2C0WA

Molecular structure of fd filamentous bacteriophage refined with respect to x-ray fibre diffraction
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Virus
molecule keywords COAT PROTEIN B
publication title Molecular Structure of Fd (F1, M13) Filamentous Bacteriophage Refined with Respect to X-Ray Fibre Diffraction and Solid-State NMR Data Supports Specific Models of Phage Assembly at the Bacterial Membrane.
pubmed doi rcsb
source organism Enterobacteria phage fd
total genus 19
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2005-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c0wA00
2MJZA 1HGZA 1HGVA 1HH0A 2C0WA 2CPSA 1IFJA 1IFDA 2C0XA 1NH4A 2CPBA 1FDMA 1IFIA
chains in the Genus database with same CATH superfamily
1BGYD 1J1DC 2P67A 1YYCA 1NKNA 3N4XA 4PV1C 1NU1G 4NPEA 3SWKA 2ZYAA 1BSNA 5KJ7D 1SQXG 1L4AD 3M9QA 1FE6A 2WT7A 4NPDA 1NTME 3AE6C 3H1ID 1SP4A 1NTKE 2J5UA 1EC5A 5CJ4A 2L5GB 4D6TJ 4HB1A 3L75E 2WPVB 4JYBA 3HE4B 4IL6E 1NYHA 1L4AB 3TK1A 4OWFA 2GUSA 3H1HE 2BEQD 1NTMK 3U59A 1SQQK 1Q7YQ 4U3FE 2Q3EA 5AVTB 1NTKK 1XTCC 3H6PA 3WUTA 2AEMA 3VOPA 4PD4H 4I6MC 1EXJA 3LIDA 3P8MC 4DOJA 5B5EH 3EQ2A 1SQPD 2OYOA 3MGNA 1U7MA 1BGYG 1IFNA 3ITKA 1SQBE 4W7YA 3MIWA 5APWA 4GODA 5APTA 3B5NC 5AVYB 2YNYA 2PAJA 3Q2YA 2O01N 4UB6E 2ZXXA 3H32B 2OYHB 4K3AA 1PGOA 1JY2P 2QJYC 1H88A 1A02F 3RK3C 3H1IG 3RGUA 2H88C 1KQGB 2FFDB 1HJ0A 2R3SA 2N1TC 2NPSD 1GK4A 1W2EA 1M1JC 5KKZC 1P84E 3AEFC 2W6AA 4OGQC 2K9JA 3KDPB 2MKVA 2SPZA 2K37A 1URQA 1N8RQ 1LTTC 1S2EA 2W83C 1L2PA 3AEGC 1G2CB 1GTWA 3TGUE 1YJNP 4BXLA 2XKMA 3RL0C 1GK6A 2NPSB 3HD7D 5CHXA 1LTSC 2WVRA 1JEKA 3P32A 3H1JJ 3W68A 1T6AA 2KP8A 1FU1A 4D6TE 1FZCB 3SWYA 2ZVOB 1VQNP 1SQPG 1IO4A 1K04A 2CPSA 5TISE 3OJAB 1L0LJ 1GDTA 4Y28J 4EIJA 3HD7B 1KB9I 5AVQB 1R5SA 2Z4EA 1N73C 5KAFH 3VMXA 5GTIH 3IAOA 2WSEJ 3L70D 5GTHE 1ZRTE 3E1RA 3KQGA 3L71D 4CPGA 3U1AA 1RF1B 3EFGA 1U7JA 2E74C 4ZNCA 4PJ0H 4C7NA 2C0XA 1DD3A 1RF0A 3WUUA 4GKGA 2WWWA 3CXHI 2XNXA 4LC1A 4UB8E 2QEXP 3FGAD 1WRGA 1CI6A 5B66E 2XDJA 3QH9A 1Q81Q 1S3JA 3A7OA 3D6ZA 3D71A 4TLFA 4L74A 3M0DA 3RK3E 2Y9YA 2P1JA 1NVOA 3BCCD 3NXSA 3HE4A 1KB9E 1YTZI 2BCCE 1BE3D 1SQPK 4I7ZB 1FOSE 2OARA 3AE4C 3R4YA 4ASWA 2QG4A 1L0NK 3WUVA 3MZWB 2LXBA 1CW5A 3LW5H 3CCUP 1KILC 3L70G 2OYIB 1N7SC 1Y9BA 2WPQA 3WU2H 1HBWA 2WT7B 2QE7H 3L73J 3L71G 1S9KE 3CX5H 1EZVD 2QJPB 1KYOD 1L0LE 3CXHE 1NTZE 3BATA 1SFCC 2M8RA 1EDKA 1M57D 5KLVE 3VMYA 1M56D 2E76D 1X0TA 1QX8A 2P2UA 2M5AA 5BU8B 3JCUH 3CWBJ 5CBOA 3RK2C 2ZVNB 1JTHB 1J1EC 4IL6X 2JEEA 3VP8A 1NTZK 1LWUC 1PGQA 2E76B 3BCCG 4DZOA 2N9BA 1QL2A 1JY3N 5KAIE 1BE3G 2YMYA 3OAKA 2Q9IA 1UIXA 3S9OA 3AE2C 4RESB 5H2FH 3NFQA 2YO3A 2NRGA 4DJGA 1NTMD 3L74J 1T8ZA 4BRYA 5B5EE 1GL2C 2FXOA 1NTKD 1HGVA 2NPSA 1OW7A 2M3EA 3L75D 3GHGB 1T2KC 3M9HA 2O1JA 3V2PA 3M91A 1NWQA 1FZCA 4EDFA 3CCLP 4DT0A 1FZBA 2PFXA 1EZVG 1LT9B 3Q3DA 3H1HD 2ZFCA 3I5CA 2G3AA 3V5BA 1BDCA 3L72J 2IYOA 4H44D 3HD7A 4U3FD 2Q5UA 1SQQJ 2AEFA 2Y0DA 2AXCA 3N7NA 1M7LA 1E5WA 1YJ9P 2D2CB 1FDIA 2E42A 2W6BA 2FYNC 4WY4C 2RKLA 3VN0A 1NAYA 2WTYA 2Q6QA 1KILE 3U1CA 1VF5D 1SQBD 2E5YA 1M8OB 3II6A 3GLMA 3HE5B 2Y0CA 3LW5J 5APQA 3Q1MA 4H13D 5AVRB 1NU1J 2IDBA 1LNQA 2ZAEB 3M06A 3CL3D 5CCGC 3AEDC 1NTMG 3WMM0 2WZ7A 1SQXJ 1VF5B 2K3RA 1M1KQ 2KZJA 1NTKG 2QM7A 3PTZA 4MN4C 1QGKB 3HUSB 3PP5A 2W8ZA 3L75G 2H89C 1FBMA 5CMZA 1P84D 5AW4B 3HTKA 2WPSA 1RQUA 1RY3A 1IFPA 1PP9E 4H13B 2XZRA 4WVZA 1SVFA 1PGJA 3P8CE 1QL1A 3KHUA 1MUUA 4JQ0D 5KAFE 3H1HG 2W6JH 3A0HE 5GTIE 4C7NB 3TGUD 4H0LC 1FZGA 4YPCA 3G4SP 4U3FG 3C1LA 3V2QA 2FYUE 1BCCD 5APVA 2R44A 1AA0A 1MKMA 1S5LX 2ZT9C 3GMAA 4AYCA 2FKWB 1J1DB 3PRJA 4D6TD 2HPCB 2OYIA 3Q5PA 1CI6B 2YKPA 1LTIC 3V6IA 1SQBG 1GW4A 1BGYJ 2WSEH 5AW8B 2JWDA 2LXCB 4BWNA 5KJ7C 5AW9B 1P84I 3TDKA 1L4AC 1ZRTD 1WT6A 3O6QB 1LTBC 2IZ1A 1PIXA 5AW5B 1K9MQ 2P58A 4C46A 1PZQA 3H1IJ 1A02J 4TT3H 2M3BA 1JTHA 4RJTA 1EDIA 5DJUB 4Y99B 2A45I 3L36A 1EDLA 2PP6A 4C7RA 2KI7B 4N78D 4WBAA 1FJPA 3MTUE 4LLHA 4N3YB 4XFJA 3TGUG 1JB0J 4R4MA 3WU2E 2V7QH 3S4RA 1L0ND 3VTPC 2KK7A 2QM8A 3KZIE 2HLOA 1SS1A 1BCCG 3A2AA 3CX5E 3JC22 3RK3D 3CCSP 3VP9A 2M5AB 2VRSA 4D6TG 2OYHC 3GHGA 2N1TD 3CMAP 1NO4A 1KB9D 4GT1A 2LKMA 2BCCD 3VYIA 3RBXA 2QSIA 4OGQD 1VQLP 1KV4A 1SQPJ 2JWAA 1LT9A 2FFDC 1SQBK 3TNUA 2O3JA 3V4QA 2Z5IA 2QJYB 4K35A 5AW3B 1RE4C 1AVYA 3RL0D 1M1JB 2KLUA 1JY3O 4HH2A 2ZJSE 4BRYB 1S9KD 1AQTA 5AW2B 1ZMEC 1WMKA 1L0LD 3CXHD 1DEBA 1NTZD 2QVAA 1OVRA 3KYQA 5E79H 5KLVD 1HWTC 4M3LA 2E5TA 2FBWC 1NGMB 1PL5A 3I56P 2OGUA 1E79H 3HE5A 1KQFB 4GOEA 4AUWA 2E75C 3MUDA 3B4SA 1L0NG 3H1KJ 1KYOH 1W2BO 1NHLA 1Q2NA 3HUSA 3IR9A 4IFMA 1K05A 1KTMA 2HG5D 2BCCG 2E74D 3VMAA 1S5LE 1N73B 1RE3C 1RQVA 2AXTH 4ASVA 3AEBC 1RF1C 3A5TA 1FS0E 1LTJC 2IPPA 1KZUB 1JCCA 4I1LA 4RKUJ 4Z1MH 1ZR4A 3A0BH 3IN6A 3AE5C 2HR3A 3AE3C 3M0AA 3L70J 2HPCA 4R4LA 2C9NY 2O01H 3L71J 1IJDB 2OTJP 1HUCA 1L0LG 5CCHC 3HTKB 1GZLA 1KFMA 1NTZG 2V7QJ 2QIWA 1FJKA 3L37A 5K5GB 2ITAA 3AE8C 5KLVG 2KZIA 1YTZT 1VQPP 1NAFA 1KFNA 1U57A 3CCEP 2A06E 3PHLA 1LP1B 1S4XA 2IX7C 3F89A 3AE7C 3O6QA 1QLED 3CMEP 3OA7A 1KILD 4JPZB 4GIFA 1N7SD 1FC2C 4KJMA 1ZR2A 1HTLC 4PD4I 3CCRP 5CBNA 5APUA 1LTGC 3H1JE 1YHQP 1USDA 2R32A 3BCCJ 2H43A 2OTLP 1SFCD 1KILB 5AW1B 1N7SB 2JJLA 1PFIA 4RO0A 4YXWH 4OH8B 1QVFO 5APSA 2POHA 3H1KE 3G9RA 3RK2D 2QJKC 1PP9D 1SFCB 1Q86Q 3P8CD 1SQVJ 5AVSB 2KYVA 3B5NA 3TSIA 1AQ5A 4JYCA 1PPJE 1YIJP 4WB4A 1L0LK 4YXDC 1AFOA 1JY2N 2HODA 3RK2B 2FYUD 5KLVK 2IYPA 3FWNA 2J58A 4EYYQ 1JO5A 2YIUB 4ZKPA 1FDOA 2N1TA 4PD4E 1MFTA 1IK9A 1M1JA 1LWUB 2MJZA 1MZ9A 5AW0B 2RH0A 2JP3A 2KSEA 1T2KD 2KOGA 2G8YA 1FZAA 3CCVP 5AW7B 3EWKA 4XE5B 1OX3A 3CCJP 1OZHA 3EFFK 1LTAC 2RMZA 1IK7A 2Q3IA 3TNUB 4JF7A 1AV1A 1G1JA 3SSUA 1KN7A 1VQ8P 3E7KA 1NTMJ 2O01J 1S72P 1NTKJ 1URQC 1Y47A 3H1LJ 4YTPC 4WY4D 3L75J 1PP9G 1SLQA 3MP7B 4EOTA 2FYZA 2D2CC 1VQ9P 3Q5SA 3ZDMA 1RH5B 3L73E 1M90Q 1N73A 4H44B 1GD2E 1T3JA 3H1HJ 1S1CX 2FYUG 2FXMA 5TJHA 5AVXB 1EQ7A 2FYNB 4U3FJ 2YXQB 4WY4B 5CCGD 3CX5D 3CC2P 2KXPB 1TU3F 5E79E 1HF9A 1HJBA 1W5CE 2IBZE 3CWBE 1VF5C 5AVZB 5APYA 1SQVE 2R3CA 5B66H 2KS1A 4QMAA 2RN0A 4JBZA 4H0LD 4HKZH 3SWFA 1KB9H 2JO1A 3D70A 2KNCB 1NKZB 4PV1D 3USSA 1H89A 2ZT9D 1LP1A 1JUNA 1RF0C 5KLIB 3L74E 3L4FA 1RHZB 2LR2A 5M1BA 2W90A 2R5BA 4PJ0E 4H0LB 4XA4A 1PV3A 3V2RA 1DIPA 3FXEA 3CX5I 4PV1B 3PH0A 2ZT9B 3A0BE 3M0DC 3TGUJ 2OTKE 1KILA 3CI9A 3T97A 1N7SA 3CXHH 3L72E 3P7KA 2FYUK 1KD1Q 1MV8A 1SQQE 2C9LY 2FY8A 1BCCJ 1DX7A 3IFMA 3QWOC 3H25A 3GF7A 3H1LE 2V4HA 3IF4A 5APXA 1KC8Q 1X79B 3MD0A 1SFCA 1H0TB 2YXRB 1YJWP 4AQRD 4EI2A 4Y99C 3LIEA 3O8ZA 2HFED 1JOCA 2XV5A 3D6YA 3B5ND 5KAIH 2CK3H 4W7ZA 1DEEG 2E43A 2N9YB 1CSBA 1KORA 1NU1E 2A45G 3TYYA 3RL0g 2YO2A 1LWUA 3G3ZA 3UIAA 2C0WA 1SQXE 1J2JB 2WQYC 2Y0EA 1HVVA 1EDJA 2WSCH 3OW2O 2W27A 3C9IA 2YKOA 3B5NB 4HYTB 1GU5A 1VDFA 4WWIA 3B8EB 1GL2A 1IFJA 2A06D 3V4WA 1N86A 2BASA 1NU1K 3JCUE 3GG2A 4KT0J 1IFDA 2HODB 3FXDA 1JNMA 2HYNA 2PRRA 3PJSK 3RK3B 1L0NJ 3CCMP 1SQXK 4LGDE 1ZXGA 3BRVB 1JY2O 1OW8A 1JY3P 1CZQA 3FX0A 2N1TB 3H1JD 5KKZB 1HH0A 1VQ7P 4OGQB 1ZLLA 2BCCJ 1K8AQ 2NPSC 2GUVA 2IZ0A 3B71A 1NJIQ 5AVWB 5H2FE 3CLQA 1BGYE 5C39A 3H1KD 1FZCC 2E75D 3RL0B 1DD4A 1YQ3C 4WY4A 5EFWB 1BCCE 1R8EA 2B87A 1BDDA 1AJYA 3AEAC 1IFIA 3HD7C 2ZYDA 1JM0A 1IFMA 1PPJD 3MHVA 3H1IE 2YKQA 2R5DA 1X8YA 2IFNA 2E75B 1NTZJ 1OVUA 5CCGA 5KLVJ 3L35A 2K9YA 4OVNF 1FOSF 4ZMDA 1LGHB 4PD4D 2A06G 5AW6B 2Q1KA 3F5HA 3CPWO 2P7JA 2KNCA 1OXZA 3A0HH 1G1IA 1N2DC 2YMKA 3CCQP 1Q82Q 3H1JG 1Q90D 3I55P 2E74B 4N6JA 1LTJB 3AE1C 3G6EP 1YITP 5CCHD 2PGDA 1BSHA 5AVVB 3R2PA 1VQOP 4L73A 4IOIH 4N78E 3V2NA 4A7PA 1SQPE 2KS1B 2KLVA 2KUBA 2JKVA 3H1KG 4W80A 3TF5A 2O1KA 4I2LC 1DH3A 1FDMA 1L0NE 1GW3A 3BVHA 1D7MA 4KHXA 2H7HA 4IL6H 5L8RJ 1ZW0A 3A3YB 2WSCJ 1VQMP 4I7ZC 2XU6A 1H8AA 3RBZA 3L73D 3E1IA 3AE9C 1PPJG 1H0TA 3AEEC 3AECC 5KJ7A 1VL2A 1L4AA 1OVVA 4L75A 5BVZA 2OYIC 2KIKA 3FWLA 2FXPA 4B86A 3SFDC 1YQ4C 5BU5A 2BEZF 1BE3J 1Z56A 1IZNB 3C8VA 3GF3A 1OWAA 2ZYGA 3T97B 2IBZD 3CWBD 1KQSO 2QJPC 3SFEC 4U7JA 1OFCX 1SQVD 3PLNA 3KZIH 2J59M 1VQ4P 3G71P 1VPCA 2KSJA 4UB6H 2IFMA 1FAVA 1MFZA 2OQQA 1EXIA 2P10A 1LT1A 1OIPA 2WSFH 1HGZA 1GU4A 2QJKB 3K5BA 3H32A 2OYHA 2B88A 3L74D 1P84H 2E76C 1JCDA 3CD6P 3M9BA 2ZXEB 3CC4P 1J1EB 2XNDH 1GL2D 2YIUC 2QRXA 2FFDA 3BRTB 3JSVC 2L91A 1PP9J 3L73G 1R5LA 3Q5RA 1QVGO 3L70E 1RE4A 2A45H 4GDOA 2B9BA 1Y8AA 2QA4P 3L71E 2NZ2A 2IBZI 3L72D 3GHGC 2AEJA 3BASA 4DCKA 2WMMA 2Q7CA 1G2CA 1SQQD 2FYUJ 1GL2B 1VQKP 2H8PD 2UWJE 3H1LD 1EZVI 1LT9C 1XTGB 2GM4A 1URQD 5TISH 4L76A 2IBZG 3CWBG 1KYOI 3CC7P 4NPFX 3VMZA 1SQVG 1USEA 3HRNA 2JDIH 1K73Q 1KQLA 2I8DA 2D2CD 4IFFA 1YBKA 1X9VA 5AVUB 2Z5HA 1UIIA 1X22A 1YI2P 3W67A 1NH4A 1N7LA 2K9JB 5GTHH 1ZOYC 1KMIZ 3NMDA 2Y9ZA 3BCCE 1JMMA 1URQB 4ZKUA 1S5LH 1NU1D 4H44C 1BE3E 1ZN5A 3L74G 1OW6A 2WITA 2B89A 1SQXD 5KTBA 1OMIA 1FZFA 1GMJA 4IFDK 3KPEA 1RE3A 1PGPA 2GA1A 2I1JA 2B87B 1RF1A 1T3UA 3MUDC 1LTJA 1ZP0C 4O9BA 2DW3A 4UB8H 2WSSH 3KXDA 4HJGH 2CPBA 3HUSC 1VQ6P 1SQBJ 5DJTB 2K1AA 3L72G 2WPRA 3S1KA 1EZVE 2I1KA 1SQQG 1KYOE 4H13C 1VQ5P 2KB7P 1JMBA 2K88A 3H1LG 1ZV8A 5CCHA 5CJ0A 1AVOA 4GOFA 2M0BA 1NOHA 2JR8A 1LJ2A 3ABVC 1FZEA 2WSFJ 1QEXA 3GW6A 1SQVK 1IC2A 5KLIC 3NTNA 2AXTE
chains in the Genus database with same CATH topology
1J1DC 3BRVB 1HGVA 2NPSA 2P67A 1JY2O 1JY3P 1YTZT 1CZQA 1NAFA 2N1TB 1YYCA 1HH0A 1NKNA 3GHGB 1T2KC 3N4XA 3M9HA 2O1JA 1KFNA 3V2PA 3M91A 1NWQA 1FZCA 1ZLLA 5KJ7D 2IX7C 1FZBA 2NPSC 2GUVA 1L4AD 1LT9B 3M9QA 3OA7A 2WT7A 5AVWB 2ZFCA 1KILD 3I5CA 4GIFA 1N7SD 3V5BA 3CLQA 1SP4A 1ZR2A 1HTLC 3HD7A 2Q5UA 1FZCC 5APUA 3RL0B 5CJ4A 2L5GB 1LTGC 4WY4A 3N7NA 1M7LA 4JYBA 1E5WA 2R32A 3HE4B 2H43A 1IFIA 1SFCD 3HD7C 1L4AB 2E42A 2W6BA 3TK1A 4WY4C 1KILB 5AW1B 3VN0A 1N7SB 2GUSA 2JJLA 2WTYA 3U1CA 1IFMA 1PFIA 2YKQA 2R5DA 1X8YA 1NTMK 3U59A 1SQQK 2IFNA 4OH8B 5APSA 2POHA 5CCGA 3II6A 5AVTB 3RK2D 1NTKK 1XTCC 3H6PA 3L35A 3VOPA 1FOSF 3HE5B 5APQA 4I6MC 1LGHB 1SFCB 3LIDA 3P8CD 3P8MC 5AVRB 5AW6B 4DOJA 5AVSB 2KYVA 2P7JA 3B5NA 1OXZA 3M06A 3EQ2A 3TSIA 3CL3D 5CCGC 1AQ5A 1G1IA 3WMM0 3MGNA 1N2DC 2WZ7A 4JYCA 2QM7A 4WB4A 1L0LK 1IFNA 1AFOA 1JY2N 4W7YA 3MIWA 3HUSB 2HODA 3PP5A 3RK2B 5APWA 5APTA 1FBMA 3B5NC 5CMZA 5AVYB 4N6JA 2YNYA 5AW4B 5KLVK 1LTJB 3HTKA 2J58A 2WPSA 2PAJA 5CCHD 1JO5A 1RY3A 3H32B 4ZKPA 2XZRA 2OYHB 5AVVB 2N1TA 3R2PA 1SVFA 3P8CE 1IK9A 1M1JA 1QL1A 1LWUB 2MJZA 1MUUA 4N78E 1JY2P 1MZ9A 3V2NA 1H88A 1A02F 5AW0B 2KLVA 3RK3C 1T2KD 4C7NB 2KOGA 1FZAA 1FZGA 5AW7B 2FFDB 4W80A 3V2QA 2N1TC 2NPSD 1GK4A 2O1KA 1W2EA 4I2LC 1DH3A 1M1JC 1FDMA 1GW3A 3BVHA 5APVA 2W6AA 4KHXA 2H7HA 3A3YB 4XE5B 4AYCA 2FKWB 3KDPB 1J1DB 2XU6A 1H8AA 1LTAC 1URQA 2HPCB 2OYIA 2Q3IA 1LTTC 3E1IA 1CI6B 2YKPA 3TNUB 4JF7A 1G1JA 1LTIC 1G2CB 1GTWA 5KJ7A 2XKMA 1L4AA 3RL0C 1GK6A 2NPSB 1GW4A 3HD7D 1URQC 5CHXA 5BVZA 2OYIC 1LTSC 2WSEH 4WY4D 5AW8B 4B86A 3P32A 1SLQA 5BU5A 4EOTA 2FYZA 2KP8A 1FU1A 1Z56A 5AW9B 5KJ7C 1FZCB 3SWYA 1L4AC 1OWAA 1WT6A 1LTBC 1IO4A 1N73A 5AW5B 2CPSA 1GD2E 1T3JA 3OJAB 4C46A 1GDTA 2J59M 1A02J 4EIJA 3HD7B 2M3BA 1VPCA 2KSJA 2FXMA 5AVQB 1JTHA 5AVXB 1EQ7A 2IFMA 5CCGD 4WY4B 2Z4EA 4Y99B 1FAVA 1MFZA 2A45I 3L36A 1N73C 2PP6A 4C7RA 3VMXA 4N78D 2WSFH 4WBAA 1HJBA 1FJPA 1HGZA 1GU4A 3MTUE 4LLHA 4N3YB 3H32A 5AVZB 5APYA 2OYHA 3KQGA 2R3CA 3U1AA 1RF1B 3VTPC 2QM8A 3EFGA 1JCDA 2HLOA 3M9BA 2ZXEB 3A2AA 4C7NA 2C0XA 3RK3D 1J1EB 1GL2D 3VP9A 2VRSA 1RF0A 2FFDA 4GKGA 2OYHC 3BRTB 3GHGA 3SWFA 2N1TD 2WWWA 1NO4A 4GT1A 2LKMA 1RE4A 1NKZB 2A45H 2XNXA 3VYIA 1H89A 4LC1A 1JUNA 1LT9A 1RF0C 2FFDC 3L4FA 1WRGA 1SQBK 1CI6A 3TNUA 3GHGC 3V4QA 2XDJA 2Z5IA 3BASA 3A7OA 2Q7CA 1G2CA 5AW3B 1GL2B 1RE4C 3M0DA 2R5BA 2H8PD 4XA4A 3V2RA 2P1JA 1LT9C 3RL0D 3NXSA 1XTGB 1M1JB 1URQD 2GM4A 3HE4A 1YTZI 1JY3O 4HH2A 3VMZA 1SQPK 3M0DC 1FOSE 3HRNA 1S9KD 1KQLA 2OARA 5AW2B 1KILA 3CI9A 3T97A 4IFFA 1N7SA 1X9VA 3P7KA 5AVUB 1DEBA 1L0NK 2FYUK 2Z5HA 1MV8A 2C9LY 3KYQA 1NH4A 1N7LA 1DX7A 1CW5A 3IFMA 3LW5H 1HWTC 4M3LA 3NMDA 1JMMA 1URQB 3HE5A 1KILC 4ZKUA 2OYIB 1N7SC 2WPQA 5APXA 1HBWA 2WT7B 1X79B 3MD0A 1SFCA 4AUWA 1ZN5A 3MUDA 1S9KE 2WITA 4AQRD 5KTBA 1FZFA 4IFDK 3KPEA 4Y99C 1RE3A 2I1JA 3BATA 3LIEA 1NHLA 3HUSA 3O8ZA 1SFCC 2M8RA 3IR9A 2HFED 1RF1A 4IFMA 1T3UA 1JOCA 2XV5A 3VMYA 1LTJA 2HG5D 3B5ND 2P2UA 4O9BA 4W7ZA 2E43A 1CSBA 1N73B 2A45G 3TYYA 5BU8B 1RE3C 2YO2A 1LWUA 2CPBA 3HUSC 3G3ZA 3UIAA 3RK2C 1RF1C 2C0WA 2WPRA 3A5TA 1J2JB 1LTJC 2I1KA 1JTHB 1J1EC 2IPPA 1KZUB 1HVVA 1JCCA 2JEEA 2KB7P 4I1LA 3VP8A 1NTZK 1LWUC 2WSCH 4DZOA 2W27A 3C9IA 2YKOA 3B5NB 1ZV8A 4HYTB 2N9BA 5CCHA 1ZR4A 1GU5A 1VDFA 1QL2A 5CJ0A 3B8EB 1GL2A 1JY3N 1NOHA 2YMYA 3OAKA 3M0AA 2Q9IA 1IFJA 2HPCA 1FZEA 3V4WA 1SQVK 1IC2A 1N86A 1NU1K 2BASA 2C9NY 4RESB 2O01H 1IFDA 2HODB 3NTNA 3NFQA 2YO3A 1JNMA 2HYNA 1IJDB 1HUCA 3RK3B 1T8ZA 5CCHC 3HTKB 1GZLA 1KFMA 1SQXK 1FJKA 4LGDE 3L37A 1GL2C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2MJZ A;  1HGZ A;  1HGV A;  1HH0 A;  2C0W A;  2CPS A;  1IFJ A;  1IFD A;  2C0X A;  1NH4 A;  2CPB A;  1FDM A;  1IFI A; 
#chains in the Genus database with same CATH topology
 1BGY D;  1J1D C;  2P67 A;  1YYC A;  1NKN A;  3N4X A;  4PV1 C;  1NU1 G;  4NPE A;  3SWK A;  2ZYA A;  1BSN A;  5KJ7 D;  1SQX G;  1L4A D;  3M9Q A;  1FE6 A;  2WT7 A;  4NPD A;  1NTM E;  3AE6 C;  3H1I D;  1SP4 A;  1NTK E;  2J5U A;  1EC5 A;  5CJ4 A;  2L5G B;  4D6T J;  4HB1 A;  3L75 E;  2WPV B;  4JYB A;  3HE4 B;  4IL6 E;  1NYH A;  1L4A B;  3TK1 A;  4OWF A;  2GUS A;  3H1H E;  2BEQ D;  1NTM K;  3U59 A;  1SQQ K;  1Q7Y Q;  4U3F E;  2Q3E A;  5AVT B;  1NTK K;  1XTC C;  3H6P A;  3WUT A;  2AEM A;  3VOP A;  4PD4 H;  4I6M C;  1EXJ A;  3LID A;  3P8M C;  4DOJ A;  5B5E H;  3EQ2 A;  1SQP D;  2OYO A;  3MGN A;  1U7M A;  1BGY G;  1IFN A;  3ITK A;  1SQB E;  4W7Y A;  3MIW A;  5APW A;  4GOD A;  5APT A;  3B5N C;  5AVY B;  2YNY A;  2PAJ A;  3Q2Y A;  2O01 N;  4UB6 E;  2ZXX A;  3H32 B;  2OYH B;  4K3A A;  1PGO A;  1JY2 P;  2QJY C;  1H88 A;  1A02 F;  3RK3 C;  3H1I G;  3RGU A;  2H88 C;  1KQG B;  2FFD B;  1HJ0 A;  2R3S A;  2N1T C;  2NPS D;  1GK4 A;  1W2E A;  1M1J C;  5KKZ C;  1P84 E;  3AEF C;  2W6A A;  4OGQ C;  2K9J A;  3KDP B;  2MKV A;  2SPZ A;  2K37 A;  1URQ A;  1N8R Q;  1LTT C;  1S2E A;  2W83 C;  1L2P A;  3AEG C;  1G2C B;  1GTW A;  3TGU E;  1YJN P;  4BXL A;  2XKM A;  3RL0 C;  1GK6 A;  2NPS B;  3HD7 D;  5CHX A;  1LTS C;  2WVR A;  1JEK A;  3P32 A;  3H1J J;  3W68 A;  1T6A A;  2KP8 A;  1FU1 A;  4D6T E;  1FZC B;  3SWY A;  2ZVO B;  1VQN P;  1SQP G;  1IO4 A;  1K04 A;  2CPS A;  5TIS E;  3OJA B;  1L0L J;  1GDT A;  4Y28 J;  4EIJ A;  3HD7 B;  1KB9 I;  5AVQ B;  1R5S A;  2Z4E A;  1N73 C;  5KAF H;  3VMX A;  5GTI H;  3IAO A;  2WSE J;  3L70 D;  5GTH E;  1ZRT E;  3E1R A;  3KQG A;  3L71 D;  4CPG A;  3U1A A;  1RF1 B;  3EFG A;  1U7J A;  2E74 C;  4ZNC A;  4PJ0 H;  4C7N A;  2C0X A;  1DD3 A;  1RF0 A;  3WUU A;  4GKG A;  2WWW A;  3CXH I;  2XNX A;  4LC1 A;  4UB8 E;  2QEX P;  3FGA D;  1WRG A;  1CI6 A;  5B66 E;  2XDJ A;  3QH9 A;  1Q81 Q;  1S3J A;  3A7O A;  3D6Z A;  3D71 A;  4TLF A;  4L74 A;  3M0D A;  3RK3 E;  2Y9Y A;  2P1J A;  1NVO A;  3BCC D;  3NXS A;  3HE4 A;  1KB9 E;  1YTZ I;  2BCC E;  1BE3 D;  1SQP K;  4I7Z B;  1FOS E;  2OAR A;  3AE4 C;  3R4Y A;  4ASW A;  2QG4 A;  1L0N K;  3WUV A;  3MZW B;  2LXB A;  1CW5 A;  3LW5 H;  3CCU P;  1KIL C;  3L70 G;  2OYI B;  1N7S C;  1Y9B A;  2WPQ A;  3WU2 H;  1HBW A;  2WT7 B;  2QE7 H;  3L73 J;  3L71 G;  1S9K E;  3CX5 H;  1EZV D;  2QJP B;  1KYO D;  1L0L E;  3CXH E;  1NTZ E;  3BAT A;  1SFC C;  2M8R A;  1EDK A;  1M57 D;  5KLV E;  3VMY A;  1M56 D;  2E76 D;  1X0T A;  1QX8 A;  2P2U A;  2M5A A;  5BU8 B;  3JCU H;  3CWB J;  5CBO A;  3RK2 C;  2ZVN B;  1JTH B;  1J1E C;  4IL6 X;  2JEE A;  3VP8 A;  1NTZ K;  1LWU C;  1PGQ A;  2E76 B;  3BCC G;  4DZO A;  2N9B A;  1QL2 A;  1JY3 N;  5KAI E;  1BE3 G;  2YMY A;  3OAK A;  2Q9I A;  1UIX A;  3S9O A;  3AE2 C;  4RES B;  5H2F H;  3NFQ A;  2YO3 A;  2NRG A;  4DJG A;  1NTM D;  3L74 J;  1T8Z A;  4BRY A;  5B5E E;  1GL2 C;  2FXO A;  1NTK D;  1HGV A;  2NPS A;  1OW7 A;  2M3E A;  3L75 D;  3GHG B;  1T2K C;  3M9H A;  2O1J A;  3V2P A;  3M91 A;  1NWQ A;  1FZC A;  4EDF A;  3CCL P;  4DT0 A;  1FZB A;  2PFX A;  1EZV G;  1LT9 B;  3Q3D A;  3H1H D;  2ZFC A;  3I5C A;  2G3A A;  3V5B A;  1BDC A;  3L72 J;  2IYO A;  4H44 D;  3HD7 A;  4U3F D;  2Q5U A;  1SQQ J;  2AEF A;  2Y0D A;  2AXC A;  3N7N A;  1M7L A;  1E5W A;  1YJ9 P;  2D2C B;  1FDI A;  2E42 A;  2W6B A;  2FYN C;  4WY4 C;  2RKL A;  3VN0 A;  1NAY A;  2WTY A;  2Q6Q A;  1KIL E;  3U1C A;  1VF5 D;  1SQB D;  2E5Y A;  1M8O B;  3II6 A;  3GLM A;  3HE5 B;  2Y0C A;  3LW5 J;  5APQ A;  3Q1M A;  4H13 D;  5AVR B;  1NU1 J;  2IDB A;  1LNQ A;  2ZAE B;  3M06 A;  3CL3 D;  5CCG C;  3AED C;  1NTM G;  3WMM 0;  2WZ7 A;  1SQX J;  1VF5 B;  2K3R A;  1M1K Q;  2KZJ A;  1NTK G;  2QM7 A;  3PTZ A;  4MN4 C;  1QGK B;  3HUS B;  3PP5 A;  2W8Z A;  3L75 G;  2H89 C;  1FBM A;  5CMZ A;  1P84 D;  5AW4 B;  3HTK A;  2WPS A;  1RQU A;  1RY3 A;  1IFP A;  1PP9 E;  4H13 B;  2XZR A;  4WVZ A;  1SVF A;  1PGJ A;  3P8C E;  1QL1 A;  3KHU A;  1MUU A;  4JQ0 D;  5KAF E;  3H1H G;  2W6J H;  3A0H E;  5GTI E;  4C7N B;  3TGU D;  4H0L C;  1FZG A;  4YPC A;  3G4S P;  4U3F G;  3C1L A;  3V2Q A;  2FYU E;  1BCC D;  5APV A;  2R44 A;  1AA0 A;  1MKM A;  1S5L X;  2ZT9 C;  3GMA A;  4AYC A;  2FKW B;  1J1D B;  3PRJ A;  4D6T D;  2HPC B;  2OYI A;  3Q5P A;  1CI6 B;  2YKP A;  1LTI C;  3V6I A;  1SQB G;  1GW4 A;  1BGY J;  2WSE H;  5AW8 B;  2JWD A;  2LXC B;  4BWN A;  5KJ7 C;  5AW9 B;  1P84 I;  3TDK A;  1L4A C;  1ZRT D;  1WT6 A;  3O6Q B;  1LTB C;  2IZ1 A;  1PIX A;  5AW5 B;  1K9M Q;  2P58 A;  4C46 A;  1PZQ A;  3H1I J;  1A02 J;  4TT3 H;  2M3B A;  1JTH A;  4RJT A;  1EDI A;  5DJU B;  4Y99 B;  2A45 I;  3L36 A;  1EDL A;  2PP6 A;  4C7R A;  2KI7 B;  4N78 D;  4WBA A;  1FJP A;  3MTU E;  4LLH A;  4N3Y B;  4XFJ A;  3TGU G;  1JB0 J;  4R4M A;  3WU2 E;  2V7Q H;  3S4R A;  1L0N D;  3VTP C;  2KK7 A;  2QM8 A;  3KZI E;  2HLO A;  1SS1 A;  1BCC G;  3A2A A;  3CX5 E;  3JC2 2;  3RK3 D;  3CCS P;  3VP9 A;  2M5A B;  2VRS A;  4D6T G;  2OYH C;  3GHG A;  2N1T D;  3CMA P;  1NO4 A;  1KB9 D;  4GT1 A;  2LKM A;  2BCC D;  3VYI A;  3RBX A;  2QSI A;  4OGQ D;  1VQL P;  1KV4 A;  1SQP J;  2JWA A;  1LT9 A;  2FFD C;  1SQB K;  3TNU A;  2O3J A;  3V4Q A;  2Z5I A;  2QJY B;  4K35 A;  5AW3 B;  1RE4 C;  1AVY A;  3RL0 D;  1M1J B;  2KLU A;  1JY3 O;  4HH2 A;  2ZJS E;  4BRY B;  1S9K D;  1AQT A;  5AW2 B;  1ZME C;  1WMK A;  1L0L D;  3CXH D;  1DEB A;  1NTZ D;  2QVA A;  1OVR A;  3KYQ A;  5E79 H;  5KLV D;  1HWT C;  4M3L A;  2E5T A;  2FBW C;  1NGM B;  1PL5 A;  3I56 P;  2OGU A;  1E79 H;  3HE5 A;  1KQF B;  4GOE A;  4AUW A;  2E75 C;  3MUD A;  3B4S A;  1L0N G;  3H1K J;  1KYO H;  1W2B O;  1NHL A;  1Q2N A;  3HUS A;  3IR9 A;  4IFM A;  1K05 A;  1KTM A;  2HG5 D;  2BCC G;  2E74 D;  3VMA A;  1S5L E;  1N73 B;  1RE3 C;  1RQV A;  2AXT H;  4ASV A;  3AEB C;  1RF1 C;  3A5T A;  1FS0 E;  1LTJ C;  2IPP A;  1KZU B;  1JCC A;  4I1L A;  4RKU J;  4Z1M H;  1ZR4 A;  3A0B H;  3IN6 A;  3AE5 C;  2HR3 A;  3AE3 C;  3M0A A;  3L70 J;  2HPC A;  4R4L A;  2C9N Y;  2O01 H;  3L71 J;  1IJD B;  2OTJ P;  1HUC A;  1L0L G;  5CCH C;  3HTK B;  1GZL A;  1KFM A;  1NTZ G;  2V7Q J;  2QIW A;  1FJK A;  3L37 A;  5K5G B;  2ITA A;  3AE8 C;  5KLV G;  2KZI A;  1YTZ T;  1VQP P;  1NAF A;  1KFN A;  1U57 A;  3CCE P;  2A06 E;  3PHL A;  1LP1 B;  1S4X A;  2IX7 C;  3F89 A;  3AE7 C;  3O6Q A;  1QLE D;  3CME P;  3OA7 A;  1KIL D;  4JPZ B;  4GIF A;  1N7S D;  1FC2 C;  4KJM A;  1ZR2 A;  1HTL C;  4PD4 I;  3CCR P;  5CBN A;  5APU A;  1LTG C;  3H1J E;  1YHQ P;  1USD A;  2R32 A;  3BCC J;  2H43 A;  2OTL P;  1SFC D;  1KIL B;  5AW1 B;  1N7S B;  2JJL A;  1PFI A;  4RO0 A;  4YXW H;  4OH8 B;  1QVF O;  5APS A;  2POH A;  3H1K E;  3G9R A;  3RK2 D;  2QJK C;  1PP9 D;  1SFC B;  1Q86 Q;  3P8C D;  1SQV J;  5AVS B;  2KYV A;  3B5N A;  3TSI A;  1AQ5 A;  4JYC A;  1PPJ E;  1YIJ P;  4WB4 A;  1L0L K;  4YXD C;  1AFO A;  1JY2 N;  2HOD A;  3RK2 B;  2FYU D;  5KLV K;  2IYP A;  3FWN A;  2J58 A;  4EYY Q;  1JO5 A;  2YIU B;  4ZKP A;  1FDO A;  2N1T A;  4PD4 E;  1MFT A;  1IK9 A;  1M1J A;  1LWU B;  2MJZ A;  1MZ9 A;  5AW0 B;  2RH0 A;  2JP3 A;  2KSE A;  1T2K D;  2KOG A;  2G8Y A;  1FZA A;  3CCV P;  5AW7 B;  3EWK A;  4XE5 B;  1OX3 A;  3CCJ P;  1OZH A;  3EFF K;  1LTA C;  2RMZ A;  1IK7 A;  2Q3I A;  3TNU B;  4JF7 A;  1AV1 A;  1G1J A;  3SSU A;  1KN7 A;  1VQ8 P;  3E7K A;  1NTM J;  2O01 J;  1S72 P;  1NTK J;  1URQ C;  1Y47 A;  3H1L J;  4YTP C;  4WY4 D;  3L75 J;  1PP9 G;  1SLQ A;  3MP7 B;  4EOT A;  2FYZ A;  2D2C C;  1VQ9 P;  3Q5S A;  3ZDM A;  1RH5 B;  3L73 E;  1M90 Q;  1N73 A;  4H44 B;  1GD2 E;  1T3J A;  3H1H J;  1S1C X;  2FYU G;  2FXM A;  5TJH A;  5AVX B;  1EQ7 A;  2FYN B;  4U3F J;  2YXQ B;  4WY4 B;  5CCG D;  3CX5 D;  3CC2 P;  2KXP B;  1TU3 F;  5E79 E;  1HF9 A;  1HJB A;  1W5C E;  2IBZ E;  3CWB E;  1VF5 C;  5AVZ B;  5APY A;  1SQV E;  2R3C A;  5B66 H;  2KS1 A;  4QMA A;  2RN0 A;  4JBZ A;  4H0L D;  4HKZ H;  3SWF A;  1KB9 H;  2JO1 A;  3D70 A;  2KNC B;  1NKZ B;  4PV1 D;  3USS A;  1H89 A;  2ZT9 D;  1LP1 A;  1JUN A;  1RF0 C;  5KLI B;  3L74 E;  3L4F A;  1RHZ B;  2LR2 A;  5M1B A;  2W90 A;  2R5B A;  4PJ0 E;  4H0L B;  4XA4 A;  1PV3 A;  3V2R A;  1DIP A;  3FXE A;  3CX5 I;  4PV1 B;  3PH0 A;  2ZT9 B;  3A0B E;  3M0D C;  3TGU J;  2OTK E;  1KIL A;  3CI9 A;  3T97 A;  1N7S A;  3CXH H;  3L72 E;  3P7K A;  2FYU K;  1KD1 Q;  1MV8 A;  1SQQ E;  2C9L Y;  2FY8 A;  1BCC J;  1DX7 A;  3IFM A;  3QWO C;  3H25 A;  3GF7 A;  3H1L E;  2V4H A;  3IF4 A;  5APX A;  1KC8 Q;  1X79 B;  3MD0 A;  1SFC A;  1H0T B;  2YXR B;  1YJW P;  4AQR D;  4EI2 A;  4Y99 C;  3LIE A;  3O8Z A;  2HFE D;  1JOC A;  2XV5 A;  3D6Y A;  3B5N D;  5KAI H;  2CK3 H;  4W7Z A;  1DEE G;  2E43 A;  2N9Y B;  1CSB A;  1KOR A;  1NU1 E;  2A45 G;  3TYY A;  3RL0 g;  2YO2 A;  1LWU A;  3G3Z A;  3UIA A;  2C0W A;  1SQX E;  1J2J B;  2WQY C;  2Y0E A;  1HVV A;  1EDJ A;  2WSC H;  3OW2 O;  2W27 A;  3C9I A;  2YKO A;  3B5N B;  4HYT B;  1GU5 A;  1VDF A;  4WWI A;  3B8E B;  1GL2 A;  1IFJ A;  2A06 D;  3V4W A;  1N86 A;  2BAS A;  1NU1 K;  3JCU E;  3GG2 A;  4KT0 J;  1IFD A;  2HOD B;  3FXD A;  1JNM A;  2HYN A;  2PRR A;  3PJS K;  3RK3 B;  1L0N J;  3CCM P;  1SQX K;  4LGD E;  1ZXG A;  3BRV B;  1JY2 O;  1OW8 A;  1JY3 P;  1CZQ A;  3FX0 A;  2N1T B;  3H1J D;  5KKZ B;  1HH0 A;  1VQ7 P;  4OGQ B;  1ZLL A;  2BCC J;  1K8A Q;  2NPS C;  2GUV A;  2IZ0 A;  3B71 A;  1NJI Q;  5AVW B;  5H2F E;  3CLQ A;  1BGY E;  5C39 A;  3H1K D;  1FZC C;  2E75 D;  3RL0 B;  1DD4 A;  1YQ3 C;  4WY4 A;  5EFW B;  1BCC E;  1R8E A;  2B87 A;  1BDD A;  1AJY A;  3AEA C;  1IFI A;  3HD7 C;  2ZYD A;  1JM0 A;  1IFM A;  1PPJ D;  3MHV A;  3H1I E;  2YKQ A;  2R5D A;  1X8Y A;  2IFN A;  2E75 B;  1NTZ J;  1OVU A;  5CCG A;  5KLV J;  3L35 A;  2K9Y A;  4OVN F;  1FOS F;  4ZMD A;  1LGH B;  4PD4 D;  2A06 G;  5AW6 B;  2Q1K A;  3F5H A;  3CPW O;  2P7J A;  2KNC A;  1OXZ A;  3A0H H;  1G1I A;  1N2D C;  2YMK A;  3CCQ P;  1Q82 Q;  3H1J G;  1Q90 D;  3I55 P;  2E74 B;  4N6J A;  1LTJ B;  3AE1 C;  3G6E P;  1YIT P;  5CCH D;  2PGD A;  1BSH A;  5AVV B;  3R2P A;  1VQO P;  4L73 A;  4IOI H;  4N78 E;  3V2N A;  4A7P A;  1SQP E;  2KS1 B;  2KLV A;  2KUB A;  2JKV A;  3H1K G;  4W80 A;  3TF5 A;  2O1K A;  4I2L C;  1DH3 A;  1FDM A;  1L0N E;  1GW3 A;  3BVH A;  1D7M A;  4KHX A;  2H7H A;  4IL6 H;  5L8R J;  1ZW0 A;  3A3Y B;  2WSC J;  1VQM P;  4I7Z C;  2XU6 A;  1H8A A;  3RBZ A;  3L73 D;  3E1I A;  3AE9 C;  1PPJ G;  1H0T A;  3AEE C;  3AEC C;  5KJ7 A;  1VL2 A;  1L4A A;  1OVV A;  4L75 A;  5BVZ A;  2OYI C;  2KIK A;  3FWL A;  2FXP A;  4B86 A;  3SFD C;  1YQ4 C;  5BU5 A;  2BEZ F;  1BE3 J;  1Z56 A;  1IZN B;  3C8V A;  3GF3 A;  1OWA A;  2ZYG A;  3T97 B;  2IBZ D;  3CWB D;  1KQS O;  2QJP C;  3SFE C;  4U7J A;  1OFC X;  1SQV D;  3PLN A;  3KZI H;  2J59 M;  1VQ4 P;  3G71 P;  1VPC A;  2KSJ A;  4UB6 H;  2IFM A;  1FAV A;  1MFZ A;  2OQQ A;  1EXI A;  2P10 A;  1LT1 A;  1OIP A;  2WSF H;  1HGZ A;  1GU4 A;  2QJK B;  3K5B A;  3H32 A;  2OYH A;  2B88 A;  3L74 D;  1P84 H;  2E76 C;  1JCD A;  3CD6 P;  3M9B A;  2ZXE B;  3CC4 P;  1J1E B;  2XND H;  1GL2 D;  2YIU C;  2QRX A;  2FFD A;  3BRT B;  3JSV C;  2L91 A;  1PP9 J;  3L73 G;  1R5L A;  3Q5R A;  1QVG O;  3L70 E;  1RE4 A;  2A45 H;  4GDO A;  2B9B A;  1Y8A A;  2QA4 P;  3L71 E;  2NZ2 A;  2IBZ I;  3L72 D;  3GHG C;  2AEJ A;  3BAS A;  4DCK A;  2WMM A;  2Q7C A;  1G2C A;  1SQQ D;  2FYU J;  1GL2 B;  1VQK P;  2H8P D;  2UWJ E;  3H1L D;  1EZV I;  1LT9 C;  1XTG B;  2GM4 A;  1URQ D;  5TIS H;  4L76 A;  2IBZ G;  3CWB G;  1KYO I;  3CC7 P;  4NPF X;  3VMZ A;  1SQV G;  1USE A;  3HRN A;  2JDI H;  1K73 Q;  1KQL A;  2I8D A;  2D2C D;  4IFF A;  1YBK A;  1X9V A;  5AVU B;  2Z5H A;  1UII A;  1X22 A;  1YI2 P;  3W67 A;  1NH4 A;  1N7L A;  2K9J B;  5GTH H;  1ZOY C;  1KMI Z;  3NMD A;  2Y9Z A;  3BCC E;  1JMM A;  1URQ B;  4ZKU A;  1S5L H;  1NU1 D;  4H44 C;  1BE3 E;  1ZN5 A;  3L74 G;  1OW6 A;  2WIT A;  2B89 A;  1SQX D;  5KTB A;  1OMI A;  1FZF A;  1GMJ A;  4IFD K;  3KPE A;  1RE3 A;  1PGP A;  2GA1 A;  2I1J A;  2B87 B;  1RF1 A;  1T3U A;  3MUD C;  1LTJ A;  1ZP0 C;  4O9B A;  2DW3 A;  4UB8 H;  2WSS H;  3KXD A;  4HJG H;  2CPB A;  3HUS C;  1VQ6 P;  1SQB J;  5DJT B;  2K1A A;  3L72 G;  2WPR A;  3S1K A;  1EZV E;  2I1K A;  1SQQ G;  1KYO E;  4H13 C;  1VQ5 P;  2KB7 P;  1JMB A;  2K88 A;  3H1L G;  1ZV8 A;  5CCH A;  5CJ0 A;  1AVO A;  4GOF A;  2M0B A;  1NOH A;  2JR8 A;  1LJ2 A;  3ABV C;  1FZE A;  2WSF J;  1QEX A;  3GW6 A;  1SQV K;  1IC2 A;  5KLI C;  3NTN A;  2AXT E; 
#chains in the Genus database with same CATH homology
 1J1D C;  3BRV B;  1HGV A;  2NPS A;  2P67 A;  1JY2 O;  1JY3 P;  1YTZ T;  1CZQ A;  1NAF A;  2N1T B;  1YYC A;  1HH0 A;  1NKN A;  3GHG B;  1T2K C;  3N4X A;  3M9H A;  2O1J A;  1KFN A;  3V2P A;  3M91 A;  1NWQ A;  1FZC A;  1ZLL A;  5KJ7 D;  2IX7 C;  1FZB A;  2NPS C;  2GUV A;  1L4A D;  1LT9 B;  3M9Q A;  3OA7 A;  2WT7 A;  5AVW B;  2ZFC A;  1KIL D;  3I5C A;  4GIF A;  1N7S D;  3V5B A;  3CLQ A;  1SP4 A;  1ZR2 A;  1HTL C;  3HD7 A;  2Q5U A;  1FZC C;  5APU A;  3RL0 B;  5CJ4 A;  2L5G B;  1LTG C;  4WY4 A;  3N7N A;  1M7L A;  4JYB A;  1E5W A;  2R32 A;  3HE4 B;  2H43 A;  1IFI A;  1SFC D;  3HD7 C;  1L4A B;  2E42 A;  2W6B A;  3TK1 A;  4WY4 C;  1KIL B;  5AW1 B;  3VN0 A;  1N7S B;  2GUS A;  2JJL A;  2WTY A;  3U1C A;  1IFM A;  1PFI A;  2YKQ A;  2R5D A;  1X8Y A;  1NTM K;  3U59 A;  1SQQ K;  2IFN A;  4OH8 B;  5APS A;  2POH A;  5CCG A;  3II6 A;  5AVT B;  3RK2 D;  1NTK K;  1XTC C;  3H6P A;  3L35 A;  3VOP A;  1FOS F;  3HE5 B;  5APQ A;  4I6M C;  1LGH B;  1SFC B;  3LID A;  3P8C D;  3P8M C;  5AVR B;  5AW6 B;  4DOJ A;  5AVS B;  2KYV A;  2P7J A;  3B5N A;  1OXZ A;  3M06 A;  3EQ2 A;  3TSI A;  3CL3 D;  5CCG C;  1AQ5 A;  1G1I A;  3WMM 0;  3MGN A;  1N2D C;  2WZ7 A;  4JYC A;  2QM7 A;  4WB4 A;  1L0L K;  1IFN A;  1AFO A;  1JY2 N;  4W7Y A;  3MIW A;  3HUS B;  2HOD A;  3PP5 A;  3RK2 B;  5APW A;  5APT A;  1FBM A;  3B5N C;  5CMZ A;  5AVY B;  4N6J A;  2YNY A;  5AW4 B;  5KLV K;  1LTJ B;  3HTK A;  2J58 A;  2WPS A;  2PAJ A;  5CCH D;  1JO5 A;  1RY3 A;  3H32 B;  4ZKP A;  2XZR A;  2OYH B;  5AVV B;  2N1T A;  3R2P A;  1SVF A;  3P8C E;  1IK9 A;  1M1J A;  1QL1 A;  1LWU B;  2MJZ A;  1MUU A;  4N78 E;  1JY2 P;  1MZ9 A;  3V2N A;  1H88 A;  1A02 F;  5AW0 B;  2KLV A;  3RK3 C;  1T2K D;  4C7N B;  2KOG A;  1FZA A;  1FZG A;  5AW7 B;  2FFD B;  4W80 A;  3V2Q A;  2N1T C;  2NPS D;  1GK4 A;  2O1K A;  1W2E A;  4I2L C;  1DH3 A;  1M1J C;  1FDM A;  1GW3 A;  3BVH A;  5APV A;  2W6A A;  4KHX A;  2H7H A;  3A3Y B;  4XE5 B;  4AYC A;  2FKW B;  3KDP B;  1J1D B;  2XU6 A;  1H8A A;  1LTA C;  1URQ A;  2HPC B;  2OYI A;  2Q3I A;  1LTT C;  3E1I A;  1CI6 B;  2YKP A;  3TNU B;  4JF7 A;  1G1J A;  1LTI C;  1G2C B;  1GTW A;  5KJ7 A;  2XKM A;  1L4A A;  3RL0 C;  1GK6 A;  2NPS B;  1GW4 A;  3HD7 D;  1URQ C;  5CHX A;  5BVZ A;  2OYI C;  1LTS C;  2WSE H;  4WY4 D;  5AW8 B;  4B86 A;  3P32 A;  1SLQ A;  5BU5 A;  4EOT A;  2FYZ A;  2KP8 A;  1FU1 A;  1Z56 A;  5AW9 B;  5KJ7 C;  1FZC B;  3SWY A;  1L4A C;  1OWA A;  1WT6 A;  1LTB C;  1IO4 A;  1N73 A;  5AW5 B;  2CPS A;  1GD2 E;  1T3J A;  3OJA B;  4C46 A;  1GDT A;  2J59 M;  1A02 J;  4EIJ A;  3HD7 B;  2M3B A;  1VPC A;  2KSJ A;  2FXM A;  5AVQ B;  1JTH A;  5AVX B;  1EQ7 A;  2IFM A;  5CCG D;  4WY4 B;  2Z4E A;  4Y99 B;  1FAV A;  1MFZ A;  2A45 I;  3L36 A;  1N73 C;  2PP6 A;  4C7R A;  3VMX A;  4N78 D;  2WSF H;  4WBA A;  1HJB A;  1FJP A;  1HGZ A;  1GU4 A;  3MTU E;  4LLH A;  4N3Y B;  3H32 A;  5AVZ B;  5APY A;  2OYH A;  3KQG A;  2R3C A;  3U1A A;  1RF1 B;  3VTP C;  2QM8 A;  3EFG A;  1JCD A;  2HLO A;  3M9B A;  2ZXE B;  3A2A A;  4C7N A;  2C0X A;  3RK3 D;  1J1E B;  1GL2 D;  3VP9 A;  2VRS A;  1RF0 A;  2FFD A;  4GKG A;  2OYH C;  3BRT B;  3GHG A;  3SWF A;  2N1T D;  2WWW A;  1NO4 A;  4GT1 A;  2LKM A;  1RE4 A;  1NKZ B;  2A45 H;  2XNX A;  3VYI A;  1H89 A;  4LC1 A;  1JUN A;  1LT9 A;  1RF0 C;  2FFD C;  3L4F A;  1WRG A;  1SQB K;  1CI6 A;  3TNU A;  3GHG C;  3V4Q A;  2XDJ A;  2Z5I A;  3BAS A;  3A7O A;  2Q7C A;  1G2C A;  5AW3 B;  1GL2 B;  1RE4 C;  3M0D A;  2R5B A;  2H8P D;  4XA4 A;  3V2R A;  2P1J A;  1LT9 C;  3RL0 D;  3NXS A;  1XTG B;  1M1J B;  1URQ D;  2GM4 A;  3HE4 A;  1YTZ I;  1JY3 O;  4HH2 A;  3VMZ A;  1SQP K;  3M0D C;  1FOS E;  3HRN A;  1S9K D;  1KQL A;  2OAR A;  5AW2 B;  1KIL A;  3CI9 A;  3T97 A;  4IFF A;  1N7S A;  1X9V A;  3P7K A;  5AVU B;  1DEB A;  1L0N K;  2FYU K;  2Z5H A;  1MV8 A;  2C9L Y;  3KYQ A;  1NH4 A;  1N7L A;  1DX7 A;  1CW5 A;  3IFM A;  3LW5 H;  1HWT C;  4M3L A;  3NMD A;  1JMM A;  1URQ B;  3HE5 A;  1KIL C;  4ZKU A;  2OYI B;  1N7S C;  2WPQ A;  5APX A;  1HBW A;  2WT7 B;  1X79 B;  3MD0 A;  1SFC A;  4AUW A;  1ZN5 A;  3MUD A;  1S9K E;  2WIT A;  4AQR D;  5KTB A;  1FZF A;  4IFD K;  3KPE A;  4Y99 C;  1RE3 A;  2I1J A;  3BAT A;  3LIE A;  1NHL A;  3HUS A;  3O8Z A;  1SFC C;  2M8R A;  3IR9 A;  2HFE D;  1RF1 A;  4IFM A;  1T3U A;  1JOC A;  2XV5 A;  3VMY A;  1LTJ A;  2HG5 D;  3B5N D;  2P2U A;  4O9B A;  4W7Z A;  2E43 A;  1CSB A;  1N73 B;  2A45 G;  3TYY A;  5BU8 B;  1RE3 C;  2YO2 A;  1LWU A;  2CPB A;  3HUS C;  3G3Z A;  3UIA A;  3RK2 C;  1RF1 C;  2C0W A;  2WPR A;  3A5T A;  1J2J B;  1LTJ C;  2I1K A;  1JTH B;  1J1E C;  2IPP A;  1KZU B;  1HVV A;  1JCC A;  2JEE A;  2KB7 P;  4I1L A;  3VP8 A;  1NTZ K;  1LWU C;  2WSC H;  4DZO A;  2W27 A;  3C9I A;  2YKO A;  3B5N B;  1ZV8 A;  4HYT B;  2N9B A;  5CCH A;  1ZR4 A;  1GU5 A;  1VDF A;  1QL2 A;  5CJ0 A;  3B8E B;  1GL2 A;  1JY3 N;  1NOH A;  2YMY A;  3OAK A;  3M0A A;  2Q9I A;  1IFJ A;  2HPC A;  1FZE A;  3V4W A;  1SQV K;  1IC2 A;  1N86 A;  1NU1 K;  2BAS A;  2C9N Y;  4RES B;  2O01 H;  1IFD A;  2HOD B;  3NTN A;  3NFQ A;  2YO3 A;  1JNM A;  2HYN A;  1IJD B;  1HUC A;  3RK3 B;  1T8Z A;  5CCH C;  3HTK B;  1GZL A;  1KFM A;  1SQX K;  1FJK A;  4LGD E;  3L37 A;  1GL2 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...