4EOTA

Crystal structure of the mafa homodimer bound to the consensus mare
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
92
structure length
92
Chain Sequence
RFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Transcription factor MafA
publication title A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities.
pubmed doi rcsb
source organism Homo sapiens
total genus 39
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4eotA00
3M0AA 1OXZA 2C9LY 5APSA 1MUUA 2Z5HA 3P7KA 3VYIA 4EOTA 2YNYA 3LIDA 5AW1B 5AVQB 1JNMA 3MGNA 1FAVA 5APYA 5APWA 5AW2B 3NXSA 5APTA 1H88A 3V4WA 1NWQA 2VRSA 5AW3B 1CI6B 3NTNA 2P2UA 2WTYA 1JUNA 2IPPA 1NAFA 2W27A 3O8ZA 5AW4B 1GD2E 3SWFA 3A5TA 1H89A 2N9BA 2H7HA 4I2LC 3V4QA 4RESB 1OWAA 3HE5B 4XE5B 1FOSE 1GK6A 5AVWB 3L37A 2ZXEB 3VMZA 3M91A 1T2KC 3MD0A 1MV8A 3M06A 5AVTB 3L35A 1X8YA 3TYYA 3UIAA 4C7NB 2Q3IA 3A7OA 2R3CA 3HTKA 3NFQA 1GZLA 5AVVB 1A02J 1MFZA 1GTWA 3M9BA 1YYCA 3VTPC 4HYTB 2Z5IA 3HE4B 3L36A 2ZFCA 3M9HA 5AVYB 4C46A 4DZOA 3P32A 3T97A 4JYBA 5AW6B 4LC1A 3VMXA 5CMZA 2WPQA 2WT7B 1IO4A 4M3LA 3TNUA 1J2JB 2WPRA 2WPSA 3LIEA 3A3YB 1GU4A 2P7JA 2R5DA 2JJLA 3TK1A 4KHXA 3M0DA 2R32A 1GK4A 5AW9B 4I6MC 2C9NY 2QM7A 1HWTC 2P67A 3OAKA 1DH3A 5AW7B 1SP4A 2XV5A 2Q5UA 1HUCA 4AYCA 1A02F 2E42A 1CI6A 2KP8A 3I5CA 3VN0A 3V5BA 1S9KE 3HE4A 1HJBA 5APUA 1FOSF 5AW8B 2E43A 1CSBA 1H8AA 3KDPB 5AVZB 2YO3A 3A2AA 2W6AA 3HE5A 2WWWA 1G2CB 2XZRA 2WT7A 3NMDA 2YO2A 5APQA 5APXA 2BASA 2R5BA 2XU6A 2Q7CA 4GT1A 5AVUB 1GU5A 2QM8A 5AVRB 3B8EB 5AVXB 4JYCA 1CZQA 4C7NA 3KQGA 1KQLA 3TNUB 3IR9A 1S9KD 1T2KD 4GKGA 1HBWA 4B86A 1SLQA 5AW0B 5APVA 3VMYA 5AW5B 5AVSB 4AUWA 4AQRD 3P8MC
chains in the Genus database with same CATH superfamily
3U59A 1MUUA 2Z5HA 1LWUA 1N7SD 2A06E 1FAVA 2WSFJ 3RL0B 3IF4A 1J1DC 1OVVA 2IPPA 5AW4B 2KSEA 3CCEP 1ZP0C 4H13D 1KV4A 1LGHB 2J58A 3PP5A 3HD7A 5KJ7A 1T2KC 3CWBE 4NPFX 1ZXGA 4D6TD 1YJNP 2IBZE 3L70E 3H1JD 2K9YA 3MIWA 1SQPE 5CCGD 3HE4B 1HGZA 1L4AA 3T97A 2O01H 1SQPK 3CWBJ 1IO4A 4M3LA 3TNUA 2WPSA 3Q5SA 4JQ0D 3Q3DA 1FZBA 3L70J 1PFIA 1NU1G 4IL6X 1SQPJ 2FYZA 3IFMA 2W90A 1HWTC 1PPJD 1R5LA 2RKLA 2Q5UA 1A02F 2D2CB 2YIUC 2KP8A 3V5BA 3V2NA 4W7YA 1URQA 4WY4A 1H8AA 1L0LE 1N2DC 2R5BA 1L0LK 1QL1A 2QSIA 1NTZD 3E1RA 3CCJP 5KTBA 1L0LJ 1EDLA 3OA7A 5CBNA 2FYNB 3KXDA 1GW4A 5CJ4A 4IL6E 2VRSA 5AW3B 1CI6B 3AECC 1RHZB 2KS1B 3TGUG 1N7LA 3H6PA 3D6YA 3JCUE 1FBMA 1BE3D 3A0HE 4H13C 2XNDH 3L71E 1RY3A 3U1AA 5KLVD 4OVNF 3G3ZA 1M1JC 1SQXE 3D71A 2ZFCA 3OW2O 2LKMA 1SQXK 2H8PD 3P32A 1NTKE 2QJPB 5CMZA 2NRGA 5CCGC 2WPRA 1NTKK 1S2EA 3L71J 1GU4A 1OZHA 1U7MA 1SQXJ 3ABVC 1JMMA 1BCCD 1W2BO 1NTKJ 1FE6A 1CW5A 2ZT9C 2HODA 3L72D 2NPSA 1RF1C 3AE5C 4W7ZA 2B87B 1J1EC 3W68A 1FOSF 2KZJA 2N1TB 3H1LD 4QMAA 5AVZB 4BWNA 3L75D 3P8CD 2YO2A 1KILC 2QM8A 2OYIA 3QWOC 2Y0EA 2ZYDA 3USSA 3CLQA 1JY2O 5KLIC 1DIPA 2JKVA 1LT1A 1D7MA 4JPZB 3M0AA 2E74C 4H44D 1JNMA 4Y28J 3MGNA 2BEZF 2AXTH 4D6TE 2B89A 2W27A 2BEQD 2M8RA 1YITP 3H1JE 4IFFA 1GL2B 4ZMDA 3HRNA 2P1JA 1PP9J 2HFED 3TYYA 4PJ0E 2YMKA 4D6TJ 2B9BA 3HTKA 3H1JJ 1PV3A 2Y0DA 4WBAA 3H1ID 4IOIH 4YPCA 4JYBA 3SWYA 1PPJE 1N8RQ 1M8OB 1DX7A 1J2JB 3LIEA 2ZAEB 2K9JA 1IJDB 1AFOA 1VQKP 2HG5D 2C9NY 1NYHA 1ZMEC 3FWLA 4U7JA 1LWUB 1KN7A 1NTZE 2G8YA 3MHVA 2KIKA 4MN4C 2E43A 1LTBC 2WT7A 2XZRA 5BU5A 3CX5D 1QL2A 1QX8A 2YKPA 3RGUA 4K35A 1KQLA 3G71P 4PD4I 1MZ9A 4AUWA 2V7QH 3MUDC 5APSA 1BE3E 1J1DB 4I7ZC 1H88A 5APTA 1T8ZA 4PD4D 2OTLP 1X79B 1EXIA 4H44C 5KLVE 3OJAB 1LTTC 2WSCJ 3GG2A 5KLVK 1BE3J 1VPCA 4A7PA 1X0TA 3IAOA 2OYHC 1VQNP 4KJMA 3AE9C 5KLVJ 1YHQP 5AVVB 2OTKE 1MFZA 2PRRA 2WSEJ 2WSSH 1YJ9P 3H32B 1BCCE 1URQB 4PV1D 1NAYA 2Q1KA 3L72E 1VQ4P 3A3YB 2QEXP 3H1LE 3SWKA 3L75E 1HJ0A 3P8CE 1BCCJ 1G1JA 2IBZI 3L72J 3R2PA 1CI6A 3CXHH 2KS1A 3PLNA 3H1LJ 1CSBA 2C0WA 2KLVA 3L75J 4DCKA 1VL2A 3WMM0 1GU5A 2KSJA 1K05A 3CI9A 3PJSK 3A0BH 1EZVG 1VF5D 1RQUA 1LTIC 1VQLP 4YXDC 1SQVG 1GD2E 2M0BA 3B5ND 2H7HA 4I2LC 1IFIA 4RESB 2ZYAA 3H1IE 2YXQB 3CL3D 1HTLC 1VQ6P 2QVAA 2B87A 4LLHA 1M1JB 3HD7D 1KZUB 1VQ8P 3LW5J 4HYTB 3H1IJ 4RJTA 3FXEA 3KYQA 2Y9YA 3C8VA 3I55P 5BVZA 3V2QA 4CPGA 1YQ3C 3TK1A 3Q1MA 1IFPA 1JB0J 1L4AD 4HJGH 1Q82Q 1QGKB 2ZT9B 1SQQK 4I6MC 3C1LA 3CX5E 1DH3A 1J1EB 2A06G 3L74G 1SQQJ 3V2RA 1KILB 1GL2A 1FC2C 1JY3P 1QEXA 4OWFA 5AVXB 4WY4D 1GDTA 1M56D 3V6IA 4PD4E 5AW0B 2E74B 1ZR2A 1SQBG 4AQRD 3M0DC 3P7KA 1S4XA 5AW1B 1VQMP 3NXSA 3ZDMA 3V4WA 2PGDA 4JF7A 2O01N 1VF5C 2E75B 4LGDE 3L73G 1H89A 2KI7B 2JDIH 1N73C 2ZXEB 3B5NC 3FXDA 3VP8A 1Y9BA 4NPEA 1NKZB 4C7NB 2ZYGA 4OGQD 1Q86Q 2W8ZA 3M9BA 1YYCA 3CMAP 5CCHA 3CCUP 1LJ2A 1PGOA 2WT7B 2P7JA 1RF0A 1PP9D 4YXWH 2HLOA 1YTZT 2IFMA 2XNXA 3WU2H 3VMAA 3BCCG 2KB7P 5APUA 1HGVA 4TT3H 2W6AA 1G2CB 2NPSD 5APQA 3EQ2A 5KAIH 3S9OA 1JCCA 3GHGC 3SFDC 3H32A 2O01J 1M90Q 4W80A 4I7ZB 2PFXA 1NTKG 5AW2B 1VDFA 5B5EH 3PTZA 3O8ZA 4U3FD 1S5LH 2R3SA 2E76D 1OWAA 3IN6A 3L37A 1Q81Q 1FJKA 5KAFH 2GUVA 1VQ9P 3I56P 3A7OA 1DEBA 2AXCA 1QLED 5K5GB 1E5WA 2DW3A 1N7SC 5AVYB 1DD4A 1SFCB 4IFMA 1ZRTD 2BCCG 2FYUD 2KK7A 4R4MA 1XTGB 1LTGC 2ITAA 4H0LD 1ZLLA 4ZNCA 1AQ5A 1K9MQ 1OVRA 5B66H 1NU1K 3GMAA 4Y99B 4D6TG 4N3YB 2IFNA 3M9QA 3KPEA 3RK3B 2K37A 3RL0D 1JY2N 5AVRB 1NU1J 1PZQA 1M1JA 3AE6C 1EC5A 3F89A 3D70A 5CCGA 1PPJG 5APWA 3CXHI 1HVVA 1KB9H 1XTCC 1OVUA 3RK2B 4O9BA 2W6BA 3M91A 1KTMA 3CXHD 2M3EA 2E76C 2JO1A 4KT0J 2IX7C 2XKMA 3NFQA 1KFMA 1KILA 1NTZG 1PP9E 3WUVA 1S72P 1SS1A 2D2CD 4C46A 2JR8A 1AQTA 1IFNA 1VQ7P 1N86A 3TGUJ 5AW6B 2AXTE 2QIWA 2KUBA 5GTIH 1U7JA 3H25A 1FZAA 1BGYD 4Z1MH 1KQFB 2W83C 1BE3G 2SPZA 4H0LC 2E5YA 1NOHA 2WMMA 3F5HA 1G1IA 1KFNA 2WWWA 2FY8A 3NMDA 1LTJC 1PL5A 3MTUE 1FZCC 1CZQA 1IFMA 4C7NA 4C7RA 3RL0C 3AEEC 2A45G 3IR9A 3CX5I 1S9KD 1FDIA 4U3FE 5APVA 1NTMD 2HR3A 1K8AQ 1SQQD 5BU8B 2C9LY 4EIJA 3VYIA 1USEA 2YNYA 5TISH 4RKUJ 1RE4C 2WTYA 4U3FJ 2PAJA 1EZVI 1KYOH 3H1LG 5CBOA 4RO0A 3V4QA 1N73B 3AE8C 3L75G 3EWKA 1GK6A 1ZRTE 2JWDA 1MV8A 5AVTB 3L35A 2RH0A 1EZVD 2L91A 2FYUE 1GW3A 3L4FA 4L73A 1G2CA 2FYUK 3H1KG 1IK7A 2WPVB 4DZOA 2N1TD 1SQVD 2N9YB 3AE7C 1FDOA 1NH4A 2FYUJ 3BASA 3MZWB 3MUDA 2V7QJ 4XFJA 3GLMA 1JO5A 1FU1A 1IK9A 1K73Q 2A45H 5AW7B 4AYCA 3VN0A 1AA0A 1RE3C 1QVGO 3FX0A 3JC22 2FYNC 2OYHA 5APXA 3GHGB 2AEFA 1GL2D 3RBXA 2Y0CA 5H2FH 2YIUB 1YIJP 1JOCA 2Q3EA 4DT0A 4GOFA 1SFCA 3L74D 5GTHH 2W6JH 5AVQB 1L0NG 3SFEC 3CXHE 2Z4EA 5M1BA 4UB8H 1OW7A 3HUSC 1JY3O 4ZKUA 1Q2NA 1USDA 2N9BA 3RBZA 4XE5B 1NVOA 3CD6P 4OH8B 2GM4A 1SQBD 2MKVA 2KNCB 3BRTB 2Q3IA 1N7SB 2IZ1A 2QRXA 1P84H 2R44A 3A0BE 2RMZA 3VTPC 2FFDC 3L36A 1KD1Q 3VOPA 1BGYE 1BDDA 4LC1A 3L73D 3H1HG 4H13B 1WMKA 2N1TC 2P10A 2IYOA 4DOJA 5CCHD 2FXMA 2P58A 1BGYJ 3PHLA 1IC2A 5KJ7D 3D6ZA 1FJPA 1S9KE 1AJYA 3FWNA 5KKZC 1NTME 1YI2P 4PV1C 5DJUB 2H88C 1SQQE 1NTMK 3V2PA 1VQ5P 4JYCA 2ZXXA 1KQGB 3KQGA 1RF1B 1T2KD 3CC7P 1HF9A 1HBWA 1X22A 1VQPP 1NTMJ 2OQQA 5AVSB 1DEEG 1E79H 3BCCD 1LT9C 3AEFC 4GOEA 3AEDC 3GF7A 2QE7H 1JTHB 3NTNA 1NU1D 1URQD 1EZVE 1NAFA 5KLIB 4ASWA 3CWBG 2H89C 5E79H 3W67A 2WVRA 3G6EP 2IBZG 5AVWB 3L70G 1SQVE 1SQPG 4HB1A 2K88A 1SQVK 1LTAC 1YBKA 3FGAD 1OX3A 1A02J 2LR2A 3KZIH 1SQVJ 3S4RA 4UB6H 1EDIA 4HKZH 2WITA 1LWUC 1IZNB 2WSFH 3M0DA 1KB9I 1GK4A 1MKMA 1NO4A 1BDCA 2KLUA 1QVFO 3AE1C 1HUCA 1L0LG 3G9RA 3HD7C 3TGUD 5KJ7C 1KB9D 1LTJB 1N73A 3E1IA 4L76A 3B5NA 1FZCB 2BCCD 5L8RJ 1EXJA 2AEMA 4I1LA 3L74E 3WUTA 2J59M 3II6A 4EDFA 1L4AC 1FDMA 1SLQA 2O3JA 1S5LX 1NJIQ 3L74J 1NHLA 3LIDA 2GUSA 5CHXA 3AE4C 4N6JA 3WU2E 1M7LA 1NWQA 1SQBE 2B88A 2KYVA 2JP3A 1SQBK 3A5TA 2O1JA 2QJKC 5KAIE 3L71G 3C9IA 1URQC 1FOSE 4WY4C 1FZGA 2H43A 1JMBA 3L73E 1SQXG 3VP9A 3M06A 1SQBJ 2ZT9D 3UIAA 2R3CA 4H44B 2O1KA 3GHGA 1OW8A 3L73J 1YJWP 1KILD 5B5EE 2WPQA 2OYHB 1RH5B 1S5LE 4EI2A 4KHXA 1KYOI 4TLFA 2M3BA 2IZ0A 1WRGA 5KAFE 1RQVA 2QM7A 2OGUA 2IYPA 4EYYQ 4OGQC 2E74D 1Q7YQ 1KYOD 4IL6H 3KDPB 3GW6A 4WB4A 1LTSC 3CPWO 2JEEA 4GT1A 5AVUB 2E75D 3JCUH 3BCCE 2KNCA 3A0HH 1NU1E 2AEJA 1N7SA 1UIIA 2FXPA 1PP9G 2PP6A 3P8MC 1AV1A 3BCCJ 2A45I 2J5UA 3H1JG 5B66E 1T3UA 5APYA 3HUSB 4L74A 2NPSC 3SWFA 3HE5B 2HPCB 2M5AB 4NPDA 1FS0E 3O6QB 3VMZA 3CCVP 3Q5PA 1Y47A 1BSNA 2OYIC 1ZV8A 1IFDA 2CPSA 4HH2A 5C39A 2FFDB 1GTWA 3EFFK 1JCDA 2Z5IA 2RN0A 3U1CA 2XDJA 3WUUA 1JM0A 1AVYA 1WT6A 2C0XA 3N4XA 3QH9A 1RF1A 1K04A 3S1KA 3TGUE 1KQSO 1PIXA 4XA4A 1W2EA 1KB9E 3JSVC 1NGMB 2R32A 4U3FG 1UIXA 1BSHA 1EDJA 1H0TB 1AVOA 2BCCE 2KXPB 1SVFA 2YXRB 4BRYB 1JTHA 2WQYC 1S1CX 2E42A 3H1KD 3I5CA 3K5BA 5KKZB 3CCQP 1LP1B 1HJBA 3CC2P 4L75A 4PV1B 1P84I 1OIPA 2FKWB 2YO3A 2QJYC 2BCCJ 2OTJP 4GIFA 1LNQA 1Q90D 5GTIE 2KOGA 5TJHA 3CCSP 2QG4A 1YTZI 2E75C 4GKGA 1P84D 4PJ0H 1VQOP 2I1KA 2FYUG 5AW5B 1JEKA 1LT9B 3AEGC 3CCRP 2JWAA 2I8DA 4EOTA 5KLVG 1TU3F 5CJ0A 1SFCD 4N78D 4IFDK 1ZOYC 1ZW0A 3B71A 3TDKA 2G3AA 1KILE 3MD0A 1BCCG 3KHUA 1VF5B 1LTJA 1L0ND 1FZCA 3Q5RA 1DD3A 4WWIA 3L72G 1M57D 5TISE 3RL0g 3TSIA 3B5NB 1M1KQ 1X9VA 3RK3D 1NTZK 2JJLA 1KYOE 1R8EA 2FBWC 1JY2P 2FXOA 5AW9B 1OMIA 1L2PA 2OYOA 1RE4A 1NTZJ 2WSCH 3HD7B 3OAKA 1FZFA 1OW6A 3HE4A 1Z56A 2D2CC 2NZ2A 3CC4P 3H1HD 2V4HA 1ZR4A 1OFCX 1IFJA 2BASA 1T3JA 2WSEH 2ZJSE 3B8EB 1L4AB 3T97B 3E7KA 3AE2C 3TNUB 3RK2D 3PH0A 4JBZA 1PGPA 4GODA 1HH0A 4ASVA 2OARA 3VMYA 1OXZA 1MFTA 2GA1A 1JY3N 2Q6QA 1BGYG 3BRVB 3H1IG 1U57A 2P2UA 1PGJA 2QJKB 1YQ4C 1KC8Q 4WY4B 1SFCC 2KZIA 2Y9ZA 2A06D 5H2FE 2YKOA 1RE3A 1S3JA 1GZLA 1NTMG 2ZVOB 5GTHE 3M9HA 4YTPC 1SQQG 4UB8E 3N7NA 3VMXA 1GMJA 3CWBD 3H1KE 3EFGA 4DJGA 2QJPC 3PRJA 4Y99C 2IBZD 3L70D 3RK3C 1SQPD 2POHA 4OGQB 3CMEP 2P67A 2K3RA 3HUSA 1SP4A 2XV5A 3H1KJ 3CCMP 2CK3H 1P84E 5AW8B 2LXBA 3HE5A 2HPCA 2M5AA 3O6QA 3B4SA 2LXCB 3LW5H 2IDBA 2FFDA 3GF3A 4N78E 1KMIZ 3RK2C 1L0LD 4K3AA 4BXLA 2K1AA 5EFWB 2N1TA 3ITKA 2E5TA 2HODB 4ZKPA 2NPSB 1JUNA 1L0NE 1H0TA 2CPBA 2ZVNB 1L0NK 1GL2C 3BVHA 5DJTB 4WVZA 2YMYA 4BRYA 3CX5H 2OYIB 3RK3E 1X8YA 1T6AA 1LP1A 1PGQA 1L0NJ 2I1JA 4GDOA 1EDKA 3CCLP 1EQ7A 2QA4P 2E76B 3SSUA 2R5DA 3L71D 1ZN5A 5E79E 4PD4H 2L5GB 1SQXD 1LT9A 3AE3C 3H1HE 3G4SP 1W5CE 2UWJE 1NTKD 3AEBC 2YKQA 2MJZA 2QJYB 3HTKB 3TF5A 1Y8AA 2Q9IA 3H1HJ 3A2AA 3KZIE 1KORA 3MP7B 2Q7CA 3Q2YA 4R4LA 2XU6A 4UB6E 3BATA 2HYNA 5CCHC 4H0LB 3AEAC 1FZEA 1R5SA 4B86A 2K9JB 2WZ7A 3R4YA 1RF0C 1NKNA
chains in the Genus database with same CATH topology
5BU8B 3U59A 4EIJA 2C9LY 1MUUA 2Z5HA 1LWUA 2A45I 3VYIA 2YNYA 1N7SD 1T3UA 1FAVA 5APYA 3HUSB 1LTIC 1RE4C 3RL0B 1J1DC 2WTYA 2IPPA 2PAJA 5AW4B 2NPSC 1GD2E 3SWFA 3B5ND 2H7HA 4I2LC 3V4QA 1N73B 1IFIA 4RESB 1LGHB 2J58A 3HE5B 3PP5A 2HPCB 3CL3D 1GK6A 3HD7A 1HTLC 5KJ7A 3VMZA 1T2KC 1MV8A 5AVTB 3L35A 2OYIC 4LLHA 1ZV8A 1IFDA 2CPSA 4HH2A 1M1JB 2FFDB 3HD7D 1KZUB 1GW3A 1GTWA 3L4FA 1JCDA 1G2CA 2FYUK 3MIWA 4HYTB 2Z5IA 1HGZA 3HE4B 5CCGD 3U1CA 2XDJA 4DZOA 1L4AA 3KYQA 2N1TD 2O01H 1SQPK 1WT6A 3T97A 2C0XA 3N4XA 1IO4A 4M3LA 3TNUA 1RF1A 2WPSA 5BVZA 3V2QA 1NH4A 3BASA 3TK1A 4XA4A 1W2EA 1FZBA 1PFIA 1L4AD 3MUDA 2R32A 2FYZA 1JO5A 3IFMA 1SQQK 1FU1A 4I6MC 1IK9A 1HWTC 1SVFA 2A45H 1DH3A 5AW7B 1J1EB 2Q5UA 1JTHA 2E42A 4AYCA 1A02F 2KP8A 3I5CA 3VN0A 3V5BA 3V2NA 1HJBA 4W7YA 1URQA 3V2RA 1RE3C 4WY4A 1KILB 1GL2A 1H8AA 2FKWB 2YO3A 1JY3P 2OYHA 4GIFA 1N2DC 5APXA 2R5BA 3GHGB 1L0LK 2KOGA 5AVXB 4WY4D 1GL2D 1QL1A 1GDTA 1YTZI 4GKGA 1JOCA 5AW0B 2I1KA 5KTBA 5AW5B 1ZR2A 1SFCA 1LT9B 4AQRD 3OA7A 3M0DC 3P7KA 4EOTA 5AW1B 5AVQB 2Z4EA 5CJ0A 1GW4A 3NXSA 3V4WA 5CJ4A 2VRSA 5AW3B 1CI6B 1SFCD 4JF7A 3HUSC 1JY3O 4ZKUA 4N78D 4LGDE 1N7LA 1H89A 3H6PA 2N9BA 4IFDK 1FBMA 4XE5B 1N73C 2ZXEB 3B5NC 3VP8A 3MD0A 4OH8B 1NKZB 2GM4A 4C7NB 3BRTB 2Q3IA 1RY3A 3U1AA 1N7SB 1LTJA 3G3ZA 1FZCA 1M1JC 3M9BA 1YYCA 3VTPC 2FFDC 3L36A 2ZFCA 3VOPA 2LKMA 3TSIA 1SQXK 2H8PD 3P32A 5CCHA 4LC1A 3B5NB 5CMZA 2WT7B 1X9VA 5CCGC 3RK3D 2WPRA 1NTKK 1GU4A 2P7JA 1NTZK 1RF0A 2JJLA 2N1TC 4DOJA 5CCHD 2FXMA 1JY2P 1JMMA 2HLOA 5AW9B 1YTZT 1IC2A 2IFMA 2XNXA 5KJ7D 1RE4A 1CW5A 2WSCH 3HD7B 3OAKA 1FZFA 2HODA 1FJPA 2NPSA 1RF1C 4W7ZA 1S9KE 3HE4A 1J1EC 1Z56A 2KB7P 5APUA 1FOSF 2N1TB 1HGVA 5AVZB 2W6AA 3P8CD 1G2CB 2NPSD 2YO2A 5APQA 1ZR4A 1IFJA 1KILC 1NTMK 2BASA 3EQ2A 3V2PA 1T3JA 2QM8A 2WSEH 2OYIA 3B8EB 1L4AB 1JCCA 4JYCA 3GHGC 3KQGA 3CLQA 3TNUB 3RK2D 1RF1B 1JY2O 1T2KD 1HBWA 1HH0A 2OARA 3VMYA 3H32A 5AVSB 3M0AA 1OXZA 4W80A 1JY3N 1LT9C 1JNMA 3MGNA 3BRVB 5AW2B 1JTHB 1VDFA 3NTNA 2P2UA 1URQD 2W27A 1NAFA 2M8RA 3O8ZA 4IFFA 4WY4B 1GL2B 1SFCC 1OWAA 3HRNA 2P1JA 5AVWB 3L37A 1FJKA 2GUVA 2HFED 2YKOA 3TYYA 1RE3A 1SQVK 3A7OA 1LTAC 3HTKA 1DEBA 1GZLA 1A02J 1E5WA 4WBAA 1N7SC 3M9HA 5AVYB 1SFCB 4IFMA 4JYBA 3SWYA 3N7NA 3VMXA 1DX7A 1J2JB 2WITA 1LWUC 3LIEA 3EFGA 4Y99C 2WSFH 1IJDB 3M0DA 1XTGB 3RK3C 1AFOA 1LTGC 2POHA 1GK4A 1NO4A 2HG5D 2C9NY 1ZLLA 2P67A 3HUSA 1AQ5A 1SP4A 2XV5A 1HUCA 3HD7C 5KJ7C 1LWUB 1NU1K 4Y99B 5AW8B 4N3YB 2E43A 2IFNA 1LTJB 1N73A 3M9QA 3E1IA 3KPEA 1LTBC 3B5NA 3RK3B 1FZCB 3HE5A 2WT7A 2HPCA 3RL0D 2XZRA 5BU5A 1JY2N 1QL2A 4I1LA 5AVRB 2YKPA 3LW5H 2J59M 3II6A 1KQLA 1L4AC 1M1JA 2FFDA 1FDMA 4N78E 1SLQA 1MZ9A 3RK2C 4AUWA 5CCGA 5APSA 1NHLA 3LIDA 2GUSA 5CHXA 2N1TA 4N6JA 1J1DB 5APWA 1H88A 5APTA 1T8ZA 1M7LA 1NWQA 2HODB 4ZKPA 2NPSB 1X79B 2KYVA 1JUNA 3OJAB 1SQBK 1LTTC 3A5TA 1HVVA 2O1JA 1XTCC 2CPBA 5KLVK 3RK2B 3C9IA 1URQC 1L0NK 4O9BA 2W6BA 4WY4C 1FOSE 1GL2C 1VPCA 3BVHA 2YMYA 3M91A 1FZGA 2OYIB 2H43A 3VP9A 2OYHC 3M06A 1X8YA 3UIAA 2IX7C 2XKMA 2R3CA 3NFQA 1KFMA 1KILA 2I1JA 5AVVB 1MFZA 3H32B 4C46A 2O1KA 1IFNA 3GHGA 1URQB 1N86A 5AW6B 1KILD 1EQ7A 2WPQA 2OYHB 3A3YB 2R5DA 1ZN5A 1FZAA 4KHXA 2M3BA 2L5GB 1LT9A 1WRGA 3P8CE 2QM7A 1G1JA 2YKQA 3R2PA 1CI6A 1NOHA 2MJZA 1CSBA 3HTKB 1G1IA 2C0WA 3KDPB 2KLVA 2Q9IA 4WB4A 3A2AA 1KFNA 2WWWA 1LTSC 3NMDA 2Q7CA 3WMM0 2JEEA 2XU6A 1LTJC 4GT1A 5AVUB 1GU5A 3BATA 3MTUE 1FZCC 2HYNA 1CZQA 1IFMA 4C7NA 4C7RA 3RL0C 2A45G 5CCHC 3IR9A 1S9KD 2KSJA 1N7SA 1FZEA 3CI9A 4B86A 2WZ7A 5APVA 1RF0C 2PP6A 1NKNA 3P8MC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0A A;  1OXZ A;  2C9L Y;  5APS A;  1MUU A;  2Z5H A;  3P7K A;  3VYI A;  4EOT A;  2YNY A;  3LID A;  5AW1 B;  5AVQ B;  1JNM A;  3MGN A;  1FAV A;  5APY A;  5APW A;  5AW2 B;  3NXS A;  5APT A;  1H88 A;  3V4W A;  1NWQ A;  2VRS A;  5AW3 B;  1CI6 B;  3NTN A;  2P2U A;  2WTY A;  1JUN A;  2IPP A;  1NAF A;  2W27 A;  3O8Z A;  5AW4 B;  1GD2 E;  3SWF A;  3A5T A;  1H89 A;  2N9B A;  2H7H A;  4I2L C;  3V4Q A;  4RES B;  1OWA A;  3HE5 B;  4XE5 B;  1FOS E;  1GK6 A;  5AVW B;  3L37 A;  2ZXE B;  3VMZ A;  3M91 A;  1T2K C;  3MD0 A;  1MV8 A;  3M06 A;  5AVT B;  3L35 A;  1X8Y A;  3TYY A;  3UIA A;  4C7N B;  2Q3I A;  3A7O A;  2R3C A;  3HTK A;  3NFQ A;  1GZL A;  5AVV B;  1A02 J;  1MFZ A;  1GTW A;  3M9B A;  1YYC A;  3VTP C;  4HYT B;  2Z5I A;  3HE4 B;  3L36 A;  2ZFC A;  3M9H A;  5AVY B;  4C46 A;  4DZO A;  3P32 A;  3T97 A;  4JYB A;  5AW6 B;  4LC1 A;  3VMX A;  5CMZ A;  2WPQ A;  2WT7 B;  1IO4 A;  4M3L A;  3TNU A;  1J2J B;  2WPR A;  2WPS A;  3LIE A;  3A3Y B;  1GU4 A;  2P7J A;  2R5D A;  2JJL A;  3TK1 A;  4KHX A;  3M0D A;  2R32 A;  1GK4 A;  5AW9 B;  4I6M C;  2C9N Y;  2QM7 A;  1HWT C;  2P67 A;  3OAK A;  1DH3 A;  5AW7 B;  1SP4 A;  2XV5 A;  2Q5U A;  1HUC A;  4AYC A;  1A02 F;  2E42 A;  1CI6 A;  2KP8 A;  3I5C A;  3VN0 A;  3V5B A;  1S9K E;  3HE4 A;  1HJB A;  5APU A;  1FOS F;  5AW8 B;  2E43 A;  1CSB A;  1H8A A;  3KDP B;  5AVZ B;  2YO3 A;  3A2A A;  2W6A A;  3HE5 A;  2WWW A;  1G2C B;  2XZR A;  2WT7 A;  3NMD A;  2YO2 A;  5APQ A;  5APX A;  2BAS A;  2R5B A;  2XU6 A;  2Q7C A;  4GT1 A;  5AVU B;  1GU5 A;  2QM8 A;  5AVR B;  3B8E B;  5AVX B;  4JYC A;  1CZQ A;  4C7N A;  3KQG A;  1KQL A;  3TNU B;  3IR9 A;  1S9K D;  1T2K D;  4GKG A;  1HBW A;  4B86 A;  1SLQ A;  5AW0 B;  5APV A;  3VMY A;  5AW5 B;  5AVS B;  4AUW A;  4AQR D;  3P8M C; 
#chains in the Genus database with same CATH topology
 3U59 A;  1MUU A;  2Z5H A;  1LWU A;  1N7S D;  2A06 E;  1FAV A;  2WSF J;  3RL0 B;  3IF4 A;  1J1D C;  1OVV A;  2IPP A;  5AW4 B;  2KSE A;  3CCE P;  1ZP0 C;  4H13 D;  1KV4 A;  1LGH B;  2J58 A;  3PP5 A;  3HD7 A;  5KJ7 A;  1T2K C;  3CWB E;  4NPF X;  1ZXG A;  4D6T D;  1YJN P;  2IBZ E;  3L70 E;  3H1J D;  2K9Y A;  3MIW A;  1SQP E;  5CCG D;  3HE4 B;  1HGZ A;  1L4A A;  3T97 A;  2O01 H;  1SQP K;  3CWB J;  1IO4 A;  4M3L A;  3TNU A;  2WPS A;  3Q5S A;  4JQ0 D;  3Q3D A;  1FZB A;  3L70 J;  1PFI A;  1NU1 G;  4IL6 X;  1SQP J;  2FYZ A;  3IFM A;  2W90 A;  1HWT C;  1PPJ D;  1R5L A;  2RKL A;  2Q5U A;  1A02 F;  2D2C B;  2YIU C;  2KP8 A;  3V5B A;  3V2N A;  4W7Y A;  1URQ A;  4WY4 A;  1H8A A;  1L0L E;  1N2D C;  2R5B A;  1L0L K;  1QL1 A;  2QSI A;  1NTZ D;  3E1R A;  3CCJ P;  5KTB A;  1L0L J;  1EDL A;  3OA7 A;  5CBN A;  2FYN B;  3KXD A;  1GW4 A;  5CJ4 A;  4IL6 E;  2VRS A;  5AW3 B;  1CI6 B;  3AEC C;  1RHZ B;  2KS1 B;  3TGU G;  1N7L A;  3H6P A;  3D6Y A;  3JCU E;  1FBM A;  1BE3 D;  3A0H E;  4H13 C;  2XND H;  3L71 E;  1RY3 A;  3U1A A;  5KLV D;  4OVN F;  3G3Z A;  1M1J C;  1SQX E;  3D71 A;  2ZFC A;  3OW2 O;  2LKM A;  1SQX K;  2H8P D;  3P32 A;  1NTK E;  2QJP B;  5CMZ A;  2NRG A;  5CCG C;  2WPR A;  1NTK K;  1S2E A;  3L71 J;  1GU4 A;  1OZH A;  1U7M A;  1SQX J;  3ABV C;  1JMM A;  1BCC D;  1W2B O;  1NTK J;  1FE6 A;  1CW5 A;  2ZT9 C;  2HOD A;  3L72 D;  2NPS A;  1RF1 C;  3AE5 C;  4W7Z A;  2B87 B;  1J1E C;  3W68 A;  1FOS F;  2KZJ A;  2N1T B;  3H1L D;  4QMA A;  5AVZ B;  4BWN A;  3L75 D;  3P8C D;  2YO2 A;  1KIL C;  2QM8 A;  2OYI A;  3QWO C;  2Y0E A;  2ZYD A;  3USS A;  3CLQ A;  1JY2 O;  5KLI C;  1DIP A;  2JKV A;  1LT1 A;  1D7M A;  4JPZ B;  3M0A A;  2E74 C;  4H44 D;  1JNM A;  4Y28 J;  3MGN A;  2BEZ F;  2AXT H;  4D6T E;  2B89 A;  2W27 A;  2BEQ D;  2M8R A;  1YIT P;  3H1J E;  4IFF A;  1GL2 B;  4ZMD A;  3HRN A;  2P1J A;  1PP9 J;  2HFE D;  3TYY A;  4PJ0 E;  2YMK A;  4D6T J;  2B9B A;  3HTK A;  3H1J J;  1PV3 A;  2Y0D A;  4WBA A;  3H1I D;  4IOI H;  4YPC A;  4JYB A;  3SWY A;  1PPJ E;  1N8R Q;  1M8O B;  1DX7 A;  1J2J B;  3LIE A;  2ZAE B;  2K9J A;  1IJD B;  1AFO A;  1VQK P;  2HG5 D;  2C9N Y;  1NYH A;  1ZME C;  3FWL A;  4U7J A;  1LWU B;  1KN7 A;  1NTZ E;  2G8Y A;  3MHV A;  2KIK A;  4MN4 C;  2E43 A;  1LTB C;  2WT7 A;  2XZR A;  5BU5 A;  3CX5 D;  1QL2 A;  1QX8 A;  2YKP A;  3RGU A;  4K35 A;  1KQL A;  3G71 P;  4PD4 I;  1MZ9 A;  4AUW A;  2V7Q H;  3MUD C;  5APS A;  1BE3 E;  1J1D B;  4I7Z C;  1H88 A;  5APT A;  1T8Z A;  4PD4 D;  2OTL P;  1X79 B;  1EXI A;  4H44 C;  5KLV E;  3OJA B;  1LTT C;  2WSC J;  3GG2 A;  5KLV K;  1BE3 J;  1VPC A;  4A7P A;  1X0T A;  3IAO A;  2OYH C;  1VQN P;  4KJM A;  3AE9 C;  5KLV J;  1YHQ P;  5AVV B;  2OTK E;  1MFZ A;  2PRR A;  2WSE J;  2WSS H;  1YJ9 P;  3H32 B;  1BCC E;  1URQ B;  4PV1 D;  1NAY A;  2Q1K A;  3L72 E;  1VQ4 P;  3A3Y B;  2QEX P;  3H1L E;  3SWK A;  3L75 E;  1HJ0 A;  3P8C E;  1BCC J;  1G1J A;  2IBZ I;  3L72 J;  3R2P A;  1CI6 A;  3CXH H;  2KS1 A;  3PLN A;  3H1L J;  1CSB A;  2C0W A;  2KLV A;  3L75 J;  4DCK A;  1VL2 A;  3WMM 0;  1GU5 A;  2KSJ A;  1K05 A;  3CI9 A;  3PJS K;  3A0B H;  1EZV G;  1VF5 D;  1RQU A;  1LTI C;  1VQL P;  4YXD C;  1SQV G;  1GD2 E;  2M0B A;  3B5N D;  2H7H A;  4I2L C;  1IFI A;  4RES B;  2ZYA A;  3H1I E;  2YXQ B;  3CL3 D;  1HTL C;  1VQ6 P;  2QVA A;  2B87 A;  4LLH A;  1M1J B;  3HD7 D;  1KZU B;  1VQ8 P;  3LW5 J;  4HYT B;  3H1I J;  4RJT A;  3FXE A;  3KYQ A;  2Y9Y A;  3C8V A;  3I55 P;  5BVZ A;  3V2Q A;  4CPG A;  1YQ3 C;  3TK1 A;  3Q1M A;  1IFP A;  1JB0 J;  1L4A D;  4HJG H;  1Q82 Q;  1QGK B;  2ZT9 B;  1SQQ K;  4I6M C;  3C1L A;  3CX5 E;  1DH3 A;  1J1E B;  2A06 G;  3L74 G;  1SQQ J;  3V2R A;  1KIL B;  1GL2 A;  1FC2 C;  1JY3 P;  1QEX A;  4OWF A;  5AVX B;  4WY4 D;  1GDT A;  1M56 D;  3V6I A;  4PD4 E;  5AW0 B;  2E74 B;  1ZR2 A;  1SQB G;  4AQR D;  3M0D C;  3P7K A;  1S4X A;  5AW1 B;  1VQM P;  3NXS A;  3ZDM A;  3V4W A;  2PGD A;  4JF7 A;  2O01 N;  1VF5 C;  2E75 B;  4LGD E;  3L73 G;  1H89 A;  2KI7 B;  2JDI H;  1N73 C;  2ZXE B;  3B5N C;  3FXD A;  3VP8 A;  1Y9B A;  4NPE A;  1NKZ B;  4C7N B;  2ZYG A;  4OGQ D;  1Q86 Q;  2W8Z A;  3M9B A;  1YYC A;  3CMA P;  5CCH A;  3CCU P;  1LJ2 A;  1PGO A;  2WT7 B;  2P7J A;  1RF0 A;  1PP9 D;  4YXW H;  2HLO A;  1YTZ T;  2IFM A;  2XNX A;  3WU2 H;  3VMA A;  3BCC G;  2KB7 P;  5APU A;  1HGV A;  4TT3 H;  2W6A A;  1G2C B;  2NPS D;  5APQ A;  3EQ2 A;  5KAI H;  3S9O A;  1JCC A;  3GHG C;  3SFD C;  3H32 A;  2O01 J;  1M90 Q;  4W80 A;  4I7Z B;  2PFX A;  1NTK G;  5AW2 B;  1VDF A;  5B5E H;  3PTZ A;  3O8Z A;  4U3F D;  1S5L H;  2R3S A;  2E76 D;  1OWA A;  3IN6 A;  3L37 A;  1Q81 Q;  1FJK A;  5KAF H;  2GUV A;  1VQ9 P;  3I56 P;  3A7O A;  1DEB A;  2AXC A;  1QLE D;  5K5G B;  1E5W A;  2DW3 A;  1N7S C;  5AVY B;  1DD4 A;  1SFC B;  4IFM A;  1ZRT D;  2BCC G;  2FYU D;  2KK7 A;  4R4M A;  1XTG B;  1LTG C;  2ITA A;  4H0L D;  1ZLL A;  4ZNC A;  1AQ5 A;  1K9M Q;  1OVR A;  5B66 H;  1NU1 K;  3GMA A;  4Y99 B;  4D6T G;  4N3Y B;  2IFN A;  3M9Q A;  3KPE A;  3RK3 B;  2K37 A;  3RL0 D;  1JY2 N;  5AVR B;  1NU1 J;  1PZQ A;  1M1J A;  3AE6 C;  1EC5 A;  3F89 A;  3D70 A;  5CCG A;  1PPJ G;  5APW A;  3CXH I;  1HVV A;  1KB9 H;  1XTC C;  1OVU A;  3RK2 B;  4O9B A;  2W6B A;  3M91 A;  1KTM A;  3CXH D;  2M3E A;  2E76 C;  2JO1 A;  4KT0 J;  2IX7 C;  2XKM A;  3NFQ A;  1KFM A;  1KIL A;  1NTZ G;  1PP9 E;  3WUV A;  1S72 P;  1SS1 A;  2D2C D;  4C46 A;  2JR8 A;  1AQT A;  1IFN A;  1VQ7 P;  1N86 A;  3TGU J;  5AW6 B;  2AXT E;  2QIW A;  2KUB A;  5GTI H;  1U7J A;  3H25 A;  1FZA A;  1BGY D;  4Z1M H;  1KQF B;  2W83 C;  1BE3 G;  2SPZ A;  4H0L C;  2E5Y A;  1NOH A;  2WMM A;  3F5H A;  1G1I A;  1KFN A;  2WWW A;  2FY8 A;  3NMD A;  1LTJ C;  1PL5 A;  3MTU E;  1FZC C;  1CZQ A;  1IFM A;  4C7N A;  4C7R A;  3RL0 C;  3AEE C;  2A45 G;  3IR9 A;  3CX5 I;  1S9K D;  1FDI A;  4U3F E;  5APV A;  1NTM D;  2HR3 A;  1K8A Q;  1SQQ D;  5BU8 B;  2C9L Y;  4EIJ A;  3VYI A;  1USE A;  2YNY A;  5TIS H;  4RKU J;  1RE4 C;  2WTY A;  4U3F J;  2PAJ A;  1EZV I;  1KYO H;  3H1L G;  5CBO A;  4RO0 A;  3V4Q A;  1N73 B;  3AE8 C;  3L75 G;  3EWK A;  1GK6 A;  1ZRT E;  2JWD A;  1MV8 A;  5AVT B;  3L35 A;  2RH0 A;  1EZV D;  2L91 A;  2FYU E;  1GW3 A;  3L4F A;  4L73 A;  1G2C A;  2FYU K;  3H1K G;  1IK7 A;  2WPV B;  4DZO A;  2N1T D;  1SQV D;  2N9Y B;  3AE7 C;  1FDO A;  1NH4 A;  2FYU J;  3BAS A;  3MZW B;  3MUD A;  2V7Q J;  4XFJ A;  3GLM A;  1JO5 A;  1FU1 A;  1IK9 A;  1K73 Q;  2A45 H;  5AW7 B;  4AYC A;  3VN0 A;  1AA0 A;  1RE3 C;  1QVG O;  3FX0 A;  3JC2 2;  2FYN C;  2OYH A;  5APX A;  3GHG B;  2AEF A;  1GL2 D;  3RBX A;  2Y0C A;  5H2F H;  2YIU B;  1YIJ P;  1JOC A;  2Q3E A;  4DT0 A;  4GOF A;  1SFC A;  3L74 D;  5GTH H;  2W6J H;  5AVQ B;  1L0N G;  3SFE C;  3CXH E;  2Z4E A;  5M1B A;  4UB8 H;  1OW7 A;  3HUS C;  1JY3 O;  4ZKU A;  1Q2N A;  1USD A;  2N9B A;  3RBZ A;  4XE5 B;  1NVO A;  3CD6 P;  4OH8 B;  2GM4 A;  1SQB D;  2MKV A;  2KNC B;  3BRT B;  2Q3I A;  1N7S B;  2IZ1 A;  2QRX A;  1P84 H;  2R44 A;  3A0B E;  2RMZ A;  3VTP C;  2FFD C;  3L36 A;  1KD1 Q;  3VOP A;  1BGY E;  1BDD A;  4LC1 A;  3L73 D;  3H1H G;  4H13 B;  1WMK A;  2N1T C;  2P10 A;  2IYO A;  4DOJ A;  5CCH D;  2FXM A;  2P58 A;  1BGY J;  3PHL A;  1IC2 A;  5KJ7 D;  3D6Z A;  1FJP A;  1S9K E;  1AJY A;  3FWN A;  5KKZ C;  1NTM E;  1YI2 P;  4PV1 C;  5DJU B;  2H88 C;  1SQQ E;  1NTM K;  3V2P A;  1VQ5 P;  4JYC A;  2ZXX A;  1KQG B;  3KQG A;  1RF1 B;  1T2K D;  3CC7 P;  1HF9 A;  1HBW A;  1X22 A;  1VQP P;  1NTM J;  2OQQ A;  5AVS B;  1DEE G;  1E79 H;  3BCC D;  1LT9 C;  3AEF C;  4GOE A;  3AED C;  3GF7 A;  2QE7 H;  1JTH B;  3NTN A;  1NU1 D;  1URQ D;  1EZV E;  1NAF A;  5KLI B;  4ASW A;  3CWB G;  2H89 C;  5E79 H;  3W67 A;  2WVR A;  3G6E P;  2IBZ G;  5AVW B;  3L70 G;  1SQV E;  1SQP G;  4HB1 A;  2K88 A;  1SQV K;  1LTA C;  1YBK A;  3FGA D;  1OX3 A;  1A02 J;  2LR2 A;  3KZI H;  1SQV J;  3S4R A;  4UB6 H;  1EDI A;  4HKZ H;  2WIT A;  1LWU C;  1IZN B;  2WSF H;  3M0D A;  1KB9 I;  1GK4 A;  1MKM A;  1NO4 A;  1BDC A;  2KLU A;  1QVF O;  3AE1 C;  1HUC A;  1L0L G;  3G9R A;  3HD7 C;  3TGU D;  5KJ7 C;  1KB9 D;  1LTJ B;  1N73 A;  3E1I A;  4L76 A;  3B5N A;  1FZC B;  2BCC D;  5L8R J;  1EXJ A;  2AEM A;  4I1L A;  3L74 E;  3WUT A;  2J59 M;  3II6 A;  4EDF A;  1L4A C;  1FDM A;  1SLQ A;  2O3J A;  1S5L X;  1NJI Q;  3L74 J;  1NHL A;  3LID A;  2GUS A;  5CHX A;  3AE4 C;  4N6J A;  3WU2 E;  1M7L A;  1NWQ A;  1SQB E;  2B88 A;  2KYV A;  2JP3 A;  1SQB K;  3A5T A;  2O1J A;  2QJK C;  5KAI E;  3L71 G;  3C9I A;  1URQ C;  1FOS E;  4WY4 C;  1FZG A;  2H43 A;  1JMB A;  3L73 E;  1SQX G;  3VP9 A;  3M06 A;  1SQB J;  2ZT9 D;  3UIA A;  2R3C A;  4H44 B;  2O1K A;  3GHG A;  1OW8 A;  3L73 J;  1YJW P;  1KIL D;  5B5E E;  2WPQ A;  2OYH B;  1RH5 B;  1S5L E;  4EI2 A;  4KHX A;  1KYO I;  4TLF A;  2M3B A;  2IZ0 A;  1WRG A;  5KAF E;  1RQV A;  2QM7 A;  2OGU A;  2IYP A;  4EYY Q;  4OGQ C;  2E74 D;  1Q7Y Q;  1KYO D;  4IL6 H;  3KDP B;  3GW6 A;  4WB4 A;  1LTS C;  3CPW O;  2JEE A;  4GT1 A;  5AVU B;  2E75 D;  3JCU H;  3BCC E;  2KNC A;  3A0H H;  1NU1 E;  2AEJ A;  1N7S A;  1UII A;  2FXP A;  1PP9 G;  2PP6 A;  3P8M C;  1AV1 A;  3BCC J;  2A45 I;  2J5U A;  3H1J G;  5B66 E;  1T3U A;  5APY A;  3HUS B;  4L74 A;  2NPS C;  3SWF A;  3HE5 B;  2HPC B;  2M5A B;  4NPD A;  1FS0 E;  3O6Q B;  3VMZ A;  3CCV P;  3Q5P A;  1Y47 A;  1BSN A;  2OYI C;  1ZV8 A;  1IFD A;  2CPS A;  4HH2 A;  5C39 A;  2FFD B;  1GTW A;  3EFF K;  1JCD A;  2Z5I A;  2RN0 A;  3U1C A;  2XDJ A;  3WUU A;  1JM0 A;  1AVY A;  1WT6 A;  2C0X A;  3N4X A;  3QH9 A;  1RF1 A;  1K04 A;  3S1K A;  3TGU E;  1KQS O;  1PIX A;  4XA4 A;  1W2E A;  1KB9 E;  3JSV C;  1NGM B;  2R32 A;  4U3F G;  1UIX A;  1BSH A;  1EDJ A;  1H0T B;  1AVO A;  2BCC E;  2KXP B;  1SVF A;  2YXR B;  4BRY B;  1JTH A;  2WQY C;  1S1C X;  2E42 A;  3H1K D;  3I5C A;  3K5B A;  5KKZ B;  3CCQ P;  1LP1 B;  1HJB A;  3CC2 P;  4L75 A;  4PV1 B;  1P84 I;  1OIP A;  2FKW B;  2YO3 A;  2QJY C;  2BCC J;  2OTJ P;  4GIF A;  1LNQ A;  1Q90 D;  5GTI E;  2KOG A;  5TJH A;  3CCS P;  2QG4 A;  1YTZ I;  2E75 C;  4GKG A;  1P84 D;  4PJ0 H;  1VQO P;  2I1K A;  2FYU G;  5AW5 B;  1JEK A;  1LT9 B;  3AEG C;  3CCR P;  2JWA A;  2I8D A;  4EOT A;  5KLV G;  1TU3 F;  5CJ0 A;  1SFC D;  4N78 D;  4IFD K;  1ZOY C;  1ZW0 A;  3B71 A;  3TDK A;  2G3A A;  1KIL E;  3MD0 A;  1BCC G;  3KHU A;  1VF5 B;  1LTJ A;  1L0N D;  1FZC A;  3Q5R A;  1DD3 A;  4WWI A;  3L72 G;  1M57 D;  5TIS E;  3RL0 g;  3TSI A;  3B5N B;  1M1K Q;  1X9V A;  3RK3 D;  1NTZ K;  2JJL A;  1KYO E;  1R8E A;  2FBW C;  1JY2 P;  2FXO A;  5AW9 B;  1OMI A;  1L2P A;  2OYO A;  1RE4 A;  1NTZ J;  2WSC H;  3HD7 B;  3OAK A;  1FZF A;  1OW6 A;  3HE4 A;  1Z56 A;  2D2C C;  2NZ2 A;  3CC4 P;  3H1H D;  2V4H A;  1ZR4 A;  1OFC X;  1IFJ A;  2BAS A;  1T3J A;  2WSE H;  2ZJS E;  3B8E B;  1L4A B;  3T97 B;  3E7K A;  3AE2 C;  3TNU B;  3RK2 D;  3PH0 A;  4JBZ A;  1PGP A;  4GOD A;  1HH0 A;  4ASV A;  2OAR A;  3VMY A;  1OXZ A;  1MFT A;  2GA1 A;  1JY3 N;  2Q6Q A;  1BGY G;  3BRV B;  3H1I G;  1U57 A;  2P2U A;  1PGJ A;  2QJK B;  1YQ4 C;  1KC8 Q;  4WY4 B;  1SFC C;  2KZI A;  2Y9Z A;  2A06 D;  5H2F E;  2YKO A;  1RE3 A;  1S3J A;  1GZL A;  1NTM G;  2ZVO B;  5GTH E;  3M9H A;  4YTP C;  1SQQ G;  4UB8 E;  3N7N A;  3VMX A;  1GMJ A;  3CWB D;  3H1K E;  3EFG A;  4DJG A;  2QJP C;  3PRJ A;  4Y99 C;  2IBZ D;  3L70 D;  3RK3 C;  1SQP D;  2POH A;  4OGQ B;  3CME P;  2P67 A;  2K3R A;  3HUS A;  1SP4 A;  2XV5 A;  3H1K J;  3CCM P;  2CK3 H;  1P84 E;  5AW8 B;  2LXB A;  3HE5 A;  2HPC A;  2M5A A;  3O6Q A;  3B4S A;  2LXC B;  3LW5 H;  2IDB A;  2FFD A;  3GF3 A;  4N78 E;  1KMI Z;  3RK2 C;  1L0L D;  4K3A A;  4BXL A;  2K1A A;  5EFW B;  2N1T A;  3ITK A;  2E5T A;  2HOD B;  4ZKP A;  2NPS B;  1JUN A;  1L0N E;  1H0T A;  2CPB A;  2ZVN B;  1L0N K;  1GL2 C;  3BVH A;  5DJT B;  4WVZ A;  2YMY A;  4BRY A;  3CX5 H;  2OYI B;  3RK3 E;  1X8Y A;  1T6A A;  1LP1 A;  1PGQ A;  1L0N J;  2I1J A;  4GDO A;  1EDK A;  3CCL P;  1EQ7 A;  2QA4 P;  2E76 B;  3SSU A;  2R5D A;  3L71 D;  1ZN5 A;  5E79 E;  4PD4 H;  2L5G B;  1SQX D;  1LT9 A;  3AE3 C;  3H1H E;  3G4S P;  1W5C E;  2UWJ E;  1NTK D;  3AEB C;  2YKQ A;  2MJZ A;  2QJY B;  3HTK B;  3TF5 A;  1Y8A A;  2Q9I A;  3H1H J;  3A2A A;  3KZI E;  1KOR A;  3MP7 B;  2Q7C A;  3Q2Y A;  4R4L A;  2XU6 A;  4UB6 E;  3BAT A;  2HYN A;  5CCH C;  4H0L B;  3AEA C;  1FZE A;  1R5S A;  4B86 A;  2K9J B;  2WZ7 A;  3R4Y A;  1RF0 C;  1NKN A; 
#chains in the Genus database with same CATH homology
 5BU8 B;  3U59 A;  4EIJ A;  2C9L Y;  1MUU A;  2Z5H A;  1LWU A;  2A45 I;  3VYI A;  2YNY A;  1N7S D;  1T3U A;  1FAV A;  5APY A;  3HUS B;  1LTI C;  1RE4 C;  3RL0 B;  1J1D C;  2WTY A;  2IPP A;  2PAJ A;  5AW4 B;  2NPS C;  1GD2 E;  3SWF A;  3B5N D;  2H7H A;  4I2L C;  3V4Q A;  1N73 B;  1IFI A;  4RES B;  1LGH B;  2J58 A;  3HE5 B;  3PP5 A;  2HPC B;  3CL3 D;  1GK6 A;  3HD7 A;  1HTL C;  5KJ7 A;  3VMZ A;  1T2K C;  1MV8 A;  5AVT B;  3L35 A;  2OYI C;  4LLH A;  1ZV8 A;  1IFD A;  2CPS A;  4HH2 A;  1M1J B;  2FFD B;  3HD7 D;  1KZU B;  1GW3 A;  1GTW A;  3L4F A;  1JCD A;  1G2C A;  2FYU K;  3MIW A;  4HYT B;  2Z5I A;  1HGZ A;  3HE4 B;  5CCG D;  3U1C A;  2XDJ A;  4DZO A;  1L4A A;  3KYQ A;  2N1T D;  2O01 H;  1SQP K;  1WT6 A;  3T97 A;  2C0X A;  3N4X A;  1IO4 A;  4M3L A;  3TNU A;  1RF1 A;  2WPS A;  5BVZ A;  3V2Q A;  1NH4 A;  3BAS A;  3TK1 A;  4XA4 A;  1W2E A;  1FZB A;  1PFI A;  1L4A D;  3MUD A;  2R32 A;  2FYZ A;  1JO5 A;  3IFM A;  1SQQ K;  1FU1 A;  4I6M C;  1IK9 A;  1HWT C;  1SVF A;  2A45 H;  1DH3 A;  5AW7 B;  1J1E B;  2Q5U A;  1JTH A;  2E42 A;  4AYC A;  1A02 F;  2KP8 A;  3I5C A;  3VN0 A;  3V5B A;  3V2N A;  1HJB A;  4W7Y A;  1URQ A;  3V2R A;  1RE3 C;  4WY4 A;  1KIL B;  1GL2 A;  1H8A A;  2FKW B;  2YO3 A;  1JY3 P;  2OYH A;  4GIF A;  1N2D C;  5APX A;  2R5B A;  3GHG B;  1L0L K;  2KOG A;  5AVX B;  4WY4 D;  1GL2 D;  1QL1 A;  1GDT A;  1YTZ I;  4GKG A;  1JOC A;  5AW0 B;  2I1K A;  5KTB A;  5AW5 B;  1ZR2 A;  1SFC A;  1LT9 B;  4AQR D;  3OA7 A;  3M0D C;  3P7K A;  4EOT A;  5AW1 B;  5AVQ B;  2Z4E A;  5CJ0 A;  1GW4 A;  3NXS A;  3V4W A;  5CJ4 A;  2VRS A;  5AW3 B;  1CI6 B;  1SFC D;  4JF7 A;  3HUS C;  1JY3 O;  4ZKU A;  4N78 D;  4LGD E;  1N7L A;  1H89 A;  3H6P A;  2N9B A;  4IFD K;  1FBM A;  4XE5 B;  1N73 C;  2ZXE B;  3B5N C;  3VP8 A;  3MD0 A;  4OH8 B;  1NKZ B;  2GM4 A;  4C7N B;  3BRT B;  2Q3I A;  1RY3 A;  3U1A A;  1N7S B;  1LTJ A;  3G3Z A;  1FZC A;  1M1J C;  3M9B A;  1YYC A;  3VTP C;  2FFD C;  3L36 A;  2ZFC A;  3VOP A;  2LKM A;  3TSI A;  1SQX K;  2H8P D;  3P32 A;  5CCH A;  4LC1 A;  3B5N B;  5CMZ A;  2WT7 B;  1X9V A;  5CCG C;  3RK3 D;  2WPR A;  1NTK K;  1GU4 A;  2P7J A;  1NTZ K;  1RF0 A;  2JJL A;  2N1T C;  4DOJ A;  5CCH D;  2FXM A;  1JY2 P;  1JMM A;  2HLO A;  5AW9 B;  1YTZ T;  1IC2 A;  2IFM A;  2XNX A;  5KJ7 D;  1RE4 A;  1CW5 A;  2WSC H;  3HD7 B;  3OAK A;  1FZF A;  2HOD A;  1FJP A;  2NPS A;  1RF1 C;  4W7Z A;  1S9K E;  3HE4 A;  1J1E C;  1Z56 A;  2KB7 P;  5APU A;  1FOS F;  2N1T B;  1HGV A;  5AVZ B;  2W6A A;  3P8C D;  1G2C B;  2NPS D;  2YO2 A;  5APQ A;  1ZR4 A;  1IFJ A;  1KIL C;  1NTM K;  2BAS A;  3EQ2 A;  3V2P A;  1T3J A;  2QM8 A;  2WSE H;  2OYI A;  3B8E B;  1L4A B;  1JCC A;  4JYC A;  3GHG C;  3KQG A;  3CLQ A;  3TNU B;  3RK2 D;  1RF1 B;  1JY2 O;  1T2K D;  1HBW A;  1HH0 A;  2OAR A;  3VMY A;  3H32 A;  5AVS B;  3M0A A;  1OXZ A;  4W80 A;  1JY3 N;  1LT9 C;  1JNM A;  3MGN A;  3BRV B;  5AW2 B;  1JTH B;  1VDF A;  3NTN A;  2P2U A;  1URQ D;  2W27 A;  1NAF A;  2M8R A;  3O8Z A;  4IFF A;  4WY4 B;  1GL2 B;  1SFC C;  1OWA A;  3HRN A;  2P1J A;  5AVW B;  3L37 A;  1FJK A;  2GUV A;  2HFE D;  2YKO A;  3TYY A;  1RE3 A;  1SQV K;  3A7O A;  1LTA C;  3HTK A;  1DEB A;  1GZL A;  1A02 J;  1E5W A;  4WBA A;  1N7S C;  3M9H A;  5AVY B;  1SFC B;  4IFM A;  4JYB A;  3SWY A;  3N7N A;  3VMX A;  1DX7 A;  1J2J B;  2WIT A;  1LWU C;  3LIE A;  3EFG A;  4Y99 C;  2WSF H;  1IJD B;  3M0D A;  1XTG B;  3RK3 C;  1AFO A;  1LTG C;  2POH A;  1GK4 A;  1NO4 A;  2HG5 D;  2C9N Y;  1ZLL A;  2P67 A;  3HUS A;  1AQ5 A;  1SP4 A;  2XV5 A;  1HUC A;  3HD7 C;  5KJ7 C;  1LWU B;  1NU1 K;  4Y99 B;  5AW8 B;  4N3Y B;  2E43 A;  2IFN A;  1LTJ B;  1N73 A;  3M9Q A;  3E1I A;  3KPE A;  1LTB C;  3B5N A;  3RK3 B;  1FZC B;  3HE5 A;  2WT7 A;  2HPC A;  3RL0 D;  2XZR A;  5BU5 A;  1JY2 N;  1QL2 A;  4I1L A;  5AVR B;  2YKP A;  3LW5 H;  2J59 M;  3II6 A;  1KQL A;  1L4A C;  1M1J A;  2FFD A;  1FDM A;  4N78 E;  1SLQ A;  1MZ9 A;  3RK2 C;  4AUW A;  5CCG A;  5APS A;  1NHL A;  3LID A;  2GUS A;  5CHX A;  2N1T A;  4N6J A;  1J1D B;  5APW A;  1H88 A;  5APT A;  1T8Z A;  1M7L A;  1NWQ A;  2HOD B;  4ZKP A;  2NPS B;  1X79 B;  2KYV A;  1JUN A;  3OJA B;  1SQB K;  1LTT C;  3A5T A;  1HVV A;  2O1J A;  1XTC C;  2CPB A;  5KLV K;  3RK2 B;  3C9I A;  1URQ C;  1L0N K;  4O9B A;  2W6B A;  4WY4 C;  1FOS E;  1GL2 C;  1VPC A;  3BVH A;  2YMY A;  3M91 A;  1FZG A;  2OYI B;  2H43 A;  3VP9 A;  2OYH C;  3M06 A;  1X8Y A;  3UIA A;  2IX7 C;  2XKM A;  2R3C A;  3NFQ A;  1KFM A;  1KIL A;  2I1J A;  5AVV B;  1MFZ A;  3H32 B;  4C46 A;  2O1K A;  1IFN A;  3GHG A;  1URQ B;  1N86 A;  5AW6 B;  1KIL D;  1EQ7 A;  2WPQ A;  2OYH B;  3A3Y B;  2R5D A;  1ZN5 A;  1FZA A;  4KHX A;  2M3B A;  2L5G B;  1LT9 A;  1WRG A;  3P8C E;  2QM7 A;  1G1J A;  2YKQ A;  3R2P A;  1CI6 A;  1NOH A;  2MJZ A;  1CSB A;  3HTK B;  1G1I A;  2C0W A;  3KDP B;  2KLV A;  2Q9I A;  4WB4 A;  3A2A A;  1KFN A;  2WWW A;  1LTS C;  3NMD A;  2Q7C A;  3WMM 0;  2JEE A;  2XU6 A;  1LTJ C;  4GT1 A;  5AVU B;  1GU5 A;  3BAT A;  3MTU E;  1FZC C;  2HYN A;  1CZQ A;  1IFM A;  4C7N A;  4C7R A;  3RL0 C;  2A45 G;  5CCH C;  3IR9 A;  1S9K D;  2KSJ A;  1N7S A;  1FZE A;  3CI9 A;  4B86 A;  2WZ7 A;  5APV A;  1RF0 C;  2PP6 A;  1NKN A;  3P8M C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...