2N1TA

Dynamic binding mode of a synaptotagmin-1-snare complex in solution
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
NLTSNRRLQQTQAQVDEVVDIMRVNVDKVLERDQKLSELDDRADALQAGASQFETSAAKLKRKYWWKNL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Exocytosis
molecule keywords Vesicle-associated membrane protein 2
publication title Dynamic binding mode of a Synaptotagmin-1-SNARE complex in solution.
pubmed doi rcsb
source organism Rattus norvegicus
total genus 30
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2015-04-21
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2n1tA00
3HD7D 1L4AC 1L4AB 3HD7A 2PP6A 4N78E 3HTKB 2XDJA 4WY4D 3RK3C 3RK3B 4WY4A 2N1TD 1SFCA 2N1TA 2N1TC 3HD7C 1HVVA 1JTHB 1KILD 3HD7B 3M0DC 3KYQA 2YMYA 1KILA 1KILC 2NPSD 2HG5D 4W7YA 3RK2D 1SFCD 5KJ7D 3B5ND 2NPSA 2M8RA 2NPSC 4JF7A 4WY4C 3RL0D 5KJ7A 1GL2D 1SFCC 5KJ7C 3B5NA 4W7ZA 3B5NC 1N7SD 1NHLA 4WY4B 2KOGA 1XTGB 1GL2A 3RL0C 1GL2C 1URQD 3P8CE 1N7SA 2N1TB 2H8PD 1URQA 4OH8B 5CCHD 1L4AD 3VOPA 1KILB 5CCHA 1L4AA 3PP5A 5CCHC 5CCGD 3TSIA 1JTHA 2HFED 4W80A 3RK2C 5CCGA 2NPSB 5CCGC 2WZ7A 3RK2B 1SFCB 1T3JA 3B5NB 1N7SC 3RL0B 3RK3D 1GL2B 1N7SB 1URQC 1URQB 4LGDE
chains in the Genus database with same CATH superfamily
3CWBE 2NZ2A 2M5AA 1KB9I 1A02J 5B66H 2FBWC 3L71E 1LT1A 2FXMA 2BCCG 2Z5IA 5KAIE 3F5HA 1LGHB 1EDLA 1MV8A 2BCCD 2QVAA 3C1LA 5KKZB 1L0NG 2W27A 1G2CA 1NGMB 1LTSC 2O01H 1L0ND 1GK6A 5AW1B 1KFNA 1YJ9P 5KLVJ 3VMZA 1VQ9P 4IOIH 1ZMEC 1SQPE 3B5ND 2K9JB 1BGYE 3B5NC 1N7SD 3P8CD 1JY3O 3KZIH 2Q9IA 1HH0A 3V4QA 1BE3E 1MFZA 3P8CE 4D6TE 1VL2A 3L73G 2OYIB 5AVWB 5KAIH 1FJKA 2ZYDA 1KILB 2E5TA 2YIUB 2KXPB 3TSIA 3L73D 2YKPA 3RBZA 1RE4A 2NPSB 1JY3N 1NU1J 1N73B 1OX3A 3B71A 2PAJA 3SFDC 1SQXE 1YTZT 2C9NY 4ZKPA 2WT7B 5CHXA 1KB9D 4EI2A 2YO2A 2KNCB 2YO3A 1IFDA 1VQ8P 1S2EA 1X0TA 2A06E 2PP6A 1S4XA 3H1KE 2WQYC 2I1KA 1RE3C 1VQ4P 3T97A 1OZHA 1FOSE 3VP8A 3G3ZA 1J1DB 3CX5I 3CXHI 2B9BA 4IFMA 5AVXB 1DIPA 3G9RA 4LLHA 4ZMDA 1SP4A 1K73Q 2FYUG 2V7QJ 1YQ3C 5AVYB 2E75D 3TGUJ 3HUSB 2FYUD 2E75C 4C7RA 1SFCD 2SPZA 1KZUB 4CPGA 3ITKA 1H8AA 1JO5A 1SFCC 3K5BA 2I8DA 4GDOA 1NTMD 3H1HJ 4GODA 1YI2P 2KZJA 3E1IA 1L4AD 5AW2B 3OJAB 2YMKA 3EFGA 4W80A 1KYOI 3VMXA 1FC2C 4PV1B 3AE5C 4IL6X 2Y9ZA 4O9BA 1JM0A 2HPCA 3IFMA 1OXZA 5AW4B 1A02F 3PRJA 1JY3P 1X79B 3FGAD 2H43A 1LTJB 1L0LK 3CX5D 3CXHD 2HODA 4BXLA 1S3JA 1PPJE 2IFMA 2ZT9D 2AXCA 1J1EB 2ZT9C 1JTHB 1AA0A 3HD7B 3CCMP 3M0DC 1SQQE 1S9KE 1LTGC 1FDMA 1CZQA 3I55P 3Q2YA 4A7PA 1LWUC 3CC7P 3PLNA 1UIXA 2OYHC 3B5NA 1QX8A 3TGUG 5CJ0A 3D6YA 2KK7A 4I1LA 1N7SA 3CLQA 2WTYA 2H8PD 1IO4A 3NTNA 2QM8A 1PP9E 2IZ1A 1IK7A 1KQGB 1NO4A 1OVVA 1KYOD 1R5SA 2E76D 2Q6QA 2WSCH 5AW6B 1ZRTD 2L5GB 4BRYB 2N9BA 1BCCJ 1SQPK 1NTZE 3TNUB 2QJPC 3FXDA 3L75G 2XV5A 1YITP 3L75D 2FFDC 3A5TA 3H1LD 1DD3A 3H1LE 1VF5D 1ZR2A 2A45H 1Q86Q 1NH4A 1YJWP 1VF5C 3RK3B 3CCRP 1U57A 3SWFA 1SQXK 1CW5A 5AW5B 2B89A 4H13D 2P1JA 4I2LC 4H13C 2R5DA 2WT7A 2KB7P 5H2FH 2PRRA 1NVOA 3CL3D 3FX0A 2KNCA 3VP9A 2K1AA 1FDOA 3RK2D 5E79E 5KJ7D 3VYIA 1P84H 4PD4I 4DOJA 5KJ7C 2RMZA 2WPRA 2OGUA 1OMIA 4OVNF 3AE7C 3VMAA 1PGQA 3S4RA 3KDPB 3MUDA 4I7ZB 5TJHA 2POHA 1DX7A 4ZNCA 1L4AA 2O01J 2QRXA 3LW5H 2Q7CA 4Z1MH 3HUSA 1M7LA 4NPEA 1DEBA 3S9OA 3C9IA 2Z4EA 5APSA 1L2PA 2KS1B 1L0LJ 1URQB 1SQBG 1EXJA 1FZEA 1NTMK 1AVOA 1SQBD 3W68A 3RGUA 5M1BA 1M1JB 1RE4C 1BDDA 3BCCG 1NTKE 2OTKE 4L75A 2ZXEB 3H25A 3BCCD 1DEEG 3A0HE 3BATA 3CWBJ 2W6AA 4U3FE 4WY4D 2WPVB 3L71J 4HYTB 4ZKUA 4OWFA 4AUWA 3H1JD 1VPCA 1LP1B 3H1JE 2WSSH 2FY8A 5APTA 1T2KC 2J5UA 1SQVE 3TK1A 4PD4E 1FE6A 1EZVE 1LWUA 5BVZA 2OYHA 1GL2D 1IFJA 2LXBA 2L91A 1NJIQ 1GL2C 1GW4A 3WUTA 1SQPJ 2JO1A 3H32B 2QJYB 1BGYJ 5DJTB 2IZ0A 3L72E 5APWA 1SQQK 1BE3J 1JTHA 1S5LX 4D6TJ 3A0HH 3LIEA 3AE4C 1FZCC 3TYYA 4NPFX 2JR8A 1VQ5P 1GW3A 3CPWO 3CCLP 3WUVA 3B4SA 4OGQC 5EFWB 2BEZF 1IZNB 1BDCA 1SQXJ 4L74A 4WWIA 2FFDA 3AEDC 3HTKB 3O6QB 2ZVNB 2XDJA 3L70G 2E74D 3TF5A 4ASWA 3GMAA 3H1KJ 1NTZK 2E74C 3L70D 2Y9YA 1IK9A 3GHGB 3NMDA 3TNUA 4GIFA 3W67A 1H88A 2YMYA 1YIJP 1NKZB 2BCCE 1FJPA 2HG5D 2KLUA 3A7OA 2Y0DA 1TU3F 2AEFA 2QJKB 5KJ7A 4DT0A 1L0NE 1PL5A 3IR9A 5AVSB 2M3EA 1KTMA 3H1IG 4HH2A 1PGJA 3AE6C 1YHQP 4UB6E 3H1ID 1T8ZA 1JUNA 1KD1Q 1FZGA 1OW8A 1KV4A 2B88A 1QVGO 1OIPA 4H44B 1RF1B 2XU6A 2W8ZA 3ABVC 1SS1A 5KKZC 1IFIA 1N7SC 3E7KA 4IL6E 1JCDA 3CC2P 1QEXA 2WITA 3G71P 3I5CA 2YKQA 3WU2E 3L74G 2IX7C 3L73E 3L74D 3H6PA 4K3AA 2ZYAA 2PFXA 3FWNA 2LXCB 2I1JA 4H44D 1VQPP 2CPBA 2FYNB 3G4SP 3SFEC 4WY4A 2NRGA 4DJGA 1KB9E 2K88A 4JYCA 2QIWA 1IFNA 3L35A 2WSCJ 4UB6H 1KILD 4BWNA 1KILC 2A06G 1JY2N 1M56D 3IAOA 1OWAA 5BU5A 2NPSD 2YIUC 1PFIA 1NTKK 1M1JA 2ZJSE 2M8RA 2NPSC 1SQQJ 3FXEA 3R2PA 1GL2A 2MJZA 4R4LA 2FYUE 1X22A 4RO0A 2H89C 2B87A 2GA1A 1PIXA 2CK3H 3WMM0 5K5GB 1LP1A 4ASVA 5B5EE 3V6IA 1SQVK 3HE5B 1W5CE 2OTLP 5KLVG 1PP9J 1FZCA 4RJTA 1NTME 1KB9H 3CMEP 3MHVA 5KLVD 2HR3A 3MUDC 1E5WA 3HE4A 3ZDMA 1L4AC 1HUCA 2RH0A 3HUSC 1QVFO 2R32A 1PZQA 1NTZJ 3PJSK 5KAFE 1Q90D 2ZVOB 1RQUA 5AVZB 1OW7A 1ZR4A 1G1JA 4IFFA 2HLOA 4RESB 4JYBA 1NU1G 3LW5J 2WVRA 1FOSF 3GF7A 3D6ZA 2QM7A 5BU8B 2C0XA 1NU1D 2WPSA 4EOTA 4UB8E 2ZYGA 3CX5E 3CXHE 2Q5UA 3HRNA 3V2RA 4PV1D 2E5YA 3CCVP 2P7JA 2G3AA 2ZAEB 4PV1C 1XTGB 4C7NB 3A0BE 2HYNA 2N1TB 4YPCA 3CCJP 1JY2P 1MUUA 1OFCX 2IYPA 1LTTC 1N7LA 3IF4A 3VOPA 1RQVA 3GHGA 4YTPC 1ZLLA 2GUVA 1LT9B 1EDJA 2G8YA 2R3CA 2WWWA 5CBOA 3JC22 4HJGH 3TGUD 1L0NK 1AQ5A 1IJDB 3TGUE 1NKNA 2WSFH 3BVHA 1CI6B 3GG2A 3HD7D 1KQSO 4YXWH 1J1EC 1AQTA 1HJ0A 1KYOE 1K8AQ 3H1HG 4JQ0D 1PP9G 2E76C 4UB8H 1ZRTE 3CX5H 3CXHH 1BSHA 3H1HD 3KPEA 3G6EP 1T6AA 2JJLA 5KLIB 2K9JA 3VTPC 1FBMA 1RHZB 1NTKJ 1KMIZ 2M5AB 1GZLA 4U3FJ 2JDIH 3KYQA 3L75E 5TISE 2OYIA 2UWJE 1KILA 1EDIA 3MZWB 2NPSA 1YYCA 3D70A 3MD0A 1G2CB 2J59M 1N73A 1HTLC 1PGPA 5GTHE 2C9LY 1H89A 1SQVJ 1PGOA 3CI9A 1DH3A 2Q1KA 1KYOH 4OH8B 1HGZA 2WPQA 2MKVA 5CCGD 3RK2C 1LNQA 5CCGC 1U7MA 2XKMA 2KSEA 3MP7B 4N78D 2IBZI 4DZOA 3RL0B 3RK3D 2XNDH 3AEFC 3AE3C 1FAVA 1FZAA 3L72J 2OARA 2P2UA 3NFQA 2KP8A 1W2EA 1WRGA 3M9QA 5TISH 1JCCA 2QE7H 1YJNP 2FYUK 5APQA 3JSVC 2OQQA 1KN7A 4Y99B 2M0BA 4NPDA 3SWYA 3M06A 1JNMA 1QLED 3CMAP 3Q3DA 4GOEA 2Q3IA 3AE9C 2OYOA 2AXTE 1CSBA 3HE5A 1KQFB 1Z56A 1VQKP 1BCCG 3E1RA 1AVYA 3Q5PA 2E42A 3BRVB 1SQBE 4JPZB 1T3UA 5E79H 1BCCD 4I7ZC 1GD2E 2XZRA 1MZ9A 1JMBA 3BCCE 3PH0A 4PJ0E 2FXPA 4WY4C 2O3JA 5AW3B 1YBKA 5AVUB 4M3LA 5DJUB 1URQD 2BCCJ 2BASA 3JCUE 4AQRD 2YNYA 1GMJA 3D71A 2YXRB 5AVVB 5CCHD 3OAKA 1L0NJ 2IBZG 4EDFA 3CCUP 1S72P 5CCHC 1M1JC 4H0LB 2IBZD 4WVZA 1LTJA 1UIIA 3A2AA 2D2CB 1EZVG 1FDIA 2AXTH 2XNXA 1JMMA 3AEAC 3AEBC 4LGDE 4I6MC 4OGQB 3GLMA 3I56P 1DD4A 1USDA 1PV3A 3HD7A 3MTUE 2YXQB 3N4XA 3TDKA 3L72G 2W83C 1RY3A 3II6A 4PJ0H 5B66E 5CJ4A 3CD6P 5AW7B 3L73J 1LT9A 3JCUH 2HPCB 4HKZH 4N6JA 1BSNA 1XTCC 3V5BA 4PD4H 1CI6A 4LC1A 1L0LG 1IFPA 2QJYC 3RBXA 3M9HA 1HJBA 1L0LD 1N86A 3O8ZA 2HODB 3AE2C 4BRYA 1Q82Q 1KQLA 2KOGA 3L70E 3CWBG 1EQ7A 1Y9BA 3CCEP 1K9MQ 1LTAC 1RF0A 2VRSA 3L71G 3CWBD 2FXOA 3PP5A 3L71D 4GKGA 2KLVA 1EXIA 4L76A 4GT1A 5CCGA 2IDBA 1Q2NA 3SWKA 3B5NB 2FYUJ 1HGVA 2CPSA 3V2QA 1N7SB 2KYVA 4N3YB 3U59A 1U7JA 4WB4A 2AEJA 3FWLA 2R3SA 3C8VA 3H1IE 3GHGC 3AECC 1LTIC 2Y0CA 1NTMJ 2GM4A 1Y47A 1E79H 5CBNA 1SQPG 4HB1A 4WBAA 1BGYG 1SQPD 1H0TB 4XA4A 1BE3G 1LTBC 2QJKC 3GW6A 5AVTB 1BGYD 1YTZI 4D6TG 3EFFK 1BE3D 3NXSA 4D6TD 3CCQP 3L74E 1AJYA 1JY2O 1ZW0A 2WSFJ 3PHLA 2BEQD 2QEXP 1FU1A 4H44C 3QH9A 1RF1C 1SQXG 2Q3EA 2IPPA 5AW8B 1NHLA 3MGNA 4B86A 1SQXD 2KS1A 2QA4P 1URQA 1KILE 2OYIC 2KIKA 2E75B 1SQBK 1NOHA 3H1KG 4R4MA 1VQ6P 5CCHA 2A06D 2P10A 1USEA 4IL6H 3CC4P 3H1KD 1N73C 1SFCB 3V2NA 1N2DC 3WU2H 2FYNC 1SVFA 1OVUA 3VMYA 1L4AB 1FZFA 1G1IA 3CCSP 2FKWB 3S1KA 1VQ7P 1Q81Q 1J1DC 2QG4A 2ITAA 3F89A 1EC5A 5KLVE 4DCKA 1NTMG 2M3BA 2K37A 2A45I 2DW3A 3P8MC 1HVVA 5C39A 1NYHA 2K9YA 3H32A 3N7NA 2O1KA 3OW2O 3KXDA 4XE5B 4JF7A 1MKMA 4W7ZA 3L75J 3A3YB 3H1LJ 3EQ2A 1MFTA 1P84I 3R4YA 2KI7B 2ZT9B 1NU1E 1VDFA 1ZXGA 5B5EH 5GTIE 2HFED 1KC8Q 2J58A 1OW6A 1LWUB 3P7KA 2OYHB 3HTKA 1M1KQ 5AW9B 1PPJG 3O6QA 1OVRA 2KZIA 3L36A 1PPJD 1GU5A 1K04A 1R5LA 1SQQG 2QSIA 5KAFH 3AE1C 2C0WA 2WSEJ 2OTJP 1LTJC 1SQQD 1AFOA 5APUA 1S9KD 2E76B 4AYCA 3EWKA 2A45G 1K05A 1VQLP 2IFNA 3MIWA 1KORA 2N1TD 2QJPB 3SSUA 2W6BA 3V2PA 2N1TC 1Y8AA 3HD7C 5L8RJ 2O01N 5GTIH 1GTWA 2FFDB 1PP9D 1JB0J 3KHUA 3H1HE 4W7YA 4Y28J 1Q7YQ 1GU4A 5H2FE 3VN0A 3A0BH 1ZN5A 1SQBJ 1RF1A 3GF3A 5APXA 1LT9C 1NTZG 1VF5B 2RN0A 1ZP0C 1P84D 3PTZA 1HF9A 5CMZA 1P84E 4TLFA 1NTZD 3BCCJ 1H0TA 4H13B 1N8RQ 4L73A 1GK4A 1LJ2A 1IC2A 1R8EA 1J2JB 2KUBA 2PGDA 1FZBA 1YQ4C 3H1LG 2V7QH 3M91A 3QWOC 1KFMA 3H1JJ 3RK2B 3Q1MA 4MN4C 4EIJA 2E43A 2ZFCA 1T3JA 1RE3A 1W2BO 5KLIC 1RF0C 1IFMA 5APVA 3BASA 2GUSA 1HWTC 4KHXA 1X9VA 1S5LE 2O1JA 2FYZA 1QL1A 3P32A 1EDKA 3U1CA 3UIAA 2R44A 4N78E 1RH5B 2IYOA 4TT3H 3RK3E 3RK3C 2AEMA 2LKMA 2Y0EA 1FS0E 1SFCA 1EZVI 1NAFA 1AV1A 3LIDA 1M8OB 2W6JH 3WUUA 3USSA 2K3RA 1VQMP 5GTHH 2ZXXA 4JBZA 1GDTA 3RL0D 3AEEC 4WY4B 4IFDK 3RL0C 5KLVK 3AEGC 3Q5RA 1QGKB 2N9YB 1WT6A 1S5LH 3RL0g 1BCCE 4K35A 4XFJA 3L37A 4GOFA 1S1CX 3T97B 1NTKG 1HBWA 3L70J 2WSEH 1JOCA 4U3FG 1NTKD 4U7JA 1VQOP 4Y99C 1SLQA 4U3FD 1ZV8A 3U1AA 1GL2B 2H88C 3BRTB 1URQC 1D7MA 2P58A 2Z5HA 2JWDA 3Q5SA 3H1JG 3OA7A 2B87B 1NU1K 2YKOA 2IBZE 1M90Q 1SQVG 3M0DA 1VQNP 2KSJA 3L4FA 1T2KD 3M0AA 2LR2A 1SQVD 3H1IJ 2H7HA 4KT0J 5AVRB 1FZCB 4PD4D 5AVQB 2WMMA 1EZVD 2R5BA 4C7NA 3HE4B 2N1TA 3KQGA 1ZOYC 2RKLA 4YXDC 4H0LD 3M9BA 3L72D 4KJMA 4H0LC 1JEKA 1QL2A 2D2CD 5KTBA 2V4HA 5AW0B 4EYYQ 3L74J 2D2CC 2E74B 1WMKA 4OGQD 1NWQA 2JKVA 3B8EB 3IN6A 2JP3A 1X8YA 2P67A 2W90A 3V4WA 1NAYA 1L0LE 4C46A 2JWAA 3AE8C 2WZ7A 4QMAA 1M57D 3KZIE 4RKUJ 2JEEA 5APYA
chains in the Genus database with same CATH topology
3HD7D 1J1EC 1A02J 3VMYA 1L4AB 2FXMA 2Z5IA 1M1JB 1RE4C 1LGHB 1FZFA 3KPEA 1MV8A 1G1IA 2ZXEB 2FKWB 3BATA 2W6AA 1J1DC 2W27A 4WY4D 2JJLA 1G2CA 1LTSC 2O01H 4HYTB 3VTPC 1FBMA 4ZKUA 1GK6A 2M3BA 5AW1B 1KFNA 2A45I 4AUWA 1GZLA 1HVVA 3P8MC 1VPCA 3KYQA 2OYIA 3H32A 3N7NA 1KILA 3VMZA 5APTA 1T2KC 2O1KA 3TK1A 3B5ND 2NPSA 1YYCA 1LWUA 3MD0A 4JF7A 4XE5B 1G2CB 5BVZA 2OYHA 1GL2D 2J59M 1N73A 4W7ZA 1HTLC 3B5NC 1N7SD 1IFJA 1JY3O 3P8CD 2Q9IA 1HH0A 2C9LY 3V4QA 3A3YB 1GL2C 1MFZA 3P8CE 1H89A 3EQ2A 1GW4A 3CI9A 1DH3A 4OH8B 1VDFA 2OYIB 3H32B 5AVWB 1FJKA 1KILB 1HGZA 5APWA 1SQQK 2WPQA 5CCGD 3TSIA 1JTHA 2HFED 3RK2C 2J58A 2YKPA 1RE4A 2NPSB 5CCGC 3LIEA 2XKMA 1LWUB 4N78D 1JY3N 3P7KA 2OYHB 3HTKA 5AW9B 1N73B 4DZOA 1FZCC 3TYYA 3RL0B 2PAJA 3RK3D 1FAVA 1FZAA 1YTZT 2C9NY 1GW3A 4ZKPA 3L36A 2OARA 5CHXA 2WT7B 1GU5A 2P2UA 3NFQA 2KP8A 1W2EA 1WRGA 2YO2A 3M9QA 2C0WA 2YO3A 1IFDA 1JCCA 2FYUK 2PP6A 1LTJC 2FFDA 5APQA 1AFOA 5APUA 1S9KD 2I1KA 4Y99B 4AYCA 1RE3C 3HTKB 3T97A 1FOSE 3SWYA 3M06A 3VP8A 1JNMA 2XDJA 2A45G 3G3ZA 1J1DB 2IFNA 3MIWA 2Q3IA 2N1TD 4IFMA 3HE5A 1CSBA 5AVXB 2W6BA 1NTZK 4LLHA 1Z56A 1IK9A 1SP4A 3V2PA 3GHGB 2N1TC 3HD7C 2E42A 3BRVB 3NMDA 5AVYB 3TNUA 4GIFA 1H88A 1T3UA 3HUSB 2YMYA 1GTWA 2FFDB 1GD2E 2XZRA 1NKZB 1MZ9A 4C7RA 1FJPA 2HG5D 4W7YA 1GU4A 1SFCD 1KZUB 3VN0A 3A7OA 1ZN5A 1RF1A 1H8AA 4WY4C 5KJ7A 5APXA 1JO5A 1LT9C 1SFCC 5AW3B 3IR9A 5AVUB 4M3LA 5AVSB 5CMZA 1URQD 2BASA 4AQRD 2YNYA 4HH2A 3E1IA 5AVVB 1GK4A 5CCHD 1L4AD 3OAKA 1T8ZA 5AW2B 1IC2A 1JUNA 1FZGA 3OJAB 5CCHC 3EFGA 1J2JB 1M1JC 4W80A 1FZBA 1LTJA 3M91A 1KFMA 1RF1B 2XU6A 3RK2B 4EIJA 2E43A 2ZFCA 3A2AA 3VMXA 1T3JA 1IFIA 1RE3A 1N7SC 1JCDA 2XNXA 1JMMA 1RF0C 4O9BA 1IFMA 5APVA 3BASA 2WITA 2GUSA 2HPCA 4LGDE 1HWTC 4KHXA 3I5CA 2YKQA 4I6MC 1X9VA 3IFMA 1OXZA 5AW4B 1A02F 2O1JA 2IX7C 3HD7A 2FYZA 1JY3P 1QL1A 3P32A 3MTUE 1X79B 3U1CA 3N4XA 3H6PA 3UIAA 2H43A 1LTJB 1RY3A 3II6A 4N78E 1L0LK 5CJ4A 2I1JA 5AW7B 2HODA 3RK3C 2CPBA 2LKMA 2IFMA 4WY4A 1LT9A 1SFCA 2HPCB 4N6JA 4JYCA 1IFNA 3L35A 1J1EB 1NAFA 1JTHB 1KILD 1XTCC 3HD7B 3M0DC 3V5BA 3LIDA 1CI6A 4LC1A 1S9KE 1KILC 1JY2N 1LTGC 1FDMA 1OWAA 3M9HA 1CZQA 5BU5A 2NPSD 1PFIA 1HJBA 1N86A 3O8ZA 1NTKK 1M1JA 2HODB 1GDTA 2M8RA 2NPSC 1LWUC 3RL0D 2OYHC 3B5NA 1KQLA 4WY4B 5CJ0A 2KOGA 4IFDK 3R2PA 1GL2A 3RL0C 5KLVK 4I1LA 2MJZA 1N7SA 3CLQA 2WTYA 2H8PD 1WT6A 1EQ7A 1IO4A 1LTAC 1RF0A 3NTNA 2VRSA 3L37A 2QM8A 1NO4A 3PP5A 4GKGA 2KLVA 1HBWA 2WSEH 2WSCH 3WMM0 5AW6B 4GT1A 1JOCA 2L5GB 5CCGA 1SQVK 3HE5B 4Y99C 2N9BA 3B5NB 1SQPK 1SLQA 1HGVA 1FZCA 2CPSA 3V2QA 1ZV8A 3U1AA 1GL2B 3BRTB 3TNUB 1N7SB 1URQC 2KYVA 4N3YB 3U59A 1E5WA 2Z5HA 3HE4A 4WB4A 1L4AC 3GHGC 1HUCA 3OA7A 1LTIC 2XV5A 1NU1K 2YKOA 2GM4A 3HUSC 2R32A 2FFDC 3M0DA 3A5TA 2KSJA 3L4FA 1T2KD 4WBAA 3M0AA 2H7HA 5AVRB 1FZCB 5AVQB 5AVZB 1ZR2A 2A45H 4XA4A 1ZR4A 1LTBC 5AVTB 1G1JA 1NH4A 3RK3B 1YTZI 3SWFA 4IFFA 1SQXK 2R5BA 5AW5B 1CW5A 4C7NA 3HE4B 2HLOA 4RESB 4JYBA 3NXSA 2N1TA 3KQGA 1FOSF 2P1JA 4I2LC 2QM7A 2R5DA 5BU8B 2C0XA 2WT7A 2KB7P 2WPSA 3CL3D 1JY2O 3M9BA 4EOTA 3VP9A 3RK2D 5KJ7D 2Q5UA 3HRNA 3VYIA 1FU1A 1QL2A 3V2RA 4DOJA 5KTBA 1RF1C 2P7JA 5KJ7C 5AW0B 2WPRA 2IPPA 5AW8B 1NHLA 1XTGB 3MGNA 4B86A 4C7NB 2HYNA 2N1TB 1NWQA 3KDPB 3B8EB 1URQA 1JY2P 1MUUA 2OYIC 1LTTC 3MUDA 1N7LA 1X8YA 2P67A 3VOPA 1SQBK 1NOHA 1DX7A 2POHA 5CCHA 1L4AA 3GHGA 3V4WA 1ZLLA 3LW5H 2Q7CA 4C46A 2GUVA 3HUSA 1M7LA 1N73C 2WZ7A 1LT9B 1SFCB 1DEBA 2R3CA 2WWWA 3V2NA 1N2DC 3C9IA 1L0NK 2Z4EA 5APSA 1AQ5A 1IJDB 1NKNA 2WSFH 3BVHA 1CI6B 1URQB 2JEEA 1SVFA 5APYA 1FZEA 1NTMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HD7 D;  1L4A C;  1L4A B;  3HD7 A;  2PP6 A;  4N78 E;  3HTK B;  2XDJ A;  4WY4 D;  3RK3 C;  3RK3 B;  4WY4 A;  2N1T D;  1SFC A;  2N1T A;  2N1T C;  3HD7 C;  1HVV A;  1JTH B;  1KIL D;  3HD7 B;  3M0D C;  3KYQ A;  2YMY A;  1KIL A;  1KIL C;  2NPS D;  2HG5 D;  4W7Y A;  3RK2 D;  1SFC D;  5KJ7 D;  3B5N D;  2NPS A;  2M8R A;  2NPS C;  4JF7 A;  4WY4 C;  3RL0 D;  5KJ7 A;  1GL2 D;  1SFC C;  5KJ7 C;  3B5N A;  4W7Z A;  3B5N C;  1N7S D;  1NHL A;  4WY4 B;  2KOG A;  1XTG B;  1GL2 A;  3RL0 C;  1GL2 C;  1URQ D;  3P8C E;  1N7S A;  2N1T B;  2H8P D;  1URQ A;  4OH8 B;  5CCH D;  1L4A D;  3VOP A;  1KIL B;  5CCH A;  1L4A A;  3PP5 A;  5CCH C;  5CCG D;  3TSI A;  1JTH A;  2HFE D;  4W80 A;  3RK2 C;  5CCG A;  2NPS B;  5CCG C;  2WZ7 A;  3RK2 B;  1SFC B;  1T3J A;  3B5N B;  1N7S C;  3RL0 B;  3RK3 D;  1GL2 B;  1N7S B;  1URQ C;  1URQ B;  4LGD E; 
#chains in the Genus database with same CATH topology
 3CWB E;  2NZ2 A;  2M5A A;  1KB9 I;  1A02 J;  5B66 H;  2FBW C;  3L71 E;  1LT1 A;  2FXM A;  2BCC G;  2Z5I A;  5KAI E;  3F5H A;  1LGH B;  1EDL A;  1MV8 A;  2BCC D;  2QVA A;  3C1L A;  5KKZ B;  1L0N G;  2W27 A;  1G2C A;  1NGM B;  1LTS C;  2O01 H;  1L0N D;  1GK6 A;  5AW1 B;  1KFN A;  1YJ9 P;  5KLV J;  3VMZ A;  1VQ9 P;  4IOI H;  1ZME C;  1SQP E;  3B5N D;  2K9J B;  1BGY E;  3B5N C;  1N7S D;  3P8C D;  1JY3 O;  3KZI H;  2Q9I A;  1HH0 A;  3V4Q A;  1BE3 E;  1MFZ A;  3P8C E;  4D6T E;  1VL2 A;  3L73 G;  2OYI B;  5AVW B;  5KAI H;  1FJK A;  2ZYD A;  1KIL B;  2E5T A;  2YIU B;  2KXP B;  3TSI A;  3L73 D;  2YKP A;  3RBZ A;  1RE4 A;  2NPS B;  1JY3 N;  1NU1 J;  1N73 B;  1OX3 A;  3B71 A;  2PAJ A;  3SFD C;  1SQX E;  1YTZ T;  2C9N Y;  4ZKP A;  2WT7 B;  5CHX A;  1KB9 D;  4EI2 A;  2YO2 A;  2KNC B;  2YO3 A;  1IFD A;  1VQ8 P;  1S2E A;  1X0T A;  2A06 E;  2PP6 A;  1S4X A;  3H1K E;  2WQY C;  2I1K A;  1RE3 C;  1VQ4 P;  3T97 A;  1OZH A;  1FOS E;  3VP8 A;  3G3Z A;  1J1D B;  3CX5 I;  3CXH I;  2B9B A;  4IFM A;  5AVX B;  1DIP A;  3G9R A;  4LLH A;  4ZMD A;  1SP4 A;  1K73 Q;  2FYU G;  2V7Q J;  1YQ3 C;  5AVY B;  2E75 D;  3TGU J;  3HUS B;  2FYU D;  2E75 C;  4C7R A;  1SFC D;  2SPZ A;  1KZU B;  4CPG A;  3ITK A;  1H8A A;  1JO5 A;  1SFC C;  3K5B A;  2I8D A;  4GDO A;  1NTM D;  3H1H J;  4GOD A;  1YI2 P;  2KZJ A;  3E1I A;  1L4A D;  5AW2 B;  3OJA B;  2YMK A;  3EFG A;  4W80 A;  1KYO I;  3VMX A;  1FC2 C;  4PV1 B;  3AE5 C;  4IL6 X;  2Y9Z A;  4O9B A;  1JM0 A;  2HPC A;  3IFM A;  1OXZ A;  5AW4 B;  1A02 F;  3PRJ A;  1JY3 P;  1X79 B;  3FGA D;  2H43 A;  1LTJ B;  1L0L K;  3CX5 D;  3CXH D;  2HOD A;  4BXL A;  1S3J A;  1PPJ E;  2IFM A;  2ZT9 D;  2AXC A;  1J1E B;  2ZT9 C;  1JTH B;  1AA0 A;  3HD7 B;  3CCM P;  3M0D C;  1SQQ E;  1S9K E;  1LTG C;  1FDM A;  1CZQ A;  3I55 P;  3Q2Y A;  4A7P A;  1LWU C;  3CC7 P;  3PLN A;  1UIX A;  2OYH C;  3B5N A;  1QX8 A;  3TGU G;  5CJ0 A;  3D6Y A;  2KK7 A;  4I1L A;  1N7S A;  3CLQ A;  2WTY A;  2H8P D;  1IO4 A;  3NTN A;  2QM8 A;  1PP9 E;  2IZ1 A;  1IK7 A;  1KQG B;  1NO4 A;  1OVV A;  1KYO D;  1R5S A;  2E76 D;  2Q6Q A;  2WSC H;  5AW6 B;  1ZRT D;  2L5G B;  4BRY B;  2N9B A;  1BCC J;  1SQP K;  1NTZ E;  3TNU B;  2QJP C;  3FXD A;  3L75 G;  2XV5 A;  1YIT P;  3L75 D;  2FFD C;  3A5T A;  3H1L D;  1DD3 A;  3H1L E;  1VF5 D;  1ZR2 A;  2A45 H;  1Q86 Q;  1NH4 A;  1YJW P;  1VF5 C;  3RK3 B;  3CCR P;  1U57 A;  3SWF A;  1SQX K;  1CW5 A;  5AW5 B;  2B89 A;  4H13 D;  2P1J A;  4I2L C;  4H13 C;  2R5D A;  2WT7 A;  2KB7 P;  5H2F H;  2PRR A;  1NVO A;  3CL3 D;  3FX0 A;  2KNC A;  3VP9 A;  2K1A A;  1FDO A;  3RK2 D;  5E79 E;  5KJ7 D;  3VYI A;  1P84 H;  4PD4 I;  4DOJ A;  5KJ7 C;  2RMZ A;  2WPR A;  2OGU A;  1OMI A;  4OVN F;  3AE7 C;  3VMA A;  1PGQ A;  3S4R A;  3KDP B;  3MUD A;  4I7Z B;  5TJH A;  2POH A;  1DX7 A;  4ZNC A;  1L4A A;  2O01 J;  2QRX A;  3LW5 H;  2Q7C A;  4Z1M H;  3HUS A;  1M7L A;  4NPE A;  1DEB A;  3S9O A;  3C9I A;  2Z4E A;  5APS A;  1L2P A;  2KS1 B;  1L0L J;  1URQ B;  1SQB G;  1EXJ A;  1FZE A;  1NTM K;  1AVO A;  1SQB D;  3W68 A;  3RGU A;  5M1B A;  1M1J B;  1RE4 C;  1BDD A;  3BCC G;  1NTK E;  2OTK E;  4L75 A;  2ZXE B;  3H25 A;  3BCC D;  1DEE G;  3A0H E;  3BAT A;  3CWB J;  2W6A A;  4U3F E;  4WY4 D;  2WPV B;  3L71 J;  4HYT B;  4ZKU A;  4OWF A;  4AUW A;  3H1J D;  1VPC A;  1LP1 B;  3H1J E;  2WSS H;  2FY8 A;  5APT A;  1T2K C;  2J5U A;  1SQV E;  3TK1 A;  4PD4 E;  1FE6 A;  1EZV E;  1LWU A;  5BVZ A;  2OYH A;  1GL2 D;  1IFJ A;  2LXB A;  2L91 A;  1NJI Q;  1GL2 C;  1GW4 A;  3WUT A;  1SQP J;  2JO1 A;  3H32 B;  2QJY B;  1BGY J;  5DJT B;  2IZ0 A;  3L72 E;  5APW A;  1SQQ K;  1BE3 J;  1JTH A;  1S5L X;  4D6T J;  3A0H H;  3LIE A;  3AE4 C;  1FZC C;  3TYY A;  4NPF X;  2JR8 A;  1VQ5 P;  1GW3 A;  3CPW O;  3CCL P;  3WUV A;  3B4S A;  4OGQ C;  5EFW B;  2BEZ F;  1IZN B;  1BDC A;  1SQX J;  4L74 A;  4WWI A;  2FFD A;  3AED C;  3HTK B;  3O6Q B;  2ZVN B;  2XDJ A;  3L70 G;  2E74 D;  3TF5 A;  4ASW A;  3GMA A;  3H1K J;  1NTZ K;  2E74 C;  3L70 D;  2Y9Y A;  1IK9 A;  3GHG B;  3NMD A;  3TNU A;  4GIF A;  3W67 A;  1H88 A;  2YMY A;  1YIJ P;  1NKZ B;  2BCC E;  1FJP A;  2HG5 D;  2KLU A;  3A7O A;  2Y0D A;  1TU3 F;  2AEF A;  2QJK B;  5KJ7 A;  4DT0 A;  1L0N E;  1PL5 A;  3IR9 A;  5AVS B;  2M3E A;  1KTM A;  3H1I G;  4HH2 A;  1PGJ A;  3AE6 C;  1YHQ P;  4UB6 E;  3H1I D;  1T8Z A;  1JUN A;  1KD1 Q;  1FZG A;  1OW8 A;  1KV4 A;  2B88 A;  1QVG O;  1OIP A;  4H44 B;  1RF1 B;  2XU6 A;  2W8Z A;  3ABV C;  1SS1 A;  5KKZ C;  1IFI A;  1N7S C;  3E7K A;  4IL6 E;  1JCD A;  3CC2 P;  1QEX A;  2WIT A;  3G71 P;  3I5C A;  2YKQ A;  3WU2 E;  3L74 G;  2IX7 C;  3L73 E;  3L74 D;  3H6P A;  4K3A A;  2ZYA A;  2PFX A;  3FWN A;  2LXC B;  2I1J A;  4H44 D;  1VQP P;  2CPB A;  2FYN B;  3G4S P;  3SFE C;  4WY4 A;  2NRG A;  4DJG A;  1KB9 E;  2K88 A;  4JYC A;  2QIW A;  1IFN A;  3L35 A;  2WSC J;  4UB6 H;  1KIL D;  4BWN A;  1KIL C;  2A06 G;  1JY2 N;  1M56 D;  3IAO A;  1OWA A;  5BU5 A;  2NPS D;  2YIU C;  1PFI A;  1NTK K;  1M1J A;  2ZJS E;  2M8R A;  2NPS C;  1SQQ J;  3FXE A;  3R2P A;  1GL2 A;  2MJZ A;  4R4L A;  2FYU E;  1X22 A;  4RO0 A;  2H89 C;  2B87 A;  2GA1 A;  1PIX A;  2CK3 H;  3WMM 0;  5K5G B;  1LP1 A;  4ASV A;  5B5E E;  3V6I A;  1SQV K;  3HE5 B;  1W5C E;  2OTL P;  5KLV G;  1PP9 J;  1FZC A;  4RJT A;  1NTM E;  1KB9 H;  3CME P;  3MHV A;  5KLV D;  2HR3 A;  3MUD C;  1E5W A;  3HE4 A;  3ZDM A;  1L4A C;  1HUC A;  2RH0 A;  3HUS C;  1QVF O;  2R32 A;  1PZQ A;  1NTZ J;  3PJS K;  5KAF E;  1Q90 D;  2ZVO B;  1RQU A;  5AVZ B;  1OW7 A;  1ZR4 A;  1G1J A;  4IFF A;  2HLO A;  4RES B;  4JYB A;  1NU1 G;  3LW5 J;  2WVR A;  1FOS F;  3GF7 A;  3D6Z A;  2QM7 A;  5BU8 B;  2C0X A;  1NU1 D;  2WPS A;  4EOT A;  4UB8 E;  2ZYG A;  3CX5 E;  3CXH E;  2Q5U A;  3HRN A;  3V2R A;  4PV1 D;  2E5Y A;  3CCV P;  2P7J A;  2G3A A;  2ZAE B;  4PV1 C;  1XTG B;  4C7N B;  3A0B E;  2HYN A;  2N1T B;  4YPC A;  3CCJ P;  1JY2 P;  1MUU A;  1OFC X;  2IYP A;  1LTT C;  1N7L A;  3IF4 A;  3VOP A;  1RQV A;  3GHG A;  4YTP C;  1ZLL A;  2GUV A;  1LT9 B;  1EDJ A;  2G8Y A;  2R3C A;  2WWW A;  5CBO A;  3JC2 2;  4HJG H;  3TGU D;  1L0N K;  1AQ5 A;  1IJD B;  3TGU E;  1NKN A;  2WSF H;  3BVH A;  1CI6 B;  3GG2 A;  3HD7 D;  1KQS O;  4YXW H;  1J1E C;  1AQT A;  1HJ0 A;  1KYO E;  1K8A Q;  3H1H G;  4JQ0 D;  1PP9 G;  2E76 C;  4UB8 H;  1ZRT E;  3CX5 H;  3CXH H;  1BSH A;  3H1H D;  3KPE A;  3G6E P;  1T6A A;  2JJL A;  5KLI B;  2K9J A;  3VTP C;  1FBM A;  1RHZ B;  1NTK J;  1KMI Z;  2M5A B;  1GZL A;  4U3F J;  2JDI H;  3KYQ A;  3L75 E;  5TIS E;  2OYI A;  2UWJ E;  1KIL A;  1EDI A;  3MZW B;  2NPS A;  1YYC A;  3D70 A;  3MD0 A;  1G2C B;  2J59 M;  1N73 A;  1HTL C;  1PGP A;  5GTH E;  2C9L Y;  1H89 A;  1SQV J;  1PGO A;  3CI9 A;  1DH3 A;  2Q1K A;  1KYO H;  4OH8 B;  1HGZ A;  2WPQ A;  2MKV A;  5CCG D;  3RK2 C;  1LNQ A;  5CCG C;  1U7M A;  2XKM A;  2KSE A;  3MP7 B;  4N78 D;  2IBZ I;  4DZO A;  3RL0 B;  3RK3 D;  2XND H;  3AEF C;  3AE3 C;  1FAV A;  1FZA A;  3L72 J;  2OAR A;  2P2U A;  3NFQ A;  2KP8 A;  1W2E A;  1WRG A;  3M9Q A;  5TIS H;  1JCC A;  2QE7 H;  1YJN P;  2FYU K;  5APQ A;  3JSV C;  2OQQ A;  1KN7 A;  4Y99 B;  2M0B A;  4NPD A;  3SWY A;  3M06 A;  1JNM A;  1QLE D;  3CMA P;  3Q3D A;  4GOE A;  2Q3I A;  3AE9 C;  2OYO A;  2AXT E;  1CSB A;  3HE5 A;  1KQF B;  1Z56 A;  1VQK P;  1BCC G;  3E1R A;  1AVY A;  3Q5P A;  2E42 A;  3BRV B;  1SQB E;  4JPZ B;  1T3U A;  5E79 H;  1BCC D;  4I7Z C;  1GD2 E;  2XZR A;  1MZ9 A;  1JMB A;  3BCC E;  3PH0 A;  4PJ0 E;  2FXP A;  4WY4 C;  2O3J A;  5AW3 B;  1YBK A;  5AVU B;  4M3L A;  5DJU B;  1URQ D;  2BCC J;  2BAS A;  3JCU E;  4AQR D;  2YNY A;  1GMJ A;  3D71 A;  2YXR B;  5AVV B;  5CCH D;  3OAK A;  1L0N J;  2IBZ G;  4EDF A;  3CCU P;  1S72 P;  5CCH C;  1M1J C;  4H0L B;  2IBZ D;  4WVZ A;  1LTJ A;  1UII A;  3A2A A;  2D2C B;  1EZV G;  1FDI A;  2AXT H;  2XNX A;  1JMM A;  3AEA C;  3AEB C;  4LGD E;  4I6M C;  4OGQ B;  3GLM A;  3I56 P;  1DD4 A;  1USD A;  1PV3 A;  3HD7 A;  3MTU E;  2YXQ B;  3N4X A;  3TDK A;  3L72 G;  2W83 C;  1RY3 A;  3II6 A;  4PJ0 H;  5B66 E;  5CJ4 A;  3CD6 P;  5AW7 B;  3L73 J;  1LT9 A;  3JCU H;  2HPC B;  4HKZ H;  4N6J A;  1BSN A;  1XTC C;  3V5B A;  4PD4 H;  1CI6 A;  4LC1 A;  1L0L G;  1IFP A;  2QJY C;  3RBX A;  3M9H A;  1HJB A;  1L0L D;  1N86 A;  3O8Z A;  2HOD B;  3AE2 C;  4BRY A;  1Q82 Q;  1KQL A;  2KOG A;  3L70 E;  3CWB G;  1EQ7 A;  1Y9B A;  3CCE P;  1K9M Q;  1LTA C;  1RF0 A;  2VRS A;  3L71 G;  3CWB D;  2FXO A;  3PP5 A;  3L71 D;  4GKG A;  2KLV A;  1EXI A;  4L76 A;  4GT1 A;  5CCG A;  2IDB A;  1Q2N A;  3SWK A;  3B5N B;  2FYU J;  1HGV A;  2CPS A;  3V2Q A;  1N7S B;  2KYV A;  4N3Y B;  3U59 A;  1U7J A;  4WB4 A;  2AEJ A;  3FWL A;  2R3S A;  3C8V A;  3H1I E;  3GHG C;  3AEC C;  1LTI C;  2Y0C A;  1NTM J;  2GM4 A;  1Y47 A;  1E79 H;  5CBN A;  1SQP G;  4HB1 A;  4WBA A;  1BGY G;  1SQP D;  1H0T B;  4XA4 A;  1BE3 G;  1LTB C;  2QJK C;  3GW6 A;  5AVT B;  1BGY D;  1YTZ I;  4D6T G;  3EFF K;  1BE3 D;  3NXS A;  4D6T D;  3CCQ P;  3L74 E;  1AJY A;  1JY2 O;  1ZW0 A;  2WSF J;  3PHL A;  2BEQ D;  2QEX P;  1FU1 A;  4H44 C;  3QH9 A;  1RF1 C;  1SQX G;  2Q3E A;  2IPP A;  5AW8 B;  1NHL A;  3MGN A;  4B86 A;  1SQX D;  2KS1 A;  2QA4 P;  1URQ A;  1KIL E;  2OYI C;  2KIK A;  2E75 B;  1SQB K;  1NOH A;  3H1K G;  4R4M A;  1VQ6 P;  5CCH A;  2A06 D;  2P10 A;  1USE A;  4IL6 H;  3CC4 P;  3H1K D;  1N73 C;  1SFC B;  3V2N A;  1N2D C;  3WU2 H;  2FYN C;  1SVF A;  1OVU A;  3VMY A;  1L4A B;  1FZF A;  1G1I A;  3CCS P;  2FKW B;  3S1K A;  1VQ7 P;  1Q81 Q;  1J1D C;  2QG4 A;  2ITA A;  3F89 A;  1EC5 A;  5KLV E;  4DCK A;  1NTM G;  2M3B A;  2K37 A;  2A45 I;  2DW3 A;  3P8M C;  1HVV A;  5C39 A;  1NYH A;  2K9Y A;  3H32 A;  3N7N A;  2O1K A;  3OW2 O;  3KXD A;  4XE5 B;  4JF7 A;  1MKM A;  4W7Z A;  3L75 J;  3A3Y B;  3H1L J;  3EQ2 A;  1MFT A;  1P84 I;  3R4Y A;  2KI7 B;  2ZT9 B;  1NU1 E;  1VDF A;  1ZXG A;  5B5E H;  5GTI E;  2HFE D;  1KC8 Q;  2J58 A;  1OW6 A;  1LWU B;  3P7K A;  2OYH B;  3HTK A;  1M1K Q;  5AW9 B;  1PPJ G;  3O6Q A;  1OVR A;  2KZI A;  3L36 A;  1PPJ D;  1GU5 A;  1K04 A;  1R5L A;  1SQQ G;  2QSI A;  5KAF H;  3AE1 C;  2C0W A;  2WSE J;  2OTJ P;  1LTJ C;  1SQQ D;  1AFO A;  5APU A;  1S9K D;  2E76 B;  4AYC A;  3EWK A;  2A45 G;  1K05 A;  1VQL P;  2IFN A;  3MIW A;  1KOR A;  2N1T D;  2QJP B;  3SSU A;  2W6B A;  3V2P A;  2N1T C;  1Y8A A;  3HD7 C;  5L8R J;  2O01 N;  5GTI H;  1GTW A;  2FFD B;  1PP9 D;  1JB0 J;  3KHU A;  3H1H E;  4W7Y A;  4Y28 J;  1Q7Y Q;  1GU4 A;  5H2F E;  3VN0 A;  3A0B H;  1ZN5 A;  1SQB J;  1RF1 A;  3GF3 A;  5APX A;  1LT9 C;  1NTZ G;  1VF5 B;  2RN0 A;  1ZP0 C;  1P84 D;  3PTZ A;  1HF9 A;  5CMZ A;  1P84 E;  4TLF A;  1NTZ D;  3BCC J;  1H0T A;  4H13 B;  1N8R Q;  4L73 A;  1GK4 A;  1LJ2 A;  1IC2 A;  1R8E A;  1J2J B;  2KUB A;  2PGD A;  1FZB A;  1YQ4 C;  3H1L G;  2V7Q H;  3M91 A;  3QWO C;  1KFM A;  3H1J J;  3RK2 B;  3Q1M A;  4MN4 C;  4EIJ A;  2E43 A;  2ZFC A;  1T3J A;  1RE3 A;  1W2B O;  5KLI C;  1RF0 C;  1IFM A;  5APV A;  3BAS A;  2GUS A;  1HWT C;  4KHX A;  1X9V A;  1S5L E;  2O1J A;  2FYZ A;  1QL1 A;  3P32 A;  1EDK A;  3U1C A;  3UIA A;  2R44 A;  4N78 E;  1RH5 B;  2IYO A;  4TT3 H;  3RK3 E;  3RK3 C;  2AEM A;  2LKM A;  2Y0E A;  1FS0 E;  1SFC A;  1EZV I;  1NAF A;  1AV1 A;  3LID A;  1M8O B;  2W6J H;  3WUU A;  3USS A;  2K3R A;  1VQM P;  5GTH H;  2ZXX A;  4JBZ A;  1GDT A;  3RL0 D;  3AEE C;  4WY4 B;  4IFD K;  3RL0 C;  5KLV K;  3AEG C;  3Q5R A;  1QGK B;  2N9Y B;  1WT6 A;  1S5L H;  3RL0 g;  1BCC E;  4K35 A;  4XFJ A;  3L37 A;  4GOF A;  1S1C X;  3T97 B;  1NTK G;  1HBW A;  3L70 J;  2WSE H;  1JOC A;  4U3F G;  1NTK D;  4U7J A;  1VQO P;  4Y99 C;  1SLQ A;  4U3F D;  1ZV8 A;  3U1A A;  1GL2 B;  2H88 C;  3BRT B;  1URQ C;  1D7M A;  2P58 A;  2Z5H A;  2JWD A;  3Q5S A;  3H1J G;  3OA7 A;  2B87 B;  1NU1 K;  2YKO A;  2IBZ E;  1M90 Q;  1SQV G;  3M0D A;  1VQN P;  2KSJ A;  3L4F A;  1T2K D;  3M0A A;  2LR2 A;  1SQV D;  3H1I J;  2H7H A;  4KT0 J;  5AVR B;  1FZC B;  4PD4 D;  5AVQ B;  2WMM A;  1EZV D;  2R5B A;  4C7N A;  3HE4 B;  2N1T A;  3KQG A;  1ZOY C;  2RKL A;  4YXD C;  4H0L D;  3M9B A;  3L72 D;  4KJM A;  4H0L C;  1JEK A;  1QL2 A;  2D2C D;  5KTB A;  2V4H A;  5AW0 B;  4EYY Q;  3L74 J;  2D2C C;  2E74 B;  1WMK A;  4OGQ D;  1NWQ A;  2JKV A;  3B8E B;  3IN6 A;  2JP3 A;  1X8Y A;  2P67 A;  2W90 A;  3V4W A;  1NAY A;  1L0L E;  4C46 A;  2JWA A;  3AE8 C;  2WZ7 A;  4QMA A;  1M57 D;  3KZI E;  4RKU J;  2JEE A;  5APY A; 
#chains in the Genus database with same CATH homology
 3HD7 D;  1J1E C;  1A02 J;  3VMY A;  1L4A B;  2FXM A;  2Z5I A;  1M1J B;  1RE4 C;  1LGH B;  1FZF A;  3KPE A;  1MV8 A;  1G1I A;  2ZXE B;  2FKW B;  3BAT A;  2W6A A;  1J1D C;  2W27 A;  4WY4 D;  2JJL A;  1G2C A;  1LTS C;  2O01 H;  4HYT B;  3VTP C;  1FBM A;  4ZKU A;  1GK6 A;  2M3B A;  5AW1 B;  1KFN A;  2A45 I;  4AUW A;  1GZL A;  1HVV A;  3P8M C;  1VPC A;  3KYQ A;  2OYI A;  3H32 A;  3N7N A;  1KIL A;  3VMZ A;  5APT A;  1T2K C;  2O1K A;  3TK1 A;  3B5N D;  2NPS A;  1YYC A;  1LWU A;  3MD0 A;  4JF7 A;  4XE5 B;  1G2C B;  5BVZ A;  2OYH A;  1GL2 D;  2J59 M;  1N73 A;  4W7Z A;  1HTL C;  3B5N C;  1N7S D;  1IFJ A;  1JY3 O;  3P8C D;  2Q9I A;  1HH0 A;  2C9L Y;  3V4Q A;  3A3Y B;  1GL2 C;  1MFZ A;  3P8C E;  1H89 A;  3EQ2 A;  1GW4 A;  3CI9 A;  1DH3 A;  4OH8 B;  1VDF A;  2OYI B;  3H32 B;  5AVW B;  1FJK A;  1KIL B;  1HGZ A;  5APW A;  1SQQ K;  2WPQ A;  5CCG D;  3TSI A;  1JTH A;  2HFE D;  3RK2 C;  2J58 A;  2YKP A;  1RE4 A;  2NPS B;  5CCG C;  3LIE A;  2XKM A;  1LWU B;  4N78 D;  1JY3 N;  3P7K A;  2OYH B;  3HTK A;  5AW9 B;  1N73 B;  4DZO A;  1FZC C;  3TYY A;  3RL0 B;  2PAJ A;  3RK3 D;  1FAV A;  1FZA A;  1YTZ T;  2C9N Y;  1GW3 A;  4ZKP A;  3L36 A;  2OAR A;  5CHX A;  2WT7 B;  1GU5 A;  2P2U A;  3NFQ A;  2KP8 A;  1W2E A;  1WRG A;  2YO2 A;  3M9Q A;  2C0W A;  2YO3 A;  1IFD A;  1JCC A;  2FYU K;  2PP6 A;  1LTJ C;  2FFD A;  5APQ A;  1AFO A;  5APU A;  1S9K D;  2I1K A;  4Y99 B;  4AYC A;  1RE3 C;  3HTK B;  3T97 A;  1FOS E;  3SWY A;  3M06 A;  3VP8 A;  1JNM A;  2XDJ A;  2A45 G;  3G3Z A;  1J1D B;  2IFN A;  3MIW A;  2Q3I A;  2N1T D;  4IFM A;  3HE5 A;  1CSB A;  5AVX B;  2W6B A;  1NTZ K;  4LLH A;  1Z56 A;  1IK9 A;  1SP4 A;  3V2P A;  3GHG B;  2N1T C;  3HD7 C;  2E42 A;  3BRV B;  3NMD A;  5AVY B;  3TNU A;  4GIF A;  1H88 A;  1T3U A;  3HUS B;  2YMY A;  1GTW A;  2FFD B;  1GD2 E;  2XZR A;  1NKZ B;  1MZ9 A;  4C7R A;  1FJP A;  2HG5 D;  4W7Y A;  1GU4 A;  1SFC D;  1KZU B;  3VN0 A;  3A7O A;  1ZN5 A;  1RF1 A;  1H8A A;  4WY4 C;  5KJ7 A;  5APX A;  1JO5 A;  1LT9 C;  1SFC C;  5AW3 B;  3IR9 A;  5AVU B;  4M3L A;  5AVS B;  5CMZ A;  1URQ D;  2BAS A;  4AQR D;  2YNY A;  4HH2 A;  3E1I A;  5AVV B;  1GK4 A;  5CCH D;  1L4A D;  3OAK A;  1T8Z A;  5AW2 B;  1IC2 A;  1JUN A;  1FZG A;  3OJA B;  5CCH C;  3EFG A;  1J2J B;  1M1J C;  4W80 A;  1FZB A;  1LTJ A;  3M91 A;  1KFM A;  1RF1 B;  2XU6 A;  3RK2 B;  4EIJ A;  2E43 A;  2ZFC A;  3A2A A;  3VMX A;  1T3J A;  1IFI A;  1RE3 A;  1N7S C;  1JCD A;  2XNX A;  1JMM A;  1RF0 C;  4O9B A;  1IFM A;  5APV A;  3BAS A;  2WIT A;  2GUS A;  2HPC A;  4LGD E;  1HWT C;  4KHX A;  3I5C A;  2YKQ A;  4I6M C;  1X9V A;  3IFM A;  1OXZ A;  5AW4 B;  1A02 F;  2O1J A;  2IX7 C;  3HD7 A;  2FYZ A;  1JY3 P;  1QL1 A;  3P32 A;  3MTU E;  1X79 B;  3U1C A;  3N4X A;  3H6P A;  3UIA A;  2H43 A;  1LTJ B;  1RY3 A;  3II6 A;  4N78 E;  1L0L K;  5CJ4 A;  2I1J A;  5AW7 B;  2HOD A;  3RK3 C;  2CPB A;  2LKM A;  2IFM A;  4WY4 A;  1LT9 A;  1SFC A;  2HPC B;  4N6J A;  4JYC A;  1IFN A;  3L35 A;  1J1E B;  1NAF A;  1JTH B;  1KIL D;  1XTC C;  3HD7 B;  3M0D C;  3V5B A;  3LID A;  1CI6 A;  4LC1 A;  1S9K E;  1KIL C;  1JY2 N;  1LTG C;  1FDM A;  1OWA A;  3M9H A;  1CZQ A;  5BU5 A;  2NPS D;  1PFI A;  1HJB A;  1N86 A;  3O8Z A;  1NTK K;  1M1J A;  2HOD B;  1GDT A;  2M8R A;  2NPS C;  1LWU C;  3RL0 D;  2OYH C;  3B5N A;  1KQL A;  4WY4 B;  5CJ0 A;  2KOG A;  4IFD K;  3R2P A;  1GL2 A;  3RL0 C;  5KLV K;  4I1L A;  2MJZ A;  1N7S A;  3CLQ A;  2WTY A;  2H8P D;  1WT6 A;  1EQ7 A;  1IO4 A;  1LTA C;  1RF0 A;  3NTN A;  2VRS A;  3L37 A;  2QM8 A;  1NO4 A;  3PP5 A;  4GKG A;  2KLV A;  1HBW A;  2WSE H;  2WSC H;  3WMM 0;  5AW6 B;  4GT1 A;  1JOC A;  2L5G B;  5CCG A;  1SQV K;  3HE5 B;  4Y99 C;  2N9B A;  3B5N B;  1SQP K;  1SLQ A;  1HGV A;  1FZC A;  2CPS A;  3V2Q A;  1ZV8 A;  3U1A A;  1GL2 B;  3BRT B;  3TNU B;  1N7S B;  1URQ C;  2KYV A;  4N3Y B;  3U59 A;  1E5W A;  2Z5H A;  3HE4 A;  4WB4 A;  1L4A C;  3GHG C;  1HUC A;  3OA7 A;  1LTI C;  2XV5 A;  1NU1 K;  2YKO A;  2GM4 A;  3HUS C;  2R32 A;  2FFD C;  3M0D A;  3A5T A;  2KSJ A;  3L4F A;  1T2K D;  4WBA A;  3M0A A;  2H7H A;  5AVR B;  1FZC B;  5AVQ B;  5AVZ B;  1ZR2 A;  2A45 H;  4XA4 A;  1ZR4 A;  1LTB C;  5AVT B;  1G1J A;  1NH4 A;  3RK3 B;  1YTZ I;  3SWF A;  4IFF A;  1SQX K;  2R5B A;  5AW5 B;  1CW5 A;  4C7N A;  3HE4 B;  2HLO A;  4RES B;  4JYB A;  3NXS A;  2N1T A;  3KQG A;  1FOS F;  2P1J A;  4I2L C;  2QM7 A;  2R5D A;  5BU8 B;  2C0X A;  2WT7 A;  2KB7 P;  2WPS A;  3CL3 D;  1JY2 O;  3M9B A;  4EOT A;  3VP9 A;  3RK2 D;  5KJ7 D;  2Q5U A;  3HRN A;  3VYI A;  1FU1 A;  1QL2 A;  3V2R A;  4DOJ A;  5KTB A;  1RF1 C;  2P7J A;  5KJ7 C;  5AW0 B;  2WPR A;  2IPP A;  5AW8 B;  1NHL A;  1XTG B;  3MGN A;  4B86 A;  4C7N B;  2HYN A;  2N1T B;  1NWQ A;  3KDP B;  3B8E B;  1URQ A;  1JY2 P;  1MUU A;  2OYI C;  1LTT C;  3MUD A;  1N7L A;  1X8Y A;  2P67 A;  3VOP A;  1SQB K;  1NOH A;  1DX7 A;  2POH A;  5CCH A;  1L4A A;  3GHG A;  3V4W A;  1ZLL A;  3LW5 H;  2Q7C A;  4C46 A;  2GUV A;  3HUS A;  1M7L A;  1N73 C;  2WZ7 A;  1LT9 B;  1SFC B;  1DEB A;  2R3C A;  2WWW A;  3V2N A;  1N2D C;  3C9I A;  1L0N K;  2Z4E A;  5APS A;  1AQ5 A;  1IJD B;  1NKN A;  2WSF H;  3BVH A;  1CI6 B;  1URQ B;  2JEE A;  1SVF A;  5APY A;  1FZE A;  1NTM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...