2XU6A

Mdv1 coiled coil domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
GPQTLVNSLEFLNIQKNSTMSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLMLEDNLKQIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Architecture of a Dynamin Adaptor: Implications for Assembly of Mitochondrial Fission Complexes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords MDV1 COILED COIL
total genus 26
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xu6A00
3P32A 2Q7CA 2JJLA 2WPQA 3SWFA 4GT1A 1X8YA 3VMXA 1GTWA 4HYTB 2E43A 4EOTA 4LC1A 4C46A 3A3YB 5AW4B 1HJBA 1FOSF 5AVUB 2R32A 5AVYB 1HWTC 3OAKA 2E42A 1S9KE 2VRSA 4GKGA 3TNUA 3TYYA 1JNMA 1CI6A 5APTA 1CZQA 2P7JA 4KHXA 3VMYA 1GK6A 4M3LA 5APUA 3VN0A 2YO2A 2N9BA 1IO4A 1YYCA 3HE4B 5AVSB 5APVA 3LIEA 3HTKA 5AW7B 3HE5B 3A7OA 3VYIA 1CSBA 2YNYA 3LIDA 3NXSA 3M0DA 2QM8A 3M06A 3P7KA 1NAFA 4RESB 2P67A 4XE5B 5AW1B 4I2LC 3IR9A 5AVRB 2WPSA 3V4WA 3A5TA 1A02F 2P2UA 3HE4A 2XV5A 1A02J 2C9NY 3UIAA 1OWAA 1FAVA 4AQRD 2Q3IA 2WT7A 1KQLA 3M9HA 1H89A 2H7HA 5AW9B 1FOSE 2Z5IA 3A2AA 5APQA 2WT7B 1GD2E 4JYBA 2R5BA 1NWQA 2W6AA 3I5CA 5AW6B 2Z5HA 4B86A 3L35A 3KDPB 3NFQA 1GZLA 2ZXEB 3NTNA 3MD0A 3VTPC 5AW5B 2Q5UA 5AW0B 3VMZA 2WPRA 5APSA 4DZOA 2WWWA 5APYA 1GU5A 3M9BA 2ZFCA 1MFZA 2XZRA 3HE5A 5AVXB 3TK1A 3O8ZA 1OXZA 5AW2B 5AW8B 5AVZB 1CI6B 1MUUA 3M0AA 1SP4A 4C7NB 1G2CB 3MGNA 3TNUB 2YO3A 1T2KD 1SLQA 4I6MC 1JUNA 3L37A 3P8MC 4AUWA 2W27A 5APXA 1T2KC 5AVVB 1HUCA 3L36A 5CMZA 1S9KD 2XU6A 2R5DA 2KP8A 3NMDA 1J2JB 2IPPA 1H88A 1H8AA 4JYCA 3V5BA 5AW3B 5AVWB 2WTYA 1GK4A 3KQGA 1DH3A 2C9LY 4C7NA 3T97A 1MV8A 1HBWA 2QM7A 2BASA 3B8EB 5AVQB 2R3CA 3V4QA 5AVTB 1GU4A 5APWA 4AYCA 3M91A
chains in the Genus database with same CATH superfamily
3P32A 3FGAD 2WPQA 3WU2E 3WUUA 4ASVA 3AEFC 5CHXA 1QL1A 1BE3G 1LTJA 1LTTC 1N73B 3VMXA 4LGDE 1KB9H 1KILB 2QVAA 4HYTB 4KJMA 2MKVA 4BRYB 4EOTA 1JCDA 1NGMB 2QJPC 2V7QJ 1PPJE 3A3YB 2D2CB 2NPSA 2ZVNB 4L73A 4IFDK 4RO0A 4WY4A 2A45G 1YI2P 2WSFJ 5AVYB 2FYUK 4WY4D 1KYOD 5TJHA 1S9KE 1IK9A 2VRSA 4IL6E 1VQ8P 3KZIH 1RH5B 2K9JA 3B5NA 2M5AA 4L74A 3AECC 3TYYA 3H1JG 3Q5RA 1JNMA 2L91A 3H6PA 1DD3A 2P58A 1DEEG 1M56D 1R5SA 4KHXA 3VMYA 4M3LA 2YIUB 1NTME 3TSIA 3CCRP 3FWNA 1HH0A 1PL5A 5AVSB 1M7LA 1NU1E 2BCCJ 2PP6A 2E75B 2PRRA 1SQBE 2KNCB 3EFFK 3GW6A 5CJ4A 1Q82Q 5KKZB 4YXWH 3CXHD 3VYIA 4H0LB 4ZKPA 3E1RA 1SFCC 1W2BO 2CPSA 1EDKA 1KQFB 2ZT9D 2H43A 1N73C 3H1IJ 5B5EH 3L71J 1FZCB 1NU1K 2P67A 4L75A 4U3FD 2NRGA 3PH0A 2OYIA 1N7LA 1SQPJ 3H1JJ 3MUDC 4IFMA 3IR9A 5KJ7D 1VQ4P 4L76A 3V4WA 3CC7P 2HODA 1JM0A 3Q3DA 1A02J 3BATA 1G1IA 1SQPE 1GU4A 1SVFA 4OGQD 2UWJE 5KJ7C 3D6YA 2IYOA 1JB0J 3H1LD 2N1TC 5B66E 5AW9B 3HUSC 2L5GB 1VQ7P 1ZRTD 3A2AA 4HJGH 5APQA 3RL0B 3Q5PA 1ZR2A 1NAYA 3JCUH 2O3JA 2R5BA 4JYBA 1ZOYC 3R2PA 1VQ5P 2POHA 3RK3B 1NWQA 1FZBA 2AEJA 1SQVJ 1HJ0A 4PV1B 1IFIA 2P1JA 5GTIE 1IK7A 3L71G 1P84E 3NTNA 4EI2A 1KC8Q 2KYVA 3L72D 3MD0A 4N78E 2IBZG 2HYNA 3L75D 3L73J 1SQQE 1S2EA 1RF1A 2AXCA 2WPRA 1URQB 1IO4A 4H13D 2OYHC 2WWWA 1J1DB 4JBZA 1GU5A 2E76D 2A06G 3N4XA 1BCCD 2FYUE 2A06E 1IFJA 1LTSC 3FXDA 5TISH 3CMEP 3CCLP 2KS1B 1M8OB 4D6TD 1NVOA 2FYUG 3TK1A 3MTUE 4OVNF 1M90Q 1OXZA 1JMBA 2J5UA 4HH2A 5CBNA 1PP9D 2OTKE 1OVRA 3M9QA 3BCCE 1NTKG 4WWIA 2Z4EA 1OW8A 3CC4P 2N1TA 1MUUA 3A0HH 1N86A 1YJNP 2QJKB 4PJ0E 1G2CB 2K9JB 1X79B 3CXHI 2WSEJ 1NHLA 1BSHA 2JO1A 3CCEP 4D6TJ 1JUNA 4JF7A 3H1JE 3V2NA 2KOGA 3RK2C 2AEMA 2OYIC 1QVGO 3MP7B 4U3FG 5CJ0A 1BCCG 2Q6QA 1SFCB 1Y9BA 1ZV8A 2FYUJ 2ZJSE 3GHGA 3H32A 2R5DA 5CMZA 5GTHH 1LT9C 1SQVE 3CCVP 1L0ND 1VQLP 3H1ID 3JCUE 1NJIQ 2IPPA 4WVZA 5BVZA 1OMIA 5KAFH 2WTYA 3H1LG 1LWUA 2RN0A 3G6EP 4BWNA 4H44C 5B66H 5KLVE 2ZT9B 1FZFA 1N2DC 5GTHE 1S4XA 3CX5D 2QM7A 3AEGC 3H1KJ 4H0LD 3G9RA 1BCCJ 1N7SC 2R3CA 1UIIA 2K88A 3L71D 4U3FJ 5AVTB 1VDFA 1JY3N 2KS1A 2YKQA 3V2PA 3V4QA 3VOPA 1KN7A 2XDJA 1DIPA 4K3AA 3HD7B 4KT0J 3CMAP 1ZW0A 1LT9A 2WQYC 1T8ZA 3AE6C 2WMMA 2A45I 2JJLA 2V4HA 2Q7CA 4UB8H 1X8YA 1W2EA 4GOEA 1YBKA 1Q86Q 4OGQC 1M1KQ 3C8VA 2H8PD 3PTZA 1SQPK 2ZVOB 2LXCB 3H1IE 1GL2D 2WSCJ 1L0NE 1LWUC 1VF5D 1HWTC 3H1IG 4NPFX 2E42A 1FJPA 1SS1A 1GMJA 4IL6H 1CI6A 2OTLP 5CCHC 2B9BA 2BCCE 2P7JA 3GHGC 3RGUA 2QIWA 1SQXJ 5APUA 2YO2A 1L0LD 2N9BA 3AEAC 2HG5D 3F89A 1N7SB 2XNDH 3H1JD 3L4FA 4UB6E 1VQKP 1YYCA 2YMKA 3HE4B 4HB1A 5APVA 5BU8B 2HODB 2HR3A 2JR8A 1PP9J 3AE7C 4WBAA 5AW7B 1DX7A 2JEEA 3A7OA 3HE5B 4N3YB 3EWKA 1CSBA 3O6QA 1HF9A 2E76C 3LIDA 1IJDB 1LTBC 1NOHA 3M06A 3AEBC 1PP9E 3NXSA 4JPZB 2K1AA 2LR2A 3RL0C 1RF1C 1YJ9P 1K05A 3AE8C 5KLVJ 2FYZA 4RESB 2RMZA 2E74D 2IYPA 1T2KD 1RE4A 1BSNA 4XE5B 5AW1B 2FYUD 1L4AC 3HTKB 1AQ5A 4YTPC 1JOCA 1BCCE 1S5LX 2P2UA 2HLOA 3H1HG 2XV5A 5CCGA 1J1EC 4DZOA 1CW5A 3KYQA 1SQXE 2Q3IA 2WZ7A 2WT7A 1PZQA 2Q3EA 1T3UA 3L75E 1AA0A 1FOSE 3L72E 3VMAA 2OYHA 1P84D 1SQBJ 2WT7B 3I56P 2JWDA 3L72G 4TT3H 2O1KA 3L73G 1NTZK 1X9VA 2OARA 3HD7C 2OYOA 3I5CA 1MFTA 4ZNCA 1KQGB 3C1LA 3GMAA 4GODA 3ITKA 1JY2P 3E1IA 1KV4A 1OW6A 5AW5B 1S3JA 2E74C 2QE7H 3SWKA 3CCSP 2RKLA 1N73A 1QVFO 4H13B 2PAJA 1URQD 1SQPD 3BRVB 1X0TA 3S4RA 5H2FH 1BGYE 3O6QB 3L74J 1Q2NA 3FWLA 3H25A 3HE5A 1VQOP 3H1KD 3KPEA 3HD7A 1PGQA 1FBMA 1NTMG 3K5BA 4K35A 5AVXB 3G4SP 1IFNA 4PV1D 2G3AA 5GTIH 3V2RA 1U7MA 3O8ZA 4H0LC 3L74G 3MUDA 1NTKJ 2C0WA 5AW8B 1BE3J 1Q81Q 2IDBA 3T97B 3M0AA 4JQ0D 3W67A 1PP9G 2M5AB 1KILC 3CXHE 4C7NB 1R8EA 1HGVA 1Q7YQ 1SQBD 2KZIA 1HVVA 4ZMDA 3RK2D 2LXBA 1L4AA 1YTZI 3CCQP 4WY4C 3WU2H 1D7MA 2Y0EA 3TGUJ 5CBOA 3P8MC 4Y99C 4R4MA 3A0HE 1XTCC 3RK3C 2QJYC 1FS0E 2GA1A 5AVVB 2Y9ZA 2KK7A 1EQ7A 5BU5A 1IFPA 4DCKA 1S9KD 1YJWP 5KJ7A 1M1JA 2QEXP 3OW2O 1ZN5A 1KZUB 1H8AA 4IOIH 3U1CA 1FE6A 3GG2A 2E75D 3H1KG 1GK4A 3QWOC 3FXEA 1GDTA 4EDFA 1Y8AA 3H1KE 1PV3A 5TISE 2IFNA 1MV8A 1BGYD 1VPCA 3T97A 3KHUA 3CPWO 2Q9IA 1EDIA 3CLQA 1MKMA 1FZAA 3B8EB 2FY8A 1LJ2A 1LTAC 1DEBA 1VF5C 4O9BA 1QLED 1NKNA 2AEFA 2B87B 2M3EA 3L75G 2WSEH 2E74B 5CCGD 1SQQK 3A0BH 3CCJP 3SFEC 2BEZF 5KTBA 3SWFA 1URQA 1SFCA 2FXOA 1OZHA 1WMKA 1IZNB 3H32B 1FZEA 3HUSB 5CCHA 2ZT9C 5CCGC 1QEXA 2FXMA 3BVHA 1BE3E 2E43A 4LC1A 4C46A 1SQXD 4W7YA 4QMAA 5AW4B 1HJBA 1NTMK 1JY2N 2XKMA 4DJGA 3L70G 3AEDC 2R32A 3V6IA 2QG4A 3OAKA 2ZYAA 2WSSH 1KORA 3F5HA 3CI9A 3L70E 1NTZJ 1G2CA 3TNUA 3OJAB 2E5YA 2HPCB 5APTA 3G71P 1T6AA 3CCMP 1GK6A 3VN0A 4Y28J 1KMIZ 1ZMEC 3IFMA 2OGUA 2W83C 1S1CX 5K5GB 2IBZI 5E79E 1JY3O 1J1EB 2KSJA 3LIEA 1BGYJ 5B5EE 3L74E 3RK3D 2WVRA 2QJYB 2M0BA 1YITP 1OVUA 1T3JA 1W5CE 2IZ1A 1SQBG 2B88A 2ZYDA 1KB9D 2QM8A 1PIXA 2JP3A 2Y9YA 1L0LE 3AE1C 3P7KA 1EZVD 2YKOA 2BCCD 3CWBG 3IAOA 1AVOA 4YXDC 3AE5C 2FKWB 2NPSD 1JCCA 1S5LH 2PGDA 2FFDB 5DJUB 4I2LC 1VQNP 4R4LA 1U7JA 2KNCA 1A02F 3D6ZA 3UIAA 3L72J 3TGUE 2V7QH 3I55P 1H89A 5KKZC 3S1KA 2OYHB 2H7HA 3C9IA 3A0BE 5EFWB 1KFNA 2HPCA 3VP8A 2AXTH 1IFDA 1HGZA 4EYYQ 1GD2E 3OA7A 4U7JA 4W80A 3BCCJ 3RBXA 3D70A 2W6AA 1JTHA 4ZKUA 5AW6B 2O01J 4B86A 2GM4A 1KFMA 1VF5B 2J58A 2RH0A 1GZLA 3NFQA 1L0LG 2NZ2A 4GIFA 1SQQG 2ZAEB 1OX3A 2IZ0A 4NPEA 3RK2B 3VTPC 1AVYA 3L71E 5KAIE 1FU1A 4IFFA 3Q1MA 2FYNB 1K73Q 3VMZA 3P8CE 5APSA 1QGKB 2DW3A 3CX5E 3W68A 2QJPB 5APYA 2OQQA 4GOFA 2W8ZA 3U59A 1KTMA 1LT9B 1SQQJ 5KLVD 2BCCG 1GL2C 1SQPG 3B4SA 4Y99B 3PJSK 3AE9C 3L75J 4PD4H 3Q2YA 2M3BA 2O01H 1LTJC 2W6BA 3BCCG 3H1HJ 1RE4C 1KILD 5AW2B 5C39A 1KD1Q 1SQVD 2P10A 1CI6B 2LKMA 1G1JA 1PPJG 2I1KA 4PJ0H 3B5NB 5KLIB 2O1JA 2GUVA 2Q1KA 3PRJA 1FZGA 2Y0CA 4I6MC 2K37A 2E76B 3L37A 3KZIE 1EZVI 3CX5H 2W27A 1SQBK 1L2PA 1M1JB 3N7NA 3ZDMA 1RY3A 1H0TA 1LTJB 1RF0A 4TLFA 3GF7A 3G3ZA 4H13C 1SQXG 2XU6A 4PD4D 2KP8A 2WSFH 2IBZD 3AE4C 1LTGC 3BCCD 3NMDA 2XNXA 4I1LA 2WSCH 1JO5A 1OFCX 1TU3F 5DJTB 1QL2A 4XFJA 3V5BA 5AW3B 1EDLA 1NTKD 2A06D 3KQGA 1Q90D 2B89A 2KLUA 3IF4A 4OH8B 3RBZA 1KQSO 2OTJP 2R3SA 1EC5A 2AXTE 4OGQB 3BASA 2YKPA 3USSA 1NTZE 2BASA 1AQTA 1ZXGA 1FZCC 1FJKA 1SQQD 3IN6A 2OYIB 1FDMA 1R5LA 1NTZG 3GLMA 5H2FE 1RQUA 2KI7B 3ABVC 4N78D 5M1BA 2FBWC 2IX7C 2YXRB 1P84I 3PP5A 4D6TG 2Y0DA 4BXLA 3CC2P 1NTZD 1VQ6P 1YQ4C 2I1JA 2NPSC 1OVVA 3GHGB 3WUTA 3V2QA 4GT1A 3AE3C 3VP9A 1USDA 1RF0C 2H89C 4A7PA 1ZRTE 1RF1B 1H0TB 1NTKE 3AE2C 1L0NJ 4DOJA 3B5NC 5KLIC 1USEA 1GTWA 3H1LE 2JDIH 1FOSF 1J1DC 1NH4A 2IBZE 2MJZA 4PV1C 5AVUB 1GL2B 3B5ND 2M8RA 1JEKA 3CWBJ 3H1LJ 4PD4E 1L0NG 1BDCA 1ZP0C 4GKGA 1NO4A 1ZR4A 3CD6P 1NTKK 2N1TB 4U3FE 3R4YA 4EIJA 4N6JA 1CZQA 1FDOA 1RHZB 2CK3H 1IFMA 1RE3A 3GF3A 3MIWA 1PFIA 1LNQA 1GW3A 3EFGA 1K04A 3CCUP 1YIJP 1JY2O 4I7ZB 4YPCA 1SQVG 4W7ZA 3HD7D 1EZVG 3EQ2A 3HTKA 4WB4A 5L8RJ 3AEEC 2FFDA 3MHVA 1NU1D 1NU1J 1FC2C 2YNYA 3M0DA 1KILE 1LP1B 1OIPA 2FYNC 1NTMD 1U57A 1LP1A 1NAFA 2R44A 4H44D 1SQXK 5KLVG 3HRNA 1FDIA 1YHQP 1QX8A 1S5LE 1FZCA 2W90A 2YIUC 3WUVA 4MN4C 5KAFE 5AVRB 1DD4A 2WPSA 1KYOE 3SWYA 3A5TA 1JTHB 2KSEA 3HE4A 4IL6X 2C9NY 3JSVC 1HTLC 1N7SA 1OWAA 1YQ3C 1FAVA 3CL3D 1PPJD 1YTZT 3P8CD 1KQLA 3M9HA 3M0DC 4AQRD 4D6TE 5CCHD 3LW5H 1SFCD 1UIXA 4H44B 3RL0g 2Z5IA 4XA4A 1EXIA 3E7KA 1XTGB 1K9MQ 2E75C 1M1JC 2Z5HA 1JY3P 3L70J 3L73E 2IFMA 2KXPB 2NPSB 3KDPB 3L35A 2ZXEB 4HKZH 3SSUA 2FFDC 2D2CD 2ITAA 2QA4P 2YMYA 5E79H 3Q5SA 1S72P 2Q5UA 2QJKC 1M57D 5KAIH 2QSIA 2JKVA 3CX5I 2HFED 3HUSA 1RQVA 3II6A 3PHLA 5AW0B 1KYOH 2K9YA 2N1TD 3SFDC 4ASWA 3TGUD 1VQPP 2D2CC 3M9BA 1EXJA 2ZFCA 1MFZA 2XZRA 3H1HE 2C0XA 2FXPA 1NYHA 1MZ9A 1EDJA 4GDOA 1LGHB 1K8AQ 2A45H 3WMM0 3MZWB 1L0NK 1EZVE 1WRGA 1AV1A 2I8DA 1KB9I 3PLNA 1N8RQ 5AVZB 1KB9E 4LLHA 4RJTA 3CXHH 3U1AA 1SP4A 2G8YA 2O01N 1Z56A 3MGNA 3TNUB 1L0LJ 3RK3E 2GUSA 2YO3A 1SLQA 3L74D 4RKUJ 4NPDA 1GL2A 3CWBE 3TF5A 1SQVK 1ZLLA 4DT0A 2E5TA 1E79H 3D71A 1L4AD 1LT1A 2QRXA 1BDDA 4I7ZC 1E5WA 4AUWA 5APXA 1T2KC 1GW4A 1KILA 3CWBD 2ZXXA 4BRYA 2KLVA 4CPGA 4UB6H 1PGOA 2J59M 3RL0D 4Z1MH 1HUCA 1URQC 3L36A 3L70D 1X22A 4C7RA 5KLVK 4WY4B 1VQMP 1NU1G 1PGPA 1Y47A 2BEQD 3S9OA 1J2JB 3KXDA 2PFXA 2WPVB 1H88A 2KB7P 4JYCA 1BE3D 2B87A 1PGJA 5AVWB 1L4AB 1VQ9P 1AFOA 1RE3C 2W6JH 1DH3A 3FX0A 2JWAA 2C9LY 3H1HD 4C7NA 2WITA 3LW5J 1IC2A 1HBWA 3JC22 2YXQB 2KUBA 1WT6A 2KIKA 2H88C 1JMMA 4UB8E 3TDKA 5AVQB 1LWUB 2KZJA 4OWFA 1KYOI 2ZYGA 2CPBA 1BGYG 2K3RA 1LTIC 3BRTB 5APWA 1VL2A 4AYCA 1NTMJ 2N9YB 3TGUG 1AJYA 3QH9A 1NKZB 1N7SD 1OW7A 2SPZA 1L0LK 3L73D 3B71A 3M91A 1P84H 4PD4I
chains in the Genus database with same CATH topology
3P32A 2WPQA 5CHXA 1QL1A 1N73B 1LTJA 1LTTC 3VMXA 1KILB 4HYTB 4EOTA 1JCDA 3A3YB 2NPSA 4IFDK 4WY4A 2A45G 5AVYB 2FYUK 4WY4D 1S9KE 1IK9A 2VRSA 3B5NA 3TYYA 1JNMA 3H6PA 4KHXA 3VMYA 4M3LA 3TSIA 1HH0A 5AVSB 1M7LA 2PP6A 5CJ4A 3VYIA 4ZKPA 1SFCC 2CPSA 1N73C 2H43A 1FZCB 1NU1K 2P67A 2OYIA 1FDMA 1N7LA 4IFMA 5KJ7D 3IR9A 3V4WA 2HODA 1A02J 3BATA 1G1IA 1SVFA 5KJ7C 2N1TC 5AW9B 3HUSC 2L5GB 3A2AA 5APQA 3RL0B 1ZR2A 4JYBA 2R5BA 3R2PA 2POHA 3RK3B 1NWQA 1FZBA 1IFIA 2P1JA 3NTNA 2KYVA 3MD0A 4N78E 2HYNA 1RF1A 2WPRA 1URQB 2OYHC 2WWWA 1J1DB 1GU5A 3N4XA 1IFJA 1LTSC 3TK1A 3MTUE 1OXZA 4HH2A 3M9QA 2Z4EA 2N1TA 1MUUA 1N86A 1G2CB 1X79B 1NHLA 1JUNA 4JF7A 3V2NA 2KOGA 3RK2C 2OYIC 5CJ0A 1SFCB 3H32A 1ZV8A 3GHGA 5CMZA 2R5DA 1LT9C 2IPPA 5BVZA 2WTYA 1LWUA 1FZFA 1N2DC 2QM7A 1N7SC 2R3CA 3V2PA 5AVTB 3V4QA 1VDFA 1JY3N 2YKQA 3VOPA 2XDJA 3HD7B 1LT9A 1T8ZA 2A45I 2JJLA 2Q7CA 1X8YA 1W2EA 2H8PD 1SQPK 1GL2D 1LWUC 1HWTC 2E42A 1FJPA 1CI6A 5CCHC 2P7JA 3GHGC 5APUA 2YO2A 2N9BA 3VP8A 1IO4A 2HG5D 1N7SB 3L4FA 1YYCA 3HE4B 5BU8B 5APVA 2HODB 4WBAA 5AW7B 1DX7A 2JEEA 3A7OA 3HE5B 4N3YB 1CSBA 3LIDA 1IJDB 1LTBC 1NOHA 3M06A 3NXSA 3RL0C 1RF1C 2FYZA 4RESB 1RE4A 4XE5B 5AW1B 1L4AC 3HTKB 1AQ5A 1JOCA 2P2UA 2HLOA 2XV5A 5CCGA 1J1EC 1CW5A 3KYQA 2WZ7A 2Q3IA 2WT7A 1T3UA 1FOSE 2OYHA 2WT7B 2O1KA 1NTZK 1X9VA 2OARA 3HD7C 3I5CA 1JY2P 3E1IA 5AW5B 1N73A 2PAJA 1URQD 3BRVB 3HE5A 3KPEA 3HD7A 1FBMA 5AVXB 1IFNA 3V2RA 3O8ZA 3MUDA 2C0WA 5AW8B 3M0AA 4C7NB 1KILC 1HGVA 1HVVA 3RK2D 1L4AA 1YTZI 4WY4C 3P8MC 4Y99C 1XTCC 5AVVB 1EQ7A 5BU5A 1S9KD 5KJ7A 1M1JA 1ZN5A 1KZUB 1H8AA 1GK4A 1GDTA 3T97A 2IFNA 1MV8A 1VPCA 2Q9IA 3CLQA 1FZAA 3B8EB 1LTAC 1DEBA 4O9BA 1NKNA 2WSEH 5CCGD 1SQQK 3SWFA 5KTBA 1URQA 1SFCA 3H32B 3HUSB 5CCHA 1FZEA 5CCGC 2FXMA 3BVHA 2E43A 4LC1A 4C46A 4W7YA 5AW4B 1HJBA 1NTMK 1JY2N 2XKMA 2R32A 3OAKA 3CI9A 3TNUA 1G2CA 3OJAB 2HPCB 5APTA 1GK6A 3VN0A 3IFMA 1JY3O 1J1EB 2KSJA 3LIEA 3RK3D 1T3JA 2QM8A 3P7KA 2YKOA 2FKWB 2NPSD 1JCCA 2FFDB 4I2LC 1A02F 3UIAA 1H89A 2OYHB 2H7HA 3C9IA 1KFNA 2HPCA 1IFDA 1HGZA 1GD2E 3OA7A 4W80A 2W6AA 1JTHA 4ZKUA 5AW6B 4B86A 2GM4A 1KFMA 2J58A 3NFQA 1GZLA 4GIFA 3RK2B 2OYIB 3VTPC 1FZCA 1FU1A 4IFFA 3VMZA 3P8CE 5APSA 4DZOA 5APYA 3U59A 1LT9B 1GL2C 4Y99B 2M3BA 2O01H 1LTJC 2W6BA 1RE4C 1KILD 5AW2B 1CI6B 2LKMA 1G1JA 2I1KA 3B5NB 2O1JA 2GUVA 1FZGA 4I6MC 3L37A 2W27A 1SQBK 3N7NA 1M1JB 1RY3A 1LTJB 1RF0A 3G3ZA 2XU6A 2KP8A 2WSFH 3NMDA 1LTGC 1JO5A 2XNXA 4I1LA 2WSCH 1QL2A 3V5BA 5AW3B 3KQGA 4OH8B 3BASA 2YKPA 2BASA 1FZCC 1FJKA 4N78D 2IX7C 3PP5A 2I1JA 2NPSC 3GHGB 3V2QA 4GT1A 3VP9A 1RF0C 1RF1B 4DOJA 1GTWA 3B5NC 1FOSF 1J1DC 1NH4A 2MJZA 5AVUB 1GL2B 3B5ND 2M8RA 4GKGA 1NO4A 1ZR4A 1NTKK 2N1TB 4EIJA 4N6JA 1CZQA 3MIWA 1IFMA 1RE3A 1PFIA 1GW3A 3EFGA 1JY2O 4W7ZA 3HD7D 3EQ2A 3HTKA 4WB4A 2FFDA 2YNYA 3M0DA 1NAFA 1SQXK 3HRNA 3SWYA 5AVRB 2WPSA 3A5TA 1JTHB 3HE4A 2C9NY 1HTLC 1N7SA 1OWAA 3CL3D 1FAVA 3P8CD 4LGDE 1YTZT 4AQRD 1KQLA 3M9HA 3M0DC 5CCHD 3LW5H 1SFCD 2Z5IA 4XA4A 1XTGB 2Z5HA 4WY4B 1JY3P 2FFDC 2IFMA 2NPSB 3KDPB 3L35A 2ZXEB 2YMYA 2Q5UA 5AW0B 3U1CA 2HFED 3HUSA 3II6A 2N1TD 3M9BA 2ZFCA 1MFZA 2XZRA 2C0XA 1MZ9A 1LGHB 2A45H 3WMM0 1L0NK 1WRGA 5AVZB 4LLHA 3U1AA 1SP4A 1Z56A 3MGNA 3TNUB 2GUSA 2YO3A 1SLQA 1T2KD 1GL2A 1SQVK 1ZLLA 1L4AD 1E5WA 4AUWA 5APXA 1T2KC 1KILA 1GW4A 2KLVA 2J59M 3RL0D 1HUCA 1URQC 3L36A 4C7RA 5KLVK 1J2JB 1H88A 2KB7P 4JYCA 1AFOA 5AVWB 1L4AB 1RE3C 1DH3A 2C9LY 4C7NA 2WITA 1HBWA 1IC2A 1WT6A 1JMMA 5AVQB 1LWUB 1GU4A 3BRTB 2CPBA 5APWA 1LTIC 4AYCA 3RK3C 1NKZB 1N7SD 3M91A 1L0LK 1M1JC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3P32 A;  2Q7C A;  2JJL A;  2WPQ A;  3SWF A;  4GT1 A;  1X8Y A;  3VMX A;  1GTW A;  4HYT B;  2E43 A;  4EOT A;  4LC1 A;  4C46 A;  3A3Y B;  5AW4 B;  1HJB A;  1FOS F;  5AVU B;  2R32 A;  5AVY B;  1HWT C;  3OAK A;  2E42 A;  1S9K E;  2VRS A;  4GKG A;  3TNU A;  3TYY A;  1JNM A;  1CI6 A;  5APT A;  1CZQ A;  2P7J A;  4KHX A;  3VMY A;  1GK6 A;  4M3L A;  5APU A;  3VN0 A;  2YO2 A;  2N9B A;  1IO4 A;  1YYC A;  3HE4 B;  5AVS B;  5APV A;  3LIE A;  3HTK A;  5AW7 B;  3HE5 B;  3A7O A;  3VYI A;  1CSB A;  2YNY A;  3LID A;  3NXS A;  3M0D A;  2QM8 A;  3M06 A;  3P7K A;  1NAF A;  4RES B;  2P67 A;  4XE5 B;  5AW1 B;  4I2L C;  3IR9 A;  5AVR B;  2WPS A;  3V4W A;  3A5T A;  1A02 F;  2P2U A;  3HE4 A;  2XV5 A;  1A02 J;  2C9N Y;  3UIA A;  1OWA A;  1FAV A;  4AQR D;  2Q3I A;  2WT7 A;  1KQL A;  3M9H A;  1H89 A;  2H7H A;  5AW9 B;  1FOS E;  2Z5I A;  3A2A A;  5APQ A;  2WT7 B;  1GD2 E;  4JYB A;  2R5B A;  1NWQ A;  2W6A A;  3I5C A;  5AW6 B;  2Z5H A;  4B86 A;  3L35 A;  3KDP B;  3NFQ A;  1GZL A;  2ZXE B;  3NTN A;  3MD0 A;  3VTP C;  5AW5 B;  2Q5U A;  5AW0 B;  3VMZ A;  2WPR A;  5APS A;  4DZO A;  2WWW A;  5APY A;  1GU5 A;  3M9B A;  2ZFC A;  1MFZ A;  2XZR A;  3HE5 A;  5AVX B;  3TK1 A;  3O8Z A;  1OXZ A;  5AW2 B;  5AW8 B;  5AVZ B;  1CI6 B;  1MUU A;  3M0A A;  1SP4 A;  4C7N B;  1G2C B;  3MGN A;  3TNU B;  2YO3 A;  1T2K D;  1SLQ A;  4I6M C;  1JUN A;  3L37 A;  3P8M C;  4AUW A;  2W27 A;  5APX A;  1T2K C;  5AVV B;  1HUC A;  3L36 A;  5CMZ A;  1S9K D;  2XU6 A;  2R5D A;  2KP8 A;  3NMD A;  1J2J B;  2IPP A;  1H88 A;  1H8A A;  4JYC A;  3V5B A;  5AW3 B;  5AVW B;  2WTY A;  1GK4 A;  3KQG A;  1DH3 A;  2C9L Y;  4C7N A;  3T97 A;  1MV8 A;  1HBW A;  2QM7 A;  2BAS A;  3B8E B;  5AVQ B;  2R3C A;  3V4Q A;  5AVT B;  1GU4 A;  5APW A;  4AYC A;  3M91 A; 
#chains in the Genus database with same CATH topology
 3P32 A;  3FGA D;  2WPQ A;  3WU2 E;  3WUU A;  4ASV A;  3AEF C;  5CHX A;  1QL1 A;  1BE3 G;  1LTJ A;  1LTT C;  1N73 B;  3VMX A;  4LGD E;  1KB9 H;  1KIL B;  2QVA A;  4HYT B;  4KJM A;  2MKV A;  4BRY B;  4EOT A;  1JCD A;  1NGM B;  2QJP C;  2V7Q J;  1PPJ E;  3A3Y B;  2D2C B;  2NPS A;  2ZVN B;  4L73 A;  4IFD K;  4RO0 A;  4WY4 A;  2A45 G;  1YI2 P;  2WSF J;  5AVY B;  2FYU K;  4WY4 D;  1KYO D;  5TJH A;  1S9K E;  1IK9 A;  2VRS A;  4IL6 E;  1VQ8 P;  3KZI H;  1RH5 B;  2K9J A;  3B5N A;  2M5A A;  4L74 A;  3AEC C;  3TYY A;  3H1J G;  3Q5R A;  1JNM A;  2L91 A;  3H6P A;  1DD3 A;  2P58 A;  1DEE G;  1M56 D;  1R5S A;  4KHX A;  3VMY A;  4M3L A;  2YIU B;  1NTM E;  3TSI A;  3CCR P;  3FWN A;  1HH0 A;  1PL5 A;  5AVS B;  1M7L A;  1NU1 E;  2BCC J;  2PP6 A;  2E75 B;  2PRR A;  1SQB E;  2KNC B;  3EFF K;  3GW6 A;  5CJ4 A;  1Q82 Q;  5KKZ B;  4YXW H;  3CXH D;  3VYI A;  4H0L B;  4ZKP A;  3E1R A;  1SFC C;  1W2B O;  2CPS A;  1EDK A;  1KQF B;  2ZT9 D;  2H43 A;  1N73 C;  3H1I J;  5B5E H;  3L71 J;  1FZC B;  1NU1 K;  2P67 A;  4L75 A;  4U3F D;  2NRG A;  3PH0 A;  2OYI A;  1N7L A;  1SQP J;  3H1J J;  3MUD C;  4IFM A;  3IR9 A;  5KJ7 D;  1VQ4 P;  4L76 A;  3V4W A;  3CC7 P;  2HOD A;  1JM0 A;  3Q3D A;  1A02 J;  3BAT A;  1G1I A;  1SQP E;  1GU4 A;  1SVF A;  4OGQ D;  2UWJ E;  5KJ7 C;  3D6Y A;  2IYO A;  1JB0 J;  3H1L D;  2N1T C;  5B66 E;  5AW9 B;  3HUS C;  2L5G B;  1VQ7 P;  1ZRT D;  3A2A A;  4HJG H;  5APQ A;  3RL0 B;  3Q5P A;  1ZR2 A;  1NAY A;  3JCU H;  2O3J A;  2R5B A;  4JYB A;  1ZOY C;  3R2P A;  1VQ5 P;  2POH A;  3RK3 B;  1NWQ A;  1FZB A;  2AEJ A;  1SQV J;  1HJ0 A;  4PV1 B;  1IFI A;  2P1J A;  5GTI E;  1IK7 A;  3L71 G;  1P84 E;  3NTN A;  4EI2 A;  1KC8 Q;  2KYV A;  3L72 D;  3MD0 A;  4N78 E;  2IBZ G;  2HYN A;  3L75 D;  3L73 J;  1SQQ E;  1S2E A;  1RF1 A;  2AXC A;  2WPR A;  1URQ B;  1IO4 A;  4H13 D;  2OYH C;  2WWW A;  1J1D B;  4JBZ A;  1GU5 A;  2E76 D;  2A06 G;  3N4X A;  1BCC D;  2FYU E;  2A06 E;  1IFJ A;  1LTS C;  3FXD A;  5TIS H;  3CME P;  3CCL P;  2KS1 B;  1M8O B;  4D6T D;  1NVO A;  2FYU G;  3TK1 A;  3MTU E;  4OVN F;  1M90 Q;  1OXZ A;  1JMB A;  2J5U A;  4HH2 A;  5CBN A;  1PP9 D;  2OTK E;  1OVR A;  3M9Q A;  3BCC E;  1NTK G;  4WWI A;  2Z4E A;  1OW8 A;  3CC4 P;  2N1T A;  1MUU A;  3A0H H;  1N86 A;  1YJN P;  2QJK B;  4PJ0 E;  1G2C B;  2K9J B;  1X79 B;  3CXH I;  2WSE J;  1NHL A;  1BSH A;  2JO1 A;  3CCE P;  4D6T J;  1JUN A;  4JF7 A;  3H1J E;  3V2N A;  2KOG A;  3RK2 C;  2AEM A;  2OYI C;  1QVG O;  3MP7 B;  4U3F G;  5CJ0 A;  1BCC G;  2Q6Q A;  1SFC B;  1Y9B A;  1ZV8 A;  2FYU J;  2ZJS E;  3GHG A;  3H32 A;  2R5D A;  5CMZ A;  5GTH H;  1LT9 C;  1SQV E;  3CCV P;  1L0N D;  1VQL P;  3H1I D;  3JCU E;  1NJI Q;  2IPP A;  4WVZ A;  5BVZ A;  1OMI A;  5KAF H;  2WTY A;  3H1L G;  1LWU A;  2RN0 A;  3G6E P;  4BWN A;  4H44 C;  5B66 H;  5KLV E;  2ZT9 B;  1FZF A;  1N2D C;  5GTH E;  1S4X A;  3CX5 D;  2QM7 A;  3AEG C;  3H1K J;  4H0L D;  3G9R A;  1BCC J;  1N7S C;  2R3C A;  1UII A;  2K88 A;  3L71 D;  4U3F J;  5AVT B;  1VDF A;  1JY3 N;  2KS1 A;  2YKQ A;  3V2P A;  3V4Q A;  3VOP A;  1KN7 A;  2XDJ A;  1DIP A;  4K3A A;  3HD7 B;  4KT0 J;  3CMA P;  1ZW0 A;  1LT9 A;  2WQY C;  1T8Z A;  3AE6 C;  2WMM A;  2A45 I;  2JJL A;  2V4H A;  2Q7C A;  4UB8 H;  1X8Y A;  1W2E A;  4GOE A;  1YBK A;  1Q86 Q;  4OGQ C;  1M1K Q;  3C8V A;  2H8P D;  3PTZ A;  1SQP K;  2ZVO B;  2LXC B;  3H1I E;  1GL2 D;  2WSC J;  1L0N E;  1LWU C;  1VF5 D;  1HWT C;  3H1I G;  4NPF X;  2E42 A;  1FJP A;  1SS1 A;  1GMJ A;  4IL6 H;  1CI6 A;  2OTL P;  5CCH C;  2B9B A;  2BCC E;  2P7J A;  3GHG C;  3RGU A;  2QIW A;  1SQX J;  5APU A;  2YO2 A;  1L0L D;  2N9B A;  3AEA C;  2HG5 D;  3F89 A;  1N7S B;  2XND H;  3H1J D;  3L4F A;  4UB6 E;  1VQK P;  1YYC A;  2YMK A;  3HE4 B;  4HB1 A;  5APV A;  5BU8 B;  2HOD B;  2HR3 A;  2JR8 A;  1PP9 J;  3AE7 C;  4WBA A;  5AW7 B;  1DX7 A;  2JEE A;  3A7O A;  3HE5 B;  4N3Y B;  3EWK A;  1CSB A;  3O6Q A;  1HF9 A;  2E76 C;  3LID A;  1IJD B;  1LTB C;  1NOH A;  3M06 A;  3AEB C;  1PP9 E;  3NXS A;  4JPZ B;  2K1A A;  2LR2 A;  3RL0 C;  1RF1 C;  1YJ9 P;  1K05 A;  3AE8 C;  5KLV J;  2FYZ A;  4RES B;  2RMZ A;  2E74 D;  2IYP A;  1T2K D;  1RE4 A;  1BSN A;  4XE5 B;  5AW1 B;  2FYU D;  1L4A C;  3HTK B;  1AQ5 A;  4YTP C;  1JOC A;  1BCC E;  1S5L X;  2P2U A;  2HLO A;  3H1H G;  2XV5 A;  5CCG A;  1J1E C;  4DZO A;  1CW5 A;  3KYQ A;  1SQX E;  2Q3I A;  2WZ7 A;  2WT7 A;  1PZQ A;  2Q3E A;  1T3U A;  3L75 E;  1AA0 A;  1FOS E;  3L72 E;  3VMA A;  2OYH A;  1P84 D;  1SQB J;  2WT7 B;  3I56 P;  2JWD A;  3L72 G;  4TT3 H;  2O1K A;  3L73 G;  1NTZ K;  1X9V A;  2OAR A;  3HD7 C;  2OYO A;  3I5C A;  1MFT A;  4ZNC A;  1KQG B;  3C1L A;  3GMA A;  4GOD A;  3ITK A;  1JY2 P;  3E1I A;  1KV4 A;  1OW6 A;  5AW5 B;  1S3J A;  2E74 C;  2QE7 H;  3SWK A;  3CCS P;  2RKL A;  1N73 A;  1QVF O;  4H13 B;  2PAJ A;  1URQ D;  1SQP D;  3BRV B;  1X0T A;  3S4R A;  5H2F H;  1BGY E;  3O6Q B;  3L74 J;  1Q2N A;  3FWL A;  3H25 A;  3HE5 A;  1VQO P;  3H1K D;  3KPE A;  3HD7 A;  1PGQ A;  1FBM A;  1NTM G;  3K5B A;  4K35 A;  5AVX B;  3G4S P;  1IFN A;  4PV1 D;  2G3A A;  5GTI H;  3V2R A;  1U7M A;  3O8Z A;  4H0L C;  3L74 G;  3MUD A;  1NTK J;  2C0W A;  5AW8 B;  1BE3 J;  1Q81 Q;  2IDB A;  3T97 B;  3M0A A;  4JQ0 D;  3W67 A;  1PP9 G;  2M5A B;  1KIL C;  3CXH E;  4C7N B;  1R8E A;  1HGV A;  1Q7Y Q;  1SQB D;  2KZI A;  1HVV A;  4ZMD A;  3RK2 D;  2LXB A;  1L4A A;  1YTZ I;  3CCQ P;  4WY4 C;  3WU2 H;  1D7M A;  2Y0E A;  3TGU J;  5CBO A;  3P8M C;  4Y99 C;  4R4M A;  3A0H E;  1XTC C;  3RK3 C;  2QJY C;  1FS0 E;  2GA1 A;  5AVV B;  2Y9Z A;  2KK7 A;  1EQ7 A;  5BU5 A;  1IFP A;  4DCK A;  1S9K D;  1YJW P;  5KJ7 A;  1M1J A;  2QEX P;  3OW2 O;  1ZN5 A;  1KZU B;  1H8A A;  4IOI H;  3U1C A;  1FE6 A;  3GG2 A;  2E75 D;  3H1K G;  1GK4 A;  3QWO C;  3FXE A;  1GDT A;  4EDF A;  1Y8A A;  3H1K E;  1PV3 A;  5TIS E;  2IFN A;  1MV8 A;  1BGY D;  1VPC A;  3T97 A;  3KHU A;  3CPW O;  2Q9I A;  1EDI A;  3CLQ A;  1MKM A;  1FZA A;  3B8E B;  2FY8 A;  1LJ2 A;  1LTA C;  1DEB A;  1VF5 C;  4O9B A;  1QLE D;  1NKN A;  2AEF A;  2B87 B;  2M3E A;  3L75 G;  2WSE H;  2E74 B;  5CCG D;  1SQQ K;  3A0B H;  3CCJ P;  3SFE C;  2BEZ F;  5KTB A;  3SWF A;  1URQ A;  1SFC A;  2FXO A;  1OZH A;  1WMK A;  1IZN B;  3H32 B;  1FZE A;  3HUS B;  5CCH A;  2ZT9 C;  5CCG C;  1QEX A;  2FXM A;  3BVH A;  1BE3 E;  2E43 A;  4LC1 A;  4C46 A;  1SQX D;  4W7Y A;  4QMA A;  5AW4 B;  1HJB A;  1NTM K;  1JY2 N;  2XKM A;  4DJG A;  3L70 G;  3AED C;  2R32 A;  3V6I A;  2QG4 A;  3OAK A;  2ZYA A;  2WSS H;  1KOR A;  3F5H A;  3CI9 A;  3L70 E;  1NTZ J;  1G2C A;  3TNU A;  3OJA B;  2E5Y A;  2HPC B;  5APT A;  3G71 P;  1T6A A;  3CCM P;  1GK6 A;  3VN0 A;  4Y28 J;  1KMI Z;  1ZME C;  3IFM A;  2OGU A;  2W83 C;  1S1C X;  5K5G B;  2IBZ I;  5E79 E;  1JY3 O;  1J1E B;  2KSJ A;  3LIE A;  1BGY J;  5B5E E;  3L74 E;  3RK3 D;  2WVR A;  2QJY B;  2M0B A;  1YIT P;  1OVU A;  1T3J A;  1W5C E;  2IZ1 A;  1SQB G;  2B88 A;  2ZYD A;  1KB9 D;  2QM8 A;  1PIX A;  2JP3 A;  2Y9Y A;  1L0L E;  3AE1 C;  3P7K A;  1EZV D;  2YKO A;  2BCC D;  3CWB G;  3IAO A;  1AVO A;  4YXD C;  3AE5 C;  2FKW B;  2NPS D;  1JCC A;  1S5L H;  2PGD A;  2FFD B;  5DJU B;  4I2L C;  1VQN P;  4R4L A;  1U7J A;  2KNC A;  1A02 F;  3D6Z A;  3UIA A;  3L72 J;  3TGU E;  2V7Q H;  3I55 P;  1H89 A;  5KKZ C;  3S1K A;  2OYH B;  2H7H A;  3C9I A;  3A0B E;  5EFW B;  1KFN A;  2HPC A;  3VP8 A;  2AXT H;  1IFD A;  1HGZ A;  4EYY Q;  1GD2 E;  3OA7 A;  4U7J A;  4W80 A;  3BCC J;  3RBX A;  3D70 A;  2W6A A;  1JTH A;  4ZKU A;  5AW6 B;  2O01 J;  4B86 A;  2GM4 A;  1KFM A;  1VF5 B;  2J58 A;  2RH0 A;  1GZL A;  3NFQ A;  1L0L G;  2NZ2 A;  4GIF A;  1SQQ G;  2ZAE B;  1OX3 A;  2IZ0 A;  4NPE A;  3RK2 B;  3VTP C;  1AVY A;  3L71 E;  5KAI E;  1FU1 A;  4IFF A;  3Q1M A;  2FYN B;  1K73 Q;  3VMZ A;  3P8C E;  5APS A;  1QGK B;  2DW3 A;  3CX5 E;  3W68 A;  2QJP B;  5APY A;  2OQQ A;  4GOF A;  2W8Z A;  3U59 A;  1KTM A;  1LT9 B;  1SQQ J;  5KLV D;  2BCC G;  1GL2 C;  1SQP G;  3B4S A;  4Y99 B;  3PJS K;  3AE9 C;  3L75 J;  4PD4 H;  3Q2Y A;  2M3B A;  2O01 H;  1LTJ C;  2W6B A;  3BCC G;  3H1H J;  1RE4 C;  1KIL D;  5AW2 B;  5C39 A;  1KD1 Q;  1SQV D;  2P10 A;  1CI6 B;  2LKM A;  1G1J A;  1PPJ G;  2I1K A;  4PJ0 H;  3B5N B;  5KLI B;  2O1J A;  2GUV A;  2Q1K A;  3PRJ A;  1FZG A;  2Y0C A;  4I6M C;  2K37 A;  2E76 B;  3L37 A;  3KZI E;  1EZV I;  3CX5 H;  2W27 A;  1SQB K;  1L2P A;  1M1J B;  3N7N A;  3ZDM A;  1RY3 A;  1H0T A;  1LTJ B;  1RF0 A;  4TLF A;  3GF7 A;  3G3Z A;  4H13 C;  1SQX G;  2XU6 A;  4PD4 D;  2KP8 A;  2WSF H;  2IBZ D;  3AE4 C;  1LTG C;  3BCC D;  3NMD A;  2XNX A;  4I1L A;  2WSC H;  1JO5 A;  1OFC X;  1TU3 F;  5DJT B;  1QL2 A;  4XFJ A;  3V5B A;  5AW3 B;  1EDL A;  1NTK D;  2A06 D;  3KQG A;  1Q90 D;  2B89 A;  2KLU A;  3IF4 A;  4OH8 B;  3RBZ A;  1KQS O;  2OTJ P;  2R3S A;  1EC5 A;  2AXT E;  4OGQ B;  3BAS A;  2YKP A;  3USS A;  1NTZ E;  2BAS A;  1AQT A;  1ZXG A;  1FZC C;  1FJK A;  1SQQ D;  3IN6 A;  2OYI B;  1FDM A;  1R5L A;  1NTZ G;  3GLM A;  5H2F E;  1RQU A;  2KI7 B;  3ABV C;  4N78 D;  5M1B A;  2FBW C;  2IX7 C;  2YXR B;  1P84 I;  3PP5 A;  4D6T G;  2Y0D A;  4BXL A;  3CC2 P;  1NTZ D;  1VQ6 P;  1YQ4 C;  2I1J A;  2NPS C;  1OVV A;  3GHG B;  3WUT A;  3V2Q A;  4GT1 A;  3AE3 C;  3VP9 A;  1USD A;  1RF0 C;  2H89 C;  4A7P A;  1ZRT E;  1RF1 B;  1H0T B;  1NTK E;  3AE2 C;  1L0N J;  4DOJ A;  3B5N C;  5KLI C;  1USE A;  1GTW A;  3H1L E;  2JDI H;  1FOS F;  1J1D C;  1NH4 A;  2IBZ E;  2MJZ A;  4PV1 C;  5AVU B;  1GL2 B;  3B5N D;  2M8R A;  1JEK A;  3CWB J;  3H1L J;  4PD4 E;  1L0N G;  1BDC A;  1ZP0 C;  4GKG A;  1NO4 A;  1ZR4 A;  3CD6 P;  1NTK K;  2N1T B;  4U3F E;  3R4Y A;  4EIJ A;  4N6J A;  1CZQ A;  1FDO A;  1RHZ B;  2CK3 H;  1IFM A;  1RE3 A;  3GF3 A;  3MIW A;  1PFI A;  1LNQ A;  1GW3 A;  3EFG A;  1K04 A;  3CCU P;  1YIJ P;  1JY2 O;  4I7Z B;  4YPC A;  1SQV G;  4W7Z A;  3HD7 D;  1EZV G;  3EQ2 A;  3HTK A;  4WB4 A;  5L8R J;  3AEE C;  2FFD A;  3MHV A;  1NU1 D;  1NU1 J;  1FC2 C;  2YNY A;  3M0D A;  1KIL E;  1LP1 B;  1OIP A;  2FYN C;  1NTM D;  1U57 A;  1LP1 A;  1NAF A;  2R44 A;  4H44 D;  1SQX K;  5KLV G;  3HRN A;  1FDI A;  1YHQ P;  1QX8 A;  1S5L E;  1FZC A;  2W90 A;  2YIU C;  3WUV A;  4MN4 C;  5KAF E;  5AVR B;  1DD4 A;  2WPS A;  1KYO E;  3SWY A;  3A5T A;  1JTH B;  2KSE A;  3HE4 A;  4IL6 X;  2C9N Y;  3JSV C;  1HTL C;  1N7S A;  1OWA A;  1YQ3 C;  1FAV A;  3CL3 D;  1PPJ D;  1YTZ T;  3P8C D;  1KQL A;  3M9H A;  3M0D C;  4AQR D;  4D6T E;  5CCH D;  3LW5 H;  1SFC D;  1UIX A;  4H44 B;  3RL0 g;  2Z5I A;  4XA4 A;  1EXI A;  3E7K A;  1XTG B;  1K9M Q;  2E75 C;  1M1J C;  2Z5H A;  1JY3 P;  3L70 J;  3L73 E;  2IFM A;  2KXP B;  2NPS B;  3KDP B;  3L35 A;  2ZXE B;  4HKZ H;  3SSU A;  2FFD C;  2D2C D;  2ITA A;  2QA4 P;  2YMY A;  5E79 H;  3Q5S A;  1S72 P;  2Q5U A;  2QJK C;  1M57 D;  5KAI H;  2QSI A;  2JKV A;  3CX5 I;  2HFE D;  3HUS A;  1RQV A;  3II6 A;  3PHL A;  5AW0 B;  1KYO H;  2K9Y A;  2N1T D;  3SFD C;  4ASW A;  3TGU D;  1VQP P;  2D2C C;  3M9B A;  1EXJ A;  2ZFC A;  1MFZ A;  2XZR A;  3H1H E;  2C0X A;  2FXP A;  1NYH A;  1MZ9 A;  1EDJ A;  4GDO A;  1LGH B;  1K8A Q;  2A45 H;  3WMM 0;  3MZW B;  1L0N K;  1EZV E;  1WRG A;  1AV1 A;  2I8D A;  1KB9 I;  3PLN A;  1N8R Q;  5AVZ B;  1KB9 E;  4LLH A;  4RJT A;  3CXH H;  3U1A A;  1SP4 A;  2G8Y A;  2O01 N;  1Z56 A;  3MGN A;  3TNU B;  1L0L J;  3RK3 E;  2GUS A;  2YO3 A;  1SLQ A;  3L74 D;  4RKU J;  4NPD A;  1GL2 A;  3CWB E;  3TF5 A;  1SQV K;  1ZLL A;  4DT0 A;  2E5T A;  1E79 H;  3D71 A;  1L4A D;  1LT1 A;  2QRX A;  1BDD A;  4I7Z C;  1E5W A;  4AUW A;  5APX A;  1T2K C;  1GW4 A;  1KIL A;  3CWB D;  2ZXX A;  4BRY A;  2KLV A;  4CPG A;  4UB6 H;  1PGO A;  2J59 M;  3RL0 D;  4Z1M H;  1HUC A;  1URQ C;  3L36 A;  3L70 D;  1X22 A;  4C7R A;  5KLV K;  4WY4 B;  1VQM P;  1NU1 G;  1PGP A;  1Y47 A;  2BEQ D;  3S9O A;  1J2J B;  3KXD A;  2PFX A;  2WPV B;  1H88 A;  2KB7 P;  4JYC A;  1BE3 D;  2B87 A;  1PGJ A;  5AVW B;  1L4A B;  1VQ9 P;  1AFO A;  1RE3 C;  2W6J H;  1DH3 A;  3FX0 A;  2JWA A;  2C9L Y;  3H1H D;  4C7N A;  2WIT A;  3LW5 J;  1IC2 A;  1HBW A;  3JC2 2;  2YXQ B;  2KUB A;  1WT6 A;  2KIK A;  2H88 C;  1JMM A;  4UB8 E;  3TDK A;  5AVQ B;  1LWU B;  2KZJ A;  4OWF A;  1KYO I;  2ZYG A;  2CPB A;  1BGY G;  2K3R A;  1LTI C;  3BRT B;  5APW A;  1VL2 A;  4AYC A;  1NTM J;  2N9Y B;  3TGU G;  1AJY A;  3QH9 A;  1NKZ B;  1N7S D;  1OW7 A;  2SPZ A;  1L0L K;  3L73 D;  3B71 A;  3M91 A;  1P84 H;  4PD4 I; 
#chains in the Genus database with same CATH homology
 3P32 A;  2WPQ A;  5CHX A;  1QL1 A;  1N73 B;  1LTJ A;  1LTT C;  3VMX A;  1KIL B;  4HYT B;  4EOT A;  1JCD A;  3A3Y B;  2NPS A;  4IFD K;  4WY4 A;  2A45 G;  5AVY B;  2FYU K;  4WY4 D;  1S9K E;  1IK9 A;  2VRS A;  3B5N A;  3TYY A;  1JNM A;  3H6P A;  4KHX A;  3VMY A;  4M3L A;  3TSI A;  1HH0 A;  5AVS B;  1M7L A;  2PP6 A;  5CJ4 A;  3VYI A;  4ZKP A;  1SFC C;  2CPS A;  1N73 C;  2H43 A;  1FZC B;  1NU1 K;  2P67 A;  2OYI A;  1FDM A;  1N7L A;  4IFM A;  5KJ7 D;  3IR9 A;  3V4W A;  2HOD A;  1A02 J;  3BAT A;  1G1I A;  1SVF A;  5KJ7 C;  2N1T C;  5AW9 B;  3HUS C;  2L5G B;  3A2A A;  5APQ A;  3RL0 B;  1ZR2 A;  4JYB A;  2R5B A;  3R2P A;  2POH A;  3RK3 B;  1NWQ A;  1FZB A;  1IFI A;  2P1J A;  3NTN A;  2KYV A;  3MD0 A;  4N78 E;  2HYN A;  1RF1 A;  2WPR A;  1URQ B;  2OYH C;  2WWW A;  1J1D B;  1GU5 A;  3N4X A;  1IFJ A;  1LTS C;  3TK1 A;  3MTU E;  1OXZ A;  4HH2 A;  3M9Q A;  2Z4E A;  2N1T A;  1MUU A;  1N86 A;  1G2C B;  1X79 B;  1NHL A;  1JUN A;  4JF7 A;  3V2N A;  2KOG A;  3RK2 C;  2OYI C;  5CJ0 A;  1SFC B;  3H32 A;  1ZV8 A;  3GHG A;  5CMZ A;  2R5D A;  1LT9 C;  2IPP A;  5BVZ A;  2WTY A;  1LWU A;  1FZF A;  1N2D C;  2QM7 A;  1N7S C;  2R3C A;  3V2P A;  5AVT B;  3V4Q A;  1VDF A;  1JY3 N;  2YKQ A;  3VOP A;  2XDJ A;  3HD7 B;  1LT9 A;  1T8Z A;  2A45 I;  2JJL A;  2Q7C A;  1X8Y A;  1W2E A;  2H8P D;  1SQP K;  1GL2 D;  1LWU C;  1HWT C;  2E42 A;  1FJP A;  1CI6 A;  5CCH C;  2P7J A;  3GHG C;  5APU A;  2YO2 A;  2N9B A;  3VP8 A;  1IO4 A;  2HG5 D;  1N7S B;  3L4F A;  1YYC A;  3HE4 B;  5BU8 B;  5APV A;  2HOD B;  4WBA A;  5AW7 B;  1DX7 A;  2JEE A;  3A7O A;  3HE5 B;  4N3Y B;  1CSB A;  3LID A;  1IJD B;  1LTB C;  1NOH A;  3M06 A;  3NXS A;  3RL0 C;  1RF1 C;  2FYZ A;  4RES B;  1RE4 A;  4XE5 B;  5AW1 B;  1L4A C;  3HTK B;  1AQ5 A;  1JOC A;  2P2U A;  2HLO A;  2XV5 A;  5CCG A;  1J1E C;  1CW5 A;  3KYQ A;  2WZ7 A;  2Q3I A;  2WT7 A;  1T3U A;  1FOS E;  2OYH A;  2WT7 B;  2O1K A;  1NTZ K;  1X9V A;  2OAR A;  3HD7 C;  3I5C A;  1JY2 P;  3E1I A;  5AW5 B;  1N73 A;  2PAJ A;  1URQ D;  3BRV B;  3HE5 A;  3KPE A;  3HD7 A;  1FBM A;  5AVX B;  1IFN A;  3V2R A;  3O8Z A;  3MUD A;  2C0W A;  5AW8 B;  3M0A A;  4C7N B;  1KIL C;  1HGV A;  1HVV A;  3RK2 D;  1L4A A;  1YTZ I;  4WY4 C;  3P8M C;  4Y99 C;  1XTC C;  5AVV B;  1EQ7 A;  5BU5 A;  1S9K D;  5KJ7 A;  1M1J A;  1ZN5 A;  1KZU B;  1H8A A;  1GK4 A;  1GDT A;  3T97 A;  2IFN A;  1MV8 A;  1VPC A;  2Q9I A;  3CLQ A;  1FZA A;  3B8E B;  1LTA C;  1DEB A;  4O9B A;  1NKN A;  2WSE H;  5CCG D;  1SQQ K;  3SWF A;  5KTB A;  1URQ A;  1SFC A;  3H32 B;  3HUS B;  5CCH A;  1FZE A;  5CCG C;  2FXM A;  3BVH A;  2E43 A;  4LC1 A;  4C46 A;  4W7Y A;  5AW4 B;  1HJB A;  1NTM K;  1JY2 N;  2XKM A;  2R32 A;  3OAK A;  3CI9 A;  3TNU A;  1G2C A;  3OJA B;  2HPC B;  5APT A;  1GK6 A;  3VN0 A;  3IFM A;  1JY3 O;  1J1E B;  2KSJ A;  3LIE A;  3RK3 D;  1T3J A;  2QM8 A;  3P7K A;  2YKO A;  2FKW B;  2NPS D;  1JCC A;  2FFD B;  4I2L C;  1A02 F;  3UIA A;  1H89 A;  2OYH B;  2H7H A;  3C9I A;  1KFN A;  2HPC A;  1IFD A;  1HGZ A;  1GD2 E;  3OA7 A;  4W80 A;  2W6A A;  1JTH A;  4ZKU A;  5AW6 B;  4B86 A;  2GM4 A;  1KFM A;  2J58 A;  3NFQ A;  1GZL A;  4GIF A;  3RK2 B;  2OYI B;  3VTP C;  1FZC A;  1FU1 A;  4IFF A;  3VMZ A;  3P8C E;  5APS A;  4DZO A;  5APY A;  3U59 A;  1LT9 B;  1GL2 C;  4Y99 B;  2M3B A;  2O01 H;  1LTJ C;  2W6B A;  1RE4 C;  1KIL D;  5AW2 B;  1CI6 B;  2LKM A;  1G1J A;  2I1K A;  3B5N B;  2O1J A;  2GUV A;  1FZG A;  4I6M C;  3L37 A;  2W27 A;  1SQB K;  3N7N A;  1M1J B;  1RY3 A;  1LTJ B;  1RF0 A;  3G3Z A;  2XU6 A;  2KP8 A;  2WSF H;  3NMD A;  1LTG C;  1JO5 A;  2XNX A;  4I1L A;  2WSC H;  1QL2 A;  3V5B A;  5AW3 B;  3KQG A;  4OH8 B;  3BAS A;  2YKP A;  2BAS A;  1FZC C;  1FJK A;  4N78 D;  2IX7 C;  3PP5 A;  2I1J A;  2NPS C;  3GHG B;  3V2Q A;  4GT1 A;  3VP9 A;  1RF0 C;  1RF1 B;  4DOJ A;  1GTW A;  3B5N C;  1FOS F;  1J1D C;  1NH4 A;  2MJZ A;  5AVU B;  1GL2 B;  3B5N D;  2M8R A;  4GKG A;  1NO4 A;  1ZR4 A;  1NTK K;  2N1T B;  4EIJ A;  4N6J A;  1CZQ A;  3MIW A;  1IFM A;  1RE3 A;  1PFI A;  1GW3 A;  3EFG A;  1JY2 O;  4W7Z A;  3HD7 D;  3EQ2 A;  3HTK A;  4WB4 A;  2FFD A;  2YNY A;  3M0D A;  1NAF A;  1SQX K;  3HRN A;  3SWY A;  5AVR B;  2WPS A;  3A5T A;  1JTH B;  3HE4 A;  2C9N Y;  1HTL C;  1N7S A;  1OWA A;  3CL3 D;  1FAV A;  3P8C D;  4LGD E;  1YTZ T;  4AQR D;  1KQL A;  3M9H A;  3M0D C;  5CCH D;  3LW5 H;  1SFC D;  2Z5I A;  4XA4 A;  1XTG B;  2Z5H A;  4WY4 B;  1JY3 P;  2FFD C;  2IFM A;  2NPS B;  3KDP B;  3L35 A;  2ZXE B;  2YMY A;  2Q5U A;  5AW0 B;  3U1C A;  2HFE D;  3HUS A;  3II6 A;  2N1T D;  3M9B A;  2ZFC A;  1MFZ A;  2XZR A;  2C0X A;  1MZ9 A;  1LGH B;  2A45 H;  3WMM 0;  1L0N K;  1WRG A;  5AVZ B;  4LLH A;  3U1A A;  1SP4 A;  1Z56 A;  3MGN A;  3TNU B;  2GUS A;  2YO3 A;  1SLQ A;  1T2K D;  1GL2 A;  1SQV K;  1ZLL A;  1L4A D;  1E5W A;  4AUW A;  5APX A;  1T2K C;  1KIL A;  1GW4 A;  2KLV A;  2J59 M;  3RL0 D;  1HUC A;  1URQ C;  3L36 A;  4C7R A;  5KLV K;  1J2J B;  1H88 A;  2KB7 P;  4JYC A;  1AFO A;  5AVW B;  1L4A B;  1RE3 C;  1DH3 A;  2C9L Y;  4C7N A;  2WIT A;  1HBW A;  1IC2 A;  1WT6 A;  1JMM A;  5AVQ B;  1LWU B;  1GU4 A;  3BRT B;  2CPB A;  5APW A;  1LTI C;  4AYC A;  3RK3 C;  1NKZ B;  1N7S D;  3M91 A;  1L0L K;  1M1J C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...