3L37A

Pie12 d-peptide against hiv entry
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
45
structure length
45
Chain Sequence
RMKQIEDKIEEIESKQKKIENEIARIKKLLQLTVWGIKQLQARIL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags De novo protein
molecule keywords GP41 N-PEPTIDE
publication title Design of a potent D-peptide HIV-1 entry inhibitor with a strong barrier to resistance.
pubmed doi rcsb
total genus 20
structure length 45
sequence length 45
ec nomenclature
pdb deposition date 2009-12-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 3l37A00
3SWFA 3IR9A 3UIAA 4JYBA 2Z5HA 4HYTB 5APVA 4JYCA 3VYIA 5AVXB 5AW5B 3HE4B 1CI6B 3TK1A 3V4QA 2H7HA 3KDPB 1CZQA 5AVUB 1SLQA 2WPQA 2Q7CA 2YO3A 1FOSF 1A02J 4AYCA 3TYYA 1J2JB 4M3LA 1GD2E 1FAVA 1G2CB 5CMZA 3L37A 1IO4A 3HE5B 3O8ZA 1NAFA 2WWWA 2W27A 2P67A 1GZLA 1GTWA 1X8YA 3NFQA 4RESB 5AVYB 1GK4A 4XE5B 1NWQA 1T2KC 1T2KD 1H8AA 4AUWA 3M9HA 3KQGA 2P7JA 3M0AA 1DH3A 3NTNA 3M06A 2WT7A 3P8MC 1MFZA 2WTYA 2YO2A 1MUUA 3L35A 4GKGA 2Q3IA 4C7NA 1GK6A 1GU5A 5AW3B 5APQA 5AW1B 5AVQB 2ZXEB 2KP8A 1KQLA 1HBWA 2ZFCA 3B8EB 3L36A 2E42A 4DZOA 3M0DA 2IPPA 3A7OA 3HE4A 5AW0B 1CI6A 1OWAA 2VRSA 4I2LC 3TNUB 1GU4A 3OAKA 5APYA 2R32A 2WPRA 1OXZA 3NMDA 5APWA 1MV8A 2R5BA 2C9NY 2W6AA 5AVWB 3I5CA 3HE5A 3VN0A 3VTPC 3VMZA 1JUNA 5APSA 3T97A 3P32A 3LIEA 5APXA 1JNMA 2Q5UA 2XV5A 3LIDA 5AW2B 3A5TA 3V5BA 3P7KA 1SP4A 5AVSB 1HUCA 5APUA 4AQRD 5AW7B 5AVVB 3TNUA 1HJBA 3A3YB 2JJLA 1HWTC 4B86A 4KHXA 4I6MC 5AW6B 1CSBA 4C46A 2YNYA 3V4WA 2BASA 3VMYA 5AVRB 2N9BA 3M9BA 3M91A 3MGNA 2XU6A 1S9KD 3VMXA 2WPSA 2XZRA 1H88A 5AVTB 3HTKA 5AW9B 2R5DA 1H89A 2R3CA 1A02F 3MD0A 2WT7B 2C9LY 2P2UA 1YYCA 2E43A 3A2AA 1FOSE 3NXSA 4EOTA 4GT1A 4C7NB 2Z5IA 4LC1A 5AW8B 1S9KE 5AW4B 5AVZB 5APTA 2QM8A 2QM7A
chains in the Genus database with same CATH superfamily
1NH4A 1FS0E 4L75A 1S2EA 3HUSC 2K88A 1LP1B 4JYCA 5KAIE 2Q9IA 1VF5D 1A02J 1AJYA 1YJWP 5KAFE 2ZJSE 3USSA 1J1EB 2HODA 3MZWB 1EXIA 5AVYB 4XE5B 3EFGA 1LTJA 2OYIA 2E76B 2WSFH 3PLNA 1NOHA 3R4YA 4EIJA 2RMZA 4C7NA 3L72D 2OYHB 5AVQB 3TF5A 2ZXEB 3VP9A 3U59A 1L0NE 3H1IG 1K05A 1LWUC 1ZN5A 3E7KA 1N86A 2Q1KA 2CK3H 1KYOE 5KLVK 1SQPJ 1OX3A 4N3YB 1QLED 1ZMEC 3H1ID 1HF9A 3CCEP 2QJYC 4B86A 2Q3EA 3L71G 4K35A 2JDIH 4H13B 2WPSA 1EZVG 5AW9B 2QRXA 2M3EA 3A2AA 1NTKG 1NO4A 1NAYA 1L0NJ 2FYUG 3A0HH 2B88A 3L71D 2BCCE 3JCUH 1VQ4P 4HYTB 1EDLA 4IOIH 2R3SA 3BASA 1NTKD 4IFFA 4WY4C 1FOSF 2JO1A 5CMZA 1KZUB 3H1LE 3WUTA 2KS1A 2NPSD 5CCGC 1IC2A 3B71A 3AE3C 1DX7A 4PD4H 5B5EH 3L35A 3A0BH 3KPEA 1P84D 2AEFA 1JY3P 1KQLA 3L74E 2ZFCA 5CCHC 3S9OA 1L4AD 3SFEC 1G1JA 1VQLP 1GMJA 3GHGA 3CCUP 1PGPA 3U1AA 4N78D 3ZDMA 1FZEA 3HD7D 3VTPC 4NPDA 1PP9J 2L5GB 3W67A 5APSA 3PJSK 2K9YA 1SQBE 1JB0J 2FY8A 1N73A 4GOFA 3AE1C 1FBMA 1RE3C 2PAJA 3M9BA 3MGNA 5AVTB 3II6A 4I7ZC 2WT7B 1RE4C 4D6TG 4YXDC 3H1HG 1LT1A 3HUSB 2W8ZA 3IFMA 1KB9I 2YMKA 1T3UA 1Q81Q 3CX5I 4D6TD 3KDPB 2AXTE 3L4FA 5BU5A 2P1JA 2A06G 3H1KE 1QVFO 1SQXD 4RESB 1NU1K 1T2KD 2QSIA 3KQGA 1KB9E 1PFIA 3P8MC 4BXLA 1LWUB 3V2RA 2IZ1A 2OGUA 3S1KA 2O1JA 1HBWA 3M9QA 2GUSA 4DZOA 3JSVC 5KJ7D 1K8AQ 2B87B 2ZT9D 1AFOA 2FYUK 3HE4A 1NTZD 4I2LC 1FDMA 2WMMA 1KFMA 5APYA 3MUDA 1M57D 1SQVJ 1KTMA 1BGYG 2QJYB 3L75J 1OIPA 3LIEA 2Q5UA 1SQQG 5AW2B 1GW3A 3PHLA 4H44D 2QJKC 4U3FG 3P8CE 1RF1C 3HRNA 2Y0CA 1JY2N 3E1IA 3CCVP 4I6MC 1BGYD 3RGUA 5AVRB 3D6YA 1SQQD 2A45H 2R3CA 4PJ0H 4U3FD 1OW8A 5BVZA 2M5AA 4NPEA 1UIIA 1L0LJ 4IFDK 4JYBA 1JY2O 4WY4B 5AW5B 1BSNA 1AQ5A 1NTMG 4HB1A 2YO3A 4YPCA 2E76D 2HYNA 1M1KQ 1S3JA 5CBOA 1M1JA 1NTMD 3WMM0 2O01J 1JTHA 4YXWH 1MFZA 1MUUA 3B5NA 1FZGA 2FXMA 1KV4A 2O3JA 1BE3E 3RL0C 3C9IA 3L72J 1N8RQ 3KZIH 1IFPA 3PH0A 1OWAA 4PV1C 2IBZI 5BU8B 1P84H 1OFCX 1PGJA 2ZYAA 1MZ9A 2P58A 3T97A 3AECC 2BCCG 3O6QB 1SP4A 4JQ0D 1KN7A 3CXHI 1KILD 2WSSH 3H1LG 1BCCE 2R5DA 2KYVA 1H0TB 3IN6A 1FOSE 3H32B 2I1JA 3FXEA 1AV1A 2IFMA 3L73D 5APTA 1KORA 1BSHA 2YXRB 4DT0A 1MFTA 2E74C 3H1LD 1Y8AA 3L71J 1SFCC 2M3BA 1RF0C 4HH2A 1SLQA 3H1JE 1HJ0A 4AYCA 4M3LA 3F5HA 5B66E 5GTIE 1NTKJ 1KILA 1IFNA 5KLVG 2KXPB 3FX0A 1NWQA 1LTAC 3SWYA 2K1AA 1BCCJ 2PGDA 2FFDA 5AW1B 1M8OB 5TISH 1SQBG 1U7JA 2G8YA 5KLVD 1FZCA 1YQ4C 4XA4A 1ZRTE 5AW0B 1LTGC 1ZXGA 2POHA 4GOEA 3NMDA 1G2CA 1YHQP 1HTLC 3VN0A 3H1JJ 2QJKB 2MKVA 1X9VA 1KQGB 4R4LA 1NTMK 2YKQA 1PIXA 3P7KA 1L0NK 4EYYQ 4JF7A 1EXJA 1LGHB 1X79B 3LW5J 1K9MQ 1VQ5P 3BRTB 1S1CX 1IFMA 5DJUB 1FC2C 1JY3N 1PZQA 1G1IA 4W7YA 2ZVOB 3G6EP 3B4SA 2PRRA 4WWIA 3CCMP 2LXBA 3CWBG 1WRGA 4DJGA 1BDCA 2M8RA 3AEEC 2QA4P 1PPJG 4OGQC 1YQ3C 3TK1A 4EI2A 4H0LD 3CCQP 1YBKA 4IL6X 4LLHA 3HE5B 3CWBD 1ZP0C 1YITP 3TSIA 1PPJD 3CX5D 2GM4A 1JY3O 4R4MA 2IFNA 2DW3A 1NHLA 3M9HA 1RY3A 1SQPE 2YMYA 1SQXJ 1JCDA 1PV3A 1GK6A 1NYHA 1DIPA 3RL0B 1RQVA 2P10A 3CC2P 4PV1B 4W7ZA 1T3JA 1VPCA 2OQQA 2N1TC 1KYOI 4L76A 2AEMA 1NGMB 1E79H 3CPWO 2IX7C 1NTZJ 2RN0A 3BCCG 2B87A 1ZV8A 1HVVA 2A45G 3AEFC 3CCJP 2XU6A 2QG4A 2FYNC 3BCCD 2V7QJ 3TGUG 1KMIZ 1LTJC 2JWDA 2OYIC 1SQQJ 1NU1G 3CI9A 1SQBK 1LT9A 1SFCB 2OYOA 3C1LA 2Z5HA 3TGUD 1UIXA 1CI6B 2Q7CA 3FWNA 4K3AA 1NU1D 1FAVA 1BE3G 3L37A 1QGKB 3CC7P 1XTGB 3RK3D 3KHUA 5CBNA 1H8AA 1EZVD 3M0AA 3RK2C 3AE2C 2KNCB 2H8PD 1LTTC 2FYUD 1PL5A 5E79H 1PP9E 3I56P 1X0TA 3BRVB 3AE9C 1Q86Q 2IBZG 1S72P 1QEXA 3ABVC 3U1CA 2WSFJ 2WITA 1JM0A 2KOGA 2NZ2A 1OXZA 3I5CA 2ZYGA 3QH9A 3V2PA 3PTZA 2Y9ZA 3A0HE 2IBZD 2GUVA 5H2FH 3V5BA 4W80A 3JCUE 3AE5C 1ZR2A 2JR8A 2G3AA 1DEEG 2NPSA 3AEBC 3R2PA 1VQ7P 1VQ9P 3CXHD 2P2UA 1L2PA 1T6AA 3QWOC 3N7NA 4OGQB 1FJKA 4PD4E 3G9RA 3OA7A 3VP8A 1D7MA 5APVA 3L73J 3G4SP 3H32A 3PRJA 2Y0DA 1L4AA 2B89A 1FZAA 2AXTH 2E75C 1HH0A 1KD1Q 3GHGC 1GTWA 3HD7A 1X8YA 2KI7B 2KUBA 1HGZA 1SVFA 5M1BA 2I1KA 1KB9H 2YO2A 1SQVE 1YI2P 2IYOA 1N73C 3CX5H 3H1HD 3L75E 2N1TB 1MKMA 3L70E 3M0DA 5CHXA 1EC5A 3OW2O 5KLVJ 3V2QA 1XTCC 3GG2A 2R44A 2WSCH 4RO0A 5APWA 4JBZA 2NRGA 2A06D 3WU2E 4L73A 1N7SC 4NPFX 2ZVNB 1OMIA 4IL6E 1OVRA 5AVSB 1GL2D 1IK7A 2JKVA 2FYNB 2HODB 2GA1A 4C46A 1L0LE 1VQ8P 3RL0g 4KT0J 1CW5A 1H88A 3HTKA 2OYIB 1JO5A 3MD0A 1VQNP 2OTJP 3CCSP 4UB8H 2C0WA 1JOCA 4C7NB 1LTBC 3L70J 5GTHE 4XFJA 1S9KE 5AVZB 3UIAA 1GL2A 2D2CC 5KJ7A 3D6ZA 3D71A 1J2JB 3WUVA 2HPCA 2UWJE 2Y9YA 1WMKA 3FGAD 3MUDC 1GZLA 4BWNA 3RK2B 3L72E 1T2KC 2WZ7A 1PGOA 2O01N 4RKUJ 3GW6A 1KQSO 1M7LA 2Q3IA 1L0NG 1DD3A 2WSEH 1AVYA 2ZT9C 3A7OA 2QEXP 1LP1A 1FU1A 2H88C 2VRSA 3SWKA 2H89C 1FDIA 3MTUE 3VOPA 4U7JA 1L0ND 3CCLP 4PJ0E 2Z4EA 5AVWB 2LXCB 1KYOD 5APXA 2FYZA 4CPGA 2KS1B 3BATA 2LR2A 2N9BA 3M91A 2YXQB 2OYHA 1SFCD 3L71E 1OW7A 1U57A 1YTZT 4H13D 4WVZA 1URQC 1M1JC 1NKNA 1NTKE 3H25A 3H1IJ 3B5NC 2KB7P 3V2NA 3GF7A 3SFDC 4ZNCA 3CXHH 4I7ZB 2E75B 1CZQA 3GHGB 2BCCD 5AVUB 1EQ7A 3TGUJ 2IYPA 2KIKA 1AA0A 2BEQD 2PFXA 2M0BA 1NU1J 1P84E 3BVHA 1ZR4A 1N73B 1GW4A 4GODA 1YIJP 2K9JB 1PGQA 3Q5SA 3L74G 3PP5A 2ZYDA 2KP8A 3SSUA 1OZHA 2E42A 4N78E 2OARA 2XNDH 2FYUJ 2W90A 1RQUA 1GU4A 3L74D 1SQPK 4GIFA 1N7SB 2C9NY 1VQMP 5L8RJ 1N2DC 4UB6H 3EQ2A 1HUCA 2W6BA 2KSJA 1CSBA 4WBAA 4OGQD 1VL2A 1AVOA 3IF4A 1KILC 2XZRA 1SQBD 2E5YA 1VQOP 2BEZF 1RHZB 3NXSA 1RF1B 1J1DC 3GF3A 4D6TE 1FJPA 2V4HA 1S5LH 4QMAA 2D2CB 5KLIC 4BRYB 2FFDC 3IR9A 4C7RA 2RKLA 3HE4B 2ZXXA 1NJIQ 1WT6A 1QL2A 3H1KG 1FZCC 1USDA 1SQXE 1VDFA 1NAFA 2WWWA 1LNQA 1ZW0A 1YJNP 1OVUA 2JWAA 2L91A 3H1KD 3CCRP 2P7JA 5C39A 2WT7A 4HKZH 3GMAA 5KAIH 1Q7YQ 1EDKA 3HUSA 1NTZE 2ZT9B 4TT3H 1KB9D 2O1KA 4D6TJ 2MJZA 3CMAP 3H1HJ 3GLMA 2KLUA 5KAFH 2M5AB 1EDJA 2FKWB 2QVAA 1Q90D 3IAOA 1BGYE 3LIDA 4L74A 3I55P 5CJ4A 5AVVB 3A3YB 1SQQE 2C0XA 2FXPA 5KTBA 1QX8A 4U3FE 4Y99C 1LWUA 1KYOH 1S9KD 1URQB 1M1JB 3P8CD 1JTHB 1YYCA 4LGDE 3FWLA 3B5NB 3L72G 5AW8B 2W6JH 2IZ0A 4GDOA 2K3RA 3CD6P 3W68A 3RK2D 1R5SA 2Q6QA 2CPSA 3V4QA 4IFMA 4H0LC 2WPQA 1BGYJ 4WY4D 2I8DA 2OTKE 1NTME 3O8ZA 2P67A 3T97B 4Y28J 3S4RA 2E74B 1RH5B 4U3FJ 5CCGD 1NVOA 1IFJA 3NTNA 3M06A 1JMMA 1VF5C 1IJDB 3WUUA 5CCHD 4WY4A 4ZMDA 3EFFK 1GDTA 2E5TA 1BE3D 1SQVK 5CCGA 1LT9C 2K37A 1ZOYC 1JUNA 3RBZA 1NTMJ 1JNMA 5CJ0A 2J58A 1KILE 1HWTC 4RJTA 4ZKUA 2KZJA 2QIWA 1KILB 5AW6B 4I1LA 3JC22 3V4WA 4N6JA 5CCHA 1BCCG 3G3ZA 1FE6A 3E1RA 4O9BA 3L73E 1J1DB 3KXDA 1H89A 2C9LY 2E75D 2KZIA 5KLIB 2FFDB 3N4XA 1IK9A 2QJPC 2AEJA 2KK7A 3SWFA 1OW6A 1BCCD 4PD4I 3AEGC 1FZCB 1L0LK 2SPZA 3H1JG 5E79E 4YTPC 3O6QA 1Y9BA 1G2CB 1RE3A 1M56D 2BCCJ 3RK3C 3D70A 4OVNF 5DJTB 3NFQA 3MHVA 3H1JD 1RE4A 5KLVE 5B5EE 1QL1A 3Q3DA 1H0TA 2J5UA 3A0BE 5H2FE 3EWKA 3Q1MA 3H1LJ 1N7SD 1M90Q 3L36A 2NPSC 3FXDA 2K9JA 3TNUB 1MV8A 1HGVA 2QE7H 1ZRTD 1S4XA 3L74J 3WU2H 3TDKA 1LTIC 1ZLLA 1X22A 3A5TA 4Y99B 2YKPA 3AEAC 4IL6H 1L4AC 3VMAA 1K04A 4EDFA 1N7SA 3CLQA 4ASWA 1AQTA 1SQXG 3CMEP 1N7LA 2D2CD 3VMXA 1KQFB 3HD7C 1A02F 2E43A 2YKOA 1SQBJ 2CPBA 4TLFA 5GTHH 1Y47A 4DOJA 2FXOA 4H0LB 3CWBE 1YTZI 4OH8B 1Q82Q 1NTZG 1PPJE 3CX5E 1R8EA 1RF1A 2H7HA 3M0DC 2JP3A 1LTJB 2O01H 2HFED 1GD2E 1S5LX 1IO4A 1W2EA 4BRYA 1NTKK 1SQPG 1E5WA 1VF5B 4AUWA 1DH3A 2RH0A 1VQKP 3CC4P 2XDJA 4GKGA 3H1KJ 1TU3F 1DD4A 1SQPD 2IPPA 3RL0D 3CWBJ 2R32A 1OVVA 1JMBA 1LT9B 4PV1D 2ITAA 2A45I 1U7MA 2WPRA 2XNXA 4UB8E 3HE5A 2YIUC 1USEA 3P32A 3H6PA 1URQD 1VQPP 1GL2C 5APUA 5AW7B 3BCCE 5KJ7C 1HJBA 4MN4C 1YJ9P 2WSCJ 3B5ND 1BDDA 4Z1MH 1IFDA 3H1IE 4ZKPA 1VQ6P 2B9BA 3K5BA 4WB4A 1LJ2A 2HLOA 2QJPB 1EZVI 3TGUE 4H44C 2OTLP 2Z5IA 4LC1A 3Q2YA 5AW4B 2QM8A 1NU1E 1URQA 2N9YB 1T8ZA 5KKZC 2E74D 3AE4C 3RK3E 2WPVB 2HG5D 1QVGO 1KFNA 3RK3B 1EZVE 2W27A 1FDOA 3BCCJ 1IFIA 2FYUE 1P84I 1J1EC 3AE8C 1SS1A 2WTYA 3AEDC 1PP9G 1SQXK 1GU5A 2NPSB 2E76C 5APQA 3B8EB 1FZFA 1SFCA 3KZIE 2OYHC 1RF0A 5B66H 5GTIH 4DCKA 1CI6A 3L73G 1EDIA 3OJAB 2IBZE 1PP9D 3LW5H 3OAKA 3V6IA 1W2BO 2J59M 2WSEJ 3VMZA 1JEKA 1L4AB 1NTZK 1LTSC 5TJHA 1BE3J 3RBXA 1K73Q 2JJLA 3KYQA 2JEEA 3CXHE 4KHXA 3HD7B 2KNCA 3VMYA 2BASA 4H13C 2ZAEB 2Y0EA 1SQQK 2WQYC 2QM7A 4A7PA 3ITKA 3VYIA 5AVXB 1JCCA 2LKMA 3F89A 4PD4D 3TYYA 3MIWA 3G71P 3Q5RA 2KSEA 1JY2P 2W83C 1GK4A 2WVRA 3H1HE 1R5LA 1Q2NA 4JPZB 3Q5PA 1SQVG 4UB6E 3L75G 5TISE 1FZBA 2HR3A 5AW3B 3L70G 3HTKB 2AXCA 1DEBA 1NKZB 2A06E 1SQVD 2H43A 2N1TD 3L75D 2YIUB 2R5BA 2W6AA 2FBWC 3L70D 1GL2B 4OWFA 2PP6A 1W5CE 2XV5A 2V7QH 1S5LE 4AQRD 4HJGH 3C8VA 3TNUA 2HPCB 2KLVA 4ASVA 1L0LG 1Z56A 3AE7C 4KJMA 2YNYA 5EFWB 5K5GB 2N1TA 3CL3D 4H44B 3AE6C 1IZNB 1L0LD 2XKMA 3MP7B 4EOTA 4GT1A 5KKZB 1KC8Q 2IDBA
chains in the Genus database with same CATH topology
1NH4A 3SWFA 1FZCB 3HUSC 3UIAA 1L0LK 1GL2A 4JYCA 1SFCC 5KJ7A 2Q9IA 2M3BA 1RF0C 4HH2A 1SLQA 1A02J 4AYCA 1J2JB 4M3LA 1G2CB 1RE3A 2HPCA 1KILA 1GZLA 1J1EB 2HODA 1IFNA 3RK3C 3RK2B 3NFQA 5AVYB 4XE5B 1NWQA 1LTAC 1T2KC 1RE4A 2WZ7A 3EFGA 1LTJA 1QL1A 2OYIA 2WSFH 3SWYA 1NOHA 4EIJA 1M7LA 2FFDA 2Q3IA 4C7NA 2OYHB 5AW1B 5AVQB 1N7SD 2ZXEB 3VP9A 3L36A 3U59A 1LWUC 2WSEH 1ZN5A 2NPSC 1FZCA 3A7OA 4XA4A 1FU1A 1N86A 5AW0B 2VRSA 1LTGC 5KLVK 3TNUB 2POHA 3MTUE 3VOPA 3NMDA 1MV8A 4N3YB 2Z4EA 1G2CA 1HGVA 5AVWB 1HTLC 3VN0A 1X9VA 5APXA 1LTIC 1ZLLA 1NTMK 2YKQA 3A5TA 3P7KA 1L0NK 4JF7A 4Y99B 1LGHB 1X79B 2YKPA 2FYZA 1L4AC 4B86A 3BRTB 1N7SA 1IFMA 3CLQA 3BATA 2N9BA 3M91A 1N7LA 2OYHA 1SFCD 3VMXA 2WPSA 3HD7C 5AW9B 1A02F 2E43A 3A2AA 1JY3N 1YTZT 1NO4A 1G1IA 1M1JC 1URQC 2YKOA 4W7YA 1NKNA 2CPBA 3B5NC 1WRGA 2KB7P 2M8RA 4DOJA 3V2NA 1YTZI 4HYTB 4OH8B 3TK1A 3BASA 1RF1A 2H7HA 3M0DC 1CZQA 1LTJB 3GHGB 5AVUB 2O01H 2HFED 4IFFA 4WY4C 1EQ7A 1FOSF 1GD2E 5CMZA 4LLHA 1IO4A 1KZUB 1W2EA 3HE5B 3TSIA 2GM4A 2NPSD 1NTKK 1JY3O 5CCGC 2IFNA 1E5WA 3BVHA 1IC2A 1NHLA 1ZR4A 4AUWA 3M9HA 1RY3A 1N73B 1DH3A 1GW4A 1DX7A 2YMYA 1JCDA 3L35A 2XDJA 3PP5A 4GKGA 1GK6A 3KPEA 3RL0B 2KP8A 1JY3P 1KQLA 2ZFCA 5CCHC 2E42A 4N78E 2OARA 4W7ZA 2IPPA 1T3JA 1VPCA 1L4AD 2N1TC 3RL0D 1G1JA 1GU4A 2R32A 1LT9B 3GHGA 1SQPK 2A45I 2WPRA 4GIFA 1N7SB 2XNXA 3U1AA 4N78D 2C9NY 1FZEA 1N2DC 2IX7C 3HD7D 3HE5A 3VTPC 2L5GB 5APSA 3P32A 3H6PA 1ZV8A 1URQD 3EQ2A 1GL2C 1HUCA 5APUA 5AW7B 5KJ7C 1HJBA 2W6BA 1HVVA 3B5ND 1N73A 1IFDA 4ZKPA 2KSJA 2A45G 1CSBA 1FBMA 4WBAA 1RE3C 2PAJA 3M9BA 3MGNA 2XU6A 1KILC 4WB4A 2XZRA 5AVTB 2HLOA 3II6A 2WT7B 1RE4C 3NXSA 1RF1B 1J1DC 1LTJC 2Z5IA 2OYIC 4LC1A 3HUSB 1FJPA 3CI9A 5AW4B 1SQBK 2QM8A 3IFMA 1LT9A 2FFDC 1SFCB 3IR9A 1URQA 4C7RA 1T8ZA 2Z5HA 1T3UA 3HE4B 1CI6B 1WT6A 1QL2A 3KDPB 1FZCC 2HG5D 3L4FA 2Q7CA 5BU5A 1KFNA 2P1JA 1VDFA 3RK3B 1FAVA 3L37A 1NAFA 2WWWA 2W27A 1XTGB 3RK3D 1IFIA 4RESB 1NU1K 1J1EC 1T2KD 1H8AA 3KQGA 2P7JA 3M0AA 3RK2C 1PFIA 2WT7A 3P8MC 2WTYA 2H8PD 1LTTC 1LWUB 1SQXK 3V2RA 2NPSB 1GU5A 5APQA 2O1JA 3HUSA 1HBWA 3B8EB 1FZFA 2O1KA 1SFCA 3M9QA 3BRVB 2MJZA 2GUSA 4DZOA 2OYHC 5KJ7D 1RF0A 3U1CA 1AFOA 2WITA 2FYUK 2KOGA 3HE4A 1CI6A 4I2LC 3OJAB 1FDMA 1KFMA 3LW5H 3OAKA 2FKWB 3MUDA 5APYA 1OXZA 3I5CA 3V2PA 2J59M 3VMZA 1NTZK 1L4AB 3LIEA 2Q5UA 2GUVA 3LIDA 5AW2B 1LTSC 1GW3A 3V5BA 4W80A 5CJ4A 5AVVB 3A3YB 2JJLA 3P8CE 1RF1C 3HRNA 3KYQA 1ZR2A 1JY2N 2JEEA 2C0XA 3E1IA 5KTBA 4KHXA 4I6MC 4Y99C 3HD7B 3VMYA 2BASA 5AVRB 1LWUA 2NPSA 1S9KD 3R2PA 1URQB 1M1JB 3P8CD 2A45H 2R3CA 1JTHB 2P2UA 1YYCA 4LGDE 3B5NB 5BVZA 3N7NA 5AW8B 1SQQK 2QM7A 1FJKA 3OA7A 4IFDK 3VP8A 4JYBA 5APVA 1JY2O 4WY4B 3VYIA 3RK2D 5AVXB 5AW5B 1JCCA 2LKMA 3H32A 2CPSA 1L4AA 3V4QA 1AQ5A 4IFMA 2WPQA 2YO3A 3TYYA 1FZAA 4WY4D 3MIWA 3O8ZA 1HH0A 2HYNA 2P67A 3GHGC 1GTWA 3HD7A 1X8YA 1JY2P 1GK4A 1HGZA 5CCGD 1SVFA 1M1JA 1IFJA 3NTNA 3M06A 3WMM0 1JTHA 2I1KA 1MFZA 1JMMA 2YO2A 1MUUA 3B5NA 1FZBA 1FZGA 1N73C 5AW3B 2FXMA 2N1TB 3HTKB 1IJDB 5CCHD 1DEBA 1NKZB 3M0DA 5CHXA 3RL0C 3C9IA 2H43A 2N1TD 4WY4A 3V2QA 1XTCC 1OWAA 1GDTA 2WSCH 5BU8B 5APWA 2R5BA 2W6AA 1SQVK 5CCGA 1GL2B 1LT9C 1MZ9A 1JUNA 1N7SC 3T97A 1JNMA 2PP6A 2XV5A 5CJ0A 1SP4A 5AVSB 4AQRD 2J58A 1GL2D 3TNUA 2HPCB 2KLVA 1HWTC 4ZKUA 1Z56A 1KILB 2HODB 5AW6B 4I1LA 4C46A 2YNYA 4N6JA 3V4WA 5CCHA 3G3ZA 4O9BA 1KILD 1J1DB 1CW5A 2N1TA 1H88A 3CL3D 3HTKA 2OYIB 1JO5A 2R5DA 2KYVA 1H89A 3MD0A 2C9LY 1FOSE 3H32B 2C0WA 2XKMA 1JOCA 2FFDB 2I1JA 4EOTA 4GT1A 1LTBC 4C7NB 3N4XA 1IK9A 2IFMA 1S9KE 5AVZB 5APTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3SWF A;  3IR9 A;  3UIA A;  4JYB A;  2Z5H A;  4HYT B;  5APV A;  4JYC A;  3VYI A;  5AVX B;  5AW5 B;  3HE4 B;  1CI6 B;  3TK1 A;  3V4Q A;  2H7H A;  3KDP B;  1CZQ A;  5AVU B;  1SLQ A;  2WPQ A;  2Q7C A;  2YO3 A;  1FOS F;  1A02 J;  4AYC A;  3TYY A;  1J2J B;  4M3L A;  1GD2 E;  1FAV A;  1G2C B;  5CMZ A;  3L37 A;  1IO4 A;  3HE5 B;  3O8Z A;  1NAF A;  2WWW A;  2W27 A;  2P67 A;  1GZL A;  1GTW A;  1X8Y A;  3NFQ A;  4RES B;  5AVY B;  1GK4 A;  4XE5 B;  1NWQ A;  1T2K C;  1T2K D;  1H8A A;  4AUW A;  3M9H A;  3KQG A;  2P7J A;  3M0A A;  1DH3 A;  3NTN A;  3M06 A;  2WT7 A;  3P8M C;  1MFZ A;  2WTY A;  2YO2 A;  1MUU A;  3L35 A;  4GKG A;  2Q3I A;  4C7N A;  1GK6 A;  1GU5 A;  5AW3 B;  5APQ A;  5AW1 B;  5AVQ B;  2ZXE B;  2KP8 A;  1KQL A;  1HBW A;  2ZFC A;  3B8E B;  3L36 A;  2E42 A;  4DZO A;  3M0D A;  2IPP A;  3A7O A;  3HE4 A;  5AW0 B;  1CI6 A;  1OWA A;  2VRS A;  4I2L C;  3TNU B;  1GU4 A;  3OAK A;  5APY A;  2R32 A;  2WPR A;  1OXZ A;  3NMD A;  5APW A;  1MV8 A;  2R5B A;  2C9N Y;  2W6A A;  5AVW B;  3I5C A;  3HE5 A;  3VN0 A;  3VTP C;  3VMZ A;  1JUN A;  5APS A;  3T97 A;  3P32 A;  3LIE A;  5APX A;  1JNM A;  2Q5U A;  2XV5 A;  3LID A;  5AW2 B;  3A5T A;  3V5B A;  3P7K A;  1SP4 A;  5AVS B;  1HUC A;  5APU A;  4AQR D;  5AW7 B;  5AVV B;  3TNU A;  1HJB A;  3A3Y B;  2JJL A;  1HWT C;  4B86 A;  4KHX A;  4I6M C;  5AW6 B;  1CSB A;  4C46 A;  2YNY A;  3V4W A;  2BAS A;  3VMY A;  5AVR B;  2N9B A;  3M9B A;  3M91 A;  3MGN A;  2XU6 A;  1S9K D;  3VMX A;  2WPS A;  2XZR A;  1H88 A;  5AVT B;  3HTK A;  5AW9 B;  2R5D A;  1H89 A;  2R3C A;  1A02 F;  3MD0 A;  2WT7 B;  2C9L Y;  2P2U A;  1YYC A;  2E43 A;  3A2A A;  1FOS E;  3NXS A;  4EOT A;  4GT1 A;  4C7N B;  2Z5I A;  4LC1 A;  5AW8 B;  1S9K E;  5AW4 B;  5AVZ B;  5APT A;  2QM8 A;  2QM7 A; 
#chains in the Genus database with same CATH topology
 1NH4 A;  1FS0 E;  4L75 A;  1S2E A;  3HUS C;  2K88 A;  1LP1 B;  4JYC A;  5KAI E;  2Q9I A;  1VF5 D;  1A02 J;  1AJY A;  1YJW P;  5KAF E;  2ZJS E;  3USS A;  1J1E B;  2HOD A;  3MZW B;  1EXI A;  5AVY B;  4XE5 B;  3EFG A;  1LTJ A;  2OYI A;  2E76 B;  2WSF H;  3PLN A;  1NOH A;  3R4Y A;  4EIJ A;  2RMZ A;  4C7N A;  3L72 D;  2OYH B;  5AVQ B;  3TF5 A;  2ZXE B;  3VP9 A;  3U59 A;  1L0N E;  3H1I G;  1K05 A;  1LWU C;  1ZN5 A;  3E7K A;  1N86 A;  2Q1K A;  2CK3 H;  1KYO E;  5KLV K;  1SQP J;  1OX3 A;  4N3Y B;  1QLE D;  1ZME C;  3H1I D;  1HF9 A;  3CCE P;  2QJY C;  4B86 A;  2Q3E A;  3L71 G;  4K35 A;  2JDI H;  4H13 B;  2WPS A;  1EZV G;  5AW9 B;  2QRX A;  2M3E A;  3A2A A;  1NTK G;  1NO4 A;  1NAY A;  1L0N J;  2FYU G;  3A0H H;  2B88 A;  3L71 D;  2BCC E;  3JCU H;  1VQ4 P;  4HYT B;  1EDL A;  4IOI H;  2R3S A;  3BAS A;  1NTK D;  4IFF A;  4WY4 C;  1FOS F;  2JO1 A;  5CMZ A;  1KZU B;  3H1L E;  3WUT A;  2KS1 A;  2NPS D;  5CCG C;  1IC2 A;  3B71 A;  3AE3 C;  1DX7 A;  4PD4 H;  5B5E H;  3L35 A;  3A0B H;  3KPE A;  1P84 D;  2AEF A;  1JY3 P;  1KQL A;  3L74 E;  2ZFC A;  5CCH C;  3S9O A;  1L4A D;  3SFE C;  1G1J A;  1VQL P;  1GMJ A;  3GHG A;  3CCU P;  1PGP A;  3U1A A;  4N78 D;  3ZDM A;  1FZE A;  3HD7 D;  3VTP C;  4NPD A;  1PP9 J;  2L5G B;  3W67 A;  5APS A;  3PJS K;  2K9Y A;  1SQB E;  1JB0 J;  2FY8 A;  1N73 A;  4GOF A;  3AE1 C;  1FBM A;  1RE3 C;  2PAJ A;  3M9B A;  3MGN A;  5AVT B;  3II6 A;  4I7Z C;  2WT7 B;  1RE4 C;  4D6T G;  4YXD C;  3H1H G;  1LT1 A;  3HUS B;  2W8Z A;  3IFM A;  1KB9 I;  2YMK A;  1T3U A;  1Q81 Q;  3CX5 I;  4D6T D;  3KDP B;  2AXT E;  3L4F A;  5BU5 A;  2P1J A;  2A06 G;  3H1K E;  1QVF O;  1SQX D;  4RES B;  1NU1 K;  1T2K D;  2QSI A;  3KQG A;  1KB9 E;  1PFI A;  3P8M C;  4BXL A;  1LWU B;  3V2R A;  2IZ1 A;  2OGU A;  3S1K A;  2O1J A;  1HBW A;  3M9Q A;  2GUS A;  4DZO A;  3JSV C;  5KJ7 D;  1K8A Q;  2B87 B;  2ZT9 D;  1AFO A;  2FYU K;  3HE4 A;  1NTZ D;  4I2L C;  1FDM A;  2WMM A;  1KFM A;  5APY A;  3MUD A;  1M57 D;  1SQV J;  1KTM A;  1BGY G;  2QJY B;  3L75 J;  1OIP A;  3LIE A;  2Q5U A;  1SQQ G;  5AW2 B;  1GW3 A;  3PHL A;  4H44 D;  2QJK C;  4U3F G;  3P8C E;  1RF1 C;  3HRN A;  2Y0C A;  1JY2 N;  3E1I A;  3CCV P;  4I6M C;  1BGY D;  3RGU A;  5AVR B;  3D6Y A;  1SQQ D;  2A45 H;  2R3C A;  4PJ0 H;  4U3F D;  1OW8 A;  5BVZ A;  2M5A A;  4NPE A;  1UII A;  1L0L J;  4IFD K;  4JYB A;  1JY2 O;  4WY4 B;  5AW5 B;  1BSN A;  1AQ5 A;  1NTM G;  4HB1 A;  2YO3 A;  4YPC A;  2E76 D;  2HYN A;  1M1K Q;  1S3J A;  5CBO A;  1M1J A;  1NTM D;  3WMM 0;  2O01 J;  1JTH A;  4YXW H;  1MFZ A;  1MUU A;  3B5N A;  1FZG A;  2FXM A;  1KV4 A;  2O3J A;  1BE3 E;  3RL0 C;  3C9I A;  3L72 J;  1N8R Q;  3KZI H;  1IFP A;  3PH0 A;  1OWA A;  4PV1 C;  2IBZ I;  5BU8 B;  1P84 H;  1OFC X;  1PGJ A;  2ZYA A;  1MZ9 A;  2P58 A;  3T97 A;  3AEC C;  2BCC G;  3O6Q B;  1SP4 A;  4JQ0 D;  1KN7 A;  3CXH I;  1KIL D;  2WSS H;  3H1L G;  1BCC E;  2R5D A;  2KYV A;  1H0T B;  3IN6 A;  1FOS E;  3H32 B;  2I1J A;  3FXE A;  1AV1 A;  2IFM A;  3L73 D;  5APT A;  1KOR A;  1BSH A;  2YXR B;  4DT0 A;  1MFT A;  2E74 C;  3H1L D;  1Y8A A;  3L71 J;  1SFC C;  2M3B A;  1RF0 C;  4HH2 A;  1SLQ A;  3H1J E;  1HJ0 A;  4AYC A;  4M3L A;  3F5H A;  5B66 E;  5GTI E;  1NTK J;  1KIL A;  1IFN A;  5KLV G;  2KXP B;  3FX0 A;  1NWQ A;  1LTA C;  3SWY A;  2K1A A;  1BCC J;  2PGD A;  2FFD A;  5AW1 B;  1M8O B;  5TIS H;  1SQB G;  1U7J A;  2G8Y A;  5KLV D;  1FZC A;  1YQ4 C;  4XA4 A;  1ZRT E;  5AW0 B;  1LTG C;  1ZXG A;  2POH A;  4GOE A;  3NMD A;  1G2C A;  1YHQ P;  1HTL C;  3VN0 A;  3H1J J;  2QJK B;  2MKV A;  1X9V A;  1KQG B;  4R4L A;  1NTM K;  2YKQ A;  1PIX A;  3P7K A;  1L0N K;  4EYY Q;  4JF7 A;  1EXJ A;  1LGH B;  1X79 B;  3LW5 J;  1K9M Q;  1VQ5 P;  3BRT B;  1S1C X;  1IFM A;  5DJU B;  1FC2 C;  1JY3 N;  1PZQ A;  1G1I A;  4W7Y A;  2ZVO B;  3G6E P;  3B4S A;  2PRR A;  4WWI A;  3CCM P;  2LXB A;  3CWB G;  1WRG A;  4DJG A;  1BDC A;  2M8R A;  3AEE C;  2QA4 P;  1PPJ G;  4OGQ C;  1YQ3 C;  3TK1 A;  4EI2 A;  4H0L D;  3CCQ P;  1YBK A;  4IL6 X;  4LLH A;  3HE5 B;  3CWB D;  1ZP0 C;  1YIT P;  3TSI A;  1PPJ D;  3CX5 D;  2GM4 A;  1JY3 O;  4R4M A;  2IFN A;  2DW3 A;  1NHL A;  3M9H A;  1RY3 A;  1SQP E;  2YMY A;  1SQX J;  1JCD A;  1PV3 A;  1GK6 A;  1NYH A;  1DIP A;  3RL0 B;  1RQV A;  2P10 A;  3CC2 P;  4PV1 B;  4W7Z A;  1T3J A;  1VPC A;  2OQQ A;  2N1T C;  1KYO I;  4L76 A;  2AEM A;  1NGM B;  1E79 H;  3CPW O;  2IX7 C;  1NTZ J;  2RN0 A;  3BCC G;  2B87 A;  1ZV8 A;  1HVV A;  2A45 G;  3AEF C;  3CCJ P;  2XU6 A;  2QG4 A;  2FYN C;  3BCC D;  2V7Q J;  3TGU G;  1KMI Z;  1LTJ C;  2JWD A;  2OYI C;  1SQQ J;  1NU1 G;  3CI9 A;  1SQB K;  1LT9 A;  1SFC B;  2OYO A;  3C1L A;  2Z5H A;  3TGU D;  1UIX A;  1CI6 B;  2Q7C A;  3FWN A;  4K3A A;  1NU1 D;  1FAV A;  1BE3 G;  3L37 A;  1QGK B;  3CC7 P;  1XTG B;  3RK3 D;  3KHU A;  5CBN A;  1H8A A;  1EZV D;  3M0A A;  3RK2 C;  3AE2 C;  2KNC B;  2H8P D;  1LTT C;  2FYU D;  1PL5 A;  5E79 H;  1PP9 E;  3I56 P;  1X0T A;  3BRV B;  3AE9 C;  1Q86 Q;  2IBZ G;  1S72 P;  1QEX A;  3ABV C;  3U1C A;  2WSF J;  2WIT A;  1JM0 A;  2KOG A;  2NZ2 A;  1OXZ A;  3I5C A;  2ZYG A;  3QH9 A;  3V2P A;  3PTZ A;  2Y9Z A;  3A0H E;  2IBZ D;  2GUV A;  5H2F H;  3V5B A;  4W80 A;  3JCU E;  3AE5 C;  1ZR2 A;  2JR8 A;  2G3A A;  1DEE G;  2NPS A;  3AEB C;  3R2P A;  1VQ7 P;  1VQ9 P;  3CXH D;  2P2U A;  1L2P A;  1T6A A;  3QWO C;  3N7N A;  4OGQ B;  1FJK A;  4PD4 E;  3G9R A;  3OA7 A;  3VP8 A;  1D7M A;  5APV A;  3L73 J;  3G4S P;  3H32 A;  3PRJ A;  2Y0D A;  1L4A A;  2B89 A;  1FZA A;  2AXT H;  2E75 C;  1HH0 A;  1KD1 Q;  3GHG C;  1GTW A;  3HD7 A;  1X8Y A;  2KI7 B;  2KUB A;  1HGZ A;  1SVF A;  5M1B A;  2I1K A;  1KB9 H;  2YO2 A;  1SQV E;  1YI2 P;  2IYO A;  1N73 C;  3CX5 H;  3H1H D;  3L75 E;  2N1T B;  1MKM A;  3L70 E;  3M0D A;  5CHX A;  1EC5 A;  3OW2 O;  5KLV J;  3V2Q A;  1XTC C;  3GG2 A;  2R44 A;  2WSC H;  4RO0 A;  5APW A;  4JBZ A;  2NRG A;  2A06 D;  3WU2 E;  4L73 A;  1N7S C;  4NPF X;  2ZVN B;  1OMI A;  4IL6 E;  1OVR A;  5AVS B;  1GL2 D;  1IK7 A;  2JKV A;  2FYN B;  2HOD B;  2GA1 A;  4C46 A;  1L0L E;  1VQ8 P;  3RL0 g;  4KT0 J;  1CW5 A;  1H88 A;  3HTK A;  2OYI B;  1JO5 A;  3MD0 A;  1VQN P;  2OTJ P;  3CCS P;  4UB8 H;  2C0W A;  1JOC A;  4C7N B;  1LTB C;  3L70 J;  5GTH E;  4XFJ A;  1S9K E;  5AVZ B;  3UIA A;  1GL2 A;  2D2C C;  5KJ7 A;  3D6Z A;  3D71 A;  1J2J B;  3WUV A;  2HPC A;  2UWJ E;  2Y9Y A;  1WMK A;  3FGA D;  3MUD C;  1GZL A;  4BWN A;  3RK2 B;  3L72 E;  1T2K C;  2WZ7 A;  1PGO A;  2O01 N;  4RKU J;  3GW6 A;  1KQS O;  1M7L A;  2Q3I A;  1L0N G;  1DD3 A;  2WSE H;  1AVY A;  2ZT9 C;  3A7O A;  2QEX P;  1LP1 A;  1FU1 A;  2H88 C;  2VRS A;  3SWK A;  2H89 C;  1FDI A;  3MTU E;  3VOP A;  4U7J A;  1L0N D;  3CCL P;  4PJ0 E;  2Z4E A;  5AVW B;  2LXC B;  1KYO D;  5APX A;  2FYZ A;  4CPG A;  2KS1 B;  3BAT A;  2LR2 A;  2N9B A;  3M91 A;  2YXQ B;  2OYH A;  1SFC D;  3L71 E;  1OW7 A;  1U57 A;  1YTZ T;  4H13 D;  4WVZ A;  1URQ C;  1M1J C;  1NKN A;  1NTK E;  3H25 A;  3H1I J;  3B5N C;  2KB7 P;  3V2N A;  3GF7 A;  3SFD C;  4ZNC A;  3CXH H;  4I7Z B;  2E75 B;  1CZQ A;  3GHG B;  2BCC D;  5AVU B;  1EQ7 A;  3TGU J;  2IYP A;  2KIK A;  1AA0 A;  2BEQ D;  2PFX A;  2M0B A;  1NU1 J;  1P84 E;  3BVH A;  1ZR4 A;  1N73 B;  1GW4 A;  4GOD A;  1YIJ P;  2K9J B;  1PGQ A;  3Q5S A;  3L74 G;  3PP5 A;  2ZYD A;  2KP8 A;  3SSU A;  1OZH A;  2E42 A;  4N78 E;  2OAR A;  2XND H;  2FYU J;  2W90 A;  1RQU A;  1GU4 A;  3L74 D;  1SQP K;  4GIF A;  1N7S B;  2C9N Y;  1VQM P;  5L8R J;  1N2D C;  4UB6 H;  3EQ2 A;  1HUC A;  2W6B A;  2KSJ A;  1CSB A;  4WBA A;  4OGQ D;  1VL2 A;  1AVO A;  3IF4 A;  1KIL C;  2XZR A;  1SQB D;  2E5Y A;  1VQO P;  2BEZ F;  1RHZ B;  3NXS A;  1RF1 B;  1J1D C;  3GF3 A;  4D6T E;  1FJP A;  2V4H A;  1S5L H;  4QMA A;  2D2C B;  5KLI C;  4BRY B;  2FFD C;  3IR9 A;  4C7R A;  2RKL A;  3HE4 B;  2ZXX A;  1NJI Q;  1WT6 A;  1QL2 A;  3H1K G;  1FZC C;  1USD A;  1SQX E;  1VDF A;  1NAF A;  2WWW A;  1LNQ A;  1ZW0 A;  1YJN P;  1OVU A;  2JWA A;  2L91 A;  3H1K D;  3CCR P;  2P7J A;  5C39 A;  2WT7 A;  4HKZ H;  3GMA A;  5KAI H;  1Q7Y Q;  1EDK A;  3HUS A;  1NTZ E;  2ZT9 B;  4TT3 H;  1KB9 D;  2O1K A;  4D6T J;  2MJZ A;  3CMA P;  3H1H J;  3GLM A;  2KLU A;  5KAF H;  2M5A B;  1EDJ A;  2FKW B;  2QVA A;  1Q90 D;  3IAO A;  1BGY E;  3LID A;  4L74 A;  3I55 P;  5CJ4 A;  5AVV B;  3A3Y B;  1SQQ E;  2C0X A;  2FXP A;  5KTB A;  1QX8 A;  4U3F E;  4Y99 C;  1LWU A;  1KYO H;  1S9K D;  1URQ B;  1M1J B;  3P8C D;  1JTH B;  1YYC A;  4LGD E;  3FWL A;  3B5N B;  3L72 G;  5AW8 B;  2W6J H;  2IZ0 A;  4GDO A;  2K3R A;  3CD6 P;  3W68 A;  3RK2 D;  1R5S A;  2Q6Q A;  2CPS A;  3V4Q A;  4IFM A;  4H0L C;  2WPQ A;  1BGY J;  4WY4 D;  2I8D A;  2OTK E;  1NTM E;  3O8Z A;  2P67 A;  3T97 B;  4Y28 J;  3S4R A;  2E74 B;  1RH5 B;  4U3F J;  5CCG D;  1NVO A;  1IFJ A;  3NTN A;  3M06 A;  1JMM A;  1VF5 C;  1IJD B;  3WUU A;  5CCH D;  4WY4 A;  4ZMD A;  3EFF K;  1GDT A;  2E5T A;  1BE3 D;  1SQV K;  5CCG A;  1LT9 C;  2K37 A;  1ZOY C;  1JUN A;  3RBZ A;  1NTM J;  1JNM A;  5CJ0 A;  2J58 A;  1KIL E;  1HWT C;  4RJT A;  4ZKU A;  2KZJ A;  2QIW A;  1KIL B;  5AW6 B;  4I1L A;  3JC2 2;  3V4W A;  4N6J A;  5CCH A;  1BCC G;  3G3Z A;  1FE6 A;  3E1R A;  4O9B A;  3L73 E;  1J1D B;  3KXD A;  1H89 A;  2C9L Y;  2E75 D;  2KZI A;  5KLI B;  2FFD B;  3N4X A;  1IK9 A;  2QJP C;  2AEJ A;  2KK7 A;  3SWF A;  1OW6 A;  1BCC D;  4PD4 I;  3AEG C;  1FZC B;  1L0L K;  2SPZ A;  3H1J G;  5E79 E;  4YTP C;  3O6Q A;  1Y9B A;  1G2C B;  1RE3 A;  1M56 D;  2BCC J;  3RK3 C;  3D70 A;  4OVN F;  5DJT B;  3NFQ A;  3MHV A;  3H1J D;  1RE4 A;  5KLV E;  5B5E E;  1QL1 A;  3Q3D A;  1H0T A;  2J5U A;  3A0B E;  5H2F E;  3EWK A;  3Q1M A;  3H1L J;  1N7S D;  1M90 Q;  3L36 A;  2NPS C;  3FXD A;  2K9J A;  3TNU B;  1MV8 A;  1HGV A;  2QE7 H;  1ZRT D;  1S4X A;  3L74 J;  3WU2 H;  3TDK A;  1LTI C;  1ZLL A;  1X22 A;  3A5T A;  4Y99 B;  2YKP A;  3AEA C;  4IL6 H;  1L4A C;  3VMA A;  1K04 A;  4EDF A;  1N7S A;  3CLQ A;  4ASW A;  1AQT A;  1SQX G;  3CME P;  1N7L A;  2D2C D;  3VMX A;  1KQF B;  3HD7 C;  1A02 F;  2E43 A;  2YKO A;  1SQB J;  2CPB A;  4TLF A;  5GTH H;  1Y47 A;  4DOJ A;  2FXO A;  4H0L B;  3CWB E;  1YTZ I;  4OH8 B;  1Q82 Q;  1NTZ G;  1PPJ E;  3CX5 E;  1R8E A;  1RF1 A;  2H7H A;  3M0D C;  2JP3 A;  1LTJ B;  2O01 H;  2HFE D;  1GD2 E;  1S5L X;  1IO4 A;  1W2E A;  4BRY A;  1NTK K;  1SQP G;  1E5W A;  1VF5 B;  4AUW A;  1DH3 A;  2RH0 A;  1VQK P;  3CC4 P;  2XDJ A;  4GKG A;  3H1K J;  1TU3 F;  1DD4 A;  1SQP D;  2IPP A;  3RL0 D;  3CWB J;  2R32 A;  1OVV A;  1JMB A;  1LT9 B;  4PV1 D;  2ITA A;  2A45 I;  1U7M A;  2WPR A;  2XNX A;  4UB8 E;  3HE5 A;  2YIU C;  1USE A;  3P32 A;  3H6P A;  1URQ D;  1VQP P;  1GL2 C;  5APU A;  5AW7 B;  3BCC E;  5KJ7 C;  1HJB A;  4MN4 C;  1YJ9 P;  2WSC J;  3B5N D;  1BDD A;  4Z1M H;  1IFD A;  3H1I E;  4ZKP A;  1VQ6 P;  2B9B A;  3K5B A;  4WB4 A;  1LJ2 A;  2HLO A;  2QJP B;  1EZV I;  3TGU E;  4H44 C;  2OTL P;  2Z5I A;  4LC1 A;  3Q2Y A;  5AW4 B;  2QM8 A;  1NU1 E;  1URQ A;  2N9Y B;  1T8Z A;  5KKZ C;  2E74 D;  3AE4 C;  3RK3 E;  2WPV B;  2HG5 D;  1QVG O;  1KFN A;  3RK3 B;  1EZV E;  2W27 A;  1FDO A;  3BCC J;  1IFI A;  2FYU E;  1P84 I;  1J1E C;  3AE8 C;  1SS1 A;  2WTY A;  3AED C;  1PP9 G;  1SQX K;  1GU5 A;  2NPS B;  2E76 C;  5APQ A;  3B8E B;  1FZF A;  1SFC A;  3KZI E;  2OYH C;  1RF0 A;  5B66 H;  5GTI H;  4DCK A;  1CI6 A;  3L73 G;  1EDI A;  3OJA B;  2IBZ E;  1PP9 D;  3LW5 H;  3OAK A;  3V6I A;  1W2B O;  2J59 M;  2WSE J;  3VMZ A;  1JEK A;  1L4A B;  1NTZ K;  1LTS C;  5TJH A;  1BE3 J;  3RBX A;  1K73 Q;  2JJL A;  3KYQ A;  2JEE A;  3CXH E;  4KHX A;  3HD7 B;  2KNC A;  3VMY A;  2BAS A;  4H13 C;  2ZAE B;  2Y0E A;  1SQQ K;  2WQY C;  2QM7 A;  4A7P A;  3ITK A;  3VYI A;  5AVX B;  1JCC A;  2LKM A;  3F89 A;  4PD4 D;  3TYY A;  3MIW A;  3G71 P;  3Q5R A;  2KSE A;  1JY2 P;  2W83 C;  1GK4 A;  2WVR A;  3H1H E;  1R5L A;  1Q2N A;  4JPZ B;  3Q5P A;  1SQV G;  4UB6 E;  3L75 G;  5TIS E;  1FZB A;  2HR3 A;  5AW3 B;  3L70 G;  3HTK B;  2AXC A;  1DEB A;  1NKZ B;  2A06 E;  1SQV D;  2H43 A;  2N1T D;  3L75 D;  2YIU B;  2R5B A;  2W6A A;  2FBW C;  3L70 D;  1GL2 B;  4OWF A;  2PP6 A;  1W5C E;  2XV5 A;  2V7Q H;  1S5L E;  4AQR D;  4HJG H;  3C8V A;  3TNU A;  2HPC B;  2KLV A;  4ASV A;  1L0L G;  1Z56 A;  3AE7 C;  4KJM A;  2YNY A;  5EFW B;  5K5G B;  2N1T A;  3CL3 D;  4H44 B;  3AE6 C;  1IZN B;  1L0L D;  2XKM A;  3MP7 B;  4EOT A;  4GT1 A;  5KKZ B;  1KC8 Q;  2IDB A; 
#chains in the Genus database with same CATH homology
 1NH4 A;  3SWF A;  1FZC B;  3HUS C;  3UIA A;  1L0L K;  1GL2 A;  4JYC A;  1SFC C;  5KJ7 A;  2Q9I A;  2M3B A;  1RF0 C;  4HH2 A;  1SLQ A;  1A02 J;  4AYC A;  1J2J B;  4M3L A;  1G2C B;  1RE3 A;  2HPC A;  1KIL A;  1GZL A;  1J1E B;  2HOD A;  1IFN A;  3RK3 C;  3RK2 B;  3NFQ A;  5AVY B;  4XE5 B;  1NWQ A;  1LTA C;  1T2K C;  1RE4 A;  2WZ7 A;  3EFG A;  1LTJ A;  1QL1 A;  2OYI A;  2WSF H;  3SWY A;  1NOH A;  4EIJ A;  1M7L A;  2FFD A;  2Q3I A;  4C7N A;  2OYH B;  5AW1 B;  5AVQ B;  1N7S D;  2ZXE B;  3VP9 A;  3L36 A;  3U59 A;  1LWU C;  2WSE H;  1ZN5 A;  2NPS C;  1FZC A;  3A7O A;  4XA4 A;  1FU1 A;  1N86 A;  5AW0 B;  2VRS A;  1LTG C;  5KLV K;  3TNU B;  2POH A;  3MTU E;  3VOP A;  3NMD A;  1MV8 A;  4N3Y B;  2Z4E A;  1G2C A;  1HGV A;  5AVW B;  1HTL C;  3VN0 A;  1X9V A;  5APX A;  1LTI C;  1ZLL A;  1NTM K;  2YKQ A;  3A5T A;  3P7K A;  1L0N K;  4JF7 A;  4Y99 B;  1LGH B;  1X79 B;  2YKP A;  2FYZ A;  1L4A C;  4B86 A;  3BRT B;  1N7S A;  1IFM A;  3CLQ A;  3BAT A;  2N9B A;  3M91 A;  1N7L A;  2OYH A;  1SFC D;  3VMX A;  2WPS A;  3HD7 C;  5AW9 B;  1A02 F;  2E43 A;  3A2A A;  1JY3 N;  1YTZ T;  1NO4 A;  1G1I A;  1M1J C;  1URQ C;  2YKO A;  4W7Y A;  1NKN A;  2CPB A;  3B5N C;  1WRG A;  2KB7 P;  2M8R A;  4DOJ A;  3V2N A;  1YTZ I;  4HYT B;  4OH8 B;  3TK1 A;  3BAS A;  1RF1 A;  2H7H A;  3M0D C;  1CZQ A;  1LTJ B;  3GHG B;  5AVU B;  2O01 H;  2HFE D;  4IFF A;  4WY4 C;  1EQ7 A;  1FOS F;  1GD2 E;  5CMZ A;  4LLH A;  1IO4 A;  1KZU B;  1W2E A;  3HE5 B;  3TSI A;  2GM4 A;  2NPS D;  1NTK K;  1JY3 O;  5CCG C;  2IFN A;  1E5W A;  3BVH A;  1IC2 A;  1NHL A;  1ZR4 A;  4AUW A;  3M9H A;  1RY3 A;  1N73 B;  1DH3 A;  1GW4 A;  1DX7 A;  2YMY A;  1JCD A;  3L35 A;  2XDJ A;  3PP5 A;  4GKG A;  1GK6 A;  3KPE A;  3RL0 B;  2KP8 A;  1JY3 P;  1KQL A;  2ZFC A;  5CCH C;  2E42 A;  4N78 E;  2OAR A;  4W7Z A;  2IPP A;  1T3J A;  1VPC A;  1L4A D;  2N1T C;  3RL0 D;  1G1J A;  1GU4 A;  2R32 A;  1LT9 B;  3GHG A;  1SQP K;  2A45 I;  2WPR A;  4GIF A;  1N7S B;  2XNX A;  3U1A A;  4N78 D;  2C9N Y;  1FZE A;  1N2D C;  2IX7 C;  3HD7 D;  3HE5 A;  3VTP C;  2L5G B;  5APS A;  3P32 A;  3H6P A;  1ZV8 A;  1URQ D;  3EQ2 A;  1GL2 C;  1HUC A;  5APU A;  5AW7 B;  5KJ7 C;  1HJB A;  2W6B A;  1HVV A;  3B5N D;  1N73 A;  1IFD A;  4ZKP A;  2KSJ A;  2A45 G;  1CSB A;  1FBM A;  4WBA A;  1RE3 C;  2PAJ A;  3M9B A;  3MGN A;  2XU6 A;  1KIL C;  4WB4 A;  2XZR A;  5AVT B;  2HLO A;  3II6 A;  2WT7 B;  1RE4 C;  3NXS A;  1RF1 B;  1J1D C;  1LTJ C;  2Z5I A;  2OYI C;  4LC1 A;  3HUS B;  1FJP A;  3CI9 A;  5AW4 B;  1SQB K;  2QM8 A;  3IFM A;  1LT9 A;  2FFD C;  1SFC B;  3IR9 A;  1URQ A;  4C7R A;  1T8Z A;  2Z5H A;  1T3U A;  3HE4 B;  1CI6 B;  1WT6 A;  1QL2 A;  3KDP B;  1FZC C;  2HG5 D;  3L4F A;  2Q7C A;  5BU5 A;  1KFN A;  2P1J A;  1VDF A;  3RK3 B;  1FAV A;  3L37 A;  1NAF A;  2WWW A;  2W27 A;  1XTG B;  3RK3 D;  1IFI A;  4RES B;  1NU1 K;  1J1E C;  1T2K D;  1H8A A;  3KQG A;  2P7J A;  3M0A A;  3RK2 C;  1PFI A;  2WT7 A;  3P8M C;  2WTY A;  2H8P D;  1LTT C;  1LWU B;  1SQX K;  3V2R A;  2NPS B;  1GU5 A;  5APQ A;  2O1J A;  3HUS A;  1HBW A;  3B8E B;  1FZF A;  2O1K A;  1SFC A;  3M9Q A;  3BRV B;  2MJZ A;  2GUS A;  4DZO A;  2OYH C;  5KJ7 D;  1RF0 A;  3U1C A;  1AFO A;  2WIT A;  2FYU K;  2KOG A;  3HE4 A;  1CI6 A;  4I2L C;  3OJA B;  1FDM A;  1KFM A;  3LW5 H;  3OAK A;  2FKW B;  3MUD A;  5APY A;  1OXZ A;  3I5C A;  3V2P A;  2J59 M;  3VMZ A;  1NTZ K;  1L4A B;  3LIE A;  2Q5U A;  2GUV A;  3LID A;  5AW2 B;  1LTS C;  1GW3 A;  3V5B A;  4W80 A;  5CJ4 A;  5AVV B;  3A3Y B;  2JJL A;  3P8C E;  1RF1 C;  3HRN A;  3KYQ A;  1ZR2 A;  1JY2 N;  2JEE A;  2C0X A;  3E1I A;  5KTB A;  4KHX A;  4I6M C;  4Y99 C;  3HD7 B;  3VMY A;  2BAS A;  5AVR B;  1LWU A;  2NPS A;  1S9K D;  3R2P A;  1URQ B;  1M1J B;  3P8C D;  2A45 H;  2R3C A;  1JTH B;  2P2U A;  1YYC A;  4LGD E;  3B5N B;  5BVZ A;  3N7N A;  5AW8 B;  1SQQ K;  2QM7 A;  1FJK A;  3OA7 A;  4IFD K;  3VP8 A;  4JYB A;  5APV A;  1JY2 O;  4WY4 B;  3VYI A;  3RK2 D;  5AVX B;  5AW5 B;  1JCC A;  2LKM A;  3H32 A;  2CPS A;  1L4A A;  3V4Q A;  1AQ5 A;  4IFM A;  2WPQ A;  2YO3 A;  3TYY A;  1FZA A;  4WY4 D;  3MIW A;  3O8Z A;  1HH0 A;  2HYN A;  2P67 A;  3GHG C;  1GTW A;  3HD7 A;  1X8Y A;  1JY2 P;  1GK4 A;  1HGZ A;  5CCG D;  1SVF A;  1M1J A;  1IFJ A;  3NTN A;  3M06 A;  3WMM 0;  1JTH A;  2I1K A;  1MFZ A;  1JMM A;  2YO2 A;  1MUU A;  3B5N A;  1FZB A;  1FZG A;  1N73 C;  5AW3 B;  2FXM A;  2N1T B;  3HTK B;  1IJD B;  5CCH D;  1DEB A;  1NKZ B;  3M0D A;  5CHX A;  3RL0 C;  3C9I A;  2H43 A;  2N1T D;  4WY4 A;  3V2Q A;  1XTC C;  1OWA A;  1GDT A;  2WSC H;  5BU8 B;  5APW A;  2R5B A;  2W6A A;  1SQV K;  5CCG A;  1GL2 B;  1LT9 C;  1MZ9 A;  1JUN A;  1N7S C;  3T97 A;  1JNM A;  2PP6 A;  2XV5 A;  5CJ0 A;  1SP4 A;  5AVS B;  4AQR D;  2J58 A;  1GL2 D;  3TNU A;  2HPC B;  2KLV A;  1HWT C;  4ZKU A;  1Z56 A;  1KIL B;  2HOD B;  5AW6 B;  4I1L A;  4C46 A;  2YNY A;  4N6J A;  3V4W A;  5CCH A;  3G3Z A;  4O9B A;  1KIL D;  1J1D B;  1CW5 A;  2N1T A;  1H88 A;  3CL3 D;  3HTK A;  2OYI B;  1JO5 A;  2R5D A;  2KYV A;  1H89 A;  3MD0 A;  2C9L Y;  1FOS E;  3H32 B;  2C0W A;  2XKM A;  1JOC A;  2FFD B;  2I1J A;  4EOT A;  4GT1 A;  1LTB C;  4C7N B;  3N4X A;  1IK9 A;  2IFM A;  1S9K E;  5AVZ B;  5APT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...