3L37A

Pie12 d-peptide against hiv entry
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
b'RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
molecule tags De novo protein
total genus 20
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l37A00
1GU5A 3M0DA 2R5BA 1HJBA 1MFZA 3V4WA 2ZFCA 2Q3IA 3M0AA 3TYYA 2Q5UA 3MD0A 1CSBA 4GKGA 4C7NB 4GT1A 3OAKA 1T2KC 4AUWA 4M3LA 5APTA 3L36A 2Z5IA 3TNUA 3I5CA 3T97A 2XV5A 3HE5A 5AW8B 1JUNA 1SP4A 4C46A 2JJLA 4LC1A 5AVTB 1H8AA 2P7JA 2WWWA 3MGNA 1NAFA 3NTNA 3HE4A 3M06A 2WPSA 2YO3A 2KP8A 1A02J 3KDPB 5AW0B 3SWFA 3M9BA 1GK4A 1A02F 3TK1A 1OXZA 1IO4A 2H7HA 3A3YB 4RESB 2QM8A 1CI6A 3V5BA 2YO2A 3VMXA 1MV8A 2WTYA 5AW2B 3A7OA 3A2AA 1CZQA 4KHXA 4AYCA 1FOSE 2WPRA 1GK6A 3A5TA 5CMZA 3NMDA 3P8MC 2P67A 3VMYA 5AVSB 2W6AA 5APUA 3O8ZA 5APQA 5AVVB 3VTPC 1GZLA 5AW3B 2Q7CA 3LIDA 4C7NA 1KQLA 3M9HA 4I2LC 5AVWB 2N9BA 3UIAA 1G2CB 4AQRD 5AW5B 1YYCA 4B86A 5APWA 2YNYA 1DH3A 5AVUB 3L35A 2XZRA 1H88A 2C9LY 1SLQA 3NFQA 5AVYB 4I6MC 3V4QA 2WT7B 2E43A 2XU6A 1HUCA 1H89A 5APVA 1GD2E 5AVXB 1GTWA 1MUUA 3HTKA 3B8EB 1HWTC 2Z5HA 5APYA 1FOSF 5AW6B 3VN0A 1S9KD 3IR9A 3L37A 4JYCA 5AW1B 1HBWA 1OWAA 1FAVA 3TNUB 4JYBA 3P7KA 3VYIA 4XE5B 3VMZA 2QM7A 1JNMA 5AW9B 3HE5B 2R3CA 2W27A 1GU4A 2VRSA 2BASA 2WPQA 2P2UA 3HE4B 2ZXEB 1T2KD 1X8YA 3NXSA 5APXA 5AVQB 5AVRB 3KQGA 2C9NY 2IPPA 3P32A 4DZOA 4HYTB 5APSA 1CI6B 1J2JB 2R5DA 3M91A 2R32A 5AW7B 1S9KE 1NWQA 3LIEA 4EOTA 5AVZB 2E42A 2WT7A 5AW4B
chains in the Genus database with same CATH superfamily
5B66H 2IZ1A 3C8VA 1KILD 1T3UA 3EQ2A 1KD1Q 3FWNA 2R3SA 2ZFCA 4OGQD 2Q3IA 1LTSC 3OAKA 3GG2A 2M0BA 1N7LA 3EFFK 1JUNA 3L75G 2QJPB 1XTGB 2M8RA 3CI9A 1S5LE 1JY3O 3LW5J 3TK1A 1RQVA 1Q82Q 5CCHA 1KYOE 2D2CC 1QGKB 1FOSE 1BSNA 1NTKJ 1GK6A 1R8EA 5CMZA 2FYZA 1YITP 1OVUA 2N9BA 4OWFA 2WSCJ 4YXWH 3R2PA 3RK3D 1H88A 3L74D 4U3FG 2M5AA 1ZW0A 3JSVC 1LJ2A 1L0LJ 3AEFC 4L74A 1EC5A 3VN0A 3HD7B 2FFDC 1YI2P 1HBWA 3RGUA 1ZXGA 4WY4C 2FBWC 5KKZB 1JNMA 1WMKA 3L71G 1HVVA 4PJ0H 3E1IA 1R5LA 2QRXA 1SQVK 3QWOC 3AE1C 3HUSC 2KOGA 3M9QA 1SQVG 1VPCA 1L0NJ 3L70G 3V2RA 1OMIA 5KLVD 2IX7C 2NPSD 2R5BA 3CCJP 2ZYAA 2MJZA 1KC8Q 3MD0A 4D6TE 1NTKG 1NHLA 1K73Q 1MZ9A 1Q7YQ 1K04A 2WZ7A 2B88A 3S9OA 3JCUH 5GTIH 2H7HA 2NRGA 2RN0A 1LWUC 1AV1A 2D2CD 3D6YA 3KYQA 2QA4P 1YJ9P 5CHXA 3H32B 1J1EC 1ZR4A 2B87A 1LTJB 2WQYC 1T8ZA 2WSFJ 1IFIA 3WU2H 2KZIA 1PZQA 1YYCA 3IN6A 3RK2D 1NKZB 1DD3A 3Q5RA 2W83C 1OIPA 5KKZC 1X0TA 2WMMA 4NPDA 3TF5A 2WSEH 4O9BA 3GF7A 1HWTC 4KJMA 1S9KD 3L37A 2JO1A 4W7YA 3P7KA 4H13B 3VMZA 3BRVB 2KYVA 3ABVC 2W27A 3L71E 1SQPJ 1PP9G 3AE4C 2OQQA 4K3AA 1JCCA 1M1JB 3BVHA 2HR3A 5APSA 4UB6H 2KS1A 3AECC 2JR8A 1HH0A 3G4SP 2OTLP 2FYNC 5CJ0A 3AE2C 4I7ZB 1LT9A 1AQTA 2JWAA 3RBXA 1LP1A 3B4SA 4GT1A 4C7NB 1T2KC 1NTKE 2Z5IA 3GF3A 4C46A 2JJLA 5GTHE 1QL2A 1N7SD 1FZEA 2WPSA 3AEAC 1IO4A 1U57A 2JEEA 1MV8A 2N1TC 2OYHA 1L0LE 4EDFA 2IDBA 2O3JA 3H1KG 1M90Q 3B5NC 1N86A 2KIKA 3H1JJ 3WMM0 1AA0A 1P84D 1Q86Q 2OGUA 3UIAA 3VP9A 2ZT9B 1JY2O 1RHZB 3MUDC 3W67A 2E43A 1KN7A 2B89A 4IFMA 2XU6A 1KQSO 1G2CA 4H0LB 4L76A 2E74C 1L0NE 3IAOA 4DJGA 2ZXXA 3L73J 3Q1MA 1KZUB 1Y8AA 5AW1B 4NPEA 3TNUB 3VYIA 1SQQJ 1U7JA 5BU5A 3L4FA 5KAFH 2VRSA 2K88A 3L72D 1EDJA 1PP9E 1JTHB 3TGUG 1KMIZ 4UB8E 3KZIH 2LKMA 4ZKUA 4PV1C 4HB1A 4W7ZA 1QLED 4IL6H 1AVOA 2QEXP 5E79H 2O1KA 2WSSH 2ZAEB 1PL5A 1TU3F 1W2EA 4BRYA 3H1IG 1HF9A 3I5CA 2PP6A 3M0DC 2MKVA 1L4AA 3M06A 3SWFA 4U7JA 1P84I 2CK3H 3RL0D 1P84H 2YMKA 1U7MA 4WY4A 1SFCB 1J1DB 2XKMA 2B87B 3A7OA 2N1TD 1NU1J 2IFNA 3BCCD 4GOEA 3HUSA 3AE8C 3B5ND 1SQQG 4H0LC 1KQLA 4H44D 4I2LC 1S2EA 2AEJA 3C1LA 1AFOA 1UIXA 4HJGH 2YIUC 2WT7B 2RH0A 3H6PA 1T6AA 2PGDA 2E74D 3PJSK 1PV3A 2K3RA 1OWAA 1PGOA 5H2FE 1YBKA 2P10A 3CX5D 1K05A 2BASA 1BCCJ 1SQXK 3SFEC 3TGUE 1LWUA 3KQGA 3V6IA 2POHA 1SQXG 2R5DA 3AEEC 5AVZB 1S4XA 3RK3B 3IFMA 1VQ8P 2IZ0A 1EZVG 1BGYJ 3GHGC 3TYYA 2KNCB 2Q5UA 3HD7A 5CBOA 1VDFA 1KB9E 4Y28J 1SFCC 3O6QB 2XV5A 1SQBK 2Q9IA 3CWBD 3H1JE 3NTNA 1SQBG 2HODB 3CCLP 1KILC 1OXZA 3HTKB 4OGQC 1YJWP 4PD4H 2V7QH 2A06E 2AXTE 1RE4A 2HLOA 3L73E 3H1LD 3G9RA 4ASWA 2W6AA 1NJIQ 5KLIB 1D7MA 1SQQE 4RJTA 1JB0J 1G2CB 3L35A 2C9LY 3CX5I 2KK7A 3CX5H 4I6MC 2ITAA 1MUUA 2H88C 1CW5A 1NOHA 1LNQA 3OA7A 1S3JA 1VQOP 1EXJA 3EFGA 2LXCB 1IFDA 3H1HJ 2D2CB 3CXHD 3H32A 2O01N 3HE5B 1S5LH 3I55P 2L5GB 1EDKA 3FXDA 1LTJA 4WB4A 5KAIE 1X8YA 1ZR2A 4OH8B 5AW7B 4KT0J 3L75D 1S1CX 1M57D 1NU1E 1ZP0C 1NTZJ 3ITKA 3MUDA 1N73C 1NTMJ 1S5LX 2FFDB 3L36A 2NZ2A 2YXRB 1IFJA 2NPSC 2P1JA 1SQBE 1A02F 4NPFX 1M1JA 2KSJA 5KLIC 2YO2A 4D6TG 4CPGA 3HUSB 4U3FD 1MKMA 1VQLP 3D71A 1RY3A 4N78E 1LGHB 2H89C 1FC2C 4GIFA 1GZLA 4C7NA 3M9HA 2G8YA 4AQRD 1PFIA 3CXHI 3CXHH 2A45G 3L71D 2HG5D 1BCCE 2Y0DA 2FYUJ 2E76D 3AEDC 1UIIA 1KORA 2J5UA 1SQVD 1HJ0A 3L70D 3CLQA 1BGYE 1LWUB 5AW9B 3RK2C 3USSA 4RO0A 3WUTA 3L74J 1J1EB 3Q2YA 2KUBA 1NTKD 1LTBC 1JCDA 1JY3P 2OYIB 1J2JB 2CPBA 4I1LA 4DCKA 2E5TA 3F89A 2PFXA 3S1KA 1H0TB 4RKUJ 3TNUA 2YKPA 1GW3A 2E75D 1OW7A 5B66E 5AVTB 2KZJA 3FXEA 1NAFA 5KLVJ 3BRTB 1JTHA 2GA1A 2KP8A 1WT6A 1NTKK 1FS0E 3V5BA 1RF1B 3IF4A 2FYUG 5M1BA 2Q6QA 2FYNB 2IYOA 2HFED 5B5EH 1N7SC 1Z56A 3H1HE 1FU1A 2KI7B 1L0LK 1DH3A 2RKLA 3CMEP 4GDOA 2Y9ZA 1L0LG 2JP3A 1PP9D 4A7PA 1YTZT 2K1AA 1VF5D 1GL2C 4OVNF 3PP5A 5AVXB 3A0BH 5CJ4A 3CCUP 1SFCA 1E5WA 2OYIC 2ZYDA 3WUUA 3SWKA 2N1TB 1NTZE 2WPQA 3HE4B 1L0NK 1NTME 1ZOYC 3B5NB 2C9NY 1SS1A 1L0NG 1JM0A 4IFFA 2I8DA 2E42A 2WT7A 3Q5SA 2Q3EA 3S4RA 2BEQD 4PJ0E 4ZKPA 1IFMA 1X22A 1CSBA 3G3ZA 3A0HE 2PRRA 5DJUB 2E74B 1RF1C 3CCEP 1HGVA 3CCRP 3H1KD 1VQ7P 1FJKA 2N9YB 3KHUA 2XNXA 5CCGC 1N2DC 3C9IA 1ZMEC 1YQ4C 5KJ7A 2H8PD 2FYUE 2ZVNB 2GM4A 5L8RJ 4PV1B 2KNCA 3JCUE 5EFWB 3RL0C 3O6QA 3RK3E 1VQKP 3VOPA 1RE3C 3TGUD 2HODA 1GD2E 1GTWA 3HTKA 1GL2D 5APYA 2Y9YA 2AEFA 3CCSP 1SQPK 4H44C 1BE3J 2NPSA 1QEXA 1SQPG 1K9MQ 1VQ6P 1KB9D 5AVQB 1JMBA 1IK7A 3PRJA 3H1ID 4WWIA 1LT1A 3M91A 5KLVE 3LIEA 3MHVA 1HJBA 3HD7D 2H43A 2YIUB 3SWYA 2IYPA 4GKGA 5KTBA 3L72J 1FJPA 4UB6E 2A06D 2I1JA 3RBZA 4YTPC 1JY2P 3HE5A 1SP4A 2RMZA 3AEGC 3PHLA 1A02J 1M1KQ 1SQQD 2Q1KA 5AW0B 3V2QA 5H2FH 1USEA 5CCGD 3N7NA 2YXQB 3A2AA 3CCQP 4W80A 5AVSB 3H1JG 2I1KA 1PPJG 4C7RA 3GHGB 1URQD 5CCHC 2FFDA 3CD6P 3BASA 4DOJA 1SLQA 5AVYB 3I56P 2L91A 2M3EA 1G1JA 3FX0A 2A06G 1KB9I 1AJYA 3R4YA 3BCCJ 3II6A 3L73G 3HRNA 1SQQK 1SQXD 1KILB 1FZGA 1BSHA 4OGQB 4JQ0D 2QJYC 2QM7A 1EZVD 3B71A 1ZN5A 3U1CA 2V7QJ 1SQPE 1KFNA 1NU1D 3NXSA 5CBNA 1QVFO 3P32A 2AXTH 1YJNP 2R32A 4EOTA 1PIXA 4ASVA 5KAFE 1SQBD 1KQGB 1MFZA 1ZLLA 4LGDE 2E76B 3M0AA 4TLFA 2KXPB 5TISH 3KZIE 2DW3A 1JMMA 1ZRTE 3AEBC 3FGAD 1VL2A 4N78D 4IL6E 1Q81Q 1NU1K 1GK4A 1KFMA 2OYIA 3GMAA 1NU1G 1KYOD 5AW2B 3JC22 2WPRA 5KAIH 1H0TA 1G1IA 3CWBJ 2XDJA 4JBZA 4XFJA 5AW3B 1PPJE 1IC2A 2HPCA 1BE3E 5CCHD 2YNYA 1IK9A 5AVUB 3VMAA 3F5HA 1N73B 1EZVI 3G71P 3K5BA 1H89A 2NPSB 2Z5HA 1RF1A 2KB7P 1QVGO 3H1LJ 1VQ4P 4MN4C 2O01H 2KLUA 2M3BA 1OZHA 1AQ5A 1FAVA 2P58A 1DEEG 4EIJA 3T97B 1USDA 3CC4P 1FDOA 1FZCC 2QJKB 3L72E 1BCCG 1FBMA 4JPZB 2BCCJ 1OVRA 2WITA 2ZT9D 2C0WA 2E76C 4Y99C 1BDCA 2QVAA 1NWQA 1GU5A 3N4XA 1BGYG 1RH5B 3MZWB 3CPWO 1T3JA 4HKZH 3V4WA 1VF5B 4D6TD 1KYOI 3E7KA 1KYOH 1XTCC 2N1TA 4IFDK 1LT9C 3HE4A 2FXOA 2YO3A 3RK2B 3PH0A 4L75A 3L75J 1BDDA 3B5NA 2K9JB 2BEZF 2YKQA 2WTYA 3AE3C 2ZYGA 3BCCE 2IBZE 3A5TA 3P8MC 2E75C 1Q2NA 4PD4E 2J59M 1LTTC 2OYHC 3PTZA 1RF0C 3V4QA 4U3FJ 2YKOA 2FKWB 2QJKC 3KXDA 3KPEA 3H1HG 2QG4A 2R44A 3E1RA 3CX5E 1GU4A 3L71J 1VF5C 1N7SB 4HYTB 4L73A 2QE7H 4ZMDA 4Z1MH 1SQVJ 3L70J 3M0DA 1VQNP 1NTZK 1HTLC 1FDIA 1NTMK 3MP7B 1NTZG 3AE5C 1GL2B 1JO5A 5BVZA 1NTMG 2FYUD 2A45I 2A45H 1DEBA 4HH2A 3OW2O 5DJTB 3CCMP 3CWBE 1VQ9P 3KDPB 1N8RQ 5KJ7D 1L0LD 2WSEJ 2HPCB 1L4AC 3H1LE 1FZFA 3VTPC 4GOFA 3AE6C 1X79B 5AVWB 4QMAA 4B86A 3GLMA 2FYUK 2FXMA 2BCCE 3P8CE 2W90A 3NFQA 1PGJA 1M7LA 2KSEA 3A0HH 1Q90D 1FOSF 1L0ND 3EWKA 4JYCA 1KV4A 3D6ZA 1M8OB 3AE7C 2OTJP 3CXHE 2QJPC 1EXIA 3SSUA 3LW5H 3L74G 3G6EP 4WBAA 2ZVOB 1PP9J 3GHGA 2W6JH 2ZJSE 1QL1A 5AVRB 1URQB 2B9BA 1PGQA 1CI6B 5BU8B 3RL0B 1OX3A 3L75E 5GTHH 2WSCH 2KLVA 4TT3H 1KILA 2OYOA 4AUWA 1JY3N 2GUSA 3V2PA 1OFCX 4M3LA 5KLVK 5APTA 3CC2P 4H44B 5KLVG 1H8AA 3W68A 3HD7C 2GUVA 1KILE 3A3YB 3VMXA 4U3FE 1EDIA 2UWJE 1JOCA 1FZCA 4KHXA 4AYCA 1EQ7A 3V2NA 3MIWA 1L4AD 2P67A 1IJDB 3CL3D 5APUA 3H1KJ 5APQA 5AVVB 1VQ5P 2JKVA 3LIDA 4WY4D 3AE9C 1SQPD 1RE4C 2FXPA 2LR2A 3RL0g 5B5EE 4XA4A 5C39A 5AW6B 1SQVE 4UB8H 3L70E 1URQC 5GTIE 2V4HA 1GW4A 3L74E 2JWDA 3A0BE 1ZRTD 3TGUJ 1ZV8A 2Z4EA 3GW6A 1N73A 3WU2E 2LXBA 2WSFH 3CCVP 1LTJC 3CMAP 4EYYQ 1DX7A 1HGZA 4IOIH 1FZAA 1RF0A 3T97A 3H1IJ 2QJYB 4LC1A 2M5AB 3PLNA 3H1JD 1PPJD 3CC7P 1BE3D 2HYNA 1FE6A 4K35A 2XNDH 1Y47A 4H13C 2CPSA 3U59A 1L2PA 1NAYA 1NO4A 3L73D 2K37A 1M1JC 2C0XA 5AW5B 5APWA 4I7ZC 2FY8A 3OJAB 3WUVA 3Q5PA 1AVYA 1K8AQ 2WVRA 1WRGA 3QH9A 5APVA 2K9JA 3Q3DA 3MTUE 3ZDMA 1YHQP 1BE3G 1Y9BA 1NH4A 4JYBA 3BATA 1GDTA 3FWLA 2P2UA 1NGMB 2ZXEB 1T2KD 1FDMA 1KB9H 2IPPA 1S9KE 1SQXJ 5AW4B 4YXDC 1VQPP 1EDLA 3L72G 2O1JA 4IL6X 2W6BA 2ZT9C 1GMJA 2IBZD 2QSIA 1S72P 1JEKA 5AW8B 3H1KE 2O01J 2P7JA 2WWWA 1FZCB 4PD4D 1IZNB 1SQBJ 1N7SA 3U1AA 1FZBA 2QM8A 4Y99B 2Y0CA 1DIPA 4H13D 2AEMA 3D70A 1JY2N 4R4LA 3VMYA 2W8ZA 2AXCA 1GL2A 1IFNA 3SFDC 5E79E 2IFMA 2YMYA 2KS1B 2Y0EA 1NYHA 2XZRA 1YIJP 2G3AA 1BCCD 3BCCG 1LT9B 2IBZG 1HUCA 1KTMA 1SVFA 3B8EB 1OW8A 1VQMP 5TJHA 1LP1B 1PGPA 4PV1D 4LLHA 1P84E 4ZNCA 1BGYD 3TDKA 1OVVA 2R3CA 1NKNA 4R4MA 2E75B 1J1DC 3H1IE 2IBZI 4DZOA 1DD4A 2OYHB 2J58A 2PAJA 1W2BO 4BXLA 4WVZA 4PD4I 1YQ3C 4N3YB 1W5CE 1MFTA 5CCGA 2JDIH 1LTGC 4YPCA 3H25A 3MGNA 4JF7A 1M56D 4DT0A 4H0LD 1E79H 2SPZA 1IFPA 3M9BA 2OTKE 1URQA 5TISE 1RQUA 4RESB 1KQFB 1CI6A 2BCCD 1LTAC 3P8CD 1CZQA 4D6TJ 1NVOA 2QIWA 3NMDA 3CWBG 1RE3A 3VP8A 3O8ZA 2Q7CA 1YTZI 1LTIC 3H1HD 5KJ7C 4N6JA 5K5GB 3RK3C 2E5YA 2WPVB 4EI2A 3H1LG 3TSIA 1SQXE 3IR9A 4BWNA 4GODA 4BRYB 1OW6A 4XE5B 1EZVE 1QX8A 2BCCG 1NTZD 1L4AB 1X9VA 1NTMD 5APXA 1SFCD 1R5SA 2K9YA 4WY4B 2OARA
chains in the Genus database with same CATH topology
1HJBA 3HD7D 2H43A 1KILD 1T3UA 3EQ2A 3GHGC 2ZFCA 2WSCH 2KLVA 2Q3IA 1LTSC 3TYYA 2Q5UA 3HD7A 3SWYA 1KILA 4GKGA 5KTBA 1VDFA 3OAKA 4AUWA 1FJPA 1JY3N 2GUSA 3V2PA 4M3LA 5KLVK 2I1JA 5APTA 1N7LA 1SFCC 2XV5A 1JY2P 3HE5A 1SQBK 2Q9IA 1JUNA 1SP4A 1H8AA 3NTNA 1XTGB 1A02J 2M8RA 3CI9A 2HODB 3HD7C 2GUVA 5AW0B 1KILC 1JY3O 3TK1A 3V2QA 1OXZA 3HTKB 5CCGD 3A3YB 3N7NA 3VMXA 5CCHA 3A2AA 1JOCA 1FZCA 4KHXA 4AYCA 1FOSE 1EQ7A 1GK6A 5CMZA 3V2NA 1RE4A 2FYZA 2HLOA 3MIWA 4W80A 1L4AD 2P67A 5AVSB 1IJDB 2W6AA 3CL3D 5APUA 2I1KA 5APQA 5AVVB 4C7RA 3LIDA 3GHGB 1URQD 5CCHC 2N9BA 1G2CB 2FFDA 4WY4D 3BASA 4DOJA 3L35A 3R2PA 3RK3D 1H88A 2C9LY 1SLQA 1RE4C 5AVYB 4I6MC 1G1JA 3II6A 4XA4A 1MUUA 3HRNA 1CW5A 1NOHA 1SQQK 5AW6B 3VN0A 3HD7B 2FFDC 1FZGA 1KILB 3OA7A 1URQC 1HBWA 3EFGA 1IFDA 4WY4C 3H32A 2QM7A 1JNMA 3HE5B 1ZN5A 3U1CA 2L5GB 1KFNA 1GW4A 1HVVA 1LTJA 3E1IA 4WB4A 1X8YA 1SQVK 3NXSA 1ZR2A 3HUSC 1ZV8A 2KOGA 3M9QA 3P32A 2Z4EA 1VPCA 4OH8B 5AW7B 2R32A 1N73A 3V2RA 4EOTA 2IX7C 2NPSD 2WSFH 2R5BA 1LTJC 1MFZA 1ZLLA 4LGDE 2MJZA 3M0AA 3MD0A 1NHLA 1DX7A 1HGZA 3MUDA 1MZ9A 1N73C 1JMMA 1FZAA 2FFDB 3L36A 2WZ7A 1RF0A 3T97A 4N78D 4LC1A 1IFJA 2NPSC 2P1JA 2HYNA 1NU1K 1GK4A 1A02F 1KFMA 2OYIA 1M1JA 2KSJA 2H7HA 2YO2A 1LWUC 3HUSB 5AW2B 2CPSA 3KYQA 2WPRA 5CHXA 3H32B 3U59A 1J1EC 1RY3A 1ZR4A 1NO4A 4N78E 1G1IA 1LGHB 1LTJB 2XDJA 1T8ZA 4GIFA 1GZLA 1IFIA 1M1JC 5AW3B 4C7NA 1IC2A 3M9HA 2HPCA 2C0XA 4AQRD 1PFIA 5CCHD 5AW5B 1YYCA 5APWA 2YNYA 1IK9A 5AVUB 3OJAB 3RK2D 2A45G 1NKZB 1N73B 2HG5D 2WSEH 1WRGA 4O9BA 1H89A 5APVA 2NPSB 1HWTC 2Z5HA 1RF1A 2KB7P 3MTUE 1S9KD 3L37A 2O01H 2M3BA 1AQ5A 1FAVA 1NH4A 3CLQA 4JYBA 3P7KA 1LWUB 3BATA 4W7YA 3BRVB 3VMZA 4EIJA 2KYVA 5AW9B 3RK2C 1GDTA 1FZCC 2W27A 1FBMA 2P2UA 1J1EB 2WITA 2ZXEB 2C0WA 1LTBC 1T2KD 1JCDA 4Y99C 1FDMA 1JY3P 2OYIB 2IPPA 1JCCA 1M1JB 3BVHA 5APSA 1J2JB 2CPBA 4I1LA 1S9KE 1HH0A 1NWQA 5CJ0A 5AW4B 1GU5A 3N4XA 1LT9A 1T3JA 3V4WA 2O1JA 2W6BA 4C7NB 4GT1A 1T2KC 3TNUA 2Z5IA 1XTCC 2N1TA 4IFDK 2YKPA 1GW3A 1LT9C 5AW8B 4C46A 2JJLA 1QL2A 5AVTB 2P7JA 2WWWA 1NAFA 1N7SD 1FZEA 3HE4A 2WPSA 3BRTB 1JTHA 2KP8A 2YO3A 3RK2B 1FZCB 3B5NA 1N7SA 2YKQA 3U1AA 1WT6A 1NTKK 1IO4A 1FZBA 3V5BA 2QM8A 1RF1B 2JEEA 1MV8A 4Y99B 2WTYA 2N1TC 2OYHA 3A5TA 1JY2N 3P8MC 3VMYA 2HFED 3B5NC 1N7SC 1Z56A 1N86A 1GL2A 3WMM0 1IFNA 1FU1A 2J59M 3UIAA 1LTTC 2IFMA 2OYHC 1L0LK 3VP9A 2YMYA 1DH3A 1JY2O 2XZRA 1RF0C 3V4QA 2E43A 1LT9B 1YTZT 4IFMA 2XU6A 2FKWB 2YKOA 1HUCA 1G2CA 1GL2C 1SVFA 3PP5A 5AVXB 3B8EB 5CJ4A 3KPEA 1KZUB 1SFCA 1E5WA 2OYIC 5AW1B 4LLHA 3TNUB 3VYIA 2N1TB 5BU5A 3L4FA 2R3CA 1GU4A 2VRSA 1NKNA 2WPQA 3HE4B 1JTHB 1L0NK 1J1DC 3B5NB 1N7SB 2C9NY 4DZOA 4HYTB 2LKMA 4IFFA 4ZKUA 2OYHB 2E42A 2WT7A 4W7ZA 2J58A 2PAJA 3M0DA 1NTZK 1HTLC 1NTMK 2O1KA 4ZKPA 1IFMA 4N3YB 1CSBA 1GL2B 1W2EA 3G3ZA 5BVZA 5CCGA 1JO5A 3RK3B 2A45I 1LTGC 2A45H 1DEBA 4HH2A 1RF1C 3I5CA 2PP6A 1HGVA 3M0DC 3MGNA 1L4AA 4JF7A 3M06A 1FJKA 2XNXA 3KDPB 3SWFA 3M9BA 5KJ7D 5CCGC 1N2DC 1URQA 3RL0D 3C9IA 4RESB 1CI6A 1LTAC 3P8CD 1SFCB 1J1DB 4WY4A 2XKMA 5KJ7A 2H8PD 3A7OA 1CZQA 2N1TD 2IFNA 2GM4A 2HPCB 1L4AC 3NMDA 1RE3A 3VP8A 3HUSA 1FZFA 3O8ZA 3VTPC 3B5ND 2Q7CA 1YTZI 1KQLA 1LTIC 4I2LC 1X79B 5AVWB 5KJ7C 4N6JA 4B86A 3RL0C 2FYUK 1AFOA 3RK3C 2FXMA 3P8CE 3NFQA 3VOPA 2WT7B 1RE3C 3H6PA 1M7LA 2HODA 1GD2E 1GTWA 3TSIA 3HTKA 1GL2D 5APYA 1FOSF 3IR9A 4JYCA 1SQPK 1OWAA 4XE5B 2NPSA 3LW5H 2BASA 1L4AB 4WBAA 1X9VA 3GHGA 1SQXK 5APXA 1QL1A 5AVQB 5AVRB 1LWUA 3KQGA 1URQB 1SFCD 2POHA 1CI6B 4WY4B 2R5DA 3M91A 5BU8B 2OARA 3LIEA 3RL0B 5AVZB 3IFMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GU5 A;  3M0D A;  2R5B A;  1HJB A;  1MFZ A;  3V4W A;  2ZFC A;  2Q3I A;  3M0A A;  3TYY A;  2Q5U A;  3MD0 A;  1CSB A;  4GKG A;  4C7N B;  4GT1 A;  3OAK A;  1T2K C;  4AUW A;  4M3L A;  5APT A;  3L36 A;  2Z5I A;  3TNU A;  3I5C A;  3T97 A;  2XV5 A;  3HE5 A;  5AW8 B;  1JUN A;  1SP4 A;  4C46 A;  2JJL A;  4LC1 A;  5AVT B;  1H8A A;  2P7J A;  2WWW A;  3MGN A;  1NAF A;  3NTN A;  3HE4 A;  3M06 A;  2WPS A;  2YO3 A;  2KP8 A;  1A02 J;  3KDP B;  5AW0 B;  3SWF A;  3M9B A;  1GK4 A;  1A02 F;  3TK1 A;  1OXZ A;  1IO4 A;  2H7H A;  3A3Y B;  4RES B;  2QM8 A;  1CI6 A;  3V5B A;  2YO2 A;  3VMX A;  1MV8 A;  2WTY A;  5AW2 B;  3A7O A;  3A2A A;  1CZQ A;  4KHX A;  4AYC A;  1FOS E;  2WPR A;  1GK6 A;  3A5T A;  5CMZ A;  3NMD A;  3P8M C;  2P67 A;  3VMY A;  5AVS B;  2W6A A;  5APU A;  3O8Z A;  5APQ A;  5AVV B;  3VTP C;  1GZL A;  5AW3 B;  2Q7C A;  3LID A;  4C7N A;  1KQL A;  3M9H A;  4I2L C;  5AVW B;  2N9B A;  3UIA A;  1G2C B;  4AQR D;  5AW5 B;  1YYC A;  4B86 A;  5APW A;  2YNY A;  1DH3 A;  5AVU B;  3L35 A;  2XZR A;  1H88 A;  2C9L Y;  1SLQ A;  3NFQ A;  5AVY B;  4I6M C;  3V4Q A;  2WT7 B;  2E43 A;  2XU6 A;  1HUC A;  1H89 A;  5APV A;  1GD2 E;  5AVX B;  1GTW A;  1MUU A;  3HTK A;  3B8E B;  1HWT C;  2Z5H A;  5APY A;  1FOS F;  5AW6 B;  3VN0 A;  1S9K D;  3IR9 A;  3L37 A;  4JYC A;  5AW1 B;  1HBW A;  1OWA A;  1FAV A;  3TNU B;  4JYB A;  3P7K A;  3VYI A;  4XE5 B;  3VMZ A;  2QM7 A;  1JNM A;  5AW9 B;  3HE5 B;  2R3C A;  2W27 A;  1GU4 A;  2VRS A;  2BAS A;  2WPQ A;  2P2U A;  3HE4 B;  2ZXE B;  1T2K D;  1X8Y A;  3NXS A;  5APX A;  5AVQ B;  5AVR B;  3KQG A;  2C9N Y;  2IPP A;  3P32 A;  4DZO A;  4HYT B;  5APS A;  1CI6 B;  1J2J B;  2R5D A;  3M91 A;  2R32 A;  5AW7 B;  1S9K E;  1NWQ A;  3LIE A;  4EOT A;  5AVZ B;  2E42 A;  2WT7 A;  5AW4 B; 
#chains in the Genus database with same CATH topology
 5B66 H;  2IZ1 A;  3C8V A;  1KIL D;  1T3U A;  3EQ2 A;  1KD1 Q;  3FWN A;  2R3S A;  2ZFC A;  4OGQ D;  2Q3I A;  1LTS C;  3OAK A;  3GG2 A;  2M0B A;  1N7L A;  3EFF K;  1JUN A;  3L75 G;  2QJP B;  1XTG B;  2M8R A;  3CI9 A;  1S5L E;  1JY3 O;  3LW5 J;  3TK1 A;  1RQV A;  1Q82 Q;  5CCH A;  1KYO E;  2D2C C;  1QGK B;  1FOS E;  1BSN A;  1NTK J;  1GK6 A;  1R8E A;  5CMZ A;  2FYZ A;  1YIT P;  1OVU A;  2N9B A;  4OWF A;  2WSC J;  4YXW H;  3R2P A;  3RK3 D;  1H88 A;  3L74 D;  4U3F G;  2M5A A;  1ZW0 A;  3JSV C;  1LJ2 A;  1L0L J;  3AEF C;  4L74 A;  1EC5 A;  3VN0 A;  3HD7 B;  2FFD C;  1YI2 P;  1HBW A;  3RGU A;  1ZXG A;  4WY4 C;  2FBW C;  5KKZ B;  1JNM A;  1WMK A;  3L71 G;  1HVV A;  4PJ0 H;  3E1I A;  1R5L A;  2QRX A;  1SQV K;  3QWO C;  3AE1 C;  3HUS C;  2KOG A;  3M9Q A;  1SQV G;  1VPC A;  1L0N J;  3L70 G;  3V2R A;  1OMI A;  5KLV D;  2IX7 C;  2NPS D;  2R5B A;  3CCJ P;  2ZYA A;  2MJZ A;  1KC8 Q;  3MD0 A;  4D6T E;  1NTK G;  1NHL A;  1K73 Q;  1MZ9 A;  1Q7Y Q;  1K04 A;  2WZ7 A;  2B88 A;  3S9O A;  3JCU H;  5GTI H;  2H7H A;  2NRG A;  2RN0 A;  1LWU C;  1AV1 A;  2D2C D;  3D6Y A;  3KYQ A;  2QA4 P;  1YJ9 P;  5CHX A;  3H32 B;  1J1E C;  1ZR4 A;  2B87 A;  1LTJ B;  2WQY C;  1T8Z A;  2WSF J;  1IFI A;  3WU2 H;  2KZI A;  1PZQ A;  1YYC A;  3IN6 A;  3RK2 D;  1NKZ B;  1DD3 A;  3Q5R A;  2W83 C;  1OIP A;  5KKZ C;  1X0T A;  2WMM A;  4NPD A;  3TF5 A;  2WSE H;  4O9B A;  3GF7 A;  1HWT C;  4KJM A;  1S9K D;  3L37 A;  2JO1 A;  4W7Y A;  3P7K A;  4H13 B;  3VMZ A;  3BRV B;  2KYV A;  3ABV C;  2W27 A;  3L71 E;  1SQP J;  1PP9 G;  3AE4 C;  2OQQ A;  4K3A A;  1JCC A;  1M1J B;  3BVH A;  2HR3 A;  5APS A;  4UB6 H;  2KS1 A;  3AEC C;  2JR8 A;  1HH0 A;  3G4S P;  2OTL P;  2FYN C;  5CJ0 A;  3AE2 C;  4I7Z B;  1LT9 A;  1AQT A;  2JWA A;  3RBX A;  1LP1 A;  3B4S A;  4GT1 A;  4C7N B;  1T2K C;  1NTK E;  2Z5I A;  3GF3 A;  4C46 A;  2JJL A;  5GTH E;  1QL2 A;  1N7S D;  1FZE A;  2WPS A;  3AEA C;  1IO4 A;  1U57 A;  2JEE A;  1MV8 A;  2N1T C;  2OYH A;  1L0L E;  4EDF A;  2IDB A;  2O3J A;  3H1K G;  1M90 Q;  3B5N C;  1N86 A;  2KIK A;  3H1J J;  3WMM 0;  1AA0 A;  1P84 D;  1Q86 Q;  2OGU A;  3UIA A;  3VP9 A;  2ZT9 B;  1JY2 O;  1RHZ B;  3MUD C;  3W67 A;  2E43 A;  1KN7 A;  2B89 A;  4IFM A;  2XU6 A;  1KQS O;  1G2C A;  4H0L B;  4L76 A;  2E74 C;  1L0N E;  3IAO A;  4DJG A;  2ZXX A;  3L73 J;  3Q1M A;  1KZU B;  1Y8A A;  5AW1 B;  4NPE A;  3TNU B;  3VYI A;  1SQQ J;  1U7J A;  5BU5 A;  3L4F A;  5KAF H;  2VRS A;  2K88 A;  3L72 D;  1EDJ A;  1PP9 E;  1JTH B;  3TGU G;  1KMI Z;  4UB8 E;  3KZI H;  2LKM A;  4ZKU A;  4PV1 C;  4HB1 A;  4W7Z A;  1QLE D;  4IL6 H;  1AVO A;  2QEX P;  5E79 H;  2O1K A;  2WSS H;  2ZAE B;  1PL5 A;  1TU3 F;  1W2E A;  4BRY A;  3H1I G;  1HF9 A;  3I5C A;  2PP6 A;  3M0D C;  2MKV A;  1L4A A;  3M06 A;  3SWF A;  4U7J A;  1P84 I;  2CK3 H;  3RL0 D;  1P84 H;  2YMK A;  1U7M A;  4WY4 A;  1SFC B;  1J1D B;  2XKM A;  2B87 B;  3A7O A;  2N1T D;  1NU1 J;  2IFN A;  3BCC D;  4GOE A;  3HUS A;  3AE8 C;  3B5N D;  1SQQ G;  4H0L C;  1KQL A;  4H44 D;  4I2L C;  1S2E A;  2AEJ A;  3C1L A;  1AFO A;  1UIX A;  4HJG H;  2YIU C;  2WT7 B;  2RH0 A;  3H6P A;  1T6A A;  2PGD A;  2E74 D;  3PJS K;  1PV3 A;  2K3R A;  1OWA A;  1PGO A;  5H2F E;  1YBK A;  2P10 A;  3CX5 D;  1K05 A;  2BAS A;  1BCC J;  1SQX K;  3SFE C;  3TGU E;  1LWU A;  3KQG A;  3V6I A;  2POH A;  1SQX G;  2R5D A;  3AEE C;  5AVZ B;  1S4X A;  3RK3 B;  3IFM A;  1VQ8 P;  2IZ0 A;  1EZV G;  1BGY J;  3GHG C;  3TYY A;  2KNC B;  2Q5U A;  3HD7 A;  5CBO A;  1VDF A;  1KB9 E;  4Y28 J;  1SFC C;  3O6Q B;  2XV5 A;  1SQB K;  2Q9I A;  3CWB D;  3H1J E;  3NTN A;  1SQB G;  2HOD B;  3CCL P;  1KIL C;  1OXZ A;  3HTK B;  4OGQ C;  1YJW P;  4PD4 H;  2V7Q H;  2A06 E;  2AXT E;  1RE4 A;  2HLO A;  3L73 E;  3H1L D;  3G9R A;  4ASW A;  2W6A A;  1NJI Q;  5KLI B;  1D7M A;  1SQQ E;  4RJT A;  1JB0 J;  1G2C B;  3L35 A;  2C9L Y;  3CX5 I;  2KK7 A;  3CX5 H;  4I6M C;  2ITA A;  1MUU A;  2H88 C;  1CW5 A;  1NOH A;  1LNQ A;  3OA7 A;  1S3J A;  1VQO P;  1EXJ A;  3EFG A;  2LXC B;  1IFD A;  3H1H J;  2D2C B;  3CXH D;  3H32 A;  2O01 N;  3HE5 B;  1S5L H;  3I55 P;  2L5G B;  1EDK A;  3FXD A;  1LTJ A;  4WB4 A;  5KAI E;  1X8Y A;  1ZR2 A;  4OH8 B;  5AW7 B;  4KT0 J;  3L75 D;  1S1C X;  1M57 D;  1NU1 E;  1ZP0 C;  1NTZ J;  3ITK A;  3MUD A;  1N73 C;  1NTM J;  1S5L X;  2FFD B;  3L36 A;  2NZ2 A;  2YXR B;  1IFJ A;  2NPS C;  2P1J A;  1SQB E;  1A02 F;  4NPF X;  1M1J A;  2KSJ A;  5KLI C;  2YO2 A;  4D6T G;  4CPG A;  3HUS B;  4U3F D;  1MKM A;  1VQL P;  3D71 A;  1RY3 A;  4N78 E;  1LGH B;  2H89 C;  1FC2 C;  4GIF A;  1GZL A;  4C7N A;  3M9H A;  2G8Y A;  4AQR D;  1PFI A;  3CXH I;  3CXH H;  2A45 G;  3L71 D;  2HG5 D;  1BCC E;  2Y0D A;  2FYU J;  2E76 D;  3AED C;  1UII A;  1KOR A;  2J5U A;  1SQV D;  1HJ0 A;  3L70 D;  3CLQ A;  1BGY E;  1LWU B;  5AW9 B;  3RK2 C;  3USS A;  4RO0 A;  3WUT A;  3L74 J;  1J1E B;  3Q2Y A;  2KUB A;  1NTK D;  1LTB C;  1JCD A;  1JY3 P;  2OYI B;  1J2J B;  2CPB A;  4I1L A;  4DCK A;  2E5T A;  3F89 A;  2PFX A;  3S1K A;  1H0T B;  4RKU J;  3TNU A;  2YKP A;  1GW3 A;  2E75 D;  1OW7 A;  5B66 E;  5AVT B;  2KZJ A;  3FXE A;  1NAF A;  5KLV J;  3BRT B;  1JTH A;  2GA1 A;  2KP8 A;  1WT6 A;  1NTK K;  1FS0 E;  3V5B A;  1RF1 B;  3IF4 A;  2FYU G;  5M1B A;  2Q6Q A;  2FYN B;  2IYO A;  2HFE D;  5B5E H;  1N7S C;  1Z56 A;  3H1H E;  1FU1 A;  2KI7 B;  1L0L K;  1DH3 A;  2RKL A;  3CME P;  4GDO A;  2Y9Z A;  1L0L G;  2JP3 A;  1PP9 D;  4A7P A;  1YTZ T;  2K1A A;  1VF5 D;  1GL2 C;  4OVN F;  3PP5 A;  5AVX B;  3A0B H;  5CJ4 A;  3CCU P;  1SFC A;  1E5W A;  2OYI C;  2ZYD A;  3WUU A;  3SWK A;  2N1T B;  1NTZ E;  2WPQ A;  3HE4 B;  1L0N K;  1NTM E;  1ZOY C;  3B5N B;  2C9N Y;  1SS1 A;  1L0N G;  1JM0 A;  4IFF A;  2I8D A;  2E42 A;  2WT7 A;  3Q5S A;  2Q3E A;  3S4R A;  2BEQ D;  4PJ0 E;  4ZKP A;  1IFM A;  1X22 A;  1CSB A;  3G3Z A;  3A0H E;  2PRR A;  5DJU B;  2E74 B;  1RF1 C;  3CCE P;  1HGV A;  3CCR P;  3H1K D;  1VQ7 P;  1FJK A;  2N9Y B;  3KHU A;  2XNX A;  5CCG C;  1N2D C;  3C9I A;  1ZME C;  1YQ4 C;  5KJ7 A;  2H8P D;  2FYU E;  2ZVN B;  2GM4 A;  5L8R J;  4PV1 B;  2KNC A;  3JCU E;  5EFW B;  3RL0 C;  3O6Q A;  3RK3 E;  1VQK P;  3VOP A;  1RE3 C;  3TGU D;  2HOD A;  1GD2 E;  1GTW A;  3HTK A;  1GL2 D;  5APY A;  2Y9Y A;  2AEF A;  3CCS P;  1SQP K;  4H44 C;  1BE3 J;  2NPS A;  1QEX A;  1SQP G;  1K9M Q;  1VQ6 P;  1KB9 D;  5AVQ B;  1JMB A;  1IK7 A;  3PRJ A;  3H1I D;  4WWI A;  1LT1 A;  3M91 A;  5KLV E;  3LIE A;  3MHV A;  1HJB A;  3HD7 D;  2H43 A;  2YIU B;  3SWY A;  2IYP A;  4GKG A;  5KTB A;  3L72 J;  1FJP A;  4UB6 E;  2A06 D;  2I1J A;  3RBZ A;  4YTP C;  1JY2 P;  3HE5 A;  1SP4 A;  2RMZ A;  3AEG C;  3PHL A;  1A02 J;  1M1K Q;  1SQQ D;  2Q1K A;  5AW0 B;  3V2Q A;  5H2F H;  1USE A;  5CCG D;  3N7N A;  2YXQ B;  3A2A A;  3CCQ P;  4W80 A;  5AVS B;  3H1J G;  2I1K A;  1PPJ G;  4C7R A;  3GHG B;  1URQ D;  5CCH C;  2FFD A;  3CD6 P;  3BAS A;  4DOJ A;  1SLQ A;  5AVY B;  3I56 P;  2L91 A;  2M3E A;  1G1J A;  3FX0 A;  2A06 G;  1KB9 I;  1AJY A;  3R4Y A;  3BCC J;  3II6 A;  3L73 G;  3HRN A;  1SQQ K;  1SQX D;  1KIL B;  1FZG A;  1BSH A;  4OGQ B;  4JQ0 D;  2QJY C;  2QM7 A;  1EZV D;  3B71 A;  1ZN5 A;  3U1C A;  2V7Q J;  1SQP E;  1KFN A;  1NU1 D;  3NXS A;  5CBN A;  1QVF O;  3P32 A;  2AXT H;  1YJN P;  2R32 A;  4EOT A;  1PIX A;  4ASV A;  5KAF E;  1SQB D;  1KQG B;  1MFZ A;  1ZLL A;  4LGD E;  2E76 B;  3M0A A;  4TLF A;  2KXP B;  5TIS H;  3KZI E;  2DW3 A;  1JMM A;  1ZRT E;  3AEB C;  3FGA D;  1VL2 A;  4N78 D;  4IL6 E;  1Q81 Q;  1NU1 K;  1GK4 A;  1KFM A;  2OYI A;  3GMA A;  1NU1 G;  1KYO D;  5AW2 B;  3JC2 2;  2WPR A;  5KAI H;  1H0T A;  1G1I A;  3CWB J;  2XDJ A;  4JBZ A;  4XFJ A;  5AW3 B;  1PPJ E;  1IC2 A;  2HPC A;  1BE3 E;  5CCH D;  2YNY A;  1IK9 A;  5AVU B;  3VMA A;  3F5H A;  1N73 B;  1EZV I;  3G71 P;  3K5B A;  1H89 A;  2NPS B;  2Z5H A;  1RF1 A;  2KB7 P;  1QVG O;  3H1L J;  1VQ4 P;  4MN4 C;  2O01 H;  2KLU A;  2M3B A;  1OZH A;  1AQ5 A;  1FAV A;  2P58 A;  1DEE G;  4EIJ A;  3T97 B;  1USD A;  3CC4 P;  1FDO A;  1FZC C;  2QJK B;  3L72 E;  1BCC G;  1FBM A;  4JPZ B;  2BCC J;  1OVR A;  2WIT A;  2ZT9 D;  2C0W A;  2E76 C;  4Y99 C;  1BDC A;  2QVA A;  1NWQ A;  1GU5 A;  3N4X A;  1BGY G;  1RH5 B;  3MZW B;  3CPW O;  1T3J A;  4HKZ H;  3V4W A;  1VF5 B;  4D6T D;  1KYO I;  3E7K A;  1KYO H;  1XTC C;  2N1T A;  4IFD K;  1LT9 C;  3HE4 A;  2FXO A;  2YO3 A;  3RK2 B;  3PH0 A;  4L75 A;  3L75 J;  1BDD A;  3B5N A;  2K9J B;  2BEZ F;  2YKQ A;  2WTY A;  3AE3 C;  2ZYG A;  3BCC E;  2IBZ E;  3A5T A;  3P8M C;  2E75 C;  1Q2N A;  4PD4 E;  2J59 M;  1LTT C;  2OYH C;  3PTZ A;  1RF0 C;  3V4Q A;  4U3F J;  2YKO A;  2FKW B;  2QJK C;  3KXD A;  3KPE A;  3H1H G;  2QG4 A;  2R44 A;  3E1R A;  3CX5 E;  1GU4 A;  3L71 J;  1VF5 C;  1N7S B;  4HYT B;  4L73 A;  2QE7 H;  4ZMD A;  4Z1M H;  1SQV J;  3L70 J;  3M0D A;  1VQN P;  1NTZ K;  1HTL C;  1FDI A;  1NTM K;  3MP7 B;  1NTZ G;  3AE5 C;  1GL2 B;  1JO5 A;  5BVZ A;  1NTM G;  2FYU D;  2A45 I;  2A45 H;  1DEB A;  4HH2 A;  3OW2 O;  5DJT B;  3CCM P;  3CWB E;  1VQ9 P;  3KDP B;  1N8R Q;  5KJ7 D;  1L0L D;  2WSE J;  2HPC B;  1L4A C;  3H1L E;  1FZF A;  3VTP C;  4GOF A;  3AE6 C;  1X79 B;  5AVW B;  4QMA A;  4B86 A;  3GLM A;  2FYU K;  2FXM A;  2BCC E;  3P8C E;  2W90 A;  3NFQ A;  1PGJ A;  1M7L A;  2KSE A;  3A0H H;  1Q90 D;  1FOS F;  1L0N D;  3EWK A;  4JYC A;  1KV4 A;  3D6Z A;  1M8O B;  3AE7 C;  2OTJ P;  3CXH E;  2QJP C;  1EXI A;  3SSU A;  3LW5 H;  3L74 G;  3G6E P;  4WBA A;  2ZVO B;  1PP9 J;  3GHG A;  2W6J H;  2ZJS E;  1QL1 A;  5AVR B;  1URQ B;  2B9B A;  1PGQ A;  1CI6 B;  5BU8 B;  3RL0 B;  1OX3 A;  3L75 E;  5GTH H;  2WSC H;  2KLV A;  4TT3 H;  1KIL A;  2OYO A;  4AUW A;  1JY3 N;  2GUS A;  3V2P A;  1OFC X;  4M3L A;  5KLV K;  5APT A;  3CC2 P;  4H44 B;  5KLV G;  1H8A A;  3W68 A;  3HD7 C;  2GUV A;  1KIL E;  3A3Y B;  3VMX A;  4U3F E;  1EDI A;  2UWJ E;  1JOC A;  1FZC A;  4KHX A;  4AYC A;  1EQ7 A;  3V2N A;  3MIW A;  1L4A D;  2P67 A;  1IJD B;  3CL3 D;  5APU A;  3H1K J;  5APQ A;  5AVV B;  1VQ5 P;  2JKV A;  3LID A;  4WY4 D;  3AE9 C;  1SQP D;  1RE4 C;  2FXP A;  2LR2 A;  3RL0 g;  5B5E E;  4XA4 A;  5C39 A;  5AW6 B;  1SQV E;  4UB8 H;  3L70 E;  1URQ C;  5GTI E;  2V4H A;  1GW4 A;  3L74 E;  2JWD A;  3A0B E;  1ZRT D;  3TGU J;  1ZV8 A;  2Z4E A;  3GW6 A;  1N73 A;  3WU2 E;  2LXB A;  2WSF H;  3CCV P;  1LTJ C;  3CMA P;  4EYY Q;  1DX7 A;  1HGZ A;  4IOI H;  1FZA A;  1RF0 A;  3T97 A;  3H1I J;  2QJY B;  4LC1 A;  2M5A B;  3PLN A;  3H1J D;  1PPJ D;  3CC7 P;  1BE3 D;  2HYN A;  1FE6 A;  4K35 A;  2XND H;  1Y47 A;  4H13 C;  2CPS A;  3U59 A;  1L2P A;  1NAY A;  1NO4 A;  3L73 D;  2K37 A;  1M1J C;  2C0X A;  5AW5 B;  5APW A;  4I7Z C;  2FY8 A;  3OJA B;  3WUV A;  3Q5P A;  1AVY A;  1K8A Q;  2WVR A;  1WRG A;  3QH9 A;  5APV A;  2K9J A;  3Q3D A;  3MTU E;  3ZDM A;  1YHQ P;  1BE3 G;  1Y9B A;  1NH4 A;  4JYB A;  3BAT A;  1GDT A;  3FWL A;  2P2U A;  1NGM B;  2ZXE B;  1T2K D;  1FDM A;  1KB9 H;  2IPP A;  1S9K E;  1SQX J;  5AW4 B;  4YXD C;  1VQP P;  1EDL A;  3L72 G;  2O1J A;  4IL6 X;  2W6B A;  2ZT9 C;  1GMJ A;  2IBZ D;  2QSI A;  1S72 P;  1JEK A;  5AW8 B;  3H1K E;  2O01 J;  2P7J A;  2WWW A;  1FZC B;  4PD4 D;  1IZN B;  1SQB J;  1N7S A;  3U1A A;  1FZB A;  2QM8 A;  4Y99 B;  2Y0C A;  1DIP A;  4H13 D;  2AEM A;  3D70 A;  1JY2 N;  4R4L A;  3VMY A;  2W8Z A;  2AXC A;  1GL2 A;  1IFN A;  3SFD C;  5E79 E;  2IFM A;  2YMY A;  2KS1 B;  2Y0E A;  1NYH A;  2XZR A;  1YIJ P;  2G3A A;  1BCC D;  3BCC G;  1LT9 B;  2IBZ G;  1HUC A;  1KTM A;  1SVF A;  3B8E B;  1OW8 A;  1VQM P;  5TJH A;  1LP1 B;  1PGP A;  4PV1 D;  4LLH A;  1P84 E;  4ZNC A;  1BGY D;  3TDK A;  1OVV A;  2R3C A;  1NKN A;  4R4M A;  2E75 B;  1J1D C;  3H1I E;  2IBZ I;  4DZO A;  1DD4 A;  2OYH B;  2J58 A;  2PAJ A;  1W2B O;  4BXL A;  4WVZ A;  4PD4 I;  1YQ3 C;  4N3Y B;  1W5C E;  1MFT A;  5CCG A;  2JDI H;  1LTG C;  4YPC A;  3H25 A;  3MGN A;  4JF7 A;  1M56 D;  4DT0 A;  4H0L D;  1E79 H;  2SPZ A;  1IFP A;  3M9B A;  2OTK E;  1URQ A;  5TIS E;  1RQU A;  4RES B;  1KQF B;  1CI6 A;  2BCC D;  1LTA C;  3P8C D;  1CZQ A;  4D6T J;  1NVO A;  2QIW A;  3NMD A;  3CWB G;  1RE3 A;  3VP8 A;  3O8Z A;  2Q7C A;  1YTZ I;  1LTI C;  3H1H D;  5KJ7 C;  4N6J A;  5K5G B;  3RK3 C;  2E5Y A;  2WPV B;  4EI2 A;  3H1L G;  3TSI A;  1SQX E;  3IR9 A;  4BWN A;  4GOD A;  4BRY B;  1OW6 A;  4XE5 B;  1EZV E;  1QX8 A;  2BCC G;  1NTZ D;  1L4A B;  1X9V A;  1NTM D;  5APX A;  1SFC D;  1R5S A;  2K9Y A;  4WY4 B;  2OAR A; 
#chains in the Genus database with same CATH homology
 1HJB A;  3HD7 D;  2H43 A;  1KIL D;  1T3U A;  3EQ2 A;  3GHG C;  2ZFC A;  2WSC H;  2KLV A;  2Q3I A;  1LTS C;  3TYY A;  2Q5U A;  3HD7 A;  3SWY A;  1KIL A;  4GKG A;  5KTB A;  1VDF A;  3OAK A;  4AUW A;  1FJP A;  1JY3 N;  2GUS A;  3V2P A;  4M3L A;  5KLV K;  2I1J A;  5APT A;  1N7L A;  1SFC C;  2XV5 A;  1JY2 P;  3HE5 A;  1SQB K;  2Q9I A;  1JUN A;  1SP4 A;  1H8A A;  3NTN A;  1XTG B;  1A02 J;  2M8R A;  3CI9 A;  2HOD B;  3HD7 C;  2GUV A;  5AW0 B;  1KIL C;  1JY3 O;  3TK1 A;  3V2Q A;  1OXZ A;  3HTK B;  5CCG D;  3A3Y B;  3N7N A;  3VMX A;  5CCH A;  3A2A A;  1JOC A;  1FZC A;  4KHX A;  4AYC A;  1FOS E;  1EQ7 A;  1GK6 A;  5CMZ A;  3V2N A;  1RE4 A;  2FYZ A;  2HLO A;  3MIW A;  4W80 A;  1L4A D;  2P67 A;  5AVS B;  1IJD B;  2W6A A;  3CL3 D;  5APU A;  2I1K A;  5APQ A;  5AVV B;  4C7R A;  3LID A;  3GHG B;  1URQ D;  5CCH C;  2N9B A;  1G2C B;  2FFD A;  4WY4 D;  3BAS A;  4DOJ A;  3L35 A;  3R2P A;  3RK3 D;  1H88 A;  2C9L Y;  1SLQ A;  1RE4 C;  5AVY B;  4I6M C;  1G1J A;  3II6 A;  4XA4 A;  1MUU A;  3HRN A;  1CW5 A;  1NOH A;  1SQQ K;  5AW6 B;  3VN0 A;  3HD7 B;  2FFD C;  1FZG A;  1KIL B;  3OA7 A;  1URQ C;  1HBW A;  3EFG A;  1IFD A;  4WY4 C;  3H32 A;  2QM7 A;  1JNM A;  3HE5 B;  1ZN5 A;  3U1C A;  2L5G B;  1KFN A;  1GW4 A;  1HVV A;  1LTJ A;  3E1I A;  4WB4 A;  1X8Y A;  1SQV K;  3NXS A;  1ZR2 A;  3HUS C;  1ZV8 A;  2KOG A;  3M9Q A;  3P32 A;  2Z4E A;  1VPC A;  4OH8 B;  5AW7 B;  2R32 A;  1N73 A;  3V2R A;  4EOT A;  2IX7 C;  2NPS D;  2WSF H;  2R5B A;  1LTJ C;  1MFZ A;  1ZLL A;  4LGD E;  2MJZ A;  3M0A A;  3MD0 A;  1NHL A;  1DX7 A;  1HGZ A;  3MUD A;  1MZ9 A;  1N73 C;  1JMM A;  1FZA A;  2FFD B;  3L36 A;  2WZ7 A;  1RF0 A;  3T97 A;  4N78 D;  4LC1 A;  1IFJ A;  2NPS C;  2P1J A;  2HYN A;  1NU1 K;  1GK4 A;  1A02 F;  1KFM A;  2OYI A;  1M1J A;  2KSJ A;  2H7H A;  2YO2 A;  1LWU C;  3HUS B;  5AW2 B;  2CPS A;  3KYQ A;  2WPR A;  5CHX A;  3H32 B;  3U59 A;  1J1E C;  1RY3 A;  1ZR4 A;  1NO4 A;  4N78 E;  1G1I A;  1LGH B;  1LTJ B;  2XDJ A;  1T8Z A;  4GIF A;  1GZL A;  1IFI A;  1M1J C;  5AW3 B;  4C7N A;  1IC2 A;  3M9H A;  2HPC A;  2C0X A;  4AQR D;  1PFI A;  5CCH D;  5AW5 B;  1YYC A;  5APW A;  2YNY A;  1IK9 A;  5AVU B;  3OJA B;  3RK2 D;  2A45 G;  1NKZ B;  1N73 B;  2HG5 D;  2WSE H;  1WRG A;  4O9B A;  1H89 A;  5APV A;  2NPS B;  1HWT C;  2Z5H A;  1RF1 A;  2KB7 P;  3MTU E;  1S9K D;  3L37 A;  2O01 H;  2M3B A;  1AQ5 A;  1FAV A;  1NH4 A;  3CLQ A;  4JYB A;  3P7K A;  1LWU B;  3BAT A;  4W7Y A;  3BRV B;  3VMZ A;  4EIJ A;  2KYV A;  5AW9 B;  3RK2 C;  1GDT A;  1FZC C;  2W27 A;  1FBM A;  2P2U A;  1J1E B;  2WIT A;  2ZXE B;  2C0W A;  1LTB C;  1T2K D;  1JCD A;  4Y99 C;  1FDM A;  1JY3 P;  2OYI B;  2IPP A;  1JCC A;  1M1J B;  3BVH A;  5APS A;  1J2J B;  2CPB A;  4I1L A;  1S9K E;  1HH0 A;  1NWQ A;  5CJ0 A;  5AW4 B;  1GU5 A;  3N4X A;  1LT9 A;  1T3J A;  3V4W A;  2O1J A;  2W6B A;  4C7N B;  4GT1 A;  1T2K C;  3TNU A;  2Z5I A;  1XTC C;  2N1T A;  4IFD K;  2YKP A;  1GW3 A;  1LT9 C;  5AW8 B;  4C46 A;  2JJL A;  1QL2 A;  5AVT B;  2P7J A;  2WWW A;  1NAF A;  1N7S D;  1FZE A;  3HE4 A;  2WPS A;  3BRT B;  1JTH A;  2KP8 A;  2YO3 A;  3RK2 B;  1FZC B;  3B5N A;  1N7S A;  2YKQ A;  3U1A A;  1WT6 A;  1NTK K;  1IO4 A;  1FZB A;  3V5B A;  2QM8 A;  1RF1 B;  2JEE A;  1MV8 A;  4Y99 B;  2WTY A;  2N1T C;  2OYH A;  3A5T A;  1JY2 N;  3P8M C;  3VMY A;  2HFE D;  3B5N C;  1N7S C;  1Z56 A;  1N86 A;  1GL2 A;  3WMM 0;  1IFN A;  1FU1 A;  2J59 M;  3UIA A;  1LTT C;  2IFM A;  2OYH C;  1L0L K;  3VP9 A;  2YMY A;  1DH3 A;  1JY2 O;  2XZR A;  1RF0 C;  3V4Q A;  2E43 A;  1LT9 B;  1YTZ T;  4IFM A;  2XU6 A;  2FKW B;  2YKO A;  1HUC A;  1G2C A;  1GL2 C;  1SVF A;  3PP5 A;  5AVX B;  3B8E B;  5CJ4 A;  3KPE A;  1KZU B;  1SFC A;  1E5W A;  2OYI C;  5AW1 B;  4LLH A;  3TNU B;  3VYI A;  2N1T B;  5BU5 A;  3L4F A;  2R3C A;  1GU4 A;  2VRS A;  1NKN A;  2WPQ A;  3HE4 B;  1JTH B;  1L0N K;  1J1D C;  3B5N B;  1N7S B;  2C9N Y;  4DZO A;  4HYT B;  2LKM A;  4IFF A;  4ZKU A;  2OYH B;  2E42 A;  2WT7 A;  4W7Z A;  2J58 A;  2PAJ A;  3M0D A;  1NTZ K;  1HTL C;  1NTM K;  2O1K A;  4ZKP A;  1IFM A;  4N3Y B;  1CSB A;  1GL2 B;  1W2E A;  3G3Z A;  5BVZ A;  5CCG A;  1JO5 A;  3RK3 B;  2A45 I;  1LTG C;  2A45 H;  1DEB A;  4HH2 A;  1RF1 C;  3I5C A;  2PP6 A;  1HGV A;  3M0D C;  3MGN A;  1L4A A;  4JF7 A;  3M06 A;  1FJK A;  2XNX A;  3KDP B;  3SWF A;  3M9B A;  5KJ7 D;  5CCG C;  1N2D C;  1URQ A;  3RL0 D;  3C9I A;  4RES B;  1CI6 A;  1LTA C;  3P8C D;  1SFC B;  1J1D B;  4WY4 A;  2XKM A;  5KJ7 A;  2H8P D;  3A7O A;  1CZQ A;  2N1T D;  2IFN A;  2GM4 A;  2HPC B;  1L4A C;  3NMD A;  1RE3 A;  3VP8 A;  3HUS A;  1FZF A;  3O8Z A;  3VTP C;  3B5N D;  2Q7C A;  1YTZ I;  1KQL A;  1LTI C;  4I2L C;  1X79 B;  5AVW B;  5KJ7 C;  4N6J A;  4B86 A;  3RL0 C;  2FYU K;  1AFO A;  3RK3 C;  2FXM A;  3P8C E;  3NFQ A;  3VOP A;  2WT7 B;  1RE3 C;  3H6P A;  1M7L A;  2HOD A;  1GD2 E;  1GTW A;  3TSI A;  3HTK A;  1GL2 D;  5APY A;  1FOS F;  3IR9 A;  4JYC A;  1SQP K;  1OWA A;  4XE5 B;  2NPS A;  3LW5 H;  2BAS A;  1L4A B;  4WBA A;  1X9V A;  3GHG A;  1SQX K;  5APX A;  1QL1 A;  5AVQ B;  5AVR B;  1LWU A;  3KQG A;  1URQ B;  1SFC D;  2POH A;  1CI6 B;  4WY4 B;  2R5D A;  3M91 A;  5BU8 B;  2OAR A;  3LIE A;  3RL0 B;  5AVZ B;  3IFM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...