2XU6A

Mdv1 coiled coil domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
GPQTLVNSLEFLNIQKNSTMSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLMLEDNLKQIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MDV1 COILED COIL
publication title Molecular Architecture of a Dynamin Adaptor: Implications for Assembly of Mitochondrial Fission Complexes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
total genus 26
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xu6A00
3O8ZA 5AW0B 1GU5A 2W27A 2QM8A 1CI6A 1GZLA 3A3YB 3KDPB 4AYCA 2WPQA 4M3LA 2YO3A 5AVWB 1NWQA 1A02F 4I2LC 3NXSA 5APSA 1SLQA 1SP4A 3M0DA 2E43A 2P2UA 3OAKA 3I5CA 5APQA 5APTA 1MV8A 5AVTB 4HYTB 5AVQB 1CZQA 4C7NA 4LC1A 3HE4B 1H88A 2YNYA 1OXZA 2Z5HA 5AVRB 5AW8B 3VMYA 3A7OA 2W6AA 1KQLA 3MGNA 1A02J 2Q3IA 3VYIA 1GTWA 2XU6A 1J2JB 3T97A 3NMDA 3UIAA 4AUWA 2WT7A 1JNMA 2E42A 1NAFA 3LIDA 2Q7CA 2WT7B 4I6MC 3P32A 5AW5B 1OWAA 5APWA 3VN0A 3V4QA 1FOSE 3VTPC 3TNUB 4AQRD 1DH3A 2XV5A 1GK4A 5AVVB 1S9KD 3HE4A 1HJBA 3MD0A 2BASA 3M9HA 5AW6B 2VRSA 2Z5IA 3VMXA 3P8MC 1T2KC 5CMZA 5APUA 1G2CB 4GKGA 2P67A 2IPPA 1HWTC 2C9LY 2WPRA 2H7HA 3A5TA 2WPSA 2R3CA 3M0AA 1S9KE 5AVZB 5AW7B 1FOSF 5AVUB 2R5DA 3V5BA 2WTYA 4JYBA 1GU4A 3L37A 3HTKA 5APXA 3V4WA 5AW1B 1HBWA 3A2AA 3L35A 3HE5B 3L36A 5APYA 3M9BA 5AW3B 1CSBA 4JYCA 3TNUA 4KHXA 2N9BA 5APVA 5AW4B 5AVXB 3NTNA 4DZOA 3TK1A 2QM7A 2ZFCA 1MUUA 4GT1A 2P7JA 1GK6A 4C46A 1X8YA 2R32A 2Q5UA 1H8AA 1FAVA 3IR9A 1CI6B 3KQGA 1JUNA 1GD2E 1YYCA 2KP8A 2R5BA 3TYYA 1H89A 2YO2A 3B8EB 1MFZA 4RESB 4EOTA 5AVSB 1HUCA 3SWFA 5AW2B 4B86A 3HE5A 3LIEA 3M91A 1IO4A 4XE5B 2C9NY 2XZRA 2ZXEB 3M06A 5AW9B 4C7NB 2JJLA 3P7KA 1T2KD 3VMZA 2WWWA 5AVYB 3NFQA
chains in the Genus database with same CATH superfamily
2W27A 2YKQA 1OMIA 1SQVE 3KDPB 2D2CD 3PRJA 4K3AA 5AVWB 2DW3A 3SWKA 2ZYAA 1NYHA 3HD7D 3D6YA 1NTZJ 1OVVA 3B5NB 2JR8A 2BEQD 1RF1A 2WQYC 1BCCG 4KJMA 2E42A 1VF5D 3O6QB 2OTKE 1SFCC 1NTKE 2LR2A 1SQQG 3IF4A 1HJBA 1AVOA 3KYQA 1OX3A 2KOGA 3MUDC 2PAJA 3CXHE 4JYCA 3TNUA 1DIPA 1M1KQ 1EQ7A 1EDLA 2D2CB 2KZIA 3PTZA 1X8YA 1SQXD 1PGQA 1VQ8P 2JKVA 4BWNA 5TISH 2H8PD 1KB9I 2QG4A 2BCCE 4R4LA 1NTZK 3AE4C 3L75J 1IO4A 4OGQB 1Q81Q 1DD3A 4PJ0E 1USEA 2WSEH 1EZVE 1VF5B 3AE6C 2P1JA 2HFED 3G71P 2B89A 1FC2C 1R5SA 2E75C 3RK3C 3C1LA 2H89C 2CK3H 5APTA 1MV8A 1BE3G 3BCCD 1H88A 3L71D 2YKPA 1NKZB 1KV4A 1HF9A 3TGUG 2PGDA 2NPSA 3T97B 4AUWA 3U1AA 1LT1A 1NJIQ 1FZCC 3VTPC 3HRNA 3L74D 1P84H 3PH0A 2OYIC 1URQD 4HJGH 2KXPB 1K9MQ 1EC5A 2VRSA 1SQQJ 1L2PA 2OTLP 4I7ZB 1SQBE 3CX5I 3WMM0 1FZGA 1GU4A 2KIKA 2O1JA 3N7NA 1VQ6P 3WU2E 4U3FG 1LT9A 1LTSC 2WSFH 1MUUA 1N2DC 1G2CA 1M7LA 3L73E 3CLQA 1RF1C 1SQXE 3E1RA 1MKMA 1KYOH 3GLMA 1T3JA 3G9RA 5AVYB 1DX7A 1BDCA 4LGDE 4AYCA 4M3LA 5KLIC 4RO0A 5CCHC 4Y99C 2A06D 3FWNA 1ZRTE 1YTZI 3BATA 1SQQK 4UB6H 3USSA 2M5AA 4PD4H 5KLVD 2YXQB 1BE3J 1K04A 1BSHA 4OWFA 4U7JA 1JNMA 1ZV8A 1SVFA 3TGUJ 3CD6P 1EDKA 3H1KG 2M0BA 2HODB 3MIWA 1KC8Q 4D6TD 1N7LA 1H0TB 3L74E 1KD1Q 1BGYG 4L73A 5AVZB 4NPDA 2Y0DA 1PZQA 2XKMA 3A2AA 1PGJA 1KFMA 3HE5B 3L36A 2B87A 2FYZA 4W7ZA 3KZIE 3PHLA 1N8RQ 5KKZB 2P7JA 3AE2C 4C46A 5L8RJ 3B71A 1H8AA 2Q5UA 3W67A 3H1LD 1YJNP 5CBNA 3H1JE 2AEMA 4WY4D 1S72P 2KNCA 2FYUG 1JY3N 4WB4A 2NPSC 2WPVB 1PP9G 2QVAA 4JYBA 2N9YB 2HPCA 1J1EC 1CI6A 1N7SA 2E5YA 1Q82Q 1P84I 3U1CA 2AEJA 4I1LA 4L74A 3RL0C 3IAOA 3WUVA 3L72G 5CCGA 3A0HE 2RKLA 1OXZA 2KSEA 1SQPG 2AXCA 2IBZI 4IL6E 1A02J 1KORA 1KMIZ 3FWLA 5GTIE 2B88A 1LT9C 2L91A 1JMBA 1VQOP 1NTMG 1NU1J 1Y8AA 4L75A 5H2FH 3CWBE 2WITA 3H1IE 2IFMA 4IOIH 3TSIA 2XNDH 2Z5IA 4GODA 3L70D 3AE1C 3H1KJ 2WMMA 2P67A 1VQ9P 1EDJA 3A5TA 1AQ5A 1FBMA 2ITAA 2JEEA 2R5DA 1G1JA 4N6JA 1HBWA 2K9YA 1BGYJ 1MFTA 1GW3A 4DZOA 1ZXGA 1FZAA 2KUBA 3FX0A 1VQKP 2QSIA 1YHQP 3WU2H 2YXRB 1OZHA 1SFCD 4EOTA 2CPBA 5CJ4A 3H1HG 3M91A 1E79H 4XE5B 2K9JB 3H1LE 2XZRA 2A45I 4PD4I 2Y0EA 3P7KA 1AFOA 1L0NJ 1RY3A 1NTZD 1AJYA 4EDFA 2FYUJ 1OW7A 3Q3DA 1NU1K 1VPCA 1K8AQ 4I2LC 2IBZG 3QH9A 1IFMA 4HKZH 4ASWA 1QVGO 1PFIA 3A0BE 1GL2A 3L72J 2E5TA 2WT7A 1NAFA 2HR3A 3P8CD 4I6MC 1VQLP 1LTAC 1SQPJ 4N3YB 1OWAA 1JCCA 3BRVB 2GM4A 1NTMJ 1SFCB 1TU3F 2E75D 2R3CA 3RK3D 1NTKD 3Q1MA 1QL1A 3V5BA 2OTJP 5APXA 3L70E 2WSEJ 3L35A 3E7KA 3N4XA 1L0NK 3CCRP 2P58A 1N7SC 2OGUA 2FYUK 2QM7A 1SQVG 4NPFX 4WBAA 3CXHD 3CPWO 1NHLA 3GG2A 4K35A 3IR9A 2Y9YA 2G8YA 5CCGC 3KZIH 3RL0g 1R8EA 3AEEC 2FXMA 3CCSP 4IFMA 1QVFO 1S4XA 1PPJE 3H1HJ 3JC22 2J58A 1JEKA 1SQPK 1JB0J 1NTZE 3M0DA 3OW2O 1X0TA 3I5CA 4GDOA 3CC7P 3B5NA 3EFFK 3H6PA 1NTMK 4DCKA 3CL3D 2JWDA 3HE4B 2E75B 2FYNC 5AW8B 1FE6A 2RN0A 4YXDC 1S5LX 1JTHA 3MP7B 3HTKB 1AA0A 3SSUA 1U57A 4XA4A 4JBZA 3V4QA 1FOSE 4TLFA 2XV5A 4UB8E 4IL6H 1EXIA 5GTIH 3P8CE 1FZCB 2BCCG 2OYIB 3CI9A 5CCHD 1L0LJ 1HGVA 2H88C 3RK3E 1VQMP 1EZVG 1VDFA 4QMAA 1IFDA 1YTZT 1SQBD 1U7MA 1T8ZA 1N73C 1GW4A 2KP8A 2R5BA 4RKUJ 1SQVJ 3TF5A 3W68A 4B86A 3ITKA 3CCVP 2GA1A 3GHGC 1AQTA 1J1DC 1EDIA 1RF1B 2R3SA 3L73D 1KZUB 3HD7B 2Y0CA 4NPEA 2YO3A 4O9BA 2AEFA 2WSCH 5M1BA 4EI2A 5KLIB 5TJHA 1UIXA 2YNYA 2KS1A 4Y99B 1RF0A 2JP3A 1JY3O 1L0LK 1LTJA 2J5UA 3CCMP 3T97A 1JY2N 1ZRTD 3WUTA 3P32A 2NPSD 3TNUB 2KB7P 4AQRD 1DH3A 2UWJE 5AVVB 3CC4P 2NRGA 1SQQE 4YTPC 2OYOA 5BVZA 2V7QH 1SQXG 3CCUP 1KN7A 3RL0D 5DJTB 3AE3C 1CSBA 1BCCJ 5AVXB 2E76C 3ABVC 3AE9C 2H43A 2FFDA 2IZ1A 3M0DC 1USDA 1ZLLA 4L76A 1JUNA 4YXWH 1H89A 3FXEA 1LWUA 2QJPC 3SFEC 3LIEA 1QGKB 2YIUC 3I55P 2AXTE 1FJPA 3M06A 3VMZA 2YKOA 2FKWB 2WWWA 3BCCG 5CHXA 3O8ZA 3L71G 2LXCB 3H1JD 2JDIH 2NPSB 1A02F 2OYHA 3SFDC 2J59M 5KJ7A 2Q1KA 2ZJSE 5GTHH 2BEZF 3TDKA 3GW6A 1NU1D 4DT0A 2I1KA 3VOPA 3QWOC 2L5GB 3RL0B 1IFJA 3Q5PA 2B9BA 2Q3IA 2XU6A 2W90A 2ZVOB 3TGUE 1J2JB 1YBKA 3SWYA 1URQB 3CX5D 1M1JA 2FY8A 1Y47A 1LT9B 2N1TA 3WUUA 1BGYD 2ZYGA 1G2CB 3EFGA 2H7HA 4OGQC 2WTYA 3CWBD 1JM0A 3H1ID 3F89A 4UB8H 2LXBA 4C7RA 1VQ5P 1SQXJ 1AV1A 1IFNA 1KB9E 3NTNA 1L4AA 1FJKA 4GT1A 3RBZA 1L0ND 1M8OB 1LTIC 2R44A 2FYUD 1S1CX 1RF0C 1LTJC 2A06G 3VP8A 2Y9ZA 4JQ0D 1GU5A 3CXHH 4U3FJ 5KLVG 3BCCJ 1Q7YQ 3H32A 3L71J 1N7SD 1W2BO 4H44C 1FDOA 4I7ZC 1KILA 1SQPD 4N78D 3AEBC 3MGNA 4D6TG 1GTWA 5CCGD 1JO5A 1VQNP 1NU1E 1NGMB 1LP1A 3UIAA 2O01H 2IFNA 3LIDA 2Q7CA 4ZKUA 4PJ0H 2FFDC 3BRTB 3H1KE 3CX5E 1LWUC 4A7PA 2WPRA 5E79E 5BU8B 1BGYE 3H1LG 2FBWC 2OARA 3D6ZA 5DJUB 3RBXA 1IJDB 2M3EA 1HJ0A 2OYHC 1GK6A 5KJ7C 1CI6B 3KQGA 1N7SB 1IFIA 4WY4B 3K5BA 2POHA 4RESB 1KYOI 5AW2B 1L0NE 2K9JA 3V2PA 2C9NY 2YMYA 1YJWP 1AVYA 2PP6A 5AW9B 3L4FA 2FYUE 3FXDA 2ZFCA 3JCUE 1M1JC 2WPQA 4WWIA 3AE8C 2YMKA 2MKVA 2N1TC 2P10A 1SLQA 1SP4A 2P2UA 3RK2C 1G1IA 5K5GB 1YITP 1PPJD 2KYVA 1OVRA 3H25A 4C7NA 5KLVJ 1W2EA 4LC1A 2GUVA 1FDMA 3ZDMA 4H0LC 1XTCC 3L72E 2K1AA 1HVVA 3L70G 1SQPE 1KQFB 4N78E 4PV1C 1U7JA 2FYNB 1PP9J 3PJSK 3HUSA 1L4AC 1IZNB 3G6EP 4GIFA 4D6TJ 1L0LD 1NTME 2ZYDA 1W5CE 3CMEP 1K73Q 5CBOA 2Q6QA 4OH8B 4GKGA 3AEDC 3D71A 2O3JA 1HTLC 3M0AA 1FOSF 4DOJA 3L37A 4Z1MH 3KPEA 5AW1B 1Q2NA 3C9IA 1M90Q 3JSVC 3MTUE 1CW5A 1JY2O 3M9BA 2KLUA 3CXHI 1M57D 3TK1A 3H1LJ 4OVNF 2WSCJ 1GMJA 1NTZG 2W6BA 2O1KA 1KILC 5KLVK 2QA4P 1N73B 3H1HE 2Q3EA 2JJLA 3L75D 3B4SA 1P84E 1HH0A 2QM8A 1JCDA 3GHGB 1J1DB 1IFPA 2MJZA 1EZVI 2PFXA 5APSA 4IFDK 2E76D 2W8ZA 2IBZE 2V7QJ 3I56P 5AVTB 1YI2P 3GF7A 5CJ0A 2WSSH 1BSNA 1NTKG 3PP5A 1JOCA 1LTGC 1ZR4A 5APWA 3LW5H 3L70J 1YJ9P 1ZOYC 1S9KD 3MD0A 3RK3B 1Z56A 5AW6B 1BCCD 3P8MC 1T2KC 5APUA 1L0LE 1HWTC 2OYIA 1UIIA 2WSFJ 3O6QA 2IDBA 1VQPP 1SQQD 1LTBC 3A0HH 3CX5H 5APVA 1D7MA 1ZN5A 3F5HA 3R4YA 2E76B 3V6IA 1GD2E 4UB6E 3R2PA 5B66E 5C39A 4PD4E 4RJTA 4LLHA 2Q9IA 1IC2A 5BU5A 2QEXP 1R5LA 4MN4C 2QJPB 1NVOA 4OGQD 3HUSC 4ZMDA 4BRYB 1VL2A 2YIUB 3AECC 3HD7A 1X9VA 3A3YB 3VP9A 4W80A 4H13C 1JTHB 2KK7A 3L75E 1KTMA 1VQ7P 3JCUH 5AVQB 3OA7A 1OFCX 1GL2C 5CCHA 2LKMA 3EQ2A 5AVRB 3AEGC 5EFWB 1LNQA 1IK9A 3AE5C 3Q2YA 2Z4EA 3PLNA 2KI7B 3NMDA 1X22A 3CCQP 1DEBA 2E74C 3AEAC 2IYPA 1BE3D 3VN0A 2WZ7A 4Y28J 4WVZA 1S5LE 1LJ2A 1NTKJ 3TGUD 3V2RA 1OVUA 2IPPA 1NOHA 2C0XA 1SQBG 1Y9BA 1S9KE 2M8RA 3GMAA 1BCCE 3V4WA 4H44D 3MHVA 1YIJP 2V4HA 3Q5RA 1NAYA 3A0BH 2QJYC 3MZWB 5KTBA 2QRXA 2QJKC 1OW8A 1SQVK 3L73G 1PGOA 1YQ3C 2ZT9C 2ZXXA 3CC2P 1JY3P 1KB9D 4EYYQ 4U3FD 2BCCJ 2ZVNB 5H2FE 2KS1B 2O01J 3OJAB 1T3UA 3IFMA 4JPZB 1SS1A 2W83C 1LTJB 1X79B 1GZLA 3B5NC 2RMZA 2CPSA 1NTKK 1NKNA 1RQVA 5KJ7D 3VMYA 4H44B 1PL5A 1URQA 3U59A 1J1EB 2HYNA 5KAFE 3L74G 2FFDB 3VMXA 1BE3E 3II6A 5CMZA 1QEXA 5KAIE 2N1TD 3D70A 2NZ2A 5AW7B 1GDTA 1NO4A 3RK2D 1LWUB 3H1KD 2D2CC 3VMAA 1SQBJ 4H0LD 3HD7C 2HODA 2PRRA 2I8DA 4ZNCA 1H0TA 4PV1D 2XNXA 1ZW0A 1QL2A 1L4AD 1YYCA 3H1JG 4XFJA 2OYHB 3B8EB 3HE5A 1VF5C 3L73J 2HG5D 1WT6A 2ZXEB 3IN6A 1S3JA 4U3FE 5B66H 1NU1G 5AW0B 2A45H 4YPCA 1Q90D 2IZ0A 3BCCE 3L71E 3C8VA 1RE4A 1MZ9A 1NWQA 2E43A 4IL6X 3OAKA 1M1JB 1PP9D 4HYTB 2N1TB 2Z5HA 3RK2B 3GF3A 3A7OA 2M5AB 1KILD 1SQBK 3CCEP 4H0LB 4W7YA 3CWBG 1FS0E 3H1IG 3L72D 4PV1B 2KZJA 3FGAD 1GK4A 2FXPA 1L4AB 3CMAP 1FZBA 2O01N 2JWAA 1N86A 2WPSA 5B5EE 1NTMD 4HH2A 1L0NG 3L74J 1S5LH 1SQXK 2GUSA 5APYA 1XTGB 2W6JH 1PGPA 2B87B 1EXJA 1LGHB 3S1KA 4ASVA 2OQQA 2IYOA 1HGZA 2R32A 3G4SP 3V2QA 2FXOA 4WY4A 4ZKPA 1KQSO 3TYYA 2XDJA 1MFZA 3H32B 1FU1A 3BVHA 1PV3A 2KNCB 3H1JJ 2K88A 1T2KD 1KILB 2A06E 1URQC 3NFQA 3EWKA 2HPCB 3LW5J 1FZEA 1ZMEC 1LP1B 1RE3A 2HLOA 3H1HD 1Q86Q 5KLVE 2G3AA 1RH5B 1P84D 5APQA 3V2NA 1T6AA 2K37A 2W6AA 1KQLA 1PP9E 4KT0J 3VYIA 4D6TE 4IFFA 1K05A 2IBZD 2AXTH 1ZP0C 1IK7A 1KILE 2BASA 1E5WA 1OW6A 3CWBJ 3RGUA 3H1IJ 2C9LY 1DEEG 4H13D 1QLED 2M3BA 5AVUB 1RQUA 5KKZC 3CCJP 1M56D 5TISE 5KAFH 5AW3B 4JF7A 1KYOD 1GL2D 4KHXA 5KAIH 1RE4C 2IX7C 1YQ4C 2QE7H 3S4RA 1SFCA 3G3ZA 1DD4A 1FAVA 3Q5SA 1KQGB 2E74D 3AEFC 2YO2A 1QX8A 2KLVA 1HUCA 1N73A 3MUDA 4GOFA 2WVRA 1RHZB 2I1JA 1SQVD 1PPJG 4C7NB 1NH4A 1S2EA 2QIWA 4PD4D 1OIPA 3GHGA 4CPGA 4TT3H 3HUSB 3NXSA 3KXDA 1KB9H 1LTTC 4H13B 1CZQA 1L0LG 1FZFA 1JY2P 3CCLP 4DJGA 2ZT9D 1GL2B 3M9QA 2WT7B 3BASA 5AW5B 4BXLA 3E1IA 2RH0A 2ZAEB 1PIXA 1WMKA 4WY4C 3HE4A 4HB1A 1ZR2A 3M9HA 2E74B 4R4MA 3B5ND 4EIJA 2A45G 3KHUA 3AE7C 3HTKA 2K3RA 1WRGA 3S9OA 2N9BA 5AW4B 1JMMA 2SPZA 2C0WA 1RE3C 5B5EH 2BCCD 2JO1A 5GTHE 1FZCA 1KYOE 3L75G 1FDIA 4GOEA 1KFNA 3SWFA 2QJYB 5AVSB 2QJKB 1VQ4P 1EZVD 2KSJA 1BDDA 2ZT9B 5E79H 4BRYA
chains in the Genus database with same CATH topology
1GU5A 2W27A 2YKQA 1LTJB 1X79B 1GZLA 3KDPB 3B5NC 1NU1K 1VPCA 5AVWB 4I2LC 3H32A 3HD7D 1N7SD 1NTKK 2CPSA 1IFMA 3B5NB 1NKNA 1KILA 1RF1A 4N78D 5KJ7D 3VMYA 3MGNA 1PFIA 1GTWA 5CCGD 1JO5A 1GL2A 3UIAA 2WT7A 2O01H 2IFNA 2E42A 1NAFA 1URQA 3LIDA 2Q7CA 4ZKUA 3P8CD 4I6MC 3U59A 1LTAC 2FFDC 4N3YB 1J1EB 1OWAA 1SFCC 1JCCA 2HYNA 3BRVB 3BRTB 1HJBA 2GM4A 1LWUC 3KYQA 2FFDB 3VMXA 1SFCB 3II6A 5CMZA 2KOGA 2WPRA 2N1TD 2R3CA 3RK3D 5BU8B 5AW7B 2PAJA 1QL1A 3V5BA 1GDTA 1NO4A 3RK2D 5APXA 1LWUB 3L35A 2OARA 3N4XA 1L0NK 4JYCA 3TNUA 3HD7C 1N7SC 2HODA 1EQ7A 1IJDB 2FYUK 2QM7A 4WBAA 2OYHC 1GK6A 1X8YA 1NHLA 5KJ7C 3IR9A 1CI6B 2XNXA 2H8PD 3KQGA 1N7SB 1IFIA 1QL2A 1L4AD 1YYCA 4WY4B 2OYHB 5CCGC 3B8EB 1NTZK 2POHA 4RESB 5AW2B 3HE5A 2FXMA 1IO4A 2HG5D 4IFMA 3V2PA 1WT6A 2C9NY 2YMYA 2PP6A 2ZXEB 5AW9B 3L4FA 2WSEH 2ZFCA 2J58A 2A45H 5AW0B 1M1JC 2P1JA 2HFED 2WPQA 1SQPK 1RE4A 1MZ9A 2N1TC 1NWQA 3RK3C 1SLQA 1SP4A 3M0DA 2E43A 2P2UA 3OAKA 1G1IA 1M1JB 3RK2C 3I5CA 2KYVA 3B5NA 3H6PA 5APTA 1NTMK 1MV8A 4HYTB 2N1TB 3CL3D 4C7NA 1FDMA 1W2EA 3HE4B 2GUVA 4LC1A 1H88A 2YKPA 1NKZB 2Z5HA 1XTCC 5AW8B 3RK2B 3A7OA 1HVVA 1KILD 2NPSA 4N78E 1JTHA 1SQBK 4AUWA 3HTKB 3HUSA 1L4AC 4W7YA 3U1AA 4XA4A 4GIFA 3V4QA 1FZCC 1FOSE 3VTPC 3HRNA 2OYIC 2XV5A 1GK4A 1URQD 1L4AB 3P8CE 2VRSA 1FZBA 4OH8B 1FZCB 4GKGA 1N86A 1HTLC 2WPSA 2OYIB 3CI9A 3M0AA 1FOSF 4DOJA 5CCHD 1FZGA 4HH2A 3WMM0 1GU4A 3L37A 3KPEA 5AW1B 1HGVA 3C9IA 1SQXK 2GUSA 2O1JA 3N7NA 3MTUE 1CW5A 1JY2O 5APYA 3M9BA 1XTGB 1LT9A 1LTSC 1LGHB 1VDFA 2WSFH 3TK1A 1IFDA 1MUUA 1YTZT 1N2DC 1HGZA 1G2CA 2R32A 3V2QA 1M7LA 1T8ZA 1N73C 2W6BA 2O1KA 4WY4A 4ZKPA 1GW4A 2KP8A 2R5BA 3CLQA 3TYYA 2XDJA 1KILC 1RF1C 1MFZA 3H32B 4B86A 5KLVK 1FU1A 3BVHA 1N73B 3GHGC 1J1DC 2JJLA 1KILB 1T2KD 1RF1B 1T3JA 1URQC 5AVYB 3NFQA 1DX7A 1HH0A 2QM8A 2HPCB 1JCDA 1KZUB 3GHGB 4LGDE 1FZEA 1J1DB 3HD7B 4AYCA 4M3LA 1RE3A 2HLOA 2YO3A 2MJZA 4O9BA 5APSA 5CCHC 4Y99C 2WSCH 4IFDK 5APQA 3V2NA 5AVTB 1YTZI 3BATA 1SQQK 2YNYA 4Y99B 1RF0A 1JY3O 1L0LK 2W6AA 1KQLA 1LTJA 3VYIA 3T97A 5CJ0A 1JY2N 4IFFA 1JNMA 1ZV8A 3PP5A 1JOCA 1LTGC 1SVFA 1ZR4A 3P32A 5APWA 2NPSD 3LW5H 3TNUB 2KB7P 4AQRD 1DH3A 5AVVB 2HODB 1S9KD 3MD0A 2BASA 3RK3B 1Z56A 1E5WA 3MIWA 5AW6B 1N7LA 3P8MC 1T2KC 5APUA 2C9LY 5BVZA 1HWTC 2OYIA 5AVZB 2M3BA 5AVUB 2XKMA 3RL0D 3A2AA 1KFMA 1LTBC 3HE5B 3L36A 5AW3B 1CSBA 4JF7A 1GL2D 4KHXA 5APVA 5AVXB 2FYZA 4W7ZA 1RE4C 2IX7C 1ZN5A 2H43A 2P7JA 4C46A 2FFDA 1SFCA 3G3ZA 1H8AA 2Q5UA 3M0DC 1FAVA 1ZLLA 1JUNA 1GD2E 3R2PA 1H89A 2YO2A 2KLVA 1LWUA 1HUCA 4LLHA 2Q9IA 1N73A 3LIEA 4WY4D 3MUDA 1IC2A 5BU5A 2I1JA 1JY3N 4WB4A 1FJPA 2NPSC 3M06A 4C7NB 3VMZA 2YKOA 2WWWA 1NH4A 2FKWB 3HUSC 5CHXA 4JYBA 3O8ZA 2HPCA 1J1EC 3GHGA 1CI6A 3HD7A 1X9VA 3A3YB 3VP9A 1N7SA 2NPSB 4W80A 1JTHB 1A02F 3U1CA 2OYHA 3HUSB 4I1LA 2J59M 3NXSA 5KJ7A 1LTTC 3RL0C 5AVQB 1CZQA 3OA7A 5CCGA 1GL2C 5CCHA 1OXZA 2LKMA 3EQ2A 5AVRB 1FZFA 2I1KA 1JY2P 3VOPA 2L5GB 3RL0B 1IFJA 1A02J 2Q3IA 1IK9A 2XU6A 1J2JB 1LT9C 3SWYA 2Z4EA 1GL2B 3NMDA 1DEBA 3M9QA 2WT7B 3BASA 1URQB 5AW5B 3E1IA 1M1JA 3VN0A 2WZ7A 2WITA 1LT9B 2IFMA 2N1TA 4WY4C 3HE4A 1ZR2A 3TSIA 3M9HA 2Z5IA 3V2RA 1G2CB 3B5ND 2P67A 2IPPA 3EFGA 2H7HA 1NOHA 2C0XA 4EIJA 2A45G 3A5TA 1AQ5A 1S9KE 1FBMA 2M8RA 2JEEA 2R5DA 2WTYA 1G1JA 3HTKA 3V4WA 4N6JA 1HBWA 1WRGA 4C7RA 2N9BA 5AW4B 1JMMA 1GW3A 1IFNA 3NTNA 4DZOA 2C0WA 1L4AA 1FJKA 1RE3C 4GT1A 1FZAA 1FZCA 5KTBA 1SQVK 1LTIC 1SFCD 1JY3P 1KFNA 4EOTA 5AVSB 3SWFA 2CPBA 5CJ4A 1RF0C 3M91A 2KSJA 4XE5B 1LTJC 2XZRA 2A45I 3P7KA 1AFOA 3VP8A 1RY3A 3OJAB 1T3UA 3IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3O8Z A;  5AW0 B;  1GU5 A;  2W27 A;  2QM8 A;  1CI6 A;  1GZL A;  3A3Y B;  3KDP B;  4AYC A;  2WPQ A;  4M3L A;  2YO3 A;  5AVW B;  1NWQ A;  1A02 F;  4I2L C;  3NXS A;  5APS A;  1SLQ A;  1SP4 A;  3M0D A;  2E43 A;  2P2U A;  3OAK A;  3I5C A;  5APQ A;  5APT A;  1MV8 A;  5AVT B;  4HYT B;  5AVQ B;  1CZQ A;  4C7N A;  4LC1 A;  3HE4 B;  1H88 A;  2YNY A;  1OXZ A;  2Z5H A;  5AVR B;  5AW8 B;  3VMY A;  3A7O A;  2W6A A;  1KQL A;  3MGN A;  1A02 J;  2Q3I A;  3VYI A;  1GTW A;  2XU6 A;  1J2J B;  3T97 A;  3NMD A;  3UIA A;  4AUW A;  2WT7 A;  1JNM A;  2E42 A;  1NAF A;  3LID A;  2Q7C A;  2WT7 B;  4I6M C;  3P32 A;  5AW5 B;  1OWA A;  5APW A;  3VN0 A;  3V4Q A;  1FOS E;  3VTP C;  3TNU B;  4AQR D;  1DH3 A;  2XV5 A;  1GK4 A;  5AVV B;  1S9K D;  3HE4 A;  1HJB A;  3MD0 A;  2BAS A;  3M9H A;  5AW6 B;  2VRS A;  2Z5I A;  3VMX A;  3P8M C;  1T2K C;  5CMZ A;  5APU A;  1G2C B;  4GKG A;  2P67 A;  2IPP A;  1HWT C;  2C9L Y;  2WPR A;  2H7H A;  3A5T A;  2WPS A;  2R3C A;  3M0A A;  1S9K E;  5AVZ B;  5AW7 B;  1FOS F;  5AVU B;  2R5D A;  3V5B A;  2WTY A;  4JYB A;  1GU4 A;  3L37 A;  3HTK A;  5APX A;  3V4W A;  5AW1 B;  1HBW A;  3A2A A;  3L35 A;  3HE5 B;  3L36 A;  5APY A;  3M9B A;  5AW3 B;  1CSB A;  4JYC A;  3TNU A;  4KHX A;  2N9B A;  5APV A;  5AW4 B;  5AVX B;  3NTN A;  4DZO A;  3TK1 A;  2QM7 A;  2ZFC A;  1MUU A;  4GT1 A;  2P7J A;  1GK6 A;  4C46 A;  1X8Y A;  2R32 A;  2Q5U A;  1H8A A;  1FAV A;  3IR9 A;  1CI6 B;  3KQG A;  1JUN A;  1GD2 E;  1YYC A;  2KP8 A;  2R5B A;  3TYY A;  1H89 A;  2YO2 A;  3B8E B;  1MFZ A;  4RES B;  4EOT A;  5AVS B;  1HUC A;  3SWF A;  5AW2 B;  4B86 A;  3HE5 A;  3LIE A;  3M91 A;  1IO4 A;  4XE5 B;  2C9N Y;  2XZR A;  2ZXE B;  3M06 A;  5AW9 B;  4C7N B;  2JJL A;  3P7K A;  1T2K D;  3VMZ A;  2WWW A;  5AVY B;  3NFQ A; 
#chains in the Genus database with same CATH topology
 2W27 A;  2YKQ A;  1OMI A;  1SQV E;  3KDP B;  2D2C D;  3PRJ A;  4K3A A;  5AVW B;  2DW3 A;  3SWK A;  2ZYA A;  1NYH A;  3HD7 D;  3D6Y A;  1NTZ J;  1OVV A;  3B5N B;  2JR8 A;  2BEQ D;  1RF1 A;  2WQY C;  1BCC G;  4KJM A;  2E42 A;  1VF5 D;  3O6Q B;  2OTK E;  1SFC C;  1NTK E;  2LR2 A;  1SQQ G;  3IF4 A;  1HJB A;  1AVO A;  3KYQ A;  1OX3 A;  2KOG A;  3MUD C;  2PAJ A;  3CXH E;  4JYC A;  3TNU A;  1DIP A;  1M1K Q;  1EQ7 A;  1EDL A;  2D2C B;  2KZI A;  3PTZ A;  1X8Y A;  1SQX D;  1PGQ A;  1VQ8 P;  2JKV A;  4BWN A;  5TIS H;  2H8P D;  1KB9 I;  2QG4 A;  2BCC E;  4R4L A;  1NTZ K;  3AE4 C;  3L75 J;  1IO4 A;  4OGQ B;  1Q81 Q;  1DD3 A;  4PJ0 E;  1USE A;  2WSE H;  1EZV E;  1VF5 B;  3AE6 C;  2P1J A;  2HFE D;  3G71 P;  2B89 A;  1FC2 C;  1R5S A;  2E75 C;  3RK3 C;  3C1L A;  2H89 C;  2CK3 H;  5APT A;  1MV8 A;  1BE3 G;  3BCC D;  1H88 A;  3L71 D;  2YKP A;  1NKZ B;  1KV4 A;  1HF9 A;  3TGU G;  2PGD A;  2NPS A;  3T97 B;  4AUW A;  3U1A A;  1LT1 A;  1NJI Q;  1FZC C;  3VTP C;  3HRN A;  3L74 D;  1P84 H;  3PH0 A;  2OYI C;  1URQ D;  4HJG H;  2KXP B;  1K9M Q;  1EC5 A;  2VRS A;  1SQQ J;  1L2P A;  2OTL P;  4I7Z B;  1SQB E;  3CX5 I;  3WMM 0;  1FZG A;  1GU4 A;  2KIK A;  2O1J A;  3N7N A;  1VQ6 P;  3WU2 E;  4U3F G;  1LT9 A;  1LTS C;  2WSF H;  1MUU A;  1N2D C;  1G2C A;  1M7L A;  3L73 E;  3CLQ A;  1RF1 C;  1SQX E;  3E1R A;  1MKM A;  1KYO H;  3GLM A;  1T3J A;  3G9R A;  5AVY B;  1DX7 A;  1BDC A;  4LGD E;  4AYC A;  4M3L A;  5KLI C;  4RO0 A;  5CCH C;  4Y99 C;  2A06 D;  3FWN A;  1ZRT E;  1YTZ I;  3BAT A;  1SQQ K;  4UB6 H;  3USS A;  2M5A A;  4PD4 H;  5KLV D;  2YXQ B;  1BE3 J;  1K04 A;  1BSH A;  4OWF A;  4U7J A;  1JNM A;  1ZV8 A;  1SVF A;  3TGU J;  3CD6 P;  1EDK A;  3H1K G;  2M0B A;  2HOD B;  3MIW A;  1KC8 Q;  4D6T D;  1N7L A;  1H0T B;  3L74 E;  1KD1 Q;  1BGY G;  4L73 A;  5AVZ B;  4NPD A;  2Y0D A;  1PZQ A;  2XKM A;  3A2A A;  1PGJ A;  1KFM A;  3HE5 B;  3L36 A;  2B87 A;  2FYZ A;  4W7Z A;  3KZI E;  3PHL A;  1N8R Q;  5KKZ B;  2P7J A;  3AE2 C;  4C46 A;  5L8R J;  3B71 A;  1H8A A;  2Q5U A;  3W67 A;  3H1L D;  1YJN P;  5CBN A;  3H1J E;  2AEM A;  4WY4 D;  1S72 P;  2KNC A;  2FYU G;  1JY3 N;  4WB4 A;  2NPS C;  2WPV B;  1PP9 G;  2QVA A;  4JYB A;  2N9Y B;  2HPC A;  1J1E C;  1CI6 A;  1N7S A;  2E5Y A;  1Q82 Q;  1P84 I;  3U1C A;  2AEJ A;  4I1L A;  4L74 A;  3RL0 C;  3IAO A;  3WUV A;  3L72 G;  5CCG A;  3A0H E;  2RKL A;  1OXZ A;  2KSE A;  1SQP G;  2AXC A;  2IBZ I;  4IL6 E;  1A02 J;  1KOR A;  1KMI Z;  3FWL A;  5GTI E;  2B88 A;  1LT9 C;  2L91 A;  1JMB A;  1VQO P;  1NTM G;  1NU1 J;  1Y8A A;  4L75 A;  5H2F H;  3CWB E;  2WIT A;  3H1I E;  2IFM A;  4IOI H;  3TSI A;  2XND H;  2Z5I A;  4GOD A;  3L70 D;  3AE1 C;  3H1K J;  2WMM A;  2P67 A;  1VQ9 P;  1EDJ A;  3A5T A;  1AQ5 A;  1FBM A;  2ITA A;  2JEE A;  2R5D A;  1G1J A;  4N6J A;  1HBW A;  2K9Y A;  1BGY J;  1MFT A;  1GW3 A;  4DZO A;  1ZXG A;  1FZA A;  2KUB A;  3FX0 A;  1VQK P;  2QSI A;  1YHQ P;  3WU2 H;  2YXR B;  1OZH A;  1SFC D;  4EOT A;  2CPB A;  5CJ4 A;  3H1H G;  3M91 A;  1E79 H;  4XE5 B;  2K9J B;  3H1L E;  2XZR A;  2A45 I;  4PD4 I;  2Y0E A;  3P7K A;  1AFO A;  1L0N J;  1RY3 A;  1NTZ D;  1AJY A;  4EDF A;  2FYU J;  1OW7 A;  3Q3D A;  1NU1 K;  1VPC A;  1K8A Q;  4I2L C;  2IBZ G;  3QH9 A;  1IFM A;  4HKZ H;  4ASW A;  1QVG O;  1PFI A;  3A0B E;  1GL2 A;  3L72 J;  2E5T A;  2WT7 A;  1NAF A;  2HR3 A;  3P8C D;  4I6M C;  1VQL P;  1LTA C;  1SQP J;  4N3Y B;  1OWA A;  1JCC A;  3BRV B;  2GM4 A;  1NTM J;  1SFC B;  1TU3 F;  2E75 D;  2R3C A;  3RK3 D;  1NTK D;  3Q1M A;  1QL1 A;  3V5B A;  2OTJ P;  5APX A;  3L70 E;  2WSE J;  3L35 A;  3E7K A;  3N4X A;  1L0N K;  3CCR P;  2P58 A;  1N7S C;  2OGU A;  2FYU K;  2QM7 A;  1SQV G;  4NPF X;  4WBA A;  3CXH D;  3CPW O;  1NHL A;  3GG2 A;  4K35 A;  3IR9 A;  2Y9Y A;  2G8Y A;  5CCG C;  3KZI H;  3RL0 g;  1R8E A;  3AEE C;  2FXM A;  3CCS P;  4IFM A;  1QVF O;  1S4X A;  1PPJ E;  3H1H J;  3JC2 2;  2J58 A;  1JEK A;  1SQP K;  1JB0 J;  1NTZ E;  3M0D A;  3OW2 O;  1X0T A;  3I5C A;  4GDO A;  3CC7 P;  3B5N A;  3EFF K;  3H6P A;  1NTM K;  4DCK A;  3CL3 D;  2JWD A;  3HE4 B;  2E75 B;  2FYN C;  5AW8 B;  1FE6 A;  2RN0 A;  4YXD C;  1S5L X;  1JTH A;  3MP7 B;  3HTK B;  1AA0 A;  3SSU A;  1U57 A;  4XA4 A;  4JBZ A;  3V4Q A;  1FOS E;  4TLF A;  2XV5 A;  4UB8 E;  4IL6 H;  1EXI A;  5GTI H;  3P8C E;  1FZC B;  2BCC G;  2OYI B;  3CI9 A;  5CCH D;  1L0L J;  1HGV A;  2H88 C;  3RK3 E;  1VQM P;  1EZV G;  1VDF A;  4QMA A;  1IFD A;  1YTZ T;  1SQB D;  1U7M A;  1T8Z A;  1N73 C;  1GW4 A;  2KP8 A;  2R5B A;  4RKU J;  1SQV J;  3TF5 A;  3W68 A;  4B86 A;  3ITK A;  3CCV P;  2GA1 A;  3GHG C;  1AQT A;  1J1D C;  1EDI A;  1RF1 B;  2R3S A;  3L73 D;  1KZU B;  3HD7 B;  2Y0C A;  4NPE A;  2YO3 A;  4O9B A;  2AEF A;  2WSC H;  5M1B A;  4EI2 A;  5KLI B;  5TJH A;  1UIX A;  2YNY A;  2KS1 A;  4Y99 B;  1RF0 A;  2JP3 A;  1JY3 O;  1L0L K;  1LTJ A;  2J5U A;  3CCM P;  3T97 A;  1JY2 N;  1ZRT D;  3WUT A;  3P32 A;  2NPS D;  3TNU B;  2KB7 P;  4AQR D;  1DH3 A;  2UWJ E;  5AVV B;  3CC4 P;  2NRG A;  1SQQ E;  4YTP C;  2OYO A;  5BVZ A;  2V7Q H;  1SQX G;  3CCU P;  1KN7 A;  3RL0 D;  5DJT B;  3AE3 C;  1CSB A;  1BCC J;  5AVX B;  2E76 C;  3ABV C;  3AE9 C;  2H43 A;  2FFD A;  2IZ1 A;  3M0D C;  1USD A;  1ZLL A;  4L76 A;  1JUN A;  4YXW H;  1H89 A;  3FXE A;  1LWU A;  2QJP C;  3SFE C;  3LIE A;  1QGK B;  2YIU C;  3I55 P;  2AXT E;  1FJP A;  3M06 A;  3VMZ A;  2YKO A;  2FKW B;  2WWW A;  3BCC G;  5CHX A;  3O8Z A;  3L71 G;  2LXC B;  3H1J D;  2JDI H;  2NPS B;  1A02 F;  2OYH A;  3SFD C;  2J59 M;  5KJ7 A;  2Q1K A;  2ZJS E;  5GTH H;  2BEZ F;  3TDK A;  3GW6 A;  1NU1 D;  4DT0 A;  2I1K A;  3VOP A;  3QWO C;  2L5G B;  3RL0 B;  1IFJ A;  3Q5P A;  2B9B A;  2Q3I A;  2XU6 A;  2W90 A;  2ZVO B;  3TGU E;  1J2J B;  1YBK A;  3SWY A;  1URQ B;  3CX5 D;  1M1J A;  2FY8 A;  1Y47 A;  1LT9 B;  2N1T A;  3WUU A;  1BGY D;  2ZYG A;  1G2C B;  3EFG A;  2H7H A;  4OGQ C;  2WTY A;  3CWB D;  1JM0 A;  3H1I D;  3F89 A;  4UB8 H;  2LXB A;  4C7R A;  1VQ5 P;  1SQX J;  1AV1 A;  1IFN A;  1KB9 E;  3NTN A;  1L4A A;  1FJK A;  4GT1 A;  3RBZ A;  1L0N D;  1M8O B;  1LTI C;  2R44 A;  2FYU D;  1S1C X;  1RF0 C;  1LTJ C;  2A06 G;  3VP8 A;  2Y9Z A;  4JQ0 D;  1GU5 A;  3CXH H;  4U3F J;  5KLV G;  3BCC J;  1Q7Y Q;  3H32 A;  3L71 J;  1N7S D;  1W2B O;  4H44 C;  1FDO A;  4I7Z C;  1KIL A;  1SQP D;  4N78 D;  3AEB C;  3MGN A;  4D6T G;  1GTW A;  5CCG D;  1JO5 A;  1VQN P;  1NU1 E;  1NGM B;  1LP1 A;  3UIA A;  2O01 H;  2IFN A;  3LID A;  2Q7C A;  4ZKU A;  4PJ0 H;  2FFD C;  3BRT B;  3H1K E;  3CX5 E;  1LWU C;  4A7P A;  2WPR A;  5E79 E;  5BU8 B;  1BGY E;  3H1L G;  2FBW C;  2OAR A;  3D6Z A;  5DJU B;  3RBX A;  1IJD B;  2M3E A;  1HJ0 A;  2OYH C;  1GK6 A;  5KJ7 C;  1CI6 B;  3KQG A;  1N7S B;  1IFI A;  4WY4 B;  3K5B A;  2POH A;  4RES B;  1KYO I;  5AW2 B;  1L0N E;  2K9J A;  3V2P A;  2C9N Y;  2YMY A;  1YJW P;  1AVY A;  2PP6 A;  5AW9 B;  3L4F A;  2FYU E;  3FXD A;  2ZFC A;  3JCU E;  1M1J C;  2WPQ A;  4WWI A;  3AE8 C;  2YMK A;  2MKV A;  2N1T C;  2P10 A;  1SLQ A;  1SP4 A;  2P2U A;  3RK2 C;  1G1I A;  5K5G B;  1YIT P;  1PPJ D;  2KYV A;  1OVR A;  3H25 A;  4C7N A;  5KLV J;  1W2E A;  4LC1 A;  2GUV A;  1FDM A;  3ZDM A;  4H0L C;  1XTC C;  3L72 E;  2K1A A;  1HVV A;  3L70 G;  1SQP E;  1KQF B;  4N78 E;  4PV1 C;  1U7J A;  2FYN B;  1PP9 J;  3PJS K;  3HUS A;  1L4A C;  1IZN B;  3G6E P;  4GIF A;  4D6T J;  1L0L D;  1NTM E;  2ZYD A;  1W5C E;  3CME P;  1K73 Q;  5CBO A;  2Q6Q A;  4OH8 B;  4GKG A;  3AED C;  3D71 A;  2O3J A;  1HTL C;  3M0A A;  1FOS F;  4DOJ A;  3L37 A;  4Z1M H;  3KPE A;  5AW1 B;  1Q2N A;  3C9I A;  1M90 Q;  3JSV C;  3MTU E;  1CW5 A;  1JY2 O;  3M9B A;  2KLU A;  3CXH I;  1M57 D;  3TK1 A;  3H1L J;  4OVN F;  2WSC J;  1GMJ A;  1NTZ G;  2W6B A;  2O1K A;  1KIL C;  5KLV K;  2QA4 P;  1N73 B;  3H1H E;  2Q3E A;  2JJL A;  3L75 D;  3B4S A;  1P84 E;  1HH0 A;  2QM8 A;  1JCD A;  3GHG B;  1J1D B;  1IFP A;  2MJZ A;  1EZV I;  2PFX A;  5APS A;  4IFD K;  2E76 D;  2W8Z A;  2IBZ E;  2V7Q J;  3I56 P;  5AVT B;  1YI2 P;  3GF7 A;  5CJ0 A;  2WSS H;  1BSN A;  1NTK G;  3PP5 A;  1JOC A;  1LTG C;  1ZR4 A;  5APW A;  3LW5 H;  3L70 J;  1YJ9 P;  1ZOY C;  1S9K D;  3MD0 A;  3RK3 B;  1Z56 A;  5AW6 B;  1BCC D;  3P8M C;  1T2K C;  5APU A;  1L0L E;  1HWT C;  2OYI A;  1UII A;  2WSF J;  3O6Q A;  2IDB A;  1VQP P;  1SQQ D;  1LTB C;  3A0H H;  3CX5 H;  5APV A;  1D7M A;  1ZN5 A;  3F5H A;  3R4Y A;  2E76 B;  3V6I A;  1GD2 E;  4UB6 E;  3R2P A;  5B66 E;  5C39 A;  4PD4 E;  4RJT A;  4LLH A;  2Q9I A;  1IC2 A;  5BU5 A;  2QEX P;  1R5L A;  4MN4 C;  2QJP B;  1NVO A;  4OGQ D;  3HUS C;  4ZMD A;  4BRY B;  1VL2 A;  2YIU B;  3AEC C;  3HD7 A;  1X9V A;  3A3Y B;  3VP9 A;  4W80 A;  4H13 C;  1JTH B;  2KK7 A;  3L75 E;  1KTM A;  1VQ7 P;  3JCU H;  5AVQ B;  3OA7 A;  1OFC X;  1GL2 C;  5CCH A;  2LKM A;  3EQ2 A;  5AVR B;  3AEG C;  5EFW B;  1LNQ A;  1IK9 A;  3AE5 C;  3Q2Y A;  2Z4E A;  3PLN A;  2KI7 B;  3NMD A;  1X22 A;  3CCQ P;  1DEB A;  2E74 C;  3AEA C;  2IYP A;  1BE3 D;  3VN0 A;  2WZ7 A;  4Y28 J;  4WVZ A;  1S5L E;  1LJ2 A;  1NTK J;  3TGU D;  3V2R A;  1OVU A;  2IPP A;  1NOH A;  2C0X A;  1SQB G;  1Y9B A;  1S9K E;  2M8R A;  3GMA A;  1BCC E;  3V4W A;  4H44 D;  3MHV A;  1YIJ P;  2V4H A;  3Q5R A;  1NAY A;  3A0B H;  2QJY C;  3MZW B;  5KTB A;  2QRX A;  2QJK C;  1OW8 A;  1SQV K;  3L73 G;  1PGO A;  1YQ3 C;  2ZT9 C;  2ZXX A;  3CC2 P;  1JY3 P;  1KB9 D;  4EYY Q;  4U3F D;  2BCC J;  2ZVN B;  5H2F E;  2KS1 B;  2O01 J;  3OJA B;  1T3U A;  3IFM A;  4JPZ B;  1SS1 A;  2W83 C;  1LTJ B;  1X79 B;  1GZL A;  3B5N C;  2RMZ A;  2CPS A;  1NTK K;  1NKN A;  1RQV A;  5KJ7 D;  3VMY A;  4H44 B;  1PL5 A;  1URQ A;  3U59 A;  1J1E B;  2HYN A;  5KAF E;  3L74 G;  2FFD B;  3VMX A;  1BE3 E;  3II6 A;  5CMZ A;  1QEX A;  5KAI E;  2N1T D;  3D70 A;  2NZ2 A;  5AW7 B;  1GDT A;  1NO4 A;  3RK2 D;  1LWU B;  3H1K D;  2D2C C;  3VMA A;  1SQB J;  4H0L D;  3HD7 C;  2HOD A;  2PRR A;  2I8D A;  4ZNC A;  1H0T A;  4PV1 D;  2XNX A;  1ZW0 A;  1QL2 A;  1L4A D;  1YYC A;  3H1J G;  4XFJ A;  2OYH B;  3B8E B;  3HE5 A;  1VF5 C;  3L73 J;  2HG5 D;  1WT6 A;  2ZXE B;  3IN6 A;  1S3J A;  4U3F E;  5B66 H;  1NU1 G;  5AW0 B;  2A45 H;  4YPC A;  1Q90 D;  2IZ0 A;  3BCC E;  3L71 E;  3C8V A;  1RE4 A;  1MZ9 A;  1NWQ A;  2E43 A;  4IL6 X;  3OAK A;  1M1J B;  1PP9 D;  4HYT B;  2N1T B;  2Z5H A;  3RK2 B;  3GF3 A;  3A7O A;  2M5A B;  1KIL D;  1SQB K;  3CCE P;  4H0L B;  4W7Y A;  3CWB G;  1FS0 E;  3H1I G;  3L72 D;  4PV1 B;  2KZJ A;  3FGA D;  1GK4 A;  2FXP A;  1L4A B;  3CMA P;  1FZB A;  2O01 N;  2JWA A;  1N86 A;  2WPS A;  5B5E E;  1NTM D;  4HH2 A;  1L0N G;  3L74 J;  1S5L H;  1SQX K;  2GUS A;  5APY A;  1XTG B;  2W6J H;  1PGP A;  2B87 B;  1EXJ A;  1LGH B;  3S1K A;  4ASV A;  2OQQ A;  2IYO A;  1HGZ A;  2R32 A;  3G4S P;  3V2Q A;  2FXO A;  4WY4 A;  4ZKP A;  1KQS O;  3TYY A;  2XDJ A;  1MFZ A;  3H32 B;  1FU1 A;  3BVH A;  1PV3 A;  2KNC B;  3H1J J;  2K88 A;  1T2K D;  1KIL B;  2A06 E;  1URQ C;  3NFQ A;  3EWK A;  2HPC B;  3LW5 J;  1FZE A;  1ZME C;  1LP1 B;  1RE3 A;  2HLO A;  3H1H D;  1Q86 Q;  5KLV E;  2G3A A;  1RH5 B;  1P84 D;  5APQ A;  3V2N A;  1T6A A;  2K37 A;  2W6A A;  1KQL A;  1PP9 E;  4KT0 J;  3VYI A;  4D6T E;  4IFF A;  1K05 A;  2IBZ D;  2AXT H;  1ZP0 C;  1IK7 A;  1KIL E;  2BAS A;  1E5W A;  1OW6 A;  3CWB J;  3RGU A;  3H1I J;  2C9L Y;  1DEE G;  4H13 D;  1QLE D;  2M3B A;  5AVU B;  1RQU A;  5KKZ C;  3CCJ P;  1M56 D;  5TIS E;  5KAF H;  5AW3 B;  4JF7 A;  1KYO D;  1GL2 D;  4KHX A;  5KAI H;  1RE4 C;  2IX7 C;  1YQ4 C;  2QE7 H;  3S4R A;  1SFC A;  3G3Z A;  1DD4 A;  1FAV A;  3Q5S A;  1KQG B;  2E74 D;  3AEF C;  2YO2 A;  1QX8 A;  2KLV A;  1HUC A;  1N73 A;  3MUD A;  4GOF A;  2WVR A;  1RHZ B;  2I1J A;  1SQV D;  1PPJ G;  4C7N B;  1NH4 A;  1S2E A;  2QIW A;  4PD4 D;  1OIP A;  3GHG A;  4CPG A;  4TT3 H;  3HUS B;  3NXS A;  3KXD A;  1KB9 H;  1LTT C;  4H13 B;  1CZQ A;  1L0L G;  1FZF A;  1JY2 P;  3CCL P;  4DJG A;  2ZT9 D;  1GL2 B;  3M9Q A;  2WT7 B;  3BAS A;  5AW5 B;  4BXL A;  3E1I A;  2RH0 A;  2ZAE B;  1PIX A;  1WMK A;  4WY4 C;  3HE4 A;  4HB1 A;  1ZR2 A;  3M9H A;  2E74 B;  4R4M A;  3B5N D;  4EIJ A;  2A45 G;  3KHU A;  3AE7 C;  3HTK A;  2K3R A;  1WRG A;  3S9O A;  2N9B A;  5AW4 B;  1JMM A;  2SPZ A;  2C0W A;  1RE3 C;  5B5E H;  2BCC D;  2JO1 A;  5GTH E;  1FZC A;  1KYO E;  3L75 G;  1FDI A;  4GOE A;  1KFN A;  3SWF A;  2QJY B;  5AVS B;  2QJK B;  1VQ4 P;  1EZV D;  2KSJ A;  1BDD A;  2ZT9 B;  5E79 H;  4BRY A; 
#chains in the Genus database with same CATH homology
 1GU5 A;  2W27 A;  2YKQ A;  1LTJ B;  1X79 B;  1GZL A;  3KDP B;  3B5N C;  1NU1 K;  1VPC A;  5AVW B;  4I2L C;  3H32 A;  3HD7 D;  1N7S D;  1NTK K;  2CPS A;  1IFM A;  3B5N B;  1NKN A;  1KIL A;  1RF1 A;  4N78 D;  5KJ7 D;  3VMY A;  3MGN A;  1PFI A;  1GTW A;  5CCG D;  1JO5 A;  1GL2 A;  3UIA A;  2WT7 A;  2O01 H;  2IFN A;  2E42 A;  1NAF A;  1URQ A;  3LID A;  2Q7C A;  4ZKU A;  3P8C D;  4I6M C;  3U59 A;  1LTA C;  2FFD C;  4N3Y B;  1J1E B;  1OWA A;  1SFC C;  1JCC A;  2HYN A;  3BRV B;  3BRT B;  1HJB A;  2GM4 A;  1LWU C;  3KYQ A;  2FFD B;  3VMX A;  1SFC B;  3II6 A;  5CMZ A;  2KOG A;  2WPR A;  2N1T D;  2R3C A;  3RK3 D;  5BU8 B;  5AW7 B;  2PAJ A;  1QL1 A;  3V5B A;  1GDT A;  1NO4 A;  3RK2 D;  5APX A;  1LWU B;  3L35 A;  2OAR A;  3N4X A;  1L0N K;  4JYC A;  3TNU A;  3HD7 C;  1N7S C;  2HOD A;  1EQ7 A;  1IJD B;  2FYU K;  2QM7 A;  4WBA A;  2OYH C;  1GK6 A;  1X8Y A;  1NHL A;  5KJ7 C;  3IR9 A;  1CI6 B;  2XNX A;  2H8P D;  3KQG A;  1N7S B;  1IFI A;  1QL2 A;  1L4A D;  1YYC A;  4WY4 B;  2OYH B;  5CCG C;  3B8E B;  1NTZ K;  2POH A;  4RES B;  5AW2 B;  3HE5 A;  2FXM A;  1IO4 A;  2HG5 D;  4IFM A;  3V2P A;  1WT6 A;  2C9N Y;  2YMY A;  2PP6 A;  2ZXE B;  5AW9 B;  3L4F A;  2WSE H;  2ZFC A;  2J58 A;  2A45 H;  5AW0 B;  1M1J C;  2P1J A;  2HFE D;  2WPQ A;  1SQP K;  1RE4 A;  1MZ9 A;  2N1T C;  1NWQ A;  3RK3 C;  1SLQ A;  1SP4 A;  3M0D A;  2E43 A;  2P2U A;  3OAK A;  1G1I A;  1M1J B;  3RK2 C;  3I5C A;  2KYV A;  3B5N A;  3H6P A;  5APT A;  1NTM K;  1MV8 A;  4HYT B;  2N1T B;  3CL3 D;  4C7N A;  1FDM A;  1W2E A;  3HE4 B;  2GUV A;  4LC1 A;  1H88 A;  2YKP A;  1NKZ B;  2Z5H A;  1XTC C;  5AW8 B;  3RK2 B;  3A7O A;  1HVV A;  1KIL D;  2NPS A;  4N78 E;  1JTH A;  1SQB K;  4AUW A;  3HTK B;  3HUS A;  1L4A C;  4W7Y A;  3U1A A;  4XA4 A;  4GIF A;  3V4Q A;  1FZC C;  1FOS E;  3VTP C;  3HRN A;  2OYI C;  2XV5 A;  1GK4 A;  1URQ D;  1L4A B;  3P8C E;  2VRS A;  1FZB A;  4OH8 B;  1FZC B;  4GKG A;  1N86 A;  1HTL C;  2WPS A;  2OYI B;  3CI9 A;  3M0A A;  1FOS F;  4DOJ A;  5CCH D;  1FZG A;  4HH2 A;  3WMM 0;  1GU4 A;  3L37 A;  3KPE A;  5AW1 B;  1HGV A;  3C9I A;  1SQX K;  2GUS A;  2O1J A;  3N7N A;  3MTU E;  1CW5 A;  1JY2 O;  5APY A;  3M9B A;  1XTG B;  1LT9 A;  1LTS C;  1LGH B;  1VDF A;  2WSF H;  3TK1 A;  1IFD A;  1MUU A;  1YTZ T;  1N2D C;  1HGZ A;  1G2C A;  2R32 A;  3V2Q A;  1M7L A;  1T8Z A;  1N73 C;  2W6B A;  2O1K A;  4WY4 A;  4ZKP A;  1GW4 A;  2KP8 A;  2R5B A;  3CLQ A;  3TYY A;  2XDJ A;  1KIL C;  1RF1 C;  1MFZ A;  3H32 B;  4B86 A;  5KLV K;  1FU1 A;  3BVH A;  1N73 B;  3GHG C;  1J1D C;  2JJL A;  1KIL B;  1T2K D;  1RF1 B;  1T3J A;  1URQ C;  5AVY B;  3NFQ A;  1DX7 A;  1HH0 A;  2QM8 A;  2HPC B;  1JCD A;  1KZU B;  3GHG B;  4LGD E;  1FZE A;  1J1D B;  3HD7 B;  4AYC A;  4M3L A;  1RE3 A;  2HLO A;  2YO3 A;  2MJZ A;  4O9B A;  5APS A;  5CCH C;  4Y99 C;  2WSC H;  4IFD K;  5APQ A;  3V2N A;  5AVT B;  1YTZ I;  3BAT A;  1SQQ K;  2YNY A;  4Y99 B;  1RF0 A;  1JY3 O;  1L0L K;  2W6A A;  1KQL A;  1LTJ A;  3VYI A;  3T97 A;  5CJ0 A;  1JY2 N;  4IFF A;  1JNM A;  1ZV8 A;  3PP5 A;  1JOC A;  1LTG C;  1SVF A;  1ZR4 A;  3P32 A;  5APW A;  2NPS D;  3LW5 H;  3TNU B;  2KB7 P;  4AQR D;  1DH3 A;  5AVV B;  2HOD B;  1S9K D;  3MD0 A;  2BAS A;  3RK3 B;  1Z56 A;  1E5W A;  3MIW A;  5AW6 B;  1N7L A;  3P8M C;  1T2K C;  5APU A;  2C9L Y;  5BVZ A;  1HWT C;  2OYI A;  5AVZ B;  2M3B A;  5AVU B;  2XKM A;  3RL0 D;  3A2A A;  1KFM A;  1LTB C;  3HE5 B;  3L36 A;  5AW3 B;  1CSB A;  4JF7 A;  1GL2 D;  4KHX A;  5APV A;  5AVX B;  2FYZ A;  4W7Z A;  1RE4 C;  2IX7 C;  1ZN5 A;  2H43 A;  2P7J A;  4C46 A;  2FFD A;  1SFC A;  3G3Z A;  1H8A A;  2Q5U A;  3M0D C;  1FAV A;  1ZLL A;  1JUN A;  1GD2 E;  3R2P A;  1H89 A;  2YO2 A;  2KLV A;  1LWU A;  1HUC A;  4LLH A;  2Q9I A;  1N73 A;  3LIE A;  4WY4 D;  3MUD A;  1IC2 A;  5BU5 A;  2I1J A;  1JY3 N;  4WB4 A;  1FJP A;  2NPS C;  3M06 A;  4C7N B;  3VMZ A;  2YKO A;  2WWW A;  1NH4 A;  2FKW B;  3HUS C;  5CHX A;  4JYB A;  3O8Z A;  2HPC A;  1J1E C;  3GHG A;  1CI6 A;  3HD7 A;  1X9V A;  3A3Y B;  3VP9 A;  1N7S A;  2NPS B;  4W80 A;  1JTH B;  1A02 F;  3U1C A;  2OYH A;  3HUS B;  4I1L A;  2J59 M;  3NXS A;  5KJ7 A;  1LTT C;  3RL0 C;  5AVQ B;  1CZQ A;  3OA7 A;  5CCG A;  1GL2 C;  5CCH A;  1OXZ A;  2LKM A;  3EQ2 A;  5AVR B;  1FZF A;  2I1K A;  1JY2 P;  3VOP A;  2L5G B;  3RL0 B;  1IFJ A;  1A02 J;  2Q3I A;  1IK9 A;  2XU6 A;  1J2J B;  1LT9 C;  3SWY A;  2Z4E A;  1GL2 B;  3NMD A;  1DEB A;  3M9Q A;  2WT7 B;  3BAS A;  1URQ B;  5AW5 B;  3E1I A;  1M1J A;  3VN0 A;  2WZ7 A;  2WIT A;  1LT9 B;  2IFM A;  2N1T A;  4WY4 C;  3HE4 A;  1ZR2 A;  3TSI A;  3M9H A;  2Z5I A;  3V2R A;  1G2C B;  3B5N D;  2P67 A;  2IPP A;  3EFG A;  2H7H A;  1NOH A;  2C0X A;  4EIJ A;  2A45 G;  3A5T A;  1AQ5 A;  1S9K E;  1FBM A;  2M8R A;  2JEE A;  2R5D A;  2WTY A;  1G1J A;  3HTK A;  3V4W A;  4N6J A;  1HBW A;  1WRG A;  4C7R A;  2N9B A;  5AW4 B;  1JMM A;  1GW3 A;  1IFN A;  3NTN A;  4DZO A;  2C0W A;  1L4A A;  1FJK A;  1RE3 C;  4GT1 A;  1FZA A;  1FZC A;  5KTB A;  1SQV K;  1LTI C;  1SFC D;  1JY3 P;  1KFN A;  4EOT A;  5AVS B;  3SWF A;  2CPB A;  5CJ4 A;  1RF0 C;  3M91 A;  2KSJ A;  4XE5 B;  1LTJ C;  2XZR A;  2A45 I;  3P7K A;  1AFO A;  3VP8 A;  1RY3 A;  3OJA B;  1T3U A;  3IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...