2C0WA

Molecular structure of fd filamentous bacteriophage refined with respect to x-ray fibre diffraction
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
50
structure length
50
Chain Sequence
AEGDDPAKAAFDSLQASATEMIGYAWAMVVVIVGATIGIKLFKKFTSKAS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords COAT PROTEIN B
publication title Molecular Structure of Fd (F1, M13) Filamentous Bacteriophage Refined with Respect to X-Ray Fibre Diffraction and Solid-State NMR Data Supports Specific Models of Phage Assembly at the Bacterial Membrane.
pubmed doi rcsb
source organism Enterobacteria phage fd
molecule tags Virus
total genus 19
structure length 50
sequence length 50
ec nomenclature
pdb deposition date 2005-09-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05371 Phage_Coat_Gp8 Phage major coat protein, Gp8
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.80 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c0wA00
1FDMA 2CPBA 2CPSA 1HH0A 2C0WA 1NH4A 2C0XA 1IFJA 1HGZA 1HGVA 1IFIA 1IFDA 2MJZA
chains in the Genus database with same CATH superfamily
1SQQK 2P67A 2Y0DA 2WVRA 2B88A 1NU1J 4M3LA 2NPSD 3VN0A 2JJLA 2J5UA 1ZRTE 3FX0A 1JO5A 1GK4A 3H1JG 1KMIZ 3H1LJ 2BCCE 4N78D 1JY3O 2MJZA 1JOCA 2XDJA 1ZP0C 4PD4H 2HODB 1DEBA 2WSEH 2QJPB 1YBKA 1S3JA 4TT3H 3RL0B 2B87A 2K9JB 5CBNA 4EI2A 1GTWA 1LTAC 3TGUG 1ZN5A 2YO3A 3BASA 5AW8B 2RN0A 1HJBA 3G6EP 1SQBK 1NTKD 3RK3C 5AW1B 5GTIH 5KTBA 4DZOA 1NAYA 1JTHB 1FBMA 1YQ4C 3MUDC 1BE3J 4JYBA 5TISH 3Q2YA 1JUNA 2C0WA 1Q90D 3U1CA 2KXPB 2XNXA 5TJHA 3H1HE 2ZT9C 4LLHA 3CXHI 1ZRTD 1M7LA 1HBWA 1RF1A 5KAIH 2XKMA 1WMKA 2WTYA 3H1IG 2BCCD 3L75J 3G9RA 1U7JA 3WU2H 2PGDA 3B5NB 3EFFK 5E79H 3RL0D 4UB8E 4OWFA 1EQ7A 3TF5A 3L72J 1S2EA 4U3FJ 1QGKB 1FU1A 1NTKK 5AVSB 3NXSA 1K9MQ 1GU5A 1JY2O 3AE4C 4C7NA 1FOSF 1HF9A 2B9BA 3W67A 1BGYE 3VP8A 3HE4A 4OGQC 2HR3A 3FXDA 1N73C 1EDKA 1S5LX 3L70E 2B89A 3RK2D 3F89A 3CCRP 3U59A 4EDFA 2PAJA 2ZXEB 1L4AC 1NTZG 3GF7A 4NPFX 1QX8A 3L73J 5CCHA 1H8AA 3H6PA 3KZIH 3RGUA 3H1HD 2W6BA 3AE7C 3W68A 1JY3N 1KN7A 3MIWA 2HODA 4GOEA 3GHGC 3L71E 4PV1B 3CLQA 4NPDA 2OYIB 1FZCC 1WT6A 1IFIA 4OH8B 2ITAA 2R3CA 1JB0J 1L0NJ 2K3RA 3AEFC 1OZHA 3L74G 1JY3P 3Q5PA 2L91A 2ZT9B 1M56D 2JR8A 5KLIB 1DEEG 1W5CE 3RBZA 3TDKA 1IK9A 1RHZB 3ZDMA 1NYHA 3IN6A 1JTHA 3H1KG 1IJDB 3A2AA 1XTCC 1BGYD 3HD7C 3L70D 1ZR4A 1KFNA 2I1KA 1EZVG 1N7SC 2XNDH 2KZJA 4U7JA 2K1AA 2ZAEB 3GF3A 3BATA 2R5DA 2WSSH 4PV1D 1NWQA 3P7KA 2P10A 1FZGA 2IYOA 2BEZF 3TSIA 3L71D 5CCGC 5AVVB 1PPJG 2KNCB 1LTSC 1SQPG 4A7PA 2QA4P 4N6JA 2QJKC 1K05A 1L4AB 2ZYGA 1T3UA 1HVVA 5KLVJ 1JY2N 4LC1A 1EC5A 2E75C 1IK7A 2N1TD 1JMBA 1SQVJ 3M91A 2PP6A 3GHGB 1SQQG 2Q3IA 1KC8Q 1NOHA 1GL2B 4UB8H 2WSFJ 4L75A 1URQD 3ABVC 3GLMA 1L0LE 1LT9C 2W6JH 3WMM0 1OVUA 5H2FE 3D6ZA 3OAKA 3AE9C 2A45H 2NPSC 1UIIA 3V4WA 2FYZA 5AW7B 3FWLA 1DD4A 3CMEP 1M90Q 2AEMA 1RF1C 3D71A 1KQGB 2OYIA 4GT1A 3IAOA 3II6A 3F5HA 3MUDA 2LR2A 2FXMA 2G8YA 4RO0A 3V2QA 1D7MA 3N7NA 3SWFA 1N7SB 1SQBG 2YKOA 1WRGA 1UIXA 3CCEP 3L36A 1CZQA 2WMMA 2OTLP 3BCCJ 1VQMP 2Q1KA 2H43A 1GL2D 5B66E 1VF5D 3I55P 2E43A 3G71P 3CCUP 2Z5HA 1RH5B 3M06A 2E5TA 3MGNA 2QJKB 1RF0A 5APTA 1L0LD 1BCCG 1AQTA 1PP9G 1VQ5P 1OW7A 3HTKB 2M8RA 1ZLLA 1EZVI 3CX5E 2UWJE 4D6TJ 2R32A 1USDA 2FKWB 4HKZH 3U1AA 2KIKA 1OFCX 3MHVA 3EWKA 2E5YA 2KLVA 1LT9B 3RL0C 2DW3A 1OW8A 2M3EA 3Q5RA 1M1KQ 4CPGA 4ZNCA 2R5BA 3AE2C 3H1JJ 4HJGH 2NPSB 1M8OB 4PD4I 3LIDA 5CCGD 1RF1B 4Y28J 1GL2A 3M9QA 1VQ9P 4WWIA 2FYNC 3CL3D 2IFMA 5AVWB 4WY4D 4B86A 3KXDA 2ZJSE 1L0LK 1OW6A 2RKLA 2WPSA 2BCCG 3HRNA 2HPCB 1KTMA 1NJIQ 2FXOA 3RK2C 1FDOA 2P1JA 3TGUJ 2HYNA 2YXQB 3P32A 4NPEA 3CX5D 1S1CX 2M0BA 1KYOI 1NTKE 1SVFA 1J1DB 2YMKA 1K73Q 3SWYA 3CMAP 5KAFE 1NTME 2O01N 3Q5SA 1HJ0A 3HE4B 3V2RA 3CC2P 2IX7C 1YHQP 1N7SA 1KQLA 3FWNA 1HGVA 1KQSO 2YIUB 5H2FH 1G2CB 1TU3F 3CXHE 1PGQA 1H89A 3Q1MA 2FFDA 3R2PA 3M0DA 3H1IJ 1P84I 5APVA 1VQOP 1NGMB 5CCGA 2AXCA 3TNUB 3BVHA 4HB1A 1Y8AA 3JSVC 2O3JA 1YTZI 3FGAD 2IYPA 3VYIA 1H88A 2KOGA 1BSHA 4K35A 3AE8C 1KORA 3CPWO 3HTKA 3G3ZA 2ZVOB 2Y0EA 4ZKPA 1FE6A 3D70A 2V7QH 2O1KA 2CK3H 1CI6A 2V4HA 3AEBC 1IO4A 5B66H 3S4RA 4D6TE 2ZXXA 4PV1C 2OYHB 2FYNB 2QJYB 4AYCA 1NTMD 4BRYB 1X9VA 3FXEA 2A45G 3LIEA 2OYIC 2C9LY 1LT9A 1NTZJ 2G3AA 3RK2B 1BGYG 2NPSA 3CX5H 3CXHD 2JDIH 3AEGC 4ASVA 5KLVK 3L70G 2KI7B 5KLIC 4EYYQ 3NFQA 1R5SA 3H1JE 1MKMA 4K3AA 3CWBE 1SQXE 2N1TC 2W90A 1K04A 3G4SP 2W8ZA 1KV4A 1FJPA 2JP3A 3OJAB 1AQ5A 2QSIA 2HPCA 1FAVA 3N4XA 3L71G 2WPRA 1M1JC 3EQ2A 2P58A 1URQC 2HLOA 3L74J 1RF0C 1G1JA 5EFWB 3V2PA 1OIPA 2FYUJ 1NTMK 1Q81Q 3KPEA 3H1KJ 2BEQD 4D6TD 4XE5B 1QL1A 1X8YA 3S1KA 1E5WA 5AW9B 2WPQA 2KLUA 3B8EB 1G2CA 2NRGA 1R5LA 4EIJA 1RY3A 2WSCJ 1FZBA 1NU1E 2JEEA 3AE3C 4RKUJ 1G1IA 3TNUA 3L37A 2LXBA 4TLFA 3H1JD 3CWBD 5KAFH 4IL6E 3H1LE 1SQXD 2OQQA 2YNYA 1GL2C 1SQPJ 2D2CD 1VF5C 2W6AA 1Q7YQ 2YO2A 4UB6E 3CXHH 2WSEJ 4I7ZC 1DD3A 4DOJA 1HTLC 2KB7P 1JNMA 2OYHA 3KHUA 2PRRA 1GW3A 4ASWA 1NVOA 2N1TB 1JMMA 3VMXA 1KD1Q 4BRYA 3AEAC 2H89C 1KILD 1MFTA 1IZNB 3VTPC 5DJUB 3AE6C 3A3YB 3USSA 1M1JB 3OW2O 1S9KE 1DH3A 3A0HE 1URQB 1BE3E 5CJ4A 1CW5A 1W2BO 1IFNA 1NU1D 2Q9IA 1SQXK 1L0LG 2IBZE 1QVGO 2FFDC 3M0DC 3BRTB 4IOIH 3H1LD 4MN4C 3C9IA 3L75E 2KZIA 3V2NA 4WY4C 1BDDA 1RE3C 2CPBA 1DIPA 4H0LB 1Q82Q 1LJ2A 1SQBJ 3L72E 3D6YA 4U3FE 3L74E 4YTPC 1SS1A 2P2UA 1PGOA 3CCMP 1LTTC 1ZR2A 3KDPB 5BVZA 1RQVA 2QRXA 2FYUE 3NMDA 2GUVA 2ZVNB 1R8EA 4IL6X 4GIFA 5APWA 1LWUC 2OGUA 1K8AQ 1VF5B 2MKVA 3IF4A 1BCCJ 1Q2NA 1PP9J 1OWAA 1Q86Q 2O01H 4YXDC 1S9KD 1NU1K 3IR9A 4W7ZA 1J2JB 4I7ZB 1NTZD 1BE3D 4HYTB 1MZ9A 3L73E 4IFDK 4C7RA 4I6MC 3PLNA 2IBZD 3MTUE 1VQKP 4GODA 2QG4A 4BWNA 2Y0CA 3MP7B 4H0LD 1LTJB 2FBWC 1LTGC 3CD6P 3L75D 4RJTA 2CPSA 4O9BA 4XFJA 4H44D 1SQPE 5CHXA 1BSNA 5KKZB 1YJNP 5BU5A 1KB9E 4L74A 3AECC 2GA1A 3L72D 2KSEA 1QL2A 1L0NE 2A06E 4U3FD 3L74D 2N1TA 2FFDB 4IL6H 1GMJA 3H32B 1J1DC 1PIXA 2FYUD 2XZRA 2BCCJ 2OARA 1M1JA 4I2LC 4WY4B 2ZYAA 1URQA 1NTZK 4Y99B 4UB6H 3GW6A 3GMAA 1MFZA 4ZKUA 1AFOA 4KHXA 2YIUC 1EZVD 1EXIA 1KYOE 3L73D 4XA4A 1A02J 1NKNA 1CI6B 5KJ7D 3E1IA 1LWUB 2LXCB 1NTKG 3C8VA 3A0HH 1SQPD 4JYCA 1NTMG 1LTIC 2KS1B 4GKGA 1KB9D 4R4LA 1KQFB 2ZYDA 1P84E 5B5EE 1L0ND 1Z56A 3B4SA 2A06D 3HE5B 4OVNF 2FYUK 3RL0g 1OMIA 5KLVE 4QMAA 4W80A 1N7LA 1SQVE 2OYHC 1IFPA 2OTJP 2JKVA 2QJYC 2E42A 5CMZA 1NH4A 2Z4EA 3O8ZA 2J59M 1W2EA 3S9OA 4JQ0D 1BCCE 1PP9E 2WT7B 1XTGB 4GOFA 1ZXGA 1YJ9P 1KYOD 2W27A 1S4XA 3H25A 1FDIA 1LTJA 1YI2P 1GK6A 3O6QB 1FZFA 1SQPK 3PHLA 3L4FA 1EDIA 3SWKA 3WUUA 2D2CC 5APSA 1L0NK 3ITKA 3HUSB 4JPZB 2QE7H 1FJKA 2WSCH 3I5CA 2RMZA 3TK1A 2QEXP 1P84D 3H32A 3VMAA 1LGHB 3A5TA 1L2PA 4AUWA 5KLVD 1NO4A 3I56P 2K37A 1FZEA 1JM0A 3BCCE 1SQVD 1U7MA 3H1HG 4WY4A 1RE3A 2IZ0A 2E74D 5CBOA 3L71J 1KILC 2L5GB 3CWBG 4H13B 3UIAA 1SQXG 1RE4A 1KB9H 3VMZA 3QH9A 5AW4B 1BCCD 1PP9D 1S5LE 4DT0A 3B71A 4WBAA 2QIWA 3V6IA 1ZW0A 2QVAA 2RH0A 3T97A 1HGZA 1LWUA 2WPVB 5C39A 5AW2B 2E76C 1YTZT 2Q6QA 1VQ4P 2KS1A 1J1EB 3P8CE 1NKZB 1VQLP 1Y9BA 3CCJP 2GM4A 3LW5J 5AVUB 3GG2A 1QLED 5CJ0A 3HE5A 1RQUA 1KYOH 1NAFA 5BU8B 1SQVK 1OVVA 4EOTA 5L8RJ 5CCHD 3BCCD 1NU1G 1QVFO 1LT1A 4H13D 5APQA 2JO1A 4N3YB 1S72P 2IPPA 2PFXA 2QM8A 2D2CB 2WT7A 3H1LG 3WUTA 1GDTA 2W83C 4AQRD 2R44A 4R4MA 1HH0A 1U57A 1P84H 5B5EH 5M1BA 2FXPA 1YITP 3TGUE 1EXJA 1LP1B 3QWOC 2GUSA 3O6QA 5AVQB 1IC2A 1KILE 3IFMA 1GW4A 1EDJA 2IDBA 1FZAA 2Q7CA 3C1LA 3CCQP 2WSFH 3KQGA 1KILB 2J58A 2I1JA 4IFFA 4H0LC 2KP8A 1MUUA 3HUSA 1X79B 1FS0E 3P8CD 1GD2E 3CC7P 2H8PD 1T2KD 3NTNA 4H44C 3K5BA 4I1LA 1L0LJ 4PJ0E 3PRJA 1VDFA 2K88A 3H1IE 1BE3G 3A7OA 5AVTB 1OVRA 3V5BA 2KYVA 2E76B 2XV5A 3RK3E 2YXRB 3VP9A 1KZUB 2IBZG 3RK3B 1VQ8P 3B5ND 2XU6A 1X22A 3L75G 1VL2A 4DCKA 3TGUD 2K9JA 1SQQJ 4LGDE 3CCLP 3L72G 4U3FG 2V7QJ 5AW6B 5KJ7C 4IFMA 1LTJC 2LKMA 1Y47A 4L76A 3PJSK 1IFMA 1PGJA 3M9BA 2A45I 2FYUG 5KKZC 1USEA 3PH0A 2M5AB 4JBZA 1NTZE 1S5LH 1SFCC 3R4YA 1OXZA 3MD0A 3TYYA 2Q5UA 1T6AA 1BDCA 3H1ID 2E76D 3PP5A 4HH2A 3L73G 2AEFA 1A02F 2Y9YA 1T8ZA 3RK3D 2NZ2A 4Y99C 2I8DA 1GZLA 3OA7A 4H44B 1RE4C 2P7JA 2YMYA 1LTBC 3AEDC 3B5NA 2AXTE 1VQ7P 4OGQB 1N73B 3A0BE 1H0TB 1NHLA 3M9HA 1AA0A 3SFEC 1LP1A 1AJYA 3E1RA 2OYOA 3AE1C 4ZMDA 3SSUA 3WUVA 2ZT9D 5AVZB 1L0NG 2WWWA 3H1KE 1KILA 4Z1MH 1HUCA 2A06G 2M3BA 1IFDA 1VQPP 1ZMEC 1MV8A 3JCUE 1FDMA 1YQ3C 1KFMA 1N8RQ 3VOPA 5GTHE 1EZVE 3RBXA 1FZCB 2QM7A 1YYCA 2K9YA 2ZFCA 4WB4A 1JY2P 1PPJE 3PTZA 1VQ6P 1NTKJ 3E7KA 4KJMA 1EDLA 1AV1A 4WVZA 2N9BA 2IZ1A 1T3JA 1NTMJ 2E74C 4OGQD 2Z5IA 2VRSA 3AEEC 2IBZI 4GDOA 1SFCB 4PD4E 3HD7B 4PJ0H 2WZ7A 1PZQA 1L4AD 3Q3DA 3JC22 4C46A 1VQNP 1PV3A 4KT0J 1HWTC 1E79H 5APXA 1SLQA 2Y9ZA 1SQQE 4L73A 3H1KD 1N86A 1VPCA 5KLVG 5K5GB 5AVYB 3L35A 4W7YA 2KK7A 2M5AA 1SQVG 1PL5A 3HUSC 2WQYC 4RESB 1PGPA 5AW0B 5GTIE 2HFED 5APYA 2JWDA 2AEJA 2YKPA 1JCCA 2BASA 1IFJA 5DJTB 4YPCA 5TISE 3T97B 3EFGA 2B87B 2OTKE 5APUA 2IFNA 1PPJD 2N9YB 2E75B 1SP4A 5CCHC 3CC4P 4H13C 4BXLA 1M57D 1FC2C 1SFCD 5AVRB 5KAIE 3HD7D 2C0XA 1AVOA 2KNCA 1YIJP 3KYQA 1N73A 2C9NY 1H0TA 2R3SA 3CCVP 3LW5H 1SQBE 4DJGA 3WU2E 3CI9A 2QJPC 1QEXA 4PD4D 5AW5B 1L4AA 5E79E 3MZWB 1N7SD 2Q3EA 1ZV8A 3H1HJ 1CSBA 2KSJA 1KB9I 1X0TA 2H88C 1SQQD 3P8MC 3CWBJ 1YJWP 1SQXJ 3GHGA 4N78E 1FOSE 2E74B 2HG5D 5AW3B 1J1EC 3BCCG 1ZOYC 2AXTH 1PFIA 1FZCA 3A0BH 2WITA 2FY8A 1N2DC 1LNQA 1T2KC 1AVYA 1DX7A 2SPZA 2O01J 3CCSP 1JEKA 1GU4A 5KJ7A 2JWAA 2E75D 3JCUH 2KUBA 3VMYA 3BRVB 4YXWH 3KZIE 3CX5I 4D6TG 2H7HA 3M0AA 3V4QA 4JF7A 1BGYJ 1SFCA 3AE5C 5GTHH 2O1JA 3HD7A 3L70J 2POHA 4C7NB 2YKQA 1JCDA 1SQBD 3B5NC 5AVXB 3SFDC 1OX3A
chains in the Genus database with same CATH topology
3M06A 5AVQB 1IC2A 3IFMA 1SQQK 3C9IA 1GW4A 2P67A 3MGNA 1RF0A 3V2NA 5APTA 4WY4C 1FZAA 4M3LA 2NPSD 1RE3C 2CPBA 2Q7CA 2WSFH 3VN0A 3KQGA 2JJLA 1KILB 2J58A 2I1JA 4IFFA 1JO5A 1GK4A 3HTKB 2KP8A 1MUUA 2M8RA 3HUSA 1X79B 1ZLLA 3P8CD 1GD2E 4N78D 2H8PD 1T2KD 3NTNA 2R32A 1JY3O 4I1LA 2MJZA 1JOCA 2P2UA 2XDJA 1LTTC 2HODB 1ZR2A 2FKWB 1DEBA 3KDPB 2WSEH 3U1AA 5BVZA 3NMDA 2GUVA 1VDFA 3A7OA 4GIFA 5APWA 3RL0B 1LWUC 5AVTB 3V5BA 2KLVA 1LT9B 3RL0C 2KYVA 2XV5A 1GTWA 1LTAC 1OWAA 3VP9A 1ZN5A 1KZUB 2R5BA 2O01H 2YO3A 1S9KD 1NU1K 3BASA 5AW8B 3IR9A 4W7ZA 1J2JB 3RK3B 1HJBA 2NPSB 4HYTB 1MZ9A 3B5ND 2XU6A 1SQBK 3RK3C 3LIDA 5CCGD 5AW1B 4IFDK 4C7RA 4I6MC 1RF1B 5KTBA 1GL2A 4DZOA 3M9QA 1JTHB 3CL3D 2IFMA 1FBMA 3MTUE 5AVWB 4WY4D 4B86A 1L0LK 2WPSA 4LGDE 1JUNA 4JYBA 1LTJB 3HRNA 2C0WA 5AW6B 1LTGC 2HPCB 5KJ7C 3U1CA 4IFMA 1LTJC 2CPSA 4O9BA 2LKMA 2XNXA 3RK2C 5CHXA 2P1JA 5BU5A 4LLHA 1IFMA 1M7LA 2HYNA 3M9BA 2A45I 3P32A 1HBWA 1RF1A 2WTYA 2XKMA 1QL2A 1SFCC 1OXZA 3MD0A 2N1TA 1SVFA 1J1DB 2FFDB 3TYYA 2Q5UA 3SWYA 3H32B 3B5NB 3RL0D 1J1DC 2XZRA 1EQ7A 3HE4B 3V2RA 2IX7C 3PP5A 4HH2A 1N7SA 2OARA 1M1JA 4I2LC 1KQLA 4WY4B 1HGVA 1URQA 1NTZK 4Y99B 1A02F 1T8ZA 3RK3D 1MFZA 1FU1A 4ZKUA 1NTKK 1AFOA 1G2CB 5AVSB 3NXSA 4Y99C 4KHXA 1H89A 1GZLA 1GU5A 1JY2O 2FFDA 3R2PA 3OA7A 3M0DA 1RE4C 2P7JA 2YMYA 1LTBC 3B5NA 4C7NA 5APVA 1FOSF 5CCGA 1N73B 4XA4A 1NHLA 3VP8A 3HE4A 1A02J 1NKNA 3M9HA 3TNUB 1CI6B 1N73C 5KJ7D 3BVHA 3RK2D 1YTZI 3E1IA 3U59A 1LWUB 3VYIA 5AVZB 2PAJA 1H88A 2ZXEB 2KOGA 1L4AC 2WWWA 1KILA 1HUCA 2M3BA 1IFDA 1MV8A 3HTKA 3G3ZA 5CCHA 1H8AA 3H6PA 4JYCA 1FDMA 4ZKPA 1KFMA 1LTIC 2W6BA 4GKGA 3VOPA 2O1KA 1JY3N 3MIWA 1CI6A 2HODA 3GHGC 1IO4A 1Z56A 3CLQA 3HE5B 2FYUK 1FZCB 2OYHB 2QM7A 1YYCA 2OYIB 1FZCC 4W80A 1WT6A 4AYCA 1N7LA 2OYHC 1IFIA 1X9VA 4OH8B 2A45G 3LIEA 2ZFCA 2OYIC 4WB4A 2C9LY 1JY2P 2R3CA 1LT9A 2E42A 5CMZA 1NH4A 2Z4EA 3O8ZA 2J59M 1JY3P 3RK2B 2N9BA 1W2EA 2NPSA 1T3JA 2WT7B 5KLVK 2Z5IA 2VRSA 1XTGB 3NFQA 1IK9A 1SFCB 1JTHA 3HD7B 2WZ7A 2W27A 1IJDB 2N1TC 3A2AA 1FJPA 1L4AD 1XTCC 3HD7C 4C46A 3OJAB 1AQ5A 1LTJA 2HPCA 1HWTC 1GK6A 1FZFA 1FAVA 1ZR4A 1SQPK 5APXA 1KFNA 1SLQA 2I1KA 3N4XA 1N7SC 2WPRA 1M1JC 3EQ2A 3L4FA 1URQC 2HLOA 1RF0C 1G1JA 5APSA 1N86A 1VPCA 3BATA 1L0NK 5AVYB 3L35A 2R5DA 4W7YA 3HUSB 3V2PA 1NWQA 3P7KA 1FJKA 2WSCH 3I5CA 1FZGA 3HUSC 3TK1A 4RESB 5AW0B 1NTMK 3TSIA 3KPEA 3H32A 5CCGC 1LGHB 5AVVB 2HFED 5APYA 4XE5B 3A5TA 1QL1A 1X8YA 2YKPA 4AUWA 1LTSC 1NO4A 1E5WA 1JCCA 2BASA 1FZEA 1IFJA 5AW9B 4N6JA 2WPQA 3EFGA 4WY4A 1RE3A 1L4AB 5APUA 3B8EB 1KILC 2L5GB 1G2CA 1T3UA 2IFNA 1HVVA 3UIAA 4EIJA 1SP4A 1RY3A 1RE4A 5CCHC 1FZBA 3VMZA 1JY2N 4LC1A 1SFCD 2N1TD 5AVRB 5AW4B 3HD7D 2C0XA 2JEEA 3M91A 3KYQA 1N73A 2PP6A 3GHGB 2C9NY 4WBAA 1G1IA 3LW5H 3TNUA 3L37A 3CI9A 5AW5B 2Q3IA 3T97A 1NOHA 1GL2B 1L4AA 1N7SD 1HGZA 2YNYA 1LWUA 1GL2C 1URQD 1ZV8A 2W6AA 1LT9C 5AW2B 1CSBA 2YO2A 2KSJA 1YTZT 3WMM0 3P8MC 3OAKA 1J1EB 3P8CE 3GHGA 1NKZB 2A45H 4N78E 1FOSE 2NPSC 4DOJA 2GM4A 2HG5D 1HTLC 5AVUB 1J1EC 5AW3B 3V4WA 2KB7P 2FYZA 5AW7B 5CJ0A 3HE5A 1PFIA 1JNMA 1NAFA 1FZCA 2WITA 2OYHA 1RF1C 5BU8B 1GW3A 1N2DC 1SQVK 2OYIA 4GT1A 2N1TB 1T2KC 3II6A 1JMMA 3VMXA 4EOTA 3MUDA 1DX7A 2FXMA 1KILD 3V2QA 1GU4A 5CCHD 5KJ7A 5APQA 3VTPC 3N7NA 3SWFA 3A3YB 4N3YB 1N7SB 1M1JB 2YKOA 2IPPA 1S9KE 1DH3A 2QM8A 1WRGA 3BRVB 1URQB 3VMYA 2WT7A 5CJ4A 1GDTA 4AQRD 3L36A 1CZQA 2H7HA 3M0AA 3V4QA 4JF7A 1CW5A 1HH0A 1SFCA 2O1JA 1IFNA 2Q9IA 3HD7A 1SQXK 2H43A 1GL2D 2POHA 4C7NB 2FFDC 2YKQA 1JCDA 3M0DC 3BRTB 3B5NC 5AVXB 2E43A 2GUSA 2Z5HA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FDM A;  2CPB A;  2CPS A;  1HH0 A;  2C0W A;  1NH4 A;  2C0X A;  1IFJ A;  1HGZ A;  1HGV A;  1IFI A;  1IFD A;  2MJZ A; 
#chains in the Genus database with same CATH topology
 1SQQ K;  2P67 A;  2Y0D A;  2WVR A;  2B88 A;  1NU1 J;  4M3L A;  2NPS D;  3VN0 A;  2JJL A;  2J5U A;  1ZRT E;  3FX0 A;  1JO5 A;  1GK4 A;  3H1J G;  1KMI Z;  3H1L J;  2BCC E;  4N78 D;  1JY3 O;  2MJZ A;  1JOC A;  2XDJ A;  1ZP0 C;  4PD4 H;  2HOD B;  1DEB A;  2WSE H;  2QJP B;  1YBK A;  1S3J A;  4TT3 H;  3RL0 B;  2B87 A;  2K9J B;  5CBN A;  4EI2 A;  1GTW A;  1LTA C;  3TGU G;  1ZN5 A;  2YO3 A;  3BAS A;  5AW8 B;  2RN0 A;  1HJB A;  3G6E P;  1SQB K;  1NTK D;  3RK3 C;  5AW1 B;  5GTI H;  5KTB A;  4DZO A;  1NAY A;  1JTH B;  1FBM A;  1YQ4 C;  3MUD C;  1BE3 J;  4JYB A;  5TIS H;  3Q2Y A;  1JUN A;  2C0W A;  1Q90 D;  3U1C A;  2KXP B;  2XNX A;  5TJH A;  3H1H E;  2ZT9 C;  4LLH A;  3CXH I;  1ZRT D;  1M7L A;  1HBW A;  1RF1 A;  5KAI H;  2XKM A;  1WMK A;  2WTY A;  3H1I G;  2BCC D;  3L75 J;  3G9R A;  1U7J A;  3WU2 H;  2PGD A;  3B5N B;  3EFF K;  5E79 H;  3RL0 D;  4UB8 E;  4OWF A;  1EQ7 A;  3TF5 A;  3L72 J;  1S2E A;  4U3F J;  1QGK B;  1FU1 A;  1NTK K;  5AVS B;  3NXS A;  1K9M Q;  1GU5 A;  1JY2 O;  3AE4 C;  4C7N A;  1FOS F;  1HF9 A;  2B9B A;  3W67 A;  1BGY E;  3VP8 A;  3HE4 A;  4OGQ C;  2HR3 A;  3FXD A;  1N73 C;  1EDK A;  1S5L X;  3L70 E;  2B89 A;  3RK2 D;  3F89 A;  3CCR P;  3U59 A;  4EDF A;  2PAJ A;  2ZXE B;  1L4A C;  1NTZ G;  3GF7 A;  4NPF X;  1QX8 A;  3L73 J;  5CCH A;  1H8A A;  3H6P A;  3KZI H;  3RGU A;  3H1H D;  2W6B A;  3AE7 C;  3W68 A;  1JY3 N;  1KN7 A;  3MIW A;  2HOD A;  4GOE A;  3GHG C;  3L71 E;  4PV1 B;  3CLQ A;  4NPD A;  2OYI B;  1FZC C;  1WT6 A;  1IFI A;  4OH8 B;  2ITA A;  2R3C A;  1JB0 J;  1L0N J;  2K3R A;  3AEF C;  1OZH A;  3L74 G;  1JY3 P;  3Q5P A;  2L91 A;  2ZT9 B;  1M56 D;  2JR8 A;  5KLI B;  1DEE G;  1W5C E;  3RBZ A;  3TDK A;  1IK9 A;  1RHZ B;  3ZDM A;  1NYH A;  3IN6 A;  1JTH A;  3H1K G;  1IJD B;  3A2A A;  1XTC C;  1BGY D;  3HD7 C;  3L70 D;  1ZR4 A;  1KFN A;  2I1K A;  1EZV G;  1N7S C;  2XND H;  2KZJ A;  4U7J A;  2K1A A;  2ZAE B;  3GF3 A;  3BAT A;  2R5D A;  2WSS H;  4PV1 D;  1NWQ A;  3P7K A;  2P10 A;  1FZG A;  2IYO A;  2BEZ F;  3TSI A;  3L71 D;  5CCG C;  5AVV B;  1PPJ G;  2KNC B;  1LTS C;  1SQP G;  4A7P A;  2QA4 P;  4N6J A;  2QJK C;  1K05 A;  1L4A B;  2ZYG A;  1T3U A;  1HVV A;  5KLV J;  1JY2 N;  4LC1 A;  1EC5 A;  2E75 C;  1IK7 A;  2N1T D;  1JMB A;  1SQV J;  3M91 A;  2PP6 A;  3GHG B;  1SQQ G;  2Q3I A;  1KC8 Q;  1NOH A;  1GL2 B;  4UB8 H;  2WSF J;  4L75 A;  1URQ D;  3ABV C;  3GLM A;  1L0L E;  1LT9 C;  2W6J H;  3WMM 0;  1OVU A;  5H2F E;  3D6Z A;  3OAK A;  3AE9 C;  2A45 H;  2NPS C;  1UII A;  3V4W A;  2FYZ A;  5AW7 B;  3FWL A;  1DD4 A;  3CME P;  1M90 Q;  2AEM A;  1RF1 C;  3D71 A;  1KQG B;  2OYI A;  4GT1 A;  3IAO A;  3II6 A;  3F5H A;  3MUD A;  2LR2 A;  2FXM A;  2G8Y A;  4RO0 A;  3V2Q A;  1D7M A;  3N7N A;  3SWF A;  1N7S B;  1SQB G;  2YKO A;  1WRG A;  1UIX A;  3CCE P;  3L36 A;  1CZQ A;  2WMM A;  2OTL P;  3BCC J;  1VQM P;  2Q1K A;  2H43 A;  1GL2 D;  5B66 E;  1VF5 D;  3I55 P;  2E43 A;  3G71 P;  3CCU P;  2Z5H A;  1RH5 B;  3M06 A;  2E5T A;  3MGN A;  2QJK B;  1RF0 A;  5APT A;  1L0L D;  1BCC G;  1AQT A;  1PP9 G;  1VQ5 P;  1OW7 A;  3HTK B;  2M8R A;  1ZLL A;  1EZV I;  3CX5 E;  2UWJ E;  4D6T J;  2R32 A;  1USD A;  2FKW B;  4HKZ H;  3U1A A;  2KIK A;  1OFC X;  3MHV A;  3EWK A;  2E5Y A;  2KLV A;  1LT9 B;  3RL0 C;  2DW3 A;  1OW8 A;  2M3E A;  3Q5R A;  1M1K Q;  4CPG A;  4ZNC A;  2R5B A;  3AE2 C;  3H1J J;  4HJG H;  2NPS B;  1M8O B;  4PD4 I;  3LID A;  5CCG D;  1RF1 B;  4Y28 J;  1GL2 A;  3M9Q A;  1VQ9 P;  4WWI A;  2FYN C;  3CL3 D;  2IFM A;  5AVW B;  4WY4 D;  4B86 A;  3KXD A;  2ZJS E;  1L0L K;  1OW6 A;  2RKL A;  2WPS A;  2BCC G;  3HRN A;  2HPC B;  1KTM A;  1NJI Q;  2FXO A;  3RK2 C;  1FDO A;  2P1J A;  3TGU J;  2HYN A;  2YXQ B;  3P32 A;  4NPE A;  3CX5 D;  1S1C X;  2M0B A;  1KYO I;  1NTK E;  1SVF A;  1J1D B;  2YMK A;  1K73 Q;  3SWY A;  3CMA P;  5KAF E;  1NTM E;  2O01 N;  3Q5S A;  1HJ0 A;  3HE4 B;  3V2R A;  3CC2 P;  2IX7 C;  1YHQ P;  1N7S A;  1KQL A;  3FWN A;  1HGV A;  1KQS O;  2YIU B;  5H2F H;  1G2C B;  1TU3 F;  3CXH E;  1PGQ A;  1H89 A;  3Q1M A;  2FFD A;  3R2P A;  3M0D A;  3H1I J;  1P84 I;  5APV A;  1VQO P;  1NGM B;  5CCG A;  2AXC A;  3TNU B;  3BVH A;  4HB1 A;  1Y8A A;  3JSV C;  2O3J A;  1YTZ I;  3FGA D;  2IYP A;  3VYI A;  1H88 A;  2KOG A;  1BSH A;  4K35 A;  3AE8 C;  1KOR A;  3CPW O;  3HTK A;  3G3Z A;  2ZVO B;  2Y0E A;  4ZKP A;  1FE6 A;  3D70 A;  2V7Q H;  2O1K A;  2CK3 H;  1CI6 A;  2V4H A;  3AEB C;  1IO4 A;  5B66 H;  3S4R A;  4D6T E;  2ZXX A;  4PV1 C;  2OYH B;  2FYN B;  2QJY B;  4AYC A;  1NTM D;  4BRY B;  1X9V A;  3FXE A;  2A45 G;  3LIE A;  2OYI C;  2C9L Y;  1LT9 A;  1NTZ J;  2G3A A;  3RK2 B;  1BGY G;  2NPS A;  3CX5 H;  3CXH D;  2JDI H;  3AEG C;  4ASV A;  5KLV K;  3L70 G;  2KI7 B;  5KLI C;  4EYY Q;  3NFQ A;  1R5S A;  3H1J E;  1MKM A;  4K3A A;  3CWB E;  1SQX E;  2N1T C;  2W90 A;  1K04 A;  3G4S P;  2W8Z A;  1KV4 A;  1FJP A;  2JP3 A;  3OJA B;  1AQ5 A;  2QSI A;  2HPC A;  1FAV A;  3N4X A;  3L71 G;  2WPR A;  1M1J C;  3EQ2 A;  2P58 A;  1URQ C;  2HLO A;  3L74 J;  1RF0 C;  1G1J A;  5EFW B;  3V2P A;  1OIP A;  2FYU J;  1NTM K;  1Q81 Q;  3KPE A;  3H1K J;  2BEQ D;  4D6T D;  4XE5 B;  1QL1 A;  1X8Y A;  3S1K A;  1E5W A;  5AW9 B;  2WPQ A;  2KLU A;  3B8E B;  1G2C A;  2NRG A;  1R5L A;  4EIJ A;  1RY3 A;  2WSC J;  1FZB A;  1NU1 E;  2JEE A;  3AE3 C;  4RKU J;  1G1I A;  3TNU A;  3L37 A;  2LXB A;  4TLF A;  3H1J D;  3CWB D;  5KAF H;  4IL6 E;  3H1L E;  1SQX D;  2OQQ A;  2YNY A;  1GL2 C;  1SQP J;  2D2C D;  1VF5 C;  2W6A A;  1Q7Y Q;  2YO2 A;  4UB6 E;  3CXH H;  2WSE J;  4I7Z C;  1DD3 A;  4DOJ A;  1HTL C;  2KB7 P;  1JNM A;  2OYH A;  3KHU A;  2PRR A;  1GW3 A;  4ASW A;  1NVO A;  2N1T B;  1JMM A;  3VMX A;  1KD1 Q;  4BRY A;  3AEA C;  2H89 C;  1KIL D;  1MFT A;  1IZN B;  3VTP C;  5DJU B;  3AE6 C;  3A3Y B;  3USS A;  1M1J B;  3OW2 O;  1S9K E;  1DH3 A;  3A0H E;  1URQ B;  1BE3 E;  5CJ4 A;  1CW5 A;  1W2B O;  1IFN A;  1NU1 D;  2Q9I A;  1SQX K;  1L0L G;  2IBZ E;  1QVG O;  2FFD C;  3M0D C;  3BRT B;  4IOI H;  3H1L D;  4MN4 C;  3C9I A;  3L75 E;  2KZI A;  3V2N A;  4WY4 C;  1BDD A;  1RE3 C;  2CPB A;  1DIP A;  4H0L B;  1Q82 Q;  1LJ2 A;  1SQB J;  3L72 E;  3D6Y A;  4U3F E;  3L74 E;  4YTP C;  1SS1 A;  2P2U A;  1PGO A;  3CCM P;  1LTT C;  1ZR2 A;  3KDP B;  5BVZ A;  1RQV A;  2QRX A;  2FYU E;  3NMD A;  2GUV A;  2ZVN B;  1R8E A;  4IL6 X;  4GIF A;  5APW A;  1LWU C;  2OGU A;  1K8A Q;  1VF5 B;  2MKV A;  3IF4 A;  1BCC J;  1Q2N A;  1PP9 J;  1OWA A;  1Q86 Q;  2O01 H;  4YXD C;  1S9K D;  1NU1 K;  3IR9 A;  4W7Z A;  1J2J B;  4I7Z B;  1NTZ D;  1BE3 D;  4HYT B;  1MZ9 A;  3L73 E;  4IFD K;  4C7R A;  4I6M C;  3PLN A;  2IBZ D;  3MTU E;  1VQK P;  4GOD A;  2QG4 A;  4BWN A;  2Y0C A;  3MP7 B;  4H0L D;  1LTJ B;  2FBW C;  1LTG C;  3CD6 P;  3L75 D;  4RJT A;  2CPS A;  4O9B A;  4XFJ A;  4H44 D;  1SQP E;  5CHX A;  1BSN A;  5KKZ B;  1YJN P;  5BU5 A;  1KB9 E;  4L74 A;  3AEC C;  2GA1 A;  3L72 D;  2KSE A;  1QL2 A;  1L0N E;  2A06 E;  4U3F D;  3L74 D;  2N1T A;  2FFD B;  4IL6 H;  1GMJ A;  3H32 B;  1J1D C;  1PIX A;  2FYU D;  2XZR A;  2BCC J;  2OAR A;  1M1J A;  4I2L C;  4WY4 B;  2ZYA A;  1URQ A;  1NTZ K;  4Y99 B;  4UB6 H;  3GW6 A;  3GMA A;  1MFZ A;  4ZKU A;  1AFO A;  4KHX A;  2YIU C;  1EZV D;  1EXI A;  1KYO E;  3L73 D;  4XA4 A;  1A02 J;  1NKN A;  1CI6 B;  5KJ7 D;  3E1I A;  1LWU B;  2LXC B;  1NTK G;  3C8V A;  3A0H H;  1SQP D;  4JYC A;  1NTM G;  1LTI C;  2KS1 B;  4GKG A;  1KB9 D;  4R4L A;  1KQF B;  2ZYD A;  1P84 E;  5B5E E;  1L0N D;  1Z56 A;  3B4S A;  2A06 D;  3HE5 B;  4OVN F;  2FYU K;  3RL0 g;  1OMI A;  5KLV E;  4QMA A;  4W80 A;  1N7L A;  1SQV E;  2OYH C;  1IFP A;  2OTJ P;  2JKV A;  2QJY C;  2E42 A;  5CMZ A;  1NH4 A;  2Z4E A;  3O8Z A;  2J59 M;  1W2E A;  3S9O A;  4JQ0 D;  1BCC E;  1PP9 E;  2WT7 B;  1XTG B;  4GOF A;  1ZXG A;  1YJ9 P;  1KYO D;  2W27 A;  1S4X A;  3H25 A;  1FDI A;  1LTJ A;  1YI2 P;  1GK6 A;  3O6Q B;  1FZF A;  1SQP K;  3PHL A;  3L4F A;  1EDI A;  3SWK A;  3WUU A;  2D2C C;  5APS A;  1L0N K;  3ITK A;  3HUS B;  4JPZ B;  2QE7 H;  1FJK A;  2WSC H;  3I5C A;  2RMZ A;  3TK1 A;  2QEX P;  1P84 D;  3H32 A;  3VMA A;  1LGH B;  3A5T A;  1L2P A;  4AUW A;  5KLV D;  1NO4 A;  3I56 P;  2K37 A;  1FZE A;  1JM0 A;  3BCC E;  1SQV D;  1U7M A;  3H1H G;  4WY4 A;  1RE3 A;  2IZ0 A;  2E74 D;  5CBO A;  3L71 J;  1KIL C;  2L5G B;  3CWB G;  4H13 B;  3UIA A;  1SQX G;  1RE4 A;  1KB9 H;  3VMZ A;  3QH9 A;  5AW4 B;  1BCC D;  1PP9 D;  1S5L E;  4DT0 A;  3B71 A;  4WBA A;  2QIW A;  3V6I A;  1ZW0 A;  2QVA A;  2RH0 A;  3T97 A;  1HGZ A;  1LWU A;  2WPV B;  5C39 A;  5AW2 B;  2E76 C;  1YTZ T;  2Q6Q A;  1VQ4 P;  2KS1 A;  1J1E B;  3P8C E;  1NKZ B;  1VQL P;  1Y9B A;  3CCJ P;  2GM4 A;  3LW5 J;  5AVU B;  3GG2 A;  1QLE D;  5CJ0 A;  3HE5 A;  1RQU A;  1KYO H;  1NAF A;  5BU8 B;  1SQV K;  1OVV A;  4EOT A;  5L8R J;  5CCH D;  3BCC D;  1NU1 G;  1QVF O;  1LT1 A;  4H13 D;  5APQ A;  2JO1 A;  4N3Y B;  1S72 P;  2IPP A;  2PFX A;  2QM8 A;  2D2C B;  2WT7 A;  3H1L G;  3WUT A;  1GDT A;  2W83 C;  4AQR D;  2R44 A;  4R4M A;  1HH0 A;  1U57 A;  1P84 H;  5B5E H;  5M1B A;  2FXP A;  1YIT P;  3TGU E;  1EXJ A;  1LP1 B;  3QWO C;  2GUS A;  3O6Q A;  5AVQ B;  1IC2 A;  1KIL E;  3IFM A;  1GW4 A;  1EDJ A;  2IDB A;  1FZA A;  2Q7C A;  3C1L A;  3CCQ P;  2WSF H;  3KQG A;  1KIL B;  2J58 A;  2I1J A;  4IFF A;  4H0L C;  2KP8 A;  1MUU A;  3HUS A;  1X79 B;  1FS0 E;  3P8C D;  1GD2 E;  3CC7 P;  2H8P D;  1T2K D;  3NTN A;  4H44 C;  3K5B A;  4I1L A;  1L0L J;  4PJ0 E;  3PRJ A;  1VDF A;  2K88 A;  3H1I E;  1BE3 G;  3A7O A;  5AVT B;  1OVR A;  3V5B A;  2KYV A;  2E76 B;  2XV5 A;  3RK3 E;  2YXR B;  3VP9 A;  1KZU B;  2IBZ G;  3RK3 B;  1VQ8 P;  3B5N D;  2XU6 A;  1X22 A;  3L75 G;  1VL2 A;  4DCK A;  3TGU D;  2K9J A;  1SQQ J;  4LGD E;  3CCL P;  3L72 G;  4U3F G;  2V7Q J;  5AW6 B;  5KJ7 C;  4IFM A;  1LTJ C;  2LKM A;  1Y47 A;  4L76 A;  3PJS K;  1IFM A;  1PGJ A;  3M9B A;  2A45 I;  2FYU G;  5KKZ C;  1USE A;  3PH0 A;  2M5A B;  4JBZ A;  1NTZ E;  1S5L H;  1SFC C;  3R4Y A;  1OXZ A;  3MD0 A;  3TYY A;  2Q5U A;  1T6A A;  1BDC A;  3H1I D;  2E76 D;  3PP5 A;  4HH2 A;  3L73 G;  2AEF A;  1A02 F;  2Y9Y A;  1T8Z A;  3RK3 D;  2NZ2 A;  4Y99 C;  2I8D A;  1GZL A;  3OA7 A;  4H44 B;  1RE4 C;  2P7J A;  2YMY A;  1LTB C;  3AED C;  3B5N A;  2AXT E;  1VQ7 P;  4OGQ B;  1N73 B;  3A0B E;  1H0T B;  1NHL A;  3M9H A;  1AA0 A;  3SFE C;  1LP1 A;  1AJY A;  3E1R A;  2OYO A;  3AE1 C;  4ZMD A;  3SSU A;  3WUV A;  2ZT9 D;  5AVZ B;  1L0N G;  2WWW A;  3H1K E;  1KIL A;  4Z1M H;  1HUC A;  2A06 G;  2M3B A;  1IFD A;  1VQP P;  1ZME C;  1MV8 A;  3JCU E;  1FDM A;  1YQ3 C;  1KFM A;  1N8R Q;  3VOP A;  5GTH E;  1EZV E;  3RBX A;  1FZC B;  2QM7 A;  1YYC A;  2K9Y A;  2ZFC A;  4WB4 A;  1JY2 P;  1PPJ E;  3PTZ A;  1VQ6 P;  1NTK J;  3E7K A;  4KJM A;  1EDL A;  1AV1 A;  4WVZ A;  2N9B A;  2IZ1 A;  1T3J A;  1NTM J;  2E74 C;  4OGQ D;  2Z5I A;  2VRS A;  3AEE C;  2IBZ I;  4GDO A;  1SFC B;  4PD4 E;  3HD7 B;  4PJ0 H;  2WZ7 A;  1PZQ A;  1L4A D;  3Q3D A;  3JC2 2;  4C46 A;  1VQN P;  1PV3 A;  4KT0 J;  1HWT C;  1E79 H;  5APX A;  1SLQ A;  2Y9Z A;  1SQQ E;  4L73 A;  3H1K D;  1N86 A;  1VPC A;  5KLV G;  5K5G B;  5AVY B;  3L35 A;  4W7Y A;  2KK7 A;  2M5A A;  1SQV G;  1PL5 A;  3HUS C;  2WQY C;  4RES B;  1PGP A;  5AW0 B;  5GTI E;  2HFE D;  5APY A;  2JWD A;  2AEJ A;  2YKP A;  1JCC A;  2BAS A;  1IFJ A;  5DJT B;  4YPC A;  5TIS E;  3T97 B;  3EFG A;  2B87 B;  2OTK E;  5APU A;  2IFN A;  1PPJ D;  2N9Y B;  2E75 B;  1SP4 A;  5CCH C;  3CC4 P;  4H13 C;  4BXL A;  1M57 D;  1FC2 C;  1SFC D;  5AVR B;  5KAI E;  3HD7 D;  2C0X A;  1AVO A;  2KNC A;  1YIJ P;  3KYQ A;  1N73 A;  2C9N Y;  1H0T A;  2R3S A;  3CCV P;  3LW5 H;  1SQB E;  4DJG A;  3WU2 E;  3CI9 A;  2QJP C;  1QEX A;  4PD4 D;  5AW5 B;  1L4A A;  5E79 E;  3MZW B;  1N7S D;  2Q3E A;  1ZV8 A;  3H1H J;  1CSB A;  2KSJ A;  1KB9 I;  1X0T A;  2H88 C;  1SQQ D;  3P8M C;  3CWB J;  1YJW P;  1SQX J;  3GHG A;  4N78 E;  1FOS E;  2E74 B;  2HG5 D;  5AW3 B;  1J1E C;  3BCC G;  1ZOY C;  2AXT H;  1PFI A;  1FZC A;  3A0B H;  2WIT A;  2FY8 A;  1N2D C;  1LNQ A;  1T2K C;  1AVY A;  1DX7 A;  2SPZ A;  2O01 J;  3CCS P;  1JEK A;  1GU4 A;  5KJ7 A;  2JWA A;  2E75 D;  3JCU H;  2KUB A;  3VMY A;  3BRV B;  4YXW H;  3KZI E;  3CX5 I;  4D6T G;  2H7H A;  3M0A A;  3V4Q A;  4JF7 A;  1BGY J;  1SFC A;  3AE5 C;  5GTH H;  2O1J A;  3HD7 A;  3L70 J;  2POH A;  4C7N B;  2YKQ A;  1JCD A;  1SQB D;  3B5N C;  5AVX B;  3SFD C;  1OX3 A; 
#chains in the Genus database with same CATH homology
 3M06 A;  5AVQ B;  1IC2 A;  3IFM A;  1SQQ K;  3C9I A;  1GW4 A;  2P67 A;  3MGN A;  1RF0 A;  3V2N A;  5APT A;  4WY4 C;  1FZA A;  4M3L A;  2NPS D;  1RE3 C;  2CPB A;  2Q7C A;  2WSF H;  3VN0 A;  3KQG A;  2JJL A;  1KIL B;  2J58 A;  2I1J A;  4IFF A;  1JO5 A;  1GK4 A;  3HTK B;  2KP8 A;  1MUU A;  2M8R A;  3HUS A;  1X79 B;  1ZLL A;  3P8C D;  1GD2 E;  4N78 D;  2H8P D;  1T2K D;  3NTN A;  2R32 A;  1JY3 O;  4I1L A;  2MJZ A;  1JOC A;  2P2U A;  2XDJ A;  1LTT C;  2HOD B;  1ZR2 A;  2FKW B;  1DEB A;  3KDP B;  2WSE H;  3U1A A;  5BVZ A;  3NMD A;  2GUV A;  1VDF A;  3A7O A;  4GIF A;  5APW A;  3RL0 B;  1LWU C;  5AVT B;  3V5B A;  2KLV A;  1LT9 B;  3RL0 C;  2KYV A;  2XV5 A;  1GTW A;  1LTA C;  1OWA A;  3VP9 A;  1ZN5 A;  1KZU B;  2R5B A;  2O01 H;  2YO3 A;  1S9K D;  1NU1 K;  3BAS A;  5AW8 B;  3IR9 A;  4W7Z A;  1J2J B;  3RK3 B;  1HJB A;  2NPS B;  4HYT B;  1MZ9 A;  3B5N D;  2XU6 A;  1SQB K;  3RK3 C;  3LID A;  5CCG D;  5AW1 B;  4IFD K;  4C7R A;  4I6M C;  1RF1 B;  5KTB A;  1GL2 A;  4DZO A;  3M9Q A;  1JTH B;  3CL3 D;  2IFM A;  1FBM A;  3MTU E;  5AVW B;  4WY4 D;  4B86 A;  1L0L K;  2WPS A;  4LGD E;  1JUN A;  4JYB A;  1LTJ B;  3HRN A;  2C0W A;  5AW6 B;  1LTG C;  2HPC B;  5KJ7 C;  3U1C A;  4IFM A;  1LTJ C;  2CPS A;  4O9B A;  2LKM A;  2XNX A;  3RK2 C;  5CHX A;  2P1J A;  5BU5 A;  4LLH A;  1IFM A;  1M7L A;  2HYN A;  3M9B A;  2A45 I;  3P32 A;  1HBW A;  1RF1 A;  2WTY A;  2XKM A;  1QL2 A;  1SFC C;  1OXZ A;  3MD0 A;  2N1T A;  1SVF A;  1J1D B;  2FFD B;  3TYY A;  2Q5U A;  3SWY A;  3H32 B;  3B5N B;  3RL0 D;  1J1D C;  2XZR A;  1EQ7 A;  3HE4 B;  3V2R A;  2IX7 C;  3PP5 A;  4HH2 A;  1N7S A;  2OAR A;  1M1J A;  4I2L C;  1KQL A;  4WY4 B;  1HGV A;  1URQ A;  1NTZ K;  4Y99 B;  1A02 F;  1T8Z A;  3RK3 D;  1MFZ A;  1FU1 A;  4ZKU A;  1NTK K;  1AFO A;  1G2C B;  5AVS B;  3NXS A;  4Y99 C;  4KHX A;  1H89 A;  1GZL A;  1GU5 A;  1JY2 O;  2FFD A;  3R2P A;  3OA7 A;  3M0D A;  1RE4 C;  2P7J A;  2YMY A;  1LTB C;  3B5N A;  4C7N A;  5APV A;  1FOS F;  5CCG A;  1N73 B;  4XA4 A;  1NHL A;  3VP8 A;  3HE4 A;  1A02 J;  1NKN A;  3M9H A;  3TNU B;  1CI6 B;  1N73 C;  5KJ7 D;  3BVH A;  3RK2 D;  1YTZ I;  3E1I A;  3U59 A;  1LWU B;  3VYI A;  5AVZ B;  2PAJ A;  1H88 A;  2ZXE B;  2KOG A;  1L4A C;  2WWW A;  1KIL A;  1HUC A;  2M3B A;  1IFD A;  1MV8 A;  3HTK A;  3G3Z A;  5CCH A;  1H8A A;  3H6P A;  4JYC A;  1FDM A;  4ZKP A;  1KFM A;  1LTI C;  2W6B A;  4GKG A;  3VOP A;  2O1K A;  1JY3 N;  3MIW A;  1CI6 A;  2HOD A;  3GHG C;  1IO4 A;  1Z56 A;  3CLQ A;  3HE5 B;  2FYU K;  1FZC B;  2OYH B;  2QM7 A;  1YYC A;  2OYI B;  1FZC C;  4W80 A;  1WT6 A;  4AYC A;  1N7L A;  2OYH C;  1IFI A;  1X9V A;  4OH8 B;  2A45 G;  3LIE A;  2ZFC A;  2OYI C;  4WB4 A;  2C9L Y;  1JY2 P;  2R3C A;  1LT9 A;  2E42 A;  5CMZ A;  1NH4 A;  2Z4E A;  3O8Z A;  2J59 M;  1JY3 P;  3RK2 B;  2N9B A;  1W2E A;  2NPS A;  1T3J A;  2WT7 B;  5KLV K;  2Z5I A;  2VRS A;  1XTG B;  3NFQ A;  1IK9 A;  1SFC B;  1JTH A;  3HD7 B;  2WZ7 A;  2W27 A;  1IJD B;  2N1T C;  3A2A A;  1FJP A;  1L4A D;  1XTC C;  3HD7 C;  4C46 A;  3OJA B;  1AQ5 A;  1LTJ A;  2HPC A;  1HWT C;  1GK6 A;  1FZF A;  1FAV A;  1ZR4 A;  1SQP K;  5APX A;  1KFN A;  1SLQ A;  2I1K A;  3N4X A;  1N7S C;  2WPR A;  1M1J C;  3EQ2 A;  3L4F A;  1URQ C;  2HLO A;  1RF0 C;  1G1J A;  5APS A;  1N86 A;  1VPC A;  3BAT A;  1L0N K;  5AVY B;  3L35 A;  2R5D A;  4W7Y A;  3HUS B;  3V2P A;  1NWQ A;  3P7K A;  1FJK A;  2WSC H;  3I5C A;  1FZG A;  3HUS C;  3TK1 A;  4RES B;  5AW0 B;  1NTM K;  3TSI A;  3KPE A;  3H32 A;  5CCG C;  1LGH B;  5AVV B;  2HFE D;  5APY A;  4XE5 B;  3A5T A;  1QL1 A;  1X8Y A;  2YKP A;  4AUW A;  1LTS C;  1NO4 A;  1E5W A;  1JCC A;  2BAS A;  1FZE A;  1IFJ A;  5AW9 B;  4N6J A;  2WPQ A;  3EFG A;  4WY4 A;  1RE3 A;  1L4A B;  5APU A;  3B8E B;  1KIL C;  2L5G B;  1G2C A;  1T3U A;  2IFN A;  1HVV A;  3UIA A;  4EIJ A;  1SP4 A;  1RY3 A;  1RE4 A;  5CCH C;  1FZB A;  3VMZ A;  1JY2 N;  4LC1 A;  1SFC D;  2N1T D;  5AVR B;  5AW4 B;  3HD7 D;  2C0X A;  2JEE A;  3M91 A;  3KYQ A;  1N73 A;  2PP6 A;  3GHG B;  2C9N Y;  4WBA A;  1G1I A;  3LW5 H;  3TNU A;  3L37 A;  3CI9 A;  5AW5 B;  2Q3I A;  3T97 A;  1NOH A;  1GL2 B;  1L4A A;  1N7S D;  1HGZ A;  2YNY A;  1LWU A;  1GL2 C;  1URQ D;  1ZV8 A;  2W6A A;  1LT9 C;  5AW2 B;  1CSB A;  2YO2 A;  2KSJ A;  1YTZ T;  3WMM 0;  3P8M C;  3OAK A;  1J1E B;  3P8C E;  3GHG A;  1NKZ B;  2A45 H;  4N78 E;  1FOS E;  2NPS C;  4DOJ A;  2GM4 A;  2HG5 D;  1HTL C;  5AVU B;  1J1E C;  5AW3 B;  3V4W A;  2KB7 P;  2FYZ A;  5AW7 B;  5CJ0 A;  3HE5 A;  1PFI A;  1JNM A;  1NAF A;  1FZC A;  2WIT A;  2OYH A;  1RF1 C;  5BU8 B;  1GW3 A;  1N2D C;  1SQV K;  2OYI A;  4GT1 A;  2N1T B;  1T2K C;  3II6 A;  1JMM A;  3VMX A;  4EOT A;  3MUD A;  1DX7 A;  2FXM A;  1KIL D;  3V2Q A;  1GU4 A;  5CCH D;  5KJ7 A;  5APQ A;  3VTP C;  3N7N A;  3SWF A;  3A3Y B;  4N3Y B;  1N7S B;  1M1J B;  2YKO A;  2IPP A;  1S9K E;  1DH3 A;  2QM8 A;  1WRG A;  3BRV B;  1URQ B;  3VMY A;  2WT7 A;  5CJ4 A;  1GDT A;  4AQR D;  3L36 A;  1CZQ A;  2H7H A;  3M0A A;  3V4Q A;  4JF7 A;  1CW5 A;  1HH0 A;  1SFC A;  2O1J A;  1IFN A;  2Q9I A;  3HD7 A;  1SQX K;  2H43 A;  1GL2 D;  2POH A;  4C7N B;  2FFD C;  2YKQ A;  1JCD A;  3M0D C;  3BRT B;  3B5N C;  5AVX B;  2E43 A;  2GUS A;  2Z5H A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...