2XU6A

Mdv1 coiled coil domain
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
GPQTLVNSLEFLNIQKNSTMSEIRDIEVEVENLRQKKEKLLGKIANIEQNQLMLEDNLKQIDD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Molecular Architecture of a Dynamin Adaptor: Implications for Assembly of Mitochondrial Fission Complexes
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Protein binding
molecule keywords MDV1 COILED COIL
total genus 26
structure length 63
sequence length 63
chains with identical sequence B
ec nomenclature
pdb deposition date 2010-10-14
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2xu6A00
1G2CB 3P32A 3NMDA 5APWA 4C46A 5AW8B 2W6AA 3NFQA 2E42A 1KQLA 4B86A 1YYCA 4GT1A 4I2LC 3TYYA 1GK6A 1HUCA 3VN0A 1H89A 2Q7CA 3VMYA 5AVSB 3KQGA 2C9LY 4JYBA 3TNUB 3NXSA 4DZOA 1IO4A 5AVQB 1X8YA 3HE4A 2N9BA 1MUUA 2P7JA 2W27A 3A2AA 2R3CA 5AW0B 3SWFA 3M0AA 2YNYA 3O8ZA 4JYCA 2QM7A 2P67A 1SP4A 5AW7B 4C7NB 3A7OA 4GKGA 5AW6B 3VMXA 4C7NA 3NTNA 5AVWB 3OAKA 1T2KD 2WT7A 1CI6A 1A02F 1GTWA 2WPSA 2BASA 3T97A 1FOSE 2KP8A 3L35A 1FOSF 3L36A 1HWTC 2XV5A 3TK1A 1GU5A 2Q5UA 3KDPB 4EOTA 2WWWA 2ZFCA 3A3YB 5APQA 5AW2B 4AYCA 2WPQA 3M9BA 3LIDA 1A02J 2E43A 3V5BA 3A5TA 1MFZA 1OXZA 4RESB 5APXA 3MGNA 3V4QA 4XE5B 2QM8A 1CSBA 3HTKA 3L37A 1DH3A 5APSA 4AQRD 2XZRA 1GZLA 5APUA 1NAFA 2IPPA 1CI6B 4I6MC 5AW9B 2Q3IA 5AW1B 2YO3A 3M9HA 1MV8A 5AVVB 1NWQA 3B8EB 5AVUB 5AVTB 3HE5A 3M91A 5AW3B 1FAVA 2VRSA 1OWAA 4M3LA 1HJBA 1H88A 1T2KC 2P2UA 1JNMA 5AVZB 1J2JB 3HE4B 3VTPC 5AW4B 3IR9A 1S9KE 2H7HA 1GU4A 4LC1A 2ZXEB 3M0DA 5APVA 2Z5IA 1JUNA 3M06A 5APYA 4AUWA 3VMZA 3P8MC 1SLQA 5AVRB 4HYTB 3I5CA 1CZQA 1S9KD 2C9NY 1HBWA 3TNUA 2R5BA 4KHXA 1GD2E 1GK4A 2WTYA 2JJLA 3P7KA 5AVXB 2R32A 3HE5B 2R5DA 2Z5HA 5AW5B 5CMZA 3UIAA 3V4WA 3VYIA 5APTA 1H8AA 2WT7B 2YO2A 2XU6A 2WPRA 3MD0A 3LIEA 5AVYB
chains in the Genus database with same CATH superfamily
2UWJE 1VQ9P 1S5LE 3V2RA 3P32A 4ASVA 1M57D 2JWDA 3Q2YA 2ZYGA 2KYVA 4C46A 3G71P 2K9JB 2ITAA 1LTJA 2W6AA 2WSFJ 2Y9ZA 1KQLA 3H6PA 1NTKE 2K37A 4B86A 2FFDB 3AE4C 3VN0A 1SQQK 2WZ7A 1IZNB 3BCCG 5TISE 2WMMA 2H8PD 4JF7A 4JYBA 4YTPC 1EDKA 2FYZA 2IZ1A 3PP5A 4KT0J 3R2PA 2AXTH 1YI2P 1PP9E 1NTZE 2KS1B 4Z1MH 1BDDA 4OGQC 3V2NA 1IO4A 3PRJA 1LTIC 1PPJG 1KV4A 2MKVA 2NZ2A 1GL2B 4ZKPA 1JY2O 4RKUJ 1EZVG 4W80A 2FFDC 4HJGH 4WB4A 2IYPA 1VL2A 1VQ4P 3H1JJ 3HUSB 2OYIB 2N1TB 3O8ZA 2G3AA 1PL5A 1T8ZA 1D7MA 2WSSH 2P67A 2AEFA 5C39A 1JCDA 1HGVA 4C7NB 3D6ZA 4JQ0D 3H1JD 1PGJA 3L74E 4GKGA 4EI2A 5L8RJ 1YHQP 1FJPA 1R8EA 3V6IA 4BRYA 5TJHA 2OQQA 1N86A 4CPGA 2YKPA 4WWIA 2OTLP 1BDCA 1CI6A 3ZDMA 1A02F 1KZUB 4U3FE 4DT0A 5KKZB 1BCCE 2C0WA 2YKQA 1FZAA 2KP8A 2QIWA 1S3JA 3T97B 2M0BA 1FDIA 1K8AQ 1M1JC 2P58A 3L35A 1FOSF 1HGZA 3C8VA 1BCCD 3L36A 1JMMA 3RBXA 5BU5A 2IX7C 2AEMA 4NPFX 4YPCA 2B87A 3HD7C 1USEA 2HYNA 2Q5UA 3IAOA 1ZRTE 2BEQD 4EOTA 1N7LA 4D6TG 1N2DC 1OW6A 1PFIA 1SQXG 1M7LA 5APQA 3U1AA 1KFNA 3RBZA 2KB7P 3H1ID 1KILB 4OVNF 2XDJA 3A0BE 3CCSP 1A02J 3H1HJ 1KILE 1MFZA 4IL6X 2G8YA 3L74G 1Q86Q 3N7NA 4HB1A 3CC4P 4WBAA 3V4QA 3L73E 1NTMD 5KTBA 1DH3A 3ITKA 1OVVA 1PGQA 5APSA 1J1EC 3ABVC 2PP6A 3IFMA 3RK2C 3H1KE 1PIXA 3A0BH 4OGQD 5CJ0A 1NAFA 2KZIA 2QG4A 1CI6B 1ZLLA 1M1KQ 3LW5H 3CXHD 1U57A 1SQQG 3Q5PA 3CPWO 3L72D 2ZT9C 2ZJSE 1R5LA 2E74B 3MZWB 1HVVA 3KXDA 1RQUA 3C1LA 4N6JA 2OYIC 1SQPD 1FZCA 1JY3O 4RO0A 1SQBG 1RY3A 3HE5A 2HR3A 4BWNA 3MHVA 2LXCB 1BGYD 4DCKA 3L72E 2BCCJ 3M9QA 2VRSA 1KYOH 3TGUG 4D6TJ 1HJBA 2YKOA 3H1KJ 1LT9A 1RF0C 2IFNA 1YJ9P 1FZGA 2ZYAA 4K35A 1J1DC 1NO4A 3G9RA 2N1TD 5KLIB 4D6TD 2B88A 2I8DA 1SFCD 4L73A 1IFNA 1J2JB 1H0TA 2KUBA 2D2CD 2QJKC 3LW5J 3S4RA 3FXEA 3IR9A 1JY2P 1TU3F 3E1RA 4LC1A 2YXRB 1NTZK 1X9VA 2A06G 3RGUA 3M06A 1KB9D 4AUWA 1KILD 2OTJP 1URQD 2MJZA 2I1JA 1SQVK 5CHXA 5AVRB 1E5WA 1N73C 3CX5I 3CMEP 3GF3A 3TNUA 3RL0C 4KHXA 1BGYG 1GD2E 2WSCH 2HG5D 3AEBC 2W90A 2QEXP 3BATA 2R3SA 1NTMK 2JP3A 3AEDC 3P7KA 4L74A 3IF4A 2R32A 3AE3C 3SWKA 2WTYA 1FBMA 3HE5B 4DJGA 1DD4A 2IDBA 1DEBA 1PGPA 4UB8H 1VQMP 2KZJA 1PGOA 4GDOA 5APTA 3CXHH 1NU1G 1BGYE 1G2CB 2AEJA 1LTGC 1YITP 1IFIA 3NMDA 5KJ7D 3H1LG 3CCUP 3FWLA 1L0LK 3A0HH 1BE3J 3W67A 2E42A 2ZT9D 4H13C 3OW2O 2XKMA 1GW3A 2KNCA 2FXPA 4I2LC 2E75B 1GK6A 1HJ0A 1LTJC 1SQVG 2Q7CA 4EYYQ 5AVSB 1KILA 2FKWB 2O01J 4IL6H 1NTMJ 2E76B 1NU1E 1LP1A 2P1JA 3B5NB 1NTKD 3TNUB 2OYHA 3CC2P 1SQXJ 4L76A 2LKMA 2JO1A 4ASWA 5CBNA 5E79E 1LGHB 1EZVE 1X8YA 1GMJA 2W27A 4PD4E 5AVQB 1FS0E 2B9BA 3H1IE 3L72J 1FZFA 4H0LD 1MZ9A 3O6QB 5AW0B 3L70E 1EQ7A 1JTHA 1VF5C 3M0AA 1YTZI 2WPVB 1SQPK 2DW3A 1N7SD 2B89A 2Q1KA 3FGAD 2WSEH 3F5HA 3H1KD 2LR2A 1IFJA 1JOCA 4GIFA 4PV1D 4BRYB 4HKZH 3WU2E 4C7NA 5CJ4A 2J58A 1P84E 1AVYA 3E7KA 3WMM0 3D71A 1AFOA 1AJYA 1N8RQ 2Y9YA 4U3FG 1SQBJ 1Q90D 3H1JG 3CL3D 1M90Q 1SQPE 2GM4A 1L0LE 1UIXA 1SS1A 2R44A 4N3YB 1FOSE 1OMIA 3RK3C 1S72P 2E75C 2KK7A 1L0ND 3H25A 3H1HE 5H2FE 1IK7A 2XV5A 4YXWH 3KZIE 3H1IG 3BASA 3KDPB 2H89C 4A7PA 1ZR2A 4H13D 3A3YB 1VDFA 3HD7D 1EZVD 4PD4D 1LTSC 1NOHA 4PJ0H 3PJSK 2KI7B 3GLMA 3LIDA 3MUDA 1ZRTD 2RKLA 2V7QH 4RESB 1JY2N 3HTKA 1AQ5A 1G1IA 1L4AD 2WSCJ 1ZR4A 4AQRD 4W7YA 4XA4A 1L4AA 3FX0A 3L75J 2IPPA 1G2CA 4DOJA 5AW1B 1P84D 3CCRP 1LTAC 1N73A 2OYHC 2NPSD 3L71E 1J1DB 3BRTB 2WQYC 2QRXA 4JBZA 3L74J 4UB6E 2WSEJ 1NWQA 3B8EB 3H1HG 5AVUB 2ZVNB 5KJ7A 1L0LD 2L5GB 3CXHE 3M91A 2HPCA 5AW3B 1IC2A 1FAVA 4ZKUA 1W2BO 1LJ2A 1OWAA 4M3LA 5CCGD 4PD4H 1H88A 1KYOI 1EC5A 2E74C 1OFCX 4TLFA 1N73B 1LP1B 2OYHB 5AVZB 2IBZG 1FE6A 3AE2C 4GOEA 3VP9A 2Q9IA 3MIWA 1Q2NA 2I1KA 2BEZF 1KFMA 2E76D 1L2PA 1NTZJ 2N1TC 3KYQA 1S5LH 4YXDC 1AVOA 1SFCC 2Y0CA 1NU1D 2HPCB 5APVA 1X22A 1VQPP 2IYOA 1NKZB 2PAJA 2BCCE 3CI9A 1QX8A 1RH5B 4I7ZB 1QEXA 3L75E 2P10A 3Q1MA 1NU1K 3VMZA 4U3FJ 2IBZI 3P8MC 4WY4D 3U1CA 3B5NC 5KAFE 1L4AB 1EDJA 5DJTB 2J59M 1EXJA 1HBWA 1KILC 2FY8A 1IFDA 1GK4A 5GTHH 1KB9E 5CCHD 4NPDA 2PRRA 2IZ0A 2JJLA 5AVXB 1KD1Q 1MFTA 1NGMB 4KJMA 1KQFB 2FYNC 1K9MQ 1SFCA 3AE6C 3G4SP 1BSHA 5AW5B 4H13B 3MTUE 3VYIA 1LT1A 3L75G 1YQ3C 1Q7YQ 2WT7B 3K5BA 3EFFK 4GOFA 4IFMA 2XU6A 1XTCC 3EFGA 1KYOE 3LIEA 1W2EA 1S2EA 2O1JA 4I1LA 2PGDA 3R4YA 3GMAA 4D6TE 5CBOA 5APWA 1NTZG 4O9BA 5AW8B 2KNCB 1NJIQ 2FYNB 3NFQA 4N78D 2NPSC 5K5GB 1Q81Q 1QVFO 2D2CB 3II6A 1ZV8A 4OWFA 1VQLP 1FC2C 2J5UA 1YYCA 3GW6A 4GT1A 4NPEA 3SFEC 2NRGA 1LT9B 3H1LD 3I56P 3VMYA 2K9YA 2WSFH 2C9LY 4N78E 3RK3E 5KAIE 3NXSA 2BCCD 4DZOA 4PV1B 3H1LJ 1EDIA 1XTGB 3L75D 1T6AA 4I7ZC 3USSA 1VQ7P 2FBWC 3JCUE 1N7SA 1VPCA 1MUUA 3GHGA 2QJPB 1YBKA 3HE4A 3A2AA 2JKVA 3QWOC 3GF7A 2D2CC 2R3CA 3HTKB 3TDKA 3Q5RA 1VQNP 3L70J 3SWFA 1BSNA 3V2PA 1VQKP 3VP8A 5KKZC 4UB8E 1YJWP 1K73Q 3L4FA 1FZCB 3B5NA 1CW5A 5AW7B 2POHA 2A45H 3L70D 4K3AA 1VQOP 3VMXA 1Y8AA 1T2KD 2M5AA 2QJPC 2YXQB 1KYOD 3OAKA 1IK9A 4OGQB 1BE3G 1L0NK 1NTKG 4XE5B 5E79H 3F89A 1L0NG 1NTKK 3JC22 2N9YB 1OW8A 2OYIA 1NAYA 2W8ZA 3S1KA 2QA4P 4MN4C 2BASA 1NU1J 2W6JH 3G6EP 4JPZB 1L0LG 3N4XA 5EFWB 1HTLC 3W68A 1LT9C 5B5EH 3AE5C 5B66H 1LWUA 1PV3A 1T3JA 1P84I 3RK2B 1KC8Q 3L73G 3WUVA 1KQSO 3CCVP 3TK1A 3L72G 1GU5A 2GA1A 5KJ7C 1GDTA 1G1JA 1NVOA 1L0NE 1M1JA 1NHLA 3CWBJ 3H1KG 3H1HD 2WWWA 5B66E 1BCCJ 1JM0A 3Q5SA 5AW2B 1ZMEC 1SVFA 2OARA 1SQQE 3OJAB 2WPQA 4XFJA 3M9BA 2YMKA 1NTMG 1FZEA 3CWBD 2E43A 3A5TA 2CK3H 1LWUB 2RH0A 1RF1C 2W83C 3HUSC 3O6QA 1CSBA 3IN6A 1EZVI 1K04A 1SQQD 2A06E 2NPSA 3H1IJ 3L37A 4PD4I 3CMAP 2QVAA 2V7QJ 3SFDC 3WU2H 1IJDB 5KLIC 5AW9B 2Q3IA 1GW4A 4H0LC 3FWNA 5BU8B 3M9HA 2KIKA 2A06D 3PLNA 4R4MA 3SSUA 3BVHA 3AECC 1MV8A 1M8OB 2KS1A 2CPBA 2O1KA 2AXTE 5AVVB 5GTIE 5AVTB 1RF0A 2KLUA 4ZNCA 5KAIH 2Z4EA 1GL2A 2PFXA 3L71D 1ZW0A 1ZN5A 4H44C 2KXPB 3RL0g 3CCEP 3CWBG 1DIPA 1YTZT 1SQPJ 1T2KC 1Z56A 3RL0B 1JO5A 2P2UA 2K3RA 1BGYJ 1QGKB 1R5SA 5CCGC 2QE7H 3L71J 1LTTC 3TF5A 1JNMA 1FDMA 1N7SB 3GHGB 3HE4B 4EDFA 2KSJA 4IOIH 2IBZE 3CCMP 1S9KE 3AEAC 1GU4A 3RK3D 1OVUA 2XNXA 3M0DA 2Z5IA 1GL2C 2GUSA 1JUNA 1PPJE 1KB9I 1W5CE 3B4SA 3CWBE 1L0NJ 3RL0D 4GODA 2FYUK 1SLQA 1AV1A 2BCCG 3H32A 1CZQA 4HYTB 2K88A 3EQ2A 1JCCA 4WY4A 1Y9BA 4IL6E 3TSIA 2ZVOB 4BXLA 2XNDH 3B5ND 1U7JA 1OVRA 2HLOA 3L73J 1DD3A 5CCHC 3M0DC 2AXCA 4UB6H 1M56D 2RN0A 2M5AB 1JY3N 2O01N 3GG2A 4IFDK 2Y0EA 2ZT9B 3JSVC 2YO2A 3L71G 1UIIA 2KLVA 1AA0A 3MD0A 3AE8C 2HODB 2O01H 5AVYB 2QJYB 4Y28J 1NH4A 1H0TB 5KLVK 3P8CE 2B87B 1SQVD 3B71A 3EWKA 3WUUA 2Q3EA 1KORA 3KPEA 1JY3P 1Q82Q 2KOGA 3HRNA 5CCHA 3I55P 1SQBK 1P84H 3BCCE 4LLHA 1K05A 1HUCA 3TYYA 1VQ5P 3G3ZA 2QJKB 1H89A 4IFFA 1SQVJ 2W6BA 3KQGA 3TGUJ 1EXIA 4H44D 1SQQJ 1FJKA 1IFPA 2SPZA 4WY4B 4Y99B 3H32B 1IFMA 3AEEC 1FZCC 3RK2D 1VQ8P 3H1LE 1QLED 1DX7A 2E74D 1X79B 1NKNA 3C9IA 2N9BA 2P7JA 5GTHE 1VF5D 1JB0J 3CLQA 5H2FH 3D70A 2N1TA 1SQXD 1YQ4C 1ZOYC 4WVZA 1U7MA 1N7SC 3GHGC 3H1JE 2YNYA 4JYCA 1EDLA 2QM7A 1GL2D 4Y99C 4H0LB 1RE4A 4PV1C 1YJNP 1KQGB 1SP4A 3PHLA 1PZQA 3VMAA 1SQXK 5CCGA 1FZBA 3A7OA 4W7ZA 4WY4C 1PP9J 2L91A 4TT3H 5AW6B 3VOPA 4U3FD 1S1CX 3NTNA 5AVWB 1VQ6P 1OX3A 1QVGO 1RF1A 2JWAA 2YIUC 1SQBE 3L70G 5KAFH 2WT7A 2QJYC 3KZIH 1NYHA 1GTWA 2E75D 2WPSA 3T97A 2A45G 2JDIH 4HH2A 4RJTA 1SQBD 3BCCD 2IFMA 1LTJB 2WITA 2Y0DA 1LTBC 2KSEA 2OYOA 2FFDA 1URQC 1LNQA 1HWTC 5DJUB 1RF1B 1QL1A 2YIUB 3BCCJ 2K9JA 3BRVB 1LWUC 3E1IA 4U7JA 4LGDE 3MUDC 1JMBA 1FDOA 1SQPG 1KMIZ 2IBZD 2ZFCA 3QH9A 4L75A 1T3UA 1M1JB 3L73D 2K1AA 2C0XA 4AYCA 1E79H 4EIJA 3Q3DA 1SQXE 1OW7A 5BVZA 3CCJP 3CCLP 2M3BA 1L4AC 1OXZA 2ZXXA 3AE1C 3MP7B 1WRGA 5APXA 3MGNA 3V5BA 1HH0A 1URQB 2E5YA 2QM8A 5KLVJ 1RE3C 3FXDA 3A0HE 3PTZA 5TISH 2Q6QA 2XZRA 4PJ0E 1GZLA 2JEEA 3HUSA 4OH8B 3L74D 5APUA 1BE3D 2HODA 4I6MC 1ZP0C 1AQTA 5KLVD 1L0LJ 2A45I 4R4LA 2FXMA 2YO3A 2ZYDA 1Y47A 3V2QA 3WUTA 3D6YA 2HFED 1VF5B 3AEFC 1BE3E 3TGUD 1KB9H 3CD6P 1SFCB 2FXOA 1JEKA 1NTKJ 2V4HA 1ZXGA 1RE3A 4QMAA 3SWYA 3KHUA 3CX5H 1BCCG 2CPSA 3CX5D 3RK3B 3P8CD 1USDA 3TGUE 1SQVE 2FYUE 3U59A 1YIJP 2E76C 2FYUJ 1S4XA 2M8RA 1RE4C 1QL2A 1X0TA 3S9OA 2O3JA 3VTPC 3CX5E 4H44B 5AW4B 1KN7A 2QSIA 3AE7C 2H7HA 1MKMA 2FYUD 2JR8A 2ZXEB 3OA7A 5KLVG 3HD7B 5GTIH 2ZAEB 1URQA 1KTMA 5M1BA 2RMZA 1PP9D 5APYA 1NTZD 2OGUA 1JTHB 3CCQP 3I5CA 1S9KD 2C9NY 3CC7P 1NTME 1HF9A 1DEEG 5B5EE 3PH0A 2R5BA 2H43A 1PPJD 4C7RA 1PP9G 1FU1A 1WMKA 4ZMDA 1WT6A 2GUVA 5KLVE 2M3EA 2NPSB 2R5DA 1J1EB 2Z5HA 3HD7A 3JCUH 5CMZA 3UIAA 3V4WA 1S5LX 1RQVA 1H8AA 2WVRA 2YMYA 1OZHA 2E5TA 3CXHI 1OIPA 3AE9C 2H88C 2OTKE 2WPRA 3AEGC 2FYUG 2LXBA 1RHZB
chains in the Genus database with same CATH topology
3V2RA 3P32A 4C46A 2KYVA 1LTJA 2W6AA 1KQLA 3H6PA 4B86A 2FFDB 3VN0A 1SQQK 2WZ7A 2H8PD 4JF7A 4JYBA 2FYZA 3PP5A 3R2PA 1IO4A 3V2NA 1LTIC 1GL2B 4ZKPA 1JY2O 2FFDC 4W80A 4WB4A 3HUSB 2OYIB 2N1TB 3O8ZA 1T8ZA 2P67A 1JCDA 1HGVA 4C7NB 4GKGA 1FJPA 1N86A 2YKPA 1CI6A 1A02F 1KZUB 2C0WA 2YKQA 1FZAA 2KP8A 1M1JC 3L35A 1FOSF 1HGZA 3L36A 1JMMA 5BU5A 2IX7C 3HD7C 2HYNA 2Q5UA 4EOTA 1N7LA 1PFIA 1N2DC 5APQA 1M7LA 3U1AA 1KFNA 2KB7P 1KILB 2XDJA 1A02J 1MFZA 3N7NA 4WBAA 3V4QA 5KTBA 1DH3A 5APSA 1J1EC 3RK2C 2PP6A 3IFMA 5CJ0A 1NAFA 1CI6B 1ZLLA 3LW5H 4N6JA 1HVVA 2OYIC 1JY3O 1RY3A 3HE5A 3M9QA 2VRSA 1HJBA 2YKOA 1LT9A 1RF0C 2IFNA 1FZGA 1J1DC 1NO4A 2N1TD 1SFCD 1IFNA 1J2JB 3IR9A 1JY2P 4LC1A 1NTZK 1X9VA 3M06A 4AUWA 1KILD 1URQD 2MJZA 2I1JA 1SQVK 5CHXA 5AVRB 1E5WA 1N73C 3TNUA 3RL0C 4KHXA 1GD2E 2WSCH 2HG5D 3BATA 1NTMK 3P7KA 2WTYA 2R32A 1FBMA 3HE5B 1DEBA 5APTA 1G2CB 1LTGC 1IFIA 3NMDA 5KJ7D 1L0LK 2E42A 2XKMA 1GW3A 4I2LC 1GK6A 1LTJC 2Q7CA 5AVSB 1KILA 2FKWB 2P1JA 3TNUB 2OYHA 2LKMA 1LGHB 5AVQB 1X8YA 2W27A 1FZFA 1MZ9A 5AW0B 1EQ7A 1JTHA 3M0AA 1YTZI 1SQPK 1N7SD 2WSEH 4GIFA 1IFJA 1JOCA 4C7NA 5CJ4A 2J58A 3WMM0 1AFOA 3CL3D 2GM4A 4N3YB 1FOSE 3RK3C 2XV5A 3BASA 3KDPB 1ZR2A 3A3YB 1VDFA 3HD7D 1LTSC 1NOHA 3MUDA 3LIDA 4RESB 1JY2N 3HTKA 1AQ5A 1G1IA 1L4AD 1ZR4A 4AQRD 4W7YA 4XA4A 1L4AA 2IPPA 1G2CA 4DOJA 5AW1B 1LTAC 1N73A 2OYHC 2NPSD 1J1DB 3BRTB 1NWQA 3B8EB 5AVUB 5KJ7A 2L5GB 3M91A 2HPCA 5AW3B 1IC2A 1FAVA 4ZKUA 1OWAA 4M3LA 5CCGD 1H88A 1N73B 2OYHB 5AVZB 3VP9A 2Q9IA 3MIWA 2I1KA 1KFMA 2N1TC 3KYQA 1SFCC 2HPCB 5APVA 1NKZB 2PAJA 3CI9A 1NU1K 3VMZA 4WY4D 3P8MC 3U1CA 3B5NC 1L4AB 1HBWA 2J59M 1KILC 1IFDA 1GK4A 5CCHD 2JJLA 5AVXB 1SFCA 5AW5B 3MTUE 3VYIA 2WT7B 4IFMA 2XU6A 1XTCC 3EFGA 3LIEA 1W2EA 2O1JA 4I1LA 5APWA 4O9BA 5AW8B 3NFQA 2NPSC 3II6A 1ZV8A 1YYCA 4GT1A 1LT9B 3VMYA 2WSFH 2C9LY 4N78E 3NXSA 4DZOA 1XTGB 1N7SA 1VPCA 1MUUA 3GHGA 3HE4A 4N78D 3A2AA 2R3CA 3HTKB 3SWFA 3V2PA 3VP8A 1FZCB 1CW5A 3L4FA 3B5NA 5AW7B 2POHA 2A45H 3VMXA 1T2KD 3OAKA 1IK9A 1L0NK 1NTKK 2OYIA 2BASA 3N4XA 1HTLC 1LT9C 1LWUA 1T3JA 3RK2B 3TK1A 1GU5A 5KJ7C 1GDTA 1G1JA 1M1JA 1NHLA 2WWWA 5AW2B 1SVFA 2OARA 3OJAB 2WPQA 3M9BA 1FZEA 2E43A 3A5TA 1LWUB 1RF1C 3HUSC 4XE5B 1CSBA 3L37A 2NPSA 1IJDB 5AW9B 2Q3IA 1GW4A 5BU8B 3M9HA 3BVHA 1MV8A 5AVVB 2O1KA 2CPBA 5AVTB 1RF0A 2Z4EA 1GL2A 1ZN5A 1YTZT 1T2KC 1Z56A 3RL0B 1JO5A 2P2UA 1FZCA 5CCGC 1JNMA 1LTTC 1FDMA 1N7SB 3GHGB 3HE4B 2KSJA 1S9KE 1GU4A 3RK3D 2XNXA 3M0DA 2Z5IA 1GL2C 2GUSA 1JUNA 3RL0D 2FYUK 1SLQA 4HYTB 3H32A 1CZQA 3EQ2A 1JCCA 4WY4A 3TSIA 3B5ND 2HLOA 5CCHC 3M0DC 1JY3N 4IFDK 2YO2A 2KLVA 3MD0A 5AVYB 2HODB 2O01H 1NH4A 5KLVK 3P8CE 3KPEA 1JY3P 2KOGA 3HRNA 5CCHA 1SQBK 4LLHA 3TYYA 1H89A 1HUCA 3G3ZA 4IFFA 2W6BA 3KQGA 1FJKA 4Y99B 4WY4B 3H32B 1IFMA 1FZCC 3RK2D 1DX7A 1X79B 1NKNA 3C9IA 2N9BA 2P7JA 3CLQA 2N1TA 1N7SC 3GHGC 2YNYA 4JYCA 2QM7A 1GL2D 4Y99C 1RE4A 5CCGA 1SP4A 1SQXK 1FZBA 3A7OA 4W7ZA 4WY4C 3VOPA 5AW6B 3NTNA 5AVWB 1RF1A 2WT7A 1GTWA 2WPSA 3T97A 2A45G 4HH2A 2IFMA 1LTJB 2WITA 1LTBC 2FFDA 1URQC 1HWTC 1RF1B 1QL1A 3BRVB 1LWUC 3E1IA 4LGDE 2ZFCA 1T3UA 1M1JB 4AYCA 4EIJA 2C0XA 2M3BA 1L4AC 1OXZA 5APXA 3V5BA 5BVZA 1WRGA 3MGNA 1HH0A 1URQB 2QM8A 1RE3C 2XZRA 1GZLA 2JEEA 3HUSA 4OH8B 5APUA 2HODA 4I6MC 2A45I 3V2QA 2FXMA 2YO3A 2HFED 1SFCB 1RE3A 3SWYA 2CPSA 3RK3B 3P8CD 3U59A 2M8RA 1RE4C 1QL2A 3VTPC 5AW4B 2H7HA 3OA7A 2ZXEB 3HD7B 1URQA 5APYA 1JTHB 3I5CA 1S9KD 2C9NY 2R5BA 2H43A 4C7RA 1FU1A 1WT6A 2GUVA 2NPSB 2R5DA 1J1EB 2Z5HA 3HD7A 5CMZA 3UIAA 3V4WA 1H8AA 2YMYA 2WPRA 3B5NB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2C B;  3P32 A;  3NMD A;  5APW A;  4C46 A;  5AW8 B;  2W6A A;  3NFQ A;  2E42 A;  1KQL A;  4B86 A;  1YYC A;  4GT1 A;  4I2L C;  3TYY A;  1GK6 A;  1HUC A;  3VN0 A;  1H89 A;  2Q7C A;  3VMY A;  5AVS B;  3KQG A;  2C9L Y;  4JYB A;  3TNU B;  3NXS A;  4DZO A;  1IO4 A;  5AVQ B;  1X8Y A;  3HE4 A;  2N9B A;  1MUU A;  2P7J A;  2W27 A;  3A2A A;  2R3C A;  5AW0 B;  3SWF A;  3M0A A;  2YNY A;  3O8Z A;  4JYC A;  2QM7 A;  2P67 A;  1SP4 A;  5AW7 B;  4C7N B;  3A7O A;  4GKG A;  5AW6 B;  3VMX A;  4C7N A;  3NTN A;  5AVW B;  3OAK A;  1T2K D;  2WT7 A;  1CI6 A;  1A02 F;  1GTW A;  2WPS A;  2BAS A;  3T97 A;  1FOS E;  2KP8 A;  3L35 A;  1FOS F;  3L36 A;  1HWT C;  2XV5 A;  3TK1 A;  1GU5 A;  2Q5U A;  3KDP B;  4EOT A;  2WWW A;  2ZFC A;  3A3Y B;  5APQ A;  5AW2 B;  4AYC A;  2WPQ A;  3M9B A;  3LID A;  1A02 J;  2E43 A;  3V5B A;  3A5T A;  1MFZ A;  1OXZ A;  4RES B;  5APX A;  3MGN A;  3V4Q A;  4XE5 B;  2QM8 A;  1CSB A;  3HTK A;  3L37 A;  1DH3 A;  5APS A;  4AQR D;  2XZR A;  1GZL A;  5APU A;  1NAF A;  2IPP A;  1CI6 B;  4I6M C;  5AW9 B;  2Q3I A;  5AW1 B;  2YO3 A;  3M9H A;  1MV8 A;  5AVV B;  1NWQ A;  3B8E B;  5AVU B;  5AVT B;  3HE5 A;  3M91 A;  5AW3 B;  1FAV A;  2VRS A;  1OWA A;  4M3L A;  1HJB A;  1H88 A;  1T2K C;  2P2U A;  1JNM A;  5AVZ B;  1J2J B;  3HE4 B;  3VTP C;  5AW4 B;  3IR9 A;  1S9K E;  2H7H A;  1GU4 A;  4LC1 A;  2ZXE B;  3M0D A;  5APV A;  2Z5I A;  1JUN A;  3M06 A;  5APY A;  4AUW A;  3VMZ A;  3P8M C;  1SLQ A;  5AVR B;  4HYT B;  3I5C A;  1CZQ A;  1S9K D;  2C9N Y;  1HBW A;  3TNU A;  2R5B A;  4KHX A;  1GD2 E;  1GK4 A;  2WTY A;  2JJL A;  3P7K A;  5AVX B;  2R32 A;  3HE5 B;  2R5D A;  2Z5H A;  5AW5 B;  5CMZ A;  3UIA A;  3V4W A;  3VYI A;  5APT A;  1H8A A;  2WT7 B;  2YO2 A;  2XU6 A;  2WPR A;  3MD0 A;  3LIE A;  5AVY B; 
#chains in the Genus database with same CATH topology
 2UWJ E;  1VQ9 P;  1S5L E;  3V2R A;  3P32 A;  4ASV A;  1M57 D;  2JWD A;  3Q2Y A;  2ZYG A;  2KYV A;  4C46 A;  3G71 P;  2K9J B;  2ITA A;  1LTJ A;  2W6A A;  2WSF J;  2Y9Z A;  1KQL A;  3H6P A;  1NTK E;  2K37 A;  4B86 A;  2FFD B;  3AE4 C;  3VN0 A;  1SQQ K;  2WZ7 A;  1IZN B;  3BCC G;  5TIS E;  2WMM A;  2H8P D;  4JF7 A;  4JYB A;  4YTP C;  1EDK A;  2FYZ A;  2IZ1 A;  3PP5 A;  4KT0 J;  3R2P A;  2AXT H;  1YI2 P;  1PP9 E;  1NTZ E;  2KS1 B;  4Z1M H;  1BDD A;  4OGQ C;  3V2N A;  1IO4 A;  3PRJ A;  1LTI C;  1PPJ G;  1KV4 A;  2MKV A;  2NZ2 A;  1GL2 B;  4ZKP A;  1JY2 O;  4RKU J;  1EZV G;  4W80 A;  2FFD C;  4HJG H;  4WB4 A;  2IYP A;  1VL2 A;  1VQ4 P;  3H1J J;  3HUS B;  2OYI B;  2N1T B;  3O8Z A;  2G3A A;  1PL5 A;  1T8Z A;  1D7M A;  2WSS H;  2P67 A;  2AEF A;  5C39 A;  1JCD A;  1HGV A;  4C7N B;  3D6Z A;  4JQ0 D;  3H1J D;  1PGJ A;  3L74 E;  4GKG A;  4EI2 A;  5L8R J;  1YHQ P;  1FJP A;  1R8E A;  3V6I A;  4BRY A;  5TJH A;  2OQQ A;  1N86 A;  4CPG A;  2YKP A;  4WWI A;  2OTL P;  1BDC A;  1CI6 A;  3ZDM A;  1A02 F;  1KZU B;  4U3F E;  4DT0 A;  5KKZ B;  1BCC E;  2C0W A;  2YKQ A;  1FZA A;  2KP8 A;  2QIW A;  1S3J A;  3T97 B;  2M0B A;  1FDI A;  1K8A Q;  1M1J C;  2P58 A;  3L35 A;  1FOS F;  1HGZ A;  3C8V A;  1BCC D;  3L36 A;  1JMM A;  3RBX A;  5BU5 A;  2IX7 C;  2AEM A;  4NPF X;  4YPC A;  2B87 A;  3HD7 C;  1USE A;  2HYN A;  2Q5U A;  3IAO A;  1ZRT E;  2BEQ D;  4EOT A;  1N7L A;  4D6T G;  1N2D C;  1OW6 A;  1PFI A;  1SQX G;  1M7L A;  5APQ A;  3U1A A;  1KFN A;  3RBZ A;  2KB7 P;  3H1I D;  1KIL B;  4OVN F;  2XDJ A;  3A0B E;  3CCS P;  1A02 J;  3H1H J;  1KIL E;  1MFZ A;  4IL6 X;  2G8Y A;  3L74 G;  1Q86 Q;  3N7N A;  4HB1 A;  3CC4 P;  4WBA A;  3V4Q A;  3L73 E;  1NTM D;  5KTB A;  1DH3 A;  3ITK A;  1OVV A;  1PGQ A;  5APS A;  1J1E C;  3ABV C;  2PP6 A;  3IFM A;  3RK2 C;  3H1K E;  1PIX A;  3A0B H;  4OGQ D;  5CJ0 A;  1NAF A;  2KZI A;  2QG4 A;  1CI6 B;  1ZLL A;  1M1K Q;  3LW5 H;  3CXH D;  1U57 A;  1SQQ G;  3Q5P A;  3CPW O;  3L72 D;  2ZT9 C;  2ZJS E;  1R5L A;  2E74 B;  3MZW B;  1HVV A;  3KXD A;  1RQU A;  3C1L A;  4N6J A;  2OYI C;  1SQP D;  1FZC A;  1JY3 O;  4RO0 A;  1SQB G;  1RY3 A;  3HE5 A;  2HR3 A;  4BWN A;  3MHV A;  2LXC B;  1BGY D;  4DCK A;  3L72 E;  2BCC J;  3M9Q A;  2VRS A;  1KYO H;  3TGU G;  4D6T J;  1HJB A;  2YKO A;  3H1K J;  1LT9 A;  1RF0 C;  2IFN A;  1YJ9 P;  1FZG A;  2ZYA A;  4K35 A;  1J1D C;  1NO4 A;  3G9R A;  2N1T D;  5KLI B;  4D6T D;  2B88 A;  2I8D A;  1SFC D;  4L73 A;  1IFN A;  1J2J B;  1H0T A;  2KUB A;  2D2C D;  2QJK C;  3LW5 J;  3S4R A;  3FXE A;  3IR9 A;  1JY2 P;  1TU3 F;  3E1R A;  4LC1 A;  2YXR B;  1NTZ K;  1X9V A;  2A06 G;  3RGU A;  3M06 A;  1KB9 D;  4AUW A;  1KIL D;  2OTJ P;  1URQ D;  2MJZ A;  2I1J A;  1SQV K;  5CHX A;  5AVR B;  1E5W A;  1N73 C;  3CX5 I;  3CME P;  3GF3 A;  3TNU A;  3RL0 C;  4KHX A;  1BGY G;  1GD2 E;  2WSC H;  2HG5 D;  3AEB C;  2W90 A;  2QEX P;  3BAT A;  2R3S A;  1NTM K;  2JP3 A;  3AED C;  3P7K A;  4L74 A;  3IF4 A;  2R32 A;  3AE3 C;  3SWK A;  2WTY A;  1FBM A;  3HE5 B;  4DJG A;  1DD4 A;  2IDB A;  1DEB A;  1PGP A;  4UB8 H;  1VQM P;  2KZJ A;  1PGO A;  4GDO A;  5APT A;  3CXH H;  1NU1 G;  1BGY E;  1G2C B;  2AEJ A;  1LTG C;  1YIT P;  1IFI A;  3NMD A;  5KJ7 D;  3H1L G;  3CCU P;  3FWL A;  1L0L K;  3A0H H;  1BE3 J;  3W67 A;  2E42 A;  2ZT9 D;  4H13 C;  3OW2 O;  2XKM A;  1GW3 A;  2KNC A;  2FXP A;  4I2L C;  2E75 B;  1GK6 A;  1HJ0 A;  1LTJ C;  1SQV G;  2Q7C A;  4EYY Q;  5AVS B;  1KIL A;  2FKW B;  2O01 J;  4IL6 H;  1NTM J;  2E76 B;  1NU1 E;  1LP1 A;  2P1J A;  3B5N B;  1NTK D;  3TNU B;  2OYH A;  3CC2 P;  1SQX J;  4L76 A;  2LKM A;  2JO1 A;  4ASW A;  5CBN A;  5E79 E;  1LGH B;  1EZV E;  1X8Y A;  1GMJ A;  2W27 A;  4PD4 E;  5AVQ B;  1FS0 E;  2B9B A;  3H1I E;  3L72 J;  1FZF A;  4H0L D;  1MZ9 A;  3O6Q B;  5AW0 B;  3L70 E;  1EQ7 A;  1JTH A;  1VF5 C;  3M0A A;  1YTZ I;  2WPV B;  1SQP K;  2DW3 A;  1N7S D;  2B89 A;  2Q1K A;  3FGA D;  2WSE H;  3F5H A;  3H1K D;  2LR2 A;  1IFJ A;  1JOC A;  4GIF A;  4PV1 D;  4BRY B;  4HKZ H;  3WU2 E;  4C7N A;  5CJ4 A;  2J58 A;  1P84 E;  1AVY A;  3E7K A;  3WMM 0;  3D71 A;  1AFO A;  1AJY A;  1N8R Q;  2Y9Y A;  4U3F G;  1SQB J;  1Q90 D;  3H1J G;  3CL3 D;  1M90 Q;  1SQP E;  2GM4 A;  1L0L E;  1UIX A;  1SS1 A;  2R44 A;  4N3Y B;  1FOS E;  1OMI A;  3RK3 C;  1S72 P;  2E75 C;  2KK7 A;  1L0N D;  3H25 A;  3H1H E;  5H2F E;  1IK7 A;  2XV5 A;  4YXW H;  3KZI E;  3H1I G;  3BAS A;  3KDP B;  2H89 C;  4A7P A;  1ZR2 A;  4H13 D;  3A3Y B;  1VDF A;  3HD7 D;  1EZV D;  4PD4 D;  1LTS C;  1NOH A;  4PJ0 H;  3PJS K;  2KI7 B;  3GLM A;  3LID A;  3MUD A;  1ZRT D;  2RKL A;  2V7Q H;  4RES B;  1JY2 N;  3HTK A;  1AQ5 A;  1G1I A;  1L4A D;  2WSC J;  1ZR4 A;  4AQR D;  4W7Y A;  4XA4 A;  1L4A A;  3FX0 A;  3L75 J;  2IPP A;  1G2C A;  4DOJ A;  5AW1 B;  1P84 D;  3CCR P;  1LTA C;  1N73 A;  2OYH C;  2NPS D;  3L71 E;  1J1D B;  3BRT B;  2WQY C;  2QRX A;  4JBZ A;  3L74 J;  4UB6 E;  2WSE J;  1NWQ A;  3B8E B;  3H1H G;  5AVU B;  2ZVN B;  5KJ7 A;  1L0L D;  2L5G B;  3CXH E;  3M91 A;  2HPC A;  5AW3 B;  1IC2 A;  1FAV A;  4ZKU A;  1W2B O;  1LJ2 A;  1OWA A;  4M3L A;  5CCG D;  4PD4 H;  1H88 A;  1KYO I;  1EC5 A;  2E74 C;  1OFC X;  4TLF A;  1N73 B;  1LP1 B;  2OYH B;  5AVZ B;  2IBZ G;  1FE6 A;  3AE2 C;  4GOE A;  3VP9 A;  2Q9I A;  3MIW A;  1Q2N A;  2I1K A;  2BEZ F;  1KFM A;  2E76 D;  1L2P A;  1NTZ J;  2N1T C;  3KYQ A;  1S5L H;  4YXD C;  1AVO A;  1SFC C;  2Y0C A;  1NU1 D;  2HPC B;  5APV A;  1X22 A;  1VQP P;  2IYO A;  1NKZ B;  2PAJ A;  2BCC E;  3CI9 A;  1QX8 A;  1RH5 B;  4I7Z B;  1QEX A;  3L75 E;  2P10 A;  3Q1M A;  1NU1 K;  3VMZ A;  4U3F J;  2IBZ I;  3P8M C;  4WY4 D;  3U1C A;  3B5N C;  5KAF E;  1L4A B;  1EDJ A;  5DJT B;  2J59 M;  1EXJ A;  1HBW A;  1KIL C;  2FY8 A;  1IFD A;  1GK4 A;  5GTH H;  1KB9 E;  5CCH D;  4NPD A;  2PRR A;  2IZ0 A;  2JJL A;  5AVX B;  1KD1 Q;  1MFT A;  1NGM B;  4KJM A;  1KQF B;  2FYN C;  1K9M Q;  1SFC A;  3AE6 C;  3G4S P;  1BSH A;  5AW5 B;  4H13 B;  3MTU E;  3VYI A;  1LT1 A;  3L75 G;  1YQ3 C;  1Q7Y Q;  2WT7 B;  3K5B A;  3EFF K;  4GOF A;  4IFM A;  2XU6 A;  1XTC C;  3EFG A;  1KYO E;  3LIE A;  1W2E A;  1S2E A;  2O1J A;  4I1L A;  2PGD A;  3R4Y A;  3GMA A;  4D6T E;  5CBO A;  5APW A;  1NTZ G;  4O9B A;  5AW8 B;  2KNC B;  1NJI Q;  2FYN B;  3NFQ A;  4N78 D;  2NPS C;  5K5G B;  1Q81 Q;  1QVF O;  2D2C B;  3II6 A;  1ZV8 A;  4OWF A;  1VQL P;  1FC2 C;  2J5U A;  1YYC A;  3GW6 A;  4GT1 A;  4NPE A;  3SFE C;  2NRG A;  1LT9 B;  3H1L D;  3I56 P;  3VMY A;  2K9Y A;  2WSF H;  2C9L Y;  4N78 E;  3RK3 E;  5KAI E;  3NXS A;  2BCC D;  4DZO A;  4PV1 B;  3H1L J;  1EDI A;  1XTG B;  3L75 D;  1T6A A;  4I7Z C;  3USS A;  1VQ7 P;  2FBW C;  3JCU E;  1N7S A;  1VPC A;  1MUU A;  3GHG A;  2QJP B;  1YBK A;  3HE4 A;  3A2A A;  2JKV A;  3QWO C;  3GF7 A;  2D2C C;  2R3C A;  3HTK B;  3TDK A;  3Q5R A;  1VQN P;  3L70 J;  3SWF A;  1BSN A;  3V2P A;  1VQK P;  3VP8 A;  5KKZ C;  4UB8 E;  1YJW P;  1K73 Q;  3L4F A;  1FZC B;  3B5N A;  1CW5 A;  5AW7 B;  2POH A;  2A45 H;  3L70 D;  4K3A A;  1VQO P;  3VMX A;  1Y8A A;  1T2K D;  2M5A A;  2QJP C;  2YXQ B;  1KYO D;  3OAK A;  1IK9 A;  4OGQ B;  1BE3 G;  1L0N K;  1NTK G;  4XE5 B;  5E79 H;  3F89 A;  1L0N G;  1NTK K;  3JC2 2;  2N9Y B;  1OW8 A;  2OYI A;  1NAY A;  2W8Z A;  3S1K A;  2QA4 P;  4MN4 C;  2BAS A;  1NU1 J;  2W6J H;  3G6E P;  4JPZ B;  1L0L G;  3N4X A;  5EFW B;  1HTL C;  3W68 A;  1LT9 C;  5B5E H;  3AE5 C;  5B66 H;  1LWU A;  1PV3 A;  1T3J A;  1P84 I;  3RK2 B;  1KC8 Q;  3L73 G;  3WUV A;  1KQS O;  3CCV P;  3TK1 A;  3L72 G;  1GU5 A;  2GA1 A;  5KJ7 C;  1GDT A;  1G1J A;  1NVO A;  1L0N E;  1M1J A;  1NHL A;  3CWB J;  3H1K G;  3H1H D;  2WWW A;  5B66 E;  1BCC J;  1JM0 A;  3Q5S A;  5AW2 B;  1ZME C;  1SVF A;  2OAR A;  1SQQ E;  3OJA B;  2WPQ A;  4XFJ A;  3M9B A;  2YMK A;  1NTM G;  1FZE A;  3CWB D;  2E43 A;  3A5T A;  2CK3 H;  1LWU B;  2RH0 A;  1RF1 C;  2W83 C;  3HUS C;  3O6Q A;  1CSB A;  3IN6 A;  1EZV I;  1K04 A;  1SQQ D;  2A06 E;  2NPS A;  3H1I J;  3L37 A;  4PD4 I;  3CMA P;  2QVA A;  2V7Q J;  3SFD C;  3WU2 H;  1IJD B;  5KLI C;  5AW9 B;  2Q3I A;  1GW4 A;  4H0L C;  3FWN A;  5BU8 B;  3M9H A;  2KIK A;  2A06 D;  3PLN A;  4R4M A;  3SSU A;  3BVH A;  3AEC C;  1MV8 A;  1M8O B;  2KS1 A;  2CPB A;  2O1K A;  2AXT E;  5AVV B;  5GTI E;  5AVT B;  1RF0 A;  2KLU A;  4ZNC A;  5KAI H;  2Z4E A;  1GL2 A;  2PFX A;  3L71 D;  1ZW0 A;  1ZN5 A;  4H44 C;  2KXP B;  3RL0 g;  3CCE P;  3CWB G;  1DIP A;  1YTZ T;  1SQP J;  1T2K C;  1Z56 A;  3RL0 B;  1JO5 A;  2P2U A;  2K3R A;  1BGY J;  1QGK B;  1R5S A;  5CCG C;  2QE7 H;  3L71 J;  1LTT C;  3TF5 A;  1JNM A;  1FDM A;  1N7S B;  3GHG B;  3HE4 B;  4EDF A;  2KSJ A;  4IOI H;  2IBZ E;  3CCM P;  1S9K E;  3AEA C;  1GU4 A;  3RK3 D;  1OVU A;  2XNX A;  3M0D A;  2Z5I A;  1GL2 C;  2GUS A;  1JUN A;  1PPJ E;  1KB9 I;  1W5C E;  3B4S A;  3CWB E;  1L0N J;  3RL0 D;  4GOD A;  2FYU K;  1SLQ A;  1AV1 A;  2BCC G;  3H32 A;  1CZQ A;  4HYT B;  2K88 A;  3EQ2 A;  1JCC A;  4WY4 A;  1Y9B A;  4IL6 E;  3TSI A;  2ZVO B;  4BXL A;  2XND H;  3B5N D;  1U7J A;  1OVR A;  2HLO A;  3L73 J;  1DD3 A;  5CCH C;  3M0D C;  2AXC A;  4UB6 H;  1M56 D;  2RN0 A;  2M5A B;  1JY3 N;  2O01 N;  3GG2 A;  4IFD K;  2Y0E A;  2ZT9 B;  3JSV C;  2YO2 A;  3L71 G;  1UII A;  2KLV A;  1AA0 A;  3MD0 A;  3AE8 C;  2HOD B;  2O01 H;  5AVY B;  2QJY B;  4Y28 J;  1NH4 A;  1H0T B;  5KLV K;  3P8C E;  2B87 B;  1SQV D;  3B71 A;  3EWK A;  3WUU A;  2Q3E A;  1KOR A;  3KPE A;  1JY3 P;  1Q82 Q;  2KOG A;  3HRN A;  5CCH A;  3I55 P;  1SQB K;  1P84 H;  3BCC E;  4LLH A;  1K05 A;  1HUC A;  3TYY A;  1VQ5 P;  3G3Z A;  2QJK B;  1H89 A;  4IFF A;  1SQV J;  2W6B A;  3KQG A;  3TGU J;  1EXI A;  4H44 D;  1SQQ J;  1FJK A;  1IFP A;  2SPZ A;  4WY4 B;  4Y99 B;  3H32 B;  1IFM A;  3AEE C;  1FZC C;  3RK2 D;  1VQ8 P;  3H1L E;  1QLE D;  1DX7 A;  2E74 D;  1X79 B;  1NKN A;  3C9I A;  2N9B A;  2P7J A;  5GTH E;  1VF5 D;  1JB0 J;  3CLQ A;  5H2F H;  3D70 A;  2N1T A;  1SQX D;  1YQ4 C;  1ZOY C;  4WVZ A;  1U7M A;  1N7S C;  3GHG C;  3H1J E;  2YNY A;  4JYC A;  1EDL A;  2QM7 A;  1GL2 D;  4Y99 C;  4H0L B;  1RE4 A;  4PV1 C;  1YJN P;  1KQG B;  1SP4 A;  3PHL A;  1PZQ A;  3VMA A;  1SQX K;  5CCG A;  1FZB A;  3A7O A;  4W7Z A;  4WY4 C;  1PP9 J;  2L91 A;  4TT3 H;  5AW6 B;  3VOP A;  4U3F D;  1S1C X;  3NTN A;  5AVW B;  1VQ6 P;  1OX3 A;  1QVG O;  1RF1 A;  2JWA A;  2YIU C;  1SQB E;  3L70 G;  5KAF H;  2WT7 A;  2QJY C;  3KZI H;  1NYH A;  1GTW A;  2E75 D;  2WPS A;  3T97 A;  2A45 G;  2JDI H;  4HH2 A;  4RJT A;  1SQB D;  3BCC D;  2IFM A;  1LTJ B;  2WIT A;  2Y0D A;  1LTB C;  2KSE A;  2OYO A;  2FFD A;  1URQ C;  1LNQ A;  1HWT C;  5DJU B;  1RF1 B;  1QL1 A;  2YIU B;  3BCC J;  2K9J A;  3BRV B;  1LWU C;  3E1I A;  4U7J A;  4LGD E;  3MUD C;  1JMB A;  1FDO A;  1SQP G;  1KMI Z;  2IBZ D;  2ZFC A;  3QH9 A;  4L75 A;  1T3U A;  1M1J B;  3L73 D;  2K1A A;  2C0X A;  4AYC A;  1E79 H;  4EIJ A;  3Q3D A;  1SQX E;  1OW7 A;  5BVZ A;  3CCJ P;  3CCL P;  2M3B A;  1L4A C;  1OXZ A;  2ZXX A;  3AE1 C;  3MP7 B;  1WRG A;  5APX A;  3MGN A;  3V5B A;  1HH0 A;  1URQ B;  2E5Y A;  2QM8 A;  5KLV J;  1RE3 C;  3FXD A;  3A0H E;  3PTZ A;  5TIS H;  2Q6Q A;  2XZR A;  4PJ0 E;  1GZL A;  2JEE A;  3HUS A;  4OH8 B;  3L74 D;  5APU A;  1BE3 D;  2HOD A;  4I6M C;  1ZP0 C;  1AQT A;  5KLV D;  1L0L J;  2A45 I;  4R4L A;  2FXM A;  2YO3 A;  2ZYD A;  1Y47 A;  3V2Q A;  3WUT A;  3D6Y A;  2HFE D;  1VF5 B;  3AEF C;  1BE3 E;  3TGU D;  1KB9 H;  3CD6 P;  1SFC B;  2FXO A;  1JEK A;  1NTK J;  2V4H A;  1ZXG A;  1RE3 A;  4QMA A;  3SWY A;  3KHU A;  3CX5 H;  1BCC G;  2CPS A;  3CX5 D;  3RK3 B;  3P8C D;  1USD A;  3TGU E;  1SQV E;  2FYU E;  3U59 A;  1YIJ P;  2E76 C;  2FYU J;  1S4X A;  2M8R A;  1RE4 C;  1QL2 A;  1X0T A;  3S9O A;  2O3J A;  3VTP C;  3CX5 E;  4H44 B;  5AW4 B;  1KN7 A;  2QSI A;  3AE7 C;  2H7H A;  1MKM A;  2FYU D;  2JR8 A;  2ZXE B;  3OA7 A;  5KLV G;  3HD7 B;  5GTI H;  2ZAE B;  1URQ A;  1KTM A;  5M1B A;  2RMZ A;  1PP9 D;  5APY A;  1NTZ D;  2OGU A;  1JTH B;  3CCQ P;  3I5C A;  1S9K D;  2C9N Y;  3CC7 P;  1NTM E;  1HF9 A;  1DEE G;  5B5E E;  3PH0 A;  2R5B A;  2H43 A;  1PPJ D;  4C7R A;  1PP9 G;  1FU1 A;  1WMK A;  4ZMD A;  1WT6 A;  2GUV A;  5KLV E;  2M3E A;  2NPS B;  2R5D A;  1J1E B;  2Z5H A;  3HD7 A;  3JCU H;  5CMZ A;  3UIA A;  3V4W A;  1S5L X;  1RQV A;  1H8A A;  2WVR A;  2YMY A;  1OZH A;  2E5T A;  3CXH I;  1OIP A;  3AE9 C;  2H88 C;  2OTK E;  2WPR A;  3AEG C;  2FYU G;  2LXB A;  1RHZ B; 
#chains in the Genus database with same CATH homology
 3V2R A;  3P32 A;  4C46 A;  2KYV A;  1LTJ A;  2W6A A;  1KQL A;  3H6P A;  4B86 A;  2FFD B;  3VN0 A;  1SQQ K;  2WZ7 A;  2H8P D;  4JF7 A;  4JYB A;  2FYZ A;  3PP5 A;  3R2P A;  1IO4 A;  3V2N A;  1LTI C;  1GL2 B;  4ZKP A;  1JY2 O;  2FFD C;  4W80 A;  4WB4 A;  3HUS B;  2OYI B;  2N1T B;  3O8Z A;  1T8Z A;  2P67 A;  1JCD A;  1HGV A;  4C7N B;  4GKG A;  1FJP A;  1N86 A;  2YKP A;  1CI6 A;  1A02 F;  1KZU B;  2C0W A;  2YKQ A;  1FZA A;  2KP8 A;  1M1J C;  3L35 A;  1FOS F;  1HGZ A;  3L36 A;  1JMM A;  5BU5 A;  2IX7 C;  3HD7 C;  2HYN A;  2Q5U A;  4EOT A;  1N7L A;  1PFI A;  1N2D C;  5APQ A;  1M7L A;  3U1A A;  1KFN A;  2KB7 P;  1KIL B;  2XDJ A;  1A02 J;  1MFZ A;  3N7N A;  4WBA A;  3V4Q A;  5KTB A;  1DH3 A;  5APS A;  1J1E C;  3RK2 C;  2PP6 A;  3IFM A;  5CJ0 A;  1NAF A;  1CI6 B;  1ZLL A;  3LW5 H;  4N6J A;  1HVV A;  2OYI C;  1JY3 O;  1RY3 A;  3HE5 A;  3M9Q A;  2VRS A;  1HJB A;  2YKO A;  1LT9 A;  1RF0 C;  2IFN A;  1FZG A;  1J1D C;  1NO4 A;  2N1T D;  1SFC D;  1IFN A;  1J2J B;  3IR9 A;  1JY2 P;  4LC1 A;  1NTZ K;  1X9V A;  3M06 A;  4AUW A;  1KIL D;  1URQ D;  2MJZ A;  2I1J A;  1SQV K;  5CHX A;  5AVR B;  1E5W A;  1N73 C;  3TNU A;  3RL0 C;  4KHX A;  1GD2 E;  2WSC H;  2HG5 D;  3BAT A;  1NTM K;  3P7K A;  2WTY A;  2R32 A;  1FBM A;  3HE5 B;  1DEB A;  5APT A;  1G2C B;  1LTG C;  1IFI A;  3NMD A;  5KJ7 D;  1L0L K;  2E42 A;  2XKM A;  1GW3 A;  4I2L C;  1GK6 A;  1LTJ C;  2Q7C A;  5AVS B;  1KIL A;  2FKW B;  2P1J A;  3TNU B;  2OYH A;  2LKM A;  1LGH B;  5AVQ B;  1X8Y A;  2W27 A;  1FZF A;  1MZ9 A;  5AW0 B;  1EQ7 A;  1JTH A;  3M0A A;  1YTZ I;  1SQP K;  1N7S D;  2WSE H;  4GIF A;  1IFJ A;  1JOC A;  4C7N A;  5CJ4 A;  2J58 A;  3WMM 0;  1AFO A;  3CL3 D;  2GM4 A;  4N3Y B;  1FOS E;  3RK3 C;  2XV5 A;  3BAS A;  3KDP B;  1ZR2 A;  3A3Y B;  1VDF A;  3HD7 D;  1LTS C;  1NOH A;  3MUD A;  3LID A;  4RES B;  1JY2 N;  3HTK A;  1AQ5 A;  1G1I A;  1L4A D;  1ZR4 A;  4AQR D;  4W7Y A;  4XA4 A;  1L4A A;  2IPP A;  1G2C A;  4DOJ A;  5AW1 B;  1LTA C;  1N73 A;  2OYH C;  2NPS D;  1J1D B;  3BRT B;  1NWQ A;  3B8E B;  5AVU B;  5KJ7 A;  2L5G B;  3M91 A;  2HPC A;  5AW3 B;  1IC2 A;  1FAV A;  4ZKU A;  1OWA A;  4M3L A;  5CCG D;  1H88 A;  1N73 B;  2OYH B;  5AVZ B;  3VP9 A;  2Q9I A;  3MIW A;  2I1K A;  1KFM A;  2N1T C;  3KYQ A;  1SFC C;  2HPC B;  5APV A;  1NKZ B;  2PAJ A;  3CI9 A;  1NU1 K;  3VMZ A;  4WY4 D;  3P8M C;  3U1C A;  3B5N C;  1L4A B;  1HBW A;  2J59 M;  1KIL C;  1IFD A;  1GK4 A;  5CCH D;  2JJL A;  5AVX B;  1SFC A;  5AW5 B;  3MTU E;  3VYI A;  2WT7 B;  4IFM A;  2XU6 A;  1XTC C;  3EFG A;  3LIE A;  1W2E A;  2O1J A;  4I1L A;  5APW A;  4O9B A;  5AW8 B;  3NFQ A;  2NPS C;  3II6 A;  1ZV8 A;  1YYC A;  4GT1 A;  1LT9 B;  3VMY A;  2WSF H;  2C9L Y;  4N78 E;  3NXS A;  4DZO A;  1XTG B;  1N7S A;  1VPC A;  1MUU A;  3GHG A;  3HE4 A;  4N78 D;  3A2A A;  2R3C A;  3HTK B;  3SWF A;  3V2P A;  3VP8 A;  1FZC B;  1CW5 A;  3L4F A;  3B5N A;  5AW7 B;  2POH A;  2A45 H;  3VMX A;  1T2K D;  3OAK A;  1IK9 A;  1L0N K;  1NTK K;  2OYI A;  2BAS A;  3N4X A;  1HTL C;  1LT9 C;  1LWU A;  1T3J A;  3RK2 B;  3TK1 A;  1GU5 A;  5KJ7 C;  1GDT A;  1G1J A;  1M1J A;  1NHL A;  2WWW A;  5AW2 B;  1SVF A;  2OAR A;  3OJA B;  2WPQ A;  3M9B A;  1FZE A;  2E43 A;  3A5T A;  1LWU B;  1RF1 C;  3HUS C;  4XE5 B;  1CSB A;  3L37 A;  2NPS A;  1IJD B;  5AW9 B;  2Q3I A;  1GW4 A;  5BU8 B;  3M9H A;  3BVH A;  1MV8 A;  5AVV B;  2O1K A;  2CPB A;  5AVT B;  1RF0 A;  2Z4E A;  1GL2 A;  1ZN5 A;  1YTZ T;  1T2K C;  1Z56 A;  3RL0 B;  1JO5 A;  2P2U A;  1FZC A;  5CCG C;  1JNM A;  1LTT C;  1FDM A;  1N7S B;  3GHG B;  3HE4 B;  2KSJ A;  1S9K E;  1GU4 A;  3RK3 D;  2XNX A;  3M0D A;  2Z5I A;  1GL2 C;  2GUS A;  1JUN A;  3RL0 D;  2FYU K;  1SLQ A;  4HYT B;  3H32 A;  1CZQ A;  3EQ2 A;  1JCC A;  4WY4 A;  3TSI A;  3B5N D;  2HLO A;  5CCH C;  3M0D C;  1JY3 N;  4IFD K;  2YO2 A;  2KLV A;  3MD0 A;  5AVY B;  2HOD B;  2O01 H;  1NH4 A;  5KLV K;  3P8C E;  3KPE A;  1JY3 P;  2KOG A;  3HRN A;  5CCH A;  1SQB K;  4LLH A;  3TYY A;  1H89 A;  1HUC A;  3G3Z A;  4IFF A;  2W6B A;  3KQG A;  1FJK A;  4Y99 B;  4WY4 B;  3H32 B;  1IFM A;  1FZC C;  3RK2 D;  1DX7 A;  1X79 B;  1NKN A;  3C9I A;  2N9B A;  2P7J A;  3CLQ A;  2N1T A;  1N7S C;  3GHG C;  2YNY A;  4JYC A;  2QM7 A;  1GL2 D;  4Y99 C;  1RE4 A;  5CCG A;  1SP4 A;  1SQX K;  1FZB A;  3A7O A;  4W7Z A;  4WY4 C;  3VOP A;  5AW6 B;  3NTN A;  5AVW B;  1RF1 A;  2WT7 A;  1GTW A;  2WPS A;  3T97 A;  2A45 G;  4HH2 A;  2IFM A;  1LTJ B;  2WIT A;  1LTB C;  2FFD A;  1URQ C;  1HWT C;  1RF1 B;  1QL1 A;  3BRV B;  1LWU C;  3E1I A;  4LGD E;  2ZFC A;  1T3U A;  1M1J B;  4AYC A;  4EIJ A;  2C0X A;  2M3B A;  1L4A C;  1OXZ A;  5APX A;  3V5B A;  5BVZ A;  1WRG A;  3MGN A;  1HH0 A;  1URQ B;  2QM8 A;  1RE3 C;  2XZR A;  1GZL A;  2JEE A;  3HUS A;  4OH8 B;  5APU A;  2HOD A;  4I6M C;  2A45 I;  3V2Q A;  2FXM A;  2YO3 A;  2HFE D;  1SFC B;  1RE3 A;  3SWY A;  2CPS A;  3RK3 B;  3P8C D;  3U59 A;  2M8R A;  1RE4 C;  1QL2 A;  3VTP C;  5AW4 B;  2H7H A;  3OA7 A;  2ZXE B;  3HD7 B;  1URQ A;  5APY A;  1JTH B;  3I5C A;  1S9K D;  2C9N Y;  2R5B A;  2H43 A;  4C7R A;  1FU1 A;  1WT6 A;  2GUV A;  2NPS B;  2R5D A;  1J1E B;  2Z5H A;  3HD7 A;  5CMZ A;  3UIA A;  3V4W A;  1H8A A;  2YMY A;  2WPR A;  3B5N B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...