2C0WA

Molecular structure of fd filamentous bacteriophage refined with respect to x-ray fibre diffraction
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
50
structure length
50
Chain Sequence
b'AEGDDPAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKAS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAT PROTEIN B
publication title Molecular Structure of Fd (F1, M13) Filamentous Bacteriophage Refined with Respect to X-Ray Fibre Diffraction and Solid-State NMR Data Supports Specific Models of Phage Assembly at the Bacterial Membrane.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
total genus 19
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2005-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c0wA00
1HGZA 1IFDA 1HH0A 2C0XA 1IFJA 1FDMA 1NH4A 2CPSA 2MJZA 2C0WA 2CPBA 1IFIA 1HGVA
chains in the Genus database with same CATH superfamily
2ZFCA 2QJKB 1ZOYC 3TGUE 1J1DB 1N73C 1IFMA 4GODA 3D71A 2E75C 1H0TA 3O6QA 5E79E 1OW6A 2R5BA 1EXJA 1NO4A 1DD4A 4N6JA 2HFED 2KIKA 3BCCE 2B9BA 3Q2YA 2GA1A 2OYIC 5CCHD 3CPWO 2A45G 1KILB 4JQ0D 1JY3O 1SLQA 3IAOA 3WUVA 1FOSE 1OW7A 2M8RA 3H1HG 3H1HJ 2O01N 1CSBA 2BCCD 1KILD 2M3BA 2QJPC 3I55P 1L0LE 1HH0A 2J59M 4PD4H 3NMDA 3TGUG 5KAIE 3H1JD 3TGUJ 2Y0CA 3AE3C 2G8YA 1MFZA 1BSHA 2K9JA 2IDBA 1NTMK 2K9YA 5AVQB 3BCCG 1EC5A 1LGHB 1FE6A 2PP6A 2N1TC 5B5EE 1LTJB 1NTZD 1S5LE 3A7OA 3L73D 1L0NK 3Q5PA 1LTIC 2GM4A 1SQPE 2ZXEB 1M1KQ 3P8MC 3W67A 3P7KA 5K5GB 1USEA 3KZIH 2FFDB 2N9BA 3L35A 1L0LG 1KFMA 2FYNB 3RK3B 1L0LJ 1PPJE 1Q7YQ 5TJHA 3ZDMA 5M1BA 1P84I 1NWQA 2MJZA 4B86A 3FGAD 1P84E 3RK3D 1USDA 1ZRTD 3FX0A 3MHVA 1D7MA 3RK2C 4IL6E 2BEZF 2JDIH 2POHA 3D6ZA 1ZMEC 2FYUD 3CX5I 3EFGA 3H1LE 3CXHI 4UB8E 1SQPG 4LGDE 1SQPJ 2QJKC 3CXHE 5AVZB 3JCUH 1LT9B 1FZCB 1N7SB 1Y9BA 1MZ9A 2CPBA 1SQBE 2KB7P 5CCHC 2AXTE 2AEMA 2XV5A 2W8ZA 1PPJG 4Y28J 1BGYE 4PJ0E 1N7SD 3VMXA 3WUUA 1YHQP 1NU1E 1FAVA 2JEEA 1NTKE 3M0DA 2P2UA 1OX3A 1K9MQ 1KILC 1H8AA 2FXOA 3H6PA 4IFMA 3H1LG 3E7KA 5AVYB 2Q6QA 1FS0E 5KLIC 4W80A 5C39A 4OVNF 1LTSC 1SQBG 2B88A 4C7NB 1SQBJ 2NRGA 1S9KE 2Y0EA 2KZJA 1BGYG 1Q82Q 3CX5H 3G9RA 1VQLP 2YNYA 1NU1G 3S1KA 1H0TB 4XE5B 1NU1J 1KB9I 1GW4A 3O6QB 1NTKG 1SQVJ 2QG4A 1NTKJ 2P58A 2B87A 3I5CA 3H1ID 3M9BA 2WITA 1KB9E 3A5TA 2JWDA 2V7QJ 5GTHH 3B8EB 2CK3H 1YTZI 2IZ1A 2FFDC 1URQD 2VRSA 3GHGA 1RE3A 5H2FE 3RK3C 3PP5A 1AV1A 3TYYA 3CL3D 4GDOA 2J5UA 1FJPA 1KFNA 4TLFA 3KPEA 1RY3A 2A06D 1VQOP 1AFOA 3M9HA 4LLHA 3QH9A 5KAFE 1T8ZA 1HBWA 4WBAA 1RE4A 3FXEA 5AW6B 3L74E 3CC4P 1RF0C 5AVSB 2WQYC 1KQGB 2K9JB 5GTIE 1AVOA 3VYIA 2Q3EA 2W6BA 1Y8AA 3CCLP 1FOSF 3GMAA 3OJAB 1N7SC 1PGPA 1L0LK 2BCCJ 1DH3A 5L8RJ 4N78D 4U3FD 1QVFO 4PD4D 2WPSA 2P1JA 1E79H 2M0BA 1YIJP 3GLMA 2E5YA 1WRGA 3NFQA 3N4XA 2Q7CA 1IFJA 1FDIA 1OXZA 1M56D 3L74G 4XA4A 2E42A 3L73J 1SQPK 3A0BE 1PGOA 3EFFK 3MIWA 1LNQA 1KQSO 3CLQA 2KOGA 1HJBA 2QM7A 2OQQA 3CCVP 3A0HE 2O01H 1YITP 4I1LA 4D6TD 2LXBA 1Q2NA 1TU3F 1JM0A 5AVTB 1OVUA 1KMIZ 2PAJA 3MUDA 3BVHA 1SQXE 1BE3E 5CJ4A 1SQQD 2WSFJ 4RO0A 3HE5A 1URQC 2ZYGA 1YQ4C 2QE7H 2FYUJ 3IR9A 1AQ5A 1NH4A 4Y99B 1PZQA 3HD7A 4YXWH 1JMMA 5KTBA 1IJDB 1SQBK 2OTLP 3H32A 3CCUP 4WY4A 4WVZA 1L4AA 1H89A 1NU1K 1SQVK 3E1IA 1NTKK 2KS1A 3H1KE 1SQXG 1BE3G 1SQXJ 5B66H 1BE3J 2PGDA 4ZKPA 5AW8B 3E1RA 1HTLC 1IO4A 2XKMA 4WB4A 2B87B 2N9YB 4H44B 1VQ6P 3ABVC 1EDLA 2E5TA 4QMAA 2ZAEB 1U57A 2AEFA 5AW0B 1OFCX 3VMAA 4BXLA 1KYOI 4H44D 2WSEJ 3GHGB 1LTGC 1KYOE 4MN4C 1YYCA 2Q3IA 4JYBA 1E5WA 3H1KG 3CX5D 3H1KJ 2R5DA 1UIXA 1QVGO 1PFIA 2W83C 3WU2H 2XZRA 1SP4A 1GL2A 1JB0J 1QGKB 5KJ7A 3R4YA 1BGYD 4XFJA 2H89C 4O9BA 1VDFA 3CWBD 1KQLA 1EDIA 4GIFA 2IYPA 1LTTC 1N86A 3CCJP 4W7YA 1FZGA 1PV3A 1X0TA 2NZ2A 1GZLA 1VF5C 1MFTA 4UB6H 2IBZE 2ZYDA 2XDJA 3L70D 1LWUC 3SSUA 4BRYA 1AQTA 1SS1A 4I6MC 4N3YB 4TT3H 5TISE 3M0DC 4Y99C 3C8VA 5KLVD 2LR2A 3TF5A 1VQ8P 1CZQA 4RJTA 5AW7B 3SFEC 4ZMDA 3AEFC 3VOPA 3HUSA 2C9NY 3L72D 3PH0A 2LXCB 4KT0J 1AJYA 1OWAA 3PHLA 2Q5UA 2A45H 1PP9E 3P8CD 3L71E 2NPSC 2KK7A 3WMM0 2FYUK 2WPVB 4A7PA 3NTNA 3GF7A 5APSA 2IBZG 1NOHA 2HYNA 3FXDA 1VQNP 1FJKA 1GDTA 1YBKA 5CCGA 3HE5B 4H44C 5AW3B 1YTZT 1ZV8A 5E79H 4U7JA 2KLVA 1YI2P 2H8PD 3G71P 3S4RA 2HODA 2O3JA 1YJWP 3HD7B 1GW3A 2RKLA 1OZHA 5AW1B 3GHGC 4DCKA 1RE3C 1GTWA 3AEDC 5APYA 1SQXK 3H32B 3V4WA 3RBZA 1IZNB 1PP9G 2QIWA 3HD7D 1PP9J 4WY4B 1SQQJ 3L71G 1Q81Q 3QWOC 1L4AB 3L71J 1ZR2A 1HGZA 1IFDA 4Z1MH 2XNDH 1VL2A 2KS1B 1OVRA 1T2KD 4WY4D 3L75E 1L4AD 2YO2A 5DJUB 3AE7C 5KAIH 2BEQD 1HWTC 4DJGA 2Y0DA 1JOCA 2OGUA 3VMYA 1S1CX 1M90Q 3CC7P 1J1DC 4JF7A 5CBOA 3HTKA 5B5EH 1S5LH 1A02F 1NTMD 2KLUA 4AUWA 4OWFA 3D70A 4JYCA 2HPCB 5APVA 1SQVE 2E43A 1S72P 1KC8Q 4NPFX 1L0ND 2GUVA 3WUTA 1U7MA 1VQ7P 3L75G 1BCCD 2E74B 3L75J 1NYHA 4GOFA 1X22A 1SFCB 1JCCA 1LJ2A 1GL2B 1WMKA 1EZVD 1P84H 2E74D 4L75A 2D2CB 2JKVA 1RH5B 5CHXA 4IL6H 1SFCD 2E76B 4PV1B 1KZUB 3Q5RA 3ITKA 1GL2D 3V4QA 1ZXGA 2WSCJ 1IFNA 3SWFA 3IN6A 5AVXB 5KJ7D 1QEXA 4UB8H 3V2RA 2D2CD 3Q5SA 1KN7A 1R8EA 2DW3A 2P67A 2E76D 2ITAA 4PV1D 3TSIA 3MUDC 1FBMA 3CXHH 4ASVA 1SQVG 1LTJC 3V5BA 2UWJE 2AXTH 4BRYB 1U7JA 4ZKUA 4PJ0H 1RQUA 2BCCE 1KILE 2JP3A 4IFDK 1CI6A 3VP8A 2AEJA 1IK7A 2N1TA 3O8ZA 3AECC 1GU4A 2FYNC 3H1JE 3HUSB 4K35A 1FZEA 1MUUA 1FZBA 2BASA 2V7QH 2WZ7A 4L74A 1K05A 2IFMA 3CMAP 2ZT9B 2I8DA 3F89A 1KV4A 2K3RA 1JNMA 2QRXA 3LIEA 4H13B 4I7ZB 1ZW0A 3CCQP 1NTZE 3L73E 4M3LA 4EOTA 1J2JB 2ZT9D 1PIXA 4L73A 2ZYAA 3AEBC 5CBNA 1GD2E 4H13D 5APQA 3MD0A 2WWWA 1JO5A 3SWKA 3L72J 1W5CE 1M8OB 1LT9C 1FZCC 4HJGH 2BCCG 3CI9A 1ZR4A 4EYYQ 2OYHA 1SQQK 3RL0B 2HODB 1CW5A 3H1JG 2R44A 1YJ9P 1KB9H 5CCGD 3H1JJ 4GT1A 3HRNA 3U1AA 3RK3E 3TK1A 3P32A 3RL0D 3JC22 3H1HD 5CCHA 1DIPA 5H2FH 1T6AA 4HH2A 2R3SA 2FYUE 1NTZG 2E74C 3L73G 1NTZJ 3BATA 1JY2P 2G3AA 2JR8A 1SFCC 1VQ9P 1PGQA 2XNXA 3TGUD 3M9QA 3CCRP 2B89A 1GK4A 5KAFH 2D2CC 3BCCD 2KNCA 1S2EA 5GTIH 1K04A 3FWLA 3JSVC 3KXDA 3CD6P 1T3JA 3HTKB 2KSEA 3S9OA 2O1JA 1LP1A 3PJSK 2IX7C 1BSNA 1JY3N 1VQPP 2YXRB 3HE4A 5AW5B 3CCEP 2KSJA 2FYUG 1DD3A 4K3AA 2WPRA 1W2EA 1L0LD 3GW6A 3D6YA 2E75B 2YMYA 1M7LA 1RHZB 3AEGC 1VQ5P 3HUSC 2W90A 2E75D 2W27A 3FWNA 3A0BH 2QSIA 2ZT9C 1KORA 1X79B 3IFMA 4AYCA 3RBXA 4H13C 1YJNP 3U59A 2WSSH 1SQPD 3H1IE 3A0HH 3M91A 3EQ2A 2KXPB 1FU1A 2IZ0A 2QM8A 1BCCJ 2QJPB 4DOJA 5AW4B 3OW2O 1PPJD 3MP7B 1FDOA 5AVRB 3AE9C 1RF0A 1G1IA 2CPSA 5AVUB 1RF1A 3AE8C 3MGNA 5APTA 1P84D 2KUBA 1NHLA 2Z4EA 1CI6B 1EDKA 2A06E 2QJYB 2FXMA 2N1TB 2YXQB 2HLOA 2WTYA 2HG5D 3LIDA 3K5BA 1PL5A 3H1LD 2N1TD 3H1IG 3H1IJ 3CXHD 2WSEH 1NJIQ 1L2PA 1G2CA 5EFWB 1SQBD 3B5NA 3EWKA 3L4FA 2H7HA 4DZOA 4PD4I 4LC1A 4U3FE 1ZP0C 1OVVA 1NKZB 1NU1D 2RN0A 4EDFA 4W7ZA 3LW5J 1SQVD 4PD4E 3F5HA 1NTKD 4GKGA 1VQMP 3RK2B 1T3UA 1Y47A 3T97A 2A06G 4I2LC 2OYHB 2IBZI 2H43A 1NTZK 1IFIA 1G1JA 1HJ0A 3RK2D 1R5LA 1J1EB 3V6IA 1S4XA 2K1AA 2IPPA 3G6EP 1QL2A 3I56P 5BU8B 3TDKA 1KYOH 4KJMA 3RGUA 3V2PA 1S9KD 2ZVNB 1URQA 2WVRA 2W6AA 4D6TE 3KZIE 4U3FG 4U3FJ 3MZWB 2R3CA 4ASWA 1KB9D 2FXPA 1SQQE 3IF4A 2KNCB 5AW9B 2W6JH 3M06A 1RQVA 4CPGA 1HGVA 1OW8A 3AE2C 5KLIB 2J58A 1LP1B 2WMMA 4OH8B 3Q1MA 1GK6A 1JY2N 3HE4B 3OA7A 3JCUE 1LT1A 2L91A 3W68A 3C9IA 1GMJA 2C0XA 4D6TG 1K8AQ 3BCCJ 4D6TJ 3M0AA 2QJYC 5TISH 2WT7A 3L74D 2LKMA 1LTBC 2R32A 1IFPA 1NAYA 1AA0A 3N7NA 2QEXP 5CJ0A 1SQQG 1NKNA 3H25A 1NVOA 1Q86Q 1JY3P 1HVVA 1VQKP 2WPQA 2ZJSE 2M3EA 3L37A 1RE4C 3AE4C 4EIJA 1XTCC 1OIPA 4ZNCA 3II6A 4IFFA 4H0LB 3VP9A 1JEKA 5AVWB 2I1KA 4KHXA 4DT0A 4IOIH 1QX8A 3TNUA 4EI2A 4BWNA 4HB1A 4H0LD 5AVVB 1EDJA 2K88A 1M1JA 2OYHC 1RF1B 3A3YB 2C0WA 3CX5E 1KD1Q 2AXCA 1J1EC 3V2NA 1N73A 3KHUA 3B4SA 1VQ4P 2O1KA 4NPEA 3RL0g 5GTHE 1JTHA 1HF9A 1LWUA 3CWBE 1G2CB 3BASA 2OYIA 3B5NB 2JO1A 1SQXD 1BE3D 2Z5IA 1HUCA 2YKQA 1IC2A 3B5ND 1X9VA 2YIUB 3L70E 3H1LJ 2ZXXA 3T97B 2Y9ZA 5KLVE 3A2AA 3L36A 2H88C 2WSCH 5AW2B 1N7LA 2NPSA 1UIIA 2Q9IA 5APUA 1BGYJ 3L72E 3KQGA 5KKZB 2KI7B 2YKOA 4YXDC 3HD7C 1S5LX 3CWBG 4R4LA 3CWBJ 2YO3A 3PTZA 3CMEP 3H1KD 1GU5A 1LTAC 3P8CE 1URQB 3Q3DA 1T2KC 4WY4C 2V4HA 1L4AC 2M5AA 3B71A 1M57D 3C1LA 2OARA 3L70G 3L70J 4RESB 1DEBA 2JJLA 2FYZA 1JY2O 2P10A 3PLNA 5KLVG 5KLVJ 2Z5HA 4R4MA 2QA4P 3AE5C 4H0LC 3VN0A 1AVYA 3PRJA 1KTMA 2PRRA 1JCDA 4IL6X 1KYOD 3L72G 1H88A 1EXIA 3CCMP 1RF1C 4GOEA 1ZLLA 1KQFB 2IYOA 4C46A 2WT7B 2OYOA 4HYTB 1ZRTE 3G4SP 1MKMA 1NAFA 1IK9A 3BRTB 3CCSP 1R5SA 1GL2C 2HR3A 4WWIA 3B5NC 1K73Q 2KZIA 1Z56A 1DX7A 5KJ7C 3SFDC 4RKUJ 2E76C 2O01J 4PV1C 3L74J 1KILA 2IBZD 1NTME 3R2PA 1NGMB 1FZFA 2YKPA 2YIUC 3AE1C 3TNUB 5BVZA 3V2QA 1BDCA 1BDDA 1OMIA 1M1JB 2Y9YA 1L0NE 4OGQB 1DEEG 5B66E 3GG2A 3KDPB 3VTPC 4C7RA 2L5GB 1BCCE 3NXSA 1VPCA 1FC2C 1EZVI 4YTPC 5KKZC 4OGQD 2FBWC 3AE6C 1N73B 1EZVE 2KP8A 4AQRD 2P7JA 2YMKA 1PP9D 4HKZH 1VF5B 3L71D 2WSFH 1LTJA 2I1JA 3MTUE 1EQ7A 1JTHB 1LWUB 2OYIB 1NTMG 2FY8A 1Q90D 1VF5D 1NTMJ 2XU6A 2FFDA 4I7ZC 1MV8A 2RMZA 1QLED 3AEEC 1L0NG 3VMZA 4L76A 1L0NJ 5BU5A 4YPCA 1JMBA 3WU2E 2PFXA 2Q1KA 2MKVA 1BCCG 1YQ3C 1W2BO 2JWAA 1N8RQ 5CCGC 1EZVG 2NPSB 5APXA 1FZAA 3RL0C 4NPDA 1QL1A 2ZVOB 2NPSD 2IFNA 1LT9A 3L75D 1FZCA 3U1CA 1N7SA 4JBZA 1S3JA 5KLVK 1WT6A 5DJTB 2GUSA 4UB6E 2SPZA 2OTJP 2K37A 3AEAC 2M5AB 1ZN5A 3OAKA 5CMZA 2HPCA 1N2DC 3GF3A 2QVAA 2RH0A 2FKWB 3BRVB 1FDMA 1A02J 4N78E 1PGJA 3CC2P 1JUNA 2A45I 3SWYA 1SFCA 3USSA 3UIAA 1M1JC 2OTKE 3KYQA 1XTGB 3G3ZA 4OGQC 3H1HE 2C9LY 2KYVA 1X8YA 5APWA 4JPZB 4C7NA 1SVFA 3LW5H
chains in the Genus database with same CATH topology
3IR9A 2ZFCA 2IFMA 1AQ5A 1NH4A 4Y99B 3TNUA 1J1DB 1N73C 1JNMA 1IFMA 3HD7A 3LIEA 5AVVB 1JMMA 5KTBA 1IJDB 1M1JA 2OYHC 1RF1B 1SQBK 4M3LA 2R5BA 4EOTA 1J2JB 3H32A 3A3YB 1NO4A 4N6JA 2HFED 1GD2E 2C0WA 2OYIC 4WY4A 5APQA 5CCHD 1L4AA 3MD0A 1J1EC 2WWWA 1JO5A 1H89A 1NU1K 1LT9C 1FZCC 1SQVK 3V2NA 3E1IA 1NTKK 1N73A 3CI9A 2A45G 1ZR4A 1KILB 2O1KA 1JY3O 2OYHA 1SQQK 1SLQA 3RL0B 2HODB 1FOSE 1CW5A 2M8RA 5CCGD 4ZKPA 4GT1A 5AW8B 1JTHA 1LWUA 3HRNA 3U1AA 1G2CB 1CSBA 3BASA 2OYIA 1KILD 2M3BA 1HTLC 3B5NB 3TK1A 1IO4A 1HH0A 2J59M 2XKMA 3P32A 4WB4A 3RL0D 2Z5IA 3NMDA 1HUCA 5CCHA 2YKQA 1IC2A 4HH2A 1MFZA 3B5ND 5AW0B 3BATA 1X9VA 1NTMK 1JY2P 1SFCC 2XNXA 5AVQB 3M9QA 3GHGB 1LTGC 1LGHB 1GK4A 2PP6A 1YYCA 2Q3IA 2N1TC 1LTJB 3A7OA 4JYBA 3A2AA 3L36A 1L0NK 2WSCH 1LTIC 5AW2B 1N7LA 2GM4A 1E5WA 2NPSA 2ZXEB 2Q9IA 5APUA 2R5DA 1PFIA 3P8MC 3KQGA 3P7KA 2XZRA 2YKOA 2FFDB 3HD7C 1T3JA 1SP4A 1GL2A 2N9BA 3L35A 3HTKB 2YO3A 2O1JA 1KFMA 3RK3B 1GU5A 5KJ7A 1LTAC 2IX7C 3P8CE 1URQB 1JY3N 1NWQA 1T2KC 4O9BA 2MJZA 5AW5B 3HE4A 4WY4C 1VDFA 2KSJA 4B86A 1L4AC 1KQLA 2WPRA 4GIFA 1LTTC 3RK3D 1W2EA 2OARA 1N86A 4RESB 3RK2C 1DEBA 2YMYA 4W7YA 1M7LA 1FZGA 2POHA 2JJLA 2FYZA 1JY2O 1GZLA 3HUSC 2Z5HA 3EFGA 3VN0A 2XDJA 2W27A 1LWUC 4LGDE 1JCDA 4I6MC 4N3YB 5AVZB 3M0DC 1LT9B 1FZCB 1X79B 3IFMA 4Y99C 1H88A 1N7SB 4AYCA 1MZ9A 2CPBA 2KB7P 3U59A 5CCHC 1CZQA 5AW7B 2XV5A 1RF1C 3M91A 3EQ2A 3VOPA 3HUSA 1FU1A 2C9NY 3VMXA 1N7SD 1ZLLA 2QM8A 1OWAA 4C46A 1FAVA 2JEEA 2WT7B 4DOJA 5AW4B 2Q5UA 4HYTB 3M0DA 2P2UA 2A45H 5AVRB 3P8CD 1KILC 1G1IA 1RF0A 1NAFA 2CPSA 5AVUB 2NPSC 1IK9A 1RF1A 1H8AA 3WMM0 3BRTB 2FYUK 3MGNA 5APTA 3NTNA 3H6PA 5APSA 1NHLA 4IFMA 2Z4EA 5AVYB 1NOHA 1CI6B 1GL2C 2FXMA 2HYNA 3B5NC 1FJKA 2N1TB 4W80A 1GDTA 1Z56A 1DX7A 2HLOA 2WTYA 2HG5D 3LIDA 5CCGA 5KJ7C 3HE5B 5AW3B 1LTSC 1YTZT 4C7NB 1KILA 1ZV8A 3R2PA 2KLVA 1S9KE 2H8PD 1FZFA 2YKPA 2N1TD 2HODA 3TNUB 5BVZA 2WSEH 3V2QA 3HD7B 1GW3A 5AW1B 2YNYA 1G2CA 3GHGC 4XE5B 1M1JB 1RE3C 1GTWA 1GW4A 3B5NA 5APYA 3L4FA 1SQXK 3I5CA 2H7HA 3H32B 3M9BA 2WITA 3V4WA 3KDPB 3VTPC 4C7RA 3HD7D 2L5GB 4DZOA 4LC1A 3NXSA 4WY4B 3A5TA 1VPCA 1NKZB 1L4AB 1ZR2A 1HGZA 1IFDA 4W7ZA 3B8EB 4GKGA 3RK2B 1YTZI 1N73B 2FFDC 2KP8A 4AQRD 1T2KD 2P7JA 1URQD 1T3UA 2VRSA 4WY4D 3T97A 3GHGA 4I2LC 1RE3A 1L4AD 2OYHB 3RK3C 2YO2A 3PP5A 2WSFH 1LTJA 2I1JA 2H43A 1NTZK 1IFIA 3MTUE 1G1JA 3TYYA 1HWTC 1EQ7A 3RK2D 3CL3D 1JTHB 1LWUB 1FJPA 1KFNA 2OYIB 1JOCA 3KPEA 1J1EB 1RY3A 1AFOA 2IPPA 3M9HA 1QL2A 4LLHA 3VMYA 1T8ZA 1HBWA 4WBAA 1J1DC 1RE4A 4JF7A 2XU6A 5BU8B 2FFDA 5AW6B 1RF0C 1MV8A 5AVSB 3HTKA 3V2PA 3VMZA 1A02F 4AUWA 1S9KD 3VYIA 5BU5A 1URQA 2W6AA 2W6BA 4JYCA 2HPCB 1FOSF 5APVA 2E43A 3OJAB 1N7SC 2R3CA 1L0LK 2GUVA 5CCGC 1DH3A 2NPSB 4N78D 5AW9B 5APXA 1FZAA 3RL0C 1QL1A 1SFCB 1JCCA 3M06A 2WPSA 2P1JA 1GL2B 2NPSD 1HGVA 1WRGA 3NFQA 3N4XA 2Q7CA 1IFJA 2IFNA 1LT9A 1OXZA 2J58A 3U1CA 1FZCA 4OH8B 1N7SA 5KLVK 5CHXA 1SFCD 1WT6A 1KZUB 2GUSA 1GK6A 1GL2D 3V4QA 1JY2N 3HE4B 4XA4A 1IFNA 3SWFA 2E42A 3OA7A 1SQPK 1ZN5A 5AVXB 5KJ7D 3C9IA 2C0XA 3OAKA 3V2RA 2P67A 5CMZA 2HPCA 3TSIA 3MIWA 1N2DC 1FBMA 3M0AA 3CLQA 2WT7A 2KOGA 1HJBA 2QM7A 2LKMA 1LTBC 2FKWB 3BRVB 1LTJC 2R32A 1FDMA 2O01H 3V5BA 4I1LA 3N7NA 1A02J 4N78E 5CJ0A 1NKNA 4ZKUA 1JUNA 2A45I 3SWYA 1JY3P 1HVVA 1SFCA 5AVTB 2WPQA 3L37A 2PAJA 1RE4C 4IFDK 3MUDA 1CI6A 3UIAA 1M1JC 3VP8A 4EIJA 3BVHA 1XTCC 2N1TA 3KYQA 5CJ4A 1XTGB 3O8ZA 3G3ZA 1GU4A 3HUSB 2C9LY 2KYVA 3HE5A 3II6A 4IFFA 1FZEA 1MUUA 1X8YA 1FZBA 1URQC 5APWA 3VP9A 2BASA 2I1KA 4KHXA 5AVWB 4C7NA 1SVFA 3LW5H 2WZ7A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HGZ A;  1IFD A;  1HH0 A;  2C0X A;  1IFJ A;  1FDM A;  1NH4 A;  2CPS A;  2MJZ A;  2C0W A;  2CPB A;  1IFI A;  1HGV A; 
#chains in the Genus database with same CATH topology
 2ZFC A;  2QJK B;  1ZOY C;  3TGU E;  1J1D B;  1N73 C;  1IFM A;  4GOD A;  3D71 A;  2E75 C;  1H0T A;  3O6Q A;  5E79 E;  1OW6 A;  2R5B A;  1EXJ A;  1NO4 A;  1DD4 A;  4N6J A;  2HFE D;  2KIK A;  3BCC E;  2B9B A;  3Q2Y A;  2GA1 A;  2OYI C;  5CCH D;  3CPW O;  2A45 G;  1KIL B;  4JQ0 D;  1JY3 O;  1SLQ A;  3IAO A;  3WUV A;  1FOS E;  1OW7 A;  2M8R A;  3H1H G;  3H1H J;  2O01 N;  1CSB A;  2BCC D;  1KIL D;  2M3B A;  2QJP C;  3I55 P;  1L0L E;  1HH0 A;  2J59 M;  4PD4 H;  3NMD A;  3TGU G;  5KAI E;  3H1J D;  3TGU J;  2Y0C A;  3AE3 C;  2G8Y A;  1MFZ A;  1BSH A;  2K9J A;  2IDB A;  1NTM K;  2K9Y A;  5AVQ B;  3BCC G;  1EC5 A;  1LGH B;  1FE6 A;  2PP6 A;  2N1T C;  5B5E E;  1LTJ B;  1NTZ D;  1S5L E;  3A7O A;  3L73 D;  1L0N K;  3Q5P A;  1LTI C;  2GM4 A;  1SQP E;  2ZXE B;  1M1K Q;  3P8M C;  3W67 A;  3P7K A;  5K5G B;  1USE A;  3KZI H;  2FFD B;  2N9B A;  3L35 A;  1L0L G;  1KFM A;  2FYN B;  3RK3 B;  1L0L J;  1PPJ E;  1Q7Y Q;  5TJH A;  3ZDM A;  5M1B A;  1P84 I;  1NWQ A;  2MJZ A;  4B86 A;  3FGA D;  1P84 E;  3RK3 D;  1USD A;  1ZRT D;  3FX0 A;  3MHV A;  1D7M A;  3RK2 C;  4IL6 E;  2BEZ F;  2JDI H;  2POH A;  3D6Z A;  1ZME C;  2FYU D;  3CX5 I;  3EFG A;  3H1L E;  3CXH I;  4UB8 E;  1SQP G;  4LGD E;  1SQP J;  2QJK C;  3CXH E;  5AVZ B;  3JCU H;  1LT9 B;  1FZC B;  1N7S B;  1Y9B A;  1MZ9 A;  2CPB A;  1SQB E;  2KB7 P;  5CCH C;  2AXT E;  2AEM A;  2XV5 A;  2W8Z A;  1PPJ G;  4Y28 J;  1BGY E;  4PJ0 E;  1N7S D;  3VMX A;  3WUU A;  1YHQ P;  1NU1 E;  1FAV A;  2JEE A;  1NTK E;  3M0D A;  2P2U A;  1OX3 A;  1K9M Q;  1KIL C;  1H8A A;  2FXO A;  3H6P A;  4IFM A;  3H1L G;  3E7K A;  5AVY B;  2Q6Q A;  1FS0 E;  5KLI C;  4W80 A;  5C39 A;  4OVN F;  1LTS C;  1SQB G;  2B88 A;  4C7N B;  1SQB J;  2NRG A;  1S9K E;  2Y0E A;  2KZJ A;  1BGY G;  1Q82 Q;  3CX5 H;  3G9R A;  1VQL P;  2YNY A;  1NU1 G;  3S1K A;  1H0T B;  4XE5 B;  1NU1 J;  1KB9 I;  1GW4 A;  3O6Q B;  1NTK G;  1SQV J;  2QG4 A;  1NTK J;  2P58 A;  2B87 A;  3I5C A;  3H1I D;  3M9B A;  2WIT A;  1KB9 E;  3A5T A;  2JWD A;  2V7Q J;  5GTH H;  3B8E B;  2CK3 H;  1YTZ I;  2IZ1 A;  2FFD C;  1URQ D;  2VRS A;  3GHG A;  1RE3 A;  5H2F E;  3RK3 C;  3PP5 A;  1AV1 A;  3TYY A;  3CL3 D;  4GDO A;  2J5U A;  1FJP A;  1KFN A;  4TLF A;  3KPE A;  1RY3 A;  2A06 D;  1VQO P;  1AFO A;  3M9H A;  4LLH A;  3QH9 A;  5KAF E;  1T8Z A;  1HBW A;  4WBA A;  1RE4 A;  3FXE A;  5AW6 B;  3L74 E;  3CC4 P;  1RF0 C;  5AVS B;  2WQY C;  1KQG B;  2K9J B;  5GTI E;  1AVO A;  3VYI A;  2Q3E A;  2W6B A;  1Y8A A;  3CCL P;  1FOS F;  3GMA A;  3OJA B;  1N7S C;  1PGP A;  1L0L K;  2BCC J;  1DH3 A;  5L8R J;  4N78 D;  4U3F D;  1QVF O;  4PD4 D;  2WPS A;  2P1J A;  1E79 H;  2M0B A;  1YIJ P;  3GLM A;  2E5Y A;  1WRG A;  3NFQ A;  3N4X A;  2Q7C A;  1IFJ A;  1FDI A;  1OXZ A;  1M56 D;  3L74 G;  4XA4 A;  2E42 A;  3L73 J;  1SQP K;  3A0B E;  1PGO A;  3EFF K;  3MIW A;  1LNQ A;  1KQS O;  3CLQ A;  2KOG A;  1HJB A;  2QM7 A;  2OQQ A;  3CCV P;  3A0H E;  2O01 H;  1YIT P;  4I1L A;  4D6T D;  2LXB A;  1Q2N A;  1TU3 F;  1JM0 A;  5AVT B;  1OVU A;  1KMI Z;  2PAJ A;  3MUD A;  3BVH A;  1SQX E;  1BE3 E;  5CJ4 A;  1SQQ D;  2WSF J;  4RO0 A;  3HE5 A;  1URQ C;  2ZYG A;  1YQ4 C;  2QE7 H;  2FYU J;  3IR9 A;  1AQ5 A;  1NH4 A;  4Y99 B;  1PZQ A;  3HD7 A;  4YXW H;  1JMM A;  5KTB A;  1IJD B;  1SQB K;  2OTL P;  3H32 A;  3CCU P;  4WY4 A;  4WVZ A;  1L4A A;  1H89 A;  1NU1 K;  1SQV K;  3E1I A;  1NTK K;  2KS1 A;  3H1K E;  1SQX G;  1BE3 G;  1SQX J;  5B66 H;  1BE3 J;  2PGD A;  4ZKP A;  5AW8 B;  3E1R A;  1HTL C;  1IO4 A;  2XKM A;  4WB4 A;  2B87 B;  2N9Y B;  4H44 B;  1VQ6 P;  3ABV C;  1EDL A;  2E5T A;  4QMA A;  2ZAE B;  1U57 A;  2AEF A;  5AW0 B;  1OFC X;  3VMA A;  4BXL A;  1KYO I;  4H44 D;  2WSE J;  3GHG B;  1LTG C;  1KYO E;  4MN4 C;  1YYC A;  2Q3I A;  4JYB A;  1E5W A;  3H1K G;  3CX5 D;  3H1K J;  2R5D A;  1UIX A;  1QVG O;  1PFI A;  2W83 C;  3WU2 H;  2XZR A;  1SP4 A;  1GL2 A;  1JB0 J;  1QGK B;  5KJ7 A;  3R4Y A;  1BGY D;  4XFJ A;  2H89 C;  4O9B A;  1VDF A;  3CWB D;  1KQL A;  1EDI A;  4GIF A;  2IYP A;  1LTT C;  1N86 A;  3CCJ P;  4W7Y A;  1FZG A;  1PV3 A;  1X0T A;  2NZ2 A;  1GZL A;  1VF5 C;  1MFT A;  4UB6 H;  2IBZ E;  2ZYD A;  2XDJ A;  3L70 D;  1LWU C;  3SSU A;  4BRY A;  1AQT A;  1SS1 A;  4I6M C;  4N3Y B;  4TT3 H;  5TIS E;  3M0D C;  4Y99 C;  3C8V A;  5KLV D;  2LR2 A;  3TF5 A;  1VQ8 P;  1CZQ A;  4RJT A;  5AW7 B;  3SFE C;  4ZMD A;  3AEF C;  3VOP A;  3HUS A;  2C9N Y;  3L72 D;  3PH0 A;  2LXC B;  4KT0 J;  1AJY A;  1OWA A;  3PHL A;  2Q5U A;  2A45 H;  1PP9 E;  3P8C D;  3L71 E;  2NPS C;  2KK7 A;  3WMM 0;  2FYU K;  2WPV B;  4A7P A;  3NTN A;  3GF7 A;  5APS A;  2IBZ G;  1NOH A;  2HYN A;  3FXD A;  1VQN P;  1FJK A;  1GDT A;  1YBK A;  5CCG A;  3HE5 B;  4H44 C;  5AW3 B;  1YTZ T;  1ZV8 A;  5E79 H;  4U7J A;  2KLV A;  1YI2 P;  2H8P D;  3G71 P;  3S4R A;  2HOD A;  2O3J A;  1YJW P;  3HD7 B;  1GW3 A;  2RKL A;  1OZH A;  5AW1 B;  3GHG C;  4DCK A;  1RE3 C;  1GTW A;  3AED C;  5APY A;  1SQX K;  3H32 B;  3V4W A;  3RBZ A;  1IZN B;  1PP9 G;  2QIW A;  3HD7 D;  1PP9 J;  4WY4 B;  1SQQ J;  3L71 G;  1Q81 Q;  3QWO C;  1L4A B;  3L71 J;  1ZR2 A;  1HGZ A;  1IFD A;  4Z1M H;  2XND H;  1VL2 A;  2KS1 B;  1OVR A;  1T2K D;  4WY4 D;  3L75 E;  1L4A D;  2YO2 A;  5DJU B;  3AE7 C;  5KAI H;  2BEQ D;  1HWT C;  4DJG A;  2Y0D A;  1JOC A;  2OGU A;  3VMY A;  1S1C X;  1M90 Q;  3CC7 P;  1J1D C;  4JF7 A;  5CBO A;  3HTK A;  5B5E H;  1S5L H;  1A02 F;  1NTM D;  2KLU A;  4AUW A;  4OWF A;  3D70 A;  4JYC A;  2HPC B;  5APV A;  1SQV E;  2E43 A;  1S72 P;  1KC8 Q;  4NPF X;  1L0N D;  2GUV A;  3WUT A;  1U7M A;  1VQ7 P;  3L75 G;  1BCC D;  2E74 B;  3L75 J;  1NYH A;  4GOF A;  1X22 A;  1SFC B;  1JCC A;  1LJ2 A;  1GL2 B;  1WMK A;  1EZV D;  1P84 H;  2E74 D;  4L75 A;  2D2C B;  2JKV A;  1RH5 B;  5CHX A;  4IL6 H;  1SFC D;  2E76 B;  4PV1 B;  1KZU B;  3Q5R A;  3ITK A;  1GL2 D;  3V4Q A;  1ZXG A;  2WSC J;  1IFN A;  3SWF A;  3IN6 A;  5AVX B;  5KJ7 D;  1QEX A;  4UB8 H;  3V2R A;  2D2C D;  3Q5S A;  1KN7 A;  1R8E A;  2DW3 A;  2P67 A;  2E76 D;  2ITA A;  4PV1 D;  3TSI A;  3MUD C;  1FBM A;  3CXH H;  4ASV A;  1SQV G;  1LTJ C;  3V5B A;  2UWJ E;  2AXT H;  4BRY B;  1U7J A;  4ZKU A;  4PJ0 H;  1RQU A;  2BCC E;  1KIL E;  2JP3 A;  4IFD K;  1CI6 A;  3VP8 A;  2AEJ A;  1IK7 A;  2N1T A;  3O8Z A;  3AEC C;  1GU4 A;  2FYN C;  3H1J E;  3HUS B;  4K35 A;  1FZE A;  1MUU A;  1FZB A;  2BAS A;  2V7Q H;  2WZ7 A;  4L74 A;  1K05 A;  2IFM A;  3CMA P;  2ZT9 B;  2I8D A;  3F89 A;  1KV4 A;  2K3R A;  1JNM A;  2QRX A;  3LIE A;  4H13 B;  4I7Z B;  1ZW0 A;  3CCQ P;  1NTZ E;  3L73 E;  4M3L A;  4EOT A;  1J2J B;  2ZT9 D;  1PIX A;  4L73 A;  2ZYA A;  3AEB C;  5CBN A;  1GD2 E;  4H13 D;  5APQ A;  3MD0 A;  2WWW A;  1JO5 A;  3SWK A;  3L72 J;  1W5C E;  1M8O B;  1LT9 C;  1FZC C;  4HJG H;  2BCC G;  3CI9 A;  1ZR4 A;  4EYY Q;  2OYH A;  1SQQ K;  3RL0 B;  2HOD B;  1CW5 A;  3H1J G;  2R44 A;  1YJ9 P;  1KB9 H;  5CCG D;  3H1J J;  4GT1 A;  3HRN A;  3U1A A;  3RK3 E;  3TK1 A;  3P32 A;  3RL0 D;  3JC2 2;  3H1H D;  5CCH A;  1DIP A;  5H2F H;  1T6A A;  4HH2 A;  2R3S A;  2FYU E;  1NTZ G;  2E74 C;  3L73 G;  1NTZ J;  3BAT A;  1JY2 P;  2G3A A;  2JR8 A;  1SFC C;  1VQ9 P;  1PGQ A;  2XNX A;  3TGU D;  3M9Q A;  3CCR P;  2B89 A;  1GK4 A;  5KAF H;  2D2C C;  3BCC D;  2KNC A;  1S2E A;  5GTI H;  1K04 A;  3FWL A;  3JSV C;  3KXD A;  3CD6 P;  1T3J A;  3HTK B;  2KSE A;  3S9O A;  2O1J A;  1LP1 A;  3PJS K;  2IX7 C;  1BSN A;  1JY3 N;  1VQP P;  2YXR B;  3HE4 A;  5AW5 B;  3CCE P;  2KSJ A;  2FYU G;  1DD3 A;  4K3A A;  2WPR A;  1W2E A;  1L0L D;  3GW6 A;  3D6Y A;  2E75 B;  2YMY A;  1M7L A;  1RHZ B;  3AEG C;  1VQ5 P;  3HUS C;  2W90 A;  2E75 D;  2W27 A;  3FWN A;  3A0B H;  2QSI A;  2ZT9 C;  1KOR A;  1X79 B;  3IFM A;  4AYC A;  3RBX A;  4H13 C;  1YJN P;  3U59 A;  2WSS H;  1SQP D;  3H1I E;  3A0H H;  3M91 A;  3EQ2 A;  2KXP B;  1FU1 A;  2IZ0 A;  2QM8 A;  1BCC J;  2QJP B;  4DOJ A;  5AW4 B;  3OW2 O;  1PPJ D;  3MP7 B;  1FDO A;  5AVR B;  3AE9 C;  1RF0 A;  1G1I A;  2CPS A;  5AVU B;  1RF1 A;  3AE8 C;  3MGN A;  5APT A;  1P84 D;  2KUB A;  1NHL A;  2Z4E A;  1CI6 B;  1EDK A;  2A06 E;  2QJY B;  2FXM A;  2N1T B;  2YXQ B;  2HLO A;  2WTY A;  2HG5 D;  3LID A;  3K5B A;  1PL5 A;  3H1L D;  2N1T D;  3H1I G;  3H1I J;  3CXH D;  2WSE H;  1NJI Q;  1L2P A;  1G2C A;  5EFW B;  1SQB D;  3B5N A;  3EWK A;  3L4F A;  2H7H A;  4DZO A;  4PD4 I;  4LC1 A;  4U3F E;  1ZP0 C;  1OVV A;  1NKZ B;  1NU1 D;  2RN0 A;  4EDF A;  4W7Z A;  3LW5 J;  1SQV D;  4PD4 E;  3F5H A;  1NTK D;  4GKG A;  1VQM P;  3RK2 B;  1T3U A;  1Y47 A;  3T97 A;  2A06 G;  4I2L C;  2OYH B;  2IBZ I;  2H43 A;  1NTZ K;  1IFI A;  1G1J A;  1HJ0 A;  3RK2 D;  1R5L A;  1J1E B;  3V6I A;  1S4X A;  2K1A A;  2IPP A;  3G6E P;  1QL2 A;  3I56 P;  5BU8 B;  3TDK A;  1KYO H;  4KJM A;  3RGU A;  3V2P A;  1S9K D;  2ZVN B;  1URQ A;  2WVR A;  2W6A A;  4D6T E;  3KZI E;  4U3F G;  4U3F J;  3MZW B;  2R3C A;  4ASW A;  1KB9 D;  2FXP A;  1SQQ E;  3IF4 A;  2KNC B;  5AW9 B;  2W6J H;  3M06 A;  1RQV A;  4CPG A;  1HGV A;  1OW8 A;  3AE2 C;  5KLI B;  2J58 A;  1LP1 B;  2WMM A;  4OH8 B;  3Q1M A;  1GK6 A;  1JY2 N;  3HE4 B;  3OA7 A;  3JCU E;  1LT1 A;  2L91 A;  3W68 A;  3C9I A;  1GMJ A;  2C0X A;  4D6T G;  1K8A Q;  3BCC J;  4D6T J;  3M0A A;  2QJY C;  5TIS H;  2WT7 A;  3L74 D;  2LKM A;  1LTB C;  2R32 A;  1IFP A;  1NAY A;  1AA0 A;  3N7N A;  2QEX P;  5CJ0 A;  1SQQ G;  1NKN A;  3H25 A;  1NVO A;  1Q86 Q;  1JY3 P;  1HVV A;  1VQK P;  2WPQ A;  2ZJS E;  2M3E A;  3L37 A;  1RE4 C;  3AE4 C;  4EIJ A;  1XTC C;  1OIP A;  4ZNC A;  3II6 A;  4IFF A;  4H0L B;  3VP9 A;  1JEK A;  5AVW B;  2I1K A;  4KHX A;  4DT0 A;  4IOI H;  1QX8 A;  3TNU A;  4EI2 A;  4BWN A;  4HB1 A;  4H0L D;  5AVV B;  1EDJ A;  2K88 A;  1M1J A;  2OYH C;  1RF1 B;  3A3Y B;  2C0W A;  3CX5 E;  1KD1 Q;  2AXC A;  1J1E C;  3V2N A;  1N73 A;  3KHU A;  3B4S A;  1VQ4 P;  2O1K A;  4NPE A;  3RL0 g;  5GTH E;  1JTH A;  1HF9 A;  1LWU A;  3CWB E;  1G2C B;  3BAS A;  2OYI A;  3B5N B;  2JO1 A;  1SQX D;  1BE3 D;  2Z5I A;  1HUC A;  2YKQ A;  1IC2 A;  3B5N D;  1X9V A;  2YIU B;  3L70 E;  3H1L J;  2ZXX A;  3T97 B;  2Y9Z A;  5KLV E;  3A2A A;  3L36 A;  2H88 C;  2WSC H;  5AW2 B;  1N7L A;  2NPS A;  1UII A;  2Q9I A;  5APU A;  1BGY J;  3L72 E;  3KQG A;  5KKZ B;  2KI7 B;  2YKO A;  4YXD C;  3HD7 C;  1S5L X;  3CWB G;  4R4L A;  3CWB J;  2YO3 A;  3PTZ A;  3CME P;  3H1K D;  1GU5 A;  1LTA C;  3P8C E;  1URQ B;  3Q3D A;  1T2K C;  4WY4 C;  2V4H A;  1L4A C;  2M5A A;  3B71 A;  1M57 D;  3C1L A;  2OAR A;  3L70 G;  3L70 J;  4RES B;  1DEB A;  2JJL A;  2FYZ A;  1JY2 O;  2P10 A;  3PLN A;  5KLV G;  5KLV J;  2Z5H A;  4R4M A;  2QA4 P;  3AE5 C;  4H0L C;  3VN0 A;  1AVY A;  3PRJ A;  1KTM A;  2PRR A;  1JCD A;  4IL6 X;  1KYO D;  3L72 G;  1H88 A;  1EXI A;  3CCM P;  1RF1 C;  4GOE A;  1ZLL A;  1KQF B;  2IYO A;  4C46 A;  2WT7 B;  2OYO A;  4HYT B;  1ZRT E;  3G4S P;  1MKM A;  1NAF A;  1IK9 A;  3BRT B;  3CCS P;  1R5S A;  1GL2 C;  2HR3 A;  4WWI A;  3B5N C;  1K73 Q;  2KZI A;  1Z56 A;  1DX7 A;  5KJ7 C;  3SFD C;  4RKU J;  2E76 C;  2O01 J;  4PV1 C;  3L74 J;  1KIL A;  2IBZ D;  1NTM E;  3R2P A;  1NGM B;  1FZF A;  2YKP A;  2YIU C;  3AE1 C;  3TNU B;  5BVZ A;  3V2Q A;  1BDC A;  1BDD A;  1OMI A;  1M1J B;  2Y9Y A;  1L0N E;  4OGQ B;  1DEE G;  5B66 E;  3GG2 A;  3KDP B;  3VTP C;  4C7R A;  2L5G B;  1BCC E;  3NXS A;  1VPC A;  1FC2 C;  1EZV I;  4YTP C;  5KKZ C;  4OGQ D;  2FBW C;  3AE6 C;  1N73 B;  1EZV E;  2KP8 A;  4AQR D;  2P7J A;  2YMK A;  1PP9 D;  4HKZ H;  1VF5 B;  3L71 D;  2WSF H;  1LTJ A;  2I1J A;  3MTU E;  1EQ7 A;  1JTH B;  1LWU B;  2OYI B;  1NTM G;  2FY8 A;  1Q90 D;  1VF5 D;  1NTM J;  2XU6 A;  2FFD A;  4I7Z C;  1MV8 A;  2RMZ A;  1QLE D;  3AEE C;  1L0N G;  3VMZ A;  4L76 A;  1L0N J;  5BU5 A;  4YPC A;  1JMB A;  3WU2 E;  2PFX A;  2Q1K A;  2MKV A;  1BCC G;  1YQ3 C;  1W2B O;  2JWA A;  1N8R Q;  5CCG C;  1EZV G;  2NPS B;  5APX A;  1FZA A;  3RL0 C;  4NPD A;  1QL1 A;  2ZVO B;  2NPS D;  2IFN A;  1LT9 A;  3L75 D;  1FZC A;  3U1C A;  1N7S A;  4JBZ A;  1S3J A;  5KLV K;  1WT6 A;  5DJT B;  2GUS A;  4UB6 E;  2SPZ A;  2OTJ P;  2K37 A;  3AEA C;  2M5A B;  1ZN5 A;  3OAK A;  5CMZ A;  2HPC A;  1N2D C;  3GF3 A;  2QVA A;  2RH0 A;  2FKW B;  3BRV B;  1FDM A;  1A02 J;  4N78 E;  1PGJ A;  3CC2 P;  1JUN A;  2A45 I;  3SWY A;  1SFC A;  3USS A;  3UIA A;  1M1J C;  2OTK E;  3KYQ A;  1XTG B;  3G3Z A;  4OGQ C;  3H1H E;  2C9L Y;  2KYV A;  1X8Y A;  5APW A;  4JPZ B;  4C7N A;  1SVF A;  3LW5 H; 
#chains in the Genus database with same CATH homology
 3IR9 A;  2ZFC A;  2IFM A;  1AQ5 A;  1NH4 A;  4Y99 B;  3TNU A;  1J1D B;  1N73 C;  1JNM A;  1IFM A;  3HD7 A;  3LIE A;  5AVV B;  1JMM A;  5KTB A;  1IJD B;  1M1J A;  2OYH C;  1RF1 B;  1SQB K;  4M3L A;  2R5B A;  4EOT A;  1J2J B;  3H32 A;  3A3Y B;  1NO4 A;  4N6J A;  2HFE D;  1GD2 E;  2C0W A;  2OYI C;  4WY4 A;  5APQ A;  5CCH D;  1L4A A;  3MD0 A;  1J1E C;  2WWW A;  1JO5 A;  1H89 A;  1NU1 K;  1LT9 C;  1FZC C;  1SQV K;  3V2N A;  3E1I A;  1NTK K;  1N73 A;  3CI9 A;  2A45 G;  1ZR4 A;  1KIL B;  2O1K A;  1JY3 O;  2OYH A;  1SQQ K;  1SLQ A;  3RL0 B;  2HOD B;  1FOS E;  1CW5 A;  2M8R A;  5CCG D;  4ZKP A;  4GT1 A;  5AW8 B;  1JTH A;  1LWU A;  3HRN A;  3U1A A;  1G2C B;  1CSB A;  3BAS A;  2OYI A;  1KIL D;  2M3B A;  1HTL C;  3B5N B;  3TK1 A;  1IO4 A;  1HH0 A;  2J59 M;  2XKM A;  3P32 A;  4WB4 A;  3RL0 D;  2Z5I A;  3NMD A;  1HUC A;  5CCH A;  2YKQ A;  1IC2 A;  4HH2 A;  1MFZ A;  3B5N D;  5AW0 B;  3BAT A;  1X9V A;  1NTM K;  1JY2 P;  1SFC C;  2XNX A;  5AVQ B;  3M9Q A;  3GHG B;  1LTG C;  1LGH B;  1GK4 A;  2PP6 A;  1YYC A;  2Q3I A;  2N1T C;  1LTJ B;  3A7O A;  4JYB A;  3A2A A;  3L36 A;  1L0N K;  2WSC H;  1LTI C;  5AW2 B;  1N7L A;  2GM4 A;  1E5W A;  2NPS A;  2ZXE B;  2Q9I A;  5APU A;  2R5D A;  1PFI A;  3P8M C;  3KQG A;  3P7K A;  2XZR A;  2YKO A;  2FFD B;  3HD7 C;  1T3J A;  1SP4 A;  1GL2 A;  2N9B A;  3L35 A;  3HTK B;  2YO3 A;  2O1J A;  1KFM A;  3RK3 B;  1GU5 A;  5KJ7 A;  1LTA C;  2IX7 C;  3P8C E;  1URQ B;  1JY3 N;  1NWQ A;  1T2K C;  4O9B A;  2MJZ A;  5AW5 B;  3HE4 A;  4WY4 C;  1VDF A;  2KSJ A;  4B86 A;  1L4A C;  1KQL A;  2WPR A;  4GIF A;  1LTT C;  3RK3 D;  1W2E A;  2OAR A;  1N86 A;  4RES B;  3RK2 C;  1DEB A;  2YMY A;  4W7Y A;  1M7L A;  1FZG A;  2POH A;  2JJL A;  2FYZ A;  1JY2 O;  1GZL A;  3HUS C;  2Z5H A;  3EFG A;  3VN0 A;  2XDJ A;  2W27 A;  1LWU C;  4LGD E;  1JCD A;  4I6M C;  4N3Y B;  5AVZ B;  3M0D C;  1LT9 B;  1FZC B;  1X79 B;  3IFM A;  4Y99 C;  1H88 A;  1N7S B;  4AYC A;  1MZ9 A;  2CPB A;  2KB7 P;  3U59 A;  5CCH C;  1CZQ A;  5AW7 B;  2XV5 A;  1RF1 C;  3M91 A;  3EQ2 A;  3VOP A;  3HUS A;  1FU1 A;  2C9N Y;  3VMX A;  1N7S D;  1ZLL A;  2QM8 A;  1OWA A;  4C46 A;  1FAV A;  2JEE A;  2WT7 B;  4DOJ A;  5AW4 B;  2Q5U A;  4HYT B;  3M0D A;  2P2U A;  2A45 H;  5AVR B;  3P8C D;  1KIL C;  1G1I A;  1RF0 A;  1NAF A;  2CPS A;  5AVU B;  2NPS C;  1IK9 A;  1RF1 A;  1H8A A;  3WMM 0;  3BRT B;  2FYU K;  3MGN A;  5APT A;  3NTN A;  3H6P A;  5APS A;  1NHL A;  4IFM A;  2Z4E A;  5AVY B;  1NOH A;  1CI6 B;  1GL2 C;  2FXM A;  2HYN A;  3B5N C;  1FJK A;  2N1T B;  4W80 A;  1GDT A;  1Z56 A;  1DX7 A;  2HLO A;  2WTY A;  2HG5 D;  3LID A;  5CCG A;  5KJ7 C;  3HE5 B;  5AW3 B;  1LTS C;  1YTZ T;  4C7N B;  1KIL A;  1ZV8 A;  3R2P A;  2KLV A;  1S9K E;  2H8P D;  1FZF A;  2YKP A;  2N1T D;  2HOD A;  3TNU B;  5BVZ A;  2WSE H;  3V2Q A;  3HD7 B;  1GW3 A;  5AW1 B;  2YNY A;  1G2C A;  3GHG C;  4XE5 B;  1M1J B;  1RE3 C;  1GTW A;  1GW4 A;  3B5N A;  5APY A;  3L4F A;  1SQX K;  3I5C A;  2H7H A;  3H32 B;  3M9B A;  2WIT A;  3V4W A;  3KDP B;  3VTP C;  4C7R A;  3HD7 D;  2L5G B;  4DZO A;  4LC1 A;  3NXS A;  4WY4 B;  3A5T A;  1VPC A;  1NKZ B;  1L4A B;  1ZR2 A;  1HGZ A;  1IFD A;  4W7Z A;  3B8E B;  4GKG A;  3RK2 B;  1YTZ I;  1N73 B;  2FFD C;  2KP8 A;  4AQR D;  1T2K D;  2P7J A;  1URQ D;  1T3U A;  2VRS A;  4WY4 D;  3T97 A;  3GHG A;  4I2L C;  1RE3 A;  1L4A D;  2OYH B;  3RK3 C;  2YO2 A;  3PP5 A;  2WSF H;  1LTJ A;  2I1J A;  2H43 A;  1NTZ K;  1IFI A;  3MTU E;  1G1J A;  3TYY A;  1HWT C;  1EQ7 A;  3RK2 D;  3CL3 D;  1JTH B;  1LWU B;  1FJP A;  1KFN A;  2OYI B;  1JOC A;  3KPE A;  1J1E B;  1RY3 A;  1AFO A;  2IPP A;  3M9H A;  1QL2 A;  4LLH A;  3VMY A;  1T8Z A;  1HBW A;  4WBA A;  1J1D C;  1RE4 A;  4JF7 A;  2XU6 A;  5BU8 B;  2FFD A;  5AW6 B;  1RF0 C;  1MV8 A;  5AVS B;  3HTK A;  3V2P A;  3VMZ A;  1A02 F;  4AUW A;  1S9K D;  3VYI A;  5BU5 A;  1URQ A;  2W6A A;  2W6B A;  4JYC A;  2HPC B;  1FOS F;  5APV A;  2E43 A;  3OJA B;  1N7S C;  2R3C A;  1L0L K;  2GUV A;  5CCG C;  1DH3 A;  2NPS B;  4N78 D;  5AW9 B;  5APX A;  1FZA A;  3RL0 C;  1QL1 A;  1SFC B;  1JCC A;  3M06 A;  2WPS A;  2P1J A;  1GL2 B;  2NPS D;  1HGV A;  1WRG A;  3NFQ A;  3N4X A;  2Q7C A;  1IFJ A;  2IFN A;  1LT9 A;  1OXZ A;  2J58 A;  3U1C A;  1FZC A;  4OH8 B;  1N7S A;  5KLV K;  5CHX A;  1SFC D;  1WT6 A;  1KZU B;  2GUS A;  1GK6 A;  1GL2 D;  3V4Q A;  1JY2 N;  3HE4 B;  4XA4 A;  1IFN A;  3SWF A;  2E42 A;  3OA7 A;  1SQP K;  1ZN5 A;  5AVX B;  5KJ7 D;  3C9I A;  2C0X A;  3OAK A;  3V2R A;  2P67 A;  5CMZ A;  2HPC A;  3TSI A;  3MIW A;  1N2D C;  1FBM A;  3M0A A;  3CLQ A;  2WT7 A;  2KOG A;  1HJB A;  2QM7 A;  2LKM A;  1LTB C;  2FKW B;  3BRV B;  1LTJ C;  2R32 A;  1FDM A;  2O01 H;  3V5B A;  4I1L A;  3N7N A;  1A02 J;  4N78 E;  5CJ0 A;  1NKN A;  4ZKU A;  1JUN A;  2A45 I;  3SWY A;  1JY3 P;  1HVV A;  1SFC A;  5AVT B;  2WPQ A;  3L37 A;  2PAJ A;  1RE4 C;  4IFD K;  3MUD A;  1CI6 A;  3UIA A;  1M1J C;  3VP8 A;  4EIJ A;  3BVH A;  1XTC C;  2N1T A;  3KYQ A;  5CJ4 A;  1XTG B;  3O8Z A;  3G3Z A;  1GU4 A;  3HUS B;  2C9L Y;  2KYV A;  3HE5 A;  3II6 A;  4IFF A;  1FZE A;  1MUU A;  1X8Y A;  1FZB A;  1URQ C;  5APW A;  3VP9 A;  2BAS A;  2I1K A;  4KHX A;  5AVW B;  4C7N A;  1SVF A;  3LW5 H;  2WZ7 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...