3L37A

Pie12 d-peptide against hiv entry
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
molecule keywords GP41 N-PEPTIDE
total genus 20
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l37A00
4I6MC 4XE5B 3MD0A 2P7JA 2YO3A 1YYCA 3SWFA 5AVYB 1SP4A 2ZFCA 3IR9A 4RESB 1SLQA 4AQRD 1HJBA 1S9KD 1H88A 1GU5A 2BASA 2WT7A 4JYCA 3KQGA 3P32A 2XV5A 3VMYA 1GU4A 2WT7B 1J2JB 2W6AA 4C7NB 2N9BA 2WWWA 3NTNA 1MUUA 4HYTB 3LIEA 2Q5UA 3TNUA 3L36A 3UIAA 2R32A 1IO4A 5AW0B 2P67A 3M9BA 2WPQA 3HTKA 3NMDA 2WPSA 3A2AA 5APSA 1HWTC 3O8ZA 3NXSA 2Q3IA 1GK4A 5AW4B 5AW7B 1H89A 2R5DA 1FOSE 5AVUB 4AYCA 1JNMA 5APYA 2QM7A 2R3CA 1JUNA 1GZLA 5AVSB 1NAFA 5APUA 2XU6A 3A5TA 2YO2A 1OWAA 5APQA 3M0DA 3T97A 5AVTB 3V4WA 3VTPC 3P7KA 2WTYA 2YNYA 2JJLA 2Z5IA 3L37A 4JYBA 5AVRB 3L35A 3A3YB 5AW3B 5AW9B 2IPPA 1NWQA 4C7NA 2QM8A 4LC1A 1HBWA 3V4QA 3M06A 5AVXB 2C9NY 1CI6B 3M9HA 3KDPB 3VMXA 1FOSF 1OXZA 2E43A 5AW5B 5AW6B 3TNUB 2R5BA 5APXA 1CSBA 4I2LC 1X8YA 1MV8A 3MGNA 2WPRA 3B8EB 1GD2E 4M3LA 4EOTA 2C9LY 2E42A 2VRSA 5AW8B 1A02F 2H7HA 3M91A 4DZOA 3TK1A 1CZQA 5AW2B 3VN0A 3M0AA 1CI6A 4AUWA 5APWA 5CMZA 3I5CA 2XZRA 5AVZB 2P2UA 2KP8A 4KHXA 3V5BA 3NFQA 4GKGA 4C46A 1T2KC 1KQLA 5AVQB 1S9KE 3P8MC 3HE5B 2ZXEB 3HE4B 1FAVA 2Q7CA 4B86A 1A02J 3VMZA 1T2KD 5APVA 3VYIA 5APTA 3A7OA 1GTWA 4GT1A 3LIDA 2W27A 5AW1B 2Z5HA 3TYYA 1HUCA 1GK6A 1MFZA 1H8AA 5AVWB 5AVVB 3HE4A 3HE5A 3OAKA 1DH3A 1G2CB
chains in the Genus database with same CATH superfamily
3FX0A 1LT1A 2FYUG 3U59A 1SQVK 1RQVA 2P7JA 2YO3A 3HD7D 4I7ZC 3L70D 1L0LE 1X79B 2ZFCA 1LWUA 1JY2N 2ZT9D 1E79H 3CI9A 4WY4A 3B4SA 3L74E 3AE9C 4TLFA 1J1EB 1HJBA 1NTMJ 3BCCG 1L0ND 3FXEA 3KQGA 3A0HH 3L74J 1KQFB 2B9BA 2P10A 2XV5A 2Y9YA 1NVOA 2WITA 3LW5J 2WT7B 2K1AA 3ZDMA 2KSEA 3AE2C 3MP7B 2D2CC 1VQ5P 3Q5RA 1BDCA 1YTZT 1KV4A 2IYOA 1NTMG 3BCCJ 2IBZG 2P58A 2C0XA 2O01J 1JCCA 4PD4H 4L74A 3CXHI 5H2FE 2JDIH 1EZVI 3CCSP 2J5UA 2ZYGA 3MIWA 1PIXA 3SWKA 2M3EA 1BE3E 2BCCJ 2WPQA 3JCUH 3KZIE 3NMDA 2B87A 1IK7A 2NPSA 4GIFA 1HWTC 1SQXE 5GTHH 5CCHA 1KZUB 1ZRTD 4GOEA 2E75C 1HJ0A 3L72G 4YPCA 5AVUB 5AW4B 4AYCA 1W2BO 1H89A 2J58A 1FOSE 2A06G 1FZEA 3GHGC 3JSVC 2Z4EA 1N2DC 1JUNA 2GUSA 5AVSB 1NAFA 2XU6A 3H1ID 4NPDA 4Y99C 1M90Q 1BGYE 1PFIA 3AEBC 3L72J 2QJYC 4Y28J 2KYVA 3FWNA 1BSHA 3T97A 3RK3C 3V4WA 3VTPC 1KILE 2FYNB 2KUBA 5KLVE 3P7KA 2OYHB 3H1LG 3II6A 5EFWB 1IK9A 1LTGC 1S1CX 2Z5IA 4YXWH 1L0NE 1S4XA 2YIUB 3L35A 4JF7A 1UIXA 1VQ9P 2OGUA 3F89A 3KHUA 3CD6P 5AW3B 3P8CD 4TT3H 1IZNB 3O6QA 2N1TA 4C7NA 3RK3D 1NWQA 5KLVD 1IJDB 2QM8A 3H1LJ 1PP9J 3C9IA 4W7YA 5CJ0A 2QJKB 1SQPG 2RMZA 1BGYG 2C0WA 3AE3C 1X0TA 2QE7H 1N7SD 4R4LA 1SQBJ 3G9RA 2C9NY 2PGDA 2OTLP 2KOGA 2GUVA 2WSFH 2XKMA 2Y0DA 1PP9G 3VP8A 1DEEG 1NU1G 5CCGA 1MKMA 1BSNA 1W2EA 4PD4E 1NTKK 3TNUB 4H0LC 4JQ0D 4I1LA 1SQQK 1LP1A 4UB8E 1ZW0A 1SQBG 2YMYA 3L73J 2WPRA 3PLNA 4WWIA 3G3ZA 2O01H 3F5HA 3B5ND 3M9QA 2QJYB 2WSFJ 3GMAA 4M3LA 1SQQE 4EOTA 2E42A 1OFCX 2VRSA 3ABVC 3AE6C 3H1JG 1NTME 2FFDA 3M91A 2E76D 2N1TB 2ZVNB 3M0AA 2KNCB 4D6TJ 1NKNA 3BRVB 4W7ZA 5CMZA 1PGPA 3G6EP 1QLED 4WY4B 5AVZB 2JP3A 2P2UA 1IFIA 1LGHB 1M1JA 1NTKJ 1UIIA 2XDJA 3C1LA 3NFQA 1RHZB 1JCDA 3TF5A 1G2CA 1TU3F 2E76C 1JB0J 3L74G 2W6JH 3AEFC 1KQLA 1J1DC 3B5NA 1RF1B 3PJSK 1YI2P 1PPJE 3P8MC 1HF9A 3HE4B 2ZXEB 3MUDC 1KYOH 2FYUE 2KZJA 2ZAEB 4UB6H 2OTKE 4B86A 1BDDA 1ZN5A 5CCGD 1ZRTE 1KTMA 4DOJA 3VMZA 1JY2P 4ZKPA 2O01N 1JOCA 2WSEJ 2RKLA 1FZCA 2B87B 2NPSB 2YKOA 1XTGB 3CCQP 1FZAA 1GK6A 1PZQA 4ZNCA 2PRRA 4OGQD 3CWBG 4IFMA 1KD1Q 1L0NJ 2MKVA 4IL6H 4EIJA 4RJTA 1WMKA 1N7SC 1BCCJ 1KILB 2IBZI 1L0LK 1LTTC 4U3FJ 1G2CB 5KJ7D 1QGKB 3GHGB 1MFTA 4XE5B 2GM4A 2Q6QA 4GOFA 3WUUA 2FYUD 4N6JA 4EDFA 3H32B 3OW2O 1K04A 3G4SP 1BE3D 3EQ2A 1KB9E 2E5TA 2QRXA 1OX3A 3IR9A 3LW5H 4H0LD 4HB1A 5CJ4A 1EDKA 1SQVG 1L0NK 1VL2A 1KYOI 2Y0EA 2KNCA 4AQRD 3WU2H 5KJ7C 1GU5A 1M56D 3OA7A 3IFMA 3H32A 3P32A 1EDJA 2Y0CA 1Q2NA 1NTZD 1URQA 3M0DC 1KC8Q 2ZT9C 4C7NB 1RF0C 1SQVJ 1RE4A 1QVFO 2FYUJ 1SQPJ 2I8DA 2K9JA 3CMAP 1BE3J 1L4AA 2BCCE 1OIPA 3CCJP 3AEGC 1LT9B 2B88A 2Q5UA 4NPEA 4PJ0H 3TNUA 2IBZD 2R32A 3H1HJ 1IO4A 2OYHA 2OYIB 2KIKA 3M9BA 3SSUA 1S72P 2WPSA 3A2AA 5KAIH 3O8ZA 4N78D 3NXSA 5E79H 1NJIQ 4IFDK 2Q3IA 1AFOA 5GTHE 4K3AA 1SFCC 2WPVB 1USDA 3TGUE 1KQGB 1G1JA 1URQD 2E43A 1KQSO 2BEQD 3AEDC 1E5WA 1OVRA 2AXTE 3KPEA 1ZR2A 4HH2A 3BVHA 2QJPC 1L4AC 3AE8C 2LXCB 3H1IG 5KKZB 2E75D 1YJWP 2YO2A 1JTHB 2OQQA 4LLHA 2BCCG 3H1KG 3M0DA 4WBAA 5APQA 5AVTB 4Z1MH 1RF1A 1CW5A 1OVUA 2WSCJ 2JJLA 1SQBD 4DJGA 1SS1A 2FXPA 2DW3A 3QWOC 5AVRB 5KJ7A 2QA4P 1FZFA 1IC2A 1ZV8A 2RH0A 4RO0A 1NO4A 1RY3A 1SQQD 3A3YB 5BVZA 3V2RA 3SFEC 4PV1B 4KT0J 2ZVOB 3EFGA 1JO5A 3H1IE 2E76B 1GW4A 3I56P 1VF5D 1U7MA 3FXDA 1RF1C 3M06A 2NZ2A 1LTJB 1BGYD 4R4MA 1X22A 1U7JA 3KDPB 1SFCB 1FC2C 1LJ2A 3M9HA 2AXTH 1LTBC 4IL6E 3TGUG 3VMXA 4BRYA 1GW3A 3GF3A 5AW5B 1FBMA 5AW6B 1YITP 1JEKA 1SQPE 1Y47A 3FGAD 4ASWA 1SFCA 4I2LC 5E79E 3CCLP 3C8VA 3V2PA 3L4FA 3H6PA 2M0BA 1BGYJ 2CPBA 3SWYA 1N7LA 2YKQA 1NH4A 3V6IA 1DD4A 2FKWB 1OMIA 5GTIH 2OYHC 1IFNA 1ZOYC 2B89A 3MUDA 1FE6A 2I1KA 2ZJSE 4AUWA 1N86A 2M5AB 3HUSB 4XA4A 3B5NC 3V2QA 1RE4C 1YHQP 2KP8A 1RF0A 3V5BA 2FXOA 4D6TE 1URQC 5KTBA 2K37A 2SPZA 3Q1MA 1M1JC 3PH0A 1HH0A 1FS0E 2A45H 1AV1A 1T2KC 1VQPP 1L4AD 1SQXK 3BRTB 2ZYDA 1EQ7A 5AVQB 4ASVA 1S9KE 1Q81Q 3S1KA 3CC2P 3HE5B 1FAVA 2JEEA 1ZP0C 2KZIA 2UWJE 2Q7CA 2E74C 3VMAA 3L70G 4D6TD 3E7KA 2BEZF 1MZ9A 3CL3D 4U3FD 1T2KD 3CC4P 1KN7A 1EDIA 3L75E 3N4XA 1N7SA 3A7OA 1LTIC 3WUVA 5B5EH 3USSA 1FDMA 3L70J 3CC7P 1DD3A 3TSIA 1PGOA 2QG4A 4ZMDA 1HGVA 2FFDB 3CXHH 1Q7YQ 1GDTA 5AVVB 3HE4A 1NTZK 1NU1E 1FZCC 1FZGA 1T3UA 3WMM0 3MTUE 4O9BA 4I6MC 3QH9A 1NKZB 3MD0A 2M8RA 1S5LX 1M1JB 4JBZA 1L0LG 1SQXD 1S3JA 4RESB 2N9YB 2HLOA 3CX5E 1LNQA 1SLQA 2FYUK 1ZXGA 2AEJA 2KI7B 1R5SA 2V7QH 3A0BH 3CXHE 1FU1A 4N78E 1YIJP 1EZVE 1S9KD 1H88A 2BASA 2WT7A 4JYCA 1VQ8P 2KXPB 1K73Q 2H88C 2KLVA 5BU5A 4L75A 1BCCD 1L0NG 2QSIA 3AE5C 3VMYA 1GU4A 1BCCG 2W6AA 2H8PD 2YIUC 4OGQB 2OYOA 2HR3A 3A0HE 1M7LA 1LP1B 1Y8AA 3L75D 1KILD 5H2FH 2Q1KA 3L36A 3UIAA 1JY3N 1NTKE 5AW0B 2P67A 4KJMA 2FFDC 1T3JA 2W6BA 1SQBE 1YJ9P 2P1JA 5APSA 2HPCB 1DEBA 3L70E 2O3JA 2WQYC 1JY3P 2CK3H 1PP9E 1SQVD 3L72E 1JNMA 4PV1D 1SQPD 2E74D 1FZBA 1K05A 3L75J 2QM7A 5APYA 4I7ZB 5CCGC 1PV3A 1GZLA 1N8RQ 1VF5B 3H1HD 3RBZA 4HJGH 3RK2D 3H1HG 1P84H 2BCCD 3AEEC 3W67A 1SFCD 1PP9D 3MZWB 1QVGO 3GG2A 1VQLP 3L71G 3P8CE 1W5CE 3IAOA 4MN4C 3L71D 3H1KD 2WTYA 2WVRA 1VQ7P 1BCCE 2AXCA 1P84I 1VPCA 1M57D 2N1TC 3CMEP 2POHA 5C39A 3D71A 2K9JB 3IN6A 2YXQB 2AEMA 3AE7C 3E1IA 4WY4C 3WUTA 5KLVG 2IPPA 2H43A 1DIPA 2JKVA 1OW6A 2O1JA 2XNXA 1USEA 3L71E 1URQB 1YBKA 3L73D 2A06D 4PD4D 1IFMA 2V7QJ 4H13C 3L73G 1VQNP 3V4QA 3OJAB 2IDBA 3HUSA 2YKPA 1CI6B 2E75B 1FJKA 1SQPK 1NAYA 3HTKB 1LWUB 1NU1D 1OXZA 1KB9I 3H1JJ 3PTZA 4IFFA 1SQBK 2LKMA 1SQQJ 4RKUJ 3HRNA 1GL2C 3GHGA 1AQTA 2LXBA 1VF5C 4GODA 1Z56A 4H13D 2QEXP 1L4AB 5APXA 1CSBA 2FXMA 1X8YA 4Y99B 5CBOA 3H25A 1NU1K 3U1AA 1QL2A 1T6AA 4BXLA 5CCHC 3JCUE 1FDIA 1N73A 1NTKG 1EXJA 1HVVA 2NPSC 2K88A 1SQQG 2KK7A 3CCMP 3CCEP 2FYNC 1HGZA 2H7HA 1XTCC 2IFNA 2AEFA 3Q5SA 3G71P 1NYHA 2R44A 1CZQA 5AW2B 3GLMA 3WU2E 2D2CD 1M1KQ 3TGUJ 3A0BE 4PD4I 4QMAA 3RL0D 1L0LJ 1S5LH 3H1KE 5CCHD 1PPJD 2PFXA 4IOIH 5KLIC 1M8OB 2A45G 1U57A 4PV1C 2W8ZA 4CPGA 1WT6A 1RQUA 4H44D 4DCKA 2PP6A 1GMJA 2QVAA 4DT0A 1QEXA 5DJUB 3KYQA 3L73E 3KZIH 4GDOA 1LTJC 2WSCH 1L2PA 2KS1B 4JPZB 4D6TG 1KB9H 1OVVA 4A7PA 2Q9IA 1EXIA 2OTJP 1DX7A 1LWUC 2CPSA 5K5GB 1OW7A 1PGJA 2W90A 3HD7B 2XNDH 4H44C 4OH8B 2YXRB 2LR2A 1KORA 3S9OA 1JY2O 1A02J 3CWBJ 1JTHA 1RE3A 2ZT9B 3VYIA 1KYOD 3FWLA 1PGQA 1YQ3C 4U3FG 2K9YA 1AVYA 2PAJA 1S5LE 2RN0A 2R3SA 3GW6A 2HYNA 2Q3EA 1LT9C 4GT1A 5AW1B 4OVNF 1NTZE 1WRGA 2Z5HA 4K35A 5CBNA 1ZMEC 3TYYA 1KFNA 3HD7A 3PHLA 1YTZI 2HFED 5CHXA 3CPWO 2ITAA 2I1JA 3N7NA 5AVWB 3L75G 1H8AA 3HE5A 3AECC 3Q3DA 1VQMP 2L5GB 1OW8A 1EC5A 3CWBD 3OAKA 3I55P 1YJNP 1DH3A 2NRGA 2WSSH 3Q2YA 5TJHA 5KAFH 2KSJA 1YYCA 4UB6E 1GL2D 5AVYB 1D7MA 3SWFA 1SP4A 2QJPB 3PRJA 1BE3G 3V2NA 4L73A 3U1CA 5M1BA 3RL0g 3EWKA 2E74B 1NHLA 5GTIE 1IFJA 2IBZE 1NTMK 1J2JB 4N3YB 5DJTB 4EI2A 2N9BA 3RK2B 1FDOA 2WWWA 2YMKA 3NTNA 4W80A 2M3BA 4UB8H 3AE4C 1MUUA 4HYTB 1N73B 1LTAC 2JWDA 3R2PA 3D6YA 3LIEA 1JM0A 1KFMA 1VQ4P 1KYOE 1IFPA 1ZR4A 1EZVG 1JMMA 1ZLLA 2IZ0A 3MHVA 2QJKC 2Y9ZA 3CCVP 3HTKA 2JR8A 1KILA 1VQOP 5B66H 1NTZJ 3K5BA 1GK4A 3VP9A 1KB9D 1KILC 2E5YA 5AW7B 3H1KJ 2R5DA 3CCRP 1VQ6P 2WMMA 1Q86Q 1K9MQ 2JWAA 3BCCD 2R3CA 3CX5H 3EFFK 5APUA 3A5TA 1NOHA 1GD2E 2HODB 1J1EC 1X9VA 3AE1C 1KMIZ 1R8EA 1H0TA 1Q90D 1OWAA 2ZYAA 5KAIE 2G8YA 1JY3O 4IL6X 4WB4A 2OYIA 1LTSC 2YNYA 1T8ZA 3T97B 2L91A 1AJYA 3L37A 4JYBA 4U7JA 1H0TB 3RK2C 4L76A 1NU1J 4PJ0E 2GA1A 2J59M 3TDKA 1PL5A 3PP5A 3B5NB 3H1IJ 4HKZH 5AW9B 2W83C 1HTLC 5KLIB 1AA0A 1SQVE 3L72D 2KLUA 4C7RA 2IYPA 4LC1A 4WVZA 2OYIC 1AQ5A 1HBWA 3CLQA 5KKZC 5KLVK 2N1TD 3L71J 1SVFA 1J1DB 5AVXB 3RL0B 2M5AA 1EDLA 2FYZA 1FOSF 2G3AA 3GF7A 3CX5I 5BU8B 3HD7C 4H44B 2FY8A 3CWBE 3TGUD 3D6ZA 1RH5B 2IZ1A 4YTPC 3E1RA 1VQKP 3ITKA 1LT9A 2R5BA 3BATA 1QX8A 4BRYB 5KLVJ 4EYYQ 1G1IA 2KB7P 3H1LD 3D70A 1MV8A 1VDFA 1NTKD 3B8EB 3BASA 1QL1A 2ZXXA 3MGNA 5L8RJ 5TISE 5B66E 1RE3C 2C9LY 3RK3E 3RBXA 3RK3B 1JMBA 5AW8B 1A02F 2FBWC 3H1JD 4DZOA 4OWFA 3TK1A 3VN0A 2V4HA 1Y9BA 1CI6A 3H1LE 1FZCB 5B5EE 5APWA 1LTJA 2MJZA 3I5CA 1P84D 1N7SB 2IX7C 2XZRA 3Q5PA 2NPSD 4KHXA 1PPJG 2JO1A 1OZHA 1YQ4C 2H89C 3H1HE 4GKGA 4YXDC 2HG5D 3CX5D 3O6QB 4C46A 4H13B 3R4YA 3RL0C 2A06E 2KS1A 3CCUP 1FJPA 3VOPA 5KAFE 1NGMB 1L0LD 1S2EA 1SQXG 2A45I 2QIWA 3KXDA 1GL2B 4LGDE 3IF4A 3JC22 2O1KA 4H0LB 4XFJA 3AEAC 5APVA 2D2CB 4OGQC 2HODA 3H1JE 5APTA 1N73C 1Q82Q 3W68A 1GTWA 4BWNA 3LIDA 2W27A 4WY4D 3RGUA 2IFMA 1SQXJ 1NTZG 1P84E 1GL2A 2WSEH 3B71A 1R5LA 1HUCA 3S4RA 5TISH 1K8AQ 1MFZA 2K3RA 4U3FE 4ZKUA 1NTMD 1AVOA 1IFDA 3HUSC 3L74D 4NPFX 2WZ7A 3SFDC 3CXHD 2HPCA 3BCCE 1EZVD 2OARA
chains in the Genus database with same CATH topology
3U59A 1SQVK 3HD7D 2P7JA 2YO3A 1X79B 2ZFCA 1LWUA 1JY2N 3CI9A 4WY4A 4Y99B 1J1EB 1HJBA 3KQGA 2XV5A 2WITA 2WT7B 1YTZT 2C0XA 1JCCA 2WPQA 3NMDA 4GIFA 2NPSA 1HWTC 5CCHA 1KZUB 5AW4B 1H89A 1FOSE 5AVUB 4AYCA 2J58A 1FZEA 3GHGC 2Z4EA 1N2DC 1JUNA 2GUSA 5AVSB 1NAFA 2XU6A 4Y99C 1PFIA 2KYVA 3T97A 3RK3C 3V4WA 3VTPC 3P7KA 2OYHB 3II6A 1IK9A 1LTGC 2Z5IA 3L35A 4JF7A 5AW3B 3P8CD 2N1TA 4C7NA 3RK3D 1NWQA 1IJDB 2QM8A 3C9IA 4W7YA 5CJ0A 2C0WA 2C9NY 1N7SD 2KOGA 2GUVA 2WSFH 2XKMA 3VP8A 5CCGA 1W2EA 1NTKK 3TNUB 4I1LA 1SQQK 2YMYA 2WPRA 1GD2E 3G3ZA 2O01H 3M9QA 3B5ND 4M3LA 4EOTA 2E42A 2VRSA 2FFDA 3M91A 2N1TB 3M0AA 1NKNA 3BRVB 4W7ZA 5CMZA 4WY4B 5AVZB 2P2UA 1IFIA 1LGHB 1M1JA 2XDJA 3NFQA 1JCDA 1G2CA 1RF1B 1KQLA 1J1DC 3B5NA 3P8MC 3HE4B 2ZXEB 4B86A 1ZN5A 5CCGD 4DOJA 3VMZA 1JY2P 4ZKPA 1JOCA 1FZCA 2NPSB 2YKOA 1XTGB 1FZAA 1GK6A 4IFMA 4EIJA 1N7SC 1KILB 5KJ7D 1L0LK 1LTTC 1G2CB 4XE5B 3GHGB 2GM4A 1CW5A 4N6JA 3H32B 3EQ2A 3IR9A 3LW5H 5CJ4A 4AQRD 1L0NK 5KJ7C 1GU5A 3OA7A 3IFMA 3H32A 3P32A 3M0DC 1URQA 4C7NB 1RF0C 1RE4A 1L4AA 1LT9B 2Q5UA 3TNUA 2R32A 1IO4A 2OYHA 2OYIB 3M9BA 2WPSA 3A2AA 3O8ZA 4N78D 3NXSA 4IFDK 1AFOA 2Q3IA 1SFCC 1URQD 1G1JA 1ZR2A 1E5WA 4HH2A 3BVHA 1L4AC 2YO2A 1JTHB 4LLHA 4WBAA 3M0DA 5APQA 5AVTB 1RF1A 2JJLA 5AVRB 5KJ7A 1FZFA 1IC2A 1ZV8A 1NO4A 1RY3A 3A3YB 5BVZA 3V2RA 3EFGA 1JO5A 1GW4A 1RF1C 3M06A 1LTJB 3M9HA 3KDPB 1SFCB 3VMXA 1LTBC 1GW3A 5AW5B 1FBMA 5AW6B 1SFCA 4I2LC 3V2PA 3L4FA 3H6PA 2CPBA 3SWYA 1N7LA 2YKQA 1NH4A 2OYHC 2FKWB 1IFNA 4AUWA 3MUDA 2I1KA 1N86A 3HUSB 4XA4A 3B5NC 1RE4C 2KP8A 1RF0A 3V5BA 1URQC 5KTBA 1M1JC 1HH0A 2A45H 1T2KC 1L4AD 1SQXK 3BRTB 5AVQB 1EQ7A 1S9KE 3HE5B 1FAVA 2JEEA 2Q7CA 1MZ9A 3CL3D 1T2KD 3N4XA 1N7SA 3A7OA 1LTIC 1FDMA 3TSIA 1HGVA 2FFDB 1GDTA 5AVVB 3HE4A 1NTZK 1FZCC 1FZGA 1T3UA 3WMM0 3MTUE 4O9BA 4I6MC 1NKZB 3MD0A 2M8RA 1M1JB 4RESB 2HLOA 3KPEA 1SLQA 2FYUK 3MIWA 1DX7A 4N78E 1FU1A 1S9KD 1H88A 2BASA 2WT7A 4JYCA 5BU5A 2KLVA 3VMYA 1GU4A 2W6AA 2H8PD 1M7LA 1KILD 3L36A 3UIAA 1JY3N 5AW0B 2P67A 2FFDC 1T3JA 2W6BA 2P1JA 5APSA 2HPCB 1DEBA 1JY3P 1JNMA 1FZBA 5APYA 2QM7A 5CCGC 1GZLA 3RK2D 1SFCD 3P8CE 2WTYA 1VPCA 2N1TC 2POHA 3E1IA 4WY4C 2H43A 2IPPA 2O1JA 2XNXA 1URQB 1IFMA 3V4QA 3OJAB 3HUSA 2YKPA 1CI6B 1FJKA 1SQPK 3HTKB 1LWUB 1OXZA 4IFFA 1SQBK 2LKMA 3HRNA 1GL2C 3GHGA 1Z56A 1L4AB 5APXA 1CSBA 2FXMA 1X8YA 1N73A 1NU1K 3U1AA 1QL2A 5CCHC 1HVVA 2NPSC 1HGZA 2H7HA 1XTCC 2IFNA 1CZQA 5AW2B 5CCHD 3RL0D 2A45G 1WT6A 2PP6A 3KYQA 1LTJC 2WSCH 2Q9IA 1LWUC 2CPSA 3HD7B 4OH8B 1A02J 1JY2O 1JTHA 1RE3A 3VYIA 2PAJA 4GT1A 2HYNA 3V2QA 1LT9C 5AW1B 1WRGA 2Z5HA 3TYYA 1KFNA 3HD7A 1YTZI 2HFED 5CHXA 3N7NA 2I1JA 1H8AA 5AVWB 3HE5A 2L5GB 3OAKA 1DH3A 3SWFA 2KSJA 1YYCA 1GL2D 5AVYB 1SP4A 3V2NA 3U1CA 1NHLA 1IFJA 1NTMK 1J2JB 4N3YB 2N9BA 3RK2B 2WWWA 3NTNA 4W80A 1N73B 2M3BA 1MUUA 4HYTB 1LTAC 3R2PA 3LIEA 1KFMA 1ZR4A 1JMMA 1ZLLA 3HTKA 1KILA 1GK4A 3VP9A 1KILC 5AW7B 2R5DA 2R3CA 5APUA 3A5TA 1NOHA 2HODB 1J1EC 1X9VA 1OWAA 1JY3O 4WB4A 2OYIA 1LTSC 2YNYA 1T8ZA 3L37A 4JYBA 3RK2C 2J59M 3PP5A 3B5NB 5AW9B 1HTLC 4C7RA 4LC1A 2OYIC 1AQ5A 1HBWA 3CLQA 5KLVK 2N1TD 1SVFA 1J1DB 5AVXB 3RL0B 2FYZA 1FOSF 5BU8B 3HD7C 2E43A 1LT9A 2R5BA 3BATA 1G1IA 2KB7P 3MGNA 1MV8A 1VDFA 3B8EB 3BASA 1QL1A 2C9LY 1RE3C 3RK3B 5AW8B 1A02F 4DZOA 3TK1A 3VN0A 1CI6A 1FZCB 5APWA 1LTJA 2MJZA 3I5CA 2XZRA 1N7SB 2IX7C 2NPSD 4KHXA 4GKGA 2HG5D 4C46A 3RL0C 1FJPA 3VOPA 2A45I 1GL2B 4LGDE 2O1KA 5APVA 2HODA 5APTA 1N73C 1GTWA 3LIDA 2W27A 4WY4D 2IFMA 2WSEH 1GL2A 1HUCA 1MFZA 4ZKUA 1IFDA 3HUSC 2WZ7A 2HPCA 2OARA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4I6M C;  4XE5 B;  3MD0 A;  2P7J A;  2YO3 A;  1YYC A;  3SWF A;  5AVY B;  1SP4 A;  2ZFC A;  3IR9 A;  4RES B;  1SLQ A;  4AQR D;  1HJB A;  1S9K D;  1H88 A;  1GU5 A;  2BAS A;  2WT7 A;  4JYC A;  3KQG A;  3P32 A;  2XV5 A;  3VMY A;  1GU4 A;  2WT7 B;  1J2J B;  2W6A A;  4C7N B;  2N9B A;  2WWW A;  3NTN A;  1MUU A;  4HYT B;  3LIE A;  2Q5U A;  3TNU A;  3L36 A;  3UIA A;  2R32 A;  1IO4 A;  5AW0 B;  2P67 A;  3M9B A;  2WPQ A;  3HTK A;  3NMD A;  2WPS A;  3A2A A;  5APS A;  1HWT C;  3O8Z A;  3NXS A;  2Q3I A;  1GK4 A;  5AW4 B;  5AW7 B;  1H89 A;  2R5D A;  1FOS E;  5AVU B;  4AYC A;  1JNM A;  5APY A;  2QM7 A;  2R3C A;  1JUN A;  1GZL A;  5AVS B;  1NAF A;  5APU A;  2XU6 A;  3A5T A;  2YO2 A;  1OWA A;  5APQ A;  3M0D A;  3T97 A;  5AVT B;  3V4W A;  3VTP C;  3P7K A;  2WTY A;  2YNY A;  2JJL A;  2Z5I A;  3L37 A;  4JYB A;  5AVR B;  3L35 A;  3A3Y B;  5AW3 B;  5AW9 B;  2IPP A;  1NWQ A;  4C7N A;  2QM8 A;  4LC1 A;  1HBW A;  3V4Q A;  3M06 A;  5AVX B;  2C9N Y;  1CI6 B;  3M9H A;  3KDP B;  3VMX A;  1FOS F;  1OXZ A;  2E43 A;  5AW5 B;  5AW6 B;  3TNU B;  2R5B A;  5APX A;  1CSB A;  4I2L C;  1X8Y A;  1MV8 A;  3MGN A;  2WPR A;  3B8E B;  1GD2 E;  4M3L A;  4EOT A;  2C9L Y;  2E42 A;  2VRS A;  5AW8 B;  1A02 F;  2H7H A;  3M91 A;  4DZO A;  3TK1 A;  1CZQ A;  5AW2 B;  3VN0 A;  3M0A A;  1CI6 A;  4AUW A;  5APW A;  5CMZ A;  3I5C A;  2XZR A;  5AVZ B;  2P2U A;  2KP8 A;  4KHX A;  3V5B A;  3NFQ A;  4GKG A;  4C46 A;  1T2K C;  1KQL A;  5AVQ B;  1S9K E;  3P8M C;  3HE5 B;  2ZXE B;  3HE4 B;  1FAV A;  2Q7C A;  4B86 A;  1A02 J;  3VMZ A;  1T2K D;  5APV A;  3VYI A;  5APT A;  3A7O A;  1GTW A;  4GT1 A;  3LID A;  2W27 A;  5AW1 B;  2Z5H A;  3TYY A;  1HUC A;  1GK6 A;  1MFZ A;  1H8A A;  5AVW B;  5AVV B;  3HE4 A;  3HE5 A;  3OAK A;  1DH3 A;  1G2C B; 
#chains in the Genus database with same CATH topology
 3FX0 A;  1LT1 A;  2FYU G;  3U59 A;  1SQV K;  1RQV A;  2P7J A;  2YO3 A;  3HD7 D;  4I7Z C;  3L70 D;  1L0L E;  1X79 B;  2ZFC A;  1LWU A;  1JY2 N;  2ZT9 D;  1E79 H;  3CI9 A;  4WY4 A;  3B4S A;  3L74 E;  3AE9 C;  4TLF A;  1J1E B;  1HJB A;  1NTM J;  3BCC G;  1L0N D;  3FXE A;  3KQG A;  3A0H H;  3L74 J;  1KQF B;  2B9B A;  2P10 A;  2XV5 A;  2Y9Y A;  1NVO A;  2WIT A;  3LW5 J;  2WT7 B;  2K1A A;  3ZDM A;  2KSE A;  3AE2 C;  3MP7 B;  2D2C C;  1VQ5 P;  3Q5R A;  1BDC A;  1YTZ T;  1KV4 A;  2IYO A;  1NTM G;  3BCC J;  2IBZ G;  2P58 A;  2C0X A;  2O01 J;  1JCC A;  4PD4 H;  4L74 A;  3CXH I;  5H2F E;  2JDI H;  1EZV I;  3CCS P;  2J5U A;  2ZYG A;  3MIW A;  1PIX A;  3SWK A;  2M3E A;  1BE3 E;  2BCC J;  2WPQ A;  3JCU H;  3KZI E;  3NMD A;  2B87 A;  1IK7 A;  2NPS A;  4GIF A;  1HWT C;  1SQX E;  5GTH H;  5CCH A;  1KZU B;  1ZRT D;  4GOE A;  2E75 C;  1HJ0 A;  3L72 G;  4YPC A;  5AVU B;  5AW4 B;  4AYC A;  1W2B O;  1H89 A;  2J58 A;  1FOS E;  2A06 G;  1FZE A;  3GHG C;  3JSV C;  2Z4E A;  1N2D C;  1JUN A;  2GUS A;  5AVS B;  1NAF A;  2XU6 A;  3H1I D;  4NPD A;  4Y99 C;  1M90 Q;  1BGY E;  1PFI A;  3AEB C;  3L72 J;  2QJY C;  4Y28 J;  2KYV A;  3FWN A;  1BSH A;  3T97 A;  3RK3 C;  3V4W A;  3VTP C;  1KIL E;  2FYN B;  2KUB A;  5KLV E;  3P7K A;  2OYH B;  3H1L G;  3II6 A;  5EFW B;  1IK9 A;  1LTG C;  1S1C X;  2Z5I A;  4YXW H;  1L0N E;  1S4X A;  2YIU B;  3L35 A;  4JF7 A;  1UIX A;  1VQ9 P;  2OGU A;  3F89 A;  3KHU A;  3CD6 P;  5AW3 B;  3P8C D;  4TT3 H;  1IZN B;  3O6Q A;  2N1T A;  4C7N A;  3RK3 D;  1NWQ A;  5KLV D;  1IJD B;  2QM8 A;  3H1L J;  1PP9 J;  3C9I A;  4W7Y A;  5CJ0 A;  2QJK B;  1SQP G;  2RMZ A;  1BGY G;  2C0W A;  3AE3 C;  1X0T A;  2QE7 H;  1N7S D;  4R4L A;  1SQB J;  3G9R A;  2C9N Y;  2PGD A;  2OTL P;  2KOG A;  2GUV A;  2WSF H;  2XKM A;  2Y0D A;  1PP9 G;  3VP8 A;  1DEE G;  1NU1 G;  5CCG A;  1MKM A;  1BSN A;  1W2E A;  4PD4 E;  1NTK K;  3TNU B;  4H0L C;  4JQ0 D;  4I1L A;  1SQQ K;  1LP1 A;  4UB8 E;  1ZW0 A;  1SQB G;  2YMY A;  3L73 J;  2WPR A;  3PLN A;  4WWI A;  3G3Z A;  2O01 H;  3F5H A;  3B5N D;  3M9Q A;  2QJY B;  2WSF J;  3GMA A;  4M3L A;  1SQQ E;  4EOT A;  2E42 A;  1OFC X;  2VRS A;  3ABV C;  3AE6 C;  3H1J G;  1NTM E;  2FFD A;  3M91 A;  2E76 D;  2N1T B;  2ZVN B;  3M0A A;  2KNC B;  4D6T J;  1NKN A;  3BRV B;  4W7Z A;  5CMZ A;  1PGP A;  3G6E P;  1QLE D;  4WY4 B;  5AVZ B;  2JP3 A;  2P2U A;  1IFI A;  1LGH B;  1M1J A;  1NTK J;  1UII A;  2XDJ A;  3C1L A;  3NFQ A;  1RHZ B;  1JCD A;  3TF5 A;  1G2C A;  1TU3 F;  2E76 C;  1JB0 J;  3L74 G;  2W6J H;  3AEF C;  1KQL A;  1J1D C;  3B5N A;  1RF1 B;  3PJS K;  1YI2 P;  1PPJ E;  3P8M C;  1HF9 A;  3HE4 B;  2ZXE B;  3MUD C;  1KYO H;  2FYU E;  2KZJ A;  2ZAE B;  4UB6 H;  2OTK E;  4B86 A;  1BDD A;  1ZN5 A;  5CCG D;  1ZRT E;  1KTM A;  4DOJ A;  3VMZ A;  1JY2 P;  4ZKP A;  2O01 N;  1JOC A;  2WSE J;  2RKL A;  1FZC A;  2B87 B;  2NPS B;  2YKO A;  1XTG B;  3CCQ P;  1FZA A;  1GK6 A;  1PZQ A;  4ZNC A;  2PRR A;  4OGQ D;  3CWB G;  4IFM A;  1KD1 Q;  1L0N J;  2MKV A;  4IL6 H;  4EIJ A;  4RJT A;  1WMK A;  1N7S C;  1BCC J;  1KIL B;  2IBZ I;  1L0L K;  1LTT C;  4U3F J;  1G2C B;  5KJ7 D;  1QGK B;  3GHG B;  1MFT A;  4XE5 B;  2GM4 A;  2Q6Q A;  4GOF A;  3WUU A;  2FYU D;  4N6J A;  4EDF A;  3H32 B;  3OW2 O;  1K04 A;  3G4S P;  1BE3 D;  3EQ2 A;  1KB9 E;  2E5T A;  2QRX A;  1OX3 A;  3IR9 A;  3LW5 H;  4H0L D;  4HB1 A;  5CJ4 A;  1EDK A;  1SQV G;  1L0N K;  1VL2 A;  1KYO I;  2Y0E A;  2KNC A;  4AQR D;  3WU2 H;  5KJ7 C;  1GU5 A;  1M56 D;  3OA7 A;  3IFM A;  3H32 A;  3P32 A;  1EDJ A;  2Y0C A;  1Q2N A;  1NTZ D;  1URQ A;  3M0D C;  1KC8 Q;  2ZT9 C;  4C7N B;  1RF0 C;  1SQV J;  1RE4 A;  1QVF O;  2FYU J;  1SQP J;  2I8D A;  2K9J A;  3CMA P;  1BE3 J;  1L4A A;  2BCC E;  1OIP A;  3CCJ P;  3AEG C;  1LT9 B;  2B88 A;  2Q5U A;  4NPE A;  4PJ0 H;  3TNU A;  2IBZ D;  2R32 A;  3H1H J;  1IO4 A;  2OYH A;  2OYI B;  2KIK A;  3M9B A;  3SSU A;  1S72 P;  2WPS A;  3A2A A;  5KAI H;  3O8Z A;  4N78 D;  3NXS A;  5E79 H;  1NJI Q;  4IFD K;  2Q3I A;  1AFO A;  5GTH E;  4K3A A;  1SFC C;  2WPV B;  1USD A;  3TGU E;  1KQG B;  1G1J A;  1URQ D;  2E43 A;  1KQS O;  2BEQ D;  3AED C;  1E5W A;  1OVR A;  2AXT E;  3KPE A;  1ZR2 A;  4HH2 A;  3BVH A;  2QJP C;  1L4A C;  3AE8 C;  2LXC B;  3H1I G;  5KKZ B;  2E75 D;  1YJW P;  2YO2 A;  1JTH B;  2OQQ A;  4LLH A;  2BCC G;  3H1K G;  3M0D A;  4WBA A;  5APQ A;  5AVT B;  4Z1M H;  1RF1 A;  1CW5 A;  1OVU A;  2WSC J;  2JJL A;  1SQB D;  4DJG A;  1SS1 A;  2FXP A;  2DW3 A;  3QWO C;  5AVR B;  5KJ7 A;  2QA4 P;  1FZF A;  1IC2 A;  1ZV8 A;  2RH0 A;  4RO0 A;  1NO4 A;  1RY3 A;  1SQQ D;  3A3Y B;  5BVZ A;  3V2R A;  3SFE C;  4PV1 B;  4KT0 J;  2ZVO B;  3EFG A;  1JO5 A;  3H1I E;  2E76 B;  1GW4 A;  3I56 P;  1VF5 D;  1U7M A;  3FXD A;  1RF1 C;  3M06 A;  2NZ2 A;  1LTJ B;  1BGY D;  4R4M A;  1X22 A;  1U7J A;  3KDP B;  1SFC B;  1FC2 C;  1LJ2 A;  3M9H A;  2AXT H;  1LTB C;  4IL6 E;  3TGU G;  3VMX A;  4BRY A;  1GW3 A;  3GF3 A;  5AW5 B;  1FBM A;  5AW6 B;  1YIT P;  1JEK A;  1SQP E;  1Y47 A;  3FGA D;  4ASW A;  1SFC A;  4I2L C;  5E79 E;  3CCL P;  3C8V A;  3V2P A;  3L4F A;  3H6P A;  2M0B A;  1BGY J;  2CPB A;  3SWY A;  1N7L A;  2YKQ A;  1NH4 A;  3V6I A;  1DD4 A;  2FKW B;  1OMI A;  5GTI H;  2OYH C;  1IFN A;  1ZOY C;  2B89 A;  3MUD A;  1FE6 A;  2I1K A;  2ZJS E;  4AUW A;  1N86 A;  2M5A B;  3HUS B;  4XA4 A;  3B5N C;  3V2Q A;  1RE4 C;  1YHQ P;  2KP8 A;  1RF0 A;  3V5B A;  2FXO A;  4D6T E;  1URQ C;  5KTB A;  2K37 A;  2SPZ A;  3Q1M A;  1M1J C;  3PH0 A;  1HH0 A;  1FS0 E;  2A45 H;  1AV1 A;  1T2K C;  1VQP P;  1L4A D;  1SQX K;  3BRT B;  2ZYD A;  1EQ7 A;  5AVQ B;  4ASV A;  1S9K E;  1Q81 Q;  3S1K A;  3CC2 P;  3HE5 B;  1FAV A;  2JEE A;  1ZP0 C;  2KZI A;  2UWJ E;  2Q7C A;  2E74 C;  3VMA A;  3L70 G;  4D6T D;  3E7K A;  2BEZ F;  1MZ9 A;  3CL3 D;  4U3F D;  1T2K D;  3CC4 P;  1KN7 A;  1EDI A;  3L75 E;  3N4X A;  1N7S A;  3A7O A;  1LTI C;  3WUV A;  5B5E H;  3USS A;  1FDM A;  3L70 J;  3CC7 P;  1DD3 A;  3TSI A;  1PGO A;  2QG4 A;  4ZMD A;  1HGV A;  2FFD B;  3CXH H;  1Q7Y Q;  1GDT A;  5AVV B;  3HE4 A;  1NTZ K;  1NU1 E;  1FZC C;  1FZG A;  1T3U A;  3WMM 0;  3MTU E;  4O9B A;  4I6M C;  3QH9 A;  1NKZ B;  3MD0 A;  2M8R A;  1S5L X;  1M1J B;  4JBZ A;  1L0L G;  1SQX D;  1S3J A;  4RES B;  2N9Y B;  2HLO A;  3CX5 E;  1LNQ A;  1SLQ A;  2FYU K;  1ZXG A;  2AEJ A;  2KI7 B;  1R5S A;  2V7Q H;  3A0B H;  3CXH E;  1FU1 A;  4N78 E;  1YIJ P;  1EZV E;  1S9K D;  1H88 A;  2BAS A;  2WT7 A;  4JYC A;  1VQ8 P;  2KXP B;  1K73 Q;  2H88 C;  2KLV A;  5BU5 A;  4L75 A;  1BCC D;  1L0N G;  2QSI A;  3AE5 C;  3VMY A;  1GU4 A;  1BCC G;  2W6A A;  2H8P D;  2YIU C;  4OGQ B;  2OYO A;  2HR3 A;  3A0H E;  1M7L A;  1LP1 B;  1Y8A A;  3L75 D;  1KIL D;  5H2F H;  2Q1K A;  3L36 A;  3UIA A;  1JY3 N;  1NTK E;  5AW0 B;  2P67 A;  4KJM A;  2FFD C;  1T3J A;  2W6B A;  1SQB E;  1YJ9 P;  2P1J A;  5APS A;  2HPC B;  1DEB A;  3L70 E;  2O3J A;  2WQY C;  1JY3 P;  2CK3 H;  1PP9 E;  1SQV D;  3L72 E;  1JNM A;  4PV1 D;  1SQP D;  2E74 D;  1FZB A;  1K05 A;  3L75 J;  2QM7 A;  5APY A;  4I7Z B;  5CCG C;  1PV3 A;  1GZL A;  1N8R Q;  1VF5 B;  3H1H D;  3RBZ A;  4HJG H;  3RK2 D;  3H1H G;  1P84 H;  2BCC D;  3AEE C;  3W67 A;  1SFC D;  1PP9 D;  3MZW B;  1QVG O;  3GG2 A;  1VQL P;  3L71 G;  3P8C E;  1W5C E;  3IAO A;  4MN4 C;  3L71 D;  3H1K D;  2WTY A;  2WVR A;  1VQ7 P;  1BCC E;  2AXC A;  1P84 I;  1VPC A;  1M57 D;  2N1T C;  3CME P;  2POH A;  5C39 A;  3D71 A;  2K9J B;  3IN6 A;  2YXQ B;  2AEM A;  3AE7 C;  3E1I A;  4WY4 C;  3WUT A;  5KLV G;  2IPP A;  2H43 A;  1DIP A;  2JKV A;  1OW6 A;  2O1J A;  2XNX A;  1USE A;  3L71 E;  1URQ B;  1YBK A;  3L73 D;  2A06 D;  4PD4 D;  1IFM A;  2V7Q J;  4H13 C;  3L73 G;  1VQN P;  3V4Q A;  3OJA B;  2IDB A;  3HUS A;  2YKP A;  1CI6 B;  2E75 B;  1FJK A;  1SQP K;  1NAY A;  3HTK B;  1LWU B;  1NU1 D;  1OXZ A;  1KB9 I;  3H1J J;  3PTZ A;  4IFF A;  1SQB K;  2LKM A;  1SQQ J;  4RKU J;  3HRN A;  1GL2 C;  3GHG A;  1AQT A;  2LXB A;  1VF5 C;  4GOD A;  1Z56 A;  4H13 D;  2QEX P;  1L4A B;  5APX A;  1CSB A;  2FXM A;  1X8Y A;  4Y99 B;  5CBO A;  3H25 A;  1NU1 K;  3U1A A;  1QL2 A;  1T6A A;  4BXL A;  5CCH C;  3JCU E;  1FDI A;  1N73 A;  1NTK G;  1EXJ A;  1HVV A;  2NPS C;  2K88 A;  1SQQ G;  2KK7 A;  3CCM P;  3CCE P;  2FYN C;  1HGZ A;  2H7H A;  1XTC C;  2IFN A;  2AEF A;  3Q5S A;  3G71 P;  1NYH A;  2R44 A;  1CZQ A;  5AW2 B;  3GLM A;  3WU2 E;  2D2C D;  1M1K Q;  3TGU J;  3A0B E;  4PD4 I;  4QMA A;  3RL0 D;  1L0L J;  1S5L H;  3H1K E;  5CCH D;  1PPJ D;  2PFX A;  4IOI H;  5KLI C;  1M8O B;  2A45 G;  1U57 A;  4PV1 C;  2W8Z A;  4CPG A;  1WT6 A;  1RQU A;  4H44 D;  4DCK A;  2PP6 A;  1GMJ A;  2QVA A;  4DT0 A;  1QEX A;  5DJU B;  3KYQ A;  3L73 E;  3KZI H;  4GDO A;  1LTJ C;  2WSC H;  1L2P A;  2KS1 B;  4JPZ B;  4D6T G;  1KB9 H;  1OVV A;  4A7P A;  2Q9I A;  1EXI A;  2OTJ P;  1DX7 A;  1LWU C;  2CPS A;  5K5G B;  1OW7 A;  1PGJ A;  2W90 A;  3HD7 B;  2XND H;  4H44 C;  4OH8 B;  2YXR B;  2LR2 A;  1KOR A;  3S9O A;  1JY2 O;  1A02 J;  3CWB J;  1JTH A;  1RE3 A;  2ZT9 B;  3VYI A;  1KYO D;  3FWL A;  1PGQ A;  1YQ3 C;  4U3F G;  2K9Y A;  1AVY A;  2PAJ A;  1S5L E;  2RN0 A;  2R3S A;  3GW6 A;  2HYN A;  2Q3E A;  1LT9 C;  4GT1 A;  5AW1 B;  4OVN F;  1NTZ E;  1WRG A;  2Z5H A;  4K35 A;  5CBN A;  1ZME C;  3TYY A;  1KFN A;  3HD7 A;  3PHL A;  1YTZ I;  2HFE D;  5CHX A;  3CPW O;  2ITA A;  2I1J A;  3N7N A;  5AVW B;  3L75 G;  1H8A A;  3HE5 A;  3AEC C;  3Q3D A;  1VQM P;  2L5G B;  1OW8 A;  1EC5 A;  3CWB D;  3OAK A;  3I55 P;  1YJN P;  1DH3 A;  2NRG A;  2WSS H;  3Q2Y A;  5TJH A;  5KAF H;  2KSJ A;  1YYC A;  4UB6 E;  1GL2 D;  5AVY B;  1D7M A;  3SWF A;  1SP4 A;  2QJP B;  3PRJ A;  1BE3 G;  3V2N A;  4L73 A;  3U1C A;  5M1B A;  3RL0 g;  3EWK A;  2E74 B;  1NHL A;  5GTI E;  1IFJ A;  2IBZ E;  1NTM K;  1J2J B;  4N3Y B;  5DJT B;  4EI2 A;  2N9B A;  3RK2 B;  1FDO A;  2WWW A;  2YMK A;  3NTN A;  4W80 A;  2M3B A;  4UB8 H;  3AE4 C;  1MUU A;  4HYT B;  1N73 B;  1LTA C;  2JWD A;  3R2P A;  3D6Y A;  3LIE A;  1JM0 A;  1KFM A;  1VQ4 P;  1KYO E;  1IFP A;  1ZR4 A;  1EZV G;  1JMM A;  1ZLL A;  2IZ0 A;  3MHV A;  2QJK C;  2Y9Z A;  3CCV P;  3HTK A;  2JR8 A;  1KIL A;  1VQO P;  5B66 H;  1NTZ J;  3K5B A;  1GK4 A;  3VP9 A;  1KB9 D;  1KIL C;  2E5Y A;  5AW7 B;  3H1K J;  2R5D A;  3CCR P;  1VQ6 P;  2WMM A;  1Q86 Q;  1K9M Q;  2JWA A;  3BCC D;  2R3C A;  3CX5 H;  3EFF K;  5APU A;  3A5T A;  1NOH A;  1GD2 E;  2HOD B;  1J1E C;  1X9V A;  3AE1 C;  1KMI Z;  1R8E A;  1H0T A;  1Q90 D;  1OWA A;  2ZYA A;  5KAI E;  2G8Y A;  1JY3 O;  4IL6 X;  4WB4 A;  2OYI A;  1LTS C;  2YNY A;  1T8Z A;  3T97 B;  2L91 A;  1AJY A;  3L37 A;  4JYB A;  4U7J A;  1H0T B;  3RK2 C;  4L76 A;  1NU1 J;  4PJ0 E;  2GA1 A;  2J59 M;  3TDK A;  1PL5 A;  3PP5 A;  3B5N B;  3H1I J;  4HKZ H;  5AW9 B;  2W83 C;  1HTL C;  5KLI B;  1AA0 A;  1SQV E;  3L72 D;  2KLU A;  4C7R A;  2IYP A;  4LC1 A;  4WVZ A;  2OYI C;  1AQ5 A;  1HBW A;  3CLQ A;  5KKZ C;  5KLV K;  2N1T D;  3L71 J;  1SVF A;  1J1D B;  5AVX B;  3RL0 B;  2M5A A;  1EDL A;  2FYZ A;  1FOS F;  2G3A A;  3GF7 A;  3CX5 I;  5BU8 B;  3HD7 C;  4H44 B;  2FY8 A;  3CWB E;  3TGU D;  3D6Z A;  1RH5 B;  2IZ1 A;  4YTP C;  3E1R A;  1VQK P;  3ITK A;  1LT9 A;  2R5B A;  3BAT A;  1QX8 A;  4BRY B;  5KLV J;  4EYY Q;  1G1I A;  2KB7 P;  3H1L D;  3D70 A;  1MV8 A;  1VDF A;  1NTK D;  3B8E B;  3BAS A;  1QL1 A;  2ZXX A;  3MGN A;  5L8R J;  5TIS E;  5B66 E;  1RE3 C;  2C9L Y;  3RK3 E;  3RBX A;  3RK3 B;  1JMB A;  5AW8 B;  1A02 F;  2FBW C;  3H1J D;  4DZO A;  4OWF A;  3TK1 A;  3VN0 A;  2V4H A;  1Y9B A;  1CI6 A;  3H1L E;  1FZC B;  5B5E E;  5APW A;  1LTJ A;  2MJZ A;  3I5C A;  1P84 D;  1N7S B;  2IX7 C;  2XZR A;  3Q5P A;  2NPS D;  4KHX A;  1PPJ G;  2JO1 A;  1OZH A;  1YQ4 C;  2H89 C;  3H1H E;  4GKG A;  4YXD C;  2HG5 D;  3CX5 D;  3O6Q B;  4C46 A;  4H13 B;  3R4Y A;  3RL0 C;  2A06 E;  2KS1 A;  3CCU P;  1FJP A;  3VOP A;  5KAF E;  1NGM B;  1L0L D;  1S2E A;  1SQX G;  2A45 I;  2QIW A;  3KXD A;  1GL2 B;  4LGD E;  3IF4 A;  3JC2 2;  2O1K A;  4H0L B;  4XFJ A;  3AEA C;  5APV A;  2D2C B;  4OGQ C;  2HOD A;  3H1J E;  5APT A;  1N73 C;  1Q82 Q;  3W68 A;  1GTW A;  4BWN A;  3LID A;  2W27 A;  4WY4 D;  3RGU A;  2IFM A;  1SQX J;  1NTZ G;  1P84 E;  1GL2 A;  2WSE H;  3B71 A;  1R5L A;  1HUC A;  3S4R A;  5TIS H;  1K8A Q;  1MFZ A;  2K3R A;  4U3F E;  4ZKU A;  1NTM D;  1AVO A;  1IFD A;  3HUS C;  3L74 D;  4NPF X;  2WZ7 A;  3SFD C;  3CXH D;  2HPC A;  3BCC E;  1EZV D;  2OAR A; 
#chains in the Genus database with same CATH homology
 3U59 A;  1SQV K;  3HD7 D;  2P7J A;  2YO3 A;  1X79 B;  2ZFC A;  1LWU A;  1JY2 N;  3CI9 A;  4WY4 A;  4Y99 B;  1J1E B;  1HJB A;  3KQG A;  2XV5 A;  2WIT A;  2WT7 B;  1YTZ T;  2C0X A;  1JCC A;  2WPQ A;  3NMD A;  4GIF A;  2NPS A;  1HWT C;  5CCH A;  1KZU B;  5AW4 B;  1H89 A;  1FOS E;  5AVU B;  4AYC A;  2J58 A;  1FZE A;  3GHG C;  2Z4E A;  1N2D C;  1JUN A;  2GUS A;  5AVS B;  1NAF A;  2XU6 A;  4Y99 C;  1PFI A;  2KYV A;  3T97 A;  3RK3 C;  3V4W A;  3VTP C;  3P7K A;  2OYH B;  3II6 A;  1IK9 A;  1LTG C;  2Z5I A;  3L35 A;  4JF7 A;  5AW3 B;  3P8C D;  2N1T A;  4C7N A;  3RK3 D;  1NWQ A;  1IJD B;  2QM8 A;  3C9I A;  4W7Y A;  5CJ0 A;  2C0W A;  2C9N Y;  1N7S D;  2KOG A;  2GUV A;  2WSF H;  2XKM A;  3VP8 A;  5CCG A;  1W2E A;  1NTK K;  3TNU B;  4I1L A;  1SQQ K;  2YMY A;  2WPR A;  1GD2 E;  3G3Z A;  2O01 H;  3M9Q A;  3B5N D;  4M3L A;  4EOT A;  2E42 A;  2VRS A;  2FFD A;  3M91 A;  2N1T B;  3M0A A;  1NKN A;  3BRV B;  4W7Z A;  5CMZ A;  4WY4 B;  5AVZ B;  2P2U A;  1IFI A;  1LGH B;  1M1J A;  2XDJ A;  3NFQ A;  1JCD A;  1G2C A;  1RF1 B;  1KQL A;  1J1D C;  3B5N A;  3P8M C;  3HE4 B;  2ZXE B;  4B86 A;  1ZN5 A;  5CCG D;  4DOJ A;  3VMZ A;  1JY2 P;  4ZKP A;  1JOC A;  1FZC A;  2NPS B;  2YKO A;  1XTG B;  1FZA A;  1GK6 A;  4IFM A;  4EIJ A;  1N7S C;  1KIL B;  5KJ7 D;  1L0L K;  1LTT C;  1G2C B;  4XE5 B;  3GHG B;  2GM4 A;  1CW5 A;  4N6J A;  3H32 B;  3EQ2 A;  3IR9 A;  3LW5 H;  5CJ4 A;  4AQR D;  1L0N K;  5KJ7 C;  1GU5 A;  3OA7 A;  3IFM A;  3H32 A;  3P32 A;  3M0D C;  1URQ A;  4C7N B;  1RF0 C;  1RE4 A;  1L4A A;  1LT9 B;  2Q5U A;  3TNU A;  2R32 A;  1IO4 A;  2OYH A;  2OYI B;  3M9B A;  2WPS A;  3A2A A;  3O8Z A;  4N78 D;  3NXS A;  4IFD K;  1AFO A;  2Q3I A;  1SFC C;  1URQ D;  1G1J A;  1ZR2 A;  1E5W A;  4HH2 A;  3BVH A;  1L4A C;  2YO2 A;  1JTH B;  4LLH A;  4WBA A;  3M0D A;  5APQ A;  5AVT B;  1RF1 A;  2JJL A;  5AVR B;  5KJ7 A;  1FZF A;  1IC2 A;  1ZV8 A;  1NO4 A;  1RY3 A;  3A3Y B;  5BVZ A;  3V2R A;  3EFG A;  1JO5 A;  1GW4 A;  1RF1 C;  3M06 A;  1LTJ B;  3M9H A;  3KDP B;  1SFC B;  3VMX A;  1LTB C;  1GW3 A;  5AW5 B;  1FBM A;  5AW6 B;  1SFC A;  4I2L C;  3V2P A;  3L4F A;  3H6P A;  2CPB A;  3SWY A;  1N7L A;  2YKQ A;  1NH4 A;  2OYH C;  2FKW B;  1IFN A;  4AUW A;  3MUD A;  2I1K A;  1N86 A;  3HUS B;  4XA4 A;  3B5N C;  1RE4 C;  2KP8 A;  1RF0 A;  3V5B A;  1URQ C;  5KTB A;  1M1J C;  1HH0 A;  2A45 H;  1T2K C;  1L4A D;  1SQX K;  3BRT B;  5AVQ B;  1EQ7 A;  1S9K E;  3HE5 B;  1FAV A;  2JEE A;  2Q7C A;  1MZ9 A;  3CL3 D;  1T2K D;  3N4X A;  1N7S A;  3A7O A;  1LTI C;  1FDM A;  3TSI A;  1HGV A;  2FFD B;  1GDT A;  5AVV B;  3HE4 A;  1NTZ K;  1FZC C;  1FZG A;  1T3U A;  3WMM 0;  3MTU E;  4O9B A;  4I6M C;  1NKZ B;  3MD0 A;  2M8R A;  1M1J B;  4RES B;  2HLO A;  3KPE A;  1SLQ A;  2FYU K;  3MIW A;  1DX7 A;  4N78 E;  1FU1 A;  1S9K D;  1H88 A;  2BAS A;  2WT7 A;  4JYC A;  5BU5 A;  2KLV A;  3VMY A;  1GU4 A;  2W6A A;  2H8P D;  1M7L A;  1KIL D;  3L36 A;  3UIA A;  1JY3 N;  5AW0 B;  2P67 A;  2FFD C;  1T3J A;  2W6B A;  2P1J A;  5APS A;  2HPC B;  1DEB A;  1JY3 P;  1JNM A;  1FZB A;  5APY A;  2QM7 A;  5CCG C;  1GZL A;  3RK2 D;  1SFC D;  3P8C E;  2WTY A;  1VPC A;  2N1T C;  2POH A;  3E1I A;  4WY4 C;  2H43 A;  2IPP A;  2O1J A;  2XNX A;  1URQ B;  1IFM A;  3V4Q A;  3OJA B;  3HUS A;  2YKP A;  1CI6 B;  1FJK A;  1SQP K;  3HTK B;  1LWU B;  1OXZ A;  4IFF A;  1SQB K;  2LKM A;  3HRN A;  1GL2 C;  3GHG A;  1Z56 A;  1L4A B;  5APX A;  1CSB A;  2FXM A;  1X8Y A;  1N73 A;  1NU1 K;  3U1A A;  1QL2 A;  5CCH C;  1HVV A;  2NPS C;  1HGZ A;  2H7H A;  1XTC C;  2IFN A;  1CZQ A;  5AW2 B;  5CCH D;  3RL0 D;  2A45 G;  1WT6 A;  2PP6 A;  3KYQ A;  1LTJ C;  2WSC H;  2Q9I A;  1LWU C;  2CPS A;  3HD7 B;  4OH8 B;  1A02 J;  1JY2 O;  1JTH A;  1RE3 A;  3VYI A;  2PAJ A;  4GT1 A;  2HYN A;  3V2Q A;  1LT9 C;  5AW1 B;  1WRG A;  2Z5H A;  3TYY A;  1KFN A;  3HD7 A;  1YTZ I;  2HFE D;  5CHX A;  3N7N A;  2I1J A;  1H8A A;  5AVW B;  3HE5 A;  2L5G B;  3OAK A;  1DH3 A;  3SWF A;  2KSJ A;  1YYC A;  1GL2 D;  5AVY B;  1SP4 A;  3V2N A;  3U1C A;  1NHL A;  1IFJ A;  1NTM K;  1J2J B;  4N3Y B;  2N9B A;  3RK2 B;  2WWW A;  3NTN A;  4W80 A;  1N73 B;  2M3B A;  1MUU A;  4HYT B;  1LTA C;  3R2P A;  3LIE A;  1KFM A;  1ZR4 A;  1JMM A;  1ZLL A;  3HTK A;  1KIL A;  1GK4 A;  3VP9 A;  1KIL C;  5AW7 B;  2R5D A;  2R3C A;  5APU A;  3A5T A;  1NOH A;  2HOD B;  1J1E C;  1X9V A;  1OWA A;  1JY3 O;  4WB4 A;  2OYI A;  1LTS C;  2YNY A;  1T8Z A;  3L37 A;  4JYB A;  3RK2 C;  2J59 M;  3PP5 A;  3B5N B;  5AW9 B;  1HTL C;  4C7R A;  4LC1 A;  2OYI C;  1AQ5 A;  1HBW A;  3CLQ A;  5KLV K;  2N1T D;  1SVF A;  1J1D B;  5AVX B;  3RL0 B;  2FYZ A;  1FOS F;  5BU8 B;  3HD7 C;  2E43 A;  1LT9 A;  2R5B A;  3BAT A;  1G1I A;  2KB7 P;  3MGN A;  1MV8 A;  1VDF A;  3B8E B;  3BAS A;  1QL1 A;  2C9L Y;  1RE3 C;  3RK3 B;  5AW8 B;  1A02 F;  4DZO A;  3TK1 A;  3VN0 A;  1CI6 A;  1FZC B;  5APW A;  1LTJ A;  2MJZ A;  3I5C A;  2XZR A;  1N7S B;  2IX7 C;  2NPS D;  4KHX A;  4GKG A;  2HG5 D;  4C46 A;  3RL0 C;  1FJP A;  3VOP A;  2A45 I;  1GL2 B;  4LGD E;  2O1K A;  5APV A;  2HOD A;  5APT A;  1N73 C;  1GTW A;  3LID A;  2W27 A;  4WY4 D;  2IFM A;  2WSE H;  1GL2 A;  1HUC A;  1MFZ A;  4ZKU A;  1IFD A;  3HUS C;  2WZ7 A;  2HPC A;  2OAR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...