1BDCA

Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCUS AUREUS PROTEIN A
publication title Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1bdcA00
1SS1A 3FXDA 1S3JA 1EDKA 1EDIA 2LXCB 5K5GB 4HB1A 1LP1B 2SPZA 2WMMA 4K35A 2RKLA 1OVUA 4CPGA 1BDCA 1LP1A 1Y47A 5CBNA 1EDJA 1EC5A 4HJGH 2M0BA 2B87B 2JWDA 4GOEA 1X0TA 2K3RA 4WWIA 2P58A 4NPFX 3RGUA 1BDDA 2B87A 4MN4C 2M5AB 2KZIA 2KIKA 2KUBA 4GODA 1U7MA 4BXLA 2M5AA 2Q1KA 2B89A 5CBOA 1Q2NA 2B88A 5DJUB 1MFTA 3FXEA 2KS1B 2QRXA 1ZXGA 2I8DA 4ZMDA 2R44A 4ASVA 3MHVA 2LR2A 1DEEG 1LT1A 1NVOA 3ZDMA 2HR3A 1U7JA 4GOFA 2OTKE 5EFWB 2KZJA 4HKZH 3QWOC 2KI7B 1JM0A 3MZWB 1OVRA 1ZW0A 4NPDA 4IOIH 1H0TB 4ASWA 4KJMA 1OVVA 2ZAEB 3S1KA 3PH0A 5C39A 1H0TA 4NPEA 2QVAA 4JBZA 1EDLA 2LXBA 1FC2C 1JMBA 4ZNCA 2UWJE 5DJTB 4K3AA 4EYYQ
chains in the Genus database with same CATH superfamily
4I1LA 3V5BA 1OW6A 2HPCA 1JY2P 1T3JA 3NXSA 1LTTC 3TGUD 4HB1A 4OGQB 1HBWA 1FAVA 4K35A 1EXJA 3H1IG 3M9HA 4JYBA 1OVUA 3VOPA 1RH5B 3CWBE 4PD4I 1NTKK 3L74E 2WTYA 2HLOA 3H1JJ 1L0LK 3NFQA 3RL0C 3AE5C 2WQYC 1W2BO 3A0BE 1BE3D 3Q1MA 2OTLP 1RF0A 4BXLA 3WU2H 3A0HE 3V4WA 1JO5A 1RHZB 2KS1B 2QRXA 1P84I 1SQBJ 3L71E 4UB8H 2E75B 2QJKB 2QSIA 3HRNA 2QJPB 1QGKB 5EFWB 4B86A 3CCLP 3H1LD 3CX5E 3USSA 3L4FA 4AYCA 1KILA 4EIJA 5GTIE 2G3AA 2FFDC 1PZQA 4Y28J 2C0WA 4RO0A 1YHQP 3G71P 3G6EP 3AEGC 3A7OA 2HPCB 3CCUP 1VQ6P 3AEEC 1SQQJ 2OQQA 1L2PA 4N78E 2XZRA 3F89A 2KNCA 2AXCA 1T3UA 5KKZC 1E5WA 1DH3A 3RL0B 1K05A 1MFZA 4JPZB 2R5BA 3H1HE 2WSFH 1BDDA 4PV1D 4LC1A 2OTJP 1WMKA 2P2UA 1A02F 2IYPA 3F5HA 3H1KD 1S72P 4Y99C 2A06G 4GODA 4EI2A 2RN0A 3VN0A 2Q1KA 2D2CC 2Z5IA 2WVRA 4PJ0E 4L75A 4I7ZC 1URQA 2I8DA 2R32A 1URQC 1J2JB 2Z5HA 5M1BA 3RK3C 1KFMA 1L0ND 3B5NA 1ZV8A 4O9BA 1VL2A 3FX0A 1M90Q 2LKMA 1KILB 3H1KE 5CCHA 1U57A 1KYOD 1T6AA 1NO4A 2W6JH 5CCHC 1DEBA 2BEZF 3A0HH 1M1JA 2ZAEB 4D6TD 2YNYA 3H1HG 3E7KA 4DCKA 1M1JC 1BGYJ 1NTZJ 4WY4D 4IL6X 3H32A 1BCCJ 1L0NE 5KKZB 5AW9B 3CC2P 2KNCB 1N7SC 3PP5A 3M91A 1HH0A 3CLQA 1NGMB 1FZGA 2K1AA 3SFEC 3P8MC 2RKLA 1EZVE 1GW4A 3CX5H 1QVGO 4CPGA 1KYOE 4HYTB 1SQVJ 1SLQA 3CCVP 3SWFA 3L74J 4GOEA 4Y99B 4D6TE 2H89C 4GDOA 2D2CB 1LGHB 4I7ZB 3V2NA 4MN4C 3BCCG 1NH4A 1H89A 4LLHA 2M3EA 3VMXA 1URQB 5TJHA 3C9IA 3RK3B 2IBZI 1DD3A 3TGUJ 2VRSA 5AW8B 2B88A 2BCCG 3B5NB 1NTKD 4N3YB 1L0LD 1T2KC 2HR3A 2Y0CA 3KPEA 3PTZA 3L72G 1K9MQ 1BE3J 5CMZA 3B8EB 1JM0A 3WMM0 1Q90D 2R3CA 4RJTA 1M1JB 1WT6A 1S5LX 3AE4C 1FE6A 3G4SP 3W67A 1OW8A 3S1KA 3H32B 2A45G 2WPSA 2ZXEB 1SQPE 2FYUG 3VMAA 5APUA 2C9NY 1IFJA 1D7MA 1GK4A 1M56D 1JCCA 1ZOYC 1SFCA 3H1LJ 1CI6A 1SFCC 3TSIA 4Z1MH 3TF5A 1BSHA 2FYNC 1MKMA 2ITAA 2KYVA 3AE2C 2OARA 1X0TA 4BRYA 4WWIA 3Q5RA 5KAFE 5CCGD 2YMKA 5AVRB 2CPBA 2ZYDA 3L36A 2CK3H 2KIKA 2N9YB 3KYQA 2WPVB 5AVSB 2Y9ZA 3MUDC 2O01H 3L73D 2QG4A 1JTHA 1KYOH 1SP4A 2AEJA 3I55P 2P7JA 3ZDMA 5AVTB 1OFCX 2N1TC 2JEEA 4I2LC 4L73A 1FDMA 1PIXA 1QL2A 3H1KJ 1OVRA 2OYHA 2ZVNB 1PP9D 2NPSD 4H13B 2K37A 1LTSC 3MTUE 2OYHC 1HJBA 3L70D 1NU1G 1NAFA 1H88A 1VQLP 1XTGB 3HE4A 1GU5A 4U3FE 2UWJE 1SFCB 1L0NJ 3P7KA 1PPJE 1BSNA 3L75D 1CI6B 1EQ7A 3E1RA 3M0AA 1LTIC 2SPZA 3JCUE 4C7RA 5AW2B 2L5GB 1LP1A 4BRYB 5CBNA 1GMJA 3AEAC 2GUSA 3L70E 3GF7A 2E43A 2PP6A 3RK2C 4WBAA 2YKOA 4D6TJ 3VYIA 3U1AA 2ZVOB 3H1JG 4HH2A 1NKZB 3L75E 5BVZA 2YKQA 2KOGA 4DT0A 1HVVA 1NHLA 4H0LD 4W80A 1ZP0C 1VF5C 2KLUA 3OJAB 3U1CA 1L0NK 4W7YA 1YITP 3CC7P 1Q7YQ 3GHGA 3TYYA 2JDIH 5KTBA 2PRRA 1SQBG 3FWNA 4WVZA 3GW6A 2OYHB 3BRTB 5KAFH 2XU6A 3A2AA 3H1IE 3TNUA 3AE8C 3GF3A 2K9JA 4KHXA 2KSEA 3UIAA 3HE4B 4L74A 1VQOP 1VQKP 2WT7A 2E74D 2E76D 3PH0A 4IL6E 5C39A 3VP9A 3EFGA 1NTKJ 3PLNA 1KYOI 1L0LJ 4GT1A 2FXMA 5H2FE 3KHUA 1VQ5P 1EDIA 4TT3H 2OYOA 3D6ZA 2E75C 3RK2B 3CWBD 1LP1B 2QIWA 1FZCA 1SQQG 2HFED 1OX3A 1S9KE 1FZCC 1Y47A 1YIJP 4JQ0D 1GU4A 1UIIA 4C46A 1KQLA 1NWQA 1ZR4A 1VF5B 3VMZA 3P32A 2IFNA 3SWYA 1ZLLA 1SQXG 1Y8AA 1MFTA 3L71D 2JR8A 1SQPK 3GHGB 4ZMDA 2ZFCA 3JCUH 4ASVA 2AEFA 2IZ1A 1N7LA 3CMAP 2LR2A 1AVOA 4XE5B 2FKWB 3CX5D 2K9YA 2BASA 3TNUB 2K9JB 1RF0C 3LIEA 1IFNA 5AW4B 2WT7B 1FOSE 3FWLA 2IBZG 1MZ9A 1AFOA 1LT9A 2IFMA 2I1JA 1ZN5A 1Y9BA 1QVFO 3L73J 1EDLA 2LXBA 4U3FJ 4N78D 4WB4A 3CCJP 4M3LA 1T8ZA 3HD7D 2A06E 3CCMP 1FZCB 1BGYG 1KB9D 1FDOA 1NTZG 3VMYA 1KV4A 1Q82Q 1R8EA 3JSVC 1RE4A 1KILC 3H1HD 1PP9J 1AJYA 3OA7A 5KAIE 1NKNA 1RE4C 4IFDK 5AW1B 3L70J 5CJ4A 4GIFA 1FOSF 1SQVG 2DW3A 2R3SA 1AQ5A 3OAKA 1QEXA 2YO2A 1NAYA 3L75J 5AVWB 2W90A 5H2FH 1KB9E 2WITA 2W83C 3H6PA 1VQ7P 4XA4A 3HE5A 3TGUG 2GA1A 3WUUA 1DEEG 3HUSA 1YJWP 2NRGA 1DIPA 3CXHD 3HUSC 1LT9B 1PL5A 1BE3G 5GTHE 1OVVA 1ZRTE 4YXDC 1IFIA 1X9VA 1N2DC 3B5NC 3BCCE 3L72D 3O8ZA 1IC2A 3VP8A 3A0BH 1EZVD 1FU1A 4PV1B 3TDKA 1G2CA 1FZEA 3CXHE 1VPCA 5APTA 2BCCE 3CD6P 2XDJA 2WWWA 3SSUA 2KSJA 1EDJA 2WSFJ 3L37A 1GL2D 3H1LG 1W2EA 1JY3N 2FYUD 2JWDA 2WPRA 1SVFA 1VQ9P 2WSEH 1IFDA 1CSBA 3L72E 1K73Q 5KLVE 5AVVB 1ZR2A 2O1JA 2XNXA 2NZ2A 1IK9A 3M9BA 1S2EA 2L91A 1JNMA 3CWBJ 2GM4A 2WSSH 3HE5B 5GTIH 3MP7B 2HG5D 1OW7A 1LTJA 3R2PA 2FY8A 5KAIH 2FYUE 1LTJC 3HUSB 1YTZI 3II6A 1ZMEC 3O6QA 1LTAC 1JUNA 2OTKE 2KZJA 1E79H 2KI7B 1KB9H 3RK3E 4LGDE 3SWKA 2YXRB 1SQPD 1PGQA 3L71J 2K88A 1N7SD 1H0TA 2WSEJ 2IX7C 3CCQP 2J59M 1XTCC 3CCSP 4OVNF 5KLVG 4KT0J 1NTMG 3G3ZA 1G2CB 4QMAA 1NJIQ 3RBXA 5K5GB 1OMIA 4PJ0H 2ZT9D 2N9BA 4YTPC 4EDFA 4PD4E 1A02J 1GTWA 4H13C 2JP3A 1LWUA 4HJGH 2XKMA 4C7NA 2FXOA 4R4MA 1LWUC 1GW3A 2P10A 1LNQA 3MD0A 3S9OA 3V2PA 3RBZA 1LTJB 3BRVB 1T2KD 1NU1E 3CXHH 1JB0J 3H1HJ 1N73A 5AVXB 2QJYB 3O6QB 1VQPP 2NPSA 4DOJA 1L4AD 4H44D 3QWOC 2OYIA 3MZWB 3CX5I 4NPDA 3GLMA 2OYIC 1H0TB 4U3FD 4DZOA 5APQA 1PFIA 2V7QH 1PPJD 4DJGA 2A45H 3Q5SA 1KQGB 3BVHA 3H1JE 1USEA 4UB6E 1NTKG 1L0LG 3RL0g 2XV5A 3I56P 2POHA 4OWFA 1LWUB 2C0XA 1KB9I 1M7LA 1IZNB 2KK7A 4C7NB 2XNDH 4W7ZA 2M0BA 1JY3P 1SQBE 2MJZA 1OIPA 4H0LC 1QLED 3L72J 3M9QA 3AE3C 4ZKPA 3TK1A 2KZIA 2J58A 2KUBA 1VQMP 2O01J 2FBWC 2H7HA 2Z4EA 1IO4A 2H8PD 2FXPA 1JY2O 2V7QJ 2I1KA 1N73B 2MKVA 2NPSB 2N1TD 4PD4H 2FYUJ 1IFPA 2YMYA 1JOCA 2KLVA 2KB7P 1GK6A 3H1ID 2OYIB 1YQ3C 4RESB 1SQXD 3S4RA 1SQQE 2E74C 3BATA 3Q3DA 2E76C 2P67A 3WU2E 3CCEP 2QE7H 4AUWA 2RH0A 3CXHI 2Q5UA 1FS0E 3KXDA 2AEMA 3GHGC 1FC2C 2J5UA 3QH9A 4K3AA 4EYYQ 3FXDA 1S9KD 1SQXE 1KFNA 2P1JA 3ITKA 1JMMA 2W8ZA 5AW5B 3Q5PA 1FBMA 2FYUK 1EZVI 4H0LB 3A5TA 5KJ7D 1EC5A 1SQPJ 2YXQB 3PJSK 1PP9G 2A45I 1VQNP 3MGNA 3V2RA 4OGQD 5TISE 1CW5A 1HUCA 1VF5D 3K5BA 4AQRD 2IBZE 4UB6H 2M5AA 2PFXA 4GKGA 2YKPA 3EFFK 2ZYGA 4IFMA 1OWAA 2E74B 2E76B 3IN6A 2ZXXA 1BGYE 1GZLA 1NTZE 1N86A 5AVQB 2JWAA 3FGAD 1DD4A 5APVA 2Q9IA 1KMIZ 3HD7A 1KQFB 1YJNP 3I5CA 3HD7C 3H25A 1SQVE 4NPEA 1FZFA 2A06D 2E75D 2QM7A 1S4XA 2JKVA 1K04A 1SS1A 1S5LE 3IFMA 2Q6QA 1NU1K 3IR9A 1HGZA 2RMZA 1KTMA 2W27A 1EXIA 1KQSO 3OW2O 3W68A 1KC8Q 1HGVA 1BDCA 3R4YA 2FYZA 1LT9C 3TGUE 3B71A 2JO1A 1KD1Q 3GMAA 2GUVA 2K3RA 1R5LA 4L76A 1RF1A 5L8RJ 4NPFX 1FZBA 1USDA 1OZHA 1BCCG 2M5AB 3L35A 1WRGA 1RF1C 3G9RA 3AE1C 5CJ0A 3RL0D 3JC22 3T97A 1N8RQ 2QM8A 3AEDC 3WUTA 4PV1C 3A3YB 1BE3E 1HF9A 3HTKA 1W5CE 2FFDA 1AA0A 1ZXGA 2R44A 4IL6H 3CWBG 2KXPB 3L74G 3SFDC 3LIDA 1Q81Q 2QEXP 1M8OB 3HD7B 2E42A 1VDFA 3NMDA 1VQ8P 3C8VA 1AVYA 2Y0EA 4I6MC 4EOTA 3IF4A 5TISH 1ZRTD 3H1LE 4ASWA 1SQBK 3BCCD 1YI2P 2QVAA 2IYOA 4ZNCA 3L71G 1GL2A 3WUVA 3H1IJ 4WY4A 5AW7B 1HTLC 2BCCD 1KILD 3IAOA 4XFJA 3D6YA 2AXTE 1GL2C 5APWA 4WY4C 1SQXJ 3KDPB 2WMMA 1M1KQ 3CC4P 5B5EE 1RF1B 5KLVD 1NTMD 2ZJSE 1LJ2A 5E79E 1SQQK 5APYA 3M06A 3T97B 2R5DA 1KILE 3N4XA 1S5LH 3HTKB 2FFDB 5CBOA 5AW0B 3B4SA 3D70A 5DJUB 3FXEA 3BASA 5B66E 3AECC 3D71A 2BEQD 3Q2YA 1YBKA 2D2CD 1PV3A 4IFFA 1LT1A 1FJPA 1NTME 5AVZB 4TLFA 1JEKA 1SQXK 3VTPC 1URQD 1N7SA 4HKZH 3RK3D 1IJDB 4YXWH 4JF7A 3AE9C 1RE3A 3B5ND 3KQGA 1RE3C 1PGPA 1GL2B 4WY4B 3NTNA 2ZYAA 5CCHD 1X22A 2QJYC 1S1CX 3P8CD 2Y9YA 2ZT9C 2C9LY 3AE7C 2IZ0A 2LXCB 2Y0DA 4PD4D 1IFMA 5APXA 2E5TA 3CMEP 1YJ9P 3H1KG 5CHXA 1TU3F 4N6JA 2QA4P 3CI9A 1NTZK 2P58A 4A7PA 3GG2A 3P8CE 1L0NG 4ZKUA 5CCGA 1NU1D 5AW6B 1P84D 1JY3O 2H43A 1KN7A 5CCGC 1L4AA 1Z56A 2AXTH 1G1JA 1SQVK 1HWTC 1L4AC 1EZVG 5GTHH 1AQTA 4H44C 2Q3IA 1UIXA 1N7SB 3AE6C 5B5EH 3EWKA 1YTZT 1KZUB 4D6TG 2WZ7A 1FZAA 1NTKE 4U7JA 5E79H 2Q7CA 1L0LE 4BWNA 1M57D 5AVUB 2WSCH 2WPQA 1RQUA 1P84E 1JCDA 4R4LA 3E1IA 3ABVC 4IOIH 2ZT9B 3H1JD 2Q3EA 1N73C 3CL3D 2HODA 1HJ0A 2W6BA 2NPSC 5B66H 1K8AQ 5KLIC 1OXZA 4RKUJ 2M8RA 1Q86Q 1S3JA 1JY2N 1VQ4P 2G8YA 3N7NA 4H13D 2PGDA 1YQ4C 3KZIE 3EQ2A 3MUDA 1SQBD 2W6AA 1CZQA 2V4HA 2IPPA 3BCCJ 1RQVA 1SFCD 2M3BA 2B87A 3V6IA 1SQPG 2WSCJ 2N1TA 1L4AB 2BCCJ 4H44B 1U7MA 5AVYB 1Q2NA 1FJKA 3CPWO 2YIUC 3MHVA 1J1EC 1R5SA 1X79B 4JYCA 1NVOA 5KLVJ 1SQQD 1NTMJ 3L73E 1FDIA 1LTGC 5APSA 2JJLA 2KP8A 1LTBC 2H88C 2E5YA 2FYNB 1ZW0A 5KLIB 4YPCA 2IDBA 2HODB 4KJMA 3CCRP 1PP9E 1PGJA 4JBZA 1J1DC 1JMBA 2YO3A 5KJ7A 2CPSA 1EDKA 5BU8B 1GDTA 5KJ7C 1DX7A 2O01N 1PGOA 1NOHA 3PHLA 1P84H 3U59A 5KLVK 1NTMK 4UB8E 1JTHB 1G1IA 4OGQC 2B87B 2PAJA 3V4QA 1RY3A 2N1TB 3L73G 5AW3B 1MUUA 2IBZD 5BU5A 4U3FG 3RGUA 3RK2D 3LW5H 2OGUA 3AEBC 1PPJG 2YIUB 1NYHA 2B9BA 1YYCA 1J1EB 3MIWA 2B89A 3PRJA 2O3JA 2HYNA 3C1LA 1AV1A 3KZIH 1IK7A 1BGYD 1NTZD 2KS1A 3L70G 1QL1A 1BCCD 1U7JA 3AEFC 3M0DA 4GOFA 4OH8B 1GD2E 3V2QA 3M0DC 2O1KA 3L75G 1NU1J 1J1DB 1SQVD 2QJKC 2QJPC 3L74D 1QX8A 1H8AA 1X8YA 3LW5J 5DJTB 1BCCE 1MV8A 1KORA
chains in the Genus database with same CATH topology
1SS1A 3FXDA 1S3JA 1EDKA 1EDIA 2LXCB 5K5GB 4HB1A 1LP1B 2SPZA 2WMMA 4K35A 2RKLA 1OVUA 4CPGA 1BDCA 1LP1A 1Y47A 5CBNA 1EDJA 1EC5A 4HJGH 2M0BA 2B87B 2JWDA 4GOEA 1X0TA 2K3RA 4WWIA 2P58A 4NPFX 3RGUA 1BDDA 2B87A 4MN4C 2M5AB 2KZIA 2KIKA 2KUBA 4GODA 1U7MA 4BXLA 2M5AA 2Q1KA 2B89A 5CBOA 1Q2NA 2B88A 5DJUB 1MFTA 3FXEA 2KS1B 2QRXA 1ZXGA 2I8DA 4ZMDA 2R44A 4ASVA 3MHVA 2LR2A 1DEEG 1LT1A 1NVOA 3ZDMA 2HR3A 1U7JA 4GOFA 2OTKE 5EFWB 2KZJA 4HKZH 3QWOC 2KI7B 1JM0A 3MZWB 1OVRA 1ZW0A 4NPDA 4IOIH 1H0TB 4ASWA 4KJMA 1OVVA 2ZAEB 3S1KA 3PH0A 5C39A 1H0TA 4NPEA 2QVAA 4JBZA 1EDLA 2LXBA 1FC2C 1JMBA 4ZNCA 2UWJE 5DJTB 4K3AA 4EYYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS1 A;  3FXD A;  1S3J A;  1EDK A;  1EDI A;  2LXC B;  5K5G B;  4HB1 A;  1LP1 B;  2SPZ A;  2WMM A;  4K35 A;  2RKL A;  1OVU A;  4CPG A;  1BDC A;  1LP1 A;  1Y47 A;  5CBN A;  1EDJ A;  1EC5 A;  4HJG H;  2M0B A;  2B87 B;  2JWD A;  4GOE A;  1X0T A;  2K3R A;  4WWI A;  2P58 A;  4NPF X;  3RGU A;  1BDD A;  2B87 A;  4MN4 C;  2M5A B;  2KZI A;  2KIK A;  2KUB A;  4GOD A;  1U7M A;  4BXL A;  2M5A A;  2Q1K A;  2B89 A;  5CBO A;  1Q2N A;  2B88 A;  5DJU B;  1MFT A;  3FXE A;  2KS1 B;  2QRX A;  1ZXG A;  2I8D A;  4ZMD A;  2R44 A;  4ASV A;  3MHV A;  2LR2 A;  1DEE G;  1LT1 A;  1NVO A;  3ZDM A;  2HR3 A;  1U7J A;  4GOF A;  2OTK E;  5EFW B;  2KZJ A;  4HKZ H;  3QWO C;  2KI7 B;  1JM0 A;  3MZW B;  1OVR A;  1ZW0 A;  4NPD A;  4IOI H;  1H0T B;  4ASW A;  4KJM A;  1OVV A;  2ZAE B;  3S1K A;  3PH0 A;  5C39 A;  1H0T A;  4NPE A;  2QVA A;  4JBZ A;  1EDL A;  2LXB A;  1FC2 C;  1JMB A;  4ZNC A;  2UWJ E;  5DJT B;  4K3A A;  4EYY Q; 
#chains in the Genus database with same CATH topology
 4I1L A;  3V5B A;  1OW6 A;  2HPC A;  1JY2 P;  1T3J A;  3NXS A;  1LTT C;  3TGU D;  4HB1 A;  4OGQ B;  1HBW A;  1FAV A;  4K35 A;  1EXJ A;  3H1I G;  3M9H A;  4JYB A;  1OVU A;  3VOP A;  1RH5 B;  3CWB E;  4PD4 I;  1NTK K;  3L74 E;  2WTY A;  2HLO A;  3H1J J;  1L0L K;  3NFQ A;  3RL0 C;  3AE5 C;  2WQY C;  1W2B O;  3A0B E;  1BE3 D;  3Q1M A;  2OTL P;  1RF0 A;  4BXL A;  3WU2 H;  3A0H E;  3V4W A;  1JO5 A;  1RHZ B;  2KS1 B;  2QRX A;  1P84 I;  1SQB J;  3L71 E;  4UB8 H;  2E75 B;  2QJK B;  2QSI A;  3HRN A;  2QJP B;  1QGK B;  5EFW B;  4B86 A;  3CCL P;  3H1L D;  3CX5 E;  3USS A;  3L4F A;  4AYC A;  1KIL A;  4EIJ A;  5GTI E;  2G3A A;  2FFD C;  1PZQ A;  4Y28 J;  2C0W A;  4RO0 A;  1YHQ P;  3G71 P;  3G6E P;  3AEG C;  3A7O A;  2HPC B;  3CCU P;  1VQ6 P;  3AEE C;  1SQQ J;  2OQQ A;  1L2P A;  4N78 E;  2XZR A;  3F89 A;  2KNC A;  2AXC A;  1T3U A;  5KKZ C;  1E5W A;  1DH3 A;  3RL0 B;  1K05 A;  1MFZ A;  4JPZ B;  2R5B A;  3H1H E;  2WSF H;  1BDD A;  4PV1 D;  4LC1 A;  2OTJ P;  1WMK A;  2P2U A;  1A02 F;  2IYP A;  3F5H A;  3H1K D;  1S72 P;  4Y99 C;  2A06 G;  4GOD A;  4EI2 A;  2RN0 A;  3VN0 A;  2Q1K A;  2D2C C;  2Z5I A;  2WVR A;  4PJ0 E;  4L75 A;  4I7Z C;  1URQ A;  2I8D A;  2R32 A;  1URQ C;  1J2J B;  2Z5H A;  5M1B A;  3RK3 C;  1KFM A;  1L0N D;  3B5N A;  1ZV8 A;  4O9B A;  1VL2 A;  3FX0 A;  1M90 Q;  2LKM A;  1KIL B;  3H1K E;  5CCH A;  1U57 A;  1KYO D;  1T6A A;  1NO4 A;  2W6J H;  5CCH C;  1DEB A;  2BEZ F;  3A0H H;  1M1J A;  2ZAE B;  4D6T D;  2YNY A;  3H1H G;  3E7K A;  4DCK A;  1M1J C;  1BGY J;  1NTZ J;  4WY4 D;  4IL6 X;  3H32 A;  1BCC J;  1L0N E;  5KKZ B;  5AW9 B;  3CC2 P;  2KNC B;  1N7S C;  3PP5 A;  3M91 A;  1HH0 A;  3CLQ A;  1NGM B;  1FZG A;  2K1A A;  3SFE C;  3P8M C;  2RKL A;  1EZV E;  1GW4 A;  3CX5 H;  1QVG O;  4CPG A;  1KYO E;  4HYT B;  1SQV J;  1SLQ A;  3CCV P;  3SWF A;  3L74 J;  4GOE A;  4Y99 B;  4D6T E;  2H89 C;  4GDO A;  2D2C B;  1LGH B;  4I7Z B;  3V2N A;  4MN4 C;  3BCC G;  1NH4 A;  1H89 A;  4LLH A;  2M3E A;  3VMX A;  1URQ B;  5TJH A;  3C9I A;  3RK3 B;  2IBZ I;  1DD3 A;  3TGU J;  2VRS A;  5AW8 B;  2B88 A;  2BCC G;  3B5N B;  1NTK D;  4N3Y B;  1L0L D;  1T2K C;  2HR3 A;  2Y0C A;  3KPE A;  3PTZ A;  3L72 G;  1K9M Q;  1BE3 J;  5CMZ A;  3B8E B;  1JM0 A;  3WMM 0;  1Q90 D;  2R3C A;  4RJT A;  1M1J B;  1WT6 A;  1S5L X;  3AE4 C;  1FE6 A;  3G4S P;  3W67 A;  1OW8 A;  3S1K A;  3H32 B;  2A45 G;  2WPS A;  2ZXE B;  1SQP E;  2FYU G;  3VMA A;  5APU A;  2C9N Y;  1IFJ A;  1D7M A;  1GK4 A;  1M56 D;  1JCC A;  1ZOY C;  1SFC A;  3H1L J;  1CI6 A;  1SFC C;  3TSI A;  4Z1M H;  3TF5 A;  1BSH A;  2FYN C;  1MKM A;  2ITA A;  2KYV A;  3AE2 C;  2OAR A;  1X0T A;  4BRY A;  4WWI A;  3Q5R A;  5KAF E;  5CCG D;  2YMK A;  5AVR B;  2CPB A;  2ZYD A;  3L36 A;  2CK3 H;  2KIK A;  2N9Y B;  3KYQ A;  2WPV B;  5AVS B;  2Y9Z A;  3MUD C;  2O01 H;  3L73 D;  2QG4 A;  1JTH A;  1KYO H;  1SP4 A;  2AEJ A;  3I55 P;  2P7J A;  3ZDM A;  5AVT B;  1OFC X;  2N1T C;  2JEE A;  4I2L C;  4L73 A;  1FDM A;  1PIX A;  1QL2 A;  3H1K J;  1OVR A;  2OYH A;  2ZVN B;  1PP9 D;  2NPS D;  4H13 B;  2K37 A;  1LTS C;  3MTU E;  2OYH C;  1HJB A;  3L70 D;  1NU1 G;  1NAF A;  1H88 A;  1VQL P;  1XTG B;  3HE4 A;  1GU5 A;  4U3F E;  2UWJ E;  1SFC B;  1L0N J;  3P7K A;  1PPJ E;  1BSN A;  3L75 D;  1CI6 B;  1EQ7 A;  3E1R A;  3M0A A;  1LTI C;  2SPZ A;  3JCU E;  4C7R A;  5AW2 B;  2L5G B;  1LP1 A;  4BRY B;  5CBN A;  1GMJ A;  3AEA C;  2GUS A;  3L70 E;  3GF7 A;  2E43 A;  2PP6 A;  3RK2 C;  4WBA A;  2YKO A;  4D6T J;  3VYI A;  3U1A A;  2ZVO B;  3H1J G;  4HH2 A;  1NKZ B;  3L75 E;  5BVZ A;  2YKQ A;  2KOG A;  4DT0 A;  1HVV A;  1NHL A;  4H0L D;  4W80 A;  1ZP0 C;  1VF5 C;  2KLU A;  3OJA B;  3U1C A;  1L0N K;  4W7Y A;  1YIT P;  3CC7 P;  1Q7Y Q;  3GHG A;  3TYY A;  2JDI H;  5KTB A;  2PRR A;  1SQB G;  3FWN A;  4WVZ A;  3GW6 A;  2OYH B;  3BRT B;  5KAF H;  2XU6 A;  3A2A A;  3H1I E;  3TNU A;  3AE8 C;  3GF3 A;  2K9J A;  4KHX A;  2KSE A;  3UIA A;  3HE4 B;  4L74 A;  1VQO P;  1VQK P;  2WT7 A;  2E74 D;  2E76 D;  3PH0 A;  4IL6 E;  5C39 A;  3VP9 A;  3EFG A;  1NTK J;  3PLN A;  1KYO I;  1L0L J;  4GT1 A;  2FXM A;  5H2F E;  3KHU A;  1VQ5 P;  1EDI A;  4TT3 H;  2OYO A;  3D6Z A;  2E75 C;  3RK2 B;  3CWB D;  1LP1 B;  2QIW A;  1FZC A;  1SQQ G;  2HFE D;  1OX3 A;  1S9K E;  1FZC C;  1Y47 A;  1YIJ P;  4JQ0 D;  1GU4 A;  1UII A;  4C46 A;  1KQL A;  1NWQ A;  1ZR4 A;  1VF5 B;  3VMZ A;  3P32 A;  2IFN A;  3SWY A;  1ZLL A;  1SQX G;  1Y8A A;  1MFT A;  3L71 D;  2JR8 A;  1SQP K;  3GHG B;  4ZMD A;  2ZFC A;  3JCU H;  4ASV A;  2AEF A;  2IZ1 A;  1N7L A;  3CMA P;  2LR2 A;  1AVO A;  4XE5 B;  2FKW B;  3CX5 D;  2K9Y A;  2BAS A;  3TNU B;  2K9J B;  1RF0 C;  3LIE A;  1IFN A;  5AW4 B;  2WT7 B;  1FOS E;  3FWL A;  2IBZ G;  1MZ9 A;  1AFO A;  1LT9 A;  2IFM A;  2I1J A;  1ZN5 A;  1Y9B A;  1QVF O;  3L73 J;  1EDL A;  2LXB A;  4U3F J;  4N78 D;  4WB4 A;  3CCJ P;  4M3L A;  1T8Z A;  3HD7 D;  2A06 E;  3CCM P;  1FZC B;  1BGY G;  1KB9 D;  1FDO A;  1NTZ G;  3VMY A;  1KV4 A;  1Q82 Q;  1R8E A;  3JSV C;  1RE4 A;  1KIL C;  3H1H D;  1PP9 J;  1AJY A;  3OA7 A;  5KAI E;  1NKN A;  1RE4 C;  4IFD K;  5AW1 B;  3L70 J;  5CJ4 A;  4GIF A;  1FOS F;  1SQV G;  2DW3 A;  2R3S A;  1AQ5 A;  3OAK A;  1QEX A;  2YO2 A;  1NAY A;  3L75 J;  5AVW B;  2W90 A;  5H2F H;  1KB9 E;  2WIT A;  2W83 C;  3H6P A;  1VQ7 P;  4XA4 A;  3HE5 A;  3TGU G;  2GA1 A;  3WUU A;  1DEE G;  3HUS A;  1YJW P;  2NRG A;  1DIP A;  3CXH D;  3HUS C;  1LT9 B;  1PL5 A;  1BE3 G;  5GTH E;  1OVV A;  1ZRT E;  4YXD C;  1IFI A;  1X9V A;  1N2D C;  3B5N C;  3BCC E;  3L72 D;  3O8Z A;  1IC2 A;  3VP8 A;  3A0B H;  1EZV D;  1FU1 A;  4PV1 B;  3TDK A;  1G2C A;  1FZE A;  3CXH E;  1VPC A;  5APT A;  2BCC E;  3CD6 P;  2XDJ A;  2WWW A;  3SSU A;  2KSJ A;  1EDJ A;  2WSF J;  3L37 A;  1GL2 D;  3H1L G;  1W2E A;  1JY3 N;  2FYU D;  2JWD A;  2WPR A;  1SVF A;  1VQ9 P;  2WSE H;  1IFD A;  1CSB A;  3L72 E;  1K73 Q;  5KLV E;  5AVV B;  1ZR2 A;  2O1J A;  2XNX A;  2NZ2 A;  1IK9 A;  3M9B A;  1S2E A;  2L91 A;  1JNM A;  3CWB J;  2GM4 A;  2WSS H;  3HE5 B;  5GTI H;  3MP7 B;  2HG5 D;  1OW7 A;  1LTJ A;  3R2P A;  2FY8 A;  5KAI H;  2FYU E;  1LTJ C;  3HUS B;  1YTZ I;  3II6 A;  1ZME C;  3O6Q A;  1LTA C;  1JUN A;  2OTK E;  2KZJ A;  1E79 H;  2KI7 B;  1KB9 H;  3RK3 E;  4LGD E;  3SWK A;  2YXR B;  1SQP D;  1PGQ A;  3L71 J;  2K88 A;  1N7S D;  1H0T A;  2WSE J;  2IX7 C;  3CCQ P;  2J59 M;  1XTC C;  3CCS P;  4OVN F;  5KLV G;  4KT0 J;  1NTM G;  3G3Z A;  1G2C B;  4QMA A;  1NJI Q;  3RBX A;  5K5G B;  1OMI A;  4PJ0 H;  2ZT9 D;  2N9B A;  4YTP C;  4EDF A;  4PD4 E;  1A02 J;  1GTW A;  4H13 C;  2JP3 A;  1LWU A;  4HJG H;  2XKM A;  4C7N A;  2FXO A;  4R4M A;  1LWU C;  1GW3 A;  2P10 A;  1LNQ A;  3MD0 A;  3S9O A;  3V2P A;  3RBZ A;  1LTJ B;  3BRV B;  1T2K D;  1NU1 E;  3CXH H;  1JB0 J;  3H1H J;  1N73 A;  5AVX B;  2QJY B;  3O6Q B;  1VQP P;  2NPS A;  4DOJ A;  1L4A D;  4H44 D;  3QWO C;  2OYI A;  3MZW B;  3CX5 I;  4NPD A;  3GLM A;  2OYI C;  1H0T B;  4U3F D;  4DZO A;  5APQ A;  1PFI A;  2V7Q H;  1PPJ D;  4DJG A;  2A45 H;  3Q5S A;  1KQG B;  3BVH A;  3H1J E;  1USE A;  4UB6 E;  1NTK G;  1L0L G;  3RL0 g;  2XV5 A;  3I56 P;  2POH A;  4OWF A;  1LWU B;  2C0X A;  1KB9 I;  1M7L A;  1IZN B;  2KK7 A;  4C7N B;  2XND H;  4W7Z A;  2M0B A;  1JY3 P;  1SQB E;  2MJZ A;  1OIP A;  4H0L C;  1QLE D;  3L72 J;  3M9Q A;  3AE3 C;  4ZKP A;  3TK1 A;  2KZI A;  2J58 A;  2KUB A;  1VQM P;  2O01 J;  2FBW C;  2H7H A;  2Z4E A;  1IO4 A;  2H8P D;  2FXP A;  1JY2 O;  2V7Q J;  2I1K A;  1N73 B;  2MKV A;  2NPS B;  2N1T D;  4PD4 H;  2FYU J;  1IFP A;  2YMY A;  1JOC A;  2KLV A;  2KB7 P;  1GK6 A;  3H1I D;  2OYI B;  1YQ3 C;  4RES B;  1SQX D;  3S4R A;  1SQQ E;  2E74 C;  3BAT A;  3Q3D A;  2E76 C;  2P67 A;  3WU2 E;  3CCE P;  2QE7 H;  4AUW A;  2RH0 A;  3CXH I;  2Q5U A;  1FS0 E;  3KXD A;  2AEM A;  3GHG C;  1FC2 C;  2J5U A;  3QH9 A;  4K3A A;  4EYY Q;  3FXD A;  1S9K D;  1SQX E;  1KFN A;  2P1J A;  3ITK A;  1JMM A;  2W8Z A;  5AW5 B;  3Q5P A;  1FBM A;  2FYU K;  1EZV I;  4H0L B;  3A5T A;  5KJ7 D;  1EC5 A;  1SQP J;  2YXQ B;  3PJS K;  1PP9 G;  2A45 I;  1VQN P;  3MGN A;  3V2R A;  4OGQ D;  5TIS E;  1CW5 A;  1HUC A;  1VF5 D;  3K5B A;  4AQR D;  2IBZ E;  4UB6 H;  2M5A A;  2PFX A;  4GKG A;  2YKP A;  3EFF K;  2ZYG A;  4IFM A;  1OWA A;  2E74 B;  2E76 B;  3IN6 A;  2ZXX A;  1BGY E;  1GZL A;  1NTZ E;  1N86 A;  5AVQ B;  2JWA A;  3FGA D;  1DD4 A;  5APV A;  2Q9I A;  1KMI Z;  3HD7 A;  1KQF B;  1YJN P;  3I5C A;  3HD7 C;  3H25 A;  1SQV E;  4NPE A;  1FZF A;  2A06 D;  2E75 D;  2QM7 A;  1S4X A;  2JKV A;  1K04 A;  1SS1 A;  1S5L E;  3IFM A;  2Q6Q A;  1NU1 K;  3IR9 A;  1HGZ A;  2RMZ A;  1KTM A;  2W27 A;  1EXI A;  1KQS O;  3OW2 O;  3W68 A;  1KC8 Q;  1HGV A;  1BDC A;  3R4Y A;  2FYZ A;  1LT9 C;  3TGU E;  3B71 A;  2JO1 A;  1KD1 Q;  3GMA A;  2GUV A;  2K3R A;  1R5L A;  4L76 A;  1RF1 A;  5L8R J;  4NPF X;  1FZB A;  1USD A;  1OZH A;  1BCC G;  2M5A B;  3L35 A;  1WRG A;  1RF1 C;  3G9R A;  3AE1 C;  5CJ0 A;  3RL0 D;  3JC2 2;  3T97 A;  1N8R Q;  2QM8 A;  3AED C;  3WUT A;  4PV1 C;  3A3Y B;  1BE3 E;  1HF9 A;  3HTK A;  1W5C E;  2FFD A;  1AA0 A;  1ZXG A;  2R44 A;  4IL6 H;  3CWB G;  2KXP B;  3L74 G;  3SFD C;  3LID A;  1Q81 Q;  2QEX P;  1M8O B;  3HD7 B;  2E42 A;  1VDF A;  3NMD A;  1VQ8 P;  3C8V A;  1AVY A;  2Y0E A;  4I6M C;  4EOT A;  3IF4 A;  5TIS H;  1ZRT D;  3H1L E;  4ASW A;  1SQB K;  3BCC D;  1YI2 P;  2QVA A;  2IYO A;  4ZNC A;  3L71 G;  1GL2 A;  3WUV A;  3H1I J;  4WY4 A;  5AW7 B;  1HTL C;  2BCC D;  1KIL D;  3IAO A;  4XFJ A;  3D6Y A;  2AXT E;  1GL2 C;  5APW A;  4WY4 C;  1SQX J;  3KDP B;  2WMM A;  1M1K Q;  3CC4 P;  5B5E E;  1RF1 B;  5KLV D;  1NTM D;  2ZJS E;  1LJ2 A;  5E79 E;  1SQQ K;  5APY A;  3M06 A;  3T97 B;  2R5D A;  1KIL E;  3N4X A;  1S5L H;  3HTK B;  2FFD B;  5CBO A;  5AW0 B;  3B4S A;  3D70 A;  5DJU B;  3FXE A;  3BAS A;  5B66 E;  3AEC C;  3D71 A;  2BEQ D;  3Q2Y A;  1YBK A;  2D2C D;  1PV3 A;  4IFF A;  1LT1 A;  1FJP A;  1NTM E;  5AVZ B;  4TLF A;  1JEK A;  1SQX K;  3VTP C;  1URQ D;  1N7S A;  4HKZ H;  3RK3 D;  1IJD B;  4YXW H;  4JF7 A;  3AE9 C;  1RE3 A;  3B5N D;  3KQG A;  1RE3 C;  1PGP A;  1GL2 B;  4WY4 B;  3NTN A;  2ZYA A;  5CCH D;  1X22 A;  2QJY C;  1S1C X;  3P8C D;  2Y9Y A;  2ZT9 C;  2C9L Y;  3AE7 C;  2IZ0 A;  2LXC B;  2Y0D A;  4PD4 D;  1IFM A;  5APX A;  2E5T A;  3CME P;  1YJ9 P;  3H1K G;  5CHX A;  1TU3 F;  4N6J A;  2QA4 P;  3CI9 A;  1NTZ K;  2P58 A;  4A7P A;  3GG2 A;  3P8C E;  1L0N G;  4ZKU A;  5CCG A;  1NU1 D;  5AW6 B;  1P84 D;  1JY3 O;  2H43 A;  1KN7 A;  5CCG C;  1L4A A;  1Z56 A;  2AXT H;  1G1J A;  1SQV K;  1HWT C;  1L4A C;  1EZV G;  5GTH H;  1AQT A;  4H44 C;  2Q3I A;  1UIX A;  1N7S B;  3AE6 C;  5B5E H;  3EWK A;  1YTZ T;  1KZU B;  4D6T G;  2WZ7 A;  1FZA A;  1NTK E;  4U7J A;  5E79 H;  2Q7C A;  1L0L E;  4BWN A;  1M57 D;  5AVU B;  2WSC H;  2WPQ A;  1RQU A;  1P84 E;  1JCD A;  4R4L A;  3E1I A;  3ABV C;  4IOI H;  2ZT9 B;  3H1J D;  2Q3E A;  1N73 C;  3CL3 D;  2HOD A;  1HJ0 A;  2W6B A;  2NPS C;  5B66 H;  1K8A Q;  5KLI C;  1OXZ A;  4RKU J;  2M8R A;  1Q86 Q;  1S3J A;  1JY2 N;  1VQ4 P;  2G8Y A;  3N7N A;  4H13 D;  2PGD A;  1YQ4 C;  3KZI E;  3EQ2 A;  3MUD A;  1SQB D;  2W6A A;  1CZQ A;  2V4H A;  2IPP A;  3BCC J;  1RQV A;  1SFC D;  2M3B A;  2B87 A;  3V6I A;  1SQP G;  2WSC J;  2N1T A;  1L4A B;  2BCC J;  4H44 B;  1U7M A;  5AVY B;  1Q2N A;  1FJK A;  3CPW O;  2YIU C;  3MHV A;  1J1E C;  1R5S A;  1X79 B;  4JYC A;  1NVO A;  5KLV J;  1SQQ D;  1NTM J;  3L73 E;  1FDI A;  1LTG C;  5APS A;  2JJL A;  2KP8 A;  1LTB C;  2H88 C;  2E5Y A;  2FYN B;  1ZW0 A;  5KLI B;  4YPC A;  2IDB A;  2HOD B;  4KJM A;  3CCR P;  1PP9 E;  1PGJ A;  4JBZ A;  1J1D C;  1JMB A;  2YO3 A;  5KJ7 A;  2CPS A;  1EDK A;  5BU8 B;  1GDT A;  5KJ7 C;  1DX7 A;  2O01 N;  1PGO A;  1NOH A;  3PHL A;  1P84 H;  3U59 A;  5KLV K;  1NTM K;  4UB8 E;  1JTH B;  1G1I A;  4OGQ C;  2B87 B;  2PAJ A;  3V4Q A;  1RY3 A;  2N1T B;  3L73 G;  5AW3 B;  1MUU A;  2IBZ D;  5BU5 A;  4U3F G;  3RGU A;  3RK2 D;  3LW5 H;  2OGU A;  3AEB C;  1PPJ G;  2YIU B;  1NYH A;  2B9B A;  1YYC A;  1J1E B;  3MIW A;  2B89 A;  3PRJ A;  2O3J A;  2HYN A;  3C1L A;  1AV1 A;  3KZI H;  1IK7 A;  1BGY D;  1NTZ D;  2KS1 A;  3L70 G;  1QL1 A;  1BCC D;  1U7J A;  3AEF C;  3M0D A;  4GOF A;  4OH8 B;  1GD2 E;  3V2Q A;  3M0D C;  2O1K A;  3L75 G;  1NU1 J;  1J1D B;  1SQV D;  2QJK C;  2QJP C;  3L74 D;  1QX8 A;  1H8A A;  1X8Y A;  3LW5 J;  5DJT B;  1BCC E;  1MV8 A;  1KOR A; 
#chains in the Genus database with same CATH homology
 1SS1 A;  3FXD A;  1S3J A;  1EDK A;  1EDI A;  2LXC B;  5K5G B;  4HB1 A;  1LP1 B;  2SPZ A;  2WMM A;  4K35 A;  2RKL A;  1OVU A;  4CPG A;  1BDC A;  1LP1 A;  1Y47 A;  5CBN A;  1EDJ A;  1EC5 A;  4HJG H;  2M0B A;  2B87 B;  2JWD A;  4GOE A;  1X0T A;  2K3R A;  4WWI A;  2P58 A;  4NPF X;  3RGU A;  1BDD A;  2B87 A;  4MN4 C;  2M5A B;  2KZI A;  2KIK A;  2KUB A;  4GOD A;  1U7M A;  4BXL A;  2M5A A;  2Q1K A;  2B89 A;  5CBO A;  1Q2N A;  2B88 A;  5DJU B;  1MFT A;  3FXE A;  2KS1 B;  2QRX A;  1ZXG A;  2I8D A;  4ZMD A;  2R44 A;  4ASV A;  3MHV A;  2LR2 A;  1DEE G;  1LT1 A;  1NVO A;  3ZDM A;  2HR3 A;  1U7J A;  4GOF A;  2OTK E;  5EFW B;  2KZJ A;  4HKZ H;  3QWO C;  2KI7 B;  1JM0 A;  3MZW B;  1OVR A;  1ZW0 A;  4NPD A;  4IOI H;  1H0T B;  4ASW A;  4KJM A;  1OVV A;  2ZAE B;  3S1K A;  3PH0 A;  5C39 A;  1H0T A;  4NPE A;  2QVA A;  4JBZ A;  1EDL A;  2LXB A;  1FC2 C;  1JMB A;  4ZNC A;  2UWJ E;  5DJT B;  4K3A A;  4EYY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...