIE A;  2D2C C;  4JYB A;  5APW A;  2ZFC A;  3BAS A;  1NTZ G;  3S4R A;  1JTH A;  2WTY A;  3A5T A;  2BCC D;  3MD0 A;  3RK2 D;  2NPS B;  3L71 D;  2ZXX A;  5KLV J;  1BGY G;  3PRJ A;  1L0N E;  3NMD A;  2FXM A;  1OXZ A;  3V4Q A;  1EDJ A;  1BCC D;  4H0L B;  1PGQ A;  3EFF K;  2K37 A;  2IYP A;  2QG4 A;  1S9K E;  3H1I J;  2E5Y A;  3M91 A;  2LKM A;  2HYN A;  4WY4 C;  4XA4 A;  2C9N Y;  2B87 A;  2PFX A;  4WWI A;  3CL3 D;  2KK7 A;  1GU5 A;  4BRY A;  4H13 C;  1GL2 D;  5BU5 A;  3L75 G;  1PP9 J;  3AE1 C;  1SQV D;  1M90 Q;  1HTL C;  2OYH B;  1PIX A;  5C39 A;  5CCH C;  3AEC C;  2IBZ G;  1SP4 A;  4H44 D;  2K1A A;  2FYN B;  4KT0 J;  1FZB A;  3Q5S A;  3RK3 B;  3CCQ P;  3BCC G;  1U7J A;  1PPJ D;  3AEE C;  3H1I E;  1LTJ B;  3CXH H;  2O1K A;  5AVR B;  1T6A A;  3CCU P;  1QX8 A;  1Q2N A;  1BE3 G;  2L91 A;  3CCJ P;  1YBK A;  1G1I A;  2FY8 A;  4H0L C;  1KN7 A;  3CMA P;  3M0D C;  3KZI H;  1IFP A;  3ABV C;  3H32 B;  2FYU J;  1PP9 E;  1QEX A;  3VTP C;  5KTB A;  3CI9 A;  1VQO P;  1J1E B;  3SWK A;  1ZR2 A;  3W67 A;  3TYY A;  2XKM A;  1N7L A;  1MZ9 A;  1LT1 A;  1QVG O;  2W83 C;  3LW5 H;  2OYH C;  1SQX G;  5GTI E;  2CK3 H;  1SQB J;  4JPZ B;  2FYN C;  1NU1 K;  3L37 A;  5K5G B;  4EI2 A;  5AW8 B;  4N3Y B;  3L70 D;  1N2D C;  2OQQ A;  1YQ4 C;  1NTM K;  1HBW A;  1LTJ C;  2RH0 A;  1RH5 B;  3E1R A;  1PGJ A;  3EQ2 A;  3LID A;  1CI6 A;  4TLF A;  1E5W A;  2H43 A;  1YQ3 C;  1NOH A;  2WPV B;  1T8Z A;  1N73 B;  5TIS E;  2FKW B;  1ZN5 A;  2K9J A;  2QVA A;  1J1E C;  3RL0 B;  1P84 D;  5AVQ B;  2IBZ I;  3CXH I;  1SVF A;  1HUC A;  3CXH D;  4JBZ A;  4I6M C;  1IFI A;  1ZRT E;  4QMA A;  1OVV A;  3CCR P;  5CJ0 A;  2MKV A;  2ZT9 D;  4I2L C;  1SQQ E;  2Q1K A;  3H1K G;  5APY A;  2WT7 A;  3OAK A;  3HTK B;  3IAO A;  2JO1 A;  1L2P A;  1EDI A;  1L0N K;  3IF4 A;  3AEA C;  2R5B A;  5DJU B;  1PGO A;  1KQF B;  3SWF A;  2FFD A;  3WU2 E;  1URQ B;  4OGQ D;  1SFC A;  1L0L G;  2YMY A;  2H8P D;  1VQK P;  3RL0 g;  1NU1 D;  2KLV A;  3O8Z A;  3A2A A;  1KFN A;  2UWJ E;  1IFJ A;  2I1K A;  4WB4 A;  1NYH A;  1YTZ I;  3HD7 D;  3I5C A;  5KLV K;  3BVH A;  2E43 A;  2QSI A;  2G3A A;  4R4M A;  3VMX A;  4L75 A;  4ASV A;  5H2F E;  2E76 D;  4PV1 B;  2HOD B;  3L74 D;  5BVZ A;  1K04 A;  2N9B A;  3PP5 A;  1NTZ J;  3D6Z A;  1GMJ A;  1MFZ A;  3L73 G;  1KB9 D;  1YJN P;  3CWB G;  1VQL P;  5E79 E;  2WVR A;  3FGA D;  1RE3 A;  1Y8A A;  1JB0 J;  1ZOY C;  3GLM A;  5EFW B;  1LT9 B;  1NTK G;  1ZW0 A;  1BGY J;  2ZXE B;  4HB1 A;  1URQ C;  1N7S D;  4GDO A;  1L4A B;  4KJM A;  1LTG C;  5AW1 B;  4GIF A;  1FJK A;  3CX5 D;  2P2U A;  1S5L H;  1NAY A;  4UB8 H;  1KD1 Q;  1NTZ E;  4N78 E;  1VL2 A;  1M1J A;  3AE4 C;  3R4Y A;  1T2K C;  1H88 A;  2KS1 A;  1BDD A;  3L75 J;  2QEX P;  1BGY E;  1S72 P;  3BRT B;  2ZAE B;  2FYU K;  1Z56 A;  3AEF C;  4IL6 H;  5AW2 B;  1Q90 D;  1LT9 C;  3HD7 A;  3FX0 A;  2E74 B;  3Q2Y A;  1Q82 Q;  3PTZ A;  3L35 A;  3AED C;  2B89 A;  1BE3 J;  4JQ0 D;  1JY3 O;  1L4A C;  4HKZ H;  3CPW O;  1JOC A;  3H1J J;  4LLH A;  5KLV D;  1RF1 B;  1SQB K;  3C8V A;  3V5B A;  1OX3 A;  2Y0D A;  3L75 E;  1SQP J;  3PH0 A;  2WPS A;  2P67 A;  3MP7 B;  2R32 A;  1JTH B;  1LJ2 A;  1HGV A;  3JCU H;  3AE2 C;  2IBZ E;  4UB6 E;  1N7S A;  2BCC G;  3L73 D;  1TU3 F;  4D6T J;  1YHQ P;  3BCC E;  4I1L A;  4AUW A;  1SQX J;  3MIW A;  2WSF H;  1DIP A;  1JCC A;  1OVR A;  2IZ1 A;  1HGZ A;  1BE3 E;  3V6I A;  1FZE A;  4L73 A;  3D6Y A;  3H1J E;  4PD4 H;  2WWW A;  1BCC G;  1RHZ B;  4R4L A;  1FZC A;  3H1H J;  2E74 C;  3HE5 A;  3R2P A;  4ZMD A;  2JR8 A;  5CCG D;  1SQP E;  2B87 B;  3HRN A;  3AE3 C;  2JEE A;  2WSC J;  2P10 A;  2M5A A;  5AVZ B;  1RF1 C;  4BRY B;  2D2C B;  1DH3 A;  5APS A;  1OFC X;  4Z1M H;  4D6T E;  1CSB A;  4AYC A;  1VQM P;  1SQX E;  3MHV A;  1JMB A;  3TGU J;  1G2C B;  2WMM A;  2P1J A;  3OA7 A;  3RBX A;  3KHU A;  1LNQ A;  1PL5 A;  4EIJ A;  2FYU D;  3A3Y B;  3MUD A;  2HPC B;  2N1T D;  4RJT A;  1PPJ G;  2Y9Y A;  1VDF A;  1SLQ A;  1VQ7 P;  2XNX A;  1JNM A;  3S9O A;  2M3B A;  1OIP A;  3FWN A;  2WPR A;  3SFE C;  2FBW C;  2OGU A;  1SQB D;  3RK2 B;  3TNU A;  3A0H H;  1FE6 A;  1UII A;  2XZR A;  1DD4 A;  4TT3 H;  1AQ5 A;  4YXW H;  3CC4 P;  1R5L A;  3GG2 A;  3NFQ A;  1YTZ T;  3L4F A;  1IK7 A;  3I56 P;  3JC2 2;  4PD4 I;  5M1B A;  4ZKP A;  2FXP A;  4PD4 D;  1KQS O;  1Q81 Q;  3B5N D;  1KIL D;  3II6 A;  5CCG A;  1WMK A;  2LXC B;  2NZ2 A;  1NTZ K;  3L36 A;  3L70 G;  2YXR B;  2W6A A;  2GA1 A;  2O3J A;  1GL2 B;  2QJY B;  2YIU C;  2WIT A;  3CLQ A;  3K5B A;  5TJH A;  1LP1 A;  1MKM A;  4GOE A;  1OVU A;  3V2P A;  4H44 B;  3RK2 C;  2KYV A;  1H0T B;  1NVO A;  1R8E A;  2K9J B;  2KB7 P;  3TSI A;  3P7K A;  2N1T A;  3S1K A;  3CWB J;  2CPS A;  3B8E B;  4U3F G;  1P84 H;  1GW4 A;  3QWO C;  3VP8 A;  5CJ4 A;  5L8R J;  2WT7 B;  2A06 D;  1GL2 C;  2QJY C;  2WSE J;  3HE4 A;  1RE4 A;  3CCS P;  3Q3D A;  1T3J A;  2K9Y A;  3CWB E;  2SPZ A;  3IR9 A;  4H44 C;  5AW4 B;  3B5N A;  4BWN A;  1JY3 N;  1KIL A;  2FFD B;  1NTK E;  1AA0 A;  1S4X A;  3RK3 D;  1EXI A;  3L72 G;  1NKZ B;  1J2J B;  3GMA A;  1SQP K;  1DX7 A;  1W2E A;  3GHG A;  2GM4 A;  1NU1 G;  1D7M A;  2H88 C;  5APU A;  2R44 A;  1SFC D;  1NTM G;  2IFM A;  2N9Y B;  3FXD A;  4XE5 B;  3WUV A;  1KQL A;  4YXD C;  4A7P A;  2NPS A;  2WPQ A;  4K35 A;  2V7Q J;  1Y47 A;  4L76 A;  4PJ0 E;  1SQQ J;  1LTI C;  4OVN F;  3L74 G;  4W80 A;  1RF0 A;  2M0B A;  3TDK A;  3V4W A;  1YIJ P;  3HUS A;  3H25 A;  2BCC J;  1P84 I;  3D70 A;  3CD6 P;  2FFD C;  2ZT9 B;  1M56 D;  3L71 J;  3D71 A;  4DCK A;  4HYT B;  1K8A Q;  1KB9 H;  2BEQ D;  4U3F D;  3ITK A;  3NTN A;  1YJ9 P;  3JCU E;  1BCC J;  2YKP A;  5B5E H;  1KYO E;  1KZU B;  2OYH A;  5KLI B;  3P8C E;  3T97 A;  3OJA B;  3G4S P;  1RQU A;  5AVS B;  2KXP B;  2QRX A;  1M1J B;  5AVY B;  2P7J A;  4OGQ B;  2KS1 B;  1ZME C;  2BCC E;  3RL0 D;  5AVV B;  4B86 A;  1FJP A;  1EZV I;  2AXT E;  3CX5 H;  5KAF H;  1EXJ A;  1BSN A;  4Y28 J;  1EZV D;  1SQV J;  2YO2 A;  3L71 E;  5KAI H;  3U1C A;  3CC7 P;  1IO4 A;  3VMZ A;  2C0W A;  1XTG B;  1FDO A;  2Z5H A;  1RE3 C;  3AE6 C;  3JSV C;  2O01 J;  3L72 D;  2B9B A;  1SQP D;  2AEJ A;  1QGK B;  2ZT9 C;  1BCC E;  2OTK E;  4RO0 A;  4W7Y A;  1X22 A;  3KXD A;  3ZDM A;  3TK1 A;  3VOP A;  2E76 B;  2LR2 A;  4D6T D;  2RN0 A;  1NTM D;  1JCD A;  1AVY A;  2OTJ P;  3H1L D;  2RKL A;  2MJZ A;  1U7M A;  5KLV G;  5GTH E;  2KSJ A;  5KLI C;  3N4X A;  1SQV E;  2JWD A;  1M1J C;  2YXQ B;  1IFM A;  3A0B E;  4OGQ C;  3F5H A;  1N7S B;  4RKU J;  3H1H D;  5CBO A;  2M3E A;  1KB9 I;  3CME P;  1IK9 A;  3A7O A;  2VRS A;  1R5S A;  2W8Z A;  1PPJ E;  4DT0 A;  2OYI A;  2Q9I A;  1T3U A;  3WUT A;  3HD7 C;  2R3C A;  3FXE A;  3NXS A;  1CZQ A;  2JKV A;  1MFT A;  3O6Q A;  3TGU D;  1PFI A;  3L70 J;  3HE5 B;  1DD3 A;  4N6J A;  1N73 A;  2O1J A;  2PGD A;  2OYO A;  3PHL A;  2E76 C;  2M5A B;  1N86 A;  3CX5 I;  4PV1 D;  2JDI H;  2E42 A;  3Q5P A;  1AVO A;  2J5U A;  1SS1 A;  5AVU B;  2IPP A;  2IZ0 A;  1L0N D;  5KJ7 D;  3M9B A;  1RQV A;  1NO4 A;  1N7S C;  2V4H A;  4DJG A;  1W5C E;  5GTI H;  3CC2 P;  3VN0 A;  2FYU G;  2IYO A;  1S9K D;  3L70 E;  3WMM 0;  4IFM A;  1JY2 O;  2YO3 A;  2J58 A;  4U7J A;  3BCC J;  2ZJS E;  3WUU A;  1AQT A;  1DEB A;  3B4S A;  3AE9 C;  1FZC C;  2Q6Q A;  1GD2 E;  1IJD B;  4DZO A;  1VQ4 P;  3TNU B;  1SQB G;  5APT A;  2KP8 A;  2Y0C A;  1VQN P;  2GUV A;  4NPE A;  5AW9 B;  1M8O B;  4LC1 A;  3LW5 J;  1P84 E;  1USE A;  5AVX B;  1VF5 D;  3CXH E;  3H1I D;  1M57 D;  5APV A;  2KIK A;  3KZI E;  1SQQ K;  1FZF A;  2QJK B;  3MUD C;  2H7H A;  1ZLL A;  2W90 A;  1PP9 D;  1AJY A;  1BDC A;  1LP1 B;  2E75 D;  1NAF A;  5CMZ A;  1K05 A;  1MV8 A;  1VPC A;  5KJ7 A;  3MGN A;  1VQ5 P;  2ZYA A;  1EDL A;  2I8D A;  1FC2 C;  3BRV B;  3L74 J;  2N1T B;  2KUB A;  1LWU A;  1FOS F;  3AEG C;  5AW3 B;  1NU1 E;  2R5D A;  1NKN A;  1UIX A;  4WBA A;  2W6J H;  3P32 A;  4XFJ A;  2YMK A;  2O01 N;  5CCG C;  2HLO A;  2QJK C;  1SQV K;  3N7N A;  1ZXG A;  3G9R A;  2YIU B;  2KNC A;  2RMZ A;  3CCL P;  3HE4 B;  2D2C D;  5AW7 B;  2A06 G;  2KSE A;  2W27 A;  2Y0E A;  1BSH A;  3H1K J;  3L74 E;  3M9H A;  1KB9 E;  2AEM A;  3VMY A;  1KIL B;  4MN4 C;  1X8Y A;  1ZRT D;  2Q3I A;  4EOT A;  1ZV8 A;  2N1T C;  4GT1 A;  2ZVO B;  3GF3 A;  3GHG B;  3FWL A;  4AQR D;  1HJB A;  4GKG A;  1SQQ D;  4DOJ A;  3AEB C;  1L0L J;  1FOS E;  5B66 H;  2NRG A;  1QL1 A;  4WY4 D;  2GUS A;  1H8A A;  3CX5 E;  5KAF E;  3H1K E;  5KAI E;  1K73 Q;  4H13 D;  4W7Z A;  1HH0 A;  1CI6 B;  3AE5 C;  4NPD A;  3U59 A;  1RE4 C;  5CCH D;  3HUS B;  2IX7 C;  4C7R A;  2NPS D;  4C7N A;  3B5N C;  1NWQ A;  2PP6 A;  1VQ9 P;  1HWT C;  1KIL C;  3EWK A;  1L0L E;  4YTP C;  3B71 A;  3L73 J;  2ITA A;  5KKZ C;  3QH9 A;  1NTK J;  3GHG C;  4H0L D;  3Q1M A;  4OH8 B;  3UIA A;  3H6P A;  1KV4 A;  5KLV E;  1FBM A;  1EC5 A;  3T97 B;  1G2C A;  5AW6 B;  2DW3 A;  1OWA A;  2NPS C;  3GF7 A;  1JMM A;  1JY2 N;  1GTW A;  2BAS A;  5AW5 B;  2HPC A;  4UB6 H;  3L73 E;  4IOI H;  2BEZ F;  2AXC A;  2XU6 A;  1RF0 C;  1EZV G;  1VQ6 P;  2M8R A;  4JYC A;  3HUS C;  3M06 A;  3H1J G;  2I1J A;  3P8M C;  1SFC B;  3C1L A;  1NH4 A;  2Z5I A;  4WY4 A;  2XV5 A;  1YJW P;  1SQP G;  1LTT C;  4IFD K;  1S5L E;  4HJG H;  3AE8 C;  2YNY A;  2K3R A;  4UB8 E;  3F89 A;  1WRG A;  1NTZ D;  4N78 D;  2CPB A;  1JM0 A;  4D6T G;  3KDP B;  5CCH A;  4OWF A;  3H1L G;  4KHX A;  1SQX K;  1A02 F;  1K9M Q;  1BGY D;  2XND H;  1RY3 A;  1IFD A;  4IL6 E;  1OMI A;  3RK3 C;  2JJL A;  1H89 A;  3RBZ A;  2ZYD A;  4L74 A;  4ZNC A;  3H1H G;  4CPG A;  2FYU E;  2WSF J;  3AE7 C;  1QLE D;  2E5T A;  3M0D A;  2OYI B;  1A02 J;  1GL2 A;  1FU1 A;  1Q7Y Q;  2KZJ A;  5CBN A;  1SFC C;  1FDM A;  1JUN A;  1LTA C;  1OW7 A;  3O6Q B;  4Y99 B;  2Y9Z A;  3CCM P;  2WSC H;  1Q86 Q;  1H0T A;  1IZN B;  3L75 D;  3TGU G;  3OW2 O;  1DEE G;  1PZQ A;  2KOG A;  1SQB E;  3MTU E;  1KQG B;  2HR3 A;  1EDK A;  2IBZ D;  4NPF X;  3GW6 A;  1GZL A;  4BXL A;  4EYY Q;  2QJP B;  3BCC D;  3SFD C;  2LXB A;  5APX A;  2A45 G;  2IFN A;  1L0N G;  1BE3 D;  1LTJ A;  4PD4 E;  3V2R A;  1M1K Q;  3H1J D;  1KIL E;  3VMA A;  1EQ7 A;  1FZA A;  1M7L A;  1GU4 A;  2P58 A;  3VP9 A;  1VQP P;  2OYI C;  2PAJ A;  1ZP0 C;  3HD7 B;  2A45 H;  3H32 A;  3USS A;  2JP3 A;  4Y99 C;  3W68 A;  5AVT B;  4IFF A;  1N73 C;  3SSU A;  3RGU A;  2KZI A;  1FZG A;  1X9V A;  3RL0 C;  1SQX D;  1L0L K;  5CHX A;  2C0X A;  1YYC A;  3KQG A;  1G1J A;  2OAR A;  2QJP C;  4GOD A;  1FDI A;  1URQ D;  2R3S A;  2YKQ A;  1S1C X;  1XTC C;  3H1I G;  2FYZ A;  1VQ8 P;  1NGM B;  1HVV A;  4K3A A;  1GK4 A;  1GK6 A;  2WQY C;  3A0H E;  1KOR A;  1PP9 G;  1LGH B;  2A06 E;  1FZC B;  1KMI Z;  1T2K D;  5AVW B;  1NTK K;  3PLN A;  2POH A;  1LWU B;  5B66 E;  2B88 A;  3RK3 E;  2A45 I;  3IN6 A;  1S5L X;  4ZKU A;  1ZR4 A;  1W2B O;  3H1K D;  1NHL A;  2W6B A;  3V2Q A;  2QE7 H;  2OTL P;  3KYQ A;  4WVZ A;  1L4A D;  3HTK A;  1USD A;  3CCV P;  2WSE H;  4U3F J;  1FAV A;  4PV1 C;  1LTS C;  2KNC B;  1YIT P;  3I55 P;  3CCE P;  3G71 P;  2HFE D;  4IL6 X;  3V2N A;  3G6E P;  1QVF O;  1VF5 B;  1X0T A;  4PJ0 H;  3KPE A;  1L0L D;  2WSS H;  2XDJ A;  1JY2 P;  1CW5 A;  5KJ7 C;  1URQ A;  1KFM A;  5BU8 B;  3U1A A;  5DJT B;  1U57 A;  1AV1 A;  2ZYG A;  4GOF A;  2ZVN B;  1IC2 A;  5TIS H;  1KTM A;  4ASW A;  5AW0 B;  1GW3 A;  1LWU C;  1QL2 A;  3SWY A;  1JY3 P;  2QIW A;  3E7K A;  3IFM A;  2Z4E A;  3L72 J;  1AFO A;  4U3F E;  1SQQ G;  4JF7 A;  2E74 D;  2E75 B;  4RES B;  2QM7 A;  1YI2 P;  2JWA A;  1OZH A;  1NU1 J;  2V7Q H;  1GDT A;  3M0A A;  3BAT A;  1NJI Q;  1KYO H;  2WZ7 A;  2HOD A;  2G8Y A;  3CWB D; 
#chains in the Genus database with same CATH homology
 4W7Z A;  1HH0 A;  2HG5 D;  1CI6 B;  2N9B A;  1LTI C;  3PP5 A;  3U59 A;  1MFZ A;  4W80 A;  1RE4 C;  1RF0 A;  5CCH D;  1RE3 A;  3V4W A;  3HUS A;  1LT9 A;  5APQ A;  3HUS B;  1LT9 B;  2IX7 C;  2C9L Y;  4C7R A;  1X79 B;  2NPS D;  4C7N A;  4C7N B;  2ZXE B;  3B5N C;  1NWQ A;  2FFD C;  2PP6 A;  1URQ C;  1HWT C;  1KIL C;  1N7S D;  3C9I A;  2YKO A;  1L4A A;  4HYT B;  1J1D B;  1L4A B;  4C46 A;  3GHG C;  3NTN A;  1LTG C;  5AW1 B;  4M3L A;  2J59 M;  4OH8 B;  2Q7C A;  3G3Z A;  3H6P A;  2YKP A;  4GIF A;  3UIA A;  1FJK A;  2P2U A;  3VYI A;  1KZU B;  2OYH A;  4HH2 A;  3P8C E;  1FBM A;  4O9B A;  3T97 A;  3OJA B;  5AVS B;  4N78 E;  1M1J A;  1G2C A;  5AW6 B;  1M1J B;  5AVY B;  1T2K C;  1OWA A;  2P7J A;  3EFG A;  2NPS C;  1H88 A;  2QM8 A;  1JMM A;  1JY2 N;  3RL0 D;  1GTW A;  5AVV B;  2BAS A;  4B86 A;  1FJP A;  3BRT B;  5AW5 B;  1IFN A;  2HPC A;  3U1C A;  2YO2 A;  1IO4 A;  3VMZ A;  2C0W A;  1MUU A;  1XTG B;  2FYU K;  2XU6 A;  1RF0 C;  3M9Q A;  4LGD E;  2Z5H A;  1Z56 A;  2O01 H;  1RE3 C;  1JO5 A;  5AW2 B;  2M8R A;  4JYC A;  3HUS C;  1LT9 C;  3M06 A;  3HD7 A;  3B5N B;  2I1J A;  3P8M C;  1SFC B;  1NH4 A;  2Z5I A;  4WY4 A;  2XV5 A;  3E1I A;  4WY4 B;  3L35 A;  1LTT C;  4W7Y A;  4IFD K;  2L5G B;  1LTB C;  1J1D C;  1JY3 O;  2YNY A;  1L4A C;  3TK1 A;  3VOP A;  1JOC A;  4LLH A;  1WRG A;  1RF1 A;  1WT6 A;  3P8C D;  1RF1 B;  1SQB K;  2Q5U A;  3V5B A;  1JCD A;  4N78 D;  3LIE A;  2CPB A;  2MJZ A;  2KSJ A;  4JYB A;  5APW A;  2ZFC A;  3KDP B;  5CCH A;  2WPS A;  3BAS A;  2P67 A;  3N4X A;  2R32 A;  1JTH A;  4KHX A;  2WTY A;  3A5T A;  1SQX K;  1JTH B;  1A02 F;  1HGV A;  3MD0 A;  3RK2 D;  1M1J C;  2NPS B;  1IFM A;  1RY3 A;  1N7S A;  1IFD A;  1N7S B;  3RK3 C;  2JJL A;  1H89 A;  4I1L A;  4AUW A;  3MIW A;  1IK9 A;  3A7O A;  2WSF H;  2VRS A;  3NMD A;  2FXM A;  1JCC A;  1OXZ A;  3V4Q A;  3M0D A;  1HGZ A;  2OYI A;  2OYI B;  1A02 J;  1GL2 A;  2Q9I A;  1FZE A;  1T3U A;  1FU1 A;  1S9K E;  3HD7 C;  2WWW A;  2R3C A;  3NXS A;  1CZQ A;  1SFC C;  3M91 A;  1FDM A;  1JUN A;  1FZC A;  1LTA C;  2LKM A;  3HE5 A;  2HYN A;  3R2P A;  1PFI A;  3HE5 B;  4Y99 B;  5CCG D;  4WY4 C;  4XA4 A;  2C9N Y;  4N6J A;  1N73 A;  2O1J A;  2WSC H;  3HRN A;  2JEE A;  3CL3 D;  2KOG A;  3MTU E;  1GU5 A;  5AVZ B;  1RF1 C;  1N86 A;  1GL2 D;  5BU5 A;  1DH3 A;  2E42 A;  5APS A;  1HTL C;  2OYH B;  1CSB A;  4AYC A;  5CCH C;  5AVU B;  2IPP A;  1G2C B;  1SP4 A;  1GZL A;  2P1J A;  3OA7 A;  5KJ7 D;  3M9B A;  1FZB A;  4EIJ A;  3RK3 B;  1NO4 A;  1N7S C;  5APX A;  3A3Y B;  2A45 G;  2IFN A;  3MUD A;  1LTJ A;  3V2R A;  3VN0 A;  2HPC B;  1LTJ B;  2N1T D;  2O1K A;  1S9K D;  5AVR B;  3WMM 0;  4IFM A;  1VDF A;  1EQ7 A;  1SLQ A;  1G1I A;  1JY2 O;  1FZA A;  2YO3 A;  2XNX A;  1M7L A;  2J58 A;  1JNM A;  2M3B A;  3VP9 A;  1GU4 A;  3M0D C;  2OYI C;  2PAJ A;  3HD7 B;  2A45 H;  2WPR A;  3H32 A;  3H32 B;  1DEB A;  1FZC C;  3VTP C;  4Y99 C;  5KTB A;  1GD2 E;  3RK2 B;  3TNU A;  1IJD B;  4DZO A;  3TNU B;  5AVT B;  3CI9 A;  4IFF A;  1N73 C;  2XZR A;  1J1E B;  1ZR2 A;  3TYY A;  5APT A;  1AQ5 A;  2KP8 A;  2XKM A;  1FZG A;  1X9V A;  3RL0 C;  2GUV A;  1N7L A;  1MZ9 A;  1L0L K;  5CHX A;  5AW9 B;  3LW5 H;  4LC1 A;  2OYH C;  3NFQ A;  2C0X A;  1YYC A;  1YTZ T;  3L4F A;  3KQG A;  5AVX B;  1G1J A;  2OAR A;  4ZKP A;  1NU1 K;  3L37 A;  3B5N D;  5AW8 B;  5APV A;  1URQ D;  1KIL D;  4N3Y B;  2YKQ A;  3II6 A;  5CCG A;  1XTC C;  1N2D C;  1SQQ K;  1FZF A;  1NTM K;  2FYZ A;  1HBW A;  1LTJ C;  1NTZ K;  3L36 A;  2W6A A;  2H7H A;  1HVV A;  1ZLL A;  1GK4 A;  3EQ2 A;  1GK6 A;  1GL2 B;  2WIT A;  3CLQ A;  3LID A;  1CI6 A;  1E5W A;  1LGH B;  2H43 A;  1FZC B;  1NOH A;  1T8Z A;  3V2P A;  1NAF A;  5CMZ A;  3RK2 C;  1MV8 A;  1VPC A;  1N73 B;  2KYV A;  5KJ7 A;  1T2K D;  3MGN A;  2FKW B;  1ZN5 A;  5AVW B;  1J1E C;  3RL0 B;  2KB7 P;  3TSI A;  1NTK K;  3P7K A;  5AVQ B;  3BRV B;  1SVF A;  2N1T A;  2POH A;  1HUC A;  2N1T B;  1LWU A;  4I6M C;  1FOS F;  1LWU B;  1IFI A;  5AW3 B;  2A45 I;  4ZKU A;  1ZR4 A;  2R5D A;  1NKN A;  5CJ0 A;  2CPS A;  3B8E B;  4WBA A;  3P32 A;  1GW4 A;  1NHL A;  4I2L C;  2W6B A;  3V2Q A;  5CCG C;  2HLO A;  3KYQ A;  3VP8 A;  5CJ4 A;  5APY A;  1SQV K;  3N7N A;  1L4A D;  2WT7 A;  2WT7 B;  3HTK A;  2WSE H;  3OAK A;  1FAV A;  3HTK B;  1GL2 C;  1LTS C;  3HE4 A;  3HE4 B;  5AW7 B;  1RE4 A;  2HFE D;  2W27 A;  1L0N K;  1T3J A;  3V2N A;  2R5B A;  3IR9 A;  5AW4 B;  3KPE A;  3M9H A;  2XDJ A;  1JY2 P;  3SWF A;  1CW5 A;  3B5N A;  5KJ7 C;  2FFD A;  3VMY A;  1JY3 N;  1URQ A;  1KIL A;  2FFD B;  1URQ B;  1KIL B;  1KFM A;  1SFC A;  5BU8 B;  3U1A A;  1X8Y A;  3RK3 D;  2YMY A;  1NKZ B;  2Q3I A;  1J2J B;  2H8P D;  4EOT A;  1IC2 A;  2KLV A;  1ZV8 A;  2N1T C;  1SQP K;  4GT1 A;  5AW0 B;  1DX7 A;  3O8Z A;  1GW3 A;  1LWU C;  1QL2 A;  1W2E A;  3A2A A;  1JY3 P;  3SWY A;  3GHG A;  3GHG B;  1KFN A;  2GM4 A;  4AQR D;  1HJB A;  1IFJ A;  3IFM A;  4GKG A;  4DOJ A;  2Z4E A;  1FOS E;  2I1K A;  4WB4 A;  1YTZ I;  3HD7 D;  3I5C A;  5APU A;  1AFO A;  1SFC D;  5KLV K;  4JF7 A;  2IFM A;  4RES B;  1QL1 A;  2QM7 A;  3BVH A;  2E43 A;  4XE5 B;  4WY4 D;  2GUS A;  1KQL A;  1H8A A;  1GDT A;  2NPS A;  3VMX A;  2WPQ A;  3M0A A;  3BAT A;  2WZ7 A;  2HOD A;  2HOD B;  5BVZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...