1BDCA

Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords STAPHYLOCOCCUS AUREUS PROTEIN A
publication title Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1bdcA00
5K5GB 4BXLA 2B88A 2B87B 2RKLA 2P58A 2HR3A 1Q2NA 2OTKE 4HB1A 3S1KA 4NPFX 1DEEG 2QRXA 4ASVA 1ZW0A 1NVOA 4NPDA 3MHVA 1OVVA 4GOFA 2B89A 2LR2A 1EDIA 1SS1A 4MN4C 1OVRA 2M0BA 1BDDA 1X0TA 2ZAEB 1OVUA 2LXCB 1MFTA 2KI7B 2JWDA 2WMMA 2KS1B 4HJGH 3ZDMA 1Y47A 4NPEA 4ASWA 1S3JA 1EDLA 3MZWB 3RGUA 3QWOC 1ZXGA 2K3RA 4KJMA 5DJTB 4IOIH 5EFWB 4K3AA 1EDKA 2KIKA 1U7MA 5C39A 5DJUB 3FXEA 2KZIA 1LP1A 1JM0A 4GODA 1U7JA 2R44A 2QVAA 2I8DA 2UWJE 4ZNCA 4WWIA 1H0TA 3FXDA 1FC2C 4K35A 1EC5A 1LT1A 2KUBA 1LP1B 4GOEA 2M5AA 4ZMDA 1EDJA 2Q1KA 4CPGA 1BDCA 5CBOA 2B87A 2LXBA 1H0TB 4EYYQ 2SPZA 4HKZH 1JMBA 4JBZA 2KZJA 3PH0A 2M5AB 5CBNA
chains in the Genus database with same CATH superfamily
1KORA 2OYHA 3LW5J 2C9NY 1SFCA 1PPJD 2E75D 3CCJP 1GL2B 3FWLA 3TK1A 2FYUK 1QEXA 1NO4A 2M8RA 3RK2B 5B66E 1Q90D 2HLOA 1YITP 3Q5PA 1YTZI 1BSHA 3TSIA 2H8PD 1JOCA 1DEBA 4I1LA 2BCCE 3V4QA 1KV4A 2IPPA 2DW3A 2IYOA 3M9BA 3AE5C 3BCCD 3GHGC 4U7JA 1CI6A 3V2QA 5KKZB 1M57D 4Y28J 1LWUA 3TNUB 1GD2E 2KZIA 3KZIE 2WSFH 5TISH 1L0LE 2IBZD 1MZ9A 3CX5H 3HUSC 2OYIC 1P84H 3EFGA 3WU2E 3CI9A 2HG5D 3SWKA 1AQTA 2QJYC 4GOEA 1SQPD 1GU4A 1SQXG 5GTIH 2BCCJ 2PAJA 3AE4C 3MD0A 1JMBA 1VL2A 4WB4A 3HE4A 3O6QB 1EZVG 1FZEA 3K5BA 1CZQA 2K9JA 1H89A 1FOSF 3HUSB 3L4FA 1JY3N 1KN7A 2NRGA 2N1TA 1L0LJ 1IFNA 1PP9G 2P10A 3H1HG 3CX5D 3AEEC 4ASVA 2ZXXA 4A7PA 3VP9A 3P8MC 5CJ4A 2FKWB 1P84D 1R5SA 2KS1A 5AW8B 2Y9YA 1OVUA 2PFXA 3L71E 1KILA 2E74B 1KB9I 2KSEA 1Q81Q 1SQBD 2AXCA 2H43A 1X8YA 2ZYDA 4PV1C 4H0LD 4ASWA 1G1JA 1EDLA 2QJKC 3S4RA 5DJTB 2KIKA 3AEBC 1PIXA 1GW4A 3IAOA 3B5NC 3VTPC 1AQ5A 2YIUC 2QE7H 3F5HA 4L74A 1H0TA 1YQ3C 3H1KD 3L71J 3LW5H 5CCHD 1PZQA 3MGNA 2JR8A 1N7SC 2QG4A 2QJKB 2LXBA 3Q3DA 1KFNA 4KT0J 2FYUE 3L74D 5AVTB 1AVOA 4D6TD 4XFJA 4DJGA 3G3ZA 2E75C 4DCKA 2P58A 3B5NB 1NHLA 2YIUB 2YKPA 3R4YA 3S1KA 1PPJG 1NTZD 5CCGA 1ZW0A 1OIPA 2A45G 1N7SB 1KILB 3CD6P 3UIAA 2R5DA 4KHXA 5KAFE 1GU5A 1L4AA 4HH2A 2FYUJ 1NKZB 3CCRP 2IZ0A 1A02F 1NTKG 3CWBE 3E1RA 4HYTB 1G2CA 2IFNA 1ZN5A 2OTJP 4OWFA 2PRRA 3BCCG 2JEEA 2Q7CA 1KILE 2KNCB 2A06D 5E79E 3EFFK 3VYIA 2RH0A 2FYNB 3AECC 1KQGB 1IC2A 1SQVK 2WSSH 3KXDA 1VDFA 1LTJA 5KAIH 2W6JH 1WT6A 4GIFA 2BEZF 3G6EP 1AV1A 1VQ8P 1LP1B 2YNYA 4YXWH 1JB0J 1SQPG 1GW3A 1JTHB 3CWBJ 1FE6A 2SPZA 3NXSA 2IDBA 3TGUG 1QGKB 1LTBC 3WU2H 1PFIA 3SWYA 2HR3A 2FBWC 1Q2NA 2BCCD 4RKUJ 4RJTA 3NMDA 2Q5UA 2QEXP 4JPZB 1L4AB 2JP3A 2H88C 3IFMA 3MUDA 2IBZE 1G2CB 5AW4B 2ZAEB 1HJ0A 2KI7B 1PV3A 4BRYA 1L0LD 4L73A 4H0LC 1ZP0C 2WVRA 5AVVB 3V2RA 3H1IG 5B5EE 2WWWA 1ZXGA 1LTJB 4PD4E 1DD4A 2O1KA 1YHQP 2K37A 3CXHI 1FZGA 2I1KA 1LT9A 5AW2B 4DOJA 2YXQB 5TISE 4WVZA 5CCHC 3CCQP 2W83C 3TDKA 3CMAP 5APUA 4H0LB 4H44D 1SQQK 1YTZT 3PP5A 3H6PA 3L73J 1RF1A 1M1JA 1T8ZA 1RE4C 3C8VA 4U3FE 2AEFA 2Q9IA 1SFCD 1SQBE 3O8ZA 1KZUB 1SVFA 3L71D 3II6A 3LIDA 4BXLA 4IL6E 2XU6A 1KB9E 3LIEA 1RF0C 1NU1G 5KLVK 3H32B 2OQQA 4BRYB 2P2UA 2N9BA 1IFDA 5CHXA 2GM4A 1L0NK 1JY2P 1N2DC 1EZVI 1SS1A 1J1EC 2GUVA 2WPSA 5APWA 2WQYC 4U3FJ 3WUTA 1HUCA 3V5BA 3L72J 2POHA 3L74E 5KAFH 1S3JA 1LT9B 1VF5D 1MV8A 3L75G 5BU5A 2WPRA 1BCCG 3AE3C 1VQ5P 2IFMA 4PJ0E 2FYUD 2J5UA 4ZKPA 3G71P 3AE1C 5AW0B 1X9VA 2Y0CA 4EI2A 1J1EB 3H1LE 3M0DA 5AVUB 1JO5A 4AUWA 1M1JB 1NAFA 5E79H 1NTZE 1PGOA 2HPCB 1SQVJ 5AVZB 1NKNA 4AYCA 4Z1MH 1RY3A 2M5AA 3ITKA 2R3CA 2FXMA 1EQ7A 4EYYQ 2HFED 3I55P 1OMIA 2N1TD 1IZNB 3BRTB 2W6AA 1GL2C 3GLMA 3HE5A 5AVYB 3ABVC 2A06E 3D6YA 1SQXK 3CWBD 1OW6A 3M9HA 3RK2C 3H1LJ 3KQGA 3CCSP 4C7RA 3CCUP 2ZYGA 4YXDC 4OVNF 4MN4C 2R5BA 3AE8C 3F89A 5CJ0A 3S9OA 2WMMA 1W2EA 1S72P 1JY2N 1L0LG 3L70J 1GZLA 1NTMK 3GHGA 2I1JA 2C9LY 5KKZC 1FJPA 3AE7C 2A45I 1SQQE 5KLIB 4IOIH 1T2KC 1J1DB 2J58A 2IZ1A 2BEQD 1RHZB 1OFCX 1T3JA 1KYOI 4JQ0D 2FXOA 5B5EH 3VP8A 2QVAA 5KAIE 1JMMA 2QM7A 3P8CE 4K35A 4PD4H 4JYCA 2OYHC 5KLVE 1VQKP 1BDCA 1SFCC 3AEFC 3HE5B 4C7NA 1VPCA 1SQQJ 3KHUA 2MKVA 4LLHA 3RL0D 2IX7C 3L71G 4H44B 1K9MQ 5CCGD 2Q3EA 3L73D 2OTKE 1K8AQ 1NGMB 2OYHB 1L4AD 2YO2A 5AW1B 1LTSC 1NVOA 3JC22 4TT3H 1SFCB 1A02J 4PD4D 2E74C 1R8EA 4IL6H 2QJPC 2WITA 1KB9H 5KLVJ 3VMYA 1CW5A 1S5LE 3SFEC 1Y8AA 3G4SP 1IFIA 3OW2O 1LWUC 4R4LA 1BE3J 1L0NJ 3B4SA 3CX5I 2G3AA 4GT1A 3RGUA 1VQ9P 2AEMA 4U3FD 1CI6B 2QJPB 2QIWA 3L72D 1URQA 1NTKK 5L8RJ 1KB9D 1LWUB 1VQMP 1VF5B 4PJ0H 1S9KE 1ZR4A 2JWAA 3OJAB 3Q5SA 2Q1KA 5APTA 2N1TC 1YJNP 3VMXA 1S4XA 2JJLA 1JUNA 3A5TA 3CC4P 3E1IA 1SQVD 2HYNA 3OA7A 1BSNA 5AVWB 4YTPC 3GW6A 3HE4B 1KILC 4I7ZC 1SQPK 2Q6QA 3CWBG 2K9JB 1NTME 3A2AA 4OH8B 3P7KA 4NPDA 3D71A 4I6MC 2AXTH 2XNXA 4GOFA 3CPWO 1BGYE 2N1TB 4WY4A 1SQXJ 3CCMP 1QX8A 4W80A 3M0AA 3H1LD 1KC8Q 2KS1B 3IR9A 5M1BA 2JKVA 1YYCA 1HGZA 2FYNC 4I7ZB 3A7OA 1N7LA 1ZRTE 2WT7A 2O1JA 4N78E 4UB8H 2M3EA 1SP4A 1PP9J 1NTMJ 1RE3A 3L70D 1ZLLA 2YKOA 4GODA 1BGYJ 2R44A 1YJ9P 2UWJE 4IL6X 2AEJA 2QA4P 1PGPA 2B9BA 3IF4A 1VQLP 2B87A 1H0TB 2C0XA 1T6AA 3H1JE 1VQPP 5APQA 3E7KA 5CCGC 2IBZG 5AW9B 3T97A 1XTCC 2RKLA 4JYBA 1L4AC 3L36A 3FX0A 1KQFB 3AEAC 2QRXA 2RMZA 3BRVB 2Y0DA 2V4HA 2R32A 4L75A 2C0WA 1HGVA 1SQQD 1FDOA 2H7HA 3VMZA 2ZJSE 2WZ7A 3RL0B 1DD3A 2M0BA 4UB6E 2LXCB 1KYOE 3H1JJ 2V7QJ 3PLNA 4HJGH 1NU1K 4JF7A 1NTKE 3P8CD 3PHLA 1LTJC 1OW8A 3CMEP 3L35A 2YXRB 3KYQA 3W68A 2HODA 5KLVD 3W67A 3CXHH 4K3AA 1S5LH 2BASA 2W6BA 3HTKA 5AVXB 1M90Q 2WPQA 1IO4A 2E43A 1TU3F 3CC2P 4U3FG 4H13D 1N8RQ 1E79H 3L73E 1BE3D 1L0ND 1U7JA 1SQBG 1ZOYC 1VQOP 1YI2P 1LT1A 3CCVP 1PGJA 3R2PA 3BATA 3T97B 1IK9A 1NTKJ 1FS0E 4EOTA 2ZXEB 3NTNA 3RBXA 3PRJA 1M1KQ 3TGUE 3CXHD 3MUDC 2XKMA 1LTGC 3H1KG 3EWKA 3GF3A 4RESB 5AW5B 1LJ2A 1ZMEC 1LGHB 3Q2YA 1MKMA 1DH3A 3MHVA 2NPSA 3L74G 2CPSA 1M8OB 5KJ7A 4D6TG 1GDTA 3L72E 2LR2A 5AW6B 2FXPA 3A0BE 3V6IA 3WUVA 1MFTA 3HD7A 3Q1MA 1GMJA 4W7ZA 1HVVA 3ZDMA 3H1LG 1Q86Q 1LT9C 3I5CA 1W2BO 3TGUJ 3OAKA 2G8YA 3H1IE 1NTZG 4NPEA 4EIJA 1S9KD 5APXA 1FZCA 1SQXD 5AW3B 3V4WA 5C39A 2FFDA 1SQVE 2E76D 1GTWA 2O01N 1M1JC 2GA1A 3L37A 1FOSE 1OX3A 4B86A 2WSCJ 2D2CD 2P7JA 2Z4EA 5TJHA 3A0HE 4GKGA 3FXDA 3BVHA 1EC5A 3IN6A 2A06G 2K1AA 1PP9D 1NTMD 1DX7A 3Q5RA 3H1IJ 1BGYD 1WRGA 1D7MA 2KK7A 1OZHA 2PP6A 1JY3O 3M9QA 1RF1B 1GL2A 1JCCA 1S5LX 1RQUA 5GTHE 1N73A 1LTAC 1IFMA 1ZR2A 2V7QH 1CSBA 1G1IA 1ZRTD 3L70E 4N78D 2AXTE 1S2EA 4OGQD 1NH4A 4PV1D 5APVA 3D6ZA 3V2NA 2BCCG 3RK3E 2L5GB 2JDIH 1FZCB 2ZT9D 5KLIC 2FFDB 1J1DC 3GG2A 1QVFO 3M0DC 3TNUA 1U57A 5EFWB 4UB6H 1U7MA 1URQD 1BCCE 1K04A 1NU1J 1KYOH 2VRSA 3FXEA 3USSA 3H1JD 4UB8E 1FDMA 1QLED 4Y99B 2N9YB 2KSJA 2ZVOB 1JM0A 1RQVA 1S1CX 1T3UA 2E5TA 1FDIA 4IFMA 2OYOA 2KUBA 3V2PA 4I2LC 3O6QA 3CCLP 1HBWA 4CPGA 2Z5HA 4H13B 3HUSA 4H44C 1GK4A 1N73B 1KQSO 2M5AB 2OYIA 1MUUA 2Z5IA 3L75J 4BWNA 1BCCJ 2XNDH 3C9IA 4N6JA 1KYOD 1QL1A 3RBZA 1HF9A 1NTKD 3CL3D 4WY4D 4O9BA 2KB7P 1ZV8A 3VOPA 2ZVNB 2QSIA 2LKMA 1BE3E 1L0NE 4C46A 2IBZI 1OVRA 2PGDA 1KTMA 2YMKA 1FZAA 2QM8A 1OXZA 5H2FE 2WSCH 3NFQA 2WSEJ 3MTUE 1MFZA 2E76C 3A0BH 2CK3H 3GHGB 3CXHE 1WMKA 4PD4I 5DJUB 2D2CC 1KMIZ 1FBMA 3TGUD 1VF5C 3M91A 4IFFA 2W27A 3RL0g 3D70A 1Z56A 1FC2C 3WUUA 3TYYA 1P84I 2OYIB 1EDJA 2E76B 1NTMG 5CBOA 1YIJP 2FYUG 2QJYB 4HKZH 3B5NA 1BGYG 3A0HH 2D2CB 2GUSA 1UIXA 1AFOA 1LTIC 4XE5B 1VQ6P 1N7SA 1PGQA 4C7NB 1KFMA 2O01J 1SQXE 3H1ID 3AE9C 4OGQC 3KDPB 1EZVE 3A3YB 5GTHH 1BDDA 1X0TA 1AJYA 2ZT9C 1NWQA 1LNQA 2KNCA 3JCUE 1KD1Q 3G9RA 1PP9E 3H1HE 2K9YA 1IFJA 1URQC 4YPCA 1Y9BA 1K05A 3BASA 2CPBA 3QWOC 4KJMA 4OGQB 5KTBA 4PV1B 1YJWP 1RH5B 3H1JG 2KLVA 1LP1A 5APYA 2YKQA 2ZT9B 1VQ4P 1EXIA 2I8DA 3PJSK 1JTHA 3N4XA 4ZNCA 2FY8A 4WWIA 4GDOA 1NU1D 1URQB 3H1HJ 1Q7YQ 3PH0A 4R4MA 3AE2C 1SQBK 5AVRB 3MIWA 4WY4C 3RK3D 2NPSD 2ZYAA 5KJ7D 2E75B 1DEEG 2L91A 3RL0C 5B66H 1OVVA 3HD7D 1NJIQ 1Q82Q 3L75D 1BCCD 2IYPA 2WSEH 1OW7A 2KP8A 2YMYA 4M3LA 3QH9A 2K88A 2JWDA 3GF7A 1YQ4C 3L73G 3AEGC 1RE3C 4WY4B 1PPJE 1DIPA 1M7LA 2JO1A 3JSVC 1KQLA 3AEDC 3KZIH 2WT7B 2XDJA 5H2FH 1QVGO 1HJBA 5APSA 5AW7B 2NZ2A 1NTZK 3BCCE 2O3JA 4QMAA 2OGUA 1NOHA 2O01H 1GL2D 3U1AA 5CCHA 1FZBA 5AVQB 3RK2D 5AVSB 3L72G 2KOGA 3FGAD 1M56D 3H32A 4N3YB 5K5GB 2B88A 2B87B 4L76A 3B71A 1H88A 1FZFA 2XZRA 1K73Q 4HB1A 2H89C 1RE4A 1SQPE 2E42A 2MJZA 4XA4A 1FAVA 1GK6A 3HRNA 4ZKUA 2R3SA 2B89A 3BCCJ 4AQRD 1JY2O 5BU8B 3M06A 3U59A 1SQVG 1RF0A 1X22A 1IJDB 2Q3IA 1LTTC 1T2KD 2FYZA 3CX5E 3MP7B 1HH0A 3MZWB 2K3RA 4WBAA 1P84E 1EDKA 3VMAA 2Y9ZA 3CCEP 4TLFA 1SQPJ 1HWTC 1USDA 5GTIE 2YO3A 3JCUH 2HODB 2P67A 3VN0A 2HPCA 2WPVB 1QL2A 3KPEA 4LGDE 3HTKB 3FWNA 4LC1A 4W7YA 3SWFA 3I56P 2P1JA 1JCDA 4ZMDA 5CMZA 2WSFJ 3U1CA 1JNMA 1RF1C 3SFDC 3L70G 2OTLP 1L0LK 1AA0A 4JBZA 1EZVD 2KZJA 2ZFCA 3AE6C 3RK3C 2NPSC 1HTLC 2M3BA 5KJ7C 2KXPB 3PTZA 2E74D 2E5YA 3H1KE 2ITAA 2W90A 3H25A 3H1HD 3HD7C 3TF5A 1IK7A 4NPFX 1AVYA 2Y0EA 1PL5A 1SQBJ 1VQNP 3GMAA 2WTYA 4DZOA 4EDFA 2OARA 2KLUA 1XTGB 3WMM0 1J2JB 4D6TE 1NAYA 1EDIA 4RO0A 3EQ2A 3N7NA 1FZCC 2KYVA 3C1LA 1USEA 3RK3B 2NPSB 2FFDC 3B8EB 4DT0A 1NU1E 1Y47A 1JEKA 3CC7P 1OWAA 3HD7B 1SQQG 1VQ7P 4Y99C 3H1KJ 2XV5A 1NYHA 5BVZA 1EXJA 1YBKA 1R5LA 2J59M 1N86A 3CLQA 2A45H 3L74J 1FJKA 1FU1A 4D6TJ 2RN0A 1X79B 1E5WA 3P32A 1W5CE 3B5ND 4H13C 1SLQA 3L75E 5KLVG 1N73C 3SSUA 1IFPA 1UIIA 1H8AA 1L2PA 4IFDK 1N7SD 1KILD 1NTZJ 2W8ZA 1BE3G 1L0NG 5CBNA 1JY3P
chains in the Genus database with same CATH topology
5K5GB 4BXLA 2B88A 2B87B 2RKLA 2P58A 2HR3A 1Q2NA 2OTKE 4HB1A 3S1KA 4NPFX 1DEEG 2QRXA 4ASVA 1ZW0A 1NVOA 4NPDA 3MHVA 1OVVA 4GOFA 2B89A 2LR2A 1EDIA 1SS1A 4MN4C 1OVRA 2M0BA 1BDDA 1X0TA 2ZAEB 1OVUA 2LXCB 1MFTA 2KI7B 2JWDA 2WMMA 2KS1B 4HJGH 3ZDMA 1Y47A 4NPEA 4ASWA 1S3JA 1EDLA 3MZWB 3RGUA 3QWOC 1ZXGA 2K3RA 4KJMA 5DJTB 4IOIH 5EFWB 4K3AA 1EDKA 2KIKA 1U7MA 5C39A 5DJUB 3FXEA 2KZIA 1LP1A 1JM0A 4GODA 1U7JA 2R44A 2QVAA 2I8DA 2UWJE 4ZNCA 4WWIA 1H0TA 3FXDA 1FC2C 4K35A 1EC5A 1LT1A 2KUBA 1LP1B 4GOEA 2M5AA 4ZMDA 1EDJA 2Q1KA 4CPGA 1BDCA 5CBOA 2B87A 2LXBA 1H0TB 4EYYQ 2SPZA 4HKZH 1JMBA 4JBZA 2KZJA 3PH0A 2M5AB 5CBNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5K5G B;  4BXL A;  2B88 A;  2B87 B;  2RKL A;  2P58 A;  2HR3 A;  1Q2N A;  2OTK E;  4HB1 A;  3S1K A;  4NPF X;  1DEE G;  2QRX A;  4ASV A;  1ZW0 A;  1NVO A;  4NPD A;  3MHV A;  1OVV A;  4GOF A;  2B89 A;  2LR2 A;  1EDI A;  1SS1 A;  4MN4 C;  1OVR A;  2M0B A;  1BDD A;  1X0T A;  2ZAE B;  1OVU A;  2LXC B;  1MFT A;  2KI7 B;  2JWD A;  2WMM A;  2KS1 B;  4HJG H;  3ZDM A;  1Y47 A;  4NPE A;  4ASW A;  1S3J A;  1EDL A;  3MZW B;  3RGU A;  3QWO C;  1ZXG A;  2K3R A;  4KJM A;  5DJT B;  4IOI H;  5EFW B;  4K3A A;  1EDK A;  2KIK A;  1U7M A;  5C39 A;  5DJU B;  3FXE A;  2KZI A;  1LP1 A;  1JM0 A;  4GOD A;  1U7J A;  2R44 A;  2QVA A;  2I8D A;  2UWJ E;  4ZNC A;  4WWI A;  1H0T A;  3FXD A;  1FC2 C;  4K35 A;  1EC5 A;  1LT1 A;  2KUB A;  1LP1 B;  4GOE A;  2M5A A;  4ZMD A;  1EDJ A;  2Q1K A;  4CPG A;  1BDC A;  5CBO A;  2B87 A;  2LXB A;  1H0T B;  4EYY Q;  2SPZ A;  4HKZ H;  1JMB A;  4JBZ A;  2KZJ A;  3PH0 A;  2M5A B;  5CBN A; 
#chains in the Genus database with same CATH topology
 1KOR A;  2OYH A;  3LW5 J;  2C9N Y;  1SFC A;  1PPJ D;  2E75 D;  3CCJ P;  1GL2 B;  3FWL A;  3TK1 A;  2FYU K;  1QEX A;  1NO4 A;  2M8R A;  3RK2 B;  5B66 E;  1Q90 D;  2HLO A;  1YIT P;  3Q5P A;  1YTZ I;  1BSH A;  3TSI A;  2H8P D;  1JOC A;  1DEB A;  4I1L A;  2BCC E;  3V4Q A;  1KV4 A;  2IPP A;  2DW3 A;  2IYO A;  3M9B A;  3AE5 C;  3BCC D;  3GHG C;  4U7J A;  1CI6 A;  3V2Q A;  5KKZ B;  1M57 D;  4Y28 J;  1LWU A;  3TNU B;  1GD2 E;  2KZI A;  3KZI E;  2WSF H;  5TIS H;  1L0L E;  2IBZ D;  1MZ9 A;  3CX5 H;  3HUS C;  2OYI C;  1P84 H;  3EFG A;  3WU2 E;  3CI9 A;  2HG5 D;  3SWK A;  1AQT A;  2QJY C;  4GOE A;  1SQP D;  1GU4 A;  1SQX G;  5GTI H;  2BCC J;  2PAJ A;  3AE4 C;  3MD0 A;  1JMB A;  1VL2 A;  4WB4 A;  3HE4 A;  3O6Q B;  1EZV G;  1FZE A;  3K5B A;  1CZQ A;  2K9J A;  1H89 A;  1FOS F;  3HUS B;  3L4F A;  1JY3 N;  1KN7 A;  2NRG A;  2N1T A;  1L0L J;  1IFN A;  1PP9 G;  2P10 A;  3H1H G;  3CX5 D;  3AEE C;  4ASV A;  2ZXX A;  4A7P A;  3VP9 A;  3P8M C;  5CJ4 A;  2FKW B;  1P84 D;  1R5S A;  2KS1 A;  5AW8 B;  2Y9Y A;  1OVU A;  2PFX A;  3L71 E;  1KIL A;  2E74 B;  1KB9 I;  2KSE A;  1Q81 Q;  1SQB D;  2AXC A;  2H43 A;  1X8Y A;  2ZYD A;  4PV1 C;  4H0L D;  4ASW A;  1G1J A;  1EDL A;  2QJK C;  3S4R A;  5DJT B;  2KIK A;  3AEB C;  1PIX A;  1GW4 A;  3IAO A;  3B5N C;  3VTP C;  1AQ5 A;  2YIU C;  2QE7 H;  3F5H A;  4L74 A;  1H0T A;  1YQ3 C;  3H1K D;  3L71 J;  3LW5 H;  5CCH D;  1PZQ A;  3MGN A;  2JR8 A;  1N7S C;  2QG4 A;  2QJK B;  2LXB A;  3Q3D A;  1KFN A;  4KT0 J;  2FYU E;  3L74 D;  5AVT B;  1AVO A;  4D6T D;  4XFJ A;  4DJG A;  3G3Z A;  2E75 C;  4DCK A;  2P58 A;  3B5N B;  1NHL A;  2YIU B;  2YKP A;  3R4Y A;  3S1K A;  1PPJ G;  1NTZ D;  5CCG A;  1ZW0 A;  1OIP A;  2A45 G;  1N7S B;  1KIL B;  3CD6 P;  3UIA A;  2R5D A;  4KHX A;  5KAF E;  1GU5 A;  1L4A A;  4HH2 A;  2FYU J;  1NKZ B;  3CCR P;  2IZ0 A;  1A02 F;  1NTK G;  3CWB E;  3E1R A;  4HYT B;  1G2C A;  2IFN A;  1ZN5 A;  2OTJ P;  4OWF A;  2PRR A;  3BCC G;  2JEE A;  2Q7C A;  1KIL E;  2KNC B;  2A06 D;  5E79 E;  3EFF K;  3VYI A;  2RH0 A;  2FYN B;  3AEC C;  1KQG B;  1IC2 A;  1SQV K;  2WSS H;  3KXD A;  1VDF A;  1LTJ A;  5KAI H;  2W6J H;  1WT6 A;  4GIF A;  2BEZ F;  3G6E P;  1AV1 A;  1VQ8 P;  1LP1 B;  2YNY A;  4YXW H;  1JB0 J;  1SQP G;  1GW3 A;  1JTH B;  3CWB J;  1FE6 A;  2SPZ A;  3NXS A;  2IDB A;  3TGU G;  1QGK B;  1LTB C;  3WU2 H;  1PFI A;  3SWY A;  2HR3 A;  2FBW C;  1Q2N A;  2BCC D;  4RKU J;  4RJT A;  3NMD A;  2Q5U A;  2QEX P;  4JPZ B;  1L4A B;  2JP3 A;  2H88 C;  3IFM A;  3MUD A;  2IBZ E;  1G2C B;  5AW4 B;  2ZAE B;  1HJ0 A;  2KI7 B;  1PV3 A;  4BRY A;  1L0L D;  4L73 A;  4H0L C;  1ZP0 C;  2WVR A;  5AVV B;  3V2R A;  3H1I G;  5B5E E;  2WWW A;  1ZXG A;  1LTJ B;  4PD4 E;  1DD4 A;  2O1K A;  1YHQ P;  2K37 A;  3CXH I;  1FZG A;  2I1K A;  1LT9 A;  5AW2 B;  4DOJ A;  2YXQ B;  5TIS E;  4WVZ A;  5CCH C;  3CCQ P;  2W83 C;  3TDK A;  3CMA P;  5APU A;  4H0L B;  4H44 D;  1SQQ K;  1YTZ T;  3PP5 A;  3H6P A;  3L73 J;  1RF1 A;  1M1J A;  1T8Z A;  1RE4 C;  3C8V A;  4U3F E;  2AEF A;  2Q9I A;  1SFC D;  1SQB E;  3O8Z A;  1KZU B;  1SVF A;  3L71 D;  3II6 A;  3LID A;  4BXL A;  4IL6 E;  2XU6 A;  1KB9 E;  3LIE A;  1RF0 C;  1NU1 G;  5KLV K;  3H32 B;  2OQQ A;  4BRY B;  2P2U A;  2N9B A;  1IFD A;  5CHX A;  2GM4 A;  1L0N K;  1JY2 P;  1N2D C;  1EZV I;  1SS1 A;  1J1E C;  2GUV A;  2WPS A;  5APW A;  2WQY C;  4U3F J;  3WUT A;  1HUC A;  3V5B A;  3L72 J;  2POH A;  3L74 E;  5KAF H;  1S3J A;  1LT9 B;  1VF5 D;  1MV8 A;  3L75 G;  5BU5 A;  2WPR A;  1BCC G;  3AE3 C;  1VQ5 P;  2IFM A;  4PJ0 E;  2FYU D;  2J5U A;  4ZKP A;  3G71 P;  3AE1 C;  5AW0 B;  1X9V A;  2Y0C A;  4EI2 A;  1J1E B;  3H1L E;  3M0D A;  5AVU B;  1JO5 A;  4AUW A;  1M1J B;  1NAF A;  5E79 H;  1NTZ E;  1PGO A;  2HPC B;  1SQV J;  5AVZ B;  1NKN A;  4AYC A;  4Z1M H;  1RY3 A;  2M5A A;  3ITK A;  2R3C A;  2FXM A;  1EQ7 A;  4EYY Q;  2HFE D;  3I55 P;  1OMI A;  2N1T D;  1IZN B;  3BRT B;  2W6A A;  1GL2 C;  3GLM A;  3HE5 A;  5AVY B;  3ABV C;  2A06 E;  3D6Y A;  1SQX K;  3CWB D;  1OW6 A;  3M9H A;  3RK2 C;  3H1L J;  3KQG A;  3CCS P;  4C7R A;  3CCU P;  2ZYG A;  4YXD C;  4OVN F;  4MN4 C;  2R5B A;  3AE8 C;  3F89 A;  5CJ0 A;  3S9O A;  2WMM A;  1W2E A;  1S72 P;  1JY2 N;  1L0L G;  3L70 J;  1GZL A;  1NTM K;  3GHG A;  2I1J A;  2C9L Y;  5KKZ C;  1FJP A;  3AE7 C;  2A45 I;  1SQQ E;  5KLI B;  4IOI H;  1T2K C;  1J1D B;  2J58 A;  2IZ1 A;  2BEQ D;  1RHZ B;  1OFC X;  1T3J A;  1KYO I;  4JQ0 D;  2FXO A;  5B5E H;  3VP8 A;  2QVA A;  5KAI E;  1JMM A;  2QM7 A;  3P8C E;  4K35 A;  4PD4 H;  4JYC A;  2OYH C;  5KLV E;  1VQK P;  1BDC A;  1SFC C;  3AEF C;  3HE5 B;  4C7N A;  1VPC A;  1SQQ J;  3KHU A;  2MKV A;  4LLH A;  3RL0 D;  2IX7 C;  3L71 G;  4H44 B;  1K9M Q;  5CCG D;  2Q3E A;  3L73 D;  2OTK E;  1K8A Q;  1NGM B;  2OYH B;  1L4A D;  2YO2 A;  5AW1 B;  1LTS C;  1NVO A;  3JC2 2;  4TT3 H;  1SFC B;  1A02 J;  4PD4 D;  2E74 C;  1R8E A;  4IL6 H;  2QJP C;  2WIT A;  1KB9 H;  5KLV J;  3VMY A;  1CW5 A;  1S5L E;  3SFE C;  1Y8A A;  3G4S P;  1IFI A;  3OW2 O;  1LWU C;  4R4L A;  1BE3 J;  1L0N J;  3B4S A;  3CX5 I;  2G3A A;  4GT1 A;  3RGU A;  1VQ9 P;  2AEM A;  4U3F D;  1CI6 B;  2QJP B;  2QIW A;  3L72 D;  1URQ A;  1NTK K;  5L8R J;  1KB9 D;  1LWU B;  1VQM P;  1VF5 B;  4PJ0 H;  1S9K E;  1ZR4 A;  2JWA A;  3OJA B;  3Q5S A;  2Q1K A;  5APT A;  2N1T C;  1YJN P;  3VMX A;  1S4X A;  2JJL A;  1JUN A;  3A5T A;  3CC4 P;  3E1I A;  1SQV D;  2HYN A;  3OA7 A;  1BSN A;  5AVW B;  4YTP C;  3GW6 A;  3HE4 B;  1KIL C;  4I7Z C;  1SQP K;  2Q6Q A;  3CWB G;  2K9J B;  1NTM E;  3A2A A;  4OH8 B;  3P7K A;  4NPD A;  3D71 A;  4I6M C;  2AXT H;  2XNX A;  4GOF A;  3CPW O;  1BGY E;  2N1T B;  4WY4 A;  1SQX J;  3CCM P;  1QX8 A;  4W80 A;  3M0A A;  3H1L D;  1KC8 Q;  2KS1 B;  3IR9 A;  5M1B A;  2JKV A;  1YYC A;  1HGZ A;  2FYN C;  4I7Z B;  3A7O A;  1N7L A;  1ZRT E;  2WT7 A;  2O1J A;  4N78 E;  4UB8 H;  2M3E A;  1SP4 A;  1PP9 J;  1NTM J;  1RE3 A;  3L70 D;  1ZLL A;  2YKO A;  4GOD A;  1BGY J;  2R44 A;  1YJ9 P;  2UWJ E;  4IL6 X;  2AEJ A;  2QA4 P;  1PGP A;  2B9B A;  3IF4 A;  1VQL P;  2B87 A;  1H0T B;  2C0X A;  1T6A A;  3H1J E;  1VQP P;  5APQ A;  3E7K A;  5CCG C;  2IBZ G;  5AW9 B;  3T97 A;  1XTC C;  2RKL A;  4JYB A;  1L4A C;  3L36 A;  3FX0 A;  1KQF B;  3AEA C;  2QRX A;  2RMZ A;  3BRV B;  2Y0D A;  2V4H A;  2R32 A;  4L75 A;  2C0W A;  1HGV A;  1SQQ D;  1FDO A;  2H7H A;  3VMZ A;  2ZJS E;  2WZ7 A;  3RL0 B;  1DD3 A;  2M0B A;  4UB6 E;  2LXC B;  1KYO E;  3H1J J;  2V7Q J;  3PLN A;  4HJG H;  1NU1 K;  4JF7 A;  1NTK E;  3P8C D;  3PHL A;  1LTJ C;  1OW8 A;  3CME P;  3L35 A;  2YXR B;  3KYQ A;  3W68 A;  2HOD A;  5KLV D;  3W67 A;  3CXH H;  4K3A A;  1S5L H;  2BAS A;  2W6B A;  3HTK A;  5AVX B;  1M90 Q;  2WPQ A;  1IO4 A;  2E43 A;  1TU3 F;  3CC2 P;  4U3F G;  4H13 D;  1N8R Q;  1E79 H;  3L73 E;  1BE3 D;  1L0N D;  1U7J A;  1SQB G;  1ZOY C;  1VQO P;  1YI2 P;  1LT1 A;  3CCV P;  1PGJ A;  3R2P A;  3BAT A;  3T97 B;  1IK9 A;  1NTK J;  1FS0 E;  4EOT A;  2ZXE B;  3NTN A;  3RBX A;  3PRJ A;  1M1K Q;  3TGU E;  3CXH D;  3MUD C;  2XKM A;  1LTG C;  3H1K G;  3EWK A;  3GF3 A;  4RES B;  5AW5 B;  1LJ2 A;  1ZME C;  1LGH B;  3Q2Y A;  1MKM A;  1DH3 A;  3MHV A;  2NPS A;  3L74 G;  2CPS A;  1M8O B;  5KJ7 A;  4D6T G;  1GDT A;  3L72 E;  2LR2 A;  5AW6 B;  2FXP A;  3A0B E;  3V6I A;  3WUV A;  1MFT A;  3HD7 A;  3Q1M A;  1GMJ A;  4W7Z A;  1HVV A;  3ZDM A;  3H1L G;  1Q86 Q;  1LT9 C;  3I5C A;  1W2B O;  3TGU J;  3OAK A;  2G8Y A;  3H1I E;  1NTZ G;  4NPE A;  4EIJ A;  1S9K D;  5APX A;  1FZC A;  1SQX D;  5AW3 B;  3V4W A;  5C39 A;  2FFD A;  1SQV E;  2E76 D;  1GTW A;  2O01 N;  1M1J C;  2GA1 A;  3L37 A;  1FOS E;  1OX3 A;  4B86 A;  2WSC J;  2D2C D;  2P7J A;  2Z4E A;  5TJH A;  3A0H E;  4GKG A;  3FXD A;  3BVH A;  1EC5 A;  3IN6 A;  2A06 G;  2K1A A;  1PP9 D;  1NTM D;  1DX7 A;  3Q5R A;  3H1I J;  1BGY D;  1WRG A;  1D7M A;  2KK7 A;  1OZH A;  2PP6 A;  1JY3 O;  3M9Q A;  1RF1 B;  1GL2 A;  1JCC A;  1S5L X;  1RQU A;  5GTH E;  1N73 A;  1LTA C;  1IFM A;  1ZR2 A;  2V7Q H;  1CSB A;  1G1I A;  1ZRT D;  3L70 E;  4N78 D;  2AXT E;  1S2E A;  4OGQ D;  1NH4 A;  4PV1 D;  5APV A;  3D6Z A;  3V2N A;  2BCC G;  3RK3 E;  2L5G B;  2JDI H;  1FZC B;  2ZT9 D;  5KLI C;  2FFD B;  1J1D C;  3GG2 A;  1QVF O;  3M0D C;  3TNU A;  1U57 A;  5EFW B;  4UB6 H;  1U7M A;  1URQ D;  1BCC E;  1K04 A;  1NU1 J;  1KYO H;  2VRS A;  3FXE A;  3USS A;  3H1J D;  4UB8 E;  1FDM A;  1QLE D;  4Y99 B;  2N9Y B;  2KSJ A;  2ZVO B;  1JM0 A;  1RQV A;  1S1C X;  1T3U A;  2E5T A;  1FDI A;  4IFM A;  2OYO A;  2KUB A;  3V2P A;  4I2L C;  3O6Q A;  3CCL P;  1HBW A;  4CPG A;  2Z5H A;  4H13 B;  3HUS A;  4H44 C;  1GK4 A;  1N73 B;  1KQS O;  2M5A B;  2OYI A;  1MUU A;  2Z5I A;  3L75 J;  4BWN A;  1BCC J;  2XND H;  3C9I A;  4N6J A;  1KYO D;  1QL1 A;  3RBZ A;  1HF9 A;  1NTK D;  3CL3 D;  4WY4 D;  4O9B A;  2KB7 P;  1ZV8 A;  3VOP A;  2ZVN B;  2QSI A;  2LKM A;  1BE3 E;  1L0N E;  4C46 A;  2IBZ I;  1OVR A;  2PGD A;  1KTM A;  2YMK A;  1FZA A;  2QM8 A;  1OXZ A;  5H2F E;  2WSC H;  3NFQ A;  2WSE J;  3MTU E;  1MFZ A;  2E76 C;  3A0B H;  2CK3 H;  3GHG B;  3CXH E;  1WMK A;  4PD4 I;  5DJU B;  2D2C C;  1KMI Z;  1FBM A;  3TGU D;  1VF5 C;  3M91 A;  4IFF A;  2W27 A;  3RL0 g;  3D70 A;  1Z56 A;  1FC2 C;  3WUU A;  3TYY A;  1P84 I;  2OYI B;  1EDJ A;  2E76 B;  1NTM G;  5CBO A;  1YIJ P;  2FYU G;  2QJY B;  4HKZ H;  3B5N A;  1BGY G;  3A0H H;  2D2C B;  2GUS A;  1UIX A;  1AFO A;  1LTI C;  4XE5 B;  1VQ6 P;  1N7S A;  1PGQ A;  4C7N B;  1KFM A;  2O01 J;  1SQX E;  3H1I D;  3AE9 C;  4OGQ C;  3KDP B;  1EZV E;  3A3Y B;  5GTH H;  1BDD A;  1X0T A;  1AJY A;  2ZT9 C;  1NWQ A;  1LNQ A;  2KNC A;  3JCU E;  1KD1 Q;  3G9R A;  1PP9 E;  3H1H E;  2K9Y A;  1IFJ A;  1URQ C;  4YPC A;  1Y9B A;  1K05 A;  3BAS A;  2CPB A;  3QWO C;  4KJM A;  4OGQ B;  5KTB A;  4PV1 B;  1YJW P;  1RH5 B;  3H1J G;  2KLV A;  1LP1 A;  5APY A;  2YKQ A;  2ZT9 B;  1VQ4 P;  1EXI A;  2I8D A;  3PJS K;  1JTH A;  3N4X A;  4ZNC A;  2FY8 A;  4WWI A;  4GDO A;  1NU1 D;  1URQ B;  3H1H J;  1Q7Y Q;  3PH0 A;  4R4M A;  3AE2 C;  1SQB K;  5AVR B;  3MIW A;  4WY4 C;  3RK3 D;  2NPS D;  2ZYA A;  5KJ7 D;  2E75 B;  1DEE G;  2L91 A;  3RL0 C;  5B66 H;  1OVV A;  3HD7 D;  1NJI Q;  1Q82 Q;  3L75 D;  1BCC D;  2IYP A;  2WSE H;  1OW7 A;  2KP8 A;  2YMY A;  4M3L A;  3QH9 A;  2K88 A;  2JWD A;  3GF7 A;  1YQ4 C;  3L73 G;  3AEG C;  1RE3 C;  4WY4 B;  1PPJ E;  1DIP A;  1M7L A;  2JO1 A;  3JSV C;  1KQL A;  3AED C;  3KZI H;  2WT7 B;  2XDJ A;  5H2F H;  1QVG O;  1HJB A;  5APS A;  5AW7 B;  2NZ2 A;  1NTZ K;  3BCC E;  2O3J A;  4QMA A;  2OGU A;  1NOH A;  2O01 H;  1GL2 D;  3U1A A;  5CCH A;  1FZB A;  5AVQ B;  3RK2 D;  5AVS B;  3L72 G;  2KOG A;  3FGA D;  1M56 D;  3H32 A;  4N3Y B;  5K5G B;  2B88 A;  2B87 B;  4L76 A;  3B71 A;  1H88 A;  1FZF A;  2XZR A;  1K73 Q;  4HB1 A;  2H89 C;  1RE4 A;  1SQP E;  2E42 A;  2MJZ A;  4XA4 A;  1FAV A;  1GK6 A;  3HRN A;  4ZKU A;  2R3S A;  2B89 A;  3BCC J;  4AQR D;  1JY2 O;  5BU8 B;  3M06 A;  3U59 A;  1SQV G;  1RF0 A;  1X22 A;  1IJD B;  2Q3I A;  1LTT C;  1T2K D;  2FYZ A;  3CX5 E;  3MP7 B;  1HH0 A;  3MZW B;  2K3R A;  4WBA A;  1P84 E;  1EDK A;  3VMA A;  2Y9Z A;  3CCE P;  4TLF A;  1SQP J;  1HWT C;  1USD A;  5GTI E;  2YO3 A;  3JCU H;  2HOD B;  2P67 A;  3VN0 A;  2HPC A;  2WPV B;  1QL2 A;  3KPE A;  4LGD E;  3HTK B;  3FWN A;  4LC1 A;  4W7Y A;  3SWF A;  3I56 P;  2P1J A;  1JCD A;  4ZMD A;  5CMZ A;  2WSF J;  3U1C A;  1JNM A;  1RF1 C;  3SFD C;  3L70 G;  2OTL P;  1L0L K;  1AA0 A;  4JBZ A;  1EZV D;  2KZJ A;  2ZFC A;  3AE6 C;  3RK3 C;  2NPS C;  1HTL C;  2M3B A;  5KJ7 C;  2KXP B;  3PTZ A;  2E74 D;  2E5Y A;  3H1K E;  2ITA A;  2W90 A;  3H25 A;  3H1H D;  3HD7 C;  3TF5 A;  1IK7 A;  4NPF X;  1AVY A;  2Y0E A;  1PL5 A;  1SQB J;  1VQN P;  3GMA A;  2WTY A;  4DZO A;  4EDF A;  2OAR A;  2KLU A;  1XTG B;  3WMM 0;  1J2J B;  4D6T E;  1NAY A;  1EDI A;  4RO0 A;  3EQ2 A;  3N7N A;  1FZC C;  2KYV A;  3C1L A;  1USE A;  3RK3 B;  2NPS B;  2FFD C;  3B8E B;  4DT0 A;  1NU1 E;  1Y47 A;  1JEK A;  3CC7 P;  1OWA A;  3HD7 B;  1SQQ G;  1VQ7 P;  4Y99 C;  3H1K J;  2XV5 A;  1NYH A;  5BVZ A;  1EXJ A;  1YBK A;  1R5L A;  2J59 M;  1N86 A;  3CLQ A;  2A45 H;  3L74 J;  1FJK A;  1FU1 A;  4D6T J;  2RN0 A;  1X79 B;  1E5W A;  3P32 A;  1W5C E;  3B5N D;  4H13 C;  1SLQ A;  3L75 E;  5KLV G;  1N73 C;  3SSU A;  1IFP A;  1UII A;  1H8A A;  1L2P A;  4IFD K;  1N7S D;  1KIL D;  1NTZ J;  2W8Z A;  1BE3 G;  1L0N G;  5CBN A;  1JY3 P; 
#chains in the Genus database with same CATH homology
 5K5G B;  4BXL A;  2B88 A;  2B87 B;  2RKL A;  2P58 A;  2HR3 A;  1Q2N A;  2OTK E;  4HB1 A;  3S1K A;  4NPF X;  1DEE G;  2QRX A;  4ASV A;  1ZW0 A;  1NVO A;  4NPD A;  3MHV A;  1OVV A;  4GOF A;  2B89 A;  2LR2 A;  1EDI A;  1SS1 A;  4MN4 C;  1OVR A;  2M0B A;  1BDD A;  1X0T A;  2ZAE B;  1OVU A;  2LXC B;  1MFT A;  2KI7 B;  2JWD A;  2WMM A;  2KS1 B;  4HJG H;  3ZDM A;  1Y47 A;  4NPE A;  4ASW A;  1S3J A;  1EDL A;  3MZW B;  3RGU A;  3QWO C;  1ZXG A;  2K3R A;  4KJM A;  5DJT B;  4IOI H;  5EFW B;  4K3A A;  1EDK A;  2KIK A;  1U7M A;  5C39 A;  5DJU B;  3FXE A;  2KZI A;  1LP1 A;  1JM0 A;  4GOD A;  1U7J A;  2R44 A;  2QVA A;  2I8D A;  2UWJ E;  4ZNC A;  4WWI A;  1H0T A;  3FXD A;  1FC2 C;  4K35 A;  1EC5 A;  1LT1 A;  2KUB A;  1LP1 B;  4GOE A;  2M5A A;  4ZMD A;  1EDJ A;  2Q1K A;  4CPG A;  1BDC A;  5CBO A;  2B87 A;  2LXB A;  1H0T B;  4EYY Q;  2SPZ A;  4HKZ H;  1JMB A;  4JBZ A;  2KZJ A;  3PH0 A;  2M5A B;  5CBN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...