4EOTA

Crystal structure of the mafa homodimer bound to the consensus mare
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
92
structure length
92
Chain Sequence
RFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Transcription factor MafA
total genus 39
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4eotA00
2QM8A 1CZQA 2R5DA 2YNYA 1JUNA 2R32A 3MGNA 1FOSE 3M91A 3HE4A 1S9KD 5APWA 2H7HA 1HJBA 1NWQA 1GU5A 1J2JB 1OXZA 2P7JA 5AVRB 1CI6B 4AYCA 4JYBA 3TNUA 1MFZA 1OWAA 2WPSA 3VYIA 4AQRD 2VRSA 5APQA 1HWTC 4C7NB 2E42A 3A3YB 3L35A 1GK4A 2XZRA 1GZLA 3M9HA 3LIDA 1JNMA 3M0AA 3V4QA 2WPRA 1A02J 3O8ZA 3NXSA 2WTYA 1CSBA 1MUUA 5AW6B 3NTNA 4I2LC 3TYYA 1H88A 3P7KA 4AUWA 2ZXEB 5AVVB 3VMXA 3T97A 2WT7A 3HE4B 2JJLA 3P32A 1GD2E 2P2UA 3UIAA 5AVSB 5AW8B 4C46A 2W27A 3A2AA 3TK1A 4DZOA 5AVYB 2YO3A 5APUA 3M0DA 5AW0B 3KDPB 2Z5IA 2C9LY 5AW1B 1X8YA 2QM7A 3KQGA 5AW3B 2BASA 5AW4B 2XU6A 2YO2A 1HUCA 1GK6A 2Q3IA 3VTPC 4RESB 3L37A 2IPPA 3A5TA 2W6AA 1KQLA 5APXA 3OAKA 1GU4A 2R3CA 3L36A 2ZFCA 5AW5B 1H89A 3V4WA 1DH3A 4B86A 3P8MC 1SLQA 5AW7B 2Q7CA 2WT7B 4I6MC 3HE5A 3VMYA 4HYTB 3NMDA 1H8AA 2R5BA 5AVQB 2WWWA 1FOSF 5AW2B 1SP4A 4EOTA 5APVA 3B8EB 4M3LA 2WPQA 1A02F 1FAVA 2XV5A 5CMZA 5AVTB 3VN0A 4KHXA 3SWFA 3IR9A 1YYCA 3M06A 4XE5B 4C7NA 4JYCA 2E43A 5APTA 3TNUB 1S9KE 1T2KD 5APSA 5AVUB 3M9BA 1CI6A 3HE5B 4GKGA 5APYA 3LIEA 3V5BA 2Z5HA 2C9NY 3HTKA 1T2KC 3I5CA 3A7OA 3NFQA 3VMZA 1MV8A 1HBWA 4GT1A 5AW9B 2P67A 1NAFA 2N9BA 4LC1A 5AVXB 5AVZB 5AVWB 3MD0A 1G2CB 2Q5UA 1IO4A 2KP8A 1GTWA
chains in the Genus database with same CATH superfamily
1L4AB 4N78E 3CC2P 2NZ2A 2QM8A 3L70G 4PV1D 2YNYA 2YKPA 1JUNA 1LT1A 2V4HA 2JWDA 1TU3F 2YKQA 3L71D 1T6AA 1AV1A 3H1HG 1JY2O 3RBZA 3L74D 2B89A 3M91A 1KD1Q 1KB9D 2HFED 1DD3A 3U59A 1RF1A 4O9BA 2H7HA 1NH4A 2WVRA 1OXZA 4EYYQ 2OYHC 3CX5D 2OARA 2KNCA 1BGYD 1CI6B 3G9RA 3LW5H 1U57A 1HVVA 1NU1D 2QJKB 1BSHA 2BCCJ 1S5LE 4JYBA 4H44C 2WPSA 1Q82Q 4WY4C 5APQA 2Y9ZA 1LP1B 1VQ4P 4Y99C 2IX7C 2K9JB 4PV1C 2E74B 3H1HD 1N7SA 1QEXA 2QJKC 3CMEP 1PZQA 3JCUH 1SQBD 2XZRA 4WY4B 1JNMA 3CCSP 4Y99B 2WPRA 1KYOH 3B71A 3CX5E 4PV1B 3HUSC 1J1DB 1EDKA 2E75B 3FXDA 2Y9YA 3KZIH 1SVFA 4GOEA 5TISE 3CD6P 2HYNA 3F89A 2GM4A 2WSCH 2WPVB 2OTLP 3P7KA 2HG5D 4BWNA 4D6TJ 1SQQG 2IFNA 3T97A 1GL2D 3CL3D 1SQPD 2Y0DA 3KPEA 3SSUA 3HD7B 4BRYB 3HE4B 2JJLA 1RF1B 1KQGB 3A0HH 1FZCC 2P2UA 1EXIA 1BSNA 1JEKA 3B4SA 2XDJA 5AW8B 3UIAA 2Z4EA 2W27A 3A2AA 3TK1A 1N73C 3CI9A 3GW6A 5H2FH 1NTMG 2C0WA 1OVUA 1NTMK 2NPSB 4U7JA 5AVYB 1YBKA 1USEA 1JMMA 3KDPB 4I7ZB 5AW1B 2HPCB 3KQGA 1HH0A 2FYUD 1VQNP 3KXDA 1YHQP 2XU6A 5C39A 1YQ3C 3O6QA 1HUCA 4OGQB 1N8RQ 1N73B 2GA1A 1KILB 1NTKE 1LNQA 2B87A 1RF0A 1SQVG 3L73G 3LW5J 2WSEH 3H1JD 1KMIZ 1L0NG 1QX8A 3AE8C 1WT6A 4DJGA 2IBZE 1L0LJ 2A06D 3AEEC 2NPSA 4HKZH 1OZHA 4OGQC 3CCVP 2W6AA 2ZT9D 3E7KA 5B5EE 1GU4A 2R3CA 1VQ5P 2JO1A 4R4LA 5GTHE 3HD7A 1OW6A 3A0BE 3H1JJ 1KQSO 1P84D 1KV4A 3Q5RA 1OFCX 2O1JA 1PP9G 1K9MQ 3T97B 2I1KA 3MZWB 2RH0A 1IFDA 1SQVD 3SFDC 3NMDA 2R5BA 3H1KE 3V2QA 5KLVG 5KLVK 1VQ7P 5AVQB 3PJSK 1P84E 2E76C 5AW2B 3Q5SA 5K5GB 1YI2P 3F5HA 1L4AC 1GW3A 4H44B 1FZAA 1NKNA 3B8EB 1NTKJ 3KYQA 5APVA 3VMAA 1YJNP 1LTSC 2FXPA 2BEZF 1A02F 1D7MA 1G1JA 2G3AA 2N1TA 3H32B 4KHXA 2C0XA 3SWFA 4LLHA 1L0LE 1Z56A 1J1EC 3RK3B 4C7NA 3TNUB 1S5LX 1LTBC 2WSFJ 1VQLP 4N6JA 1L0NK 1FZFA 1EDJA 1GL2C 1PGPA 3G4SP 1SQXD 3RL0g 2KLUA 1JY2N 3LIEA 1Q81Q 1RE3C 3H1LG 1LTJC 2C9NY 1IJDB 2FFDA 2A45G 2E74C 3HTKA 1PL5A 2O3JA 1LWUA 4HB1A 1EDLA 3VMZA 5CCGC 2KB7P 3H6PA 2N1TD 1N86A 2FXMA 3H1KD 3CXHH 2P67A 1VL2A 3B5NC 4PJ0E 3PP5A 1KILA 3MD0A 1SQXG 4I7ZC 1EDIA 1NTZG 2Q5UA 3FGAD 3O6QB 4OWFA 1BGYG 1SQQK 1RF0C 1IFIA 2AXTH 2D2CD 2QVAA 4OGQD 2HPCA 2I8DA 3QWOC 1ZW0A 5E79E 1T2KD 3CC7P 3B5NB 2OYIA 4JPZB 3L72G 4U3FE 3GHGA 3VOPA 5KAFH 4UB6H 1H0TB 1JY3P 1RY3A 4H0LD 4PD4D 1KB9H 5CHXA 5CJ0A 1DEEG 3MGNA 4EI2A 1FOSE 1FJKA 3GMAA 2CK3H 2IBZI 1KFMA 1PFIA 1YJ9P 1SQBK 2R44A 1GMJA 3VP8A 1ZRTE 3II6A 1J2JB 1GU5A 1HJBA 1FZEA 1YIJP 2GUVA 2L5GB 2MJZA 1RQUA 2BCCE 4Z1MH 4AYCA 3L75G 2ZYAA 3Q1MA 1JY3N 2DW3A 1BE3J 3VYIA 4AQRD 4YXWH 2FYUE 2K1AA 2YMYA 4BXLA 1BCCE 3L74J 4C7NB 3PH0A 3H1KG 5CJ4A 1LTTC 1LTGC 1UIXA 4WY4A 3H1IG 3L35A 3MTUE 1JCDA 2WSSH 1RQVA 1QVGO 1M8OB 3V4QA 4KJMA 4ZKUA 1T8ZA 2KK7A 3O8ZA 3C1LA 2JR8A 1WMKA 2HODB 2MKVA 1Y9BA 5KJ7A 4IL6H 1H88A 1URQA 2ZXEB 2W90A 3Q2YA 4IFFA 1FU1A 1GL2A 1Y47A 5L8RJ 1FS0E 3TGUG 1X22A 1XTCC 4D6TG 1W2BO 1GD2E 3AEGC 2P58A 4C46A 2FFDC 1VQMP 1BE3E 3BRTB 1HF9A 1KN7A 1BCCJ 3CPWO 1JB0J 2JP3A 3EFGA 3AEBC 2IZ0A 4YXDC 1SFCA 2FYNB 2QM7A 5DJUB 2BASA 5CBNA 1URQC 1J1EB 1EZVD 2IDBA 5AW4B 2B87B 3RK3C 1G2CA 1NO4A 2SPZA 2JKVA 1SQBG 1HTLC 1IFJA 1GK6A 1BE3D 1N7LA 3BRVB 3M0DC 2QA4P 1RH5B 1P84I 3MIWA 4UB8E 3RK3E 1XTGB 1LTAC 1K04A 2E5YA 5BU5A 2IPPA 2OYHA 1KYOD 1S2EA 3A5TA 1QVFO 1FZBA 1LTJB 4ASVA 5APXA 3P8CD 4MN4C 4XA4A 1LT9A 3RBXA 3TGUE 1J1DC 2E75C 3L36A 3PLNA 3TSIA 1H0TA 3JCUE 3BCCD 1PPJE 2KOGA 3L71E 2WT7B 4IFMA 1Q90D 1SQQE 4ZNCA 5KJ7D 1KC8Q 3AEFC 1BE3G 1IFPA 4HYTB 1KYOE 2JWAA 1IFMA 3RGUA 3H1JG 2H43A 1AQ5A 3KZIE 3SWKA 4W80A 3H1KJ 1JTHB 1PP9J 1SQPJ 1FZCB 1USDA 4DT0A 4L75A 3IN6A 3G6EP 1FOSF 4HH2A 4PD4H 3H32A 2FYUG 4CPGA 5KLVJ 3W68A 4H0LC 1Q86Q 2D2CC 2Q1KA 4M3LA 2WPQA 2E75D 1FAVA 4NPDA 5CMZA 1PP9D 3ABVC 3JC22 5AVTB 3M06A 1JY3O 2H89C 2POHA 2FY8A 1FZCA 4H0LB 2E43A 2AEJA 1L0NE 5KLVD 1JTHA 3ZDMA 2K9YA 5APSA 1AA0A 1FJPA 3L71G 3M9BA 3D6ZA 1CI6A 3AE2C 3HE5B 4GKGA 3GG2A 1R5SA 1SQXK 2YIUC 2OYOA 3IF4A 1JCCA 2QJYC 2BEQD 4NPEA 1K05A 3AECC 1NU1G 1LT9B 1SQPE 2RN0A 3I5CA 3SFEC 2KI7B 3A7OA 1LTJA 1WRGA 2M0BA 3L72D 3NFQA 4OH8B 5KAIH 4KT0J 1QGKB 4A7PA 1VQOP 2ZXXA 1SFCC 5KLVE 2O01H 5AVXB 1LT9C 5GTIE 1AVYA 3AE3C 1EC5A 3TDKA 1L4AD 5B66E 1LJ2A 1G2CB 2IBZD 3MHVA 1IO4A 1RHZB 1SFCB 1ZV8A 3C8VA 4U3FJ 1DX7A 2KYVA 1RE4A 4TLFA 2R5DA 4GOFA 4GIFA 4L73A 5KTBA 2KSJA 2M3BA 1IFNA 2FFDB 4IFDK 4GDOA 1SQVK 2OQQA 4HJGH 3RL0C 3HE4A 4IOIH 3U1CA 3N7NA 3V2PA 1X0TA 5CBOA 4BRYA 3A0HE 1SQPG 1GL2B 4U3FD 1NTKK 5AVRB 3TGUJ 1URQB 2RMZA 1FDOA 1JM0A 2KS1A 3TF5A 2KUBA 2Y0CA 2FYUJ 1VF5D 2N1TC 1OWAA 1FZGA 3L74E 1URQD 1IC2A 1NU1K 1JO5A 2ZVOB 4RKUJ 1U7JA 1QLED 2NRGA 3HUSA 3TGUD 3BATA 3RK3D 3U1AA 3CMAP 1OVRA 1KB9I 3LIDA 1M1JB 3M9HA 1NGMB 3CWBE 2M5AB 2B9BA 1YQ4C 2XKMA 4EIJA 2D2CB 1L0ND 1VQ6P 1LP1A 1RE3A 3CX5I 3NXSA 3D71A 3Q3DA 2G8YA 4ZKPA 2CPBA 3NTNA 4I2LC 2R3SA 2M8RA 2H8PD 5GTHH 4AUWA 2KNCB 3VMXA 1AFOA 3CCLP 2AEMA 5KJ7C 4JF7A 2ZJSE 3H1ID 1NJIQ 1OX3A 3P32A 4WWIA 1NTME 5E79H 1FBMA 1M57D 3V2NA 1VF5B 1ZP0C 2A45H 3R4YA 4DZOA 1NU1E 2YO3A 1P84H 4QMAA 1HGZA 1OW8A 4XFJA 5AW0B 3I55P 2OGUA 1KYOI 2I1JA 4WBAA 5EFWB 1NTKG 1NYHA 3FWNA 1NKZB 1SQQD 2FKWB 3CC4P 2P10A 1NOHA 3FX0A 1DIPA 1W2EA 3CWBJ 3MUDA 2PRRA 1X79B 4N78D 3CCRP 1BDCA 2IYPA 1KILD 1SQBJ 1SQVE 3CCMP 2YIUB 1YITP 4WVZA 1KZUB 2GUSA 3ITKA 1H89A 2HLOA 3WUTA 3L71J 3V4WA 1Q7YQ 4B86A 1SQQJ 1SLQA 2IZ1A 2V7QH 5AW7B 2Q7CA 2QG4A 4I6MC 4H13D 3VMYA 3WU2H 4DCKA 1M1KQ 2A06E 2E5TA 3G3ZA 3HRNA 1KTMA 1PP9E 1LTIC 2J58A 1NU1J 2HODA 3E1RA 2W83C 4IL6E 4RO0A 2A45I 3W67A 3L4FA 4L76A 3CXHE 2YXQB 2WZ7A 3CCEP 2M5AA 1NAYA 1ZN5A 3BVHA 1ZMEC 2N1TB 1SQXJ 1EZVG 2Q9IA 1SQPK 1PGJA 1ZLLA 1MZ9A 5DJTB 4NPFX 3S4RA 1N7SB 2FYNC 2XV5A 1S3JA 3GF3A 2LXBA 1DEBA 3FWLA 3RL0B 3VN0A 3L70E 3Q5PA 1PV3A 3IR9A 1JY2P 1SQVJ 1U7MA 1YYCA 2ITAA 2PP6A 2WSFH 4GODA 2QJPC 1L0NJ 4UB6E 4XE5B 3S9OA 2YMKA 1OVVA 1M56D 1KB9E 1PGQA 1N7SC 2QRXA 3KHUA 1S5LH 2ZVNB 5AVUB 2WSCJ 1YJWP 1FE6A 5B5EH 3P8CE 3H1LE 5M1BA 2W8ZA 2ZYGA 3AE6C 1E5WA 2QJPB 3AE4C 2FBWC 1NTZD 3A0BH 4W7YA 2YKOA 2Z5HA 3CCUP 1ZOYC 3L73D 4UB8H 3L75J 2QEXP 1BCCD 4YPCA 2O1KA 1HJ0A 2KIKA 3RK2B 2B88A 3HD7D 1Q2NA 3CX5H 2QIWA 3L70D 4OVNF 4WB4A 1MV8A 4RJTA 2QE7H 1R8EA 3G71P 1ZR4A 1EZVE 1M1JC 2HR3A 2ZYDA 4H44D 1HBWA 1SQXE 5BVZA 3H25A 3CCQP 1NAFA 4LC1A 2NPSD 5AVZB 2PFXA 3EQ2A 3IFMA 5AVWB 3CXHD 5KLIC 4I1LA 2KZIA 1JOCA 3RK2C 1N73A 3B5ND 4C7RA 1IK7A 1OIPA 3L70J 4H13B 2KP8A 3RL0D 3MUDC 1ZRTD 2WITA 4DOJA 3L75D 3AEDC 4TT3H 1S4XA 5CCHD 1BGYE 2LKMA 1CZQA 2JEEA 2FXOA 3CLQA 5H2FE 4ASWA 2OTKE 1N2DC 1RF1C 4IL6X 2K3RA 1KFNA 1VF5C 2AXCA 2R32A 3S1KA 5CCGD 2Q3EA 1NTZK 2KLVA 2ZT9B 5APWA 3AE7C 1S9KD 2L91A 2Y0EA 1NWQA 1FDMA 2BCCG 1L2PA 2P7JA 2NPSC 1X9VA 3VP9A 3RK2D 3CXHI 4LGDE 5BU8B 3D6YA 1BCCG 3R2PA 1MFTA 1DD4A 1MFZA 2A06G 2E76D 4YTPC 3TNUA 2VRSA 1M90Q 2QJYB 1IK9A 4W7ZA 1HWTC 1E79H 2AEFA 2H88C 2J59M 2E42A 3A3YB 1GK4A 4D6TD 4PJ0H 1FC2C 2XNXA 1GZLA 2BCCD 2IBZG 4N3YB 3GF7A 3M0AA 3H1IE 3I56P 1G1IA 1BGYJ 2AXTE 3K5BA 1A02J 3AE5C 1N7SD 1NTMD 5KAIE 1SFCD 2WTYA 1CSBA 1MKMA 1MUUA 1T3JA 1GW4A 1YTZT 3C9IA 5AW6B 3H1HJ 3TYYA 5GTIH 5AVVB 1FDIA 3PHLA 4D6TE 5B66H 2CPSA 2XNDH 2WT7A 1QL1A 5TJHA 3GHGC 1NTMJ 1R5LA 5AVSB 2WSEJ 3AE1C 2E76B 3BASA 1OW7A 2WMMA 3CWBD 4Y28J 5KKZC 4ZMDA 4L74A 5APUA 1UIIA 3M0DA 2OYHB 1GDTA 1Y8AA 1T3UA 2Z5IA 1X8YA 2C9LY 5AW3B 3L74G 1LGHB 1QL2A 2YO2A 2PGDA 5KKZB 1LWUC 1L0LG 2Q3IA 3VTPC 3H1IJ 2LR2A 4RESB 1CW5A 3BCCJ 3FXEA 1SQBE 3OA7A 3L37A 1SS1A 4PD4I 4WY4D 3V2RA 1VQKP 3CWBG 1BDDA 3H1HE 4H13C 1KQFB 1KQLA 1LWUB 1VQPP 3OAKA 1PPJG 3HTKB 4R4MA 2ZFCA 5AW5B 1NTKD 2W6BA 1DH3A 3P8MC 1YTZI 2IYOA 3WMM0 3H1JE 4JBZA 3HE5A 3EFFK 1L0LD 2P1JA 3N4XA 3OJAB 3E1IA 2FYUK 5TISH 1EXJA 2RKLA 2K37A 2KXPB 5CCGA 1K8AQ 1H8AA 2O01N 2KSEA 5KLIB 2WWWA 1IZNB 1AJYA 5KAFE 1KORA 1PPJD 1SP4A 3WUUA 1M1JA 3EWKA 1NTZE 4EOTA 2W6JH 3USSA 2V7QJ 1S72P 3HUSB 3H1LD 3L73J 1PIXA 3BCCE 1EZVI 1JMBA 1AQTA 1NHLA 2K9JA 3L72E 2ZAEB 4JQ0D 4U3FG 5CCHC 3OW2O 1W5CE 2ZT9C 3AE9C 3PRJA 2N9YB 4JYCA 2OTJP 5APTA 3WUVA 1VPCA 2IFMA 2K88A 3AEAC 1S9KE 2KS1B 3V6IA 1VQ9P 3HD7C 2J5UA 3H1LJ 1VQ8P 3D70A 3IAOA 4K35A 1L0LK 1EQ7A 2QSIA 2M3EA 1S1CX 5APYA 1K73Q 3V5BA 2Q6QA 1NVOA 3L75E 1ZR2A 2KZJA 5CCHA 1T2KC 1OMIA 4EDFA 2JDIH 3JSVC 1AVOA 3GHGB 1HGVA 3B5NA 2OYIB 2UWJE 1L4AA 2YXRB 1KILC 3MP7B 1ZXGA 3GLMA 3QH9A 2WQYC 1NTZJ 4GT1A 5AW9B 2LXCB 3SWYA 2N9BA 3PTZA 4PD4E 3BCCG 4K3AA 2FYZA 2E74D 3L73E 3WU2E 3M9QA 3CCJP 1RE4C 2O01J 1VDFA 2OYIC 2PAJA 3L72J 1KILE 1GTWA 1PGOA 1M7LA
chains in the Genus database with same CATH topology
1L4AB 4N78E 2QM8A 1JUNA 2YNYA 2YKPA 2YKQA 1JY2O 3M91A 2HFED 3U59A 1RF1A 4O9BA 2H7HA 1NH4A 1OXZA 2OYHC 2OARA 3LW5H 1CI6B 1HVVA 4JYBA 2WPSA 4WY4C 5APQA 4Y99C 2IX7C 1N7SA 2XZRA 4WY4B 1JNMA 4Y99B 2WPRA 3HUSC 1J1DB 1SVFA 2HYNA 2GM4A 2WSCH 3P7KA 2HG5D 2IFNA 3T97A 1GL2D 3CL3D 1RF1B 3KPEA 3HD7B 3HE4B 2JJLA 1FZCC 2P2UA 3UIAA 5AW8B 2XDJA 2Z4EA 2W27A 3A2AA 3TK1A 1N73C 3CI9A 2C0WA 5AVYB 2H43A 1NTMK 2NPSB 1JMMA 3KDPB 5AW1B 2HPCB 3KQGA 1HH0A 2XU6A 1HUCA 1N73B 1KILB 1RF0A 2WSEH 1WT6A 2NPSA 2W6AA 1GU4A 2R3CA 3HD7A 2O1JA 2I1KA 1IFDA 3NMDA 2R5BA 5KLVK 3V2QA 5AVQB 5AW2B 1L4AC 1GW3A 1FZAA 1NKNA 3B8EB 3KYQA 5APVA 1LTSC 1A02F 2N1TA 1G1JA 4KHXA 3H32B 3SWFA 2C0XA 4LLHA 1Z56A 1J1EC 3RK3B 4C7NA 3TNUB 1LTBC 4N6JA 1L0NK 1FZFA 1GL2C 1JY2N 3LIEA 1RE3C 1LTJC 2C9NY 1IJDB 2FFDA 2A45G 3HTKA 1LWUA 3VMZA 5CCGC 2KB7P 3H6PA 2N1TD 1N86A 2FXMA 2P67A 3B5NC 3PP5A 1KILA 3MD0A 2Q5UA 1SQQK 1RF0C 1IFIA 2HPCA 3B5NB 2OYIA 3GHGA 3VOPA 1JY3P 1RY3A 5CJ0A 5CHXA 1PFIA 3MGNA 1FOSE 1FJKA 1KFMA 1SQBK 3VP8A 1HJBA 1GU5A 3II6A 1J2JB 1FZEA 2GUVA 2L5GB 2MJZA 4AYCA 1JY3N 3VYIA 4AQRD 2YMYA 4C7NB 5CJ4A 1LTTC 1LTGC 4WY4A 3L35A 3MTUE 1JCDA 3V4QA 4ZKUA 1T8ZA 3O8ZA 2HODB 5KJ7A 1H88A 1URQA 2ZXEB 4IFFA 1FU1A 1GL2A 1XTCC 1GD2E 4C46A 2FFDC 3BRTB 3EFGA 1SFCA 2QM7A 2BASA 1URQC 1J1EB 5AW4B 3RK3C 1G2CA 1NO4A 3BRVB 1HTLC 3M0DC 1IFJA 1GK6A 1N7LA 3MIWA 1XTGB 1LTAC 5BU5A 2OYHA 2IPPA 3A5TA 1FZBA 1LTJB 5APXA 3P8CD 4XA4A 1LT9A 1J1DC 3L36A 3TSIA 2KOGA 2WT7B 4IFMA 5KJ7D 4HYTB 1IFMA 1AQ5A 4W80A 1JTHB 1FZCB 1FOSF 4HH2A 3H32A 4M3LA 2WPQA 1FAVA 5CMZA 5AVTB 3M06A 1JY3O 2POHA 1FZCA 2E43A 1JTHA 5APSA 1FJPA 3M9BA 1CI6A 3HE5B 4GKGA 1SQXK 1JCCA 1LT9B 3I5CA 3A7OA 1LTJA 1WRGA 3NFQA 4OH8B 1SFCC 2O01H 5AVXB 1LT9C 1L4AD 1G2CB 1IO4A 1SFCB 1ZV8A 1DX7A 2KYVA 1RE4A 2R5DA 4GIFA 5KTBA 2KSJA 2M3BA 1IFNA 2FFDB 4IFDK 1SQVK 3U1CA 3RL0C 3HE4A 3N7NA 3V2PA 1GL2B 1NTKK 5AVRB 1URQB 1FZGA 2N1TC 1OWAA 1URQD 1IC2A 1NU1K 1JO5A 3HUSA 3BATA 3RK3D 3U1AA 3M9HA 3LIDA 1M1JB 4EIJA 2XKMA 1RE3A 3NXSA 4ZKPA 2CPBA 3NTNA 4I2LC 2M8RA 2H8PD 4AUWA 1AFOA 3VMXA 5KJ7C 4JF7A 3P32A 1FBMA 3V2NA 2A45H 4DZOA 2YO3A 1HGZA 5AW0B 4WBAA 2I1JA 1NKZB 2FKWB 1NOHA 1W2EA 3MUDA 4N78D 1X79B 1KILD 1KZUB 2GUSA 1H89A 2HLOA 3V4WA 4B86A 1SLQA 5CCGA 5AW7B 2Q7CA 4I6MC 3VMYA 3G3ZA 3HRNA 1LTIC 2J58A 2HODA 2A45I 3L4FA 2WZ7A 1ZN5A 3BVHA 2N1TB 2Q9IA 1SQPK 1ZLLA 1MZ9A 1N7SB 2XV5A 3VN0A 1DEBA 3IR9A 1JY2P 2PP6A 1YYCA 4XE5B 3RL0B 2WSFH 1T2KD 1N7SC 5AVUB 3P8CE 1E5WA 4W7YA 2YKOA 2Z5HA 2O1KA 3RK2B 3HD7D 4WB4A 1MV8A 1ZR4A 1M1JC 1HBWA 5BVZA 1NAFA 4LC1A 2NPSD 5AVZB 3IFMA 3EQ2A 3RK2C 5AVWB 4I1LA 1JOCA 1N73A 3B5ND 4C7RA 3RL0D 2KP8A 2WITA 4DOJA 5CCHD 2LKMA 1CZQA 2JEEA 3CLQA 1N2DC 1RF1C 1KFNA 2R32A 5CCGD 1S9KD 1NTZK 2KLVA 5APWA 1NWQA 1FDMA 2P7JA 2NPSC 1X9VA 3VP9A 3RK2D 4LGDE 5BU8B 3R2PA 3TNUA 1MFZA 1HWTC 2VRSA 1IK9A 4W7ZA 2J59M 2E42A 3A3YB 1GK4A 2XNXA 1GZLA 4N3YB 3M0AA 1G1IA 1A02J 1N7SD 2WTYA 1SFCD 1CSBA 1MUUA 1T3JA 1GW4A 1YTZT 3C9IA 5AW6B 3TYYA 5AVVB 2CPSA 2WT7A 1QL1A 3GHGC 5AVSB 3BASA 5APUA 3M0DA 2OYHB 1GDTA 2Z5IA 1T3UA 2C9LY 1X8YA 5AW3B 1LGHB 1QL2A 2YO2A 1LWUC 2Q3IA 3VTPC 4RESB 1CW5A 3OA7A 4WY4D 3L37A 3V2RA 1KQLA 1LWUB 3OAKA 3HTKB 2ZFCA 5AW5B 2W6BA 1DH3A 3P8MC 1YTZI 3WMM0 3HE5A 2P1JA 3N4XA 3OJAB 3E1IA 2FYUK 1H8AA 2WWWA 1SP4A 1M1JA 4EOTA 3HUSB 5CCHC 1NHLA 4JYCA 5APTA 1VPCA 2IFMA 1S9KE 3HD7C 1L0LK 1EQ7A 5APYA 3V5BA 1ZR2A 5CCHA 1T2KC 3GHGB 1HGVA 3B5NA 2OYIB 1L4AA 1KILC 4GT1A 5AW9B 3SWYA 2N9BA 2FYZA 3M9QA 1RE4C 1VDFA 2OYIC 2PAJA 1GTWA 1M7LA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2QM8 A;  1CZQ A;  2R5D A;  2YNY A;  1JUN A;  2R32 A;  3MGN A;  1FOS E;  3M91 A;  3HE4 A;  1S9K D;  5APW A;  2H7H A;  1HJB A;  1NWQ A;  1GU5 A;  1J2J B;  1OXZ A;  2P7J A;  5AVR B;  1CI6 B;  4AYC A;  4JYB A;  3TNU A;  1MFZ A;  1OWA A;  2WPS A;  3VYI A;  4AQR D;  2VRS A;  5APQ A;  1HWT C;  4C7N B;  2E42 A;  3A3Y B;  3L35 A;  1GK4 A;  2XZR A;  1GZL A;  3M9H A;  3LID A;  1JNM A;  3M0A A;  3V4Q A;  2WPR A;  1A02 J;  3O8Z A;  3NXS A;  2WTY A;  1CSB A;  1MUU A;  5AW6 B;  3NTN A;  4I2L C;  3TYY A;  1H88 A;  3P7K A;  4AUW A;  2ZXE B;  5AVV B;  3VMX A;  3T97 A;  2WT7 A;  3HE4 B;  2JJL A;  3P32 A;  1GD2 E;  2P2U A;  3UIA A;  5AVS B;  5AW8 B;  4C46 A;  2W27 A;  3A2A A;  3TK1 A;  4DZO A;  5AVY B;  2YO3 A;  5APU A;  3M0D A;  5AW0 B;  3KDP B;  2Z5I A;  2C9L Y;  5AW1 B;  1X8Y A;  2QM7 A;  3KQG A;  5AW3 B;  2BAS A;  5AW4 B;  2XU6 A;  2YO2 A;  1HUC A;  1GK6 A;  2Q3I A;  3VTP C;  4RES B;  3L37 A;  2IPP A;  3A5T A;  2W6A A;  1KQL A;  5APX A;  3OAK A;  1GU4 A;  2R3C A;  3L36 A;  2ZFC A;  5AW5 B;  1H89 A;  3V4W A;  1DH3 A;  4B86 A;  3P8M C;  1SLQ A;  5AW7 B;  2Q7C A;  2WT7 B;  4I6M C;  3HE5 A;  3VMY A;  4HYT B;  3NMD A;  1H8A A;  2R5B A;  5AVQ B;  2WWW A;  1FOS F;  5AW2 B;  1SP4 A;  4EOT A;  5APV A;  3B8E B;  4M3L A;  2WPQ A;  1A02 F;  1FAV A;  2XV5 A;  5CMZ A;  5AVT B;  3VN0 A;  4KHX A;  3SWF A;  3IR9 A;  1YYC A;  3M06 A;  4XE5 B;  4C7N A;  4JYC A;  2E43 A;  5APT A;  3TNU B;  1S9K E;  1T2K D;  5APS A;  5AVU B;  3M9B A;  1CI6 A;  3HE5 B;  4GKG A;  5APY A;  3LIE A;  3V5B A;  2Z5H A;  2C9N Y;  3HTK A;  1T2K C;  3I5C A;  3A7O A;  3NFQ A;  3VMZ A;  1MV8 A;  1HBW A;  4GT1 A;  5AW9 B;  2P67 A;  1NAF A;  2N9B A;  4LC1 A;  5AVX B;  5AVZ B;  5AVW B;  3MD0 A;  1G2C B;  2Q5U A;  1IO4 A;  2KP8 A;  1GTW A; 
#chains in the Genus database with same CATH topology
 1L4A B;  4N78 E;  3CC2 P;  2NZ2 A;  2QM8 A;  3L70 G;  4PV1 D;  2YNY A;  2YKP A;  1JUN A;  1LT1 A;  2V4H A;  2JWD A;  1TU3 F;  2YKQ A;  3L71 D;  1T6A A;  1AV1 A;  3H1H G;  1JY2 O;  3RBZ A;  3L74 D;  2B89 A;  3M91 A;  1KD1 Q;  1KB9 D;  2HFE D;  1DD3 A;  3U59 A;  1RF1 A;  4O9B A;  2H7H A;  1NH4 A;  2WVR A;  1OXZ A;  4EYY Q;  2OYH C;  3CX5 D;  2OAR A;  2KNC A;  1BGY D;  1CI6 B;  3G9R A;  3LW5 H;  1U57 A;  1HVV A;  1NU1 D;  2QJK B;  1BSH A;  2BCC J;  1S5L E;  4JYB A;  4H44 C;  2WPS A;  1Q82 Q;  4WY4 C;  5APQ A;  2Y9Z A;  1LP1 B;  1VQ4 P;  4Y99 C;  2IX7 C;  2K9J B;  4PV1 C;  2E74 B;  3H1H D;  1N7S A;  1QEX A;  2QJK C;  3CME P;  1PZQ A;  3JCU H;  1SQB D;  2XZR A;  4WY4 B;  1JNM A;  3CCS P;  4Y99 B;  2WPR A;  1KYO H;  3B71 A;  3CX5 E;  4PV1 B;  3HUS C;  1J1D B;  1EDK A;  2E75 B;  3FXD A;  2Y9Y A;  3KZI H;  1SVF A;  4GOE A;  5TIS E;  3CD6 P;  2HYN A;  3F89 A;  2GM4 A;  2WSC H;  2WPV B;  2OTL P;  3P7K A;  2HG5 D;  4BWN A;  4D6T J;  1SQQ G;  2IFN A;  3T97 A;  1GL2 D;  3CL3 D;  1SQP D;  2Y0D A;  3KPE A;  3SSU A;  3HD7 B;  4BRY B;  3HE4 B;  2JJL A;  1RF1 B;  1KQG B;  3A0H H;  1FZC C;  2P2U A;  1EXI A;  1BSN A;  1JEK A;  3B4S A;  2XDJ A;  5AW8 B;  3UIA A;  2Z4E A;  2W27 A;  3A2A A;  3TK1 A;  1N73 C;  3CI9 A;  3GW6 A;  5H2F H;  1NTM G;  2C0W A;  1OVU A;  1NTM K;  2NPS B;  4U7J A;  5AVY B;  1YBK A;  1USE A;  1JMM A;  3KDP B;  4I7Z B;  5AW1 B;  2HPC B;  3KQG A;  1HH0 A;  2FYU D;  1VQN P;  3KXD A;  1YHQ P;  2XU6 A;  5C39 A;  1YQ3 C;  3O6Q A;  1HUC A;  4OGQ B;  1N8R Q;  1N73 B;  2GA1 A;  1KIL B;  1NTK E;  1LNQ A;  2B87 A;  1RF0 A;  1SQV G;  3L73 G;  3LW5 J;  2WSE H;  3H1J D;  1KMI Z;  1L0N G;  1QX8 A;  3AE8 C;  1WT6 A;  4DJG A;  2IBZ E;  1L0L J;  2A06 D;  3AEE C;  2NPS A;  4HKZ H;  1OZH A;  4OGQ C;  3CCV P;  2W6A A;  2ZT9 D;  3E7K A;  5B5E E;  1GU4 A;  2R3C A;  1VQ5 P;  2JO1 A;  4R4L A;  5GTH E;  3HD7 A;  1OW6 A;  3A0B E;  3H1J J;  1KQS O;  1P84 D;  1KV4 A;  3Q5R A;  1OFC X;  2O1J A;  1PP9 G;  1K9M Q;  3T97 B;  2I1K A;  3MZW B;  2RH0 A;  1IFD A;  1SQV D;  3SFD C;  3NMD A;  2R5B A;  3H1K E;  3V2Q A;  5KLV G;  5KLV K;  1VQ7 P;  5AVQ B;  3PJS K;  1P84 E;  2E76 C;  5AW2 B;  3Q5S A;  5K5G B;  1YI2 P;  3F5H A;  1L4A C;  1GW3 A;  4H44 B;  1FZA A;  1NKN A;  3B8E B;  1NTK J;  3KYQ A;  5APV A;  3VMA A;  1YJN P;  1LTS C;  2FXP A;  2BEZ F;  1A02 F;  1D7M A;  1G1J A;  2G3A A;  2N1T A;  3H32 B;  4KHX A;  2C0X A;  3SWF A;  4LLH A;  1L0L E;  1Z56 A;  1J1E C;  3RK3 B;  4C7N A;  3TNU B;  1S5L X;  1LTB C;  2WSF J;  1VQL P;  4N6J A;  1L0N K;  1FZF A;  1EDJ A;  1GL2 C;  1PGP A;  3G4S P;  1SQX D;  3RL0 g;  2KLU A;  1JY2 N;  3LIE A;  1Q81 Q;  1RE3 C;  3H1L G;  1LTJ C;  2C9N Y;  1IJD B;  2FFD A;  2A45 G;  2E74 C;  3HTK A;  1PL5 A;  2O3J A;  1LWU A;  4HB1 A;  1EDL A;  3VMZ A;  5CCG C;  2KB7 P;  3H6P A;  2N1T D;  1N86 A;  2FXM A;  3H1K D;  3CXH H;  2P67 A;  1VL2 A;  3B5N C;  4PJ0 E;  3PP5 A;  1KIL A;  3MD0 A;  1SQX G;  4I7Z C;  1EDI A;  1NTZ G;  2Q5U A;  3FGA D;  3O6Q B;  4OWF A;  1BGY G;  1SQQ K;  1RF0 C;  1IFI A;  2AXT H;  2D2C D;  2QVA A;  4OGQ D;  2HPC A;  2I8D A;  3QWO C;  1ZW0 A;  5E79 E;  1T2K D;  3CC7 P;  3B5N B;  2OYI A;  4JPZ B;  3L72 G;  4U3F E;  3GHG A;  3VOP A;  5KAF H;  4UB6 H;  1H0T B;  1JY3 P;  1RY3 A;  4H0L D;  4PD4 D;  1KB9 H;  5CHX A;  5CJ0 A;  1DEE G;  3MGN A;  4EI2 A;  1FOS E;  1FJK A;  3GMA A;  2CK3 H;  2IBZ I;  1KFM A;  1PFI A;  1YJ9 P;  1SQB K;  2R44 A;  1GMJ A;  3VP8 A;  1ZRT E;  3II6 A;  1J2J B;  1GU5 A;  1HJB A;  1FZE A;  1YIJ P;  2GUV A;  2L5G B;  2MJZ A;  1RQU A;  2BCC E;  4Z1M H;  4AYC A;  3L75 G;  2ZYA A;  3Q1M A;  1JY3 N;  2DW3 A;  1BE3 J;  3VYI A;  4AQR D;  4YXW H;  2FYU E;  2K1A A;  2YMY A;  4BXL A;  1BCC E;  3L74 J;  4C7N B;  3PH0 A;  3H1K G;  5CJ4 A;  1LTT C;  1LTG C;  1UIX A;  4WY4 A;  3H1I G;  3L35 A;  3MTU E;  1JCD A;  2WSS H;  1RQV A;  1QVG O;  1M8O B;  3V4Q A;  4KJM A;  4ZKU A;  1T8Z A;  2KK7 A;  3O8Z A;  3C1L A;  2JR8 A;  1WMK A;  2HOD B;  2MKV A;  1Y9B A;  5KJ7 A;  4IL6 H;  1H88 A;  1URQ A;  2ZXE B;  2W90 A;  3Q2Y A;  4IFF A;  1FU1 A;  1GL2 A;  1Y47 A;  5L8R J;  1FS0 E;  3TGU G;  1X22 A;  1XTC C;  4D6T G;  1W2B O;  1GD2 E;  3AEG C;  2P58 A;  4C46 A;  2FFD C;  1VQM P;  1BE3 E;  3BRT B;  1HF9 A;  1KN7 A;  1BCC J;  3CPW O;  1JB0 J;  2JP3 A;  3EFG A;  3AEB C;  2IZ0 A;  4YXD C;  1SFC A;  2FYN B;  2QM7 A;  5DJU B;  2BAS A;  5CBN A;  1URQ C;  1J1E B;  1EZV D;  2IDB A;  5AW4 B;  2B87 B;  3RK3 C;  1G2C A;  1NO4 A;  2SPZ A;  2JKV A;  1SQB G;  1HTL C;  1IFJ A;  1GK6 A;  1BE3 D;  1N7L A;  3BRV B;  3M0D C;  2QA4 P;  1RH5 B;  1P84 I;  3MIW A;  4UB8 E;  3RK3 E;  1XTG B;  1LTA C;  1K04 A;  2E5Y A;  5BU5 A;  2IPP A;  2OYH A;  1KYO D;  1S2E A;  3A5T A;  1QVF O;  1FZB A;  1LTJ B;  4ASV A;  5APX A;  3P8C D;  4MN4 C;  4XA4 A;  1LT9 A;  3RBX A;  3TGU E;  1J1D C;  2E75 C;  3L36 A;  3PLN A;  3TSI A;  1H0T A;  3JCU E;  3BCC D;  1PPJ E;  2KOG A;  3L71 E;  2WT7 B;  4IFM A;  1Q90 D;  1SQQ E;  4ZNC A;  5KJ7 D;  1KC8 Q;  3AEF C;  1BE3 G;  1IFP A;  4HYT B;  1KYO E;  2JWA A;  1IFM A;  3RGU A;  3H1J G;  2H43 A;  1AQ5 A;  3KZI E;  3SWK A;  4W80 A;  3H1K J;  1JTH B;  1PP9 J;  1SQP J;  1FZC B;  1USD A;  4DT0 A;  4L75 A;  3IN6 A;  3G6E P;  1FOS F;  4HH2 A;  4PD4 H;  3H32 A;  2FYU G;  4CPG A;  5KLV J;  3W68 A;  4H0L C;  1Q86 Q;  2D2C C;  2Q1K A;  4M3L A;  2WPQ A;  2E75 D;  1FAV A;  4NPD A;  5CMZ A;  1PP9 D;  3ABV C;  3JC2 2;  5AVT B;  3M06 A;  1JY3 O;  2H89 C;  2POH A;  2FY8 A;  1FZC A;  4H0L B;  2E43 A;  2AEJ A;  1L0N E;  5KLV D;  1JTH A;  3ZDM A;  2K9Y A;  5APS A;  1AA0 A;  1FJP A;  3L71 G;  3M9B A;  3D6Z A;  1CI6 A;  3AE2 C;  3HE5 B;  4GKG A;  3GG2 A;  1R5S A;  1SQX K;  2YIU C;  2OYO A;  3IF4 A;  1JCC A;  2QJY C;  2BEQ D;  4NPE A;  1K05 A;  3AEC C;  1NU1 G;  1LT9 B;  1SQP E;  2RN0 A;  3I5C A;  3SFE C;  2KI7 B;  3A7O A;  1LTJ A;  1WRG A;  2M0B A;  3L72 D;  3NFQ A;  4OH8 B;  5KAI H;  4KT0 J;  1QGK B;  4A7P A;  1VQO P;  2ZXX A;  1SFC C;  5KLV E;  2O01 H;  5AVX B;  1LT9 C;  5GTI E;  1AVY A;  3AE3 C;  1EC5 A;  3TDK A;  1L4A D;  5B66 E;  1LJ2 A;  1G2C B;  2IBZ D;  3MHV A;  1IO4 A;  1RHZ B;  1SFC B;  1ZV8 A;  3C8V A;  4U3F J;  1DX7 A;  2KYV A;  1RE4 A;  4TLF A;  2R5D A;  4GOF A;  4GIF A;  4L73 A;  5KTB A;  2KSJ A;  2M3B A;  1IFN A;  2FFD B;  4IFD K;  4GDO A;  1SQV K;  2OQQ A;  4HJG H;  3RL0 C;  3HE4 A;  4IOI H;  3U1C A;  3N7N A;  3V2P A;  1X0T A;  5CBO A;  4BRY A;  3A0H E;  1SQP G;  1GL2 B;  4U3F D;  1NTK K;  5AVR B;  3TGU J;  1URQ B;  2RMZ A;  1FDO A;  1JM0 A;  2KS1 A;  3TF5 A;  2KUB A;  2Y0C A;  2FYU J;  1VF5 D;  2N1T C;  1OWA A;  1FZG A;  3L74 E;  1URQ D;  1IC2 A;  1NU1 K;  1JO5 A;  2ZVO B;  4RKU J;  1U7J A;  1QLE D;  2NRG A;  3HUS A;  3TGU D;  3BAT A;  3RK3 D;  3U1A A;  3CMA P;  1OVR A;  1KB9 I;  3LID A;  1M1J B;  3M9H A;  1NGM B;  3CWB E;  2M5A B;  2B9B A;  1YQ4 C;  2XKM A;  4EIJ A;  2D2C B;  1L0N D;  1VQ6 P;  1LP1 A;  1RE3 A;  3CX5 I;  3NXS A;  3D71 A;  3Q3D A;  2G8Y A;  4ZKP A;  2CPB A;  3NTN A;  4I2L C;  2R3S A;  2M8R A;  2H8P D;  5GTH H;  4AUW A;  2KNC B;  3VMX A;  1AFO A;  3CCL P;  2AEM A;  5KJ7 C;  4JF7 A;  2ZJS E;  3H1I D;  1NJI Q;  1OX3 A;  3P32 A;  4WWI A;  1NTM E;  5E79 H;  1FBM A;  1M57 D;  3V2N A;  1VF5 B;  1ZP0 C;  2A45 H;  3R4Y A;  4DZO A;  1NU1 E;  2YO3 A;  1P84 H;  4QMA A;  1HGZ A;  1OW8 A;  4XFJ A;  5AW0 B;  3I55 P;  2OGU A;  1KYO I;  2I1J A;  4WBA A;  5EFW B;  1NTK G;  1NYH A;  3FWN A;  1NKZ B;  1SQQ D;  2FKW B;  3CC4 P;  2P10 A;  1NOH A;  3FX0 A;  1DIP A;  1W2E A;  3CWB J;  3MUD A;  2PRR A;  1X79 B;  4N78 D;  3CCR P;  1BDC A;  2IYP A;  1KIL D;  1SQB J;  1SQV E;  3CCM P;  2YIU B;  1YIT P;  4WVZ A;  1KZU B;  2GUS A;  3ITK A;  1H89 A;  2HLO A;  3WUT A;  3L71 J;  3V4W A;  1Q7Y Q;  4B86 A;  1SQQ J;  1SLQ A;  2IZ1 A;  2V7Q H;  5AW7 B;  2Q7C A;  2QG4 A;  4I6M C;  4H13 D;  3VMY A;  3WU2 H;  4DCK A;  1M1K Q;  2A06 E;  2E5T A;  3G3Z A;  3HRN A;  1KTM A;  1PP9 E;  1LTI C;  2J58 A;  1NU1 J;  2HOD A;  3E1R A;  2W83 C;  4IL6 E;  4RO0 A;  2A45 I;  3W67 A;  3L4F A;  4L76 A;  3CXH E;  2YXQ B;  2WZ7 A;  3CCE P;  2M5A A;  1NAY A;  1ZN5 A;  3BVH A;  1ZME C;  2N1T B;  1SQX J;  1EZV G;  2Q9I A;  1SQP K;  1PGJ A;  1ZLL A;  1MZ9 A;  5DJT B;  4NPF X;  3S4R A;  1N7S B;  2FYN C;  2XV5 A;  1S3J A;  3GF3 A;  2LXB A;  1DEB A;  3FWL A;  3RL0 B;  3VN0 A;  3L70 E;  3Q5P A;  1PV3 A;  3IR9 A;  1JY2 P;  1SQV J;  1U7M A;  1YYC A;  2ITA A;  2PP6 A;  2WSF H;  4GOD A;  2QJP C;  1L0N J;  4UB6 E;  4XE5 B;  3S9O A;  2YMK A;  1OVV A;  1M56 D;  1KB9 E;  1PGQ A;  1N7S C;  2QRX A;  3KHU A;  1S5L H;  2ZVN B;  5AVU B;  2WSC J;  1YJW P;  1FE6 A;  5B5E H;  3P8C E;  3H1L E;  5M1B A;  2W8Z A;  2ZYG A;  3AE6 C;  1E5W A;  2QJP B;  3AE4 C;  2FBW C;  1NTZ D;  3A0B H;  4W7Y A;  2YKO A;  2Z5H A;  3CCU P;  1ZOY C;  3L73 D;  4UB8 H;  3L75 J;  2QEX P;  1BCC D;  4YPC A;  2O1K A;  1HJ0 A;  2KIK A;  3RK2 B;  2B88 A;  3HD7 D;  1Q2N A;  3CX5 H;  2QIW A;  3L70 D;  4OVN F;  4WB4 A;  1MV8 A;  4RJT A;  2QE7 H;  1R8E A;  3G71 P;  1ZR4 A;  1EZV E;  1M1J C;  2HR3 A;  2ZYD A;  4H44 D;  1HBW A;  1SQX E;  5BVZ A;  3H25 A;  3CCQ P;  1NAF A;  4LC1 A;  2NPS D;  5AVZ B;  2PFX A;  3EQ2 A;  3IFM A;  5AVW B;  3CXH D;  5KLI C;  4I1L A;  2KZI A;  1JOC A;  3RK2 C;  1N73 A;  3B5N D;  4C7R A;  1IK7 A;  1OIP A;  3L70 J;  4H13 B;  2KP8 A;  3RL0 D;  3MUD C;  1ZRT D;  2WIT A;  4DOJ A;  3L75 D;  3AED C;  4TT3 H;  1S4X A;  5CCH D;  1BGY E;  2LKM A;  1CZQ A;  2JEE A;  2FXO A;  3CLQ A;  5H2F E;  4ASW A;  2OTK E;  1N2D C;  1RF1 C;  4IL6 X;  2K3R A;  1KFN A;  1VF5 C;  2AXC A;  2R32 A;  3S1K A;  5CCG D;  2Q3E A;  1NTZ K;  2KLV A;  2ZT9 B;  5APW A;  3AE7 C;  1S9K D;  2L91 A;  2Y0E A;  1NWQ A;  1FDM A;  2BCC G;  1L2P A;  2P7J A;  2NPS C;  1X9V A;  3VP9 A;  3RK2 D;  3CXH I;  4LGD E;  5BU8 B;  3D6Y A;  1BCC G;  3R2P A;  1MFT A;  1DD4 A;  1MFZ A;  2A06 G;  2E76 D;  4YTP C;  3TNU A;  2VRS A;  1M90 Q;  2QJY B;  1IK9 A;  4W7Z A;  1HWT C;  1E79 H;  2AEF A;  2H88 C;  2J59 M;  2E42 A;  3A3Y B;  1GK4 A;  4D6T D;  4PJ0 H;  1FC2 C;  2XNX A;  1GZL A;  2BCC D;  2IBZ G;  4N3Y B;  3GF7 A;  3M0A A;  3H1I E;  3I56 P;  1G1I A;  1BGY J;  2AXT E;  3K5B A;  1A02 J;  3AE5 C;  1N7S D;  1NTM D;  5KAI E;  1SFC D;  2WTY A;  1CSB A;  1MKM A;  1MUU A;  1T3J A;  1GW4 A;  1YTZ T;  3C9I A;  5AW6 B;  3H1H J;  3TYY A;  5GTI H;  5AVV B;  1FDI A;  3PHL A;  4D6T E;  5B66 H;  2CPS A;  2XND H;  2WT7 A;  1QL1 A;  5TJH A;  3GHG C;  1NTM J;  1R5L A;  5AVS B;  2WSE J;  3AE1 C;  2E76 B;  3BAS A;  1OW7 A;  2WMM A;  3CWB D;  4Y28 J;  5KKZ C;  4ZMD A;  4L74 A;  5APU A;  1UII A;  3M0D A;  2OYH B;  1GDT A;  1Y8A A;  1T3U A;  2Z5I A;  1X8Y A;  2C9L Y;  5AW3 B;  3L74 G;  1LGH B;  1QL2 A;  2YO2 A;  2PGD A;  5KKZ B;  1LWU C;  1L0L G;  2Q3I A;  3VTP C;  3H1I J;  2LR2 A;  4RES B;  1CW5 A;  3BCC J;  3FXE A;  1SQB E;  3OA7 A;  3L37 A;  1SS1 A;  4PD4 I;  4WY4 D;  3V2R A;  1VQK P;  3CWB G;  1BDD A;  3H1H E;  4H13 C;  1KQF B;  1KQL A;  1LWU B;  1VQP P;  3OAK A;  1PPJ G;  3HTK B;  4R4M A;  2ZFC A;  5AW5 B;  1NTK D;  2W6B A;  1DH3 A;  3P8M C;  1YTZ I;  2IYO A;  3WMM 0;  3H1J E;  4JBZ A;  3HE5 A;  3EFF K;  1L0L D;  2P1J A;  3N4X A;  3OJA B;  3E1I A;  2FYU K;  5TIS H;  1EXJ A;  2RKL A;  2K37 A;  2KXP B;  5CCG A;  1K8A Q;  1H8A A;  2O01 N;  2KSE A;  5KLI B;  2WWW A;  1IZN B;  1AJY A;  5KAF E;  1KOR A;  1PPJ D;  1SP4 A;  3WUU A;  1M1J A;  3EWK A;  1NTZ E;  4EOT A;  2W6J H;  3USS A;  2V7Q J;  1S72 P;  3HUS B;  3H1L D;  3L73 J;  1PIX A;  3BCC E;  1EZV I;  1JMB A;  1AQT A;  1NHL A;  2K9J A;  3L72 E;  2ZAE B;  4JQ0 D;  4U3F G;  5CCH C;  3OW2 O;  1W5C E;  2ZT9 C;  3AE9 C;  3PRJ A;  2N9Y B;  4JYC A;  2OTJ P;  5APT A;  3WUV A;  1VPC A;  2IFM A;  2K88 A;  3AEA C;  1S9K E;  2KS1 B;  3V6I A;  1VQ9 P;  3HD7 C;  2J5U A;  3H1L J;  1VQ8 P;  3D70 A;  3IAO A;  4K35 A;  1L0L K;  1EQ7 A;  2QSI A;  2M3E A;  1S1C X;  5APY A;  1K73 Q;  3V5B A;  2Q6Q A;  1NVO A;  3L75 E;  1ZR2 A;  2KZJ A;  5CCH A;  1T2K C;  1OMI A;  4EDF A;  2JDI H;  3JSV C;  1AVO A;  3GHG B;  1HGV A;  3B5N A;  2OYI B;  2UWJ E;  1L4A A;  2YXR B;  1KIL C;  3MP7 B;  1ZXG A;  3GLM A;  3QH9 A;  2WQY C;  1NTZ J;  4GT1 A;  5AW9 B;  2LXC B;  3SWY A;  2N9B A;  3PTZ A;  4PD4 E;  3BCC G;  4K3A A;  2FYZ A;  2E74 D;  3L73 E;  3WU2 E;  3M9Q A;  3CCJ P;  1RE4 C;  2O01 J;  1VDF A;  2OYI C;  2PAJ A;  3L72 J;  1KIL E;  1GTW A;  1PGO A;  1M7L A; 
#chains in the Genus database with same CATH homology
 1L4A B;  4N78 E;  2QM8 A;  1JUN A;  2YNY A;  2YKP A;  2YKQ A;  1JY2 O;  3M91 A;  2HFE D;  3U59 A;  1RF1 A;  4O9B A;  2H7H A;  1NH4 A;  1OXZ A;  2OYH C;  2OAR A;  3LW5 H;  1CI6 B;  1HVV A;  4JYB A;  2WPS A;  4WY4 C;  5APQ A;  4Y99 C;  2IX7 C;  1N7S A;  2XZR A;  4WY4 B;  1JNM A;  4Y99 B;  2WPR A;  3HUS C;  1J1D B;  1SVF A;  2HYN A;  2GM4 A;  2WSC H;  3P7K A;  2HG5 D;  2IFN A;  3T97 A;  1GL2 D;  3CL3 D;  1RF1 B;  3KPE A;  3HD7 B;  3HE4 B;  2JJL A;  1FZC C;  2P2U A;  3UIA A;  5AW8 B;  2XDJ A;  2Z4E A;  2W27 A;  3A2A A;  3TK1 A;  1N73 C;  3CI9 A;  2C0W A;  5AVY B;  2H43 A;  1NTM K;  2NPS B;  1JMM A;  3KDP B;  5AW1 B;  2HPC B;  3KQG A;  1HH0 A;  2XU6 A;  1HUC A;  1N73 B;  1KIL B;  1RF0 A;  2WSE H;  1WT6 A;  2NPS A;  2W6A A;  1GU4 A;  2R3C A;  3HD7 A;  2O1J A;  2I1K A;  1IFD A;  3NMD A;  2R5B A;  5KLV K;  3V2Q A;  5AVQ B;  5AW2 B;  1L4A C;  1GW3 A;  1FZA A;  1NKN A;  3B8E B;  3KYQ A;  5APV A;  1LTS C;  1A02 F;  2N1T A;  1G1J A;  4KHX A;  3H32 B;  3SWF A;  2C0X A;  4LLH A;  1Z56 A;  1J1E C;  3RK3 B;  4C7N A;  3TNU B;  1LTB C;  4N6J A;  1L0N K;  1FZF A;  1GL2 C;  1JY2 N;  3LIE A;  1RE3 C;  1LTJ C;  2C9N Y;  1IJD B;  2FFD A;  2A45 G;  3HTK A;  1LWU A;  3VMZ A;  5CCG C;  2KB7 P;  3H6P A;  2N1T D;  1N86 A;  2FXM A;  2P67 A;  3B5N C;  3PP5 A;  1KIL A;  3MD0 A;  2Q5U A;  1SQQ K;  1RF0 C;  1IFI A;  2HPC A;  3B5N B;  2OYI A;  3GHG A;  3VOP A;  1JY3 P;  1RY3 A;  5CJ0 A;  5CHX A;  1PFI A;  3MGN A;  1FOS E;  1FJK A;  1KFM A;  1SQB K;  3VP8 A;  1HJB A;  1GU5 A;  3II6 A;  1J2J B;  1FZE A;  2GUV A;  2L5G B;  2MJZ A;  4AYC A;  1JY3 N;  3VYI A;  4AQR D;  2YMY A;  4C7N B;  5CJ4 A;  1LTT C;  1LTG C;  4WY4 A;  3L35 A;  3MTU E;  1JCD A;  3V4Q A;  4ZKU A;  1T8Z A;  3O8Z A;  2HOD B;  5KJ7 A;  1H88 A;  1URQ A;  2ZXE B;  4IFF A;  1FU1 A;  1GL2 A;  1XTC C;  1GD2 E;  4C46 A;  2FFD C;  3BRT B;  3EFG A;  1SFC A;  2QM7 A;  2BAS A;  1URQ C;  1J1E B;  5AW4 B;  3RK3 C;  1G2C A;  1NO4 A;  3BRV B;  1HTL C;  3M0D C;  1IFJ A;  1GK6 A;  1N7L A;  3MIW A;  1XTG B;  1LTA C;  5BU5 A;  2OYH A;  2IPP A;  3A5T A;  1FZB A;  1LTJ B;  5APX A;  3P8C D;  4XA4 A;  1LT9 A;  1J1D C;  3L36 A;  3TSI A;  2KOG A;  2WT7 B;  4IFM A;  5KJ7 D;  4HYT B;  1IFM A;  1AQ5 A;  4W80 A;  1JTH B;  1FZC B;  1FOS F;  4HH2 A;  3H32 A;  4M3L A;  2WPQ A;  1FAV A;  5CMZ A;  5AVT B;  3M06 A;  1JY3 O;  2POH A;  1FZC A;  2E43 A;  1JTH A;  5APS A;  1FJP A;  3M9B A;  1CI6 A;  3HE5 B;  4GKG A;  1SQX K;  1JCC A;  1LT9 B;  3I5C A;  3A7O A;  1LTJ A;  1WRG A;  3NFQ A;  4OH8 B;  1SFC C;  2O01 H;  5AVX B;  1LT9 C;  1L4A D;  1G2C B;  1IO4 A;  1SFC B;  1ZV8 A;  1DX7 A;  2KYV A;  1RE4 A;  2R5D A;  4GIF A;  5KTB A;  2KSJ A;  2M3B A;  1IFN A;  2FFD B;  4IFD K;  1SQV K;  3U1C A;  3RL0 C;  3HE4 A;  3N7N A;  3V2P A;  1GL2 B;  1NTK K;  5AVR B;  1URQ B;  1FZG A;  2N1T C;  1OWA A;  1URQ D;  1IC2 A;  1NU1 K;  1JO5 A;  3HUS A;  3BAT A;  3RK3 D;  3U1A A;  3M9H A;  3LID A;  1M1J B;  4EIJ A;  2XKM A;  1RE3 A;  3NXS A;  4ZKP A;  2CPB A;  3NTN A;  4I2L C;  2M8R A;  2H8P D;  4AUW A;  1AFO A;  3VMX A;  5KJ7 C;  4JF7 A;  3P32 A;  1FBM A;  3V2N A;  2A45 H;  4DZO A;  2YO3 A;  1HGZ A;  5AW0 B;  4WBA A;  2I1J A;  1NKZ B;  2FKW B;  1NOH A;  1W2E A;  3MUD A;  4N78 D;  1X79 B;  1KIL D;  1KZU B;  2GUS A;  1H89 A;  2HLO A;  3V4W A;  4B86 A;  1SLQ A;  5CCG A;  5AW7 B;  2Q7C A;  4I6M C;  3VMY A;  3G3Z A;  3HRN A;  1LTI C;  2J58 A;  2HOD A;  2A45 I;  3L4F A;  2WZ7 A;  1ZN5 A;  3BVH A;  2N1T B;  2Q9I A;  1SQP K;  1ZLL A;  1MZ9 A;  1N7S B;  2XV5 A;  3VN0 A;  1DEB A;  3IR9 A;  1JY2 P;  2PP6 A;  1YYC A;  4XE5 B;  3RL0 B;  2WSF H;  1T2K D;  1N7S C;  5AVU B;  3P8C E;  1E5W A;  4W7Y A;  2YKO A;  2Z5H A;  2O1K A;  3RK2 B;  3HD7 D;  4WB4 A;  1MV8 A;  1ZR4 A;  1M1J C;  1HBW A;  5BVZ A;  1NAF A;  4LC1 A;  2NPS D;  5AVZ B;  3IFM A;  3EQ2 A;  3RK2 C;  5AVW B;  4I1L A;  1JOC A;  1N73 A;  3B5N D;  4C7R A;  3RL0 D;  2KP8 A;  2WIT A;  4DOJ A;  5CCH D;  2LKM A;  1CZQ A;  2JEE A;  3CLQ A;  1N2D C;  1RF1 C;  1KFN A;  2R32 A;  5CCG D;  1S9K D;  1NTZ K;  2KLV A;  5APW A;  1NWQ A;  1FDM A;  2P7J A;  2NPS C;  1X9V A;  3VP9 A;  3RK2 D;  4LGD E;  5BU8 B;  3R2P A;  3TNU A;  1MFZ A;  1HWT C;  2VRS A;  1IK9 A;  4W7Z A;  2J59 M;  2E42 A;  3A3Y B;  1GK4 A;  2XNX A;  1GZL A;  4N3Y B;  3M0A A;  1G1I A;  1A02 J;  1N7S D;  2WTY A;  1SFC D;  1CSB A;  1MUU A;  1T3J A;  1GW4 A;  1YTZ T;  3C9I A;  5AW6 B;  3TYY A;  5AVV B;  2CPS A;  2WT7 A;  1QL1 A;  3GHG C;  5AVS B;  3BAS A;  5APU A;  3M0D A;  2OYH B;  1GDT A;  2Z5I A;  1T3U A;  2C9L Y;  1X8Y A;  5AW3 B;  1LGH B;  1QL2 A;  2YO2 A;  1LWU C;  2Q3I A;  3VTP C;  4RES B;  1CW5 A;  3OA7 A;  4WY4 D;  3L37 A;  3V2R A;  1KQL A;  1LWU B;  3OAK A;  3HTK B;  2ZFC A;  5AW5 B;  2W6B A;  1DH3 A;  3P8M C;  1YTZ I;  3WMM 0;  3HE5 A;  2P1J A;  3N4X A;  3OJA B;  3E1I A;  2FYU K;  1H8A A;  2WWW A;  1SP4 A;  1M1J A;  4EOT A;  3HUS B;  5CCH C;  1NHL A;  4JYC A;  5APT A;  1VPC A;  2IFM A;  1S9K E;  3HD7 C;  1L0L K;  1EQ7 A;  5APY A;  3V5B A;  1ZR2 A;  5CCH A;  1T2K C;  3GHG B;  1HGV A;  3B5N A;  2OYI B;  1L4A A;  1KIL C;  4GT1 A;  5AW9 B;  3SWY A;  2N9B A;  2FYZ A;  3M9Q A;  1RE4 C;  1VDF A;  2OYI C;  2PAJ A;  1GTW A;  1M7L A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...