4EOTA

Crystal structure of the mafa homodimer bound to the consensus mare
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
92
structure length
92
Chain Sequence
b'RFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor MafA
publication title A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 39
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4eotA00
1GZLA 1IO4A 3MD0A 1CZQA 2WWWA 1T2KC 3HTKA 3P7KA 1HBWA 3HE4A 1J2JB 1JNMA 1HJBA 3O8ZA 2ZXEB 5AW4B 5AW8B 5AVXB 5AW6B 2WPQA 3HE5A 1MUUA 3NTNA 5AVYB 5AW5B 3M06A 3VN0A 3NMDA 1YYCA 3LIEA 2Z5HA 5AVVB 4C46A 5AVQB 1OXZA 2W6AA 1A02J 1CI6A 1MV8A 3L35A 3V4WA 2YNYA 3TNUB 3A3YB 3M9BA 3UIAA 2C9NY 1CSBA 2E42A 4AQRD 2QM8A 1H89A 5AVSB 3VYIA 2VRSA 1GTWA 1S9KE 1GK4A 3A5TA 2ZFCA 2Q3IA 3V5BA 4XE5B 3NXSA 4I2LC 2N9BA 2WPRA 3M9HA 5APSA 5AVTB 3V4QA 2P7JA 4HYTB 2XV5A 3KDPB 1DH3A 5AW3B 1NAFA 3VMXA 3MGNA 2Z5IA 3VMYA 4LC1A 3TNUA 2WPSA 5APXA 1GD2E 2Q7CA 2Q5UA 1T2KD 5AW9B 5APUA 3P8MC 5APVA 5AW2B 5AVUB 2WT7B 1GU5A 1NWQA 1SP4A 3HE4B 1A02F 5APWA 3L37A 3VTPC 2IPPA 4B86A 5CMZA 4C7NB 3HE5B 3L36A 5APTA 2R5DA 5AW0B 3TK1A 4I6MC 4RESB 2W27A 1MFZA 2JJLA 2WTYA 2R5BA 5AVWB 3NFQA 2YO3A 5APYA 3P32A 1S9KD 2C9LY 2R3CA 3A2AA 5APQA 1CI6B 5AW1B 4DZOA 2R32A 2P2UA 1OWAA 1SLQA 4JYBA 3I5CA 1FOSF 4JYCA 5AVRB 3M0DA 3T97A 4AYCA 4GKGA 4KHXA 3B8EB 3M0AA 2WT7A 1FOSE 1HWTC 1KQLA 2P67A 1HUCA 3OAKA 4AUWA 1G2CB 2E43A 4C7NA 2H7HA 2BASA 2YO2A 3SWFA 4M3LA 2QM7A 1H8AA 3VMZA 1GU4A 3IR9A 4EOTA 3A7OA 2XZRA 1FAVA 1GK6A 3M91A 3TYYA 5AW7B 2XU6A 3LIDA 2KP8A 1X8YA 3KQGA 4GT1A 1JUNA 5AVZB 1H88A
chains in the Genus database with same CATH superfamily
1RE3C 2WWWA 3HTKA 3MHVA 4YTPC 3TGUG 2JEEA 1OW6A 2ZXEB 2AEMA 3EWKA 2ZXXA 2ZVNB 1SQQD 2YKPA 3C9IA 3II6A 2GUVA 2IFMA 1E79H 4PD4E 1JOCA 1KQFB 3SWKA 2QJYB 1NYHA 2RH0A 5BU8B 3H25A 1SQXG 2Y0CA 1L0LJ 1KB9D 2NRGA 1JCDA 3CWBD 2OYIC 4L75A 2XV5A 4YXDC 4OGQD 1ZOYC 4W80A 1NTZK 1AVOA 1S72P 1Y9BA 3MZWB 1SQBJ 4H13C 2PGDA 1URQA 4N78E 1RY3A 5CMZA 3P8CD 3CC4P 2OTJP 4RESB 2K9JB 3WU2E 2ZAEB 4EI2A 2ZYDA 2K3RA 2FYUG 2KNCB 2M3EA 3VOPA 2YIUB 2KYVA 3H32A 1N73B 1KN7A 1URQC 1AA0A 1FU1A 1EZVD 3BCCE 2QM7A 3L74E 3TYYA 2O01J 1NTMJ 4WWIA 2E74B 2Q9IA 3TDKA 4Y99B 3EQ2A 4W7ZA 3V2RA 1SQVK 2WPQA 1MUUA 1M7LA 3PHLA 1AQTA 4D6TJ 2KK7A 3L35A 2R3SA 2E42A 1P84H 3CCQP 1NTMG 2BEQD 1KYOE 1S9KE 1FC2C 2KZIA 1BE3G 1JY2P 1M1JA 5BU5A 2ITAA 3PRJA 3A0HE 1PGJA 3VMXA 2Z5IA 1GD2E 2O01N 3MTUE 3R2PA 4PD4D 4I6MC 1OMIA 2WTYA 5KLVK 1M1JC 3I56P 5B66H 3L70E 2A45H 5AW1B 3RL0g 3RBZA 1KORA 4IFFA 4JYBA 2D2CB 2E76C 2WSCJ 1HH0A 2E43A 2H7HA 2Q6QA 1BGYE 4ZKPA 1QL1A 4RO0A 1NU1J 4N78D 3CXHI 2XU6A 1X79B 1CW5A 1YTZI 2E74D 2WSEH 1RF0C 4WVZA 2QJKB 1PPJG 2YKOA 3U1AA 1LT1A 2H88C 3HE4A 1J1DB 5AW8B 5AW5B 5AVYB 1Q7YQ 3Q2YA 1VF5C 1Q82Q 1SQXK 3D70A 3CPWO 4GDOA 4GOEA 3BCCD 4L76A 3QWOC 3L74D 1Z56A 2IBZE 2WITA 1M90Q 2WPVB 1FZCA 3O6QA 3D6YA 1FZAA 1M8OB 3V4QA 5CBNA 2AEJA 2FYNB 1RE4A 1JY2O 3V2PA 3AE3C 1KZUB 1NJIQ 1HJ0A 2FYUK 1KQGB 5APWA 3IAOA 3HUSA 4C7NB 2HFED 1FZCC 2JJLA 3H1HG 2R5BA 1KYOD 1S9KD 1JCCA 3L75G 4DOJA 1P84E 3V2QA 1RE4C 4MN4C 2XKMA 3C8VA 3I5CA 4JYCA 3GMAA 1NH4A 4AYCA 2JO1A 1VQ8P 4I7ZC 2P1JA 1G2CB 3H1KE 3HUSC 1UIIA 2JWDA 1EDKA 2B9BA 4GIFA 2JP3A 5KLIC 4OGQC 5KKZC 3LIDA 2SPZA 1JUNA 2IYPA 2CPSA 1N7SB 1VQ6P 3L70D 2W8ZA 1NTKE 3KPEA 3L71D 4H0LB 1NTMK 2HPCB 1L4AB 5B66E 1OVRA 1RF1A 2GM4A 2RMZA 3HRNA 3AE4C 2A06E 3AEFC 1XTGB 4RJTA 1A02J 2GUSA 1DD3A 5CCGD 3MUDA 1QGKB 1BGYD 3Q3DA 3S4RA 3H1LE 1KD1Q 3AE9C 2N1TD 5DJTB 1BCCJ 3K5BA 3M9HA 1T8ZA 1N86A 3MUDC 3GHGB 5APVA 1SP4A 2R5DA 3CLQA 4BRYB 1LT9B 3NFQA 1NTZJ 2IBZD 3AE2C 5DJUB 5K5GB 2QJYC 3M0DA 1GMJA 2L5GB 2GA1A 1HWTC 2OARA 3KZIE 2PFXA 1LWUA 4H44B 1DIPA 2YMYA 3A7OA 1S5LE 4UB8E 1YQ3C 4GT1A 5AVZB 1SS1A 1MZ9A 1N7SD 1M57D 1P84D 1N73A 1PP9J 5KJ7A 3B5NB 5AW4B 1GL2B 1LTAC 2OGUA 3FGAD 3HE5A 1W2EA 4PJ0H 2E5YA 3BASA 3V4WA 3H1KD 2QM8A 1MKMA 4NPDA 5AVSB 1SQVJ 1VQNP 3MP7B 2E75D 3VMAA 2YIUC 3V5BA 4TLFA 2KS1B 1KC8Q 1N73C 1OIPA 1SQQG 1FDMA 3JCUE 1NTKD 2MJZA 3KDPB 4U3FD 4GOFA 3H1JE 1ZRTE 2E74C 2A06D 1U57A 1IK7A 3W68A 1ZMEC 2FFDA 3CWBG 3FX0A 2KLVA 3CC7P 2KOGA 3H1LD 3A2AA 3BRTB 1JTHA 2P2UA 2XNXA 4KHXA 2BCCJ 5KLVJ 4H44D 3A0BH 3GF3A 1HTLC 2XZRA 2O01H 4KT0J 3L72E 2RKLA 1RE3A 5KAIH 1LP1B 2OTLP 3L73D 4EYYQ 3TGUJ 1EZVG 3B5ND 1NVOA 3M06A 2QIWA 5AVQB 1CI6A 5CBOA 4AQRD 3V6IA 1SQPD 4WB4A 3CD6P 1RQUA 5CJ4A 1OFCX 1AVYA 2Q3IA 1NAYA 1SQXJ 2ZYAA 4TT3H 2HR3A 5APSA 3U59A 5CCHD 5KAFH 2OYIA 2O3JA 1ZLLA 1IJDB 1JY3P 3VMYA 2O1JA 3CCEP 1SFCB 3LW5H 5GTIE 2YKQA 2QJKC 2OTKE 5EFWB 1JM0A 1PV3A 1VQ7P 1GU5A 4PV1B 2B87B 2N1TA 3VP9A 2WQYC 3C1LA 1G1JA 4PJ0E 2AEFA 3CX5I 4K35A 2IYOA 4N3YB 4ZMDA 1FJPA 2WSFH 3E1IA 1LTJB 4DT0A 2FYUJ 5H2FH 2WSCH 3H1JD 1L0LE 2N1TC 4C7NA 1ZRTD 2Y9ZA 1HGVA 3TF5A 1GU4A 4ASVA 1SQBE 4JF7A 3CCJP 3OW2O 4A7PA 2UWJE 1KB9I 3E7KA 1J2JB 1TU3F 1YJWP 3GLMA 3ZDMA 1SQQK 4C46A 2P10A 4HH2A 1VL2A 1H89A 3T97B 1K04A 3SSUA 3L72D 2HPCA 1FDIA 4OVNF 1BE3J 1VQPP 1PGOA 3EFFK 3I55P 1W2BO 4HYTB 3USSA 2QE7H 3BCCG 5KAIE 4LC1A 1SFCD 3L74G 1H0TA 2H8PD 5AW9B 2I1JA 2YXQB 1JY3O 1M56D 1EZVI 4PV1D 4C7RA 2KLUA 5AW0B 1JB0J 4D6TE 3G9RA 3HD7B 2OYOA 2PRRA 3KHUA 5TISE 2BEZF 1QVFO 4DJGA 2KXPB 4L73A 3LW5J 2CPBA 2E75C 3KYQA 1FZFA 3WMM0 2JKVA 2OQQA 3M91A 1IFIA 3L71E 3RK2B 2KB7P 1WRGA 1EDJA 1RF0A 2WSFJ 1Q90D 2H43A 2G8YA 3G71P 2QVAA 2OYHB 1QLED 1YI2P 2YMKA 1LT9C 3GG2A 1L0LD 2W6AA 1MV8A 2YNYA 3TNUB 1L0NE 5CHXA 3AE7C 3L70G 1ZR4A 1IZNB 3L71G 4PD4I 3VYIA 4WY4B 1LGHB 2NZ2A 1SQBD 3B5NA 3CL3D 1NU1E 4H44C 3CI9A 4IL6X 3CMAP 1W5CE 4HJGH 2WPSA 5APXA 1BGYG 1J1EB 3S9OA 3HTKB 2FKWB 1RHZB 2AXTH 1ZN5A 2KS1A 3L37A 2QG4A 3AEBC 1VQMP 5APTA 1DX7A 3B5NC 3H1HJ 5CCHA 5AVWB 3L75J 3HD7D 2M5AA 1VPCA 5AVRB 5GTHH 3CCMP 3B8EB 1VQLP 2KSJA 3B71A 1N2DC 2ZVOB 4OH8B 2IBZG 2M0BA 3CX5H 5CCHC 1H8AA 3AEGC 3CCRP 3RK2D 1X8YA 4D6TD 5L8RJ 1GW3A 3MD0A 2D2CD 4ZNCA 2HLOA 2H89C 1BDDA 2QA4P 1NO4A 1OXZA 1PGPA 1YQ4C 3FWLA 3Q5RA 1FZBA 1ZR2A 4WY4D 4WBAA 1KB9H 3H32B 3A5TA 3OJAB 1KYOI 3N4XA 4XE5B 4U3FE 3AE1C 1FBMA 1DEEG 1QX8A 3G6EP 4NPEA 2RN0A 3H1KG 2IFNA 1QL2A 2IZ1A 2M8RA 2YXRB 2HODB 5APUA 1NWQA 2QSIA 2ZJSE 3IF4A 1L0ND 3PJSK 1NTKG 4B86A 1FE6A 1S4XA 1JMBA 3F89A 1JY2N 4U3FG 3AEDC 4JQ0D 3D6ZA 4DZOA 1NU1D 2A06G 1SFCA 1X22A 4GKGA 2QRXA 1BCCE 2FYZA 1OX3A 3M0AA 2O1KA 3L4FA 4YXWH 2V7QJ 1M1JB 3V2NA 3H1LG 3AEAC 2M3BA 1R8EA 2KZJA 3D71A 5AW7B 1AFOA 2QJPB 3L73E 1LTJA 1SFCC 3AE5C 4NPFX 1EC5A 1OVUA 5E79H 4XFJA 1GW4A 4PV1C 4R4LA 4N6JA 2JWAA 1USEA 4IL6H 4Y28J 3JC22 3VN0A 2K9JA 1SQPE 5AVVB 2L91A 2C0WA 1USDA 1WT6A 2KIKA 3KXDA 2C9NY 1LTJC 3RK3E 1X0TA 3L73G 1YITP 2KNCA 2LXBA 4H0LD 2B89A 2ZFCA 3PP5A 2IBZI 3NXSA 4I2LC 1SQQJ 1BSHA 2N9BA 1L4AD 2WPRA 1VF5B 1S1CX 3IN6A 3M9QA 1OVVA 3CXHH 3MGNA 1SQPG 1KTMA 2Q7CA 4PD4H 1Q2NA 1ZW0A 1OW8A 2G3AA 1PP9E 3TSIA 3CC2P 3HE4B 1A02F 3VTPC 3CWBJ 3RK3B 2W27A 3CCSP 4Z1MH 1SQVE 2C0XA 1P84I 2FBWC 1OWAA 3FXDA 1VQ9P 2WZ7A 4Y99C 1S2EA 4L74A 1HUCA 3OAKA 3RGUA 3WUVA 3O6QB 3JSVC 4JPZB 3HD7A 3WU2H 1GK6A 4R4MA 1VQKP 1ZXGA 2K88A 4OWFA 3H1JG 3P7KA 1XTCC 1S3JA 1JNMA 4DCKA 1NGMB 1BCCD 5KLIB 5KKZB 2W83C 3HD7C 1IFDA 2K37A 2I1KA 3A3YB 3M9BA 1CSBA 1N7LA 2BCCE 5KLVE 1GTWA 2LR2A 3IFMA 2OYHA 1NKNA 2Q3EA 1VF5D 1GL2D 3SFEC 1NTKK 2MKVA 1NAFA 1NTZD 3TNUA 1FDOA 1IFJA 3MIWA 3BRVB 4LGDE 1K05A 1LTBC 5E79E 1T2KD 3TGUE 1LTIC 1IFPA 2D2CC 3L72G 2R44A 2WT7B 1DD4A 1PZQA 2FXMA 1KYOH 2OYHC 3RK3D 1RF1B 2C9LY 3H1IE 1QVGO 1Y47A 1IFMA 2FXPA 2R32A 5CCGA 3F5HA 1SQXE 2FY8A 1MFTA 4WY4C 1FOSE 1L2PA 1X9VA 1JMMA 3AE8C 1PP9D 1J1DC 1AV1A 3CXHE 1N8RQ 1EXJA 1QEXA 2KP8A 1NHLA 4ASWA 5CCGC 3H1IG 4EIJA 4K3AA 1R5SA 1U7MA 1J1EC 1LTSC 3BATA 1IC2A 1SQVD 3Q5SA 1HJBA 1FZGA 1NOHA 1SVFA 3PH0A 5CJ0A 2FYUE 2FYNC 3G3ZA 1KILE 1DEBA 3CMEP 2ZT9B 2ZYGA 1SQPK 5M1BA 5B5EH 4HKZH 1VQ4P 4I1LA 1HGZA 1G2CA 1FJKA 1LWUB 4YPCA 1Q81Q 1L0LG 3SFDC 1EDLA 3Q5PA 3BCCJ 3L74J 1EQ7A 1K73Q 1N7SA 1RH5B 1S5LX 1SQBG 1KILB 2BCCD 3HE5B 3L36A 5KLVD 1L4AA 3A0BE 2KUBA 1NTME 4IOIH 2J5UA 1R5LA 1FOSF 2HODA 1NKZB 1T3UA 1N7SC 1BE3E 1LNQA 4UB6H 2P67A 4H0LC 1PGQA 1KFNA 1ZP0C 3TGUD 4LLHA 1L4AC 1M1KQ 2E5TA 3CCVP 1K8AQ 2CK3H 2DW3A 3QH9A 3GF7A 2KI7B 2I8DA 3GHGA 3H1ID 1YHQP 2P58A 2FFDB 1T3JA 5KAFE 5AW6B 1SQXD 1KFMA 3NMDA 4BRYA 1LT9A 4D6TG 2NPSB 3L70J 3UIAA 1JTHB 3L71J 2ZT9D 5TJHA 3CXHD 2Y0DA 3GHGC 4U7JA 4CPGA 1UIXA 4W7YA 1E5WA 1PPJE 2B88A 3RL0B 1BGYJ 2QJPC 5H2FE 1L0NJ 5BVZA 1EXIA 5AVUB 2FYUD 5KJ7D 1KILD 2IPPA 2K9YA 1GL2A 3G4SP 2K1AA 1G1IA 1CI6B 1EDIA 1JY3N 3W67A 5B5EE 2XNDH 1YBKA 2IX7C 1L0NG 3U1CA 2V7QH 1IFNA 2POHA 3R4YA 2OYIB 1GL2C 1NU1G 1H88A 1T2KC 1BSNA 3B4SA 1HBWA 4H13B 3FWNA 1NTMD 2N1TB 3H1HE 3L75E 3O8ZA 4GODA 3KZIH 3RK3C 3CCLP 3AE6C 1BE3D 1YYCA 3LIEA 1U7JA 1L0LK 2NPSD 4UB8H 1S5LH 2AXCA 2WMMA 4UB6E 1GK4A 1URQB 3VP8A 2PAJA 1SQBK 1ZV8A 2P7JA 1YJNP 3H1KJ 1AJYA 1DH3A 3RL0D 1RQVA 2V4HA 2Q5UA 1K9MQ 1FZEA 1T6AA 1LP1A 1NTKJ 5KTBA 4U3FJ 3E1RA 2YO3A 3JCUH 1PL5A 5APQA 1LJ2A 1GDTA 1PIXA 2WT7A 1PPJD 4HB1A 1YIJP 1KQLA 3ITKA 2QEXP 2BASA 3H1LJ 4M3LA 1PFIA 3IR9A 2HG5D 2A45G 3KQGA 4IFMA 1H0TB 3GW6A 1Y8AA 2WSEJ 1CZQA 2E75B 4H13D 3AECC 4O9BA 2B87A 5AVXB 2HYNA 3NTNA 1RF1C 1KMIZ 2Z5HA 4KJMA 3BVHA 5C39A 2E76B 2J59M 2W6BA 3L73J 2AXTE 4ZKUA 1URQD 1BDCA 3PTZA 4IFDK 4JBZA 3AEEC 1NTZE 1BCCG 1AQ5A 5AVTB 3Q1MA 3EFGA 5AW3B 3H1HD 1SQPJ 3L75D 5GTHE 1HVVA 3P8MC 4QMAA 2Z4EA 3CCUP 1VQ5P 1L0NK 2IDBA 3WUUA 3CX5E 3FXEA 3SWYA 1MFZA 2LXCB 1NTZG 2PP6A 1SLQA 1NU1K 5GTIH 2ZT9C 3M0DC 3T97A 1SQQE 3OA7A 1VDFA 3ABVC 4BWNA 4AUWA 1KILA 3WUTA 2Q1KA 1LWUC 2KSEA 4EOTA 1FAVA 2W90A 1OZHA 4RKUJ 1GZLA 1IO4A 3H1JJ 3N7NA 2FXOA 1KB9E 3CWBE 2IZ0A 2JDIH 5KJ7C 1YJ9P 1PP9G 1FZCB 1KILC 2LKMA 2M5AB 2WVRA 1HF9A 1OW7A 2WSSH 2W6JH 2E76D 3P8CE 4BXLA 1Q86Q 4EDFA 1SQVG 2VRSA 4I7ZB 1JEKA 1YTZT 3HUSB 4XA4A 3PLNA 2N9YB 2A45I 2JR8A 1LTTC 4OGQB 2NPSA 1EZVE 3L72J 1LTGC 5AW2B 1IK9A 2FFDC 1JO5A 3TK1A 2Y0EA 3S1KA 5APYA 3P32A 1KQSO 2R3CA 1D7MA 3H6PA 2NPSC 3RK2C 1FS0E 2J58A 1WMKA 4WY4A 1VQOP 2BCCG 5KLVG 4IL6E 2XDJA 2YO2A 3SWFA 2Y9YA 3VMZA 1KV4A 3A0HH 3CX5D 3RBXA 5TISH 3RL0C 3H1IJ
chains in the Genus database with same CATH topology
1RE3C 1GW3A 1MZ9A 1N7SD 3MD0A 2WWWA 3GHGA 3HTKA 2HLOA 2FFDB 1N73A 5KJ7A 2JEEA 2ZXEB 3B5NB 5AW4B 1GL2B 1LTAC 1T3JA 5AW6B 3HE5A 1W2EA 1KFMA 2YKPA 3NMDA 1LT9A 3C9IA 1NO4A 3BASA 3II6A 2GUVA 1OXZA 2IFMA 3V4WA 2NPSB 1JOCA 3UIAA 1JTHB 1FZBA 1ZR2A 2QM8A 5AVSB 5BU8B 4WY4D 3GHGC 4WBAA 3H32B 3A5TA 3V5BA 3OJAB 3N4XA 4XE5B 1N73C 4W7YA 1FDMA 1FBMA 1JCDA 2OYIC 2MJZA 2XV5A 3KDPB 4W80A 2IFNA 1E5WA 3RL0B 1NTZK 1QL2A 2M8RA 2HODB 5APUA 5BVZA 5AVUB 1NWQA 1URQA 5KJ7D 4N78E 2FFDA 1RY3A 1KILD 2IPPA 4B86A 5CMZA 3P8CD 1GL2A 4RESB 1JY2N 2KLVA 2KOGA 1G1IA 3A2AA 1CI6B 3BRTB 4DZOA 1JY3N 1SFCA 1JTHA 2P2UA 2XNXA 2IX7C 4GKGA 4KHXA 3M0AA 2FYZA 3VOPA 3U1CA 2KYVA 3H32A 1N73B 2O1KA 1URQC 3L4FA 1IFNA 2POHA 1M1JB 1FU1A 3V2NA 2QM7A 2OYIB 1GL2C 2M3BA 1HTLC 2XZRA 3TYYA 2O01H 5AW7B 1AFOA 1H88A 1RE3A 1LTJA 1SFCC 2Q9IA 4Y99B 3EQ2A 1T2KC 1HBWA 2N1TB 1GW4A 4W7ZA 3V2RA 4N6JA 1SQVK 3B5ND 3O8ZA 2WPQA 1MUUA 3M06A 3RK3C 3VN0A 1M7LA 1YYCA 3LIEA 5AVVB 5AVQB 2C0WA 1CI6A 3L35A 1WT6A 1L0LK 2NPSD 2C9NY 2E42A 4AQRD 4WB4A 1LTJC 5CJ4A 1S9KE 1GK4A 1URQB 2ZFCA 2Q3IA 3VP8A 3PP5A 3NXSA 4I2LC 2N9BA 1L4AD 1SQBK 2PAJA 1JY2P 2WPRA 1M1JA 5APSA 3U59A 5BU5A 5CCHD 1ZV8A 2P7JA 2OYIA 1ZLLA 3M9QA 1DH3A 1IJDB 3VMXA 3MGNA 1JY3P 2Z5IA 3RL0D 3VMYA 1GD2E 2O1JA 1SFCB 2Q7CA 2Q5UA 3LW5H 2YKQA 1FZEA 3MTUE 3R2PA 1GU5A 3TSIA 2N1TA 3VP9A 3HE4B 1A02F 5KTBA 3VTPC 1G1JA 3RK3B 4I6MC 2W27A 2WTYA 5KLVK 1M1JC 2YO3A 2A45H 5APQA 4N3YB 5AW1B 1GDTA 1FJPA 2WSFH 2C0XA 3E1IA 1LTJB 1OWAA 4IFFA 4JYBA 2WZ7A 2WSCH 4Y99C 2WT7A 1KQLA 1HUCA 3OAKA 2N1TC 1HH0A 2E43A 4C7NA 2H7HA 2BASA 4M3LA 1HGVA 1PFIA 4ZKPA 1QL1A 3HD7A 1GU4A 3IR9A 2HG5D 4N78D 1GK6A 2XU6A 1X79B 2A45G 1CW5A 3KQGA 1YTZI 4IFMA 4JF7A 2WSEH 1RF0C 1CZQA 2YKOA 3P7KA 4O9BA 3U1AA 1XTCC 3HE4A 1J2JB 1JNMA 1J1DB 5AW8B 5AVXB 2HYNA 3NTNA 5AVYB 5AW5B 1RF1C 1SQXK 1SQQK 2Z5HA 4C46A 3HD7C 1IFDA 3BVHA 2I1KA 3A3YB 3M9BA 1CSBA 1N7LA 4HH2A 2J59M 1H89A 2W6BA 4ZKUA 1Z56A 1GTWA 2WITA 1URQD 3IFMA 2HPCA 2OYHA 4IFDK 1FZCA 1NKNA 1FZAA 1GL2D 1AQ5A 5AVTB 3V4QA 4HYTB 1NTKK 3EFGA 5AW3B 1NAFA 1RE4A 1JY2O 3V2PA 4LC1A 3TNUA 1IFJA 1SFCD 3MIWA 3BRVB 4LGDE 1LTBC 1HVVA 1T2KD 2H8PD 5AW9B 2I1JA 1LTIC 3P8MC 1JY3O 1KZUB 2WT7B 2Z4EA 2FXMA 2FYUK 4C7RA 5APWA 3HUSA 2OYHC 1L0NK 4C7NB 2HFED 5AW0B 3RK3D 1RF1B 3SWYA 1FZCC 1MFZA 2JJLA 2R5BA 1S9KD 1JCCA 4DOJA 3HD7B 2C9LY 2PP6A 3V2QA 1RE4C 1IFMA 2R32A 5CCGA 2XKMA 1SLQA 1NU1K 3I5CA 4JYCA 1NH4A 2CPBA 3M0DC 3T97A 4AYCA 4WY4C 1FOSE 3OA7A 3KYQA 2P1JA 1VDFA 1FZFA 4AUWA 1G2CB 1KILA 1X9VA 1JMMA 3WMM0 3HUSC 1LWUC 1J1DC 4EOTA 4GIFA 1FAVA 1IFIA 3M91A 3LIDA 2KP8A 3RK2B 1NHLA 2KB7P 1JUNA 1WRGA 1GZLA 1RF0A 2CPSA 5CCGC 4EIJA 1IO4A 1N7SB 2H43A 3N7NA 1J1EC 3KPEA 1LTSC 3BATA 1IC2A 1NTMK 2HPCB 2OYHB 5KJ7C 1HJBA 1L4AB 1FZCB 1KILC 1RF1A 2LKMA 1FZGA 2GM4A 1NOHA 3HRNA 1SVFA 1LT9C 1XTGB 2W6AA 1A02J 5CJ0A 1MV8A 2GUSA 5CCGD 2YNYA 3G3ZA 3TNUB 5CHXA 1ZR4A 3MUDA 1DEBA 3P8CE 1SQPK 3VYIA 2VRSA 4WY4B 1LGHB 2N1TD 4I1LA 1HGZA 1YTZT 3HUSB 4XA4A 1G2CA 1FJKA 3B5NA 1LWUB 3CL3D 3M9HA 2A45I 1LTTC 1T8ZA 3CI9A 1N86A 2NPSA 2WPSA 5APXA 1EQ7A 1J1EB 3GHGB 1N7SA 3HTKB 5APVA 1LTGC 2FKWB 5AW2B 1IK9A 1SP4A 1ZN5A 2FFDC 3L37A 1KILB 1JO5A 3HE5B 3L36A 5APTA 1L4AA 2R5DA 3B5NC 3TK1A 3CLQA 1DX7A 5CCHA 5AVWB 1LT9B 3NFQA 5APYA 3P32A 3HD7D 2R3CA 3H6PA 2NPSC 1VPCA 3RK2C 1FOSF 2HODA 2J58A 5AVRB 3M0DA 1NKZB 1T3UA 1N7SC 3B8EB 4WY4A 2L5GB 1HWTC 2KSJA 2P67A 2XDJA 1N2DC 1KFNA 2OARA 2YO2A 4OH8B 1LWUA 4LLHA 3SWFA 1L4AC 5CCHC 1H8AA 3VMZA 2YMYA 3A7OA 3RK2D 1X8YA 4GT1A 3RL0C 5AVZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GZL A;  1IO4 A;  3MD0 A;  1CZQ A;  2WWW A;  1T2K C;  3HTK A;  3P7K A;  1HBW A;  3HE4 A;  1J2J B;  1JNM A;  1HJB A;  3O8Z A;  2ZXE B;  5AW4 B;  5AW8 B;  5AVX B;  5AW6 B;  2WPQ A;  3HE5 A;  1MUU A;  3NTN A;  5AVY B;  5AW5 B;  3M06 A;  3VN0 A;  3NMD A;  1YYC A;  3LIE A;  2Z5H A;  5AVV B;  4C46 A;  5AVQ B;  1OXZ A;  2W6A A;  1A02 J;  1CI6 A;  1MV8 A;  3L35 A;  3V4W A;  2YNY A;  3TNU B;  3A3Y B;  3M9B A;  3UIA A;  2C9N Y;  1CSB A;  2E42 A;  4AQR D;  2QM8 A;  1H89 A;  5AVS B;  3VYI A;  2VRS A;  1GTW A;  1S9K E;  1GK4 A;  3A5T A;  2ZFC A;  2Q3I A;  3V5B A;  4XE5 B;  3NXS A;  4I2L C;  2N9B A;  2WPR A;  3M9H A;  5APS A;  5AVT B;  3V4Q A;  2P7J A;  4HYT B;  2XV5 A;  3KDP B;  1DH3 A;  5AW3 B;  1NAF A;  3VMX A;  3MGN A;  2Z5I A;  3VMY A;  4LC1 A;  3TNU A;  2WPS A;  5APX A;  1GD2 E;  2Q7C A;  2Q5U A;  1T2K D;  5AW9 B;  5APU A;  3P8M C;  5APV A;  5AW2 B;  5AVU B;  2WT7 B;  1GU5 A;  1NWQ A;  1SP4 A;  3HE4 B;  1A02 F;  5APW A;  3L37 A;  3VTP C;  2IPP A;  4B86 A;  5CMZ A;  4C7N B;  3HE5 B;  3L36 A;  5APT A;  2R5D A;  5AW0 B;  3TK1 A;  4I6M C;  4RES B;  2W27 A;  1MFZ A;  2JJL A;  2WTY A;  2R5B A;  5AVW B;  3NFQ A;  2YO3 A;  5APY A;  3P32 A;  1S9K D;  2C9L Y;  2R3C A;  3A2A A;  5APQ A;  1CI6 B;  5AW1 B;  4DZO A;  2R32 A;  2P2U A;  1OWA A;  1SLQ A;  4JYB A;  3I5C A;  1FOS F;  4JYC A;  5AVR B;  3M0D A;  3T97 A;  4AYC A;  4GKG A;  4KHX A;  3B8E B;  3M0A A;  2WT7 A;  1FOS E;  1HWT C;  1KQL A;  2P67 A;  1HUC A;  3OAK A;  4AUW A;  1G2C B;  2E43 A;  4C7N A;  2H7H A;  2BAS A;  2YO2 A;  3SWF A;  4M3L A;  2QM7 A;  1H8A A;  3VMZ A;  1GU4 A;  3IR9 A;  4EOT A;  3A7O A;  2XZR A;  1FAV A;  1GK6 A;  3M91 A;  3TYY A;  5AW7 B;  2XU6 A;  3LID A;  2KP8 A;  1X8Y A;  3KQG A;  4GT1 A;  1JUN A;  5AVZ B;  1H88 A; 
#chains in the Genus database with same CATH topology
 1RE3 C;  2WWW A;  3HTK A;  3MHV A;  4YTP C;  3TGU G;  2JEE A;  1OW6 A;  2ZXE B;  2AEM A;  3EWK A;  2ZXX A;  2ZVN B;  1SQQ D;  2YKP A;  3C9I A;  3II6 A;  2GUV A;  2IFM A;  1E79 H;  4PD4 E;  1JOC A;  1KQF B;  3SWK A;  2QJY B;  1NYH A;  2RH0 A;  5BU8 B;  3H25 A;  1SQX G;  2Y0C A;  1L0L J;  1KB9 D;  2NRG A;  1JCD A;  3CWB D;  2OYI C;  4L75 A;  2XV5 A;  4YXD C;  4OGQ D;  1ZOY C;  4W80 A;  1NTZ K;  1AVO A;  1S72 P;  1Y9B A;  3MZW B;  1SQB J;  4H13 C;  2PGD A;  1URQ A;  4N78 E;  1RY3 A;  5CMZ A;  3P8C D;  3CC4 P;  2OTJ P;  4RES B;  2K9J B;  3WU2 E;  2ZAE B;  4EI2 A;  2ZYD A;  2K3R A;  2FYU G;  2KNC B;  2M3E A;  3VOP A;  2YIU B;  2KYV A;  3H32 A;  1N73 B;  1KN7 A;  1URQ C;  1AA0 A;  1FU1 A;  1EZV D;  3BCC E;  2QM7 A;  3L74 E;  3TYY A;  2O01 J;  1NTM J;  4WWI A;  2E74 B;  2Q9I A;  3TDK A;  4Y99 B;  3EQ2 A;  4W7Z A;  3V2R A;  1SQV K;  2WPQ A;  1MUU A;  1M7L A;  3PHL A;  1AQT A;  4D6T J;  2KK7 A;  3L35 A;  2R3S A;  2E42 A;  1P84 H;  3CCQ P;  1NTM G;  2BEQ D;  1KYO E;  1S9K E;  1FC2 C;  2KZI A;  1BE3 G;  1JY2 P;  1M1J A;  5BU5 A;  2ITA A;  3PRJ A;  3A0H E;  1PGJ A;  3VMX A;  2Z5I A;  1GD2 E;  2O01 N;  3MTU E;  3R2P A;  4PD4 D;  4I6M C;  1OMI A;  2WTY A;  5KLV K;  1M1J C;  3I56 P;  5B66 H;  3L70 E;  2A45 H;  5AW1 B;  3RL0 g;  3RBZ A;  1KOR A;  4IFF A;  4JYB A;  2D2C B;  2E76 C;  2WSC J;  1HH0 A;  2E43 A;  2H7H A;  2Q6Q A;  1BGY E;  4ZKP A;  1QL1 A;  4RO0 A;  1NU1 J;  4N78 D;  3CXH I;  2XU6 A;  1X79 B;  1CW5 A;  1YTZ I;  2E74 D;  2WSE H;  1RF0 C;  4WVZ A;  2QJK B;  1PPJ G;  2YKO A;  3U1A A;  1LT1 A;  2H88 C;  3HE4 A;  1J1D B;  5AW8 B;  5AW5 B;  5AVY B;  1Q7Y Q;  3Q2Y A;  1VF5 C;  1Q82 Q;  1SQX K;  3D70 A;  3CPW O;  4GDO A;  4GOE A;  3BCC D;  4L76 A;  3QWO C;  3L74 D;  1Z56 A;  2IBZ E;  2WIT A;  1M90 Q;  2WPV B;  1FZC A;  3O6Q A;  3D6Y A;  1FZA A;  1M8O B;  3V4Q A;  5CBN A;  2AEJ A;  2FYN B;  1RE4 A;  1JY2 O;  3V2P A;  3AE3 C;  1KZU B;  1NJI Q;  1HJ0 A;  2FYU K;  1KQG B;  5APW A;  3IAO A;  3HUS A;  4C7N B;  2HFE D;  1FZC C;  2JJL A;  3H1H G;  2R5B A;  1KYO D;  1S9K D;  1JCC A;  3L75 G;  4DOJ A;  1P84 E;  3V2Q A;  1RE4 C;  4MN4 C;  2XKM A;  3C8V A;  3I5C A;  4JYC A;  3GMA A;  1NH4 A;  4AYC A;  2JO1 A;  1VQ8 P;  4I7Z C;  2P1J A;  1G2C B;  3H1K E;  3HUS C;  1UII A;  2JWD A;  1EDK A;  2B9B A;  4GIF A;  2JP3 A;  5KLI C;  4OGQ C;  5KKZ C;  3LID A;  2SPZ A;  1JUN A;  2IYP A;  2CPS A;  1N7S B;  1VQ6 P;  3L70 D;  2W8Z A;  1NTK E;  3KPE A;  3L71 D;  4H0L B;  1NTM K;  2HPC B;  1L4A B;  5B66 E;  1OVR A;  1RF1 A;  2GM4 A;  2RMZ A;  3HRN A;  3AE4 C;  2A06 E;  3AEF C;  1XTG B;  4RJT A;  1A02 J;  2GUS A;  1DD3 A;  5CCG D;  3MUD A;  1QGK B;  1BGY D;  3Q3D A;  3S4R A;  3H1L E;  1KD1 Q;  3AE9 C;  2N1T D;  5DJT B;  1BCC J;  3K5B A;  3M9H A;  1T8Z A;  1N86 A;  3MUD C;  3GHG B;  5APV A;  1SP4 A;  2R5D A;  3CLQ A;  4BRY B;  1LT9 B;  3NFQ A;  1NTZ J;  2IBZ D;  3AE2 C;  5DJU B;  5K5G B;  2QJY C;  3M0D A;  1GMJ A;  2L5G B;  2GA1 A;  1HWT C;  2OAR A;  3KZI E;  2PFX A;  1LWU A;  4H44 B;  1DIP A;  2YMY A;  3A7O A;  1S5L E;  4UB8 E;  1YQ3 C;  4GT1 A;  5AVZ B;  1SS1 A;  1MZ9 A;  1N7S D;  1M57 D;  1P84 D;  1N73 A;  1PP9 J;  5KJ7 A;  3B5N B;  5AW4 B;  1GL2 B;  1LTA C;  2OGU A;  3FGA D;  3HE5 A;  1W2E A;  4PJ0 H;  2E5Y A;  3BAS A;  3V4W A;  3H1K D;  2QM8 A;  1MKM A;  4NPD A;  5AVS B;  1SQV J;  1VQN P;  3MP7 B;  2E75 D;  3VMA A;  2YIU C;  3V5B A;  4TLF A;  2KS1 B;  1KC8 Q;  1N73 C;  1OIP A;  1SQQ G;  1FDM A;  3JCU E;  1NTK D;  2MJZ A;  3KDP B;  4U3F D;  4GOF A;  3H1J E;  1ZRT E;  2E74 C;  2A06 D;  1U57 A;  1IK7 A;  3W68 A;  1ZME C;  2FFD A;  3CWB G;  3FX0 A;  2KLV A;  3CC7 P;  2KOG A;  3H1L D;  3A2A A;  3BRT B;  1JTH A;  2P2U A;  2XNX A;  4KHX A;  2BCC J;  5KLV J;  4H44 D;  3A0B H;  3GF3 A;  1HTL C;  2XZR A;  2O01 H;  4KT0 J;  3L72 E;  2RKL A;  1RE3 A;  5KAI H;  1LP1 B;  2OTL P;  3L73 D;  4EYY Q;  3TGU J;  1EZV G;  3B5N D;  1NVO A;  3M06 A;  2QIW A;  5AVQ B;  1CI6 A;  5CBO A;  4AQR D;  3V6I A;  1SQP D;  4WB4 A;  3CD6 P;  1RQU A;  5CJ4 A;  1OFC X;  1AVY A;  2Q3I A;  1NAY A;  1SQX J;  2ZYA A;  4TT3 H;  2HR3 A;  5APS A;  3U59 A;  5CCH D;  5KAF H;  2OYI A;  2O3J A;  1ZLL A;  1IJD B;  1JY3 P;  3VMY A;  2O1J A;  3CCE P;  1SFC B;  3LW5 H;  5GTI E;  2YKQ A;  2QJK C;  2OTK E;  5EFW B;  1JM0 A;  1PV3 A;  1VQ7 P;  1GU5 A;  4PV1 B;  2B87 B;  2N1T A;  3VP9 A;  2WQY C;  3C1L A;  1G1J A;  4PJ0 E;  2AEF A;  3CX5 I;  4K35 A;  2IYO A;  4N3Y B;  4ZMD A;  1FJP A;  2WSF H;  3E1I A;  1LTJ B;  4DT0 A;  2FYU J;  5H2F H;  2WSC H;  3H1J D;  1L0L E;  2N1T C;  4C7N A;  1ZRT D;  2Y9Z A;  1HGV A;  3TF5 A;  1GU4 A;  4ASV A;  1SQB E;  4JF7 A;  3CCJ P;  3OW2 O;  4A7P A;  2UWJ E;  1KB9 I;  3E7K A;  1J2J B;  1TU3 F;  1YJW P;  3GLM A;  3ZDM A;  1SQQ K;  4C46 A;  2P10 A;  4HH2 A;  1VL2 A;  1H89 A;  3T97 B;  1K04 A;  3SSU A;  3L72 D;  2HPC A;  1FDI A;  4OVN F;  1BE3 J;  1VQP P;  1PGO A;  3EFF K;  3I55 P;  1W2B O;  4HYT B;  3USS A;  2QE7 H;  3BCC G;  5KAI E;  4LC1 A;  1SFC D;  3L74 G;  1H0T A;  2H8P D;  5AW9 B;  2I1J A;  2YXQ B;  1JY3 O;  1M56 D;  1EZV I;  4PV1 D;  4C7R A;  2KLU A;  5AW0 B;  1JB0 J;  4D6T E;  3G9R A;  3HD7 B;  2OYO A;  2PRR A;  3KHU A;  5TIS E;  2BEZ F;  1QVF O;  4DJG A;  2KXP B;  4L73 A;  3LW5 J;  2CPB A;  2E75 C;  3KYQ A;  1FZF A;  3WMM 0;  2JKV A;  2OQQ A;  3M91 A;  1IFI A;  3L71 E;  3RK2 B;  2KB7 P;  1WRG A;  1EDJ A;  1RF0 A;  2WSF J;  1Q90 D;  2H43 A;  2G8Y A;  3G71 P;  2QVA A;  2OYH B;  1QLE D;  1YI2 P;  2YMK A;  1LT9 C;  3GG2 A;  1L0L D;  2W6A A;  1MV8 A;  2YNY A;  3TNU B;  1L0N E;  5CHX A;  3AE7 C;  3L70 G;  1ZR4 A;  1IZN B;  3L71 G;  4PD4 I;  3VYI A;  4WY4 B;  1LGH B;  2NZ2 A;  1SQB D;  3B5N A;  3CL3 D;  1NU1 E;  4H44 C;  3CI9 A;  4IL6 X;  3CMA P;  1W5C E;  4HJG H;  2WPS A;  5APX A;  1BGY G;  1J1E B;  3S9O A;  3HTK B;  2FKW B;  1RHZ B;  2AXT H;  1ZN5 A;  2KS1 A;  3L37 A;  2QG4 A;  3AEB C;  1VQM P;  5APT A;  1DX7 A;  3B5N C;  3H1H J;  5CCH A;  5AVW B;  3L75 J;  3HD7 D;  2M5A A;  1VPC A;  5AVR B;  5GTH H;  3CCM P;  3B8E B;  1VQL P;  2KSJ A;  3B71 A;  1N2D C;  2ZVO B;  4OH8 B;  2IBZ G;  2M0B A;  3CX5 H;  5CCH C;  1H8A A;  3AEG C;  3CCR P;  3RK2 D;  1X8Y A;  4D6T D;  5L8R J;  1GW3 A;  3MD0 A;  2D2C D;  4ZNC A;  2HLO A;  2H89 C;  1BDD A;  2QA4 P;  1NO4 A;  1OXZ A;  1PGP A;  1YQ4 C;  3FWL A;  3Q5R A;  1FZB A;  1ZR2 A;  4WY4 D;  4WBA A;  1KB9 H;  3H32 B;  3A5T A;  3OJA B;  1KYO I;  3N4X A;  4XE5 B;  4U3F E;  3AE1 C;  1FBM A;  1DEE G;  1QX8 A;  3G6E P;  4NPE A;  2RN0 A;  3H1K G;  2IFN A;  1QL2 A;  2IZ1 A;  2M8R A;  2YXR B;  2HOD B;  5APU A;  1NWQ A;  2QSI A;  2ZJS E;  3IF4 A;  1L0N D;  3PJS K;  1NTK G;  4B86 A;  1FE6 A;  1S4X A;  1JMB A;  3F89 A;  1JY2 N;  4U3F G;  3AED C;  4JQ0 D;  3D6Z A;  4DZO A;  1NU1 D;  2A06 G;  1SFC A;  1X22 A;  4GKG A;  2QRX A;  1BCC E;  2FYZ A;  1OX3 A;  3M0A A;  2O1K A;  3L4F A;  4YXW H;  2V7Q J;  1M1J B;  3V2N A;  3H1L G;  3AEA C;  2M3B A;  1R8E A;  2KZJ A;  3D71 A;  5AW7 B;  1AFO A;  2QJP B;  3L73 E;  1LTJ A;  1SFC C;  3AE5 C;  4NPF X;  1EC5 A;  1OVU A;  5E79 H;  4XFJ A;  1GW4 A;  4PV1 C;  4R4L A;  4N6J A;  2JWA A;  1USE A;  4IL6 H;  4Y28 J;  3JC2 2;  3VN0 A;  2K9J A;  1SQP E;  5AVV B;  2L91 A;  2C0W A;  1USD A;  1WT6 A;  2KIK A;  3KXD A;  2C9N Y;  1LTJ C;  3RK3 E;  1X0T A;  3L73 G;  1YIT P;  2KNC A;  2LXB A;  4H0L D;  2B89 A;  2ZFC A;  3PP5 A;  2IBZ I;  3NXS A;  4I2L C;  1SQQ J;  1BSH A;  2N9B A;  1L4A D;  2WPR A;  1VF5 B;  1S1C X;  3IN6 A;  3M9Q A;  1OVV A;  3CXH H;  3MGN A;  1SQP G;  1KTM A;  2Q7C A;  4PD4 H;  1Q2N A;  1ZW0 A;  1OW8 A;  2G3A A;  1PP9 E;  3TSI A;  3CC2 P;  3HE4 B;  1A02 F;  3VTP C;  3CWB J;  3RK3 B;  2W27 A;  3CCS P;  4Z1M H;  1SQV E;  2C0X A;  1P84 I;  2FBW C;  1OWA A;  3FXD A;  1VQ9 P;  2WZ7 A;  4Y99 C;  1S2E A;  4L74 A;  1HUC A;  3OAK A;  3RGU A;  3WUV A;  3O6Q B;  3JSV C;  4JPZ B;  3HD7 A;  3WU2 H;  1GK6 A;  4R4M A;  1VQK P;  1ZXG A;  2K88 A;  4OWF A;  3H1J G;  3P7K A;  1XTC C;  1S3J A;  1JNM A;  4DCK A;  1NGM B;  1BCC D;  5KLI B;  5KKZ B;  2W83 C;  3HD7 C;  1IFD A;  2K37 A;  2I1K A;  3A3Y B;  3M9B A;  1CSB A;  1N7L A;  2BCC E;  5KLV E;  1GTW A;  2LR2 A;  3IFM A;  2OYH A;  1NKN A;  2Q3E A;  1VF5 D;  1GL2 D;  3SFE C;  1NTK K;  2MKV A;  1NAF A;  1NTZ D;  3TNU A;  1FDO A;  1IFJ A;  3MIW A;  3BRV B;  4LGD E;  1K05 A;  1LTB C;  5E79 E;  1T2K D;  3TGU E;  1LTI C;  1IFP A;  2D2C C;  3L72 G;  2R44 A;  2WT7 B;  1DD4 A;  1PZQ A;  2FXM A;  1KYO H;  2OYH C;  3RK3 D;  1RF1 B;  2C9L Y;  3H1I E;  1QVG O;  1Y47 A;  1IFM A;  2FXP A;  2R32 A;  5CCG A;  3F5H A;  1SQX E;  2FY8 A;  1MFT A;  4WY4 C;  1FOS E;  1L2P A;  1X9V A;  1JMM A;  3AE8 C;  1PP9 D;  1J1D C;  1AV1 A;  3CXH E;  1N8R Q;  1EXJ A;  1QEX A;  2KP8 A;  1NHL A;  4ASW A;  5CCG C;  3H1I G;  4EIJ A;  4K3A A;  1R5S A;  1U7M A;  1J1E C;  1LTS C;  3BAT A;  1IC2 A;  1SQV D;  3Q5S A;  1HJB A;  1FZG A;  1NOH A;  1SVF A;  3PH0 A;  5CJ0 A;  2FYU E;  2FYN C;  3G3Z A;  1KIL E;  1DEB A;  3CME P;  2ZT9 B;  2ZYG A;  1SQP K;  5M1B A;  5B5E H;  4HKZ H;  1VQ4 P;  4I1L A;  1HGZ A;  1G2C A;  1FJK A;  1LWU B;  4YPC A;  1Q81 Q;  1L0L G;  3SFD C;  1EDL A;  3Q5P A;  3BCC J;  3L74 J;  1EQ7 A;  1K73 Q;  1N7S A;  1RH5 B;  1S5L X;  1SQB G;  1KIL B;  2BCC D;  3HE5 B;  3L36 A;  5KLV D;  1L4A A;  3A0B E;  2KUB A;  1NTM E;  4IOI H;  2J5U A;  1R5L A;  1FOS F;  2HOD A;  1NKZ B;  1T3U A;  1N7S C;  1BE3 E;  1LNQ A;  4UB6 H;  2P67 A;  4H0L C;  1PGQ A;  1KFN A;  1ZP0 C;  3TGU D;  4LLH A;  1L4A C;  1M1K Q;  2E5T A;  3CCV P;  1K8A Q;  2CK3 H;  2DW3 A;  3QH9 A;  3GF7 A;  2KI7 B;  2I8D A;  3GHG A;  3H1I D;  1YHQ P;  2P58 A;  2FFD B;  1T3J A;  5KAF E;  5AW6 B;  1SQX D;  1KFM A;  3NMD A;  4BRY A;  1LT9 A;  4D6T G;  2NPS B;  3L70 J;  3UIA A;  1JTH B;  3L71 J;  2ZT9 D;  5TJH A;  3CXH D;  2Y0D A;  3GHG C;  4U7J A;  4CPG A;  1UIX A;  4W7Y A;  1E5W A;  1PPJ E;  2B88 A;  3RL0 B;  1BGY J;  2QJP C;  5H2F E;  1L0N J;  5BVZ A;  1EXI A;  5AVU B;  2FYU D;  5KJ7 D;  1KIL D;  2IPP A;  2K9Y A;  1GL2 A;  3G4S P;  2K1A A;  1G1I A;  1CI6 B;  1EDI A;  1JY3 N;  3W67 A;  5B5E E;  2XND H;  1YBK A;  2IX7 C;  1L0N G;  3U1C A;  2V7Q H;  1IFN A;  2POH A;  3R4Y A;  2OYI B;  1GL2 C;  1NU1 G;  1H88 A;  1T2K C;  1BSN A;  3B4S A;  1HBW A;  4H13 B;  3FWN A;  1NTM D;  2N1T B;  3H1H E;  3L75 E;  3O8Z A;  4GOD A;  3KZI H;  3RK3 C;  3CCL P;  3AE6 C;  1BE3 D;  1YYC A;  3LIE A;  1U7J A;  1L0L K;  2NPS D;  4UB8 H;  1S5L H;  2AXC A;  2WMM A;  4UB6 E;  1GK4 A;  1URQ B;  3VP8 A;  2PAJ A;  1SQB K;  1ZV8 A;  2P7J A;  1YJN P;  3H1K J;  1AJY A;  1DH3 A;  3RL0 D;  1RQV A;  2V4H A;  2Q5U A;  1K9M Q;  1FZE A;  1T6A A;  1LP1 A;  1NTK J;  5KTB A;  4U3F J;  3E1R A;  2YO3 A;  3JCU H;  1PL5 A;  5APQ A;  1LJ2 A;  1GDT A;  1PIX A;  2WT7 A;  1PPJ D;  4HB1 A;  1YIJ P;  1KQL A;  3ITK A;  2QEX P;  2BAS A;  3H1L J;  4M3L A;  1PFI A;  3IR9 A;  2HG5 D;  2A45 G;  3KQG A;  4IFM A;  1H0T B;  3GW6 A;  1Y8A A;  2WSE J;  1CZQ A;  2E75 B;  4H13 D;  3AEC C;  4O9B A;  2B87 A;  5AVX B;  2HYN A;  3NTN A;  1RF1 C;  1KMI Z;  2Z5H A;  4KJM A;  3BVH A;  5C39 A;  2E76 B;  2J59 M;  2W6B A;  3L73 J;  2AXT E;  4ZKU A;  1URQ D;  1BDC A;  3PTZ A;  4IFD K;  4JBZ A;  3AEE C;  1NTZ E;  1BCC G;  1AQ5 A;  5AVT B;  3Q1M A;  3EFG A;  5AW3 B;  3H1H D;  1SQP J;  3L75 D;  5GTH E;  1HVV A;  3P8M C;  4QMA A;  2Z4E A;  3CCU P;  1VQ5 P;  1L0N K;  2IDB A;  3WUU A;  3CX5 E;  3FXE A;  3SWY A;  1MFZ A;  2LXC B;  1NTZ G;  2PP6 A;  1SLQ A;  1NU1 K;  5GTI H;  2ZT9 C;  3M0D C;  3T97 A;  1SQQ E;  3OA7 A;  1VDF A;  3ABV C;  4BWN A;  4AUW A;  1KIL A;  3WUT A;  2Q1K A;  1LWU C;  2KSE A;  4EOT A;  1FAV A;  2W90 A;  1OZH A;  4RKU J;  1GZL A;  1IO4 A;  3H1J J;  3N7N A;  2FXO A;  1KB9 E;  3CWB E;  2IZ0 A;  2JDI H;  5KJ7 C;  1YJ9 P;  1PP9 G;  1FZC B;  1KIL C;  2LKM A;  2M5A B;  2WVR A;  1HF9 A;  1OW7 A;  2WSS H;  2W6J H;  2E76 D;  3P8C E;  4BXL A;  1Q86 Q;  4EDF A;  1SQV G;  2VRS A;  4I7Z B;  1JEK A;  1YTZ T;  3HUS B;  4XA4 A;  3PLN A;  2N9Y B;  2A45 I;  2JR8 A;  1LTT C;  4OGQ B;  2NPS A;  1EZV E;  3L72 J;  1LTG C;  5AW2 B;  1IK9 A;  2FFD C;  1JO5 A;  3TK1 A;  2Y0E A;  3S1K A;  5APY A;  3P32 A;  1KQS O;  2R3C A;  1D7M A;  3H6P A;  2NPS C;  3RK2 C;  1FS0 E;  2J58 A;  1WMK A;  4WY4 A;  1VQO P;  2BCC G;  5KLV G;  4IL6 E;  2XDJ A;  2YO2 A;  3SWF A;  2Y9Y A;  3VMZ A;  1KV4 A;  3A0H H;  3CX5 D;  3RBX A;  5TIS H;  3RL0 C;  3H1I J; 
#chains in the Genus database with same CATH homology
 1RE3 C;  1GW3 A;  1MZ9 A;  1N7S D;  3MD0 A;  2WWW A;  3GHG A;  3HTK A;  2HLO A;  2FFD B;  1N73 A;  5KJ7 A;  2JEE A;  2ZXE B;  3B5N B;  5AW4 B;  1GL2 B;  1LTA C;  1T3J A;  5AW6 B;  3HE5 A;  1W2E A;  1KFM A;  2YKP A;  3NMD A;  1LT9 A;  3C9I A;  1NO4 A;  3BAS A;  3II6 A;  2GUV A;  1OXZ A;  2IFM A;  3V4W A;  2NPS B;  1JOC A;  3UIA A;  1JTH B;  1FZB A;  1ZR2 A;  2QM8 A;  5AVS B;  5BU8 B;  4WY4 D;  3GHG C;  4WBA A;  3H32 B;  3A5T A;  3V5B A;  3OJA B;  3N4X A;  4XE5 B;  1N73 C;  4W7Y A;  1FDM A;  1FBM A;  1JCD A;  2OYI C;  2MJZ A;  2XV5 A;  3KDP B;  4W80 A;  2IFN A;  1E5W A;  3RL0 B;  1NTZ K;  1QL2 A;  2M8R A;  2HOD B;  5APU A;  5BVZ A;  5AVU B;  1NWQ A;  1URQ A;  5KJ7 D;  4N78 E;  2FFD A;  1RY3 A;  1KIL D;  2IPP A;  4B86 A;  5CMZ A;  3P8C D;  1GL2 A;  4RES B;  1JY2 N;  2KLV A;  2KOG A;  1G1I A;  3A2A A;  1CI6 B;  3BRT B;  4DZO A;  1JY3 N;  1SFC A;  1JTH A;  2P2U A;  2XNX A;  2IX7 C;  4GKG A;  4KHX A;  3M0A A;  2FYZ A;  3VOP A;  3U1C A;  2KYV A;  3H32 A;  1N73 B;  2O1K A;  1URQ C;  3L4F A;  1IFN A;  2POH A;  1M1J B;  1FU1 A;  3V2N A;  2QM7 A;  2OYI B;  1GL2 C;  2M3B A;  1HTL C;  2XZR A;  3TYY A;  2O01 H;  5AW7 B;  1AFO A;  1H88 A;  1RE3 A;  1LTJ A;  1SFC C;  2Q9I A;  4Y99 B;  3EQ2 A;  1T2K C;  1HBW A;  2N1T B;  1GW4 A;  4W7Z A;  3V2R A;  4N6J A;  1SQV K;  3B5N D;  3O8Z A;  2WPQ A;  1MUU A;  3M06 A;  3RK3 C;  3VN0 A;  1M7L A;  1YYC A;  3LIE A;  5AVV B;  5AVQ B;  2C0W A;  1CI6 A;  3L35 A;  1WT6 A;  1L0L K;  2NPS D;  2C9N Y;  2E42 A;  4AQR D;  4WB4 A;  1LTJ C;  5CJ4 A;  1S9K E;  1GK4 A;  1URQ B;  2ZFC A;  2Q3I A;  3VP8 A;  3PP5 A;  3NXS A;  4I2L C;  2N9B A;  1L4A D;  1SQB K;  2PAJ A;  1JY2 P;  2WPR A;  1M1J A;  5APS A;  3U59 A;  5BU5 A;  5CCH D;  1ZV8 A;  2P7J A;  2OYI A;  1ZLL A;  3M9Q A;  1DH3 A;  1IJD B;  3VMX A;  3MGN A;  1JY3 P;  2Z5I A;  3RL0 D;  3VMY A;  1GD2 E;  2O1J A;  1SFC B;  2Q7C A;  2Q5U A;  3LW5 H;  2YKQ A;  1FZE A;  3MTU E;  3R2P A;  1GU5 A;  3TSI A;  2N1T A;  3VP9 A;  3HE4 B;  1A02 F;  5KTB A;  3VTP C;  1G1J A;  3RK3 B;  4I6M C;  2W27 A;  2WTY A;  5KLV K;  1M1J C;  2YO3 A;  2A45 H;  5APQ A;  4N3Y B;  5AW1 B;  1GDT A;  1FJP A;  2WSF H;  2C0X A;  3E1I A;  1LTJ B;  1OWA A;  4IFF A;  4JYB A;  2WZ7 A;  2WSC H;  4Y99 C;  2WT7 A;  1KQL A;  1HUC A;  3OAK A;  2N1T C;  1HH0 A;  2E43 A;  4C7N A;  2H7H A;  2BAS A;  4M3L A;  1HGV A;  1PFI A;  4ZKP A;  1QL1 A;  3HD7 A;  1GU4 A;  3IR9 A;  2HG5 D;  4N78 D;  1GK6 A;  2XU6 A;  1X79 B;  2A45 G;  1CW5 A;  3KQG A;  1YTZ I;  4IFM A;  4JF7 A;  2WSE H;  1RF0 C;  1CZQ A;  2YKO A;  3P7K A;  4O9B A;  3U1A A;  1XTC C;  3HE4 A;  1J2J B;  1JNM A;  1J1D B;  5AW8 B;  5AVX B;  2HYN A;  3NTN A;  5AVY B;  5AW5 B;  1RF1 C;  1SQX K;  1SQQ K;  2Z5H A;  4C46 A;  3HD7 C;  1IFD A;  3BVH A;  2I1K A;  3A3Y B;  3M9B A;  1CSB A;  1N7L A;  4HH2 A;  2J59 M;  1H89 A;  2W6B A;  4ZKU A;  1Z56 A;  1GTW A;  2WIT A;  1URQ D;  3IFM A;  2HPC A;  2OYH A;  4IFD K;  1FZC A;  1NKN A;  1FZA A;  1GL2 D;  1AQ5 A;  5AVT B;  3V4Q A;  4HYT B;  1NTK K;  3EFG A;  5AW3 B;  1NAF A;  1RE4 A;  1JY2 O;  3V2P A;  4LC1 A;  3TNU A;  1IFJ A;  1SFC D;  3MIW A;  3BRV B;  4LGD E;  1LTB C;  1HVV A;  1T2K D;  2H8P D;  5AW9 B;  2I1J A;  1LTI C;  3P8M C;  1JY3 O;  1KZU B;  2WT7 B;  2Z4E A;  2FXM A;  2FYU K;  4C7R A;  5APW A;  3HUS A;  2OYH C;  1L0N K;  4C7N B;  2HFE D;  5AW0 B;  3RK3 D;  1RF1 B;  3SWY A;  1FZC C;  1MFZ A;  2JJL A;  2R5B A;  1S9K D;  1JCC A;  4DOJ A;  3HD7 B;  2C9L Y;  2PP6 A;  3V2Q A;  1RE4 C;  1IFM A;  2R32 A;  5CCG A;  2XKM A;  1SLQ A;  1NU1 K;  3I5C A;  4JYC A;  1NH4 A;  2CPB A;  3M0D C;  3T97 A;  4AYC A;  4WY4 C;  1FOS E;  3OA7 A;  3KYQ A;  2P1J A;  1VDF A;  1FZF A;  4AUW A;  1G2C B;  1KIL A;  1X9V A;  1JMM A;  3WMM 0;  3HUS C;  1LWU C;  1J1D C;  4EOT A;  4GIF A;  1FAV A;  1IFI A;  3M91 A;  3LID A;  2KP8 A;  3RK2 B;  1NHL A;  2KB7 P;  1JUN A;  1WRG A;  1GZL A;  1RF0 A;  2CPS A;  5CCG C;  4EIJ A;  1IO4 A;  1N7S B;  2H43 A;  3N7N A;  1J1E C;  3KPE A;  1LTS C;  3BAT A;  1IC2 A;  1NTM K;  2HPC B;  2OYH B;  5KJ7 C;  1HJB A;  1L4A B;  1FZC B;  1KIL C;  1RF1 A;  2LKM A;  1FZG A;  2GM4 A;  1NOH A;  3HRN A;  1SVF A;  1LT9 C;  1XTG B;  2W6A A;  1A02 J;  5CJ0 A;  1MV8 A;  2GUS A;  5CCG D;  2YNY A;  3G3Z A;  3TNU B;  5CHX A;  1ZR4 A;  3MUD A;  1DEB A;  3P8C E;  1SQP K;  3VYI A;  2VRS A;  4WY4 B;  1LGH B;  2N1T D;  4I1L A;  1HGZ A;  1YTZ T;  3HUS B;  4XA4 A;  1G2C A;  1FJK A;  3B5N A;  1LWU B;  3CL3 D;  3M9H A;  2A45 I;  1LTT C;  1T8Z A;  3CI9 A;  1N86 A;  2NPS A;  2WPS A;  5APX A;  1EQ7 A;  1J1E B;  3GHG B;  1N7S A;  3HTK B;  5APV A;  1LTG C;  2FKW B;  5AW2 B;  1IK9 A;  1SP4 A;  1ZN5 A;  2FFD C;  3L37 A;  1KIL B;  1JO5 A;  3HE5 B;  3L36 A;  5APT A;  1L4A A;  2R5D A;  3B5N C;  3TK1 A;  3CLQ A;  1DX7 A;  5CCH A;  5AVW B;  1LT9 B;  3NFQ A;  5APY A;  3P32 A;  3HD7 D;  2R3C A;  3H6P A;  2NPS C;  1VPC A;  3RK2 C;  1FOS F;  2HOD A;  2J58 A;  5AVR B;  3M0D A;  1NKZ B;  1T3U A;  1N7S C;  3B8E B;  4WY4 A;  2L5G B;  1HWT C;  2KSJ A;  2P67 A;  2XDJ A;  1N2D C;  1KFN A;  2OAR A;  2YO2 A;  4OH8 B;  1LWU A;  4LLH A;  3SWF A;  1L4A C;  5CCH C;  1H8A A;  3VMZ A;  2YMY A;  3A7O A;  3RK2 D;  1X8Y A;  4GT1 A;  3RL0 C;  5AVZ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...