3L37A

Pie12 d-peptide against hiv entry
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
total genus 20
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l37A00
4HYTB 2W6AA 3HE4B 2Q5UA 5AW8B 5APYA 3M06A 5APUA 4AQRD 2XV5A 3VTPC 2QM7A 3A7OA 3L37A 4AYCA 2C9LY 5AVRB 1GK4A 1G2CB 2R32A 3HE4A 3M9HA 4RESB 1FOSE 3VMYA 1MV8A 2E42A 2WWWA 2E43A 2XU6A 3LIEA 5AVZB 1NAFA 2P7JA 3I5CA 2WPRA 3L35A 5AVWB 2Q7CA 1GU5A 4I6MC 2R3CA 1A02J 4C46A 3NFQA 5AVYB 1A02F 2ZFCA 1KQLA 4JYCA 4GT1A 5CMZA 5AW5B 3P7KA 3VMZA 1MUUA 2JJLA 5AW0B 4B86A 1JNMA 1DH3A 3KQGA 1X8YA 5AW4B 3MGNA 1GK6A 2BASA 3KDPB 3M91A 2ZXEB 1HUCA 5AVUB 2R5DA 2Z5IA 4JYBA 5AVQB 3P8MC 2H7HA 2XZRA 1GD2E 3SWFA 2P67A 2W27A 1T2KC 1S9KE 5AVXB 1T2KD 1GU4A 1NWQA 1H88A 5APQA 2Z5HA 5AVVB 4C7NA 3B8EB 2YO2A 3A2AA 5APSA 3TYYA 4EOTA 1JUNA 4AUWA 3NXSA 1GZLA 5AVSB 1CI6A 2Q3IA 3L36A 1CSBA 1CZQA 3A3YB 5AW2B 2YNYA 5APWA 3VN0A 2R5BA 2YO3A 3OAKA 4KHXA 3UIAA 5APTA 1HWTC 3P32A 1GTWA 1SP4A 5APVA 2KP8A 3TK1A 4M3LA 3MD0A 5AW3B 3V5BA 3TNUA 2IPPA 4C7NB 3M0AA 1FOSF 1SLQA 3VMXA 2WT7A 3NTNA 1CI6B 1MFZA 3LIDA 1HBWA 3HE5B 1H89A 2P2UA 5AVTB 4DZOA 5AW1B 2WTYA 2N9BA 1IO4A 2VRSA 3M9BA 3HE5A 1OWAA 3NMDA 4LC1A 3V4QA 2WPQA 3O8ZA 3HTKA 1YYCA 3V4WA 2QM8A 5AW7B 5APXA 3TNUB 1S9KD 5AW6B 4XE5B 4I2LC 1J2JB 2WT7B 1OXZA 1FAVA 5AW9B 3VYIA 2C9NY 3A5TA 1H8AA 4GKGA 1HJBA 3IR9A 3M0DA 3T97A 2WPSA
chains in the Genus database with same CATH superfamily
1JY2O 3HE4B 3V2PA 1LWUA 1VF5C 1L0NG 3L72D 3H1LG 3AE3C 4I1LA 2Y0EA 1KC8Q 2FXMA 1OMIA 3KPEA 1L0NJ 2YIUC 3H1LJ 4DOJA 1SVFA 1ZMEC 5AW0B 3HD7B 5AW4B 3Q1MA 5E79H 4BXLA 4U7JA 1SFCC 2FYUG 2E74B 1VQ7P 1Q81Q 1AQTA 4RO0A 2QJKB 3B8EB 1JUNA 3KZIE 4A7PA 3AE2C 2FYUJ 1RE3C 3PP5A 2M5AA 2HPCB 1LT1A 3P8CE 1Q90D 1MKMA 3TNUA 4KJMA 2ZXXA 3L75E 1SFCA 2FXPA 1NU1D 2QSIA 4EYYQ 5B5EH 1PIXA 1SQVK 1HGVA 3HTKA 1VQOP 3H1LD 1LTBC 1EZVG 1RE3A 3A0HE 3CCLP 4PV1C 5B66H 1EDLA 2MKVA 1R8EA 2GA1A 3IFMA 4XFJA 2QEXP 3HUSB 1WRGA 4WWIA 3I5CA 2FYUD 2KS1A 2WSEH 1GU5A 1QGKB 3PTZA 2OYHC 1RF1C 4UB6E 3RL0B 1L0LE 3VMZA 1D7MA 2K9JB 3G6EP 1PGQA 1M1JB 3M91A 1HH0A 2WVRA 2AEMA 1VQNP 4LLHA 1BE3E 4OGQB 5KLVG 4I7ZC 5KLIC 1LP1B 2KLUA 2P67A 3B5ND 1T2KC 1M57D 2FYZA 2IBZE 2OTJP 4HKZH 1NTKD 2C0XA 1WT6A 2JDIH 1MZ9A 3L73E 5KLVJ 2OYHA 1RF1A 2ZYAA 2Q9IA 1FJPA 2KSJA 3CCVP 1EZVD 2NPSD 5TISH 1OW8A 1IO4A 2YXRB 1JCDA 1KYOD 2V7QJ 3HD7C 3KZIH 1Q2NA 2KLVA 1BSHA 3L74D 2E76B 3I55P 3VP9A 1Y9BA 2E74C 5L8RJ 3U1AA 1SQQG 3CWBG 3IR9A 2BCCE 2QJKC 4HYTB 3N4XA 1JY3N 2ZT9B 3H32B 1JMMA 1QL1A 1K73Q 1VPCA 1NOHA 5KJ7C 4K35A 1SQQJ 3WMM0 3CWBJ 1BCCE 3HD7A 4C7RA 2H88C 4H13B 2I1KA 3A0HH 4JYCA 2OTKE 1N8RQ 2UWJE 4TLFA 2GUSA 3CCEP 2SPZA 4IOIH 1USEA 5KJ7A 3V2RA 1PGPA 2HPCA 2FFDB 4PD4H 2XNXA 1CSBA 5BVZA 1FZBA 3HUSC 2IFNA 2HLOA 1SQPE 3M0DC 3G71P 1KQFB 1KQSO 1NTME 2M3EA 2KOGA 1URQD 1JTHB 2DW3A 3RK3D 3RL0C 4U3FG 1K05A 2VRSA 1OWAA 3L70E 1M1JC 4W7ZA 5CCHD 4D6TG 4OGQC 2IBZI 4L73A 2WSCJ 4U3FJ 1EDJA 1H8AA 4GKGA 3CMEP 3M0DA 3U1CA 3AE5C 4L76A 4RKUJ 3FXEA 2XV5A 3A7OA 2C9LY 4D6TJ 1YHQP 2R32A 1NKNA 4H0LD 3VMYA 1IFNA 1X79B 2K9JA 2P7JA 1M1JA 3CXHD 2CPSA 3RGUA 2OQQA 3BRVB 3TSIA 3FWNA 1PV3A 1VQ6P 4TT3H 4EDFA 1RH5B 3CI9A 1NAYA 1NO4A 3CCQP 2E76C 3H1KD 1HUCA 1SQVG 4XA4A 1KILB 5AVQB 2A45G 1JY2P 2Z5HA 1SQBE 3AEGC 2ZT9C 2QE7H 3M9QA 1SQVJ 2GM4A 2A06G 3G4SP 1YIJP 4YXWH 1ZRTD 1YTZT 1G1IA 2CK3H 1NYHA 3H1JD 1KMIZ 4H13C 3LIDA 1W2EA 3S9OA 1NTZE 3D6ZA 3BCCG 3CD6P 3I56P 3H32A 4ZKPA 1R5SA 2WPVB 4OH8B 4XE5B 4R4LA 4OVNF 3BCCJ 2WSCH 2FFDC 1OVVA 5AW8B 3M06A 2BEQD 1LTIC 1HVVA 1GK4A 2WSFH 5C39A 3TDKA 1QEXA 4WY4B 4YXDC 4YPCA 1L0LK 3MUDA 5GTIE 2PGDA 1SQVD 2W8ZA 4W80A 1KZUB 2Q7CA 1K04A 3GF7A 1FZGA 2I1JA 2HG5D 3H1IG 1A02F 2ZFCA 2POHA 3CLQA 2FFDA 1P84E 1FZFA 3CX5E 1J1DB 2RH0A 3G9RA 1DH3A 2A06D 1HF9A 1KB9E 1Y8AA 3H1IJ 1IFPA 5DJTB 2LXCB 3TGUG 1Y47A 1FDIA 5KAFH 4N78D 4AUWA 3SSUA 5AVSB 4GODA 4Y99B 1KQGB 1JTHA 2AXTE 2QVAA 4JF7A 1EC5A 3TGUJ 3P32A 3RK2D 3TK1A 1DEEG 3M0AA 3TF5A 3L72E 2Q3EA 1QX8A 3NTNA 4H44B 3OA7A 1YJWP 4BRYB 3CCRP 3AE1C 4DZOA 1VDFA 1PP9E 3WUUA 2PAJA 4LC1A 1LTTC 1T8ZA 1M56D 1KILC 1EXJA 5AW9B 2NPSB 1JY3O 3AE8C 2HODB 4QMAA 3WUVA 4GOEA 2JWDA 1L4AB 2XNDH 3LIEA 1KV4A 3BASA 2H43A 1KILA 3W68A 1FBMA 2L5GB 1KQLA 5AW5B 1NU1E 3MHVA 1GL2D 2QG4A 4HB1A 1ZOYC 4JYBA 2D2CD 3P8MC 3SWFA 2WSEJ 1SQPK 1FDMA 5GTIH 1K9MQ 1RY3A 1FZEA 1OW7A 5KAIE 5GTHH 1S3JA 1NTMK 4EOTA 2KIKA 4WY4C 1CZQA 3CX5H 1IK7A 3A0BH 2LXBA 2JR8A 1RQVA 2IPPA 3MP7B 1KB9H 1MFZA 3K5BA 3CX5I 2FYUE 3HE5B 1RE4C 3L71G 2YKQA 1J1DC 1KB9I 2N9BA 2IYPA 2IZ0A 3C1LA 1BGYD 4WY4A 2WMMA 2V4HA 1J2JB 2AXTH 1R5LA 4BWNA 4GDOA 3QH9A 2W6JH 3L71J 3A5TA 1T3UA 1URQB 2OTLP 4ZKUA 1S2EA 4Y99C 3Q3DA 3V2QA 2G8YA 1RE4A 2H8PD 1VF5D 1NTKE 1IC2A 4NPFX 1L0ND 3H25A 1ZR4A 1S1CX 3MTUE 4H44C 1QLED 2LKMA 1EZVE 3L75J 1RHZB 4GT1A 1QVFO 5CMZA 3D71A 1SQBK 2XKMA 2L91A 1LNQA 2IX7C 3VP8A 3H1HG 1KYOE 5CBOA 1FU1A 1SFCD 3L74E 2KYVA 1LTSC 2NPSC 1NWQA 4EIJA 2RN0A 3ITKA 1KFNA 4O9BA 1M8OB 4Z1MH 1N7SB 3H1HJ 2Y0DA 3L71D 4BRYA 1NTZK 1L4AC 1ZP0C 1IFDA 2YO3A 3Q5PA 2BEZF 2K37A 1L0LG 2JEEA 1ZR2A 3FXDA 1HBWA 1N2DC 5H2FE 3S4RA 3N7NA 3IAOA 5AVTB 1SQXG 2HODA 3AE7C 3PH0A 1Q7YQ 3V4WA 2IBZG 3VMAA 1L0LJ 2O01N 1L4AA 4I2LC 3E1RA 5CCGC 2C9NY 3OJAB 1SQXJ 2AEFA 3L73G 4PV1D 3EFGA 4AYCA 4IL6X 3HE4A 3M9HA 2PRRA 2WWWA 3C8VA 3GW6A 3L73J 1L2PA 3H1HD 3AEAC 1NAFA 3IF4A 5KKZB 2WPRA 4ZNCA 1S4XA 3SWKA 2R3CA 1U7JA 3F5HA 5CHXA 5AVYB 5CCGA 1VQ5P 2ZVNB 5BU8B 2Y0CA 2HR3A 3RK3E 2JJLA 4PD4D 4B86A 2KB7P 2N9YB 2BCCG 2BASA 3KDPB 1G1JA 2N1TB 3B71A 2JWAA 1RQUA 2H7HA 3PRJA 3C9IA 4DT0A 5KLVD 1URQC 1T2KD 1LJ2A 2Y9YA 2BCCJ 3V6IA 1BCCG 1SQXD 2FXOA 1HTLC 3E7KA 1LTJB 5CJ0A 2IBZD 3WU2E 3SFEC 1BCCJ 3CXHE 2E75B 1GW4A 3GLMA 1KYOI 2WPQA 5CJ4A 1KN7A 3HD7D 5AW7B 4UB6H 3RK2B 3LW5J 2E74D 2ZJSE 2KUBA 3H1KE 2AXCA 1SQQD 3CWBD 1AA0A 1N7SC 2FYNB 2HFED 1SQPG 1BSNA 3KHUA 5H2FH 1NTMG 2JKVA 5KJ7D 2J58A 1NU1K 1X0TA 1HJ0A 5CBNA 1JMBA 5AVZB 3E1IA 2K9YA 4WB4A 3HUSA 2MJZA 1SQPJ 1ZRTE 4I6MC 1JB0J 3L70G 1NTMJ 1EQ7A 4DJGA 2M8RA 1GDTA 3H1JE 2WSFJ 1N7SA 1S5LX 2J5UA 2Z5IA 3AE4C 1PPJE 3L70J 1ZXGA 1LTGC 1JY3P 5AVXB 3RBXA 4GIFA 3SWYA 3U59A 1LP1A 5APSA 1N73B 1VQ8P 2FYUK 3GHGB 1GL2B 1AQ5A 1BDCA 3JSVC 1ZV8A 3FGAD 5KKZC 1CW5A 1LTAC 1OX3A 3AECC 4R4MA 4U3FD 1E5WA 1SQPD 2B89A 1DIPA 2AEJA 2N1TC 1YYCA 1IFJA 1DD3A 1SQBG 4OGQD 1U57A 4D6TD 2A06E 1NTKK 3LW5H 1NVOA 2Q6QA 2W6AA 4NPDA 4AQRD 3VTPC 3G3ZA 2GUVA 2QRXA 1SQBJ 4N78E 1IK9A 1LTJC 5K5GB 3PLNA 2XU6A 1NTZG 4LGDE 1LT9B 2N1TA 3CXHI 2E5YA 1YJNP 1AJYA 2E75C 4EI2A 3CC7P 1XTGB 1S5LE 4RJTA 1NTZJ 2ZAEB 3RK2C 2YMKA 2E76D 2ZVOB 1LTJA 2W27A 1JM0A 2NZ2A 3Q5SA 1KORA 1GU4A 3ZDMA 2FYNC 1JO5A 1ZW0A 2ZT9D 3NXSA 2M5AB 3Q5RA 3VN0A 4DCKA 2R5BA 4UB8E 1VQMP 5APTA 3KXDA 2KP8A 1PGJA 1YITP 1JEKA 1XTCC 1VQKP 4H13D 1FDOA 2K88A 2WTYA 3BCCD 3NMDA 1H0TB 1PGOA 2C0WA 2K3RA 1FS0E 2B88A 2FKWB 3B5NB 1AFOA 1YTZI 1NJIQ 1N73C 5APYA 2QM7A 3D70A 2B9BA 3GHGC 1K8AQ 1GL2C 5EFWB 2O3JA 3MIWA 1FJKA 3L72G 1YI2P 4L74A 2XDJA 1PP9G 1QVGO 4C46A 3NFQA 3L72J 3H1ID 3R2PA 3V2NA 1PP9J 1GK6A 3EFFK 1X22A 1GL2A 5B66E 1T6AA 1BGYE 3SFDC 5M1BA 3TGUD 1E79H 1VQPP 3BATA 2ZYDA 1NHLA 3AE6C 1OFCX 3OAKA 1HWTC 1GTWA 2YMYA 5APVA 3AEEC 1LT9C 1FOSF 3VMXA 3WUTA 3EWKA 1L0NE 1KTMA 1CI6B 3H1LE 2KK7A 3CC2P 1H89A 2I8DA 1LGHB 3V4QA 1W5CE 2PP6A 2QJPB 1S9KD 1P84H 1NU1J 1KILD 2IDBA 4UB8H 3CCSP 1HJBA 2O1KA 1AVOA 1PP9D 1LT9A 3CC4P 2WPSA 1P84I 2Q5UA 2K1AA 5AVRB 2W90A 4RESB 1GMJA 2FY8A 2E43A 3L71E 1YQ3C 1OVRA 2WQYC 3AEDC 3Q2YA 1FE6A 1Q82Q 5TISE 3RK3B 1SS1A 3AE9C 2P10A 3F89A 2Z4EA 1X8YA 3L75G 5KTBA 3BRTB 2KNCB 3B5NC 4JQ0D 1OW6A 2P58A 1NTKG 1YQ4C 4WY4D 4H0LB 3IN6A 1IJDB 1IFMA 1H0TA 1NTKJ 4C7NB 1VL2A 3H1HE 1VQ9P 3B5NA 1ZLLA 2JP3A 1J1EB 2R44A 3M9BA 3L74G 3O8ZA 2YKOA 1UIIA 4PD4E 3VYIA 1EDKA 1T3JA 1U7MA 1ZN5A 3FX0A 1OVUA 3L74J 2WZ7A 2QIWA 5KLVE 2KZIA 3L37A 2NPSA 5KAIH 1BE3G 3P8CD 4KT0J 1AVYA 4IFFA 1OIPA 4NPEA 1SQXE 3L75D 4ASWA 3VOPA 3T97B 4L75A 1DEBA 4H44D 3L4FA 1BE3J 3JCUE 3RL0g 2QJYB 3S1KA 4IFDK 2IFMA 3P7KA 1JNMA 1S72P 2QJPC 2M0BA 2ZXEB 2JO1A 3KYQA 1FZAA 1RF0C 4IFMA 3ABVC 1N7LA 3A2AA 3H6PA 1CI6A 3AEBC 1SQQE 4WVZA 3CWBE 3HRNA 5APWA 1L4AD 1PZQA 3O6QB 1GW3A 3MD0A 2W6BA 5AW3B 3V5BA 3RK3C 1RF0A 1L0LD 3HE5A 1BE3D 5CCHC 2QM8A 5APXA 1NGMB 3CPWO 1EXIA 4K3AA 1DX7A 3CCJP 5CCGD 1EZVI 1KFMA 2CPBA 1FZCB 1KYOH 1JY2N 3L73D 1URQA 4H0LC 3OW2O 4OWFA 2FBWC 3CL3D 5CCHA 1USDA 2M3BA 5AVWB 2KNCA 1A02J 4IL6E 3CCUP 2OYIB 1J1EC 1PFIA 1N86A 1EDIA 4PD4I 3H1KG 4N3YB 1AV1A 3MGNA 4U3FE 1TU3F 2BCCD 3GMAA 1IFIA 4W7YA 2LR2A 2XZRA 3R4YA 4D6TE 5AVVB 4C7NA 3H1KJ 2YO2A 3TYYA 1L0NK 4JPZB 1MFTA 2Q3IA 3JCUH 3A3YB 2YNYA 4Y28J 1BCCD 2V7QH 3II6A 4KHXA 3UIAA 2NRGA 2B87B 1SP4A 2KXPB 3H1JG 2OGUA 2QA4P 1SLQA 2KI7B 2WSSH 4HH2A 2QJYC 4WBAA 1IZNB 3FWLA 2P2UA 2OARA 1PPJG 5DJUB 2PFXA 3H1JJ 5BU5A 5AW6B 1QL2A 4YTPC 2WT7B 2D2CB 1PL5A 5KAFE 4HJGH 2Q1KA 2IZ1A 3T97A 1SQVE 4PJ0E 5APUA 3CMAP 2G3AA 4N6JA 1N7SD 1G2CB 3RL0D 3MZWB 1FOSE 1M90Q 1NTMD 2W83C 3AEFC 3WU2H 4GOFA 3L70D 1LWUB 1M7LA 2O01J 3CCMP 1MUUA 3CXHH 2ZYGA 3QWOC 3BCCE 5AVUB 3RBZA 3O6QA 1GD2E 1FZCC 1Q86Q 3W67A 1H88A 5APQA 2WITA 2Y9ZA 1GZLA 4CPGA 2ITAA 3L36A 3MUDC 4IL6H 5AW2B 1PPJD 2RMZA 1WMKA 1NKZB 1VF5B 1KD1Q 3GF3A 1W2BO 5TJHA 2OYIC 2O1JA 1FZCA 3GG2A 2YXQB 2YIUB 4ASVA 1M1KQ 5KLVK 3H1IE 2N1TD 3TNUB 5GTHE 1SQBD 1VQLP 1BDDA 1SFCB 3D6YA 1SQXK 1FAVA 3JC22 3HTKB 3TGUE 5E79E 2OYIA 1VQ4P 3A0BE 1MV8A 2E42A 2R3SA 2H89C 1JOCA 1NTZD 4JBZA 3PHLA 4MN4C 2YKPA 3L35A 3B4SA 3PJSK 2E5TA 2KZJA 2E75D 2J59M 2RKLA 2O01H 4PJ0H 3KQGA 1SQQK 2A45H 2KS1B 2D2CC 2R5DA 1FC2C 3USSA 2B87A 1YBKA 1S9KE 5B5EE 1UIXA 2HYNA 3BVHA 1KILE 2A45I 1NH4A 2KSEA 1HGZA 1JCCA 4PV1B 1N73A 3EQ2A 1YJ9P 2OYOA 1DD4A 2IYOA 3GHGA 4M3LA 1OZHA 2WT7A 1P84D 3CX5D 1LWUC 5AW1B 2OYHB 1RF1B 1KB9D 1Z56A 1BGYG 2P1JA 1G2CA 1S5LH 1X9VA 4I7ZB 5KLIB 4ZMDA 1OXZA 1BGYJ 1NU1G
chains in the Genus database with same CATH topology
1JY2O 2WZ7A 3HE4B 5AW8B 3M06A 1N7SC 1LTIC 3L37A 1HVVA 2HFED 3V2PA 1GK4A 2NPSA 2WSFH 4WY4B 1LWUA 3P8CD 4IFFA 5KJ7D 2J58A 1L0LK 1NU1K 3MUDA 5AVZB 3E1IA 4I1LA 3VOPA 4WB4A 4W80A 1KZUB 3HUSA 2MJZA 1DEBA 2Q7CA 4I6MC 3L4FA 2I1JA 2FXMA 1FZGA 3KPEA 2HG5D 1EQ7A 1A02F 2M8RA 2ZFCA 1GDTA 2POHA 4IFDK 3CLQA 2FFDA 2IFMA 1FZFA 3P7KA 4DOJA 1J1DB 1SVFA 5AW0B 1N7SA 1JNMA 1DH3A 3HD7B 5AW4B 2ZXEB 2Z5IA 1SFCC 3KYQA 1FZAA 1RF0C 1LTGC 1JY3P 4IFMA 5AVXB 4GIFA 3SWYA 3U59A 1N7LA 3B8EB 3A2AA 3H6PA 5APSA 1JUNA 4N78D 4AUWA 1N73B 5AVSB 1CI6A 4Y99B 1JTHA 2FYUK 3HRNA 3GHGB 5APWA 1L4AD 4JF7A 1GL2B 1RE3C 3PP5A 3P32A 1AQ5A 1GW3A 3RK2D 2HPCB 3TK1A 3P8CE 1ZV8A 3MD0A 2W6BA 5AW3B 3V5BA 3TNUA 1CW5A 3M0AA 1LTAC 3NTNA 1SFCA 3OA7A 3RK3C 1RF0A 4DZOA 1VDFA 1SQVK 1E5WA 2PAJA 3HE5A 4LC1A 1HGVA 3HTKA 1LTTC 1T8ZA 2N1TC 1YYCA 5CCHC 2QM8A 5APXA 1IFJA 1KILC 1DX7A 1LTBC 5AW9B 1NTKK 1RE3A 3LW5H 5CCGD 1KFMA 2CPBA 1FZCB 2NPSB 1JY3O 2W6AA 1JY2N 4AQRD 2HODB 3VTPC 3G3ZA 2GUVA 1URQA 3IFMA 4N78E 1L4AB 1IK9A 1LTJC 3HUSB 1WRGA 2XU6A 3LIEA 4LGDE 1LT9B 3I5CA 3CL3D 2N1TA 5CCHA 3BASA 2H43A 2M3BA 5AVWB 2WSEH 1GU5A 1KILA 1A02J 1FBMA 2L5GB 2OYIB 1KQLA 1XTGB 2OYHC 1RF1C 1J1EC 3RL0B 5AW5B 1PFIA 1N86A 3VMZA 4N3YB 3RK2C 1GL2D 3MGNA 3M91A 1M1JB 1HH0A 4LLHA 4JYBA 1IFIA 3P8MC 4W7YA 2XZRA 1LTJA 3SWFA 2P67A 2W27A 3B5ND 1T2KC 2FYZA 1SQPK 1GU4A 1FDMA 1RY3A 1FZEA 5AVVB 4C7NA 1JO5A 1NTMK 2YO2A 3TYYA 4EOTA 3NXSA 1L0NK 4WY4C 2C0XA 2Q3IA 1CZQA 3A3YB 1WT6A 2YNYA 1MZ9A 3VN0A 2R5BA 3II6A 4KHXA 3UIAA 1RF1A 5APTA 2OYHA 1SP4A 1FJPA 2Q9IA 2KP8A 2KSJA 2IPPA 1SLQA 4HH2A 1XTCC 1MFZA 2NPSD 3HE5B 4WBAA 1RE4C 2P2UA 2YKQA 2OARA 1J1DC 2WTYA 2N9BA 1IO4A 3NMDA 1JCDA 3HD7C 5BU5A 2KLVA 4WY4A 2C0WA 5AW6B 1QL2A 3VP9A 1J2JB 2WT7B 3U1AA 2FKWB 3B5NB 3A5TA 1T3UA 3IR9A 1AFOA 1URQB 3T97A 4ZKUA 4HYTB 1YTZI 3N4XA 1N73C 5APYA 1JY3N 5APUA 4Y99C 2QM7A 3H32B 1N7SD 4N6JA 1JMMA 1G2CB 3RL0D 3GHGC 1QL1A 3V2QA 1GL2C 1FOSE 1RE4A 1VPCA 1FJKA 1NOHA 3MIWA 5KJ7C 2H8PD 1IC2A 3WMM0 3HD7A 4C7RA 2XDJA 1ZR4A 3MTUE 4C46A 3NFQA 2LKMA 2I1KA 4JYCA 1LWUB 1M7LA 4GT1A 5CMZA 1SQBK 2XKMA 1MUUA 3R2PA 3V2NA 2GUSA 1GK6A 2IX7C 3VP8A 5AVUB 1GL2A 1FU1A 1SFCD 2KYVA 5KJ7A 3V2RA 1GD2E 1LTSC 1FZCC 2HPCA 2NPSC 1NWQA 1H88A 5APQA 4EIJA 2FFDB 1KFNA 2WITA 3BATA 4O9BA 1GZLA 1N7SB 2XNXA 1NHLA 3L36A 1CSBA 1NTZK 5AW2B 1L4AC 1IFDA 5BVZA 2YO3A 3OAKA 1FZBA 3HUSC 2IFNA 1HWTC 1NKZB 2HLOA 1GTWA 2YMYA 5APVA 1LT9C 3M0DC 1FOSF 3VMXA 2KOGA 2JEEA 1ZR2A 1CI6B 2OYIC 1URQD 2O1JA 1HBWA 1JTHB 1N2DC 3RK3D 3N7NA 1H89A 3RL0C 1FZCA 5AVTB 1LGHB 2VRSA 1OWAA 2HODA 3V4QA 5KLVK 1M1JC 2PP6A 4W7ZA 3V4WA 2N1TD 5CCHD 3TNUB 1S9KD 1L4AA 4I2LC 1KILD 5CCGC 2C9NY 1SFCB 1H8AA 4GKGA 1SQXK 2O1KA 3OJAB 1HJBA 1LT9A 3M0DA 2WPSA 1FAVA 3U1CA 3EFGA 2Q5UA 2XV5A 3A7OA 4AYCA 2C9LY 3HTKB 5AVRB 2R32A 2OYIA 3HE4A 3M9HA 1NKNA 4RESB 3VMYA 1IFNA 1MV8A 2E42A 2WWWA 2E43A 1X79B 1NAFA 2P7JA 1JOCA 1M1JA 2WPRA 2YKPA 3L35A 2R3CA 2CPSA 5CHXA 5AVYB 5CCGA 2J59M 3BRVB 3RK3B 3TSIA 5BU8B 2O01H 2JJLA 3CI9A 4B86A 1NO4A 2KB7P 2Z4EA 3KQGA 1X8YA 1SQQK 2A45H 2BASA 1G1JA 2N1TB 3KDPB 5KTBA 1HUCA 2R5DA 3BRTB 4XA4A 1KILB 5AVQB 2H7HA 3B5NC 3C9IA 2A45G 1S9KE 1JY2P 1URQC 1T2KD 2HYNA 3BVHA 2A45I 1NH4A 2Z5HA 1HGZA 1JCCA 3M9QA 4WY4D 2GM4A 1HTLC 1N73A 3EQ2A 1LTJB 1IJDB 1IFMA 5CJ0A 3GHGA 4M3LA 1YTZT 1G1IA 4C7NB 2WT7A 3LIDA 1W2EA 3B5NA 1LWUC 1ZLLA 1GW4A 5AW1B 2OYHB 1RF1B 1J1EB 1Z56A 3M9BA 2WPQA 3H32A 2P1JA 4ZKPA 5CJ4A 3O8ZA 3HD7D 2YKOA 1G2CA 5AW7B 3RK2B 4OH8B 4XE5B 1X9VA 3VYIA 2WSCH 2FFDC 1T3JA 1ZN5A 1OXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HYT B;  2W6A A;  3HE4 B;  2Q5U A;  5AW8 B;  5APY A;  3M06 A;  5APU A;  4AQR D;  2XV5 A;  3VTP C;  2QM7 A;  3A7O A;  3L37 A;  4AYC A;  2C9L Y;  5AVR B;  1GK4 A;  1G2C B;  2R32 A;  3HE4 A;  3M9H A;  4RES B;  1FOS E;  3VMY A;  1MV8 A;  2E42 A;  2WWW A;  2E43 A;  2XU6 A;  3LIE A;  5AVZ B;  1NAF A;  2P7J A;  3I5C A;  2WPR A;  3L35 A;  5AVW B;  2Q7C A;  1GU5 A;  4I6M C;  2R3C A;  1A02 J;  4C46 A;  3NFQ A;  5AVY B;  1A02 F;  2ZFC A;  1KQL A;  4JYC A;  4GT1 A;  5CMZ A;  5AW5 B;  3P7K A;  3VMZ A;  1MUU A;  2JJL A;  5AW0 B;  4B86 A;  1JNM A;  1DH3 A;  3KQG A;  1X8Y A;  5AW4 B;  3MGN A;  1GK6 A;  2BAS A;  3KDP B;  3M91 A;  2ZXE B;  1HUC A;  5AVU B;  2R5D A;  2Z5I A;  4JYB A;  5AVQ B;  3P8M C;  2H7H A;  2XZR A;  1GD2 E;  3SWF A;  2P67 A;  2W27 A;  1T2K C;  1S9K E;  5AVX B;  1T2K D;  1GU4 A;  1NWQ A;  1H88 A;  5APQ A;  2Z5H A;  5AVV B;  4C7N A;  3B8E B;  2YO2 A;  3A2A A;  5APS A;  3TYY A;  4EOT A;  1JUN A;  4AUW A;  3NXS A;  1GZL A;  5AVS B;  1CI6 A;  2Q3I A;  3L36 A;  1CSB A;  1CZQ A;  3A3Y B;  5AW2 B;  2YNY A;  5APW A;  3VN0 A;  2R5B A;  2YO3 A;  3OAK A;  4KHX A;  3UIA A;  5APT A;  1HWT C;  3P32 A;  1GTW A;  1SP4 A;  5APV A;  2KP8 A;  3TK1 A;  4M3L A;  3MD0 A;  5AW3 B;  3V5B A;  3TNU A;  2IPP A;  4C7N B;  3M0A A;  1FOS F;  1SLQ A;  3VMX A;  2WT7 A;  3NTN A;  1CI6 B;  1MFZ A;  3LID A;  1HBW A;  3HE5 B;  1H89 A;  2P2U A;  5AVT B;  4DZO A;  5AW1 B;  2WTY A;  2N9B A;  1IO4 A;  2VRS A;  3M9B A;  3HE5 A;  1OWA A;  3NMD A;  4LC1 A;  3V4Q A;  2WPQ A;  3O8Z A;  3HTK A;  1YYC A;  3V4W A;  2QM8 A;  5AW7 B;  5APX A;  3TNU B;  1S9K D;  5AW6 B;  4XE5 B;  4I2L C;  1J2J B;  2WT7 B;  1OXZ A;  1FAV A;  5AW9 B;  3VYI A;  2C9N Y;  3A5T A;  1H8A A;  4GKG A;  1HJB A;  3IR9 A;  3M0D A;  3T97 A;  2WPS A; 
#chains in the Genus database with same CATH topology
 1JY2 O;  3HE4 B;  3V2P A;  1LWU A;  1VF5 C;  1L0N G;  3L72 D;  3H1L G;  3AE3 C;  4I1L A;  2Y0E A;  1KC8 Q;  2FXM A;  1OMI A;  3KPE A;  1L0N J;  2YIU C;  3H1L J;  4DOJ A;  1SVF A;  1ZME C;  5AW0 B;  3HD7 B;  5AW4 B;  3Q1M A;  5E79 H;  4BXL A;  4U7J A;  1SFC C;  2FYU G;  2E74 B;  1VQ7 P;  1Q81 Q;  1AQT A;  4RO0 A;  2QJK B;  3B8E B;  1JUN A;  3KZI E;  4A7P A;  3AE2 C;  2FYU J;  1RE3 C;  3PP5 A;  2M5A A;  2HPC B;  1LT1 A;  3P8C E;  1Q90 D;  1MKM A;  3TNU A;  4KJM A;  2ZXX A;  3L75 E;  1SFC A;  2FXP A;  1NU1 D;  2QSI A;  4EYY Q;  5B5E H;  1PIX A;  1SQV K;  1HGV A;  3HTK A;  1VQO P;  3H1L D;  1LTB C;  1EZV G;  1RE3 A;  3A0H E;  3CCL P;  4PV1 C;  5B66 H;  1EDL A;  2MKV A;  1R8E A;  2GA1 A;  3IFM A;  4XFJ A;  2QEX P;  3HUS B;  1WRG A;  4WWI A;  3I5C A;  2FYU D;  2KS1 A;  2WSE H;  1GU5 A;  1QGK B;  3PTZ A;  2OYH C;  1RF1 C;  4UB6 E;  3RL0 B;  1L0L E;  3VMZ A;  1D7M A;  2K9J B;  3G6E P;  1PGQ A;  1M1J B;  3M91 A;  1HH0 A;  2WVR A;  2AEM A;  1VQN P;  4LLH A;  1BE3 E;  4OGQ B;  5KLV G;  4I7Z C;  5KLI C;  1LP1 B;  2KLU A;  2P67 A;  3B5N D;  1T2K C;  1M57 D;  2FYZ A;  2IBZ E;  2OTJ P;  4HKZ H;  1NTK D;  2C0X A;  1WT6 A;  2JDI H;  1MZ9 A;  3L73 E;  5KLV J;  2OYH A;  1RF1 A;  2ZYA A;  2Q9I A;  1FJP A;  2KSJ A;  3CCV P;  1EZV D;  2NPS D;  5TIS H;  1OW8 A;  1IO4 A;  2YXR B;  1JCD A;  1KYO D;  2V7Q J;  3HD7 C;  3KZI H;  1Q2N A;  2KLV A;  1BSH A;  3L74 D;  2E76 B;  3I55 P;  3VP9 A;  1Y9B A;  2E74 C;  5L8R J;  3U1A A;  1SQQ G;  3CWB G;  3IR9 A;  2BCC E;  2QJK C;  4HYT B;  3N4X A;  1JY3 N;  2ZT9 B;  3H32 B;  1JMM A;  1QL1 A;  1K73 Q;  1VPC A;  1NOH A;  5KJ7 C;  4K35 A;  1SQQ J;  3WMM 0;  3CWB J;  1BCC E;  3HD7 A;  4C7R A;  2H88 C;  4H13 B;  2I1K A;  3A0H H;  4JYC A;  2OTK E;  1N8R Q;  2UWJ E;  4TLF A;  2GUS A;  3CCE P;  2SPZ A;  4IOI H;  1USE A;  5KJ7 A;  3V2R A;  1PGP A;  2HPC A;  2FFD B;  4PD4 H;  2XNX A;  1CSB A;  5BVZ A;  1FZB A;  3HUS C;  2IFN A;  2HLO A;  1SQP E;  3M0D C;  3G71 P;  1KQF B;  1KQS O;  1NTM E;  2M3E A;  2KOG A;  1URQ D;  1JTH B;  2DW3 A;  3RK3 D;  3RL0 C;  4U3F G;  1K05 A;  2VRS A;  1OWA A;  3L70 E;  1M1J C;  4W7Z A;  5CCH D;  4D6T G;  4OGQ C;  2IBZ I;  4L73 A;  2WSC J;  4U3F J;  1EDJ A;  1H8A A;  4GKG A;  3CME P;  3M0D A;  3U1C A;  3AE5 C;  4L76 A;  4RKU J;  3FXE A;  2XV5 A;  3A7O A;  2C9L Y;  4D6T J;  1YHQ P;  2R32 A;  1NKN A;  4H0L D;  3VMY A;  1IFN A;  1X79 B;  2K9J A;  2P7J A;  1M1J A;  3CXH D;  2CPS A;  3RGU A;  2OQQ A;  3BRV B;  3TSI A;  3FWN A;  1PV3 A;  1VQ6 P;  4TT3 H;  4EDF A;  1RH5 B;  3CI9 A;  1NAY A;  1NO4 A;  3CCQ P;  2E76 C;  3H1K D;  1HUC A;  1SQV G;  4XA4 A;  1KIL B;  5AVQ B;  2A45 G;  1JY2 P;  2Z5H A;  1SQB E;  3AEG C;  2ZT9 C;  2QE7 H;  3M9Q A;  1SQV J;  2GM4 A;  2A06 G;  3G4S P;  1YIJ P;  4YXW H;  1ZRT D;  1YTZ T;  1G1I A;  2CK3 H;  1NYH A;  3H1J D;  1KMI Z;  4H13 C;  3LID A;  1W2E A;  3S9O A;  1NTZ E;  3D6Z A;  3BCC G;  3CD6 P;  3I56 P;  3H32 A;  4ZKP A;  1R5S A;  2WPV B;  4OH8 B;  4XE5 B;  4R4L A;  4OVN F;  3BCC J;  2WSC H;  2FFD C;  1OVV A;  5AW8 B;  3M06 A;  2BEQ D;  1LTI C;  1HVV A;  1GK4 A;  2WSF H;  5C39 A;  3TDK A;  1QEX A;  4WY4 B;  4YXD C;  4YPC A;  1L0L K;  3MUD A;  5GTI E;  2PGD A;  1SQV D;  2W8Z A;  4W80 A;  1KZU B;  2Q7C A;  1K04 A;  3GF7 A;  1FZG A;  2I1J A;  2HG5 D;  3H1I G;  1A02 F;  2ZFC A;  2POH A;  3CLQ A;  2FFD A;  1P84 E;  1FZF A;  3CX5 E;  1J1D B;  2RH0 A;  3G9R A;  1DH3 A;  2A06 D;  1HF9 A;  1KB9 E;  1Y8A A;  3H1I J;  1IFP A;  5DJT B;  2LXC B;  3TGU G;  1Y47 A;  1FDI A;  5KAF H;  4N78 D;  4AUW A;  3SSU A;  5AVS B;  4GOD A;  4Y99 B;  1KQG B;  1JTH A;  2AXT E;  2QVA A;  4JF7 A;  1EC5 A;  3TGU J;  3P32 A;  3RK2 D;  3TK1 A;  1DEE G;  3M0A A;  3TF5 A;  3L72 E;  2Q3E A;  1QX8 A;  3NTN A;  4H44 B;  3OA7 A;  1YJW P;  4BRY B;  3CCR P;  3AE1 C;  4DZO A;  1VDF A;  1PP9 E;  3WUU A;  2PAJ A;  4LC1 A;  1LTT C;  1T8Z A;  1M56 D;  1KIL C;  1EXJ A;  5AW9 B;  2NPS B;  1JY3 O;  3AE8 C;  2HOD B;  4QMA A;  3WUV A;  4GOE A;  2JWD A;  1L4A B;  2XND H;  3LIE A;  1KV4 A;  3BAS A;  2H43 A;  1KIL A;  3W68 A;  1FBM A;  2L5G B;  1KQL A;  5AW5 B;  1NU1 E;  3MHV A;  1GL2 D;  2QG4 A;  4HB1 A;  1ZOY C;  4JYB A;  2D2C D;  3P8M C;  3SWF A;  2WSE J;  1SQP K;  1FDM A;  5GTI H;  1K9M Q;  1RY3 A;  1FZE A;  1OW7 A;  5KAI E;  5GTH H;  1S3J A;  1NTM K;  4EOT A;  2KIK A;  4WY4 C;  1CZQ A;  3CX5 H;  1IK7 A;  3A0B H;  2LXB A;  2JR8 A;  1RQV A;  2IPP A;  3MP7 B;  1KB9 H;  1MFZ A;  3K5B A;  3CX5 I;  2FYU E;  3HE5 B;  1RE4 C;  3L71 G;  2YKQ A;  1J1D C;  1KB9 I;  2N9B A;  2IYP A;  2IZ0 A;  3C1L A;  1BGY D;  4WY4 A;  2WMM A;  2V4H A;  1J2J B;  2AXT H;  1R5L A;  4BWN A;  4GDO A;  3QH9 A;  2W6J H;  3L71 J;  3A5T A;  1T3U A;  1URQ B;  2OTL P;  4ZKU A;  1S2E A;  4Y99 C;  3Q3D A;  3V2Q A;  2G8Y A;  1RE4 A;  2H8P D;  1VF5 D;  1NTK E;  1IC2 A;  4NPF X;  1L0N D;  3H25 A;  1ZR4 A;  1S1C X;  3MTU E;  4H44 C;  1QLE D;  2LKM A;  1EZV E;  3L75 J;  1RHZ B;  4GT1 A;  1QVF O;  5CMZ A;  3D71 A;  1SQB K;  2XKM A;  2L91 A;  1LNQ A;  2IX7 C;  3VP8 A;  3H1H G;  1KYO E;  5CBO A;  1FU1 A;  1SFC D;  3L74 E;  2KYV A;  1LTS C;  2NPS C;  1NWQ A;  4EIJ A;  2RN0 A;  3ITK A;  1KFN A;  4O9B A;  1M8O B;  4Z1M H;  1N7S B;  3H1H J;  2Y0D A;  3L71 D;  4BRY A;  1NTZ K;  1L4A C;  1ZP0 C;  1IFD A;  2YO3 A;  3Q5P A;  2BEZ F;  2K37 A;  1L0L G;  2JEE A;  1ZR2 A;  3FXD A;  1HBW A;  1N2D C;  5H2F E;  3S4R A;  3N7N A;  3IAO A;  5AVT B;  1SQX G;  2HOD A;  3AE7 C;  3PH0 A;  1Q7Y Q;  3V4W A;  2IBZ G;  3VMA A;  1L0L J;  2O01 N;  1L4A A;  4I2L C;  3E1R A;  5CCG C;  2C9N Y;  3OJA B;  1SQX J;  2AEF A;  3L73 G;  4PV1 D;  3EFG A;  4AYC A;  4IL6 X;  3HE4 A;  3M9H A;  2PRR A;  2WWW A;  3C8V A;  3GW6 A;  3L73 J;  1L2P A;  3H1H D;  3AEA C;  1NAF A;  3IF4 A;  5KKZ B;  2WPR A;  4ZNC A;  1S4X A;  3SWK A;  2R3C A;  1U7J A;  3F5H A;  5CHX A;  5AVY B;  5CCG A;  1VQ5 P;  2ZVN B;  5BU8 B;  2Y0C A;  2HR3 A;  3RK3 E;  2JJL A;  4PD4 D;  4B86 A;  2KB7 P;  2N9Y B;  2BCC G;  2BAS A;  3KDP B;  1G1J A;  2N1T B;  3B71 A;  2JWA A;  1RQU A;  2H7H A;  3PRJ A;  3C9I A;  4DT0 A;  5KLV D;  1URQ C;  1T2K D;  1LJ2 A;  2Y9Y A;  2BCC J;  3V6I A;  1BCC G;  1SQX D;  2FXO A;  1HTL C;  3E7K A;  1LTJ B;  5CJ0 A;  2IBZ D;  3WU2 E;  3SFE C;  1BCC J;  3CXH E;  2E75 B;  1GW4 A;  3GLM A;  1KYO I;  2WPQ A;  5CJ4 A;  1KN7 A;  3HD7 D;  5AW7 B;  4UB6 H;  3RK2 B;  3LW5 J;  2E74 D;  2ZJS E;  2KUB A;  3H1K E;  2AXC A;  1SQQ D;  3CWB D;  1AA0 A;  1N7S C;  2FYN B;  2HFE D;  1SQP G;  1BSN A;  3KHU A;  5H2F H;  1NTM G;  2JKV A;  5KJ7 D;  2J58 A;  1NU1 K;  1X0T A;  1HJ0 A;  5CBN A;  1JMB A;  5AVZ B;  3E1I A;  2K9Y A;  4WB4 A;  3HUS A;  2MJZ A;  1SQP J;  1ZRT E;  4I6M C;  1JB0 J;  3L70 G;  1NTM J;  1EQ7 A;  4DJG A;  2M8R A;  1GDT A;  3H1J E;  2WSF J;  1N7S A;  1S5L X;  2J5U A;  2Z5I A;  3AE4 C;  1PPJ E;  3L70 J;  1ZXG A;  1LTG C;  1JY3 P;  5AVX B;  3RBX A;  4GIF A;  3SWY A;  3U59 A;  1LP1 A;  5APS A;  1N73 B;  1VQ8 P;  2FYU K;  3GHG B;  1GL2 B;  1AQ5 A;  1BDC A;  3JSV C;  1ZV8 A;  3FGA D;  5KKZ C;  1CW5 A;  1LTA C;  1OX3 A;  3AEC C;  4R4M A;  4U3F D;  1E5W A;  1SQP D;  2B89 A;  1DIP A;  2AEJ A;  2N1T C;  1YYC A;  1IFJ A;  1DD3 A;  1SQB G;  4OGQ D;  1U57 A;  4D6T D;  2A06 E;  1NTK K;  3LW5 H;  1NVO A;  2Q6Q A;  2W6A A;  4NPD A;  4AQR D;  3VTP C;  3G3Z A;  2GUV A;  2QRX A;  1SQB J;  4N78 E;  1IK9 A;  1LTJ C;  5K5G B;  3PLN A;  2XU6 A;  1NTZ G;  4LGD E;  1LT9 B;  2N1T A;  3CXH I;  2E5Y A;  1YJN P;  1AJY A;  2E75 C;  4EI2 A;  3CC7 P;  1XTG B;  1S5L E;  4RJT A;  1NTZ J;  2ZAE B;  3RK2 C;  2YMK A;  2E76 D;  2ZVO B;  1LTJ A;  2W27 A;  1JM0 A;  2NZ2 A;  3Q5S A;  1KOR A;  1GU4 A;  3ZDM A;  2FYN C;  1JO5 A;  1ZW0 A;  2ZT9 D;  3NXS A;  2M5A B;  3Q5R A;  3VN0 A;  4DCK A;  2R5B A;  4UB8 E;  1VQM P;  5APT A;  3KXD A;  2KP8 A;  1PGJ A;  1YIT P;  1JEK A;  1XTC C;  1VQK P;  4H13 D;  1FDO A;  2K88 A;  2WTY A;  3BCC D;  3NMD A;  1H0T B;  1PGO A;  2C0W A;  2K3R A;  1FS0 E;  2B88 A;  2FKW B;  3B5N B;  1AFO A;  1YTZ I;  1NJI Q;  1N73 C;  5APY A;  2QM7 A;  3D70 A;  2B9B A;  3GHG C;  1K8A Q;  1GL2 C;  5EFW B;  2O3J A;  3MIW A;  1FJK A;  3L72 G;  1YI2 P;  4L74 A;  2XDJ A;  1PP9 G;  1QVG O;  4C46 A;  3NFQ A;  3L72 J;  3H1I D;  3R2P A;  3V2N A;  1PP9 J;  1GK6 A;  3EFF K;  1X22 A;  1GL2 A;  5B66 E;  1T6A A;  1BGY E;  3SFD C;  5M1B A;  3TGU D;  1E79 H;  1VQP P;  3BAT A;  2ZYD A;  1NHL A;  3AE6 C;  1OFC X;  3OAK A;  1HWT C;  1GTW A;  2YMY A;  5APV A;  3AEE C;  1LT9 C;  1FOS F;  3VMX A;  3WUT A;  3EWK A;  1L0N E;  1KTM A;  1CI6 B;  3H1L E;  2KK7 A;  3CC2 P;  1H89 A;  2I8D A;  1LGH B;  3V4Q A;  1W5C E;  2PP6 A;  2QJP B;  1S9K D;  1P84 H;  1NU1 J;  1KIL D;  2IDB A;  4UB8 H;  3CCS P;  1HJB A;  2O1K A;  1AVO A;  1PP9 D;  1LT9 A;  3CC4 P;  2WPS A;  1P84 I;  2Q5U A;  2K1A A;  5AVR B;  2W90 A;  4RES B;  1GMJ A;  2FY8 A;  2E43 A;  3L71 E;  1YQ3 C;  1OVR A;  2WQY C;  3AED C;  3Q2Y A;  1FE6 A;  1Q82 Q;  5TIS E;  3RK3 B;  1SS1 A;  3AE9 C;  2P10 A;  3F89 A;  2Z4E A;  1X8Y A;  3L75 G;  5KTB A;  3BRT B;  2KNC B;  3B5N C;  4JQ0 D;  1OW6 A;  2P58 A;  1NTK G;  1YQ4 C;  4WY4 D;  4H0L B;  3IN6 A;  1IJD B;  1IFM A;  1H0T A;  1NTK J;  4C7N B;  1VL2 A;  3H1H E;  1VQ9 P;  3B5N A;  1ZLL A;  2JP3 A;  1J1E B;  2R44 A;  3M9B A;  3L74 G;  3O8Z A;  2YKO A;  1UII A;  4PD4 E;  3VYI A;  1EDK A;  1T3J A;  1U7M A;  1ZN5 A;  3FX0 A;  1OVU A;  3L74 J;  2WZ7 A;  2QIW A;  5KLV E;  2KZI A;  3L37 A;  2NPS A;  5KAI H;  1BE3 G;  3P8C D;  4KT0 J;  1AVY A;  4IFF A;  1OIP A;  4NPE A;  1SQX E;  3L75 D;  4ASW A;  3VOP A;  3T97 B;  4L75 A;  1DEB A;  4H44 D;  3L4F A;  1BE3 J;  3JCU E;  3RL0 g;  2QJY B;  3S1K A;  4IFD K;  2IFM A;  3P7K A;  1JNM A;  1S72 P;  2QJP C;  2M0B A;  2ZXE B;  2JO1 A;  3KYQ A;  1FZA A;  1RF0 C;  4IFM A;  3ABV C;  1N7L A;  3A2A A;  3H6P A;  1CI6 A;  3AEB C;  1SQQ E;  4WVZ A;  3CWB E;  3HRN A;  5APW A;  1L4A D;  1PZQ A;  3O6Q B;  1GW3 A;  3MD0 A;  2W6B A;  5AW3 B;  3V5B A;  3RK3 C;  1RF0 A;  1L0L D;  3HE5 A;  1BE3 D;  5CCH C;  2QM8 A;  5APX A;  1NGM B;  3CPW O;  1EXI A;  4K3A A;  1DX7 A;  3CCJ P;  5CCG D;  1EZV I;  1KFM A;  2CPB A;  1FZC B;  1KYO H;  1JY2 N;  3L73 D;  1URQ A;  4H0L C;  3OW2 O;  4OWF A;  2FBW C;  3CL3 D;  5CCH A;  1USD A;  2M3B A;  5AVW B;  2KNC A;  1A02 J;  4IL6 E;  3CCU P;  2OYI B;  1J1E C;  1PFI A;  1N86 A;  1EDI A;  4PD4 I;  3H1K G;  4N3Y B;  1AV1 A;  3MGN A;  4U3F E;  1TU3 F;  2BCC D;  3GMA A;  1IFI A;  4W7Y A;  2LR2 A;  2XZR A;  3R4Y A;  4D6T E;  5AVV B;  4C7N A;  3H1K J;  2YO2 A;  3TYY A;  1L0N K;  4JPZ B;  1MFT A;  2Q3I A;  3JCU H;  3A3Y B;  2YNY A;  4Y28 J;  1BCC D;  2V7Q H;  3II6 A;  4KHX A;  3UIA A;  2NRG A;  2B87 B;  1SP4 A;  2KXP B;  3H1J G;  2OGU A;  2QA4 P;  1SLQ A;  2KI7 B;  2WSS H;  4HH2 A;  2QJY C;  4WBA A;  1IZN B;  3FWL A;  2P2U A;  2OAR A;  1PPJ G;  5DJU B;  2PFX A;  3H1J J;  5BU5 A;  5AW6 B;  1QL2 A;  4YTP C;  2WT7 B;  2D2C B;  1PL5 A;  5KAF E;  4HJG H;  2Q1K A;  2IZ1 A;  3T97 A;  1SQV E;  4PJ0 E;  5APU A;  3CMA P;  2G3A A;  4N6J A;  1N7S D;  1G2C B;  3RL0 D;  3MZW B;  1FOS E;  1M90 Q;  1NTM D;  2W83 C;  3AEF C;  3WU2 H;  4GOF A;  3L70 D;  1LWU B;  1M7L A;  2O01 J;  3CCM P;  1MUU A;  3CXH H;  2ZYG A;  3QWO C;  3BCC E;  5AVU B;  3RBZ A;  3O6Q A;  1GD2 E;  1FZC C;  1Q86 Q;  3W67 A;  1H88 A;  5APQ A;  2WIT A;  2Y9Z A;  1GZL A;  4CPG A;  2ITA A;  3L36 A;  3MUD C;  4IL6 H;  5AW2 B;  1PPJ D;  2RMZ A;  1WMK A;  1NKZ B;  1VF5 B;  1KD1 Q;  3GF3 A;  1W2B O;  5TJH A;  2OYI C;  2O1J A;  1FZC A;  3GG2 A;  2YXQ B;  2YIU B;  4ASV A;  1M1K Q;  5KLV K;  3H1I E;  2N1T D;  3TNU B;  5GTH E;  1SQB D;  1VQL P;  1BDD A;  1SFC B;  3D6Y A;  1SQX K;  1FAV A;  3JC2 2;  3HTK B;  3TGU E;  5E79 E;  2OYI A;  1VQ4 P;  3A0B E;  1MV8 A;  2E42 A;  2R3S A;  2H89 C;  1JOC A;  1NTZ D;  4JBZ A;  3PHL A;  4MN4 C;  2YKP A;  3L35 A;  3B4S A;  3PJS K;  2E5T A;  2KZJ A;  2E75 D;  2J59 M;  2RKL A;  2O01 H;  4PJ0 H;  3KQG A;  1SQQ K;  2A45 H;  2KS1 B;  2D2C C;  2R5D A;  1FC2 C;  3USS A;  2B87 A;  1YBK A;  1S9K E;  5B5E E;  1UIX A;  2HYN A;  3BVH A;  1KIL E;  2A45 I;  1NH4 A;  2KSE A;  1HGZ A;  1JCC A;  4PV1 B;  1N73 A;  3EQ2 A;  1YJ9 P;  2OYO A;  1DD4 A;  2IYO A;  3GHG A;  4M3L A;  1OZH A;  2WT7 A;  1P84 D;  3CX5 D;  1LWU C;  5AW1 B;  2OYH B;  1RF1 B;  1KB9 D;  1Z56 A;  1BGY G;  2P1J A;  1G2C A;  1S5L H;  1X9V A;  4I7Z B;  5KLI B;  4ZMD A;  1OXZ A;  1BGY J;  1NU1 G; 
#chains in the Genus database with same CATH homology
 1JY2 O;  2WZ7 A;  3HE4 B;  5AW8 B;  3M06 A;  1N7S C;  1LTI C;  3L37 A;  1HVV A;  2HFE D;  3V2P A;  1GK4 A;  2NPS A;  2WSF H;  4WY4 B;  1LWU A;  3P8C D;  4IFF A;  5KJ7 D;  2J58 A;  1L0L K;  1NU1 K;  3MUD A;  5AVZ B;  3E1I A;  4I1L A;  3VOP A;  4WB4 A;  4W80 A;  1KZU B;  3HUS A;  2MJZ A;  1DEB A;  2Q7C A;  4I6M C;  3L4F A;  2I1J A;  2FXM A;  1FZG A;  3KPE A;  2HG5 D;  1EQ7 A;  1A02 F;  2M8R A;  2ZFC A;  1GDT A;  2POH A;  4IFD K;  3CLQ A;  2FFD A;  2IFM A;  1FZF A;  3P7K A;  4DOJ A;  1J1D B;  1SVF A;  5AW0 B;  1N7S A;  1JNM A;  1DH3 A;  3HD7 B;  5AW4 B;  2ZXE B;  2Z5I A;  1SFC C;  3KYQ A;  1FZA A;  1RF0 C;  1LTG C;  1JY3 P;  4IFM A;  5AVX B;  4GIF A;  3SWY A;  3U59 A;  1N7L A;  3B8E B;  3A2A A;  3H6P A;  5APS A;  1JUN A;  4N78 D;  4AUW A;  1N73 B;  5AVS B;  1CI6 A;  4Y99 B;  1JTH A;  2FYU K;  3HRN A;  3GHG B;  5APW A;  1L4A D;  4JF7 A;  1GL2 B;  1RE3 C;  3PP5 A;  3P32 A;  1AQ5 A;  1GW3 A;  3RK2 D;  2HPC B;  3TK1 A;  3P8C E;  1ZV8 A;  3MD0 A;  2W6B A;  5AW3 B;  3V5B A;  3TNU A;  1CW5 A;  3M0A A;  1LTA C;  3NTN A;  1SFC A;  3OA7 A;  3RK3 C;  1RF0 A;  4DZO A;  1VDF A;  1SQV K;  1E5W A;  2PAJ A;  3HE5 A;  4LC1 A;  1HGV A;  3HTK A;  1LTT C;  1T8Z A;  2N1T C;  1YYC A;  5CCH C;  2QM8 A;  5APX A;  1IFJ A;  1KIL C;  1DX7 A;  1LTB C;  5AW9 B;  1NTK K;  1RE3 A;  3LW5 H;  5CCG D;  1KFM A;  2CPB A;  1FZC B;  2NPS B;  1JY3 O;  2W6A A;  1JY2 N;  4AQR D;  2HOD B;  3VTP C;  3G3Z A;  2GUV A;  1URQ A;  3IFM A;  4N78 E;  1L4A B;  1IK9 A;  1LTJ C;  3HUS B;  1WRG A;  2XU6 A;  3LIE A;  4LGD E;  1LT9 B;  3I5C A;  3CL3 D;  2N1T A;  5CCH A;  3BAS A;  2H43 A;  2M3B A;  5AVW B;  2WSE H;  1GU5 A;  1KIL A;  1A02 J;  1FBM A;  2L5G B;  2OYI B;  1KQL A;  1XTG B;  2OYH C;  1RF1 C;  1J1E C;  3RL0 B;  5AW5 B;  1PFI A;  1N86 A;  3VMZ A;  4N3Y B;  3RK2 C;  1GL2 D;  3MGN A;  3M91 A;  1M1J B;  1HH0 A;  4LLH A;  4JYB A;  1IFI A;  3P8M C;  4W7Y A;  2XZR A;  1LTJ A;  3SWF A;  2P67 A;  2W27 A;  3B5N D;  1T2K C;  2FYZ A;  1SQP K;  1GU4 A;  1FDM A;  1RY3 A;  1FZE A;  5AVV B;  4C7N A;  1JO5 A;  1NTM K;  2YO2 A;  3TYY A;  4EOT A;  3NXS A;  1L0N K;  4WY4 C;  2C0X A;  2Q3I A;  1CZQ A;  3A3Y B;  1WT6 A;  2YNY A;  1MZ9 A;  3VN0 A;  2R5B A;  3II6 A;  4KHX A;  3UIA A;  1RF1 A;  5APT A;  2OYH A;  1SP4 A;  1FJP A;  2Q9I A;  2KP8 A;  2KSJ A;  2IPP A;  1SLQ A;  4HH2 A;  1XTC C;  1MFZ A;  2NPS D;  3HE5 B;  4WBA A;  1RE4 C;  2P2U A;  2YKQ A;  2OAR A;  1J1D C;  2WTY A;  2N9B A;  1IO4 A;  3NMD A;  1JCD A;  3HD7 C;  5BU5 A;  2KLV A;  4WY4 A;  2C0W A;  5AW6 B;  1QL2 A;  3VP9 A;  1J2J B;  2WT7 B;  3U1A A;  2FKW B;  3B5N B;  3A5T A;  1T3U A;  3IR9 A;  1AFO A;  1URQ B;  3T97 A;  4ZKU A;  4HYT B;  1YTZ I;  3N4X A;  1N73 C;  5APY A;  1JY3 N;  5APU A;  4Y99 C;  2QM7 A;  3H32 B;  1N7S D;  4N6J A;  1JMM A;  1G2C B;  3RL0 D;  3GHG C;  1QL1 A;  3V2Q A;  1GL2 C;  1FOS E;  1RE4 A;  1VPC A;  1FJK A;  1NOH A;  3MIW A;  5KJ7 C;  2H8P D;  1IC2 A;  3WMM 0;  3HD7 A;  4C7R A;  2XDJ A;  1ZR4 A;  3MTU E;  4C46 A;  3NFQ A;  2LKM A;  2I1K A;  4JYC A;  1LWU B;  1M7L A;  4GT1 A;  5CMZ A;  1SQB K;  2XKM A;  1MUU A;  3R2P A;  3V2N A;  2GUS A;  1GK6 A;  2IX7 C;  3VP8 A;  5AVU B;  1GL2 A;  1FU1 A;  1SFC D;  2KYV A;  5KJ7 A;  3V2R A;  1GD2 E;  1LTS C;  1FZC C;  2HPC A;  2NPS C;  1NWQ A;  1H88 A;  5APQ A;  4EIJ A;  2FFD B;  1KFN A;  2WIT A;  3BAT A;  4O9B A;  1GZL A;  1N7S B;  2XNX A;  1NHL A;  3L36 A;  1CSB A;  1NTZ K;  5AW2 B;  1L4A C;  1IFD A;  5BVZ A;  2YO3 A;  3OAK A;  1FZB A;  3HUS C;  2IFN A;  1HWT C;  1NKZ B;  2HLO A;  1GTW A;  2YMY A;  5APV A;  1LT9 C;  3M0D C;  1FOS F;  3VMX A;  2KOG A;  2JEE A;  1ZR2 A;  1CI6 B;  2OYI C;  1URQ D;  2O1J A;  1HBW A;  1JTH B;  1N2D C;  3RK3 D;  3N7N A;  1H89 A;  3RL0 C;  1FZC A;  5AVT B;  1LGH B;  2VRS A;  1OWA A;  2HOD A;  3V4Q A;  5KLV K;  1M1J C;  2PP6 A;  4W7Z A;  3V4W A;  2N1T D;  5CCH D;  3TNU B;  1S9K D;  1L4A A;  4I2L C;  1KIL D;  5CCG C;  2C9N Y;  1SFC B;  1H8A A;  4GKG A;  1SQX K;  2O1K A;  3OJA B;  1HJB A;  1LT9 A;  3M0D A;  2WPS A;  1FAV A;  3U1C A;  3EFG A;  2Q5U A;  2XV5 A;  3A7O A;  4AYC A;  2C9L Y;  3HTK B;  5AVR B;  2R32 A;  2OYI A;  3HE4 A;  3M9H A;  1NKN A;  4RES B;  3VMY A;  1IFN A;  1MV8 A;  2E42 A;  2WWW A;  2E43 A;  1X79 B;  1NAF A;  2P7J A;  1JOC A;  1M1J A;  2WPR A;  2YKP A;  3L35 A;  2R3C A;  2CPS A;  5CHX A;  5AVY B;  5CCG A;  2J59 M;  3BRV B;  3RK3 B;  3TSI A;  5BU8 B;  2O01 H;  2JJL A;  3CI9 A;  4B86 A;  1NO4 A;  2KB7 P;  2Z4E A;  3KQG A;  1X8Y A;  1SQQ K;  2A45 H;  2BAS A;  1G1J A;  2N1T B;  3KDP B;  5KTB A;  1HUC A;  2R5D A;  3BRT B;  4XA4 A;  1KIL B;  5AVQ B;  2H7H A;  3B5N C;  3C9I A;  2A45 G;  1S9K E;  1JY2 P;  1URQ C;  1T2K D;  2HYN A;  3BVH A;  2A45 I;  1NH4 A;  2Z5H A;  1HGZ A;  1JCC A;  3M9Q A;  4WY4 D;  2GM4 A;  1HTL C;  1N73 A;  3EQ2 A;  1LTJ B;  1IJD B;  1IFM A;  5CJ0 A;  3GHG A;  4M3L A;  1YTZ T;  1G1I A;  4C7N B;  2WT7 A;  3LID A;  1W2E A;  3B5N A;  1LWU C;  1ZLL A;  1GW4 A;  5AW1 B;  2OYH B;  1RF1 B;  1J1E B;  1Z56 A;  3M9B A;  2WPQ A;  3H32 A;  2P1J A;  4ZKP A;  5CJ4 A;  3O8Z A;  3HD7 D;  2YKO A;  1G2C A;  5AW7 B;  3RK2 B;  4OH8 B;  4XE5 B;  1X9V A;  3VYI A;  2WSC H;  2FFD C;  1T3J A;  1ZN5 A;  1OXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...