4EOTA

Crystal structure of the mafa homodimer bound to the consensus mare
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
92
structure length
92
Chain Sequence
RFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription factor MafA
publication title A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
total genus 39
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4eotA00
3VMYA 3P8MC 2H7HA 2BASA 4AYCA 1MV8A 4C46A 1T2KC 2XU6A 1GU5A 4M3LA 5AW2B 1G2CB 3MGNA 1H8AA 1OXZA 2VRSA 1H89A 2R32A 2ZXEB 3HE4A 1IO4A 4LC1A 4B86A 5AVTB 5AW6B 5AW7B 2YNYA 4GT1A 5APUA 4JYCA 1GTWA 3VMZA 3VN0A 1S9KD 2W27A 4I6MC 2P2UA 4AQRD 2W6AA 5AW9B 5APTA 3M06A 1JUNA 3HE5A 5AVRB 3L37A 5AVSB 2WTYA 1SLQA 1HBWA 5AVXB 1CI6B 1GZLA 2WPSA 3KQGA 3VMXA 2WPRA 2YO3A 3LIEA 3A3YB 1A02F 3M91A 2P7JA 2Z5HA 1DH3A 3M9HA 1GK4A 2C9LY 3I5CA 1X8YA 3V5BA 2XV5A 2WPQA 3VTPC 1JNMA 5AVZB 3TK1A 1SP4A 1A02J 5APYA 1CSBA 5AW4B 3KDPB 1T2KD 5AW5B 5AW0B 1YYCA 1OWAA 5AW3B 2WT7B 1S9KE 4C7NA 2IPPA 3M9BA 2YO2A 1HWTC 3OAKA 3HTKA 1FAVA 3HE4B 3NTNA 1H88A 1NWQA 3A5TA 3NXSA 1NAFA 1MUUA 3P32A 2R3CA 2E43A 5APXA 1J2JB 5AVYB 2ZFCA 3TNUA 2N9BA 3IR9A 2XZRA 3NMDA 3T97A 2JJLA 3HE5B 5AW8B 2E42A 2QM8A 2R5BA 3L35A 4KHXA 2KP8A 4I2LC 2R5DA 2P67A 3V4QA 4XE5B 3M0AA 3V4WA 2Z5IA 3LIDA 5APSA 1HUCA 2WWWA 3L36A 5CMZA 4JYBA 4DZOA 3MD0A 4HYTB 1GU4A 3A2AA 1FOSE 4RESB 5APVA 3M0DA 4AUWA 1FOSF 3A7OA 5AVUB 3NFQA 2WT7A 5AVVB 4EOTA 5AW1B 4C7NB 1CZQA 2QM7A 1CI6A 2Q5UA 2Q7CA 3UIAA 2Q3IA 3O8ZA 1KQLA 3B8EB 3SWFA 1MFZA 1HJBA 4GKGA 1GK6A 5APQA 2C9NY 3TNUB 3VYIA 3P7KA 5APWA 5AVWB 1GD2E 3TYYA 5AVQB
chains in the Genus database with same CATH superfamily
1ZN5A 3GF3A 1SQPG 2A45I 4WBAA 2FYZA 1OVVA 4OH8B 1EC5A 1IFMA 5AW2B 1JM0A 3CCMP 1KORA 1JCDA 1ZV8A 3TF5A 2IYOA 2HYNA 2HPCB 1EDIA 2I1KA 3SFEC 3H1IE 5AW9B 2E5YA 1VDFA 2E75B 1HBWA 2ZVNB 2Q1KA 2XKMA 2GUSA 3H1LE 4D6TD 2BEZF 1GW4A 3AE1C 1YQ3C 1J1EB 1RQUA 4OGQC 1SQBJ 2JO1A 5AW3B 1S5LX 1SVFA 3M9BA 3MP7B 3RK3C 3IF4A 1NTME 2PP6A 2KNCB 1H0TB 2HLOA 5EFWB 1IFJA 3OA7A 3L70G 4W7ZA 1GW3A 3CWBD 2Z5IA 2KS1B 3FWNA 3CCVP 5L8RJ 3WMM0 4L75A 2FFDB 1QLED 1NGMB 1DIPA 2KZIA 4C7NB 1KV4A 2FXMA 2ZT9B 1CI6A 2ZYDA 4OWFA 2Q5UA 1NU1K 4KT0J 4QMAA 3H1HE 3GMAA 4YTPC 2WSEH 1LWUB 3GHGC 2P10A 1KFNA 1OW7A 2ZYAA 2E76D 4D6TJ 2IBZI 2ZYGA 1KILD 1ZR4A 1NTZD 2H7HA 1SQQJ 3E1RA 1OMIA 3MGNA 4WY4A 1K73Q 1JY3P 1NTKD 1UIXA 5AVTB 3RGUA 4PV1D 2FYUJ 3Q3DA 1Q86Q 1USDA 1GL2C 3H1JG 3Q5SA 2RKLA 4NPDA 5TISH 3L37A 1CW5A 2E74B 4HKZH 1WT6A 2IYPA 1OFCX 1L4AC 1Q7YQ 1OVRA 3PTZA 1L0NK 2P7JA 1X22A 1DD4A 1IK9A 3AEBC 4L76A 3KDPB 4TT3H 4A7PA 2XNDH 3A0BE 3RK2C 2OYHA 1LJ2A 2O3JA 1JTHB 1RF1C 1H88A 4K35A 4BRYA 3IN6A 5AVYB 2O01J 2QJPB 2XZRA 4N78D 2WSEJ 2JJLA 2ZVOB 1N8RQ 1RF0A 1HH0A 2ITAA 1KILB 4I2LC 3U1CA 1ZRTD 1QVGO 1NTZJ 4EI2A 3L73E 1HJ0A 3M0AA 3H1KD 2KZJA 1FZAA 1HF9A 1NKZB 3AEFC 1SQBG 5CCHC 1AVOA 1NTKJ 1FOSF 5AVUB 2OTJP 3PH0A 1VQNP 1LT1A 3WU2E 2LKMA 4GOFA 2YIUC 1FU1A 1VQKP 4H0LD 4H44C 4DOJA 1JEKA 4UB6E 2N1TD 1URQB 1PPJD 2N9YB 1T6AA 1RE3C 1BE3E 2WPSA 2P58A 3VMXA 4D6TG 2V7QH 1SFCB 4TLFA 1FZBA 1SQQG 3H1KJ 3C1LA 3AEDC 1LTJB 3B5NB 1QX8A 5AW0B 2FYUG 3IAOA 2NZ2A 1X9VA 5E79E 5GTIH 3HD7B 3NXSA 1YHQP 1IFNA 3U59A 2N9BA 3GHGA 3H1IJ 3H1HD 1NU1E 2P67A 3H25A 2IX7C 2K1AA 3M0DA 1KB9E 2N1TB 3GF7A 1JCCA 1FDIA 4GKGA 1NTMJ 2V7QJ 3AECC 2J59M 3T97B 3I56P 3CXHE 2WPVB 1NJIQ 4ZNCA 1EZVI 2AXTH 1U57A 2VRSA 3AE2C 2QVAA 1NTKG 1Y9BA 3HE4A 1L0NE 3AE8C 5AW7B 3HUSA 1VF5B 5BU5A 2JKVA 3RK3E 1NH4A 1L0LK 2M3EA 3FWLA 3CCQP 2W6AA 2YXQB 3HE5A 3CMAP 4LGDE 1S5LH 3H1HJ 1K05A 1P84E 5KTBA 1KYOH 2RN0A 1G1IA 5CCHA 3L73D 1M90Q 1EXJA 2J5UA 4XFJA 1FZFA 1W2EA 3AE9C 1EQ7A 4GDOA 2D2CD 2B89A 1N86A 1N7SC 2HODA 1QGKB 2WQYC 3H1KG 4NPEA 3A2AA 1AJYA 4RESB 2J58A 3NFQA 4GIFA 2OTLP 1RE4C 4D6TE 1RE3A 2K88A 4PD4I 3VOPA 3H1IG 1ZLLA 1YTZI 4I1LA 1KZUB 3L74D 4RKUJ 1M56D 1W5CE 3N7NA 3CMEP 3L73J 2YKPA 2PGDA 1LTAC 5AW6B 3WUUA 1PP9D 4JYCA 1HVVA 4EYYQ 3A0HH 4GOEA 5APTA 3CWBE 2WTYA 1SLQA 4DT0A 1NTMG 5AVXB 1CI6B 1PGOA 3LIEA 1T8ZA 2C9LY 1BGYD 1NU1D 1RHZB 1CSBA 1FC2C 1BSNA 1N73C 4WY4B 1RH5B 1KB9D 5KKZB 3JSVC 2I1JA 1YTZT 1NTZE 1MKMA 2AEFA 1S3JA 1NAYA 1YQ4C 3CLQA 1DEEG 2NPSC 1AFOA 3AEGC 1T3JA 3H1HG 1OIPA 3L74J 2KSEA 2GA1A 2BCCD 1BE3J 3PHLA 1PGJA 5TJHA 2G3AA 3S4RA 1VQ6P 1M7LA 1K04A 1PGQA 3CXHD 2WITA 5TISE 1Y47A 4OGQD 3BRTB 4EIJA 3AE7C 2KI7B 2WSFH 2OYHB 2QJYC 1CZQA 3O8ZA 3GG2A 3RK3D 4BRYB 3B8EB 1LP1A 1YITP 5APQA 4L74A 3VYIA 1P84I 3P7KA 1L0LE 1NHLA 2FXPA 2GUVA 1OW6A 3TYYA 1BCCD 5AVQB 1BGYJ 1T2KC 1NU1J 4M3LA 1ZXGA 1VQPP 1AVYA 2ZXEB 4B86A 3MHVA 4HH2A 4N78E 2YNYA 4I6MC 3CC4P 1ZRTE 2QG4A 3H1KE 3KHUA 1SQXK 1GZLA 1L2PA 4YXDC 2BCCJ 3EWKA 1JY2O 3M9HA 2QJKB 3B4SA 3L73G 2WZ7A 3RL0B 2WSFJ 1L0NJ 2QA4P 1GMJA 3FXEA 2A45H 3G9RA 2PAJA 1BCCJ 2KP8A 2O1KA 3SSUA 1L4AD 3V4WA 1PPJE 1M1JA 2WMMA 2JDIH 2R44A 3TSIA 2WT7A 3G3ZA 5AVVB 3RK2D 5CJ0A 4I7ZB 2E75C 2CPBA 1EDKA 3AE3C 2JWDA 3C9IA 1BE3G 1S1CX 2Q3EA 4C46A 5GTIE 2XU6A 3VP8A 1OXZA 1HGZA 1J1EC 2R32A 1N73A 3FGAD 5GTHH 1PFIA 3SFDC 5CCHD 3VP9A 4AQRD 5H2FH 3ITKA 1FDMA 1KN7A 2FY8A 2WVRA 2NRGA 1R8EA 2W83C 2Y9YA 1NU1G 2Y0DA 4PJ0H 1G2CA 2IPPA 4H44D 3RK2B 3HE4B 3Q2YA 5KJ7C 3HUSB 4IL6H 2ZT9C 3TNUA 2ZFCA 1DD3A 2AXTE 3CWBJ 3HE5B 5AW8B 1LWUC 2BCCG 2KYVA 4IFMA 1W2BO 2QIWA 3V4QA 2W6BA 4U3FD 4JQ0D 1L0LD 1UIIA 1GU4A 2FYNC 3B71A 2PRRA 4KJMA 1BDCA 2IZ1A 2RH0A 1L0NG 2PFXA 1S5LE 3V2PA 2FBWC 1Z56A 2SPZA 2OYIA 3MTUE 2E76B 1KYOE 3SWFA 4YPCA 2E74C 2C9NY 1BCCG 1KFMA 3HRNA 3TDKA 2HODB 3KYQA 1YBKA 2BASA 1JY2N 4PV1B 1GU5A 2KB7P 3AE4C 3S9OA 2M5AA 1ZW0A 3PP5A 2H89C 3MUDC 4N3YB 1RY3A 4LC1A 1KQFB 4W7YA 3VMZA 2P2UA 5KLVK 3M06A 1S72P 1SS1A 3BASA 3R4YA 2QJPC 3KQGA 3CCRP 3N4XA 4K3AA 2POHA 1A02F 1T3UA 1GK4A 1L0LJ 1JNMA 5AVZB 4L73A 3CCLP 1YI2P 1AQTA 3L72D 1OWAA 1N7LA 2M8RA 2W90A 3L74E 1MUUA 3VMAA 5APXA 3CC7P 3NMDA 1SQQK 1ZP0C 2OYOA 2QM8A 1PP9E 2E5TA 2GM4A 3A0HE 2Z4EA 1EDLA 3ZDMA 5AW1B 3H32A 1FZCB 1URQC 2Q7CA 1JY2P 3UIAA 1BGYE 2YMKA 1MFZA 4HJGH 3CWBG 4H0LB 4HB1A 2UWJE 1FJKA 1NVOA 1SFCC 1N7SD 2K37A 1LT9B 3AE6C 1LTJC 1GL2A 3B5NC 3USSA 3QWOC 3FX0A 4O9BA 2BCCE 4DJGA 3D71A 1L4AA 1M1KQ 1E79H 5AVRB 3HD7C 2QE7H 2WSSH 1BDDA 1NTZG 1RQVA 3JC22 2YO3A 4H13D 1LP1B 2CPSA 2WSCH 3I5CA 2IFNA 2O1JA 4N6JA 3OJAB 2KLUA 1RF1A 1PGPA 1KTMA 1HWTC 3BCCD 5CCGC 1BCCE 1G1JA 1NOHA 1J1DB 3CL3D 1PIXA 1KYOD 1EZVD 1S2EA 2KOGA 1L0LG 1SQVD 2KLVA 2FKWB 1SQXD 2YKQA 1VF5C 2JWAA 4LLHA 1M57D 4GODA 5CBNA 4H13B 4IL6X 2NPSD 5KLVE 2WSCJ 1VQ4P 4ZMDA 3IFMA 1AQ5A 5DJUB 2MKVA 1M1JB 4Y99B 3Q5PA 3Q5RA 1MZ9A 1VQ9P 3VN0A 3RL0g 1NKNA 1KC8Q 1PZQA 1XTCC 1JMMA 3WUTA 1K8AQ 1JY3O 5B66H 3M91A 1VL2A 4MN4C 3CCJP 1X8YA 2XV5A 3CCEP 1PPJG 1T2KD 5AW5B 1SQXJ 1YYCA 2QEXP 4PD4D 4PD4H 1NTMK 1N73B 3NTNA 1URQA 2D2CB 3PRJA 5KLIB 3TGUE 2E43A 1LGHB 1J2JB 1IJDB 3E7KA 5GTHE 1KB9I 2O01N 1VQMP 4XE5B 4Y28J 3L36A 1FS0E 1FOSE 3MD0A 5H2FE 3RBXA 3KXDA 4U7JA 2QSIA 3L4FA 4WWIA 4EOTA 2M0BA 1AV1A 3D6YA 3CXHI 2YXRB 4ZKUA 4PJ0E 1ZOYC 3H1JD 1GK6A 1FZGA 3BATA 3TNUB 2YMYA 3VMYA 1QL1A 2AXCA 5M1BA 2JEEA 1GDTA 4IL6E 1PP9J 1LTGC 3L75E 2IBZE 1OW8A 1D7MA 4IFFA 4IOIH 4WY4C 5KKZC 3M9QA 1VQOP 1DX7A 4U3FE 1FDOA 5AVSB 2AEJA 2OYIB 4UB8H 5KAIH 2OGUA 4W80A 2YKOA 2QRXA 3II6A 1IFIA 3TK1A 3CX5D 3CX5H 2BEQD 2IFMA 5APYA 1SQVK 2KIKA 2M5AB 2YO2A 3CCUP 3JCUH 4ZKPA 3I55P 1SQPK 1VQ5P 1NWQA 1KQGB 1N7SA 3P32A 2MJZA 1U7MA 2K9JA 1TU3F 4Z1MH 2JP3A 2KUBA 2R5DA 1VQ8P 5KLVD 5K5GB 3AEAC 4ASWA 4OGQB 3EFGA 1RF0C 1RE4A 1M8OB 1SQXG 2L91A 1LNQA 3RK3B 1QEXA 1GL2D 2B87A 2A06D 2CK3H 5KJ7D 5KAFH 2ZT9D 3L72E 5AVWB 4RO0A 4ASVA 3K5BA 1QVFO 1JY3N 3CI9A 2XNXA 3QH9A 3P8CD 4AYCA 1MV8A 2QJKC 2R3SA 2ZAEB 1Q81Q 1SQQD 1JMBA 4GT1A 1GTWA 3RL0C 2FYUD 3L74G 3H32B 3CD6P 3GHGB 3TGUD 1VQ7P 3GLMA 2E74D 2L5GB 5KLVJ 2B88A 3KPEA 1PP9G 3MZWB 3O6QA 4CPGA 1S9KE 2I8DA 2Q6QA 1GL2B 1FAVA 3EQ2A 2NPSA 3L71E 3KZIH 2W8ZA 4I7ZC 1L4AB 1BGYG 2E42A 2O01H 2R5BA 1K9MQ 3BVHA 4KHXA 1IC2A 3E1IA 5B5EH 1FJPA 3PJSK 1HUCA 2Q9IA 4HYTB 2FFDC 2FYNB 1ZR2A 1RF1B 4WB4A 3L75D 2IBZD 3M0DC 1KQSO 2LR2A 3F5HA 3TGUJ 1NO4A 3EFFK 3PLNA 1U7JA 3BCCE 3CPWO 3GW6A 1Q90D 3V2QA 1EZVE 1HTLC 3W68A 1JUNA 1SQVE 3HUSC 1SQBK 1URQD 2YIUB 1S4XA 4IFDK 2WPRA 1SQXE 1SQPE 1DH3A 3VTPC 3C8VA 1SFCD 1A02J 5AW4B 4EDFA 4H44B 1Q2NA 5BVZA 1IFDA 1OVUA 3B5ND 3HTKA 3L75J 3A5TA 1MFTA 4WVZA 2KSJA 2HR3A 2E76C 4DCKA 2IDBA 3HD7D 1KILC 4U3FJ 1DEBA 3G6EP 1PL5A 3H1ID 5CBOA 5KLVG 1LTSC 4DZOA 5DJTB 2DW3A 2JR8A 4PV1C 2ZJSE 2HPCA 3H1LD 4AUWA 3A7OA 3WUVA 2A45G 2QM7A 5B66E 5BU8B 2A06G 4R4MA 5CCGD 3L70E 3W67A 2FYUK 1Q82Q 2K3RA 2K9YA 1NTMD 1PV3A 4PD4E 3P8MC 2OTKE 3V2NA 1QL2A 4NPFX 3AE5C 1KD1Q 1R5LA 2OARA 2KNCA 3SWKA 1H0TA 2V4HA 1S9KD 1IFPA 1R5SA 1FE6A 1AA0A 1VF5D 2RMZA 1NYHA 3L71D 3TGUG 2HG5D 2W6JH 2KS1A 5CHXA 3A3YB 3L72J 2FFDA 1XTGB 3H1LJ 5KJ7A 3U1AA 4YXWH 4C7NA 3H1JE 3OAKA 1NTZK 3CCSP 2LXCB 1NAFA 1LWUA 1FZCC 2R3CA 1LTBC 3IR9A 1NTKK 4H0LC 3MIWA 5CMZA 5APVA 1LT9C 4XA4A 2N1TC 1KYOI 1LTTC 3G71P 3L75G 2IBZG 4UB8E 5KAIE 2M3BA 4JPZB 3AEEC 4BWNA 2Q3IA 3CX5E 3A0BH 3L71J 1N7SB 4U3FG 1BSHA 2K9JB 2C0XA 5CJ4A 3MUDA 3JCUE 1SQBE 3D70A 1SQPD 3FXDA 1Y8AA 1H89A 1JTHA 1IO4A 3V2RA 1IK7A 2W27A 4BXLA 2B87B 1KILA 1J1DC 1FBMA 3WU2H 2Z5HA 2WPQA 1YIJP 1SP4A 4RJTA 1JOCA 1FZEA 3BCCJ 1WRGA 3OW2O 2A06E 2WT7B 5KAFE 4JF7A 2HFED 4WY4D 3P8CE 2Y0EA 4UB6H 1SQVJ 1SQQE 3L35A 4H13C 3L70D 4R4LA 3H6PA 3L72G 3LIDA 1SQPJ 5APSA 1LTIC 2H43A 1BE3D 2FYUE 3H1LG 1M1JC 4Y99C 1N2DC 2H8PD 3O6QB 3LW5H 4C7RA 3G4SP 2NPSB 1SFCA 1YJNP 2Y0CA 4OVNF 1VPCA 5APWA 5E79H 2IZ0A 1GD2E 1LTJA 3B5NA 2B9BA 1X0TA 1HGVA 1G2CB 3KZIE 1H8AA 3V6IA 2FXOA 1IZNB 3HD7A 5APUA 2QJYB 1JB0J 3D6ZA 3CC2P 2LXBA 1USEA 1FZCA 2D2CC 5B5EE 5KLIC 1KB9H 3L71G 3RBZA 1KILE 3L70J 2ZXXA 1YJ9P 3V5BA 2OQQA 1JO5A 1NTKE 3SWYA 1LT9A 1OX3A 5CCGA 2N1TA 3CXHH 3LW5J 1WMKA 3BRVB 2Y9ZA 3CX5I 1E5WA 2E75D 3RL0D 1L0ND 1OZHA 3R2PA 3T97A 2XDJA 3F89A 1KMIZ 2P1JA 1YJWP 1EXIA 1EDJA 3S1KA 3ABVC 2KXPB 2WWWA 2KK7A 4JYBA 3BCCG 1VQLP 5C39A 2H88C 1SQBD 1ZMEC 2OYHC 1P84D 1P84H 3H1JJ 3Q1MA 1X79B 2C0WA 4JBZA 3HTKB 1EZVG 2AEMA 1KQLA 1HJBA 1SQVG 2G8YA 2OYIC
chains in the Genus database with same CATH topology
1SFCC 1N7SD 1ZN5A 2A45I 4WBAA 2FYZA 4OH8B 1IFMA 5AW2B 3N7NA 1LT9B 1LTJC 1GL2A 2YKPA 3B5NC 1JCDA 1LTAC 1ZV8A 5AW6B 2HYNA 4JYCA 2HPCB 1HVVA 3V2QA 4O9BA 2I1KA 1HTLC 1L4AA 5AW9B 5APTA 1JUNA 5AVRB 3HD7C 1VDFA 2WTYA 1SLQA 3HUSC 1SQBK 1URQD 1HBWA 5AVXB 1CI6B 4IFDK 2XKMA 2WPRA 2YO3A 2GUSA 2CPSA 2WSCH 3LIEA 1DH3A 1T8ZA 2C9LY 3I5CA 3VTPC 1GW4A 2IFNA 2O1JA 1SFCD 4N6JA 3OJAB 1A02J 1J1EB 1CSBA 5AW4B 1RF1A 5BVZA 1IFDA 5AW3B 1N73C 1SVFA 3M9BA 4WY4B 1HWTC 3B5ND 3HTKA 5CCGC 3RK3C 2PP6A 1G1JA 2I1JA 3A5TA 1YTZT 2KSJA 1NOHA 2HLOA 3CLQA 1J1DB 1IFJA 2NPSC 1AFOA 3HD7D 1KILC 3CL3D 1T3JA 1DEBA 3OA7A 4W7ZA 1GW3A 2KOGA 1LTSC 2Z5IA 1M7LA 2KLVA 4DZOA 2WITA 2FKWB 2HPCA 2YKQA 4AUWA 3A7OA 3WMM0 2FFDB 3BRTB 4EIJA 2WSFH 4C7NB 2OYHB 2A45G 2QM7A 1CZQA 2FXMA 1CI6A 2Q5UA 1NU1K 5BU8B 5CCGD 3O8ZA 3RK3D 3B8EB 4LLHA 2WSEH 1LWUB 5APQA 3GHGC 1KFNA 2FYUK 3VYIA 3P7KA 2NPSD 2GUVA 1NHLA 3TYYA 5AVQB 1KILD 3IFMA 1ZR4A 3P8MC 1AQ5A 2H7HA 1T2KC 4M3LA 3V2NA 3MGNA 1QL2A 4WY4A 2ZXEB 1M1JB 4Y99B 1JY3P 4B86A 5AVTB 1MZ9A 4HH2A 4N78E 2OARA 2YNYA 3VN0A 1S9KD 1NKNA 1GL2C 4I6MC 3L37A 1CW5A 1XTCC 1WT6A 1JMMA 1SQXK 1GZLA 1L4AC 2HG5D 1JY3O 5CHXA 3A3YB 1L0NK 3M91A 2P7JA 1JY2O 3M9HA 1X8YA 2XV5A 1IK9A 2FFDA 3KDPB 2WZ7A 5AW5B 1XTGB 1T2KD 5KJ7A 1YYCA 3U1AA 3RK2C 4C7NA 2OYHA 3OAKA 1JTHB 1NTMK 1N73B 3RL0B 1NTZK 3NTNA 1H88A 1URQA 1RF1C 1NAFA 1LWUA 1FZCC 2R3CA 2E43A 1LGHB 1LTBC 1J2JB 5AVYB 1IJDB 3IR9A 2XZRA 4N78D 2JJLA 1NTKK 2A45H 2PAJA 1RF0A 1HH0A 1KILB 2KP8A 4I2LC 2O1KA 3U1CA 1L4AD 4XE5B 3M0AA 3V4WA 3MIWA 1FZAA 1M1JA 3L36A 5CMZA 1FOSE 3MD0A 1NKZB 5APVA 5CCHC 1LT9C 4XA4A 3TSIA 2N1TC 1FOSF 3L4FA 5AVUB 2WT7A 1LTTC 3G3ZA 5AVVB 4EOTA 2M3BA 3RK2D 5CJ0A 2LKMA 4ZKUA 2Q3IA 1N7SB 1GK6A 2CPBA 1FZGA 3BATA 3TNUB 3C9IA 1FU1A 2C0XA 2YMYA 3VMYA 5CJ4A 3MUDA 1QL1A 4C46A 2XU6A 3VP8A 2JEEA 1GDTA 1OXZA 1HGZA 1H89A 1JTHA 1LTGC 1J1EC 2R32A 1N73A 1IO4A 4DOJA 1PFIA 4IFFA 5CCHD 3VP9A 3V2RA 4WY4C 2N1TD 1URQB 2W27A 4AQRD 3M9QA 1RE3C 1DX7A 1FDMA 5AVSB 1KILA 2OYIB 1J1DC 4W80A 2WPSA 3VMXA 2YKOA 1SFCB 1FBMA 2Z5HA 1FZBA 2WPQA 3II6A 1IFIA 3TK1A 1LTJB 1SP4A 2IFMA 5APYA 1JOCA 1G2CA 3B5NB 1FZEA 1WRGA 5AW0B 2WT7B 1SQVK 2IPPA 2YO2A 1X9VA 4JF7A 3RK2B 3HE4B 4ZKPA 5KJ7C 1SQPK 3HD7B 1NWQA 3NXSA 1N7SA 3P32A 1IFNA 2HFED 3HUSB 4WY4D 3U59A 2MJZA 3TNUA 2ZFCA 3P8CE 2N9BA 3GHGA 3HE5B 5AW8B 1LWUC 2KYVA 3L35A 4IFMA 2R5DA 2P67A 3H6PA 3V4QA 2W6BA 3LIDA 2IX7C 5APSA 1LTIC 1GU4A 2H43A 3EFGA 1RF0C 1RE4A 3M0DA 1M1JC 4Y99C 1N2DC 2H8PD 2N1TB 3RK3B 1GL2D 3LW5H 3V2PA 4C7RA 1Z56A 2OYIA 3MTUE 2NPSB 1JCCA 1SFCA 5KJ7D 3SWFA 4GKGA 2C9NY 1VPCA 5APWA 1KFMA 2J59M 5AVWB 1GD2E 3HRNA 1LTJA 1JY3N 3B5NA 3CI9A 2HODB 2XNXA 3KYQA 2BASA 3P8CD 1MV8A 4AYCA 1HGVA 1JY2N 1GU5A 2KB7P 1G2CB 1H8AA 2VRSA 3PP5A 3HE4A 4N3YB 1RY3A 4LC1A 3HD7A 4W7YA 5AW7B 4GT1A 3HUSA 5APUA 1GTWA 5BU5A 3VMZA 1NH4A 2P2UA 5KLVK 3RL0C 1L0LK 1FZCA 2W6AA 3M06A 3HE5A 3BASA 3H32B 3GHGB 4LGDE 3KQGA 3N4XA 2POHA 1A02F 1T3UA 1GK4A 2L5GB 3V5BA 1JNMA 1JO5A 5AVZB 5KTBA 3KPEA 1G1IA 5CCHA 3SWYA 1LT9A 5CCGA 2N1TA 1S9KE 1OWAA 1N7LA 2M8RA 1GL2B 1FAVA 1FZFA 3EQ2A 2NPSA 1W2EA 3BRVB 1EQ7A 1E5WA 1MUUA 5APXA 3RL0D 3R2PA 3NMDA 3T97A 1L4AB 1SQQK 1N86A 2E42A 2XDJA 1N7SC 2HODA 2P1JA 2QM8A 2O01H 2R5BA 3BVHA 4KHXA 1IC2A 3E1IA 1FJPA 1HUCA 2WWWA 4JYBA 2Q9IA 4HYTB 2GM4A 3A2AA 4RESB 2FFDC 2Z4EA 2J58A 1ZR2A 3NFQA 4GIFA 2OYHC 1RF1B 4WB4A 1RE4C 5AW1B 3H32A 1FZCB 3M0DC 1URQC 1RE3A 1X79B 2C0WA 2Q7CA 3HTKB 1JY2P 3UIAA 1KQLA 3VOPA 1MFZA 1HJBA 1ZLLA 1YTZI 4I1LA 1KZUB 1NO4A 2OYIC 1FJKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3VMY A;  3P8M C;  2H7H A;  2BAS A;  4AYC A;  1MV8 A;  4C46 A;  1T2K C;  2XU6 A;  1GU5 A;  4M3L A;  5AW2 B;  1G2C B;  3MGN A;  1H8A A;  1OXZ A;  2VRS A;  1H89 A;  2R32 A;  2ZXE B;  3HE4 A;  1IO4 A;  4LC1 A;  4B86 A;  5AVT B;  5AW6 B;  5AW7 B;  2YNY A;  4GT1 A;  5APU A;  4JYC A;  1GTW A;  3VMZ A;  3VN0 A;  1S9K D;  2W27 A;  4I6M C;  2P2U A;  4AQR D;  2W6A A;  5AW9 B;  5APT A;  3M06 A;  1JUN A;  3HE5 A;  5AVR B;  3L37 A;  5AVS B;  2WTY A;  1SLQ A;  1HBW A;  5AVX B;  1CI6 B;  1GZL A;  2WPS A;  3KQG A;  3VMX A;  2WPR A;  2YO3 A;  3LIE A;  3A3Y B;  1A02 F;  3M91 A;  2P7J A;  2Z5H A;  1DH3 A;  3M9H A;  1GK4 A;  2C9L Y;  3I5C A;  1X8Y A;  3V5B A;  2XV5 A;  2WPQ A;  3VTP C;  1JNM A;  5AVZ B;  3TK1 A;  1SP4 A;  1A02 J;  5APY A;  1CSB A;  5AW4 B;  3KDP B;  1T2K D;  5AW5 B;  5AW0 B;  1YYC A;  1OWA A;  5AW3 B;  2WT7 B;  1S9K E;  4C7N A;  2IPP A;  3M9B A;  2YO2 A;  1HWT C;  3OAK A;  3HTK A;  1FAV A;  3HE4 B;  3NTN A;  1H88 A;  1NWQ A;  3A5T A;  3NXS A;  1NAF A;  1MUU A;  3P32 A;  2R3C A;  2E43 A;  5APX A;  1J2J B;  5AVY B;  2ZFC A;  3TNU A;  2N9B A;  3IR9 A;  2XZR A;  3NMD A;  3T97 A;  2JJL A;  3HE5 B;  5AW8 B;  2E42 A;  2QM8 A;  2R5B A;  3L35 A;  4KHX A;  2KP8 A;  4I2L C;  2R5D A;  2P67 A;  3V4Q A;  4XE5 B;  3M0A A;  3V4W A;  2Z5I A;  3LID A;  5APS A;  1HUC A;  2WWW A;  3L36 A;  5CMZ A;  4JYB A;  4DZO A;  3MD0 A;  4HYT B;  1GU4 A;  3A2A A;  1FOS E;  4RES B;  5APV A;  3M0D A;  4AUW A;  1FOS F;  3A7O A;  5AVU B;  3NFQ A;  2WT7 A;  5AVV B;  4EOT A;  5AW1 B;  4C7N B;  1CZQ A;  2QM7 A;  1CI6 A;  2Q5U A;  2Q7C A;  3UIA A;  2Q3I A;  3O8Z A;  1KQL A;  3B8E B;  3SWF A;  1MFZ A;  1HJB A;  4GKG A;  1GK6 A;  5APQ A;  2C9N Y;  3TNU B;  3VYI A;  3P7K A;  5APW A;  5AVW B;  1GD2 E;  3TYY A;  5AVQ B; 
#chains in the Genus database with same CATH topology
 1ZN5 A;  3GF3 A;  1SQP G;  2A45 I;  4WBA A;  2FYZ A;  1OVV A;  4OH8 B;  1EC5 A;  1IFM A;  5AW2 B;  1JM0 A;  3CCM P;  1KOR A;  1JCD A;  1ZV8 A;  3TF5 A;  2IYO A;  2HYN A;  2HPC B;  1EDI A;  2I1K A;  3SFE C;  3H1I E;  5AW9 B;  2E5Y A;  1VDF A;  2E75 B;  1HBW A;  2ZVN B;  2Q1K A;  2XKM A;  2GUS A;  3H1L E;  4D6T D;  2BEZ F;  1GW4 A;  3AE1 C;  1YQ3 C;  1J1E B;  1RQU A;  4OGQ C;  1SQB J;  2JO1 A;  5AW3 B;  1S5L X;  1SVF A;  3M9B A;  3MP7 B;  3RK3 C;  3IF4 A;  1NTM E;  2PP6 A;  2KNC B;  1H0T B;  2HLO A;  5EFW B;  1IFJ A;  3OA7 A;  3L70 G;  4W7Z A;  1GW3 A;  3CWB D;  2Z5I A;  2KS1 B;  3FWN A;  3CCV P;  5L8R J;  3WMM 0;  4L75 A;  2FFD B;  1QLE D;  1NGM B;  1DIP A;  2KZI A;  4C7N B;  1KV4 A;  2FXM A;  2ZT9 B;  1CI6 A;  2ZYD A;  4OWF A;  2Q5U A;  1NU1 K;  4KT0 J;  4QMA A;  3H1H E;  3GMA A;  4YTP C;  2WSE H;  1LWU B;  3GHG C;  2P10 A;  1KFN A;  1OW7 A;  2ZYA A;  2E76 D;  4D6T J;  2IBZ I;  2ZYG A;  1KIL D;  1ZR4 A;  1NTZ D;  2H7H A;  1SQQ J;  3E1R A;  1OMI A;  3MGN A;  4WY4 A;  1K73 Q;  1JY3 P;  1NTK D;  1UIX A;  5AVT B;  3RGU A;  4PV1 D;  2FYU J;  3Q3D A;  1Q86 Q;  1USD A;  1GL2 C;  3H1J G;  3Q5S A;  2RKL A;  4NPD A;  5TIS H;  3L37 A;  1CW5 A;  2E74 B;  4HKZ H;  1WT6 A;  2IYP A;  1OFC X;  1L4A C;  1Q7Y Q;  1OVR A;  3PTZ A;  1L0N K;  2P7J A;  1X22 A;  1DD4 A;  1IK9 A;  3AEB C;  4L76 A;  3KDP B;  4TT3 H;  4A7P A;  2XND H;  3A0B E;  3RK2 C;  2OYH A;  1LJ2 A;  2O3J A;  1JTH B;  1RF1 C;  1H88 A;  4K35 A;  4BRY A;  3IN6 A;  5AVY B;  2O01 J;  2QJP B;  2XZR A;  4N78 D;  2WSE J;  2JJL A;  2ZVO B;  1N8R Q;  1RF0 A;  1HH0 A;  2ITA A;  1KIL B;  4I2L C;  3U1C A;  1ZRT D;  1QVG O;  1NTZ J;  4EI2 A;  3L73 E;  1HJ0 A;  3M0A A;  3H1K D;  2KZJ A;  1FZA A;  1HF9 A;  1NKZ B;  3AEF C;  1SQB G;  5CCH C;  1AVO A;  1NTK J;  1FOS F;  5AVU B;  2OTJ P;  3PH0 A;  1VQN P;  1LT1 A;  3WU2 E;  2LKM A;  4GOF A;  2YIU C;  1FU1 A;  1VQK P;  4H0L D;  4H44 C;  4DOJ A;  1JEK A;  4UB6 E;  2N1T D;  1URQ B;  1PPJ D;  2N9Y B;  1T6A A;  1RE3 C;  1BE3 E;  2WPS A;  2P58 A;  3VMX A;  4D6T G;  2V7Q H;  1SFC B;  4TLF A;  1FZB A;  1SQQ G;  3H1K J;  3C1L A;  3AED C;  1LTJ B;  3B5N B;  1QX8 A;  5AW0 B;  2FYU G;  3IAO A;  2NZ2 A;  1X9V A;  5E79 E;  5GTI H;  3HD7 B;  3NXS A;  1YHQ P;  1IFN A;  3U59 A;  2N9B A;  3GHG A;  3H1I J;  3H1H D;  1NU1 E;  2P67 A;  3H25 A;  2IX7 C;  2K1A A;  3M0D A;  1KB9 E;  2N1T B;  3GF7 A;  1JCC A;  1FDI A;  4GKG A;  1NTM J;  2V7Q J;  3AEC C;  2J59 M;  3T97 B;  3I56 P;  3CXH E;  2WPV B;  1NJI Q;  4ZNC A;  1EZV I;  2AXT H;  1U57 A;  2VRS A;  3AE2 C;  2QVA A;  1NTK G;  1Y9B A;  3HE4 A;  1L0N E;  3AE8 C;  5AW7 B;  3HUS A;  1VF5 B;  5BU5 A;  2JKV A;  3RK3 E;  1NH4 A;  1L0L K;  2M3E A;  3FWL A;  3CCQ P;  2W6A A;  2YXQ B;  3HE5 A;  3CMA P;  4LGD E;  1S5L H;  3H1H J;  1K05 A;  1P84 E;  5KTB A;  1KYO H;  2RN0 A;  1G1I A;  5CCH A;  3L73 D;  1M90 Q;  1EXJ A;  2J5U A;  4XFJ A;  1FZF A;  1W2E A;  3AE9 C;  1EQ7 A;  4GDO A;  2D2C D;  2B89 A;  1N86 A;  1N7S C;  2HOD A;  1QGK B;  2WQY C;  3H1K G;  4NPE A;  3A2A A;  1AJY A;  4RES B;  2J58 A;  3NFQ A;  4GIF A;  2OTL P;  1RE4 C;  4D6T E;  1RE3 A;  2K88 A;  4PD4 I;  3VOP A;  3H1I G;  1ZLL A;  1YTZ I;  4I1L A;  1KZU B;  3L74 D;  4RKU J;  1M56 D;  1W5C E;  3N7N A;  3CME P;  3L73 J;  2YKP A;  2PGD A;  1LTA C;  5AW6 B;  3WUU A;  1PP9 D;  4JYC A;  1HVV A;  4EYY Q;  3A0H H;  4GOE A;  5APT A;  3CWB E;  2WTY A;  1SLQ A;  4DT0 A;  1NTM G;  5AVX B;  1CI6 B;  1PGO A;  3LIE A;  1T8Z A;  2C9L Y;  1BGY D;  1NU1 D;  1RHZ B;  1CSB A;  1FC2 C;  1BSN A;  1N73 C;  4WY4 B;  1RH5 B;  1KB9 D;  5KKZ B;  3JSV C;  2I1J A;  1YTZ T;  1NTZ E;  1MKM A;  2AEF A;  1S3J A;  1NAY A;  1YQ4 C;  3CLQ A;  1DEE G;  2NPS C;  1AFO A;  3AEG C;  1T3J A;  3H1H G;  1OIP A;  3L74 J;  2KSE A;  2GA1 A;  2BCC D;  1BE3 J;  3PHL A;  1PGJ A;  5TJH A;  2G3A A;  3S4R A;  1VQ6 P;  1M7L A;  1K04 A;  1PGQ A;  3CXH D;  2WIT A;  5TIS E;  1Y47 A;  4OGQ D;  3BRT B;  4EIJ A;  3AE7 C;  2KI7 B;  2WSF H;  2OYH B;  2QJY C;  1CZQ A;  3O8Z A;  3GG2 A;  3RK3 D;  4BRY B;  3B8E B;  1LP1 A;  1YIT P;  5APQ A;  4L74 A;  3VYI A;  1P84 I;  3P7K A;  1L0L E;  1NHL A;  2FXP A;  2GUV A;  1OW6 A;  3TYY A;  1BCC D;  5AVQ B;  1BGY J;  1T2K C;  1NU1 J;  4M3L A;  1ZXG A;  1VQP P;  1AVY A;  2ZXE B;  4B86 A;  3MHV A;  4HH2 A;  4N78 E;  2YNY A;  4I6M C;  3CC4 P;  1ZRT E;  2QG4 A;  3H1K E;  3KHU A;  1SQX K;  1GZL A;  1L2P A;  4YXD C;  2BCC J;  3EWK A;  1JY2 O;  3M9H A;  2QJK B;  3B4S A;  3L73 G;  2WZ7 A;  3RL0 B;  2WSF J;  1L0N J;  2QA4 P;  1GMJ A;  3FXE A;  2A45 H;  3G9R A;  2PAJ A;  1BCC J;  2KP8 A;  2O1K A;  3SSU A;  1L4A D;  3V4W A;  1PPJ E;  1M1J A;  2WMM A;  2JDI H;  2R44 A;  3TSI A;  2WT7 A;  3G3Z A;  5AVV B;  3RK2 D;  5CJ0 A;  4I7Z B;  2E75 C;  2CPB A;  1EDK A;  3AE3 C;  2JWD A;  3C9I A;  1BE3 G;  1S1C X;  2Q3E A;  4C46 A;  5GTI E;  2XU6 A;  3VP8 A;  1OXZ A;  1HGZ A;  1J1E C;  2R32 A;  1N73 A;  3FGA D;  5GTH H;  1PFI A;  3SFD C;  5CCH D;  3VP9 A;  4AQR D;  5H2F H;  3ITK A;  1FDM A;  1KN7 A;  2FY8 A;  2WVR A;  2NRG A;  1R8E A;  2W83 C;  2Y9Y A;  1NU1 G;  2Y0D A;  4PJ0 H;  1G2C A;  2IPP A;  4H44 D;  3RK2 B;  3HE4 B;  3Q2Y A;  5KJ7 C;  3HUS B;  4IL6 H;  2ZT9 C;  3TNU A;  2ZFC A;  1DD3 A;  2AXT E;  3CWB J;  3HE5 B;  5AW8 B;  1LWU C;  2BCC G;  2KYV A;  4IFM A;  1W2B O;  2QIW A;  3V4Q A;  2W6B A;  4U3F D;  4JQ0 D;  1L0L D;  1UII A;  1GU4 A;  2FYN C;  3B71 A;  2PRR A;  4KJM A;  1BDC A;  2IZ1 A;  2RH0 A;  1L0N G;  2PFX A;  1S5L E;  3V2P A;  2FBW C;  1Z56 A;  2SPZ A;  2OYI A;  3MTU E;  2E76 B;  1KYO E;  3SWF A;  4YPC A;  2E74 C;  2C9N Y;  1BCC G;  1KFM A;  3HRN A;  3TDK A;  2HOD B;  3KYQ A;  1YBK A;  2BAS A;  1JY2 N;  4PV1 B;  1GU5 A;  2KB7 P;  3AE4 C;  3S9O A;  2M5A A;  1ZW0 A;  3PP5 A;  2H89 C;  3MUD C;  4N3Y B;  1RY3 A;  4LC1 A;  1KQF B;  4W7Y A;  3VMZ A;  2P2U A;  5KLV K;  3M06 A;  1S72 P;  1SS1 A;  3BAS A;  3R4Y A;  2QJP C;  3KQG A;  3CCR P;  3N4X A;  4K3A A;  2POH A;  1A02 F;  1T3U A;  1GK4 A;  1L0L J;  1JNM A;  5AVZ B;  4L73 A;  3CCL P;  1YI2 P;  1AQT A;  3L72 D;  1OWA A;  1N7L A;  2M8R A;  2W90 A;  3L74 E;  1MUU A;  3VMA A;  5APX A;  3CC7 P;  3NMD A;  1SQQ K;  1ZP0 C;  2OYO A;  2QM8 A;  1PP9 E;  2E5T A;  2GM4 A;  3A0H E;  2Z4E A;  1EDL A;  3ZDM A;  5AW1 B;  3H32 A;  1FZC B;  1URQ C;  2Q7C A;  1JY2 P;  3UIA A;  1BGY E;  2YMK A;  1MFZ A;  4HJG H;  3CWB G;  4H0L B;  4HB1 A;  2UWJ E;  1FJK A;  1NVO A;  1SFC C;  1N7S D;  2K37 A;  1LT9 B;  3AE6 C;  1LTJ C;  1GL2 A;  3B5N C;  3USS A;  3QWO C;  3FX0 A;  4O9B A;  2BCC E;  4DJG A;  3D71 A;  1L4A A;  1M1K Q;  1E79 H;  5AVR B;  3HD7 C;  2QE7 H;  2WSS H;  1BDD A;  1NTZ G;  1RQV A;  3JC2 2;  2YO3 A;  4H13 D;  1LP1 B;  2CPS A;  2WSC H;  3I5C A;  2IFN A;  2O1J A;  4N6J A;  3OJA B;  2KLU A;  1RF1 A;  1PGP A;  1KTM A;  1HWT C;  3BCC D;  5CCG C;  1BCC E;  1G1J A;  1NOH A;  1J1D B;  3CL3 D;  1PIX A;  1KYO D;  1EZV D;  1S2E A;  2KOG A;  1L0L G;  1SQV D;  2KLV A;  2FKW B;  1SQX D;  2YKQ A;  1VF5 C;  2JWA A;  4LLH A;  1M57 D;  4GOD A;  5CBN A;  4H13 B;  4IL6 X;  2NPS D;  5KLV E;  2WSC J;  1VQ4 P;  4ZMD A;  3IFM A;  1AQ5 A;  5DJU B;  2MKV A;  1M1J B;  4Y99 B;  3Q5P A;  3Q5R A;  1MZ9 A;  1VQ9 P;  3VN0 A;  3RL0 g;  1NKN A;  1KC8 Q;  1PZQ A;  1XTC C;  1JMM A;  3WUT A;  1K8A Q;  1JY3 O;  5B66 H;  3M91 A;  1VL2 A;  4MN4 C;  3CCJ P;  1X8Y A;  2XV5 A;  3CCE P;  1PPJ G;  1T2K D;  5AW5 B;  1SQX J;  1YYC A;  2QEX P;  4PD4 D;  4PD4 H;  1NTM K;  1N73 B;  3NTN A;  1URQ A;  2D2C B;  3PRJ A;  5KLI B;  3TGU E;  2E43 A;  1LGH B;  1J2J B;  1IJD B;  3E7K A;  5GTH E;  1KB9 I;  2O01 N;  1VQM P;  4XE5 B;  4Y28 J;  3L36 A;  1FS0 E;  1FOS E;  3MD0 A;  5H2F E;  3RBX A;  3KXD A;  4U7J A;  2QSI A;  3L4F A;  4WWI A;  4EOT A;  2M0B A;  1AV1 A;  3D6Y A;  3CXH I;  2YXR B;  4ZKU A;  4PJ0 E;  1ZOY C;  3H1J D;  1GK6 A;  1FZG A;  3BAT A;  3TNU B;  2YMY A;  3VMY A;  1QL1 A;  2AXC A;  5M1B A;  2JEE A;  1GDT A;  4IL6 E;  1PP9 J;  1LTG C;  3L75 E;  2IBZ E;  1OW8 A;  1D7M A;  4IFF A;  4IOI H;  4WY4 C;  5KKZ C;  3M9Q A;  1VQO P;  1DX7 A;  4U3F E;  1FDO A;  5AVS B;  2AEJ A;  2OYI B;  4UB8 H;  5KAI H;  2OGU A;  4W80 A;  2YKO A;  2QRX A;  3II6 A;  1IFI A;  3TK1 A;  3CX5 D;  3CX5 H;  2BEQ D;  2IFM A;  5APY A;  1SQV K;  2KIK A;  2M5A B;  2YO2 A;  3CCU P;  3JCU H;  4ZKP A;  3I55 P;  1SQP K;  1VQ5 P;  1NWQ A;  1KQG B;  1N7S A;  3P32 A;  2MJZ A;  1U7M A;  2K9J A;  1TU3 F;  4Z1M H;  2JP3 A;  2KUB A;  2R5D A;  1VQ8 P;  5KLV D;  5K5G B;  3AEA C;  4ASW A;  4OGQ B;  3EFG A;  1RF0 C;  1RE4 A;  1M8O B;  1SQX G;  2L91 A;  1LNQ A;  3RK3 B;  1QEX A;  1GL2 D;  2B87 A;  2A06 D;  2CK3 H;  5KJ7 D;  5KAF H;  2ZT9 D;  3L72 E;  5AVW B;  4RO0 A;  4ASV A;  3K5B A;  1QVF O;  1JY3 N;  3CI9 A;  2XNX A;  3QH9 A;  3P8C D;  4AYC A;  1MV8 A;  2QJK C;  2R3S A;  2ZAE B;  1Q81 Q;  1SQQ D;  1JMB A;  4GT1 A;  1GTW A;  3RL0 C;  2FYU D;  3L74 G;  3H32 B;  3CD6 P;  3GHG B;  3TGU D;  1VQ7 P;  3GLM A;  2E74 D;  2L5G B;  5KLV J;  2B88 A;  3KPE A;  1PP9 G;  3MZW B;  3O6Q A;  4CPG A;  1S9K E;  2I8D A;  2Q6Q A;  1GL2 B;  1FAV A;  3EQ2 A;  2NPS A;  3L71 E;  3KZI H;  2W8Z A;  4I7Z C;  1L4A B;  1BGY G;  2E42 A;  2O01 H;  2R5B A;  1K9M Q;  3BVH A;  4KHX A;  1IC2 A;  3E1I A;  5B5E H;  1FJP A;  3PJS K;  1HUC A;  2Q9I A;  4HYT B;  2FFD C;  2FYN B;  1ZR2 A;  1RF1 B;  4WB4 A;  3L75 D;  2IBZ D;  3M0D C;  1KQS O;  2LR2 A;  3F5H A;  3TGU J;  1NO4 A;  3EFF K;  3PLN A;  1U7J A;  3BCC E;  3CPW O;  3GW6 A;  1Q90 D;  3V2Q A;  1EZV E;  1HTL C;  3W68 A;  1JUN A;  1SQV E;  3HUS C;  1SQB K;  1URQ D;  2YIU B;  1S4X A;  4IFD K;  2WPR A;  1SQX E;  1SQP E;  1DH3 A;  3VTP C;  3C8V A;  1SFC D;  1A02 J;  5AW4 B;  4EDF A;  4H44 B;  1Q2N A;  5BVZ A;  1IFD A;  1OVU A;  3B5N D;  3HTK A;  3L75 J;  3A5T A;  1MFT A;  4WVZ A;  2KSJ A;  2HR3 A;  2E76 C;  4DCK A;  2IDB A;  3HD7 D;  1KIL C;  4U3F J;  1DEB A;  3G6E P;  1PL5 A;  3H1I D;  5CBO A;  5KLV G;  1LTS C;  4DZO A;  5DJT B;  2DW3 A;  2JR8 A;  4PV1 C;  2ZJS E;  2HPC A;  3H1L D;  4AUW A;  3A7O A;  3WUV A;  2A45 G;  2QM7 A;  5B66 E;  5BU8 B;  2A06 G;  4R4M A;  5CCG D;  3L70 E;  3W67 A;  2FYU K;  1Q82 Q;  2K3R A;  2K9Y A;  1NTM D;  1PV3 A;  4PD4 E;  3P8M C;  2OTK E;  3V2N A;  1QL2 A;  4NPF X;  3AE5 C;  1KD1 Q;  1R5L A;  2OAR A;  2KNC A;  3SWK A;  1H0T A;  2V4H A;  1S9K D;  1IFP A;  1R5S A;  1FE6 A;  1AA0 A;  1VF5 D;  2RMZ A;  1NYH A;  3L71 D;  3TGU G;  2HG5 D;  2W6J H;  2KS1 A;  5CHX A;  3A3Y B;  3L72 J;  2FFD A;  1XTG B;  3H1L J;  5KJ7 A;  3U1A A;  4YXW H;  4C7N A;  3H1J E;  3OAK A;  1NTZ K;  3CCS P;  2LXC B;  1NAF A;  1LWU A;  1FZC C;  2R3C A;  1LTB C;  3IR9 A;  1NTK K;  4H0L C;  3MIW A;  5CMZ A;  5APV A;  1LT9 C;  4XA4 A;  2N1T C;  1KYO I;  1LTT C;  3G71 P;  3L75 G;  2IBZ G;  4UB8 E;  5KAI E;  2M3B A;  4JPZ B;  3AEE C;  4BWN A;  2Q3I A;  3CX5 E;  3A0B H;  3L71 J;  1N7S B;  4U3F G;  1BSH A;  2K9J B;  2C0X A;  5CJ4 A;  3MUD A;  3JCU E;  1SQB E;  3D70 A;  1SQP D;  3FXD A;  1Y8A A;  1H89 A;  1JTH A;  1IO4 A;  3V2R A;  1IK7 A;  2W27 A;  4BXL A;  2B87 B;  1KIL A;  1J1D C;  1FBM A;  3WU2 H;  2Z5H A;  2WPQ A;  1YIJ P;  1SP4 A;  4RJT A;  1JOC A;  1FZE A;  3BCC J;  1WRG A;  3OW2 O;  2A06 E;  2WT7 B;  5KAF E;  4JF7 A;  2HFE D;  4WY4 D;  3P8C E;  2Y0E A;  4UB6 H;  1SQV J;  1SQQ E;  3L35 A;  4H13 C;  3L70 D;  4R4L A;  3H6P A;  3L72 G;  3LID A;  1SQP J;  5APS A;  1LTI C;  2H43 A;  1BE3 D;  2FYU E;  3H1L G;  1M1J C;  4Y99 C;  1N2D C;  2H8P D;  3O6Q B;  3LW5 H;  4C7R A;  3G4S P;  2NPS B;  1SFC A;  1YJN P;  2Y0C A;  4OVN F;  1VPC A;  5APW A;  5E79 H;  2IZ0 A;  1GD2 E;  1LTJ A;  3B5N A;  2B9B A;  1X0T A;  1HGV A;  1G2C B;  3KZI E;  1H8A A;  3V6I A;  2FXO A;  1IZN B;  3HD7 A;  5APU A;  2QJY B;  1JB0 J;  3D6Z A;  3CC2 P;  2LXB A;  1USE A;  1FZC A;  2D2C C;  5B5E E;  5KLI C;  1KB9 H;  3L71 G;  3RBZ A;  1KIL E;  3L70 J;  2ZXX A;  1YJ9 P;  3V5B A;  2OQQ A;  1JO5 A;  1NTK E;  3SWY A;  1LT9 A;  1OX3 A;  5CCG A;  2N1T A;  3CXH H;  3LW5 J;  1WMK A;  3BRV B;  2Y9Z A;  3CX5 I;  1E5W A;  2E75 D;  3RL0 D;  1L0N D;  1OZH A;  3R2P A;  3T97 A;  2XDJ A;  3F89 A;  1KMI Z;  2P1J A;  1YJW P;  1EXI A;  1EDJ A;  3S1K A;  3ABV C;  2KXP B;  2WWW A;  2KK7 A;  4JYB A;  3BCC G;  1VQL P;  5C39 A;  2H88 C;  1SQB D;  1ZME C;  2OYH C;  1P84 D;  1P84 H;  3H1J J;  3Q1M A;  1X79 B;  2C0W A;  4JBZ A;  3HTK B;  1EZV G;  2AEM A;  1KQL A;  1HJB A;  1SQV G;  2G8Y A;  2OYI C; 
#chains in the Genus database with same CATH homology
 1SFC C;  1N7S D;  1ZN5 A;  2A45 I;  4WBA A;  2FYZ A;  4OH8 B;  1IFM A;  5AW2 B;  3N7N A;  1LT9 B;  1LTJ C;  1GL2 A;  2YKP A;  3B5N C;  1JCD A;  1LTA C;  1ZV8 A;  5AW6 B;  2HYN A;  4JYC A;  2HPC B;  1HVV A;  3V2Q A;  4O9B A;  2I1K A;  1HTL C;  1L4A A;  5AW9 B;  5APT A;  1JUN A;  5AVR B;  3HD7 C;  1VDF A;  2WTY A;  1SLQ A;  3HUS C;  1SQB K;  1URQ D;  1HBW A;  5AVX B;  1CI6 B;  4IFD K;  2XKM A;  2WPR A;  2YO3 A;  2GUS A;  2CPS A;  2WSC H;  3LIE A;  1DH3 A;  1T8Z A;  2C9L Y;  3I5C A;  3VTP C;  1GW4 A;  2IFN A;  2O1J A;  1SFC D;  4N6J A;  3OJA B;  1A02 J;  1J1E B;  1CSB A;  5AW4 B;  1RF1 A;  5BVZ A;  1IFD A;  5AW3 B;  1N73 C;  1SVF A;  3M9B A;  4WY4 B;  1HWT C;  3B5N D;  3HTK A;  5CCG C;  3RK3 C;  2PP6 A;  1G1J A;  2I1J A;  3A5T A;  1YTZ T;  2KSJ A;  1NOH A;  2HLO A;  3CLQ A;  1J1D B;  1IFJ A;  2NPS C;  1AFO A;  3HD7 D;  1KIL C;  3CL3 D;  1T3J A;  1DEB A;  3OA7 A;  4W7Z A;  1GW3 A;  2KOG A;  1LTS C;  2Z5I A;  1M7L A;  2KLV A;  4DZO A;  2WIT A;  2FKW B;  2HPC A;  2YKQ A;  4AUW A;  3A7O A;  3WMM 0;  2FFD B;  3BRT B;  4EIJ A;  2WSF H;  4C7N B;  2OYH B;  2A45 G;  2QM7 A;  1CZQ A;  2FXM A;  1CI6 A;  2Q5U A;  1NU1 K;  5BU8 B;  5CCG D;  3O8Z A;  3RK3 D;  3B8E B;  4LLH A;  2WSE H;  1LWU B;  5APQ A;  3GHG C;  1KFN A;  2FYU K;  3VYI A;  3P7K A;  2NPS D;  2GUV A;  1NHL A;  3TYY A;  5AVQ B;  1KIL D;  3IFM A;  1ZR4 A;  3P8M C;  1AQ5 A;  2H7H A;  1T2K C;  4M3L A;  3V2N A;  3MGN A;  1QL2 A;  4WY4 A;  2ZXE B;  1M1J B;  4Y99 B;  1JY3 P;  4B86 A;  5AVT B;  1MZ9 A;  4HH2 A;  4N78 E;  2OAR A;  2YNY A;  3VN0 A;  1S9K D;  1NKN A;  1GL2 C;  4I6M C;  3L37 A;  1CW5 A;  1XTC C;  1WT6 A;  1JMM A;  1SQX K;  1GZL A;  1L4A C;  2HG5 D;  1JY3 O;  5CHX A;  3A3Y B;  1L0N K;  3M91 A;  2P7J A;  1JY2 O;  3M9H A;  1X8Y A;  2XV5 A;  1IK9 A;  2FFD A;  3KDP B;  2WZ7 A;  5AW5 B;  1XTG B;  1T2K D;  5KJ7 A;  1YYC A;  3U1A A;  3RK2 C;  4C7N A;  2OYH A;  3OAK A;  1JTH B;  1NTM K;  1N73 B;  3RL0 B;  1NTZ K;  3NTN A;  1H88 A;  1URQ A;  1RF1 C;  1NAF A;  1LWU A;  1FZC C;  2R3C A;  2E43 A;  1LGH B;  1LTB C;  1J2J B;  5AVY B;  1IJD B;  3IR9 A;  2XZR A;  4N78 D;  2JJL A;  1NTK K;  2A45 H;  2PAJ A;  1RF0 A;  1HH0 A;  1KIL B;  2KP8 A;  4I2L C;  2O1K A;  3U1C A;  1L4A D;  4XE5 B;  3M0A A;  3V4W A;  3MIW A;  1FZA A;  1M1J A;  3L36 A;  5CMZ A;  1FOS E;  3MD0 A;  1NKZ B;  5APV A;  5CCH C;  1LT9 C;  4XA4 A;  3TSI A;  2N1T C;  1FOS F;  3L4F A;  5AVU B;  2WT7 A;  1LTT C;  3G3Z A;  5AVV B;  4EOT A;  2M3B A;  3RK2 D;  5CJ0 A;  2LKM A;  4ZKU A;  2Q3I A;  1N7S B;  1GK6 A;  2CPB A;  1FZG A;  3BAT A;  3TNU B;  3C9I A;  1FU1 A;  2C0X A;  2YMY A;  3VMY A;  5CJ4 A;  3MUD A;  1QL1 A;  4C46 A;  2XU6 A;  3VP8 A;  2JEE A;  1GDT A;  1OXZ A;  1HGZ A;  1H89 A;  1JTH A;  1LTG C;  1J1E C;  2R32 A;  1N73 A;  1IO4 A;  4DOJ A;  1PFI A;  4IFF A;  5CCH D;  3VP9 A;  3V2R A;  4WY4 C;  2N1T D;  1URQ B;  2W27 A;  4AQR D;  3M9Q A;  1RE3 C;  1DX7 A;  1FDM A;  5AVS B;  1KIL A;  2OYI B;  1J1D C;  4W80 A;  2WPS A;  3VMX A;  2YKO A;  1SFC B;  1FBM A;  2Z5H A;  1FZB A;  2WPQ A;  3II6 A;  1IFI A;  3TK1 A;  1LTJ B;  1SP4 A;  2IFM A;  5APY A;  1JOC A;  1G2C A;  3B5N B;  1FZE A;  1WRG A;  5AW0 B;  2WT7 B;  1SQV K;  2IPP A;  2YO2 A;  1X9V A;  4JF7 A;  3RK2 B;  3HE4 B;  4ZKP A;  5KJ7 C;  1SQP K;  3HD7 B;  1NWQ A;  3NXS A;  1N7S A;  3P32 A;  1IFN A;  2HFE D;  3HUS B;  4WY4 D;  3U59 A;  2MJZ A;  3TNU A;  2ZFC A;  3P8C E;  2N9B A;  3GHG A;  3HE5 B;  5AW8 B;  1LWU C;  2KYV A;  3L35 A;  4IFM A;  2R5D A;  2P67 A;  3H6P A;  3V4Q A;  2W6B A;  3LID A;  2IX7 C;  5APS A;  1LTI C;  1GU4 A;  2H43 A;  3EFG A;  1RF0 C;  1RE4 A;  3M0D A;  1M1J C;  4Y99 C;  1N2D C;  2H8P D;  2N1T B;  3RK3 B;  1GL2 D;  3LW5 H;  3V2P A;  4C7R A;  1Z56 A;  2OYI A;  3MTU E;  2NPS B;  1JCC A;  1SFC A;  5KJ7 D;  3SWF A;  4GKG A;  2C9N Y;  1VPC A;  5APW A;  1KFM A;  2J59 M;  5AVW B;  1GD2 E;  3HRN A;  1LTJ A;  1JY3 N;  3B5N A;  3CI9 A;  2HOD B;  2XNX A;  3KYQ A;  2BAS A;  3P8C D;  1MV8 A;  4AYC A;  1HGV A;  1JY2 N;  1GU5 A;  2KB7 P;  1G2C B;  1H8A A;  2VRS A;  3PP5 A;  3HE4 A;  4N3Y B;  1RY3 A;  4LC1 A;  3HD7 A;  4W7Y A;  5AW7 B;  4GT1 A;  3HUS A;  5APU A;  1GTW A;  5BU5 A;  3VMZ A;  1NH4 A;  2P2U A;  5KLV K;  3RL0 C;  1L0L K;  1FZC A;  2W6A A;  3M06 A;  3HE5 A;  3BAS A;  3H32 B;  3GHG B;  4LGD E;  3KQG A;  3N4X A;  2POH A;  1A02 F;  1T3U A;  1GK4 A;  2L5G B;  3V5B A;  1JNM A;  1JO5 A;  5AVZ B;  5KTB A;  3KPE A;  1G1I A;  5CCH A;  3SWY A;  1LT9 A;  5CCG A;  2N1T A;  1S9K E;  1OWA A;  1N7L A;  2M8R A;  1GL2 B;  1FAV A;  1FZF A;  3EQ2 A;  2NPS A;  1W2E A;  3BRV B;  1EQ7 A;  1E5W A;  1MUU A;  5APX A;  3RL0 D;  3R2P A;  3NMD A;  3T97 A;  1L4A B;  1SQQ K;  1N86 A;  2E42 A;  2XDJ A;  1N7S C;  2HOD A;  2P1J A;  2QM8 A;  2O01 H;  2R5B A;  3BVH A;  4KHX A;  1IC2 A;  3E1I A;  1FJP A;  1HUC A;  2WWW A;  4JYB A;  2Q9I A;  4HYT B;  2GM4 A;  3A2A A;  4RES B;  2FFD C;  2Z4E A;  2J58 A;  1ZR2 A;  3NFQ A;  4GIF A;  2OYH C;  1RF1 B;  4WB4 A;  1RE4 C;  5AW1 B;  3H32 A;  1FZC B;  3M0D C;  1URQ C;  1RE3 A;  1X79 B;  2C0W A;  2Q7C A;  3HTK B;  1JY2 P;  3UIA A;  1KQL A;  3VOP A;  1MFZ A;  1HJB A;  1ZLL A;  1YTZ I;  4I1L A;  1KZU B;  1NO4 A;  2OYI C;  1FJK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...