4EOTA

Crystal structure of the mafa homodimer bound to the consensus mare
Total Genus 39
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
39
sequence length
92
structure length
92
Chain Sequence
RFSDDQLVSMSVRELNRQLRGFSKEEVIRLKQKRRTLKNRGYAQSCRFKRVQQRHILESEKCQLQSQVEQLKLEVGRLAKERDLYKEKYEKL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Novel DNA Binding Mechanism for maf Basic Region-Leucine Zipper Factors Inferred from a MafA-DNA Complex Structure and Binding Specificities.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords Transcription factor MafA
total genus 39
structure length 92
sequence length 92
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF03131 bZIP_Maf bZIP Maf transcription factor
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4eotA00
2IPPA 4HYTB 3TNUA 2H7HA 2N9BA 5AVWB 5AW1B 3A3YB 2WPQA 2R32A 5AVTB 1A02F 5AVUB 4AQRD 3M9BA 2W6AA 1MFZA 2YO3A 1S9KD 5APVA 1CI6B 3P7KA 3M0AA 1CZQA 3TYYA 2WTYA 4EOTA 1FOSE 3MD0A 3L35A 3V5BA 5APQA 4JYCA 2KP8A 3T97A 1OXZA 3KQGA 3NFQA 1OWAA 2WT7B 3VTPC 2R5BA 3VMYA 3V4QA 2ZXEB 1JUNA 5AVQB 4GKGA 1T2KC 2ZFCA 3VMXA 3B8EB 4C7NB 5APYA 5AW6B 1GK6A 5AVZB 5CMZA 3OAKA 2WT7A 2WWWA 4M3LA 1GU5A 5AW9B 1J2JB 2P7JA 2P2UA 3HE4A 4XE5B 2XV5A 3NMDA 5APSA 3I5CA 1NAFA 1H89A 2Q3IA 2Q7CA 3VMZA 2Q5UA 1GZLA 3SWFA 1KQLA 3A5TA 3NTNA 3M91A 3V4WA 2E42A 3KDPB 2QM7A 2YO2A 5AVSB 5APWA 3P32A 1HJBA 3VYIA 3TNUB 4DZOA 1JNMA 1GD2E 4I6MC 4I2LC 1GU4A 1X8YA 1SP4A 2Z5IA 3HE5A 3M0DA 1FOSF 2C9LY 3L37A 3M06A 3P8MC 1CI6A 3M9HA 1H88A 1MV8A 5AVRB 5AVXB 3LIEA 5AW4B 3A7OA 3HE4B 3UIAA 1S9KE 1T2KD 2P67A 2JJLA 1FAVA 2BASA 3MGNA 3O8ZA 1CSBA 1YYCA 4C7NA 2WPRA 4JYBA 1HWTC 5APUA 1GK4A 5AW2B 1H8AA 3HTKA 2XU6A 5AW8B 2R5DA 1DH3A 4AYCA 5APTA 3TK1A 1A02J 5AW0B 5AVYB 4RESB 4C46A 5AW3B 5AW7B 3VN0A 5AW5B 4LC1A 1MUUA 2W27A 2Z5HA 4GT1A 5APXA 1G2CB 1GTWA 2WPSA 2YNYA 2C9NY 2R3CA 3A2AA 3L36A 2VRSA 1HBWA 5AVVB 2QM8A 3LIDA 1HUCA 2XZRA 3IR9A 3NXSA 3HE5B 4B86A 1IO4A 2E43A 4AUWA 4KHXA 1SLQA 1NWQA
chains in the Genus database with same CATH superfamily
1EDKA 3H1IJ 4PD4E 4HYTB 1FJPA 4N78D 1HF9A 2H7HA 2N9BA 4YPCA 1G2CA 1M56D 1NTZD 2FXPA 3H1IE 5CJ4A 1J1EB 3RK2D 1HGVA 1RY3A 2W90A 3PP5A 4H13D 3RGUA 5KLIB 2E74C 3HUSB 3CL3D 1N73A 1SQPE 1JY3N 1RE3A 1SQQD 4TT3H 1L0LD 3H1JE 3IAOA 5CHXA 1CI6B 4UB6H 1T8ZA 1NU1D 1QVFO 1IJDB 1XTGB 3L72E 1URQD 2MKVA 1PL5A 1OZHA 1PV3A 2O1JA 3MHVA 5APQA 4EIJA 3V6IA 1SQXG 2FYUD 2FFDB 1JEKA 3L71G 2OYIB 5KJ7A 2IFNA 3Q5RA 1JUNA 3H1LE 1X0TA 2JP3A 1NWQA 3M9QA 3LW5H 4H0LB 2NPSD 2YXQB 1T2KC 1JMBA 2XNDH 2YKPA 3G6EP 4D6TE 1OW8A 3OAKA 3QH9A 2G8YA 5KJ7D 1LTAC 2N1TD 2V4HA 2OYHB 2KNCA 2OYIC 1BGYJ 3IFMA 1A02F 1PPJG 1KMIZ 2A45I 2ZAEB 1J2JB 1LJ2A 3O6QB 3GF3A 1BGYE 1QLED 2O3JA 3B5NA 2YMKA 4NPEA 5APSA 3WU2E 4LGDE 1SQPJ 1JY2N 1RHZB 4W80A 1DEBA 1AVOA 2Q3IA 1H89A 4U3FD 1N86A 2IYOA 1FS0E 1KORA 4HH2A 4DOJA 1M1JC 3SWFA 3A5TA 3NTNA 3M91A 3CXHE 2BCCJ 1LWUB 1IFJA 3KDPB 3D6ZA 2P10A 2H43A 1EDJA 3JCUE 1FZAA 2WSCH 2WQYC 3BCCD 3HD7C 2CK3H 3L74D 3P32A 3VYIA 1HJBA 4HJGH 1IFDA 2PGDA 3TNUB 3WMM0 2GM4A 1PP9E 1H0TA 1ZW0A 1NTME 2NPSB 4GIFA 2JDIH 2WSFJ 1LTJC 4I6MC 4PV1D 2IBZE 1LWUC 1N7SA 1NTMJ 3M0DA 1FOSF 2C9LY 4WY4A 1JTHB 2O01J 2PRRA 1LTTC 2ZT9C 2WPVB 3L71J 1BCCJ 3U1CA 2M0BA 4YXDC 3P8MC 1LP1A 3AEBC 1L4AA 3M9HA 4PD4I 5DJTB 1SQQK 3A0BH 1EZVG 4WY4B 5KLVK 3A7OA 1SS1A 3HE4B 3CX5E 1NU1E 1FAVA 1WMKA 1FC2C 3GW6A 2WSCJ 2WPRA 4JYBA 1ZRTE 2BCCE 3SWYA 1RQVA 2D2CC 5APUA 2OQQA 1P84D 2M5AB 1N7SD 2YIUC 3HTKA 1H8AA 1FDOA 1FZGA 2RN0A 4JQ0D 1NJIQ 3L4FA 2AXTH 4IL6X 3CCMP 3H1LG 4JBZA 1G1IA 4LLHA 3TK1A 1LT9A 3MUDA 1OIPA 2GA1A 3VOPA 1VQNP 3H1IG 3HTKB 4C46A 3AE8C 3OA7A 1QL2A 4D6TG 2KK7A 1KTMA 4YXWH 1RF1A 1NKZB 1H0TB 2R3SA 1SQPG 4H0LC 3ITKA 1EDIA 1GW4A 2QSIA 2FFDC 2E75B 3H32B 1VQ6P 1BGYG 3II6A 3P8CD 3L72G 2AXCA 1KB9D 4I7ZC 1FBMA 4N3YB 3B5ND 3CLQA 1S4XA 1L0LJ 2E76C 2R3CA 2YNYA 3GHGC 1OVVA 2O1KA 5K5GB 2P58A 1SQVK 3L36A 3ZDMA 1JY3O 5KKZB 1IFNA 3CX5D 5AVVB 1HBWA 1KD1Q 2QIWA 3AEEC 1Y8AA 1XTCC 1HGZA 1HUCA 3AE3C 2XZRA 3HUSC 2O01H 3LIDA 5BU5A 1RE3C 1YQ3C 4OGQB 3CC7P 1Y47A 3IR9A 3OW2O 1FZCB 4IFDK 3L75G 2N9YB 3H1JJ 1IO4A 1P84H 2WSEJ 4AUWA 2YMYA 2A45G 1KFNA 2IPPA 5KLVD 1SFCB 3GMAA 2IBZG 5AVWB 5AW1B 4C7RA 3W68A 5B5EH 2LR2A 3I56P 2WPQA 3TGUG 1M7LA 4PD4H 3G4SP 3D71A 2M3BA 1T3UA 4AQRD 1SQPK 1WRGA 3EFGA 1Y9BA 1URQA 1FE6A 3SWKA 3A0HH 3L73J 1KILD 3U1AA 3P7KA 1DEEG 3M0AA 4D6TJ 2Q9IA 3N7NA 1BSNA 3L73E 1CW5A 1OFCX 4O9BA 3V5BA 1AA0A 3FWNA 1W5CE 4R4LA 1QX8A 1SQVJ 1OXZA 1KYOI 1URQB 1KB9H 2KP8A 3EFFK 3H1LJ 1S5LX 1NYHA 2BCCD 2FKWB 1JB0J 4IFMA 1N7SB 5CCGC 3V2NA 2QA4P 5CCHC 1AV1A 1IK9A 2OYHA 1IK7A 2ZFCA 3TF5A 2WVRA 1YIJP 4C7NB 1USDA 2KLUA 2D2CB 3F89A 4JF7A 3CXHD 2D2CD 3KZIE 2WWWA 3AE4C 1MZ9A 4L74A 1ZXGA 1JCDA 3B4SA 1YTZT 3V2QA 5AW9B 1RE4A 2NZ2A 2P7JA 1YHQP 1PZQA 2IYPA 4WVZA 2AEMA 1IFPA 3AE7C 1L0ND 1MKMA 3L70J 1PP9J 1LTJB 3AE1C 4WY4D 2L91A 3CI9A 4PJ0E 2Q5UA 1KILB 5B5EE 1KV4A 3B5NB 1KQLA 3L72D 1SQBE 4A7PA 3MTUE 3L72J 3VP8A 1PIXA 2POHA 2YO2A 1KYOE 4ZNCA 1K04A 1SQPD 2KYVA 3E1RA 1RH5B 5APWA 1Q82Q 1JCCA 4D6TD 2LXCB 3B71A 4NPDA 3S4RA 2YXRB 3D70A 2O01N 3BASA 2K9JB 3LW5J 3AECC 4I2LC 5E79H 4UB8H 3CC4P 3PH0A 2QVAA 1EXIA 3HE5A 1NO4A 4GODA 2W83C 1JOCA 1GL2C 2K9YA 3L37A 2ITAA 3MZWB 4ZMDA 1CI6A 2I8DA 4I1LA 4XFJA 1SQQE 2E5YA 2OYOA 1YBKA 3RBZA 4ASVA 3TGUD 1H88A 4EYYQ 2A06E 2QG4A 1LT9C 1VQ4P 1SFCC 1W2EA 1S9KE 1Q7YQ 1Q81Q 2RMZA 1T6AA 1FZBA 2FYZA 1HTLC 1YQ4C 2H89C 1OVRA 2JEEA 2K3RA 2P67A 3F5HA 3HD7A 1YYCA 3W67A 3RK3C 3RBXA 4PJ0H 5TISE 3D6YA 2IFMA 3FGAD 1VF5D 1NTZE 3CXHI 1G1JA 1OW7A 1Q90D 2OTJP 1U57A 1RF1B 3GF7A 5AW8B 1PGQA 1DH3A 2KSEA 4AYCA 1VPCA 1EZVI 5APTA 1ZLLA 3WUVA 2DW3A 1URQC 2ZYGA 3H1KE 1YJ9P 1FDIA 4WY4C 2NPSA 1D7MA 1HH0A 1U7JA 2IBZI 1DIPA 1MUUA 2WITA 2FY8A 1L0NG 2FYUJ 4UB8E 1FZEA 2NPSC 1JMMA 1SQXJ 2W27A 1K9MQ 3IF4A 1VQMP 2B89A 2P1JA 2QJKC 1M8OB 4GT1A 4DCKA 2FXOA 1GMJA 2YIUB 3HD7D 1G2CB 4RKUJ 2XKMA 1IZNB 3AEGC 2WPSA 3H6PA 4U3FG 2YKQA 1HVVA 2VRSA 1VQKP 3AEFC 1AQ5A 1VL2A 1S72P 1LTBC 2HPCA 2J59M 1HWTC 1EXJA 1PPJD 2W6BA 1P84E 3CXHH 1M1JA 3WUUA 1X9VA 1JTHA 1VQOP 2BCCG 3H1HE 1BDCA 1FDMA 2B87A 2FXMA 2Q6QA 2E43A 3AEDC 2J5UA 4IL6H 1SLQA 3AE5C 4GOFA 2LKMA 3TSIA 3FWLA 1J1DB 3FX0A 4OH8B 4U3FJ 3A3YB 1VQ7P 3L71D 3V2RA 5AVTB 1JO5A 1L0NJ 2FYUG 3K5BA 1BDDA 1EZVE 3JSVC 1LWUA 3KHUA 4Z1MH 1KB9E 1L0NK 2W6AA 3OJAB 1KYOD 2YO3A 4PV1C 3RL0B 1M57D 1S9KD 3PLNA 4K3AA 5APVA 5KAFE 2IBZD 1NU1G 3BRTB 4XA4A 4DT0A 3Q5SA 2JR8A 3TYYA 4HB1A 5KLVG 1L0LG 2WTYA 5H2FE 3MD0A 3A0HE 4K35A 1YI2P 1S5LE 3L75D 4H44C 3BCCE 1KC8Q 2QJYB 3NFQA 5KKZC 1KB9I 1OWAA 1X22A 3SFEC 2R5BA 1NTZG 5L8RJ 3VTPC 2E76B 2QJPB 5AVQB 2UWJE 3L70E 3TDKA 3WUTA 3VP9A 1ZMEC 1SFCA 1EQ7A 3VMXA 3B8EB 5APYA 5AW6B 2I1KA 5AVZB 1UIXA 1FU1A 4JPZB 5CMZA 2KIKA 2PP6A 4OVNF 2IX7C 4H44B 3E1IA 3CCLP 1QEXA 2HFED 2QJYC 2ZYDA 1GU5A 1BGYD 2A06G 2WZ7A 3MUDC 4ASWA 1L0NE 2E75D 1GDTA 2LXBA 2XV5A 3NMDA 2K37A 1OW6A 3L74J 1NAFA 4IOIH 3E7KA 3RL0D 4R4MA 1VQLP 1SQBJ 3O6QA 2ZVNB 1VQ9P 1L4AB 3VMZA 1SQBK 3RL0g 1PGPA 5CCHA 3H1ID 4U3FE 5DJUB 3EWKA 3V4WA 3N4XA 3GHGA 3I55P 3L75J 3H32A 2QM7A 3H1LD 1SQVG 3MP7B 2QEXP 1BCCD 4OGQD 2Z4EA 3CCUP 3L75E 1SQXK 2CPSA 2Y9YA 3H1KG 3CWBE 1NTMD 4Y99B 2KUBA 2E76D 2JO1A 5KLIC 1L4AC 5TJHA 1S5LH 4DZOA 1JNMA 3GHGB 3CCEP 1RE4C 1U7MA 3CD6P 2V7QH 1EDLA 3HRNA 1LTGC 1EC5A 1SP4A 4Y28J 3SFDC 2FYUK 4ZKUA 3MIWA 1EZVD 1FZCC 1MV8A 1T3JA 1N7LA 1E79H 2KOGA 1K05A 5AVRB 3LIEA 5AW4B 4OWFA 3RK3E 2M3EA 4BRYA 3H1JG 3C9IA 1N73B 3MGNA 2BASA 1CSBA 3CCRP 2FBWC 1NVOA 1NTZK 3H1HG 2E74D 3KZIH 2KZIA 2KS1A 5AW2B 2H88C 1YJWP 1SQXE 3L74G 1GW3A 3BCCG 1LTIC 4QMAA 1KILC 5CBOA 2BEQD 2XNXA 3CWBJ 1RQUA 2FFDA 1S3JA 3AEAC 3CX5I 1W2BO 1BSHA 2I1JA 5AW0B 4PD4D 3RL0C 3USSA 3KXDA 4RESB 5KLVE 2OYIA 1JM0A 1BE3J 2HPCB 5AW3B 2FYUE 4H44D 5CJ0A 5KAIE 4L76A 2OTLP 5CCGD 5AW5B 1YJNP 4LC1A 1BE3E 2OGUA 3RK2B 1RF0C 3S1KA 4ZKPA 2NRGA 2HG5D 1R8EA 1N8RQ 2HODA 1R5SA 4IFFA 4MN4C 1PPJE 3TGUJ 1OVUA 2AEFA 2M8RA 2MJZA 2QE7H 2W8ZA 2Y0EA 2Z5HA 3EQ2A 3HD7B 4L73A 5GTIE 3JC22 1DX7A 2N1TC 1LNQA 1GTWA 1NTKK 3G3ZA 3P8CE 5TISH 2ZVOB 3JCUH 4GOEA 1J1DC 2PAJA 3A2AA 3FXEA 1OX3A 1AFOA 2QM8A 2E74B 2WSEH 2E75C 4TLFA 1S2EA 4N78E 1VDFA 2ZT9B 3WU2H 2K1AA 1LT9B 3CPWO 1GL2D 1NTZJ 3BATA 2K9JA 3KYQA 1M1KQ 4B86A 5KLVJ 3HE5B 3GLMA 1SQXD 2Y0CA 2C0WA 2V7QJ 1PP9G 2KZJA 4KHXA 2JWAA 3BRVB 2CPBA 1GL2A 1SFCD 2C0XA 2WSSH 3H1KJ 1DD3A 3TNUA 3CMEP 1VQ8P 1IFMA 5B66E 4N6JA 4OGQC 4BWNA 1SQQG 1VQPP 2JKVA 2R32A 1NKNA 1JY2P 2B88A 3CCSP 3CWBD 5AVUB 1M90Q 1AJYA 1VF5C 3M9BA 3O8ZA 4H13B 4RO0A 1MFZA 2E5TA 2GUSA 2SPZA 3T97B 2G3AA 5CCGA 5KTBA 1LP1B 3QWOC 2HODB 1CZQA 5EFWB 4EOTA 1FOSE 3BCCJ 1NTKG 3L35A 1IFIA 1WT6A 2Q3EA 3C1LA 4JYCA 4L75A 1JY2O 3T97A 2QJKB 3CWBG 5GTHE 4DJGA 3TGUE 1QVGO 3KQGA 5GTIH 4KJMA 2WT7B 1KQGB 4CPGA 3VMYA 3V4QA 2ZXEB 1AQTA 4H0LD 3SSUA 4GKGA 1N73C 3L74E 3CX5H 2FYNB 2KS1B 3H1HJ 4KT0J 3CCVP 3FXDA 4W7YA 1SQBD 2Y0DA 1ZP0C 2JWDA 1PP9D 1TU3F 1GK6A 1MFTA 2WMMA 3RK3D 3CCQP 2WT7A 3RK3B 3AE9C 2KSJA 4PV1B 1KZUB 3Q3DA 1N7SC 3M0DC 4M3LA 1BCCE 1ZR4A 2OARA 4BRYB 2ZJSE 1KN7A 1QGKB 2XDJA 1RF1C 4GDOA 3Q2YA 2P2UA 3HE4A 4XE5B 3V2PA 1KILA 3I5CA 5E79E 3CC2P 4EDFA 2K88A 3R4YA 2Q7CA 3Q1MA 5B66H 1NOHA 1GZLA 5CBNA 2R44A 1LGHB 1NHLA 4HKZH 4NPFX 2HLOA 5BU8B 2HYNA 2E42A 3HUSA 4WB4A 1J1EC 2H8PD 2WSFH 1Q2NA 2KI7B 3ABVC 1AVYA 1FJKA 2N1TA 5AVSB 1QL1A 2A45H 3L70D 2RKLA 1HJ0A 1UIIA 3B5NC 1LT1A 1KQFB 2PFXA 3L73D 5BVZA 1GD2E 1NTMK 1BE3G 2L5GB 2AXTE 2N1TB 4U7JA 3CCJP 1GU4A 1X8YA 2Z5IA 3PTZA 4WWIA 1FZCA 4I7ZB 2IZ1A 1M1JB 2QJPC 3M06A 1NAYA 1LTJA 4IL6E 1NGMB 5M1BA 3S9OA 1SVFA 3H1HD 2ZXXA 3CMAP 1ZV8A 2QRXA 1FZFA 1IC2A 2W6JH 1NTKJ 1KFMA 1PGOA 1P84I 3AE6C 2KLVA 5AVXB 5CCHD 2KNCB 3UIAA 1USEA 1X79B 1L0LE 3H1JD 1LTSC 2AEJA 4Y99C 4BXLA 3A0BE 1T2KD 2JJLA 2KXPB 1BE3D 1KILE 1DD4A 3PRJA 1NU1K 1ZR2A 2OYHC 2RH0A 3RK2C 3L73G 4C7NA 3L71E 4RJTA 4H13C 2Y9ZA 1NU1J 2ZYAA 1GK4A 5C39A 5KAIH 4WBAA 1N2DC 1SQQJ 2XU6A 3L70G 2IDBA 3C8VA 3PJSK 3U59A 1Z56A 2R5DA 2YKOA 3IN6A 1E5WA 1R5LA 1ZN5A 3VMAA 1A02J 1YTZI 1PGJA 5AVYB 4YTPC 2M5AA 5GTHH 5AW7B 1ZRTD 1NTMG 3VN0A 1KYOH 3GG2A 3H1KD 1NH4A 1BCCG 1JY3P 3H25A 1Q86Q 1SQVD 4EI2A 1ZOYC 3R2PA 4UB6E 2B9BA 3PHLA 5APXA 3Q5PA 2GUVA 3KPEA 1NTKE 1L0LK 1OMIA 5KJ7C 2FYNC 2C9NY 1L4AD 2HR3A 2J58A 1PFIA 1SQVE 1SQBG 1YITP 2IZ0A 3G9RA 3BVHA 1GL2B 2B87B 4W7ZA 1K73Q 2BEZF 1VF5B 1S1CX 2A06D 2ZT9D 3G71P 2Q1KA 5KAFH 1K8AQ 2KB7P 3NXSA 1L2PA 2OTKE 5H2FH 1RF0A 1NTKD 3AE2C 1KQSO 1VQ5P
chains in the Genus database with same CATH topology
4HYTB 1FJPA 4N78D 2H7HA 2N9BA 1G2CA 5CJ4A 1J1EB 3RK2D 1HGVA 1RY3A 3PP5A 1A02F 1N73A 3HUSB 3CL3D 1JY3N 1RE3A 5CHXA 1CI6B 1T8ZA 1IJDB 1XTGB 1URQD 2O1JA 5APQA 4EIJA 2FFDB 2OYIB 5KJ7A 2IFNA 1JUNA 3M9QA 3LW5H 2NPSD 1T2KC 2YKPA 3OAKA 5KJ7D 1LTAC 2N1TD 2OYHB 2OYIC 3IFMA 2A45I 1J2JB 3B5NA 5APSA 4LGDE 1JY2N 4W80A 1H89A 1DEBA 2Q3IA 1N86A 3SWFA 4HH2A 4DOJA 1M1JC 3A5TA 3NTNA 3M91A 2H43A 1LWUB 1IFJA 3KDPB 1FZAA 2WSCH 3HD7C 3P32A 1HJBA 3VYIA 3WMM0 1IFDA 3TNUB 4GIFA 2NPSB 1LTJC 4I6MC 1LWUC 3M0DA 1N7SA 1FOSF 2C9LY 4WY4A 1JTHB 1LTTC 3U1CA 3P8MC 1L4AA 3M9HA 1SQQK 4WY4B 5KLVK 3A7OA 3HE4B 1FAVA 2WPRA 4JYBA 3SWYA 1HWTC 4IFDK 5APUA 1N7SD 1H8AA 3HTKA 1FZGA 3L4FA 1G1IA 4LLHA 3TK1A 1LT9A 3MUDA 3VOPA 3HTKB 4C46A 3OA7A 1QL2A 1RF1A 1NKZB 1GW4A 2FFDC 3H32B 3II6A 3P8CD 4N3YB 1FBMA 3B5ND 3CLQA 2YNYA 3GHGC 2R3CA 2O1KA 1SQVK 3L36A 1HBWA 1JY3O 1IFNA 5AVVB 3HUSC 3LIDA 1XTCC 1HGZA 1HUCA 2XZRA 2O01H 5BU5A 1RE3C 3IR9A 1FZCB 1IO4A 4AUWA 2YMYA 2A45G 1KFNA 2IPPA 1SFCB 5AVWB 4C7RA 5AW1B 2WPQA 1M7LA 2M3BA 1T3UA 4AQRD 1SQPK 1WRGA 3EFGA 1URQA 1KILD 3P7KA 3M0AA 2Q9IA 3N7NA 1CW5A 4O9BA 3V5BA 1URQB 2KP8A 1OXZA 3U1AA 4IFMA 2FKWB 5CCGC 1N7SB 3V2NA 2OYHA 5CCHC 1IK9A 2ZFCA 4C7NB 4JF7A 2WWWA 1MZ9A 1JCDA 3V2QA 1YTZT 5AW9B 1RE4A 2P7JA 1LTJB 4WY4D 3CI9A 2Q5UA 1KILB 3B5NB 1KQLA 3MTUE 3VP8A 2POHA 2YO2A 2KYVA 5APWA 1JCCA 3BASA 4I2LC 3HE5A 1NO4A 1JOCA 1GL2C 3L37A 1CI6A 4I1LA 1H88A 1LT9C 1SFCC 1W2EA 1S9KE 1FZBA 2FYZA 3O8ZA 1HTLC 2JEEA 2P67A 3HD7A 1YYCA 3RK3C 2IFMA 1G1JA 1RF1B 5AW8B 1DH3A 4AYCA 1VPCA 5APTA 1ZLLA 1URQC 4WY4C 2NPSA 1HH0A 1MUUA 2WITA 1FZEA 2NPSC 1JMMA 2W27A 2P1JA 4GT1A 3HD7D 1G2CB 2XKMA 3H6PA 2WPSA 2YKQA 1HVVA 2VRSA 1AQ5A 1LTBC 2HPCA 2J59M 2W6BA 1M1JA 1X9VA 1JTHA 2FXMA 2E43A 1SLQA 2LKMA 3TSIA 1J1DB 4OH8B 3A3YB 3V2RA 1JO5A 5AVTB 1LWUA 2W6AA 1L0NK 3OJAB 2YO3A 3RL0B 1S9KD 5APVA 4XA4A 3BRTB 3TYYA 2WTYA 3MD0A 3NFQA 1OWAA 3VTPC 2R5BA 5AVQB 3VP9A 1SFCA 1EQ7A 3VMXA 3B8EB 5APYA 5AW6B 2I1KA 5AVZB 1FU1A 5CMZA 2PP6A 2IX7C 3E1IA 2HFED 1GU5A 2WZ7A 1GDTA 2XV5A 3NMDA 2GM4A 3RL0D 1NAFA 1L4AB 3VMZA 1SQBK 5CCHA 3V4WA 3N4XA 3GHGA 3H32A 2QM7A 2Z4EA 1SQXK 2CPSA 4Y99B 4DZOA 1L4AC 1JNMA 3GHGB 1RE4C 3HRNA 1LTGC 1SP4A 2FYUK 4ZKUA 3MIWA 1FZCC 1MV8A 1T3JA 1N7LA 2KOGA 5AVRB 3LIEA 5AW4B 3C9IA 1N73B 3MGNA 2BASA 1CSBA 1NTZK 5AW2B 1GW3A 1LTIC 1KILC 2XNXA 2FFDA 2I1JA 5AW0B 3RL0C 2HPCB 4RESB 2OYIA 5AW3B 5CJ0A 5CCGD 5AW5B 4LC1A 3RK2B 1RF0C 4ZKPA 2HG5D 2HODA 4IFFA 3EQ2A 1FDMA 2M8RA 2MJZA 2Z5HA 3HD7B 1DX7A 2N1TC 1GTWA 1NTKK 3G3ZA 3P8CE 1J1DC 2PAJA 3A2AA 1AFOA 2QM8A 2WSEH 4N78E 1VDFA 1LT9B 1GL2D 3BATA 3KYQA 4B86A 3HE5B 2C0WA 4KHXA 1NWQA 3BRVB 2CPBA 1GL2A 1SFCD 2C0XA 3TNUA 1IFMA 4N6JA 2R32A 1NKNA 1JY2P 5AVUB 3M9BA 1MFZA 2GUSA 5CCGA 5KTBA 2HODB 1CZQA 4EOTA 1FOSE 3L35A 1IFIA 1WT6A 4JYCA 1JY2O 3T97A 3KQGA 2WT7B 3VMYA 3V4QA 2ZXEB 4GKGA 1N73C 4W7YA 1GK6A 3RK3D 2WT7A 3RK3B 2KSJA 1KZUB 1N7SC 3M0DC 4M3LA 1ZR4A 2OARA 2XDJA 1RF1C 2P2UA 3HE4A 4XE5B 3V2PA 1KILA 3I5CA 2Q7CA 1NOHA 1GZLA 1LGHB 1NHLA 5BU8B 2HLOA 2HYNA 2E42A 3HUSA 4WB4A 1J1EC 2H8PD 2WSFH 1FJKA 2N1TA 5AVSB 1QL1A 2A45H 3B5NC 1GD2E 5BVZA 1NTMK 2L5GB 2N1TB 1GU4A 1X8YA 2Z5IA 1FZCA 1M1JB 3M06A 1LTJA 1SVFA 1ZV8A 1FZFA 1IC2A 5AVXB 1KFMA 2KLVA 5CCHD 3UIAA 1X79B 1LTSC 4Y99C 1T2KD 2JJLA 2OYHC 1NU1K 1ZR2A 3RK2C 4C7NA 1GK4A 4WBAA 1N2DC 2XU6A 3U59A 1Z56A 2R5DA 2YKOA 1E5WA 1ZN5A 1A02J 1YTZI 5AVYB 5AW7B 3VN0A 1NH4A 1JY3P 3R2PA 5APXA 2GUVA 3KPEA 5KJ7C 1L0LK 2C9NY 1L4AD 2J58A 1PFIA 3BVHA 1GL2B 4W7ZA 2KB7P 3NXSA 1RF0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2IPP A;  4HYT B;  3TNU A;  2H7H A;  2N9B A;  5AVW B;  5AW1 B;  3A3Y B;  2WPQ A;  2R32 A;  5AVT B;  1A02 F;  5AVU B;  4AQR D;  3M9B A;  2W6A A;  1MFZ A;  2YO3 A;  1S9K D;  5APV A;  1CI6 B;  3P7K A;  3M0A A;  1CZQ A;  3TYY A;  2WTY A;  4EOT A;  1FOS E;  3MD0 A;  3L35 A;  3V5B A;  5APQ A;  4JYC A;  2KP8 A;  3T97 A;  1OXZ A;  3KQG A;  3NFQ A;  1OWA A;  2WT7 B;  3VTP C;  2R5B A;  3VMY A;  3V4Q A;  2ZXE B;  1JUN A;  5AVQ B;  4GKG A;  1T2K C;  2ZFC A;  3VMX A;  3B8E B;  4C7N B;  5APY A;  5AW6 B;  1GK6 A;  5AVZ B;  5CMZ A;  3OAK A;  2WT7 A;  2WWW A;  4M3L A;  1GU5 A;  5AW9 B;  1J2J B;  2P7J A;  2P2U A;  3HE4 A;  4XE5 B;  2XV5 A;  3NMD A;  5APS A;  3I5C A;  1NAF A;  1H89 A;  2Q3I A;  2Q7C A;  3VMZ A;  2Q5U A;  1GZL A;  3SWF A;  1KQL A;  3A5T A;  3NTN A;  3M91 A;  3V4W A;  2E42 A;  3KDP B;  2QM7 A;  2YO2 A;  5AVS B;  5APW A;  3P32 A;  1HJB A;  3VYI A;  3TNU B;  4DZO A;  1JNM A;  1GD2 E;  4I6M C;  4I2L C;  1GU4 A;  1X8Y A;  1SP4 A;  2Z5I A;  3HE5 A;  3M0D A;  1FOS F;  2C9L Y;  3L37 A;  3M06 A;  3P8M C;  1CI6 A;  3M9H A;  1H88 A;  1MV8 A;  5AVR B;  5AVX B;  3LIE A;  5AW4 B;  3A7O A;  3HE4 B;  3UIA A;  1S9K E;  1T2K D;  2P67 A;  2JJL A;  1FAV A;  2BAS A;  3MGN A;  3O8Z A;  1CSB A;  1YYC A;  4C7N A;  2WPR A;  4JYB A;  1HWT C;  5APU A;  1GK4 A;  5AW2 B;  1H8A A;  3HTK A;  2XU6 A;  5AW8 B;  2R5D A;  1DH3 A;  4AYC A;  5APT A;  3TK1 A;  1A02 J;  5AW0 B;  5AVY B;  4RES B;  4C46 A;  5AW3 B;  5AW7 B;  3VN0 A;  5AW5 B;  4LC1 A;  1MUU A;  2W27 A;  2Z5H A;  4GT1 A;  5APX A;  1G2C B;  1GTW A;  2WPS A;  2YNY A;  2C9N Y;  2R3C A;  3A2A A;  3L36 A;  2VRS A;  1HBW A;  5AVV B;  2QM8 A;  3LID A;  1HUC A;  2XZR A;  3IR9 A;  3NXS A;  3HE5 B;  4B86 A;  1IO4 A;  2E43 A;  4AUW A;  4KHX A;  1SLQ A;  1NWQ A; 
#chains in the Genus database with same CATH topology
 1EDK A;  3H1I J;  4PD4 E;  4HYT B;  1FJP A;  4N78 D;  1HF9 A;  2H7H A;  2N9B A;  4YPC A;  1G2C A;  1M56 D;  1NTZ D;  2FXP A;  3H1I E;  5CJ4 A;  1J1E B;  3RK2 D;  1HGV A;  1RY3 A;  2W90 A;  3PP5 A;  4H13 D;  3RGU A;  5KLI B;  2E74 C;  3HUS B;  3CL3 D;  1N73 A;  1SQP E;  1JY3 N;  1RE3 A;  1SQQ D;  4TT3 H;  1L0L D;  3H1J E;  3IAO A;  5CHX A;  1CI6 B;  4UB6 H;  1T8Z A;  1NU1 D;  1QVF O;  1IJD B;  1XTG B;  3L72 E;  1URQ D;  2MKV A;  1PL5 A;  1OZH A;  1PV3 A;  2O1J A;  3MHV A;  5APQ A;  4EIJ A;  3V6I A;  1SQX G;  2FYU D;  2FFD B;  1JEK A;  3L71 G;  2OYI B;  5KJ7 A;  2IFN A;  3Q5R A;  1JUN A;  3H1L E;  1X0T A;  2JP3 A;  1NWQ A;  3M9Q A;  3LW5 H;  4H0L B;  2NPS D;  2YXQ B;  1T2K C;  1JMB A;  2XND H;  2YKP A;  3G6E P;  4D6T E;  1OW8 A;  3OAK A;  3QH9 A;  2G8Y A;  5KJ7 D;  1LTA C;  2N1T D;  2V4H A;  2OYH B;  2KNC A;  2OYI C;  1BGY J;  3IFM A;  1A02 F;  1PPJ G;  1KMI Z;  2A45 I;  2ZAE B;  1J2J B;  1LJ2 A;  3O6Q B;  3GF3 A;  1BGY E;  1QLE D;  2O3J A;  3B5N A;  2YMK A;  4NPE A;  5APS A;  3WU2 E;  4LGD E;  1SQP J;  1JY2 N;  1RHZ B;  4W80 A;  1DEB A;  1AVO A;  2Q3I A;  1H89 A;  4U3F D;  1N86 A;  2IYO A;  1FS0 E;  1KOR A;  4HH2 A;  4DOJ A;  1M1J C;  3SWF A;  3A5T A;  3NTN A;  3M91 A;  3CXH E;  2BCC J;  1LWU B;  1IFJ A;  3KDP B;  3D6Z A;  2P10 A;  2H43 A;  1EDJ A;  3JCU E;  1FZA A;  2WSC H;  2WQY C;  3BCC D;  3HD7 C;  2CK3 H;  3L74 D;  3P32 A;  3VYI A;  1HJB A;  4HJG H;  1IFD A;  2PGD A;  3TNU B;  3WMM 0;  2GM4 A;  1PP9 E;  1H0T A;  1ZW0 A;  1NTM E;  2NPS B;  4GIF A;  2JDI H;  2WSF J;  1LTJ C;  4I6M C;  4PV1 D;  2IBZ E;  1LWU C;  1N7S A;  1NTM J;  3M0D A;  1FOS F;  2C9L Y;  4WY4 A;  1JTH B;  2O01 J;  2PRR A;  1LTT C;  2ZT9 C;  2WPV B;  3L71 J;  1BCC J;  3U1C A;  2M0B A;  4YXD C;  3P8M C;  1LP1 A;  3AEB C;  1L4A A;  3M9H A;  4PD4 I;  5DJT B;  1SQQ K;  3A0B H;  1EZV G;  4WY4 B;  5KLV K;  3A7O A;  1SS1 A;  3HE4 B;  3CX5 E;  1NU1 E;  1FAV A;  1WMK A;  1FC2 C;  3GW6 A;  2WSC J;  2WPR A;  4JYB A;  1ZRT E;  2BCC E;  3SWY A;  1RQV A;  2D2C C;  5APU A;  2OQQ A;  1P84 D;  2M5A B;  1N7S D;  2YIU C;  3HTK A;  1H8A A;  1FDO A;  1FZG A;  2RN0 A;  4JQ0 D;  1NJI Q;  3L4F A;  2AXT H;  4IL6 X;  3CCM P;  3H1L G;  4JBZ A;  1G1I A;  4LLH A;  3TK1 A;  1LT9 A;  3MUD A;  1OIP A;  2GA1 A;  3VOP A;  1VQN P;  3H1I G;  3HTK B;  4C46 A;  3AE8 C;  3OA7 A;  1QL2 A;  4D6T G;  2KK7 A;  1KTM A;  4YXW H;  1RF1 A;  1NKZ B;  1H0T B;  2R3S A;  1SQP G;  4H0L C;  3ITK A;  1EDI A;  1GW4 A;  2QSI A;  2FFD C;  2E75 B;  3H32 B;  1VQ6 P;  1BGY G;  3II6 A;  3P8C D;  3L72 G;  2AXC A;  1KB9 D;  4I7Z C;  1FBM A;  4N3Y B;  3B5N D;  3CLQ A;  1S4X A;  1L0L J;  2E76 C;  2R3C A;  2YNY A;  3GHG C;  1OVV A;  2O1K A;  5K5G B;  2P58 A;  1SQV K;  3L36 A;  3ZDM A;  1JY3 O;  5KKZ B;  1IFN A;  3CX5 D;  5AVV B;  1HBW A;  1KD1 Q;  2QIW A;  3AEE C;  1Y8A A;  1XTC C;  1HGZ A;  1HUC A;  3AE3 C;  2XZR A;  3HUS C;  2O01 H;  3LID A;  5BU5 A;  1RE3 C;  1YQ3 C;  4OGQ B;  3CC7 P;  1Y47 A;  3IR9 A;  3OW2 O;  1FZC B;  4IFD K;  3L75 G;  2N9Y B;  3H1J J;  1IO4 A;  1P84 H;  2WSE J;  4AUW A;  2YMY A;  2A45 G;  1KFN A;  2IPP A;  5KLV D;  1SFC B;  3GMA A;  2IBZ G;  5AVW B;  5AW1 B;  4C7R A;  3W68 A;  5B5E H;  2LR2 A;  3I56 P;  2WPQ A;  3TGU G;  1M7L A;  4PD4 H;  3G4S P;  3D71 A;  2M3B A;  1T3U A;  4AQR D;  1SQP K;  1WRG A;  3EFG A;  1Y9B A;  1URQ A;  1FE6 A;  3SWK A;  3A0H H;  3L73 J;  1KIL D;  3U1A A;  3P7K A;  1DEE G;  3M0A A;  4D6T J;  2Q9I A;  3N7N A;  1BSN A;  3L73 E;  1CW5 A;  1OFC X;  4O9B A;  3V5B A;  1AA0 A;  3FWN A;  1W5C E;  4R4L A;  1QX8 A;  1SQV J;  1OXZ A;  1KYO I;  1URQ B;  1KB9 H;  2KP8 A;  3EFF K;  3H1L J;  1S5L X;  1NYH A;  2BCC D;  2FKW B;  1JB0 J;  4IFM A;  1N7S B;  5CCG C;  3V2N A;  2QA4 P;  5CCH C;  1AV1 A;  1IK9 A;  2OYH A;  1IK7 A;  2ZFC A;  3TF5 A;  2WVR A;  1YIJ P;  4C7N B;  1USD A;  2KLU A;  2D2C B;  3F89 A;  4JF7 A;  3CXH D;  2D2C D;  3KZI E;  2WWW A;  3AE4 C;  1MZ9 A;  4L74 A;  1ZXG A;  1JCD A;  3B4S A;  1YTZ T;  3V2Q A;  5AW9 B;  1RE4 A;  2NZ2 A;  2P7J A;  1YHQ P;  1PZQ A;  2IYP A;  4WVZ A;  2AEM A;  1IFP A;  3AE7 C;  1L0N D;  1MKM A;  3L70 J;  1PP9 J;  1LTJ B;  3AE1 C;  4WY4 D;  2L91 A;  3CI9 A;  4PJ0 E;  2Q5U A;  1KIL B;  5B5E E;  1KV4 A;  3B5N B;  1KQL A;  3L72 D;  1SQB E;  4A7P A;  3MTU E;  3L72 J;  3VP8 A;  1PIX A;  2POH A;  2YO2 A;  1KYO E;  4ZNC A;  1K04 A;  1SQP D;  2KYV A;  3E1R A;  1RH5 B;  5APW A;  1Q82 Q;  1JCC A;  4D6T D;  2LXC B;  3B71 A;  4NPD A;  3S4R A;  2YXR B;  3D70 A;  2O01 N;  3BAS A;  2K9J B;  3LW5 J;  3AEC C;  4I2L C;  5E79 H;  4UB8 H;  3CC4 P;  3PH0 A;  2QVA A;  1EXI A;  3HE5 A;  1NO4 A;  4GOD A;  2W83 C;  1JOC A;  1GL2 C;  2K9Y A;  3L37 A;  2ITA A;  3MZW B;  4ZMD A;  1CI6 A;  2I8D A;  4I1L A;  4XFJ A;  1SQQ E;  2E5Y A;  2OYO A;  1YBK A;  3RBZ A;  4ASV A;  3TGU D;  1H88 A;  4EYY Q;  2A06 E;  2QG4 A;  1LT9 C;  1VQ4 P;  1SFC C;  1W2E A;  1S9K E;  1Q7Y Q;  1Q81 Q;  2RMZ A;  1T6A A;  1FZB A;  2FYZ A;  1HTL C;  1YQ4 C;  2H89 C;  1OVR A;  2JEE A;  2K3R A;  2P67 A;  3F5H A;  3HD7 A;  1YYC A;  3W67 A;  3RK3 C;  3RBX A;  4PJ0 H;  5TIS E;  3D6Y A;  2IFM A;  3FGA D;  1VF5 D;  1NTZ E;  3CXH I;  1G1J A;  1OW7 A;  1Q90 D;  2OTJ P;  1U57 A;  1RF1 B;  3GF7 A;  5AW8 B;  1PGQ A;  1DH3 A;  2KSE A;  4AYC A;  1VPC A;  1EZV I;  5APT A;  1ZLL A;  3WUV A;  2DW3 A;  1URQ C;  2ZYG A;  3H1K E;  1YJ9 P;  1FDI A;  4WY4 C;  2NPS A;  1D7M A;  1HH0 A;  1U7J A;  2IBZ I;  1DIP A;  1MUU A;  2WIT A;  2FY8 A;  1L0N G;  2FYU J;  4UB8 E;  1FZE A;  2NPS C;  1JMM A;  1SQX J;  2W27 A;  1K9M Q;  3IF4 A;  1VQM P;  2B89 A;  2P1J A;  2QJK C;  1M8O B;  4GT1 A;  4DCK A;  2FXO A;  1GMJ A;  2YIU B;  3HD7 D;  1G2C B;  4RKU J;  2XKM A;  1IZN B;  3AEG C;  2WPS A;  3H6P A;  4U3F G;  2YKQ A;  1HVV A;  2VRS A;  1VQK P;  3AEF C;  1AQ5 A;  1VL2 A;  1S72 P;  1LTB C;  2HPC A;  2J59 M;  1HWT C;  1EXJ A;  1PPJ D;  2W6B A;  1P84 E;  3CXH H;  1M1J A;  3WUU A;  1X9V A;  1JTH A;  1VQO P;  2BCC G;  3H1H E;  1BDC A;  1FDM A;  2B87 A;  2FXM A;  2Q6Q A;  2E43 A;  3AED C;  2J5U A;  4IL6 H;  1SLQ A;  3AE5 C;  4GOF A;  2LKM A;  3TSI A;  3FWL A;  1J1D B;  3FX0 A;  4OH8 B;  4U3F J;  3A3Y B;  1VQ7 P;  3L71 D;  3V2R A;  5AVT B;  1JO5 A;  1L0N J;  2FYU G;  3K5B A;  1BDD A;  1EZV E;  3JSV C;  1LWU A;  3KHU A;  4Z1M H;  1KB9 E;  1L0N K;  2W6A A;  3OJA B;  1KYO D;  2YO3 A;  4PV1 C;  3RL0 B;  1M57 D;  1S9K D;  3PLN A;  4K3A A;  5APV A;  5KAF E;  2IBZ D;  1NU1 G;  3BRT B;  4XA4 A;  4DT0 A;  3Q5S A;  2JR8 A;  3TYY A;  4HB1 A;  5KLV G;  1L0L G;  2WTY A;  5H2F E;  3MD0 A;  3A0H E;  4K35 A;  1YI2 P;  1S5L E;  3L75 D;  4H44 C;  3BCC E;  1KC8 Q;  2QJY B;  3NFQ A;  5KKZ C;  1KB9 I;  1OWA A;  1X22 A;  3SFE C;  2R5B A;  1NTZ G;  5L8R J;  3VTP C;  2E76 B;  2QJP B;  5AVQ B;  2UWJ E;  3L70 E;  3TDK A;  3WUT A;  3VP9 A;  1ZME C;  1SFC A;  1EQ7 A;  3VMX A;  3B8E B;  5APY A;  5AW6 B;  2I1K A;  5AVZ B;  1UIX A;  1FU1 A;  4JPZ B;  5CMZ A;  2KIK A;  2PP6 A;  4OVN F;  2IX7 C;  4H44 B;  3E1I A;  3CCL P;  1QEX A;  2HFE D;  2QJY C;  2ZYD A;  1GU5 A;  1BGY D;  2A06 G;  2WZ7 A;  3MUD C;  4ASW A;  1L0N E;  2E75 D;  1GDT A;  2LXB A;  2XV5 A;  3NMD A;  2K37 A;  1OW6 A;  3L74 J;  1NAF A;  4IOI H;  3E7K A;  3RL0 D;  4R4M A;  1VQL P;  1SQB J;  3O6Q A;  2ZVN B;  1VQ9 P;  1L4A B;  3VMZ A;  1SQB K;  3RL0 g;  1PGP A;  5CCH A;  3H1I D;  4U3F E;  5DJU B;  3EWK A;  3V4W A;  3N4X A;  3GHG A;  3I55 P;  3L75 J;  3H32 A;  2QM7 A;  3H1L D;  1SQV G;  3MP7 B;  2QEX P;  1BCC D;  4OGQ D;  2Z4E A;  3CCU P;  3L75 E;  1SQX K;  2CPS A;  2Y9Y A;  3H1K G;  3CWB E;  1NTM D;  4Y99 B;  2KUB A;  2E76 D;  2JO1 A;  5KLI C;  1L4A C;  5TJH A;  1S5L H;  4DZO A;  1JNM A;  3GHG B;  3CCE P;  1RE4 C;  1U7M A;  3CD6 P;  2V7Q H;  1EDL A;  3HRN A;  1LTG C;  1EC5 A;  1SP4 A;  4Y28 J;  3SFD C;  2FYU K;  4ZKU A;  3MIW A;  1EZV D;  1FZC C;  1MV8 A;  1T3J A;  1N7L A;  1E79 H;  2KOG A;  1K05 A;  5AVR B;  3LIE A;  5AW4 B;  4OWF A;  3RK3 E;  2M3E A;  4BRY A;  3H1J G;  3C9I A;  1N73 B;  3MGN A;  2BAS A;  1CSB A;  3CCR P;  2FBW C;  1NVO A;  1NTZ K;  3H1H G;  2E74 D;  3KZI H;  2KZI A;  2KS1 A;  5AW2 B;  2H88 C;  1YJW P;  1SQX E;  3L74 G;  1GW3 A;  3BCC G;  1LTI C;  4QMA A;  1KIL C;  5CBO A;  2BEQ D;  2XNX A;  3CWB J;  1RQU A;  2FFD A;  1S3J A;  3AEA C;  3CX5 I;  1W2B O;  1BSH A;  2I1J A;  5AW0 B;  4PD4 D;  3RL0 C;  3USS A;  3KXD A;  4RES B;  5KLV E;  2OYI A;  1JM0 A;  1BE3 J;  2HPC B;  5AW3 B;  2FYU E;  4H44 D;  5CJ0 A;  5KAI E;  4L76 A;  2OTL P;  5CCG D;  5AW5 B;  1YJN P;  4LC1 A;  1BE3 E;  2OGU A;  3RK2 B;  1RF0 C;  3S1K A;  4ZKP A;  2NRG A;  2HG5 D;  1R8E A;  1N8R Q;  2HOD A;  1R5S A;  4IFF A;  4MN4 C;  1PPJ E;  3TGU J;  1OVU A;  2AEF A;  2M8R A;  2MJZ A;  2QE7 H;  2W8Z A;  2Y0E A;  2Z5H A;  3EQ2 A;  3HD7 B;  4L73 A;  5GTI E;  3JC2 2;  1DX7 A;  2N1T C;  1LNQ A;  1GTW A;  1NTK K;  3G3Z A;  3P8C E;  5TIS H;  2ZVO B;  3JCU H;  4GOE A;  1J1D C;  2PAJ A;  3A2A A;  3FXE A;  1OX3 A;  1AFO A;  2QM8 A;  2E74 B;  2WSE H;  2E75 C;  4TLF A;  1S2E A;  4N78 E;  1VDF A;  2ZT9 B;  3WU2 H;  2K1A A;  1LT9 B;  3CPW O;  1GL2 D;  1NTZ J;  3BAT A;  2K9J A;  3KYQ A;  1M1K Q;  4B86 A;  5KLV J;  3HE5 B;  3GLM A;  1SQX D;  2Y0C A;  2C0W A;  2V7Q J;  1PP9 G;  2KZJ A;  4KHX A;  2JWA A;  3BRV B;  2CPB A;  1GL2 A;  1SFC D;  2C0X A;  2WSS H;  3H1K J;  1DD3 A;  3TNU A;  3CME P;  1VQ8 P;  1IFM A;  5B66 E;  4N6J A;  4OGQ C;  4BWN A;  1SQQ G;  1VQP P;  2JKV A;  2R32 A;  1NKN A;  1JY2 P;  2B88 A;  3CCS P;  3CWB D;  5AVU B;  1M90 Q;  1AJY A;  1VF5 C;  3M9B A;  3O8Z A;  4H13 B;  4RO0 A;  1MFZ A;  2E5T A;  2GUS A;  2SPZ A;  3T97 B;  2G3A A;  5CCG A;  5KTB A;  1LP1 B;  3QWO C;  2HOD B;  1CZQ A;  5EFW B;  4EOT A;  1FOS E;  3BCC J;  1NTK G;  3L35 A;  1IFI A;  1WT6 A;  2Q3E A;  3C1L A;  4JYC A;  4L75 A;  1JY2 O;  3T97 A;  2QJK B;  3CWB G;  5GTH E;  4DJG A;  3TGU E;  1QVG O;  3KQG A;  5GTI H;  4KJM A;  2WT7 B;  1KQG B;  4CPG A;  3VMY A;  3V4Q A;  2ZXE B;  1AQT A;  4H0L D;  3SSU A;  4GKG A;  1N73 C;  3L74 E;  3CX5 H;  2FYN B;  2KS1 B;  3H1H J;  4KT0 J;  3CCV P;  3FXD A;  4W7Y A;  1SQB D;  2Y0D A;  1ZP0 C;  2JWD A;  1PP9 D;  1TU3 F;  1GK6 A;  1MFT A;  2WMM A;  3RK3 D;  3CCQ P;  2WT7 A;  3RK3 B;  3AE9 C;  2KSJ A;  4PV1 B;  1KZU B;  3Q3D A;  1N7S C;  3M0D C;  4M3L A;  1BCC E;  1ZR4 A;  2OAR A;  4BRY B;  2ZJS E;  1KN7 A;  1QGK B;  2XDJ A;  1RF1 C;  4GDO A;  3Q2Y A;  2P2U A;  3HE4 A;  4XE5 B;  3V2P A;  1KIL A;  3I5C A;  5E79 E;  3CC2 P;  4EDF A;  2K88 A;  3R4Y A;  2Q7C A;  3Q1M A;  5B66 H;  1NOH A;  1GZL A;  5CBN A;  2R44 A;  1LGH B;  1NHL A;  4HKZ H;  4NPF X;  2HLO A;  5BU8 B;  2HYN A;  2E42 A;  3HUS A;  4WB4 A;  1J1E C;  2H8P D;  2WSF H;  1Q2N A;  2KI7 B;  3ABV C;  1AVY A;  1FJK A;  2N1T A;  5AVS B;  1QL1 A;  2A45 H;  3L70 D;  2RKL A;  1HJ0 A;  1UII A;  3B5N C;  1LT1 A;  1KQF B;  2PFX A;  3L73 D;  5BVZ A;  1GD2 E;  1NTM K;  1BE3 G;  2L5G B;  2AXT E;  2N1T B;  4U7J A;  3CCJ P;  1GU4 A;  1X8Y A;  2Z5I A;  3PTZ A;  4WWI A;  1FZC A;  4I7Z B;  2IZ1 A;  1M1J B;  2QJP C;  3M06 A;  1NAY A;  1LTJ A;  4IL6 E;  1NGM B;  5M1B A;  3S9O A;  1SVF A;  3H1H D;  2ZXX A;  3CMA P;  1ZV8 A;  2QRX A;  1FZF A;  1IC2 A;  2W6J H;  1NTK J;  1KFM A;  1PGO A;  1P84 I;  3AE6 C;  2KLV A;  5AVX B;  5CCH D;  2KNC B;  3UIA A;  1USE A;  1X79 B;  1L0L E;  3H1J D;  1LTS C;  2AEJ A;  4Y99 C;  4BXL A;  3A0B E;  1T2K D;  2JJL A;  2KXP B;  1BE3 D;  1KIL E;  1DD4 A;  3PRJ A;  1NU1 K;  1ZR2 A;  2OYH C;  2RH0 A;  3RK2 C;  3L73 G;  4C7N A;  3L71 E;  4RJT A;  4H13 C;  2Y9Z A;  1NU1 J;  2ZYA A;  1GK4 A;  5C39 A;  5KAI H;  4WBA A;  1N2D C;  1SQQ J;  2XU6 A;  3L70 G;  2IDB A;  3C8V A;  3PJS K;  3U59 A;  1Z56 A;  2R5D A;  2YKO A;  3IN6 A;  1E5W A;  1R5L A;  1ZN5 A;  3VMA A;  1A02 J;  1YTZ I;  1PGJ A;  5AVY B;  4YTP C;  2M5A A;  5GTH H;  5AW7 B;  1ZRT D;  1NTM G;  3VN0 A;  1KYO H;  3GG2 A;  3H1K D;  1NH4 A;  1BCC G;  1JY3 P;  3H25 A;  1Q86 Q;  1SQV D;  4EI2 A;  1ZOY C;  3R2P A;  4UB6 E;  2B9B A;  3PHL A;  5APX A;  3Q5P A;  2GUV A;  3KPE A;  1NTK E;  1L0L K;  1OMI A;  5KJ7 C;  2FYN C;  2C9N Y;  1L4A D;  2HR3 A;  2J58 A;  1PFI A;  1SQV E;  1SQB G;  1YIT P;  2IZ0 A;  3G9R A;  3BVH A;  1GL2 B;  2B87 B;  4W7Z A;  1K73 Q;  2BEZ F;  1VF5 B;  1S1C X;  2A06 D;  2ZT9 D;  3G71 P;  2Q1K A;  5KAF H;  1K8A Q;  2KB7 P;  3NXS A;  1L2P A;  2OTK E;  5H2F H;  1RF0 A;  1NTK D;  3AE2 C;  1KQS O;  1VQ5 P; 
#chains in the Genus database with same CATH homology
 4HYT B;  1FJP A;  4N78 D;  2H7H A;  2N9B A;  1G2C A;  5CJ4 A;  1J1E B;  3RK2 D;  1HGV A;  1RY3 A;  3PP5 A;  1A02 F;  1N73 A;  3HUS B;  3CL3 D;  1JY3 N;  1RE3 A;  5CHX A;  1CI6 B;  1T8Z A;  1IJD B;  1XTG B;  1URQ D;  2O1J A;  5APQ A;  4EIJ A;  2FFD B;  2OYI B;  5KJ7 A;  2IFN A;  1JUN A;  3M9Q A;  3LW5 H;  2NPS D;  1T2K C;  2YKP A;  3OAK A;  5KJ7 D;  1LTA C;  2N1T D;  2OYH B;  2OYI C;  3IFM A;  2A45 I;  1J2J B;  3B5N A;  5APS A;  4LGD E;  1JY2 N;  4W80 A;  1H89 A;  1DEB A;  2Q3I A;  1N86 A;  3SWF A;  4HH2 A;  4DOJ A;  1M1J C;  3A5T A;  3NTN A;  3M91 A;  2H43 A;  1LWU B;  1IFJ A;  3KDP B;  1FZA A;  2WSC H;  3HD7 C;  3P32 A;  1HJB A;  3VYI A;  3WMM 0;  1IFD A;  3TNU B;  4GIF A;  2NPS B;  1LTJ C;  4I6M C;  1LWU C;  3M0D A;  1N7S A;  1FOS F;  2C9L Y;  4WY4 A;  1JTH B;  1LTT C;  3U1C A;  3P8M C;  1L4A A;  3M9H A;  1SQQ K;  4WY4 B;  5KLV K;  3A7O A;  3HE4 B;  1FAV A;  2WPR A;  4JYB A;  3SWY A;  1HWT C;  4IFD K;  5APU A;  1N7S D;  1H8A A;  3HTK A;  1FZG A;  3L4F A;  1G1I A;  4LLH A;  3TK1 A;  1LT9 A;  3MUD A;  3VOP A;  3HTK B;  4C46 A;  3OA7 A;  1QL2 A;  1RF1 A;  1NKZ B;  1GW4 A;  2FFD C;  3H32 B;  3II6 A;  3P8C D;  4N3Y B;  1FBM A;  3B5N D;  3CLQ A;  2YNY A;  3GHG C;  2R3C A;  2O1K A;  1SQV K;  3L36 A;  1HBW A;  1JY3 O;  1IFN A;  5AVV B;  3HUS C;  3LID A;  1XTC C;  1HGZ A;  1HUC A;  2XZR A;  2O01 H;  5BU5 A;  1RE3 C;  3IR9 A;  1FZC B;  1IO4 A;  4AUW A;  2YMY A;  2A45 G;  1KFN A;  2IPP A;  1SFC B;  5AVW B;  4C7R A;  5AW1 B;  2WPQ A;  1M7L A;  2M3B A;  1T3U A;  4AQR D;  1SQP K;  1WRG A;  3EFG A;  1URQ A;  1KIL D;  3P7K A;  3M0A A;  2Q9I A;  3N7N A;  1CW5 A;  4O9B A;  3V5B A;  1URQ B;  2KP8 A;  1OXZ A;  3U1A A;  4IFM A;  2FKW B;  5CCG C;  1N7S B;  3V2N A;  2OYH A;  5CCH C;  1IK9 A;  2ZFC A;  4C7N B;  4JF7 A;  2WWW A;  1MZ9 A;  1JCD A;  3V2Q A;  1YTZ T;  5AW9 B;  1RE4 A;  2P7J A;  1LTJ B;  4WY4 D;  3CI9 A;  2Q5U A;  1KIL B;  3B5N B;  1KQL A;  3MTU E;  3VP8 A;  2POH A;  2YO2 A;  2KYV A;  5APW A;  1JCC A;  3BAS A;  4I2L C;  3HE5 A;  1NO4 A;  1JOC A;  1GL2 C;  3L37 A;  1CI6 A;  4I1L A;  1H88 A;  1LT9 C;  1SFC C;  1W2E A;  1S9K E;  1FZB A;  2FYZ A;  3O8Z A;  1HTL C;  2JEE A;  2P67 A;  3HD7 A;  1YYC A;  3RK3 C;  2IFM A;  1G1J A;  1RF1 B;  5AW8 B;  1DH3 A;  4AYC A;  1VPC A;  5APT A;  1ZLL A;  1URQ C;  4WY4 C;  2NPS A;  1HH0 A;  1MUU A;  2WIT A;  1FZE A;  2NPS C;  1JMM A;  2W27 A;  2P1J A;  4GT1 A;  3HD7 D;  1G2C B;  2XKM A;  3H6P A;  2WPS A;  2YKQ A;  1HVV A;  2VRS A;  1AQ5 A;  1LTB C;  2HPC A;  2J59 M;  2W6B A;  1M1J A;  1X9V A;  1JTH A;  2FXM A;  2E43 A;  1SLQ A;  2LKM A;  3TSI A;  1J1D B;  4OH8 B;  3A3Y B;  3V2R A;  1JO5 A;  5AVT B;  1LWU A;  2W6A A;  1L0N K;  3OJA B;  2YO3 A;  3RL0 B;  1S9K D;  5APV A;  4XA4 A;  3BRT B;  3TYY A;  2WTY A;  3MD0 A;  3NFQ A;  1OWA A;  3VTP C;  2R5B A;  5AVQ B;  3VP9 A;  1SFC A;  1EQ7 A;  3VMX A;  3B8E B;  5APY A;  5AW6 B;  2I1K A;  5AVZ B;  1FU1 A;  5CMZ A;  2PP6 A;  2IX7 C;  3E1I A;  2HFE D;  1GU5 A;  2WZ7 A;  1GDT A;  2XV5 A;  3NMD A;  2GM4 A;  3RL0 D;  1NAF A;  1L4A B;  3VMZ A;  1SQB K;  5CCH A;  3V4W A;  3N4X A;  3GHG A;  3H32 A;  2QM7 A;  2Z4E A;  1SQX K;  2CPS A;  4Y99 B;  4DZO A;  1L4A C;  1JNM A;  3GHG B;  1RE4 C;  3HRN A;  1LTG C;  1SP4 A;  2FYU K;  4ZKU A;  3MIW A;  1FZC C;  1MV8 A;  1T3J A;  1N7L A;  2KOG A;  5AVR B;  3LIE A;  5AW4 B;  3C9I A;  1N73 B;  3MGN A;  2BAS A;  1CSB A;  1NTZ K;  5AW2 B;  1GW3 A;  1LTI C;  1KIL C;  2XNX A;  2FFD A;  2I1J A;  5AW0 B;  3RL0 C;  2HPC B;  4RES B;  2OYI A;  5AW3 B;  5CJ0 A;  5CCG D;  5AW5 B;  4LC1 A;  3RK2 B;  1RF0 C;  4ZKP A;  2HG5 D;  2HOD A;  4IFF A;  3EQ2 A;  1FDM A;  2M8R A;  2MJZ A;  2Z5H A;  3HD7 B;  1DX7 A;  2N1T C;  1GTW A;  1NTK K;  3G3Z A;  3P8C E;  1J1D C;  2PAJ A;  3A2A A;  1AFO A;  2QM8 A;  2WSE H;  4N78 E;  1VDF A;  1LT9 B;  1GL2 D;  3BAT A;  3KYQ A;  4B86 A;  3HE5 B;  2C0W A;  4KHX A;  1NWQ A;  3BRV B;  2CPB A;  1GL2 A;  1SFC D;  2C0X A;  3TNU A;  1IFM A;  4N6J A;  2R32 A;  1NKN A;  1JY2 P;  5AVU B;  3M9B A;  1MFZ A;  2GUS A;  5CCG A;  5KTB A;  2HOD B;  1CZQ A;  4EOT A;  1FOS E;  3L35 A;  1IFI A;  1WT6 A;  4JYC A;  1JY2 O;  3T97 A;  3KQG A;  2WT7 B;  3VMY A;  3V4Q A;  2ZXE B;  4GKG A;  1N73 C;  4W7Y A;  1GK6 A;  3RK3 D;  2WT7 A;  3RK3 B;  2KSJ A;  1KZU B;  1N7S C;  3M0D C;  4M3L A;  1ZR4 A;  2OAR A;  2XDJ A;  1RF1 C;  2P2U A;  3HE4 A;  4XE5 B;  3V2P A;  1KIL A;  3I5C A;  2Q7C A;  1NOH A;  1GZL A;  1LGH B;  1NHL A;  5BU8 B;  2HLO A;  2HYN A;  2E42 A;  3HUS A;  4WB4 A;  1J1E C;  2H8P D;  2WSF H;  1FJK A;  2N1T A;  5AVS B;  1QL1 A;  2A45 H;  3B5N C;  1GD2 E;  5BVZ A;  1NTM K;  2L5G B;  2N1T B;  1GU4 A;  1X8Y A;  2Z5I A;  1FZC A;  1M1J B;  3M06 A;  1LTJ A;  1SVF A;  1ZV8 A;  1FZF A;  1IC2 A;  5AVX B;  1KFM A;  2KLV A;  5CCH D;  3UIA A;  1X79 B;  1LTS C;  4Y99 C;  1T2K D;  2JJL A;  2OYH C;  1NU1 K;  1ZR2 A;  3RK2 C;  4C7N A;  1GK4 A;  4WBA A;  1N2D C;  2XU6 A;  3U59 A;  1Z56 A;  2R5D A;  2YKO A;  1E5W A;  1ZN5 A;  1A02 J;  1YTZ I;  5AVY B;  5AW7 B;  3VN0 A;  1NH4 A;  1JY3 P;  3R2P A;  5APX A;  2GUV A;  3KPE A;  5KJ7 C;  1L0L K;  2C9N Y;  1L4A D;  2J58 A;  1PFI A;  3BVH A;  1GL2 B;  4W7Z A;  2KB7 P;  3NXS A;  1RF0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...