1BDCA

Staphylococcus aureus protein a, immunoglobulin-binding b domain, nmr, 10 structures
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
60
structure length
60
Chain Sequence
TADNKFNKEQQNAFYEILHLPNLNEEQRNGFIQSLKDDPSQSANLLAEAKKLNDAQAPKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Three-dimensional solution structure of the B domain of staphylococcal protein A: comparisons of the solution and crystal structures.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Immunoglobulin-binding protein
molecule keywords STAPHYLOCOCCUS AUREUS PROTEIN A
total genus 12
structure length 60
sequence length 60
ec nomenclature
pdb deposition date 1996-06-28

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02216 B B domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 1bdcA00
2SPZA 2OTKE 2P58A 2I8DA 2KZJA 1DEEG 4BXLA 5K5GB 2LR2A 2B88A 1Q2NA 1JM0A 1MFTA 2KIKA 2B87A 1BDDA 4EYYQ 1BDCA 3ZDMA 2M5AB 4NPFX 1S3JA 1LT1A 1LP1B 2KS1B 2K3RA 1U7JA 2JWDA 4GOFA 5C39A 2Q1KA 1EDLA 1H0TB 4ASWA 2LXBA 2WMMA 5EFWB 4GOEA 3S1KA 1EDKA 1X0TA 4CPGA 4ZMDA 3FXEA 2M0BA 1LP1A 4GODA 4JBZA 1EC5A 2B89A 1OVUA 2B87B 2UWJE 5DJTB 4HJGH 1SS1A 2HR3A 3QWOC 4K35A 2KI7B 4KJMA 1FC2C 5DJUB 5CBNA 1ZW0A 4ZNCA 1U7MA 1H0TA 1ZXGA 2KUBA 2LXCB 2M5AA 2KZIA 3PH0A 1NVOA 1EDIA 2ZAEB 1Y47A 3FXDA 4K3AA 1EDJA 1OVRA 4HB1A 5CBOA 4HKZH 3MHVA 2QRXA 4MN4C 4NPDA 2R44A 2RKLA 1OVVA 4NPEA 4WWIA 3RGUA 4ASVA 3MZWB 1JMBA 4IOIH 2QVAA
chains in the Genus database with same CATH superfamily
2AXTH 4H44D 5KTBA 1NTZD 3H32A 5KAIE 1SQPD 1AVYA 3N7NA 2K37A 3CCJP 4IL6X 2YXQB 4Y99C 3CI9A 3EFGA 3C1LA 1BE3G 3HTKA 3II6A 3CXHI 1ZN5A 3TNUA 1L4AC 2J58A 3Q3DA 2FFDA 1SFCB 1H89A 4GIFA 1IO4A 2IBZI 1MV8A 1LWUC 3CWBG 2POHA 1GW3A 5CJ0A 1BCCJ 3O6QB 3RBZA 2B87A 1GL2A 4DT0A 1J2JB 2C0WA 4RESB 1S5LX 3KQGA 3VYIA 2WPQA 1BDDA 3WUVA 1CW5A 3AE4C 2E74D 2A45I 2YKOA 1TU3F 4PJ0E 4WB4A 3H1JD 3IR9A 3Q1MA 4HH2A 2P67A 3HD7D 3L71J 1LWUB 1WT6A 3CL3D 3V2QA 3BCCE 5TISE 3WMM0 5AVVB 3CCUP 1RF1C 2N1TC 3KHUA 3KZIH 1JY2P 1S3JA 1X79B 5B5EH 3AEAC 5BVZA 5KJ7A 1JY3O 3WUUA 3C8VA 4YTPC 1PPJE 1J1EB 1SQPK 3JCUE 1PP9J 2K3RA 1U7JA 1JY3P 2IYPA 2W6JH 2IX7C 3LIDA 4HYTB 4PV1D 2OYIB 2E42A 1SQVD 1NTKJ 5BU8B 1DIPA 2Z5IA 1L0LE 2N1TB 1OFCX 1Z56A 3NXSA 3H1ID 4XE5B 5E79H 1SQQG 2IZ1A 2QEXP 1EDLA 4H44B 4D6TJ 3GF3A 1SQXG 3RBXA 3PP5A 5AVWB 3LW5H 1FBMA 3I56P 2ZXEB 3OJAB 2OYIC 4JQ0D 1M90Q 3HUSB 3D70A 5EFWB 3H1IJ 3Q5RA 3VOPA 3W68A 1URQB 1NTMD 2KXPB 3L36A 4XA4A 2OYHC 2GM4A 1Q86Q 1X0TA 1BE3E 1IFDA 1MUUA 1NTZE 2JO1A 1GL2D 2IPPA 2WSCH 3EWKA 3F89A 4ZMDA 1SQQJ 2ZVOB 5GTIH 3H25A 3IN6A 3MD0A 3OA7A 4DJGA 1GMJA 1KQLA 2BCCJ 2NPSB 1G1IA 1OXZA 1K73Q 3S4RA 2B89A 1Q90D 1OVUA 2B87B 2N1TA 2OYHB 1WRGA 3FWLA 1FOSF 3VMXA 2V7QJ 3CMEP 1IFMA 2JJLA 1EZVG 2OYOA 2Q7CA 5AVXB 3BCCD 1S9KE 2FY8A 1IFNA 3A0BE 4WVZA 3JSVC 1NU1E 3SSUA 1NTKE 2WSFH 2Y9YA 4YXDC 1IK9A 2O01H 2XU6A 3H1KJ 4K35A 3L71G 3L72J 4L75A 4OH8B 3HTKB 1CI6A 2FYNB 2FYUJ 1KQGB 3H1LG 3L75G 2N9BA 5DJUB 4OGQD 5CBNA 5KAFH 2ZT9D 3VMYA 1ZW0A 3R2PA 1BGYJ 2P1JA 1FZBA 2ZVNB 4PV1C 3RL0D 3TYYA 2BCCG 1GDTA 2OYIA 2XNDH 3UIAA 2FFDC 3V6IA 1KB9I 2A06G 1G2CA 1NAFA 3G3ZA 1XTGB 2BASA 5KKZC 1KMIZ 1JB0J 1L0LG 2ZJSE 1N8RQ 1NGMB 1VQ8P 2OGUA 1QGKB 1FZCC 2YO3A 2M5AA 3AEEC 4RO0A 5CCHD 1OW6A 4A7PA 5GTHE 1URQD 2MJZA 2C9LY 3A2AA 1SQBK 1X22A 2QE7H 2IZ0A 3IFMA 3L70J 3PH0A 5KKZB 4H0LD 1LTJC 3L73G 1DX7A 1Y47A 2IFNA 2D2CC 3H1JJ 1EDJA 2W8ZA 2RN0A 1IJDB 1ZR4A 1JTHA 2KSEA 4PD4D 4I7ZB 4HKZH 2Y0EA 2QRXA 4MN4C 4WY4C 3TDKA 5CBOA 2WQYC 4AQRD 1OVVA 1NTME 2KNCB 2KB7P 4WWIA 3RK2D 1RH5B 1M8OB 2Y0CA 3RGUA 1YHQP 4BWNA 1N7SB 2KYVA 3K5BA 4IOIH 2FYUE 1PP9E 2SPZA 3HD7C 1M56D 3V4WA 1LWUA 2AEJA 3A0HE 3IAOA 5CCGC 1K9MQ 1LTSC 2QIWA 5CCHC 1FJPA 2OTKE 4PD4E 1Q7YQ 4IFDK 2P58A 1EXJA 1NTZK 2I8DA 1NU1J 1L0LD 1AV1A 1UIIA 3MIWA 1L4AA 4B86A 1QVFO 3JCUH 3L72G 3GLMA 1DEEG 1RHZB 4OGQC 5AW4B 1KD1Q 3P8CD 3SFEC 2OARA 3CX5H 5K5GB 1SQBD 3AE2C 3GF7A 1JM0A 1IC2A 2O1JA 4YPCA 1MKMA 2Y9ZA 1BSNA 1X8YA 3L75D 3LIEA 1KN7A 2IDBA 1SQPJ 3CXHH 3VP8A 3AEGC 4OGQB 1BE3J 1IFJA 1BDCA 2ZYDA 3H1JE 2JP3A 1N86A 3CXHD 3CCMP 5AW7B 4H44C 1QLED 2A45G 2IBZE 2RH0A 1URQA 2YKQA 1KB9E 2K88A 2QJPC 1KILB 2QJYC 3G6EP 1G1JA 3D6YA 2W27A 1IZNB 1OZHA 2ZFCA 1GL2C 1LT1A 1NH4A 2QA4P 1USEA 1VL2A 3KDPB 1VQOP 3G71P 1SQPG 1J1DB 1ZP0C 3ABVC 2Q3EA 4GOFA 2E76C 2QJKC 3H1HG 5B5EE 1KILC 1LT9A 1X9VA 2E74C 2QJYB 3AECC 2B9BA 3KZIE 1KB9H 1L0NE 1L2PA 1N2DC 3A0BH 1GL2B 4TLFA 4JYBA 4R4LA 4N78E 4TT3H 1RE3A 5E79E 4ASWA 1BGYG 1R8EA 5KLVJ 3F5HA 1CZQA 2N9YB 3H1LJ 2R32A 1PP9G 2AEMA 3KXDA 5AW2B 2LXBA 2KP8A 1SQXD 1NO4A 3LW5J 4GOEA 3G4SP 1NTKK 3H1KG 2A45H 1PPJG 1RE4C 2IYOA 2O1KA 1BCCG 2YO2A 3B5ND 3CWBJ 1QL1A 1PZQA 2GUVA 2R5DA 2M0BA 1NTMK 2K9YA 2FYUD 2WVRA 3PRJA 4U3FG 3CPWO 5KLVK 1GU4A 1KYOH 2PP6A 2WSCJ 2KSJA 1PL5A 3L70E 1KZUB 1FDIA 3O6QA 2XZRA 3HE5A 4PV1B 4ZKUA 1IK7A 3P8CE 1LT9B 5AW3B 1JMMA 1HVVA 2E43A 1VQNP 3CLQA 2J5UA 3KYQA 4I2LC 5APYA 2W83C 3H1JG 3QWOC 1VF5B 3L73J 2QM7A 3RK3D 1AJYA 2KI7B 1P84D 1SQQD 1HBWA 5APSA 5AW0B 1OW8A 2CPSA 3V2RA 1NOHA 4YXWH 4EIJA 3JC22 4ZKPA 3CC2P 1JY2N 1N73C 1SQVG 4D6TE 3MUDC 3PJSK 1EXIA 1YQ4C 1KILE 3MTUE 2E76D 3IF4A 1JY2O 1SQPE 2WWWA 4UB8H 1VQ4P 2WT7B 2Z5HA 3PTZA 2YIUC 2Q5UA 1RY3A 1N7SA 3EFFK 1LTTC 2H7HA 2OYHA 2K9JA 4IFMA 3RK3B 5L8RJ 1VQ5P 3AE5C 5AVZB 1VQLP 1HJ0A 1L0NG 1LJ2A 1MZ9A 1NU1G 3G9RA 3H32B 3WUTA 1VQKP 2ZT9B 3B5NA 1R5SA 4U3FD 1JO5A 3U1AA 1IFPA 1KQSO 1YBKA 2ZXXA 3HUSA 1RF1B 2KZIA 4JYCA 2YIUB 2ZYAA 3H1LE 4Z1MH 1NWQA 3T97A 1VQ6P 3FXDA 3M91A 4K3AA 2Y0DA 4UB8E 3RK3C 4EI2A 1KC8Q 1K8AQ 5CJ4A 1BCCE 2FXOA 2V7QH 3R4YA 4HB1A 3SFDC 4C7NA 2Q3IA 5KLVE 1YITP 2ZT9C 3S9OA 3CCEP 1L0NJ 3CCSP 1J1EC 2FYZA 1USDA 5APWA 1SVFA 1OWAA 2QSIA 1H88A 3BVHA 4BRYB 3H6PA 3V2PA 2PGDA 2XKMA 1RF0A 2PRRA 1GK4A 3V4QA 2HPCB 1NU1D 1BCCD 1N73B 1K04A 2W6BA 3CWBE 3Q2YA 1QEXA 1URQC 3H1KD 1T3JA 3SWKA 3U1CA 3HUSC 1DD4A 3GHGB 4BXLA 4LLHA 3V2NA 1L0LJ 1SQXJ 2LR2A 3B8EB 3PHLA 1Q2NA 1U57A 1D7MA 1LTBC 1VF5D 2NPSC 5APTA 4D6TG 5M1BA 4OWFA 4WY4D 1A02J 2KIKA 2OQQA 1KYOI 1OX3A 2XNXA 4KT0J 5CHXA 3A3YB 5BU5A 2QJKB 3I55P 3CXHE 3ZDMA 2M3BA 1SP4A 3GHGC 2J59M 3M0DA 2OTLP 2YXRB 1NTKD 1L0ND 1L4AD 1FZFA 4R4MA 4M3LA 1M1JA 1NAYA 3A7OA 4NPFX 2BEQD 2HPCA 1ZR2A 1FDMA 2YMYA 2R3CA 1HWTC 1FZAA 1RQUA 2PAJA 3MGNA 3H1HD 2WSSH 3CMAP 1GTWA 2H43A 2KS1B 2MKVA 2JWDA 1P84I 1SFCA 4IFFA 5KLIB 1BSHA 3H1IE 2M3EA 5C39A 3AE9C 3AEDC 5APQA 3PLNA 1E5WA 2HODA 2AXTE 3O8ZA 3TK1A 3B4SA 4N78D 4U3FJ 1PPJD 3SWFA 1H0TB 4EDFA 3HE4A 2JWAA 2W6AA 1M1KQ 2GA1A 1N7LA 4Y99B 1YIJP 1PP9D 1QL2A 1T2KC 1PV3A 5AVRB 2WSEH 5KLIC 3RL0g 3L72D 3GW6A 1KTMA 1S5LH 1EQ7A 2HLOA 1YTZT 1GW4A 3L73D 3RK2B 1EDKA 1M1JB 1VQMP 1L4AB 3V5BA 1SQBE 1UIXA 2D2CB 2N1TD 3P7KA 2D2CD 1KORA 1T6AA 3FXEA 5TISH 1SFCC 2JEEA 3CX5E 4WY4B 1RF0C 2QM8A 1LP1A 2E75B 2R3SA 1JUNA 1EZVE 2IFMA 2O3JA 2G3AA 5GTHH 3L74J 1OW7A 3TGUE 1M7LA 1BGYE 3RK2C 1M1JC 1NYHA 2HODB 2JR8A 2WPVB 1QX8A 3CX5I 5AVQB 1YTZI 5KAFE 2XV5A 4BRYA 3Q5PA 5DJTB 3W67A 4XFJA 1HGZA 3HD7B 4H0LB 2NZ2A 3D6ZA 2E75C 2HR3A 1T2KD 2G8YA 2Z4EA 3L74D 2BCCE 3MP7B 4KJMA 2GUSA 2A06E 4C7RA 2K1AA 1FC2C 3GHGA 4U3FE 1R5LA 2WSFJ 4LGDE 3BATA 5AVSB 3L74G 1HGVA 1S2EA 5TJHA 2ZYGA 2IBZD 2QG4A 2FBWC 2H8PD 4H0LC 3USSA 1CSBA 1GZLA 1ZV8A 2YMKA 2OTJP 3L71E 2KNCA 4ZNCA 1SFCD 3AE8C 1PIXA 3CCVP 3TSIA 3GMAA 5KLVD 2WZ7A 3NMDA 1Y9BA 2E75D 2JKVA 5AVYB 5AW1B 1H8AA 1T3UA 1T8ZA 2LXCB 1L0NK 1OMIA 1DD3A 1FZEA 1YJNP 1RE3C 1Q81Q 3CC4P 3CD6P 3E7KA 1EZVI 3H1LD 2W90A 5H2FH 3TNUB 1FJKA 2P10A 3E1RA 2BEZF 1NVOA 1LNQA 3BASA 1JCCA 3Q5SA 1NTMG 1EDIA 3L71D 3L35A 3L70G 1CI6B 2M8RA 1M57D 1OVRA 2DW3A 2WSEJ 2KS1A 2NPSD 1SQBG 2PFXA 4RJTA 5CCHA 1QVGO 4W7YA 3BCCG 1DEBA 2E5TA 3BRVB 3MHVA 4NPDA 2HFED 3WU2H 1KFMA 4UB6E 2V4HA 3P8MC 2FKWB 2RKLA 3VMAA 1AFOA 3L73E 4NPEA 1VQ9P 3L70D 2E74B 2Q9IA 1AQTA 4ASVA 1YYCA 3A0HH 1JMBA 2E76B 1SQXK 2KK7A 4H13D 4JPZB 3TGUG 2K9JB 2P7JA 2WITA 3RK3E 1FOSE 1OIPA 3TGUD 1JOCA 1ZRTD 2Q6QA 1LTJA 3ITKA 3L75J 2C0XA 1SQVK 4N3YB 3AE3C 3FGAD 5APUA 2KZJA 4I6MC 1RF1A 2AXCA 2FYNC 5B66H 3B71A 5KLVG 3CCLP 2A06D 2FXMA 1JY3N 1LTIC 3RL0C 2L5GB 5CMZA 4OVNF 5GTIE 2ITAA 1AVOA 2B88A 1PGPA 1JTHB 2BCCD 3L74E 4I1LA 3TGUJ 4C7NB 1KILD 1MFTA 1HF9A 3A5TA 1VPCA 3L72E 4PJ0H 5AW5B 3SWYA 3AE1C 1AQ5A 3L4FA 1LT9C 1KFNA 1K05A 1NTZJ 1NU1K 1PGQA 3C9IA 3L37A 4RKUJ 4N6JA 3VTPC 4EYYQ 1FZCB 3HD7A 1KYOE 1ZMEC 2M5AB 1MFZA 3NFQA 3B5NB 1LGHB 1LTGC 1EZVD 5AW9B 1W2EA 4Y28J 1S1CX 5APVA 3CX5D 2H89C 5KJ7D 2CK3H 3CC7P 1W5CE 1LTJB 2KLUA 3BRTB 1VF5C 3H1HJ 1GU5A 3VP9A 1KV4A 5AVUB 1LP1B 1NTKG 1KYOD 3FWNA 3P32A 2NPSA 4I7ZC 5AVTB 2IBZG 2KOGA 3H1HE 5AW6B 1IFIA 1NTZG 3B5NC 1YJWP 1NJIQ 1PFIA 2Q1KA 1WMKA 2WPRA 1JEKA 2O01N 3HE5B 3KPEA 1PGJA 3M9HA 3L75E 3CCQP 3N4XA 4O9BA 1E79H 1N7SC 1Q82Q 1JCDA 1SQQK 3AE6C 1NKNA 2AEFA 2KLVA 4WBAA 2XDJA 1YQ3C 4GT1A 2P2UA 4GKGA 4L76A 1FZCA 1DH3A 1FE6A 4QMAA 2WMMA 3MUDA 1BE3D 1NHLA 1ZRTE 3S1KA 1KILA 2WTYA 4L74A 4CPGA 3FX0A 4AUWA 3I5CA 3VMZA 1ZOYC 3AEFC 4W7ZA 2YKPA 3AE7C 5CCGA 4GODA 4AYCA 1RQVA 1VQ7P 3H1KE 1S5LE 5B66E 4JBZA 1KQFB 4PD4I 2FYUK 1EC5A 4L73A 2HYNA 1HJBA 2C9NY 1FU1A 1JNMA 2LKMA 2R5BA 4IL6H 2VRSA 2UWJE 1HUCA 5KAIH 1KB9D 4HJGH 3HE4B 1GD2E 2HG5D 1SQVE 1SS1A 1XTCC 1NTMJ 4GDOA 4DZOA 4DCKA 5KJ7C 2QJPB 3T97B 1HH0A 1GK6A 1NKZB 3H1IG 1HTLC 1YI2P 1W2BO 3D71A 4UB6H 2H88C 3VN0A 3WU2E 1S72P 1Y8AA 2FXPA 3CWBD 4C46A 3OAKA 1S4XA 1J1DC 4D6TD 3U59A 1U7MA 1N73A 2I1KA 4H13C 4DOJA 2E5YA 1SLQA 1LTAC 1H0TA 3CCRP 1YJ9P 1FDOA 4IL6E 1AA0A 5CCGD 1ZXGA 2I1JA 3E1IA 1P84H 1VQPP 2KUBA 2L91A 3M0AA 3M06A 2RMZA 3GG2A 3HRNA 1FAVA 2FYUG 4LC1A 3QH9A 4W80A 3M0DC 3M9BA 2O01J 2WPSA 4H13B 5AW8B 2JDIH 5APXA 2NRGA 2ZAEB 4U7JA 2FFDB 1PGOA 1FZGA 3OW2O 5H2FE 1S9KD 3M9QA 1FS0E 4WY4A 3EQ2A 3AEBC 2R44A 3TF5A 4KHXA 1SQVJ 1BGYD 1ZLLA 3BCCJ 4EOTA 1P84E 1SQQE 1VDFA 3RL0B 4PD4H 2WT7A 3NTNA 1G2CB 1RE4A 1SQXE 1SQBJ 1L0LK 3MZWB 2CPBA 4JF7A 1N7SD 2YNYA 1A02F 2QVAA
chains in the Genus database with same CATH topology
2SPZA 2OTKE 2P58A 2I8DA 2KZJA 1DEEG 4BXLA 5K5GB 2LR2A 2B88A 1Q2NA 1JM0A 1MFTA 2KIKA 2B87A 1BDDA 4EYYQ 1BDCA 3ZDMA 2M5AB 4NPFX 1S3JA 1LT1A 1LP1B 2KS1B 2K3RA 1U7JA 2JWDA 4GOFA 5C39A 2Q1KA 1EDLA 1H0TB 4ASWA 2LXBA 2WMMA 5EFWB 4GOEA 3S1KA 1EDKA 1X0TA 4CPGA 4ZMDA 3FXEA 2M0BA 1LP1A 4GODA 4JBZA 1EC5A 2B89A 1OVUA 2B87B 2UWJE 5DJTB 4HJGH 1SS1A 2HR3A 3QWOC 4K35A 2KI7B 4KJMA 1FC2C 5DJUB 5CBNA 1ZW0A 4ZNCA 1U7MA 1H0TA 1ZXGA 2KUBA 2LXCB 2M5AA 2KZIA 3PH0A 1NVOA 1EDIA 2ZAEB 1Y47A 3FXDA 4K3AA 1EDJA 1OVRA 4HB1A 5CBOA 4HKZH 3MHVA 2QRXA 4MN4C 4NPDA 2R44A 2RKLA 1OVVA 4NPEA 4WWIA 3RGUA 4ASVA 3MZWB 1JMBA 4IOIH 2QVAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2SPZ A;  2OTK E;  2P58 A;  2I8D A;  2KZJ A;  1DEE G;  4BXL A;  5K5G B;  2LR2 A;  2B88 A;  1Q2N A;  1JM0 A;  1MFT A;  2KIK A;  2B87 A;  1BDD A;  4EYY Q;  1BDC A;  3ZDM A;  2M5A B;  4NPF X;  1S3J A;  1LT1 A;  1LP1 B;  2KS1 B;  2K3R A;  1U7J A;  2JWD A;  4GOF A;  5C39 A;  2Q1K A;  1EDL A;  1H0T B;  4ASW A;  2LXB A;  2WMM A;  5EFW B;  4GOE A;  3S1K A;  1EDK A;  1X0T A;  4CPG A;  4ZMD A;  3FXE A;  2M0B A;  1LP1 A;  4GOD A;  4JBZ A;  1EC5 A;  2B89 A;  1OVU A;  2B87 B;  2UWJ E;  5DJT B;  4HJG H;  1SS1 A;  2HR3 A;  3QWO C;  4K35 A;  2KI7 B;  4KJM A;  1FC2 C;  5DJU B;  5CBN A;  1ZW0 A;  4ZNC A;  1U7M A;  1H0T A;  1ZXG A;  2KUB A;  2LXC B;  2M5A A;  2KZI A;  3PH0 A;  1NVO A;  1EDI A;  2ZAE B;  1Y47 A;  3FXD A;  4K3A A;  1EDJ A;  1OVR A;  4HB1 A;  5CBO A;  4HKZ H;  3MHV A;  2QRX A;  4MN4 C;  4NPD A;  2R44 A;  2RKL A;  1OVV A;  4NPE A;  4WWI A;  3RGU A;  4ASV A;  3MZW B;  1JMB A;  4IOI H;  2QVA A; 
#chains in the Genus database with same CATH topology
 2AXT H;  4H44 D;  5KTB A;  1NTZ D;  3H32 A;  5KAI E;  1SQP D;  1AVY A;  3N7N A;  2K37 A;  3CCJ P;  4IL6 X;  2YXQ B;  4Y99 C;  3CI9 A;  3EFG A;  3C1L A;  1BE3 G;  3HTK A;  3II6 A;  3CXH I;  1ZN5 A;  3TNU A;  1L4A C;  2J58 A;  3Q3D A;  2FFD A;  1SFC B;  1H89 A;  4GIF A;  1IO4 A;  2IBZ I;  1MV8 A;  1LWU C;  3CWB G;  2POH A;  1GW3 A;  5CJ0 A;  1BCC J;  3O6Q B;  3RBZ A;  2B87 A;  1GL2 A;  4DT0 A;  1J2J B;  2C0W A;  4RES B;  1S5L X;  3KQG A;  3VYI A;  2WPQ A;  1BDD A;  3WUV A;  1CW5 A;  3AE4 C;  2E74 D;  2A45 I;  2YKO A;  1TU3 F;  4PJ0 E;  4WB4 A;  3H1J D;  3IR9 A;  3Q1M A;  4HH2 A;  2P67 A;  3HD7 D;  3L71 J;  1LWU B;  1WT6 A;  3CL3 D;  3V2Q A;  3BCC E;  5TIS E;  3WMM 0;  5AVV B;  3CCU P;  1RF1 C;  2N1T C;  3KHU A;  3KZI H;  1JY2 P;  1S3J A;  1X79 B;  5B5E H;  3AEA C;  5BVZ A;  5KJ7 A;  1JY3 O;  3WUU A;  3C8V A;  4YTP C;  1PPJ E;  1J1E B;  1SQP K;  3JCU E;  1PP9 J;  2K3R A;  1U7J A;  1JY3 P;  2IYP A;  2W6J H;  2IX7 C;  3LID A;  4HYT B;  4PV1 D;  2OYI B;  2E42 A;  1SQV D;  1NTK J;  5BU8 B;  1DIP A;  2Z5I A;  1L0L E;  2N1T B;  1OFC X;  1Z56 A;  3NXS A;  3H1I D;  4XE5 B;  5E79 H;  1SQQ G;  2IZ1 A;  2QEX P;  1EDL A;  4H44 B;  4D6T J;  3GF3 A;  1SQX G;  3RBX A;  3PP5 A;  5AVW B;  3LW5 H;  1FBM A;  3I56 P;  2ZXE B;  3OJA B;  2OYI C;  4JQ0 D;  1M90 Q;  3HUS B;  3D70 A;  5EFW B;  3H1I J;  3Q5R A;  3VOP A;  3W68 A;  1URQ B;  1NTM D;  2KXP B;  3L36 A;  4XA4 A;  2OYH C;  2GM4 A;  1Q86 Q;  1X0T A;  1BE3 E;  1IFD A;  1MUU A;  1NTZ E;  2JO1 A;  1GL2 D;  2IPP A;  2WSC H;  3EWK A;  3F89 A;  4ZMD A;  1SQQ J;  2ZVO B;  5GTI H;  3H25 A;  3IN6 A;  3MD0 A;  3OA7 A;  4DJG A;  1GMJ A;  1KQL A;  2BCC J;  2NPS B;  1G1I A;  1OXZ A;  1K73 Q;  3S4R A;  2B89 A;  1Q90 D;  1OVU A;  2B87 B;  2N1T A;  2OYH B;  1WRG A;  3FWL A;  1FOS F;  3VMX A;  2V7Q J;  3CME P;  1IFM A;  2JJL A;  1EZV G;  2OYO A;  2Q7C A;  5AVX B;  3BCC D;  1S9K E;  2FY8 A;  1IFN A;  3A0B E;  4WVZ A;  3JSV C;  1NU1 E;  3SSU A;  1NTK E;  2WSF H;  2Y9Y A;  4YXD C;  1IK9 A;  2O01 H;  2XU6 A;  3H1K J;  4K35 A;  3L71 G;  3L72 J;  4L75 A;  4OH8 B;  3HTK B;  1CI6 A;  2FYN B;  2FYU J;  1KQG B;  3H1L G;  3L75 G;  2N9B A;  5DJU B;  4OGQ D;  5CBN A;  5KAF H;  2ZT9 D;  3VMY A;  1ZW0 A;  3R2P A;  1BGY J;  2P1J A;  1FZB A;  2ZVN B;  4PV1 C;  3RL0 D;  3TYY A;  2BCC G;  1GDT A;  2OYI A;  2XND H;  3UIA A;  2FFD C;  3V6I A;  1KB9 I;  2A06 G;  1G2C A;  1NAF A;  3G3Z A;  1XTG B;  2BAS A;  5KKZ C;  1KMI Z;  1JB0 J;  1L0L G;  2ZJS E;  1N8R Q;  1NGM B;  1VQ8 P;  2OGU A;  1QGK B;  1FZC C;  2YO3 A;  2M5A A;  3AEE C;  4RO0 A;  5CCH D;  1OW6 A;  4A7P A;  5GTH E;  1URQ D;  2MJZ A;  2C9L Y;  3A2A A;  1SQB K;  1X22 A;  2QE7 H;  2IZ0 A;  3IFM A;  3L70 J;  3PH0 A;  5KKZ B;  4H0L D;  1LTJ C;  3L73 G;  1DX7 A;  1Y47 A;  2IFN A;  2D2C C;  3H1J J;  1EDJ A;  2W8Z A;  2RN0 A;  1IJD B;  1ZR4 A;  1JTH A;  2KSE A;  4PD4 D;  4I7Z B;  4HKZ H;  2Y0E A;  2QRX A;  4MN4 C;  4WY4 C;  3TDK A;  5CBO A;  2WQY C;  4AQR D;  1OVV A;  1NTM E;  2KNC B;  2KB7 P;  4WWI A;  3RK2 D;  1RH5 B;  1M8O B;  2Y0C A;  3RGU A;  1YHQ P;  4BWN A;  1N7S B;  2KYV A;  3K5B A;  4IOI H;  2FYU E;  1PP9 E;  2SPZ A;  3HD7 C;  1M56 D;  3V4W A;  1LWU A;  2AEJ A;  3A0H E;  3IAO A;  5CCG C;  1K9M Q;  1LTS C;  2QIW A;  5CCH C;  1FJP A;  2OTK E;  4PD4 E;  1Q7Y Q;  4IFD K;  2P58 A;  1EXJ A;  1NTZ K;  2I8D A;  1NU1 J;  1L0L D;  1AV1 A;  1UII A;  3MIW A;  1L4A A;  4B86 A;  1QVF O;  3JCU H;  3L72 G;  3GLM A;  1DEE G;  1RHZ B;  4OGQ C;  5AW4 B;  1KD1 Q;  3P8C D;  3SFE C;  2OAR A;  3CX5 H;  5K5G B;  1SQB D;  3AE2 C;  3GF7 A;  1JM0 A;  1IC2 A;  2O1J A;  4YPC A;  1MKM A;  2Y9Z A;  1BSN A;  1X8Y A;  3L75 D;  3LIE A;  1KN7 A;  2IDB A;  1SQP J;  3CXH H;  3VP8 A;  3AEG C;  4OGQ B;  1BE3 J;  1IFJ A;  1BDC A;  2ZYD A;  3H1J E;  2JP3 A;  1N86 A;  3CXH D;  3CCM P;  5AW7 B;  4H44 C;  1QLE D;  2A45 G;  2IBZ E;  2RH0 A;  1URQ A;  2YKQ A;  1KB9 E;  2K88 A;  2QJP C;  1KIL B;  2QJY C;  3G6E P;  1G1J A;  3D6Y A;  2W27 A;  1IZN B;  1OZH A;  2ZFC A;  1GL2 C;  1LT1 A;  1NH4 A;  2QA4 P;  1USE A;  1VL2 A;  3KDP B;  1VQO P;  3G71 P;  1SQP G;  1J1D B;  1ZP0 C;  3ABV C;  2Q3E A;  4GOF A;  2E76 C;  2QJK C;  3H1H G;  5B5E E;  1KIL C;  1LT9 A;  1X9V A;  2E74 C;  2QJY B;  3AEC C;  2B9B A;  3KZI E;  1KB9 H;  1L0N E;  1L2P A;  1N2D C;  3A0B H;  1GL2 B;  4TLF A;  4JYB A;  4R4L A;  4N78 E;  4TT3 H;  1RE3 A;  5E79 E;  4ASW A;  1BGY G;  1R8E A;  5KLV J;  3F5H A;  1CZQ A;  2N9Y B;  3H1L J;  2R32 A;  1PP9 G;  2AEM A;  3KXD A;  5AW2 B;  2LXB A;  2KP8 A;  1SQX D;  1NO4 A;  3LW5 J;  4GOE A;  3G4S P;  1NTK K;  3H1K G;  2A45 H;  1PPJ G;  1RE4 C;  2IYO A;  2O1K A;  1BCC G;  2YO2 A;  3B5N D;  3CWB J;  1QL1 A;  1PZQ A;  2GUV A;  2R5D A;  2M0B A;  1NTM K;  2K9Y A;  2FYU D;  2WVR A;  3PRJ A;  4U3F G;  3CPW O;  5KLV K;  1GU4 A;  1KYO H;  2PP6 A;  2WSC J;  2KSJ A;  1PL5 A;  3L70 E;  1KZU B;  1FDI A;  3O6Q A;  2XZR A;  3HE5 A;  4PV1 B;  4ZKU A;  1IK7 A;  3P8C E;  1LT9 B;  5AW3 B;  1JMM A;  1HVV A;  2E43 A;  1VQN P;  3CLQ A;  2J5U A;  3KYQ A;  4I2L C;  5APY A;  2W83 C;  3H1J G;  3QWO C;  1VF5 B;  3L73 J;  2QM7 A;  3RK3 D;  1AJY A;  2KI7 B;  1P84 D;  1SQQ D;  1HBW A;  5APS A;  5AW0 B;  1OW8 A;  2CPS A;  3V2R A;  1NOH A;  4YXW H;  4EIJ A;  3JC2 2;  4ZKP A;  3CC2 P;  1JY2 N;  1N73 C;  1SQV G;  4D6T E;  3MUD C;  3PJS K;  1EXI A;  1YQ4 C;  1KIL E;  3MTU E;  2E76 D;  3IF4 A;  1JY2 O;  1SQP E;  2WWW A;  4UB8 H;  1VQ4 P;  2WT7 B;  2Z5H A;  3PTZ A;  2YIU C;  2Q5U A;  1RY3 A;  1N7S A;  3EFF K;  1LTT C;  2H7H A;  2OYH A;  2K9J A;  4IFM A;  3RK3 B;  5L8R J;  1VQ5 P;  3AE5 C;  5AVZ B;  1VQL P;  1HJ0 A;  1L0N G;  1LJ2 A;  1MZ9 A;  1NU1 G;  3G9R A;  3H32 B;  3WUT A;  1VQK P;  2ZT9 B;  3B5N A;  1R5S A;  4U3F D;  1JO5 A;  3U1A A;  1IFP A;  1KQS O;  1YBK A;  2ZXX A;  3HUS A;  1RF1 B;  2KZI A;  4JYC A;  2YIU B;  2ZYA A;  3H1L E;  4Z1M H;  1NWQ A;  3T97 A;  1VQ6 P;  3FXD A;  3M91 A;  4K3A A;  2Y0D A;  4UB8 E;  3RK3 C;  4EI2 A;  1KC8 Q;  1K8A Q;  5CJ4 A;  1BCC E;  2FXO A;  2V7Q H;  3R4Y A;  4HB1 A;  3SFD C;  4C7N A;  2Q3I A;  5KLV E;  1YIT P;  2ZT9 C;  3S9O A;  3CCE P;  1L0N J;  3CCS P;  1J1E C;  2FYZ A;  1USD A;  5APW A;  1SVF A;  1OWA A;  2QSI A;  1H88 A;  3BVH A;  4BRY B;  3H6P A;  3V2P A;  2PGD A;  2XKM A;  1RF0 A;  2PRR A;  1GK4 A;  3V4Q A;  2HPC B;  1NU1 D;  1BCC D;  1N73 B;  1K04 A;  2W6B A;  3CWB E;  3Q2Y A;  1QEX A;  1URQ C;  3H1K D;  1T3J A;  3SWK A;  3U1C A;  3HUS C;  1DD4 A;  3GHG B;  4BXL A;  4LLH A;  3V2N A;  1L0L J;  1SQX J;  2LR2 A;  3B8E B;  3PHL A;  1Q2N A;  1U57 A;  1D7M A;  1LTB C;  1VF5 D;  2NPS C;  5APT A;  4D6T G;  5M1B A;  4OWF A;  4WY4 D;  1A02 J;  2KIK A;  2OQQ A;  1KYO I;  1OX3 A;  2XNX A;  4KT0 J;  5CHX A;  3A3Y B;  5BU5 A;  2QJK B;  3I55 P;  3CXH E;  3ZDM A;  2M3B A;  1SP4 A;  3GHG C;  2J59 M;  3M0D A;  2OTL P;  2YXR B;  1NTK D;  1L0N D;  1L4A D;  1FZF A;  4R4M A;  4M3L A;  1M1J A;  1NAY A;  3A7O A;  4NPF X;  2BEQ D;  2HPC A;  1ZR2 A;  1FDM A;  2YMY A;  2R3C A;  1HWT C;  1FZA A;  1RQU A;  2PAJ A;  3MGN A;  3H1H D;  2WSS H;  3CMA P;  1GTW A;  2H43 A;  2KS1 B;  2MKV A;  2JWD A;  1P84 I;  1SFC A;  4IFF A;  5KLI B;  1BSH A;  3H1I E;  2M3E A;  5C39 A;  3AE9 C;  3AED C;  5APQ A;  3PLN A;  1E5W A;  2HOD A;  2AXT E;  3O8Z A;  3TK1 A;  3B4S A;  4N78 D;  4U3F J;  1PPJ D;  3SWF A;  1H0T B;  4EDF A;  3HE4 A;  2JWA A;  2W6A A;  1M1K Q;  2GA1 A;  1N7L A;  4Y99 B;  1YIJ P;  1PP9 D;  1QL2 A;  1T2K C;  1PV3 A;  5AVR B;  2WSE H;  5KLI C;  3RL0 g;  3L72 D;  3GW6 A;  1KTM A;  1S5L H;  1EQ7 A;  2HLO A;  1YTZ T;  1GW4 A;  3L73 D;  3RK2 B;  1EDK A;  1M1J B;  1VQM P;  1L4A B;  3V5B A;  1SQB E;  1UIX A;  2D2C B;  2N1T D;  3P7K A;  2D2C D;  1KOR A;  1T6A A;  3FXE A;  5TIS H;  1SFC C;  2JEE A;  3CX5 E;  4WY4 B;  1RF0 C;  2QM8 A;  1LP1 A;  2E75 B;  2R3S A;  1JUN A;  1EZV E;  2IFM A;  2O3J A;  2G3A A;  5GTH H;  3L74 J;  1OW7 A;  3TGU E;  1M7L A;  1BGY E;  3RK2 C;  1M1J C;  1NYH A;  2HOD B;  2JR8 A;  2WPV B;  1QX8 A;  3CX5 I;  5AVQ B;  1YTZ I;  5KAF E;  2XV5 A;  4BRY A;  3Q5P A;  5DJT B;  3W67 A;  4XFJ A;  1HGZ A;  3HD7 B;  4H0L B;  2NZ2 A;  3D6Z A;  2E75 C;  2HR3 A;  1T2K D;  2G8Y A;  2Z4E A;  3L74 D;  2BCC E;  3MP7 B;  4KJM A;  2GUS A;  2A06 E;  4C7R A;  2K1A A;  1FC2 C;  3GHG A;  4U3F E;  1R5L A;  2WSF J;  4LGD E;  3BAT A;  5AVS B;  3L74 G;  1HGV A;  1S2E A;  5TJH A;  2ZYG A;  2IBZ D;  2QG4 A;  2FBW C;  2H8P D;  4H0L C;  3USS A;  1CSB A;  1GZL A;  1ZV8 A;  2YMK A;  2OTJ P;  3L71 E;  2KNC A;  4ZNC A;  1SFC D;  3AE8 C;  1PIX A;  3CCV P;  3TSI A;  3GMA A;  5KLV D;  2WZ7 A;  3NMD A;  1Y9B A;  2E75 D;  2JKV A;  5AVY B;  5AW1 B;  1H8A A;  1T3U A;  1T8Z A;  2LXC B;  1L0N K;  1OMI A;  1DD3 A;  1FZE A;  1YJN P;  1RE3 C;  1Q81 Q;  3CC4 P;  3CD6 P;  3E7K A;  1EZV I;  3H1L D;  2W90 A;  5H2F H;  3TNU B;  1FJK A;  2P10 A;  3E1R A;  2BEZ F;  1NVO A;  1LNQ A;  3BAS A;  1JCC A;  3Q5S A;  1NTM G;  1EDI A;  3L71 D;  3L35 A;  3L70 G;  1CI6 B;  2M8R A;  1M57 D;  1OVR A;  2DW3 A;  2WSE J;  2KS1 A;  2NPS D;  1SQB G;  2PFX A;  4RJT A;  5CCH A;  1QVG O;  4W7Y A;  3BCC G;  1DEB A;  2E5T A;  3BRV B;  3MHV A;  4NPD A;  2HFE D;  3WU2 H;  1KFM A;  4UB6 E;  2V4H A;  3P8M C;  2FKW B;  2RKL A;  3VMA A;  1AFO A;  3L73 E;  4NPE A;  1VQ9 P;  3L70 D;  2E74 B;  2Q9I A;  1AQT A;  4ASV A;  1YYC A;  3A0H H;  1JMB A;  2E76 B;  1SQX K;  2KK7 A;  4H13 D;  4JPZ B;  3TGU G;  2K9J B;  2P7J A;  2WIT A;  3RK3 E;  1FOS E;  1OIP A;  3TGU D;  1JOC A;  1ZRT D;  2Q6Q A;  1LTJ A;  3ITK A;  3L75 J;  2C0X A;  1SQV K;  4N3Y B;  3AE3 C;  3FGA D;  5APU A;  2KZJ A;  4I6M C;  1RF1 A;  2AXC A;  2FYN C;  5B66 H;  3B71 A;  5KLV G;  3CCL P;  2A06 D;  2FXM A;  1JY3 N;  1LTI C;  3RL0 C;  2L5G B;  5CMZ A;  4OVN F;  5GTI E;  2ITA A;  1AVO A;  2B88 A;  1PGP A;  1JTH B;  2BCC D;  3L74 E;  4I1L A;  3TGU J;  4C7N B;  1KIL D;  1MFT A;  1HF9 A;  3A5T A;  1VPC A;  3L72 E;  4PJ0 H;  5AW5 B;  3SWY A;  3AE1 C;  1AQ5 A;  3L4F A;  1LT9 C;  1KFN A;  1K05 A;  1NTZ J;  1NU1 K;  1PGQ A;  3C9I A;  3L37 A;  4RKU J;  4N6J A;  3VTP C;  4EYY Q;  1FZC B;  3HD7 A;  1KYO E;  1ZME C;  2M5A B;  1MFZ A;  3NFQ A;  3B5N B;  1LGH B;  1LTG C;  1EZV D;  5AW9 B;  1W2E A;  4Y28 J;  1S1C X;  5APV A;  3CX5 D;  2H89 C;  5KJ7 D;  2CK3 H;  3CC7 P;  1W5C E;  1LTJ B;  2KLU A;  3BRT B;  1VF5 C;  3H1H J;  1GU5 A;  3VP9 A;  1KV4 A;  5AVU B;  1LP1 B;  1NTK G;  1KYO D;  3FWN A;  3P32 A;  2NPS A;  4I7Z C;  5AVT B;  2IBZ G;  2KOG A;  3H1H E;  5AW6 B;  1IFI A;  1NTZ G;  3B5N C;  1YJW P;  1NJI Q;  1PFI A;  2Q1K A;  1WMK A;  2WPR A;  1JEK A;  2O01 N;  3HE5 B;  3KPE A;  1PGJ A;  3M9H A;  3L75 E;  3CCQ P;  3N4X A;  4O9B A;  1E79 H;  1N7S C;  1Q82 Q;  1JCD A;  1SQQ K;  3AE6 C;  1NKN A;  2AEF A;  2KLV A;  4WBA A;  2XDJ A;  1YQ3 C;  4GT1 A;  2P2U A;  4GKG A;  4L76 A;  1FZC A;  1DH3 A;  1FE6 A;  4QMA A;  2WMM A;  3MUD A;  1BE3 D;  1NHL A;  1ZRT E;  3S1K A;  1KIL A;  2WTY A;  4L74 A;  4CPG A;  3FX0 A;  4AUW A;  3I5C A;  3VMZ A;  1ZOY C;  3AEF C;  4W7Z A;  2YKP A;  3AE7 C;  5CCG A;  4GOD A;  4AYC A;  1RQV A;  1VQ7 P;  3H1K E;  1S5L E;  5B66 E;  4JBZ A;  1KQF B;  4PD4 I;  2FYU K;  1EC5 A;  4L73 A;  2HYN A;  1HJB A;  2C9N Y;  1FU1 A;  1JNM A;  2LKM A;  2R5B A;  4IL6 H;  2VRS A;  2UWJ E;  1HUC A;  5KAI H;  1KB9 D;  4HJG H;  3HE4 B;  1GD2 E;  2HG5 D;  1SQV E;  1SS1 A;  1XTC C;  1NTM J;  4GDO A;  4DZO A;  4DCK A;  5KJ7 C;  2QJP B;  3T97 B;  1HH0 A;  1GK6 A;  1NKZ B;  3H1I G;  1HTL C;  1YI2 P;  1W2B O;  3D71 A;  4UB6 H;  2H88 C;  3VN0 A;  3WU2 E;  1S72 P;  1Y8A A;  2FXP A;  3CWB D;  4C46 A;  3OAK A;  1S4X A;  1J1D C;  4D6T D;  3U59 A;  1U7M A;  1N73 A;  2I1K A;  4H13 C;  4DOJ A;  2E5Y A;  1SLQ A;  1LTA C;  1H0T A;  3CCR P;  1YJ9 P;  1FDO A;  4IL6 E;  1AA0 A;  5CCG D;  1ZXG A;  2I1J A;  3E1I A;  1P84 H;  1VQP P;  2KUB A;  2L91 A;  3M0A A;  3M06 A;  2RMZ A;  3GG2 A;  3HRN A;  1FAV A;  2FYU G;  4LC1 A;  3QH9 A;  4W80 A;  3M0D C;  3M9B A;  2O01 J;  2WPS A;  4H13 B;  5AW8 B;  2JDI H;  5APX A;  2NRG A;  2ZAE B;  4U7J A;  2FFD B;  1PGO A;  1FZG A;  3OW2 O;  5H2F E;  1S9K D;  3M9Q A;  1FS0 E;  4WY4 A;  3EQ2 A;  3AEB C;  2R44 A;  3TF5 A;  4KHX A;  1SQV J;  1BGY D;  1ZLL A;  3BCC J;  4EOT A;  1P84 E;  1SQQ E;  1VDF A;  3RL0 B;  4PD4 H;  2WT7 A;  3NTN A;  1G2C B;  1RE4 A;  1SQX E;  1SQB J;  1L0L K;  3MZW B;  2CPB A;  4JF7 A;  1N7S D;  2YNY A;  1A02 F;  2QVA A; 
#chains in the Genus database with same CATH homology
 2SPZ A;  2OTK E;  2P58 A;  2I8D A;  2KZJ A;  1DEE G;  4BXL A;  5K5G B;  2LR2 A;  2B88 A;  1Q2N A;  1JM0 A;  1MFT A;  2KIK A;  2B87 A;  1BDD A;  4EYY Q;  1BDC A;  3ZDM A;  2M5A B;  4NPF X;  1S3J A;  1LT1 A;  1LP1 B;  2KS1 B;  2K3R A;  1U7J A;  2JWD A;  4GOF A;  5C39 A;  2Q1K A;  1EDL A;  1H0T B;  4ASW A;  2LXB A;  2WMM A;  5EFW B;  4GOE A;  3S1K A;  1EDK A;  1X0T A;  4CPG A;  4ZMD A;  3FXE A;  2M0B A;  1LP1 A;  4GOD A;  4JBZ A;  1EC5 A;  2B89 A;  1OVU A;  2B87 B;  2UWJ E;  5DJT B;  4HJG H;  1SS1 A;  2HR3 A;  3QWO C;  4K35 A;  2KI7 B;  4KJM A;  1FC2 C;  5DJU B;  5CBN A;  1ZW0 A;  4ZNC A;  1U7M A;  1H0T A;  1ZXG A;  2KUB A;  2LXC B;  2M5A A;  2KZI A;  3PH0 A;  1NVO A;  1EDI A;  2ZAE B;  1Y47 A;  3FXD A;  4K3A A;  1EDJ A;  1OVR A;  4HB1 A;  5CBO A;  4HKZ H;  3MHV A;  2QRX A;  4MN4 C;  4NPD A;  2R44 A;  2RKL A;  1OVV A;  4NPE A;  4WWI A;  3RGU A;  4ASV A;  3MZW B;  1JMB A;  4IOI H;  2QVA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...