2H43A

Crystal structure of human fragment d complexed with ala-his-arg-pro-amide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrinogen alpha chain
publication title Differences in Binding Specificity for the Homologous gamma- and beta-Chain "Holes" on Fibrinogen: Exclusive Binding of Ala-His-Arg-Pro-amide by the beta-Chain Hole.
pubmed doi rcsb
total genus 24
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2h43A00
1FZFA 2Z4EA 2OYHC 1N73A 1T3UA 3E1IA 3HUSB 1RF1C 3H32A 2FFDB 1JY2P 1RF0A 1N73C 1FZCB 2HPCB 1M1JB 1JY2N 2FFDA 1LWUB 1JY3P 3GHGB 1N86A 3HUSA 2H43A 1RF0C 2A45I 2Q9IA 2OYIB 3BVHA 1LTJB 2XNXA 1FZGA 1FZBA 1JY3N 2FFDC 2HPCA 1LT9B 3HUSC 1LWUA 1W2EA 1FZCA 1M1JA 2OYHB 1FZAA 3GHGA 2HODB 1LTJA 2OYIA 1RE3A 1RE4A 1RF1A 2A45G 1RF1B 1LWUC 1JY2O 1LT9A 1M1JC 1FZCC 2HODA 3GHGC 2OYHA 1LTJC 3H32B 2OYIC 1RE3C 1RE4C 2HLOA 1N73B 1JY3O 1LT9C 2A45H 1FZEA
chains in the Genus database with same CATH superfamily
1PZQA 1URQA 1RF1C 2GM4A 4EYYQ 1URQC 1SQXD 5BU8B 2N9YB 1NU1D 1FJKA 2KNCB 2BEQD 3Q5SA 3H1JG 3O6QB 3TNUA 1JCCA 3RL0g 1QVFO 2HYNA 3VMZA 5AW5B 1PPJE 3VTPC 1OW7A 1AQTA 1LP1B 3BVHA 5CCGA 1ZR2A 4L76A 3II6A 1PGQA 5CCGC 3D70A 4N78D 1ZLLA 1QLED 1IFDA 2O01H 4IL6H 3M91A 2YXQB 2E76C 2FYUD 4EI2A 4O9BA 1GL2D 1J1DB 2BCCG 3BCCE 3RL0B 1S5LX 4B86A 1KB9H 3L72J 1NTZE 3MD0A 1R5SA 5E79H 4GKGA 4DCKA 2HODA 2Y9YA 2M3BA 4ASWA 4BXLA 2PFXA 1PPJG 2W8ZA 2N1TB 5CBOA 1LTJB 1RHZB 2OTLP 4EOTA 1R5LA 4L74A 2R5BA 3IN6A 1SQQK 3IF4A 1K05A 4TT3H 1HUCA 1NAYA 3CWBG 1ZV8A 2CK3H 2SPZA 3HUSA 1X8YA 3PJSK 2FYNC 1NTZG 3HUSC 3L74E 1JO5A 1GW4A 3HD7D 3L72D 5APVA 2O01N 2IX7C 1YJWP 1FC2C 3GG2A 5KLVG 1SQQD 4HKZH 1GK6A 3AE5C 1XTCC 3HTKA 1KILA 3H1LE 3SFEC 4WY4B 2HR3A 1KB9I 1KILC 1S1CX 1H8AA 1NKZB 1R8EA 3N7NA 2I1KA 3MP7B 1ZRTE 1OZHA 2YO2A 3H1KE 3M9BA 1RQUA 2M8RA 2MJZA 1KB9D 1OVVA 1QGKB 2P7JA 1HGZA 3TYYA 1M57D 3L75J 2K9JA 4H13C 2FKWB 3I56P 3RK3D 3CCSP 2JO1A 2WPRA 3GF3A 5EFWB 1KD1Q 5TISH 1PGJA 1WRGA 2M3EA 1MUUA 2J59M 2XNXA 1FZBA 2VRSA 2KK7A 3CCRP 2Q3EA 1NVOA 1SQVK 1N7SD 1OVUA 1OVRA 4JPZB 1WMKA 1VF5C 1NTKG 2KIKA 1BDDA 3Q3DA 2HG5D 3TNUB 4C7RA 4GIFA 1RE3A 1RY3A 1RE3C 4L75A 5K5GB 2ZYDA 3A3YB 3KZIE 5AVQB 1NU1E 3E1IA 3L75D 3D6ZA 2A45I 3B71A 2E76B 1SQVD 3VOPA 4WVZA 2OYHB 5BU5A 2AXTH 2KP8A 1N73B 2E5TA 3W68A 3FGAD 2J5UA 4W7YA 2KXPB 3I5CA 3RGUA 4N78E 1FZCB 1N86A 3S1KA 4HYTB 1X79B 1USEA 2JEEA 2HODB 1DEEG 3Q5PA 3M9QA 3VP9A 2JJLA 2AEFA 1VQOP 3KQGA 2A06D 2C9LY 1QL2A 1HJ0A 4H44D 1IC2A 2WTYA 3CC7P 1BSHA 3CMAP 1IK7A 1LWUA 5CCHA 5AW9B 1MFTA 5AVSB 5B5EE 1LWUC 5CCHC 3D71A 1IZNB 1Q90D 3M0DA 1CW5A 3HUSB 1LTTC 2WPQA 1FBMA 3L70G 3M0DC 4KJMA 4OWFA 3D6YA 1M7LA 3CPWO 3CXHH 4HJGH 3KYQA 1GTWA 2Z5IA 2Q3IA 2IBZE 1VPCA 5AW6B 1L4AA 2ZYAA 1L4AC 1YI2P 1AV1A 1E79H 3T97B 3HTKB 1GZLA 3C9IA 3L72E 2IPPA 2R3SA 3HD7B 3WUTA 3S4RA 1JEKA 1X22A 3ABVC 2NZ2A 3CCJP 3TGUG 3RK2D 3AECC 1SQQE 2K9YA 3OA7A 1BCCD 1JUNA 1ZOYC 1JMMA 3RL0D 2K9JB 4D6TE 1NAFA 2OYIA 4IL6E 4I6MC 3BASA 1T8ZA 3BRVB 1BSNA 2OYIC 1QEXA 2O1KA 1KB9E 1GU4A 3CX5H 1LTSC 1AVOA 3CD6P 1VQ5P 1LTAC 3F89A 2N1TD 4JBZA 3G4SP 3RK3E 1BE3G 5E79E 1VF5B 3HE5A 1L0NK 2E74C 3N4XA 2Y0EA 1FJPA 3EFGA 3RBXA 4DZOA 2KLUA 1FOSE 3IFMA 3CXHI 2E42A 2E75C 2R44A 3NMDA 5H2FH 2QM8A 4N6JA 1YTZI 5CJ0A 1AA0A 1VQNP 3RBZA 1LT9A 3CXHD 3Q1MA 1JMBA 1IJDB 1KYOH 1LT9C 3O8ZA 1KQSO 2IYPA 3P8CD 1NTKJ 5AW8B 2Y0CA 3U59A 3GMAA 5CHXA 5AVTB 1NTMJ 1L0ND 1M90Q 3LW5H 4IOIH 3CC2P 3VYIA 3L75E 1X9VA 5AW1B 3VP8A 4WY4D 1SQVE 2PRRA 1LJ2A 1NTMK 1LGHB 2KZIA 4ZKUA 1IFJA 3AEGC 2O3JA 3CX5I 2Z4EA 1KMIZ 4OVNF 1CSBA 1J1EC 3CX5D 2P10A 1DD4A 5C39A 2AEJA 1NTKD 1SQXK 3I55P 1EDJA 1S4XA 2A06E 1RQVA 1JY3O 2JWDA 1NTMD 5TISE 3TK1A 1URQD 2K3RA 2O1JA 5APYA 4L73A 3H1HG 4U3FG 2C9NY 1KYOI 4Y99C 1H88A 1HTLC 3L71G 2I8DA 1EXIA 1L4AB 3L70J 5CJ4A 1KYOD 1GU5A 3GW6A 1T3JA 2FYUK 5APSA 5CCGD 4CPGA 1NKNA 1BGYG 3KXDA 1DX7A 1JY2O 2E76D 1SQPG 1TU3F 1MV8A 1W5CE 3CLQA 2B9BA 4H0LB 3CCMP 2QRXA 1H0TB 4EIJA 4TLFA 1OMIA 2AXTE 2OYIB 1EC5A 4RJTA 4IFMA 1FZAA 5B66H 4W7ZA 3SSUA 5GTIH 1OIPA 1EZVG 3TGUJ 1BCCE 3V2RA 3RK2B 3OW2O 2YKOA 2IZ1A 5APXA 4BWNA 1JY3P 2XV5A 2E74B 4C46A 4JQ0D 1D7MA 3JCUH 2XKMA 1RH5B 2WSEH 1G2CA 3QH9A 4I7ZC 2WT7B 1OXZA 2ITAA 1T6AA 1BE3J 2OTKE 2OGUA 5DJUB 1FS0E 1KZUB 5KJ7A 1ZP0C 1L0LJ 2K1AA 1XTGB 5KJ7C 2BEZF 2KOGA 1JY2P 2NPSA 3BCCG 1MKMA 3TGUD 1FDOA 2NPSC 3CXHE 1L0LK 1K9MQ 2QJKC 1S9KD 3G71P 2WSEJ 1KILD 1NYHA 3P8CE 2LKMA 2K37A 5CMZA 1A02J 3MIWA 3PTZA 2FYZA 3MZWB 3B5NA 3NTNA 1L0NE 3B5NC 2FFDA 1IK9A 1DD3A 2W6JH 2FFDC 3L36A 2QJYB 3WUVA 4H13D 1LT1A 4C7NB 2YO3A 1J1EB 1SQBJ 1HGVA 2A45H 5M1BA 5APQA 1HWTC 2R32A 1KV4A 3A0HH 1ZR4A 1L0LD 2W6AA 3Q5RA 1EDLA 1SQBK 3L74G 1EDKA 3WU2H 1PP9J 3CX5E 4Y99B 3L4FA 1VF5D 4RO0A 5L8RJ 2AXCA 1G1IA 4UB6H 3L73J 1NTME 1CZQA 1RF1B 2QJPC 2WVRA 3H1LG 1URQB 2IYOA 1KFMA 2P1JA 1U7MA 5H2FE 3V5BA 1VQKP 3H1IE 4U3FJ 1SQBD 3H1KG 1ZN5A 3ZDMA 3HRNA 3L71J 3TSIA 1FDIA 2KSJA 1KYOE 1USDA 1AFOA 1SQXE 2J58A 5KTBA 1KN7A 4M3LA 1KQGB 4UB8H 1A02F 2ZT9C 1PP9D 5KLIC 4ZKPA 1DH3A 2I1JA 1NH4A 2Y9ZA 2OARA 4DT0A 3H1JJ 4AUWA 2RMZA 2D2CC 1DIPA 1Q2NA 3AEAC 1YQ4C 3JSVC 3L73D 1Q82Q 1JTHA 3H1IG 4PD4H 3V2QA 1EQ7A 5AW3B 2LXBA 1PL5A 2FYUE 4U3FD 1G2CB 3AE8C 2WPVB 4ASVA 3E1RA 1HVVA 1NU1G 3VMXA 3W67A 2BCCJ 4RKUJ 1VQ4P 4YXDC 2OYOA 2YIUC 3WMM0 2FXOA 3CC4P 1LTIC 2H7HA 3Q2YA 2XDJA 4GOEA 2NPSB 1FZEA 1L4AD 1T3UA 2FYNB 2QJKB 3H1JD 4LGDE 3TDKA 4IL6X 1Y47A 1OW8A 1P84I 2YMYA 3PLNA 3TF5A 2RH0A 3B5NB 2DW3A 1K73Q 2ZJSE 2WSSH 3MUDA 3CCQP 3CWBJ 3AEDC 3BCCJ 3MUDC 1S72P 1P84D 4H0LD 3USSA 1NTZJ 1S2EA 1KILB 2BCCD 2HPCA 4PD4I 3PHLA 1LTGC 2N9BA 1S5LH 1NTZK 3H32A 2ZAEB 2V7QJ 4PD4D 5B66E 5KLVJ 1Q7YQ 1PPJD 1NJIQ 4OGQC 4H13B 5GTIE 3AE2C 4ZNCA 4PV1C 2E74D 1LTBC 1VL2A 3C8VA 1IFPA 1L0LE 3AE9C 2IBZG 3O6QA 1VQ8P 2R5DA 2KUBA 5KLVK 3FXDA 1SFCA 2QJPB 3CWBD 1SFCC 4W80A 1FZGA 3L72G 1LNQA 1Q81Q 4ZMDA 1NTZD 1FU1A 2G8YA 1SQQG 2C0WA 5AVWB 1YJNP 5APWA 1IFNA 1QL1A 3SFDC 1J1DC 3M9HA 4D6TG 1K8AQ 1NOHA 1YBKA 5KLVD 2ZT9B 5KLIB 1E5WA 1SQBE 1N8RQ 2WQYC 5GTHH 3H1KJ 2H88C 1JCDA 3B8EB 2D2CB 2H43A 1LTJA 2ZXEB 4K3AA 3SWYA 3ITKA 3H6PA 1LTJC 1JTHB 1NTKK 1KQLA 3BATA 3JC22 1T2KC 1PP9E 3SWFA 3HE4A 4XA4A 1UIIA 1GDTA 4WWIA 1PIXA 4OH8B 4LC1A 1IO4A 3L73E 3S9OA 1GW3A 3A0BH 3P7KA 2PAJA 4RESB 2YIUB 3A0HE 4GOFA 1YTZT 1JOCA 2WITA 4KHXA 4AYCA 3AE1C 5AW4B 1OWAA 1LWUB 3VMAA 5KKZC 4YPCA 3WU2E 4EDFA 1VQ7P 4R4LA 2WPSA 3H1KD 2GUSA 2R3CA 2AEMA 1HF9A 3L75G 2YXRB 2WWWA 4XE5B 1PFIA 1SQVG 1RF0A 4UB6E 1YJ9P 5APUA 1N7LA 1RF0C 2L5GB 1ZMEC 5AVUB 1EXJA 1HJBA 3BRTB 3H1JE 3MHVA 3AE7C 3CMEP 4JYCA 3M0AA 3A2AA 3CL3D 3EFFK 3KHUA 2HPCB 2JKVA 2P2UA 2QE7H 2WSCJ 2G3AA 1ZXGA 1EDIA 3R2PA 2A06G 3H32B 3M06A 3NXSA 4UB8E 4OGQB 1M56D 4PV1B 2H8PD 2BCCE 3V2NA 1NO4A 3EWKA 2M5AA 2ZVNB 5AVZB 3GF7A 5AVRB 3GHGA 1RE4A 3SWKA 2Y0DA 2W83C 1VQ9P 3GHGC 5AW2B 1M8OB 1RE4C 3K5BA 2QVAA 1SFCB 4NPDA 4PD4E 1U7JA 3A5TA 2NRGA 1SLQA 3AEFC 2Q1KA 1VQPP 3L70D 1WT6A 1W2EA 3HE5B 5KJ7D 2GA1A 2V4HA 2E75B 2OYHA 4Y28J 3FXEA 5DJTB 1YIJP 4U7JA 2OYHC 1N73A 3CWBE 1VQ6P 2NPSD 1N73C 4IFFA 2QEXP 1KORA 1LT9B 1FZCA 5TJHA 1OW6A 1FZCC 2YNYA 5AW7B 1BCCG 2FXPA 5KAFH 1SQQJ 3B5ND 3AE3C 1GL2A 2OQQA 3PP5A 4HH2A 1GL2C 2HFED 5KLVE 4D6TJ 2O01J 2WZ7A 2MKVA 3CCEP 2IBZI 1FE6A 1Z56A 2C0XA 2ZVOB 3HE4B 5KAIH 1Y9BA 4A7PA 2E43A 4GODA 4DOJA 2IBZD 3QWOC 1HH0A 1CI6A 1S5LE 3LIEA 1JB0J 2B87A 5KKZB 1BE3D 3OJAB 2QM7A 2POHA 4PJ0H 3E7KA 2KSEA 1PV3A 2XNDH 2P58A 1M1JA 3T97A 2H89C 1YITP 1SP4A 1M1JC 3HD7A 2GUVA 4D6TD 1AVYA 3HD7C 3AEEC 1UIXA 1L0NG 1NTKE 5AW0B 3NFQA 4GDOA 3U1CA 1KTMA 2QA4P 2RN0A 2KB7P 1SQVJ 2ZT9D 1YHQP 1QX8A 5AVYB 3H1HJ 4QMAA 1GMJA 1JY3N 3IR9A 2D2CD 1BDCA 3AE6C 1K04A 5GTHE 3G3ZA 2M5AB 3RK3C 1P84H 1VDFA 3R4YA 4HB1A 3GHGB 3UIAA 3FX0A 3CCLP 1BGYJ 1KC8Q 1NTMG 1M1KQ 1SQPJ 2W6BA 3MGNA 1IFMA 1N7SA 4KT0J 2CPSA 3FWLA 1N7SC 3P32A 1JY2N 1FOSF 1SQPK 3A0BE 3PRJA 5CCHD 1VQMP 1NWQA 3PH0A 3H1HD 4I7ZB 1MFZA 1GD2E 3V6IA 1SQXG 3L71D 1N2DC 5BVZA 4DJGA 3L70E 3IAOA 1JNMA 3CCUP 4LLHA 1U57A 5APTA 2JP3A 4Z1MH 4I1LA 3AEBC 2JDIH 4JF7A 2LXCB 1S3JA 1GL2B 2FBWC 1BGYD 1OFCX 2W90A 1SQPD 2KZJA 1EZVI 3V2PA 2ZFCA 2V7QH 3G6EP 2FYUG 1BCCJ 1W2BO 2HLOA 1AJYA 3LIDA 2XU6A 1L2PA 3TGUE 1YQ3C 2YMKA 2FFDB 1EZVD 2KS1A 1CI6B 1S9KE 4OGQD 3V4WA 4PV1D 1KILE 2UWJE 4H44C 4K35A 4YXWH 2B87B 3VN0A 1H89A 4BRYA 2Q6QA 1GK4A 1JM0A 1SFCD 1M1JB 2JWAA 3B4SA 3L35A 2KLVA 1BE3E 1G1JA 2KNCA 1YYCA 4R4MA 2BASA 4MN4C 2OTJP 2ZYGA 1FZFA 2PGDA 2E75D 2WSFH 1NHLA 3EQ2A 1H0TA 4H0LC 3V4QA 3JCUE 5AVVB 3L74J 4GT1A 3BCCD 1LP1A 1KQFB 3AE4C 2CPBA 2E5YA 1L0NJ 2FXMA 3RK2C 2LR2A 2B88A 1Y8AA 2B89A 1PGPA 3CI9A 4NPFX 2QIWA 3RL0C 2KYVA 1AQ5A 3H1LJ 5KAFE 3RK3B 1T2KD 2Z5HA 2WSFJ 2RKLA 1L0LG 3OAKA 3KDPB 2P67A 4NPEA 3G9RA 2WT7A 3CCVP 2IDBA 2W27A 2K88A 2N1TA 4WBAA 2M0BA 5KAIE 1Q86Q 1N7SB 2N1TC 1PGOA 3L74D 5CBNA 3FWNA 4AQRD 1FAVA 3KZIH 3WUUA 3MTUE 5AVXB 1VQLP 4PJ0E 1SQBG 3VMYA 3KPEA 4XFJA 2IFMA 3H1IJ 3C1LA 3H1LD 1NGMB 4IFDK 3H1HE 4U3FE 3GLMA 2L91A 1ZRTD 2IZ0A 2YKQA 1J2JB 3L71E 2JR8A 3A7OA 4JYBA 1QVGO 2QSIA 4N3YB 2WSCH 1SQXJ 4C7NA 1NU1J 1PP9G 2QG4A 2QJYC 3F5HA 4WY4A 1MZ9A 2PP6A 3LW5J 4WY4C 1OX3A 2Q9IA 3U1AA 1BGYE 1ZW0A 1NU1K 3L73G 2IFNA 2A45G 1SS1A 2Q5UA 2KI7B 1HBWA 1SQPE 1KFNA 1DEBA 2KS1B 5B5EH 4H44B 1SVFA 3H25A 3P8MC 2Q7CA 4WB4A 3L37A 2XZRA 2FY8A 1FDMA 1IFIA 4BRYB 3H1ID 2FYUJ 4I2LC 4YTPC 2ZXXA 1EZVE 2YKPA 2WMMA 1RF1A 1X0TA 1P84E
chains in the Genus database with same CATH topology
3EFGA 3OJAB 4DZOA 2QM7A 2POHA 1HVVA 1FOSE 3VMXA 1URQA 3IFMA 1RF1C 2GM4A 2E42A 1URQC 3NMDA 5BU8B 2QM8A 3WMM0 4N6JA 1FJKA 1YTZI 5CJ0A 1M1JA 3T97A 1LTIC 2H7HA 1SP4A 1LT9A 1M1JC 3HD7A 3TNUA 2GUVA 2XDJA 1IJDB 1JCCA 1LT9C 2NPSB 1FZEA 3O8ZA 3HD7C 2HYNA 1L4AD 1T3UA 3VMZA 5AW5B 3P8CD 4LGDE 5AW8B 3VTPC 3U59A 5AW0B 3NFQA 3U1CA 3BVHA 5CCGA 5CHXA 5AVTB 1ZR2A 3II6A 5CCGC 3LW5H 2YMYA 4N78D 1ZLLA 3B5NB 2KB7P 1IFDA 3VYIA 2O01H 1X9VA 5AW1B 3M91A 3MUDA 3VP8A 4WY4D 4O9BA 1GL2D 1J1DB 3RL0B 1NTMK 5AVYB 1LGHB 4B86A 1JY3N 1KILB 2HPCA 3IR9A 4ZKUA 1IFJA 3MD0A 1LTGC 2N9BA 3G3ZA 4GKGA 2HODA 2M3BA 2Z4EA 1NTZK 3H32A 3RK3C 1CSBA 1VDFA 1J1EC 2N1TB 3GHGB 3UIAA 1LTJB 4EOTA 1SQXK 1LTBC 2R5BA 2W6BA 1SQQK 3MGNA 1HUCA 1JY3O 1IFMA 3TK1A 1N7SA 1URQD 2R5DA 1ZV8A 5KLVK 2CPSA 2O1JA 1N7SC 1SFCA 3P32A 5APYA 1JY2N 1FOSF 3HUSA 1X8YA 1SQPK 1SFCC 2C9NY 4Y99C 4W80A 1FZGA 3HUSC 1H88A 1HTLC 5CCHD 1NWQA 1JO5A 1GW4A 3HD7D 1L4AB 1MFZA 1FU1A 1GD2E 5APVA 1N2DC 5CJ4A 1GU5A 2IX7C 5BVZA 1T3JA 1JNMA 2C0WA 5AVWB 5APWA 2FYUK 4LLHA 5APSA 5CCGD 1IFNA 1QL1A 5APTA 1J1DC 1GK6A 3M9HA 1NKNA 1XTCC 1NOHA 3HTKA 4I1LA 1KILA 1DX7A 1JY2O 4JF7A 1MV8A 4WY4B 1KILC 1GL2B 3CLQA 1E5WA 1H8AA 1NKZB 3N7NA 2I1KA 4EIJA 2YO2A 1JCDA 3B8EB 3M9BA 2H43A 2OYIB 2M8RA 2MJZA 3V2PA 2P7JA 4IFMA 1FZAA 2ZFCA 1HGZA 4W7ZA 1LTJA 2ZXEB 3TYYA 3SWYA 3H6PA 1LTJC 1JTHB 2HLOA 1NTKK 3RK2B 1KQLA 3V2RA 3BATA 2FKWB 2XU6A 3LIDA 3RK3D 1T2KC 2YKOA 2WPRA 3SWFA 2FFDB 3HE4A 1CI6B 4XA4A 1S9KE 5APXA 1WRGA 3V4WA 1MUUA 2J59M 1JY3P 2XV5A 1GDTA 4C46A 2XNXA 1FZBA 2VRSA 4OH8B 4LC1A 1IO4A 2XKMA 1GW3A 3VN0A 1H89A 1SQVK 3P7KA 2PAJA 4RESB 2WSEH 1N7SD 1G2CA 1GK4A 1YTZT 1JOCA 2WITA 2WT7B 1SFCD 4KHXA 4AYCA 5AW4B 1M1JB 1OWAA 1OXZA 1LWUB 3L35A 2HG5D 2KLVA 3TNUB 4C7RA 2WPSA 4GIFA 2GUSA 1RE3A 1KZUB 1G1JA 2R3CA 5KJ7A 1RY3A 1YYCA 1RE3C 1XTGB 5KJ7C 2BASA 2WWWA 4XE5B 1FZFA 3A3YB 5AVQB 2KOGA 3E1IA 2WSFH 1NHLA 1PFIA 1JY2P 1RF0A 2NPSA 3EQ2A 5APUA 1N7LA 1RF0C 2A45I 2NPSC 2L5GB 3V4QA 5AVUB 5AVVB 1L0LK 1S9KD 4GT1A 1HJBA 3BRTB 3VOPA 2OYHB 5BU5A 1KILD 2KP8A 3P8CE 2LKMA 1N73B 5CMZA 1A02J 3MIWA 4JYCA 2FYZA 3M0AA 2CPBA 3A2AA 3B5NA 3CL3D 3NTNA 2FXMA 4W7YA 3B5NC 2HPCB 3RK2C 2P2UA 3I5CA 2FFDA 4N78E 1IK9A 1N86A 1FZCB 4HYTB 1X79B 2JEEA 2FFDC 3L36A 3CI9A 3R2PA 2HODB 3RL0C 2KYVA 1AQ5A 4C7NB 3RK3B 1T2KD 3M9QA 3VP9A 2YO3A 2Z5HA 1J1EB 3H32B 2JJLA 1HGVA 3M06A 3OAKA 2A45H 3NXSA 3KDPB 2P67A 3KQGA 5APQA 2H8PD 1HWTC 2R32A 3V2NA 2C9LY 1NO4A 1ZR4A 1QL2A 2W6AA 2WT7A 1IC2A 2WTYA 5AVZB 5AVRB 1LWUA 1SQBK 2W27A 5CCHA 2N1TA 4WBAA 5AW9B 3GHGA 1RE4A 5AVSB 1LWUC 1N7SB 5CCHC 2N1TC 3GHGC 5AW2B 1RE4C 1SFCB 4Y99B 3L4FA 3M0DA 3A5TA 1CW5A 3HUSB 1LTTC 2WPQA 1FBMA 1SLQA 3M0DC 1G1IA 4AQRD 1FAVA 3MTUE 5AVXB 1WT6A 1W2EA 3HE5B 1M7LA 5KJ7D 1CZQA 1RF1B 3KYQA 1GTWA 2OYHA 1URQB 2Z5IA 2Q3IA 1VPCA 3VMYA 3KPEA 5AW6B 2IFMA 1N73A 2OYHC 1L4AA 1KFMA 2P1JA 3V5BA 2NPSD 1N73C 1L4AC 4IFFA 4IFDK 1ZN5A 3HTKB 1GZLA 3HRNA 3C9IA 3TSIA 1LT9B 2IPPA 2YKQA 1FZCA 3HD7B 1J2JB 4JYBA 3A7OA 2KSJA 4N3YB 2WSCH 1FZCC 1AFOA 2YNYA 5AW7B 4C7NA 2J58A 3B5ND 3RK2D 4WY4A 3OA7A 5KTBA 1GL2A 4M3LA 1MZ9A 2PP6A 1JUNA 4WY4C 3PP5A 1A02F 4HH2A 4ZKPA 1GL2C 2Q9IA 1JMMA 3RL0D 2HFED 1DH3A 2I1JA 1NH4A 2WZ7A 3U1AA 1NAFA 2OYIA 1NU1K 4I6MC 2OARA 2IFNA 3BASA 2A45G 4AUWA 1Z56A 2Q5UA 1HBWA 1T8ZA 3BRVB 2C0XA 2OYIC 1KFNA 1DEBA 3HE4B 2O1KA 1SVFA 1JTHA 3P8MC 2E43A 2Q7CA 1GU4A 4DOJA 4WB4A 3V2QA 1LTSC 1EQ7A 3L37A 5AW3B 1HH0A 2XZRA 1CI6A 1FDMA 1LTAC 1IFIA 2N1TD 4I2LC 3LIEA 1G2CB 3HE5A 1L0NK 2YKPA 3N4XA 1RF1A 1FJPA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZF A;  2Z4E A;  2OYH C;  1N73 A;  1T3U A;  3E1I A;  3HUS B;  1RF1 C;  3H32 A;  2FFD B;  1JY2 P;  1RF0 A;  1N73 C;  1FZC B;  2HPC B;  1M1J B;  1JY2 N;  2FFD A;  1LWU B;  1JY3 P;  3GHG B;  1N86 A;  3HUS A;  2H43 A;  1RF0 C;  2A45 I;  2Q9I A;  2OYI B;  3BVH A;  1LTJ B;  2XNX A;  1FZG A;  1FZB A;  1JY3 N;  2FFD C;  2HPC A;  1LT9 B;  3HUS C;  1LWU A;  1W2E A;  1FZC A;  1M1J A;  2OYH B;  1FZA A;  3GHG A;  2HOD B;  1LTJ A;  2OYI A;  1RE3 A;  1RE4 A;  1RF1 A;  2A45 G;  1RF1 B;  1LWU C;  1JY2 O;  1LT9 A;  1M1J C;  1FZC C;  2HOD A;  3GHG C;  2OYH A;  1LTJ C;  3H32 B;  2OYI C;  1RE3 C;  1RE4 C;  2HLO A;  1N73 B;  1JY3 O;  1LT9 C;  2A45 H;  1FZE A; 
#chains in the Genus database with same CATH topology
 1PZQ A;  1URQ A;  1RF1 C;  2GM4 A;  4EYY Q;  1URQ C;  1SQX D;  5BU8 B;  2N9Y B;  1NU1 D;  1FJK A;  2KNC B;  2BEQ D;  3Q5S A;  3H1J G;  3O6Q B;  3TNU A;  1JCC A;  3RL0 g;  1QVF O;  2HYN A;  3VMZ A;  5AW5 B;  1PPJ E;  3VTP C;  1OW7 A;  1AQT A;  1LP1 B;  3BVH A;  5CCG A;  1ZR2 A;  4L76 A;  3II6 A;  1PGQ A;  5CCG C;  3D70 A;  4N78 D;  1ZLL A;  1QLE D;  1IFD A;  2O01 H;  4IL6 H;  3M91 A;  2YXQ B;  2E76 C;  2FYU D;  4EI2 A;  4O9B A;  1GL2 D;  1J1D B;  2BCC G;  3BCC E;  3RL0 B;  1S5L X;  4B86 A;  1KB9 H;  3L72 J;  1NTZ E;  3MD0 A;  1R5S A;  5E79 H;  4GKG A;  4DCK A;  2HOD A;  2Y9Y A;  2M3B A;  4ASW A;  4BXL A;  2PFX A;  1PPJ G;  2W8Z A;  2N1T B;  5CBO A;  1LTJ B;  1RHZ B;  2OTL P;  4EOT A;  1R5L A;  4L74 A;  2R5B A;  3IN6 A;  1SQQ K;  3IF4 A;  1K05 A;  4TT3 H;  1HUC A;  1NAY A;  3CWB G;  1ZV8 A;  2CK3 H;  2SPZ A;  3HUS A;  1X8Y A;  3PJS K;  2FYN C;  1NTZ G;  3HUS C;  3L74 E;  1JO5 A;  1GW4 A;  3HD7 D;  3L72 D;  5APV A;  2O01 N;  2IX7 C;  1YJW P;  1FC2 C;  3GG2 A;  5KLV G;  1SQQ D;  4HKZ H;  1GK6 A;  3AE5 C;  1XTC C;  3HTK A;  1KIL A;  3H1L E;  3SFE C;  4WY4 B;  2HR3 A;  1KB9 I;  1KIL C;  1S1C X;  1H8A A;  1NKZ B;  1R8E A;  3N7N A;  2I1K A;  3MP7 B;  1ZRT E;  1OZH A;  2YO2 A;  3H1K E;  3M9B A;  1RQU A;  2M8R A;  2MJZ A;  1KB9 D;  1OVV A;  1QGK B;  2P7J A;  1HGZ A;  3TYY A;  1M57 D;  3L75 J;  2K9J A;  4H13 C;  2FKW B;  3I56 P;  3RK3 D;  3CCS P;  2JO1 A;  2WPR A;  3GF3 A;  5EFW B;  1KD1 Q;  5TIS H;  1PGJ A;  1WRG A;  2M3E A;  1MUU A;  2J59 M;  2XNX A;  1FZB A;  2VRS A;  2KK7 A;  3CCR P;  2Q3E A;  1NVO A;  1SQV K;  1N7S D;  1OVU A;  1OVR A;  4JPZ B;  1WMK A;  1VF5 C;  1NTK G;  2KIK A;  1BDD A;  3Q3D A;  2HG5 D;  3TNU B;  4C7R A;  4GIF A;  1RE3 A;  1RY3 A;  1RE3 C;  4L75 A;  5K5G B;  2ZYD A;  3A3Y B;  3KZI E;  5AVQ B;  1NU1 E;  3E1I A;  3L75 D;  3D6Z A;  2A45 I;  3B71 A;  2E76 B;  1SQV D;  3VOP A;  4WVZ A;  2OYH B;  5BU5 A;  2AXT H;  2KP8 A;  1N73 B;  2E5T A;  3W68 A;  3FGA D;  2J5U A;  4W7Y A;  2KXP B;  3I5C A;  3RGU A;  4N78 E;  1FZC B;  1N86 A;  3S1K A;  4HYT B;  1X79 B;  1USE A;  2JEE A;  2HOD B;  1DEE G;  3Q5P A;  3M9Q A;  3VP9 A;  2JJL A;  2AEF A;  1VQO P;  3KQG A;  2A06 D;  2C9L Y;  1QL2 A;  1HJ0 A;  4H44 D;  1IC2 A;  2WTY A;  3CC7 P;  1BSH A;  3CMA P;  1IK7 A;  1LWU A;  5CCH A;  5AW9 B;  1MFT A;  5AVS B;  5B5E E;  1LWU C;  5CCH C;  3D71 A;  1IZN B;  1Q90 D;  3M0D A;  1CW5 A;  3HUS B;  1LTT C;  2WPQ A;  1FBM A;  3L70 G;  3M0D C;  4KJM A;  4OWF A;  3D6Y A;  1M7L A;  3CPW O;  3CXH H;  4HJG H;  3KYQ A;  1GTW A;  2Z5I A;  2Q3I A;  2IBZ E;  1VPC A;  5AW6 B;  1L4A A;  2ZYA A;  1L4A C;  1YI2 P;  1AV1 A;  1E79 H;  3T97 B;  3HTK B;  1GZL A;  3C9I A;  3L72 E;  2IPP A;  2R3S A;  3HD7 B;  3WUT A;  3S4R A;  1JEK A;  1X22 A;  3ABV C;  2NZ2 A;  3CCJ P;  3TGU G;  3RK2 D;  3AEC C;  1SQQ E;  2K9Y A;  3OA7 A;  1BCC D;  1JUN A;  1ZOY C;  1JMM A;  3RL0 D;  2K9J B;  4D6T E;  1NAF A;  2OYI A;  4IL6 E;  4I6M C;  3BAS A;  1T8Z A;  3BRV B;  1BSN A;  2OYI C;  1QEX A;  2O1K A;  1KB9 E;  1GU4 A;  3CX5 H;  1LTS C;  1AVO A;  3CD6 P;  1VQ5 P;  1LTA C;  3F89 A;  2N1T D;  4JBZ A;  3G4S P;  3RK3 E;  1BE3 G;  5E79 E;  1VF5 B;  3HE5 A;  1L0N K;  2E74 C;  3N4X A;  2Y0E A;  1FJP A;  3EFG A;  3RBX A;  4DZO A;  2KLU A;  1FOS E;  3IFM A;  3CXH I;  2E42 A;  2E75 C;  2R44 A;  3NMD A;  5H2F H;  2QM8 A;  4N6J A;  1YTZ I;  5CJ0 A;  1AA0 A;  1VQN P;  3RBZ A;  1LT9 A;  3CXH D;  3Q1M A;  1JMB A;  1IJD B;  1KYO H;  1LT9 C;  3O8Z A;  1KQS O;  2IYP A;  3P8C D;  1NTK J;  5AW8 B;  2Y0C A;  3U59 A;  3GMA A;  5CHX A;  5AVT B;  1NTM J;  1L0N D;  1M90 Q;  3LW5 H;  4IOI H;  3CC2 P;  3VYI A;  3L75 E;  1X9V A;  5AW1 B;  3VP8 A;  4WY4 D;  1SQV E;  2PRR A;  1LJ2 A;  1NTM K;  1LGH B;  2KZI A;  4ZKU A;  1IFJ A;  3AEG C;  2O3J A;  3CX5 I;  2Z4E A;  1KMI Z;  4OVN F;  1CSB A;  1J1E C;  3CX5 D;  2P10 A;  1DD4 A;  5C39 A;  2AEJ A;  1NTK D;  1SQX K;  3I55 P;  1EDJ A;  1S4X A;  2A06 E;  1RQV A;  1JY3 O;  2JWD A;  1NTM D;  5TIS E;  3TK1 A;  1URQ D;  2K3R A;  2O1J A;  5APY A;  4L73 A;  3H1H G;  4U3F G;  2C9N Y;  1KYO I;  4Y99 C;  1H88 A;  1HTL C;  3L71 G;  2I8D A;  1EXI A;  1L4A B;  3L70 J;  5CJ4 A;  1KYO D;  1GU5 A;  3GW6 A;  1T3J A;  2FYU K;  5APS A;  5CCG D;  4CPG A;  1NKN A;  1BGY G;  3KXD A;  1DX7 A;  1JY2 O;  2E76 D;  1SQP G;  1TU3 F;  1MV8 A;  1W5C E;  3CLQ A;  2B9B A;  4H0L B;  3CCM P;  2QRX A;  1H0T B;  4EIJ A;  4TLF A;  1OMI A;  2AXT E;  2OYI B;  1EC5 A;  4RJT A;  4IFM A;  1FZA A;  5B66 H;  4W7Z A;  3SSU A;  5GTI H;  1OIP A;  1EZV G;  3TGU J;  1BCC E;  3V2R A;  3RK2 B;  3OW2 O;  2YKO A;  2IZ1 A;  5APX A;  4BWN A;  1JY3 P;  2XV5 A;  2E74 B;  4C46 A;  4JQ0 D;  1D7M A;  3JCU H;  2XKM A;  1RH5 B;  2WSE H;  1G2C A;  3QH9 A;  4I7Z C;  2WT7 B;  1OXZ A;  2ITA A;  1T6A A;  1BE3 J;  2OTK E;  2OGU A;  5DJU B;  1FS0 E;  1KZU B;  5KJ7 A;  1ZP0 C;  1L0L J;  2K1A A;  1XTG B;  5KJ7 C;  2BEZ F;  2KOG A;  1JY2 P;  2NPS A;  3BCC G;  1MKM A;  3TGU D;  1FDO A;  2NPS C;  3CXH E;  1L0L K;  1K9M Q;  2QJK C;  1S9K D;  3G71 P;  2WSE J;  1KIL D;  1NYH A;  3P8C E;  2LKM A;  2K37 A;  5CMZ A;  1A02 J;  3MIW A;  3PTZ A;  2FYZ A;  3MZW B;  3B5N A;  3NTN A;  1L0N E;  3B5N C;  2FFD A;  1IK9 A;  1DD3 A;  2W6J H;  2FFD C;  3L36 A;  2QJY B;  3WUV A;  4H13 D;  1LT1 A;  4C7N B;  2YO3 A;  1J1E B;  1SQB J;  1HGV A;  2A45 H;  5M1B A;  5APQ A;  1HWT C;  2R32 A;  1KV4 A;  3A0H H;  1ZR4 A;  1L0L D;  2W6A A;  3Q5R A;  1EDL A;  1SQB K;  3L74 G;  1EDK A;  3WU2 H;  1PP9 J;  3CX5 E;  4Y99 B;  3L4F A;  1VF5 D;  4RO0 A;  5L8R J;  2AXC A;  1G1I A;  4UB6 H;  3L73 J;  1NTM E;  1CZQ A;  1RF1 B;  2QJP C;  2WVR A;  3H1L G;  1URQ B;  2IYO A;  1KFM A;  2P1J A;  1U7M A;  5H2F E;  3V5B A;  1VQK P;  3H1I E;  4U3F J;  1SQB D;  3H1K G;  1ZN5 A;  3ZDM A;  3HRN A;  3L71 J;  3TSI A;  1FDI A;  2KSJ A;  1KYO E;  1USD A;  1AFO A;  1SQX E;  2J58 A;  5KTB A;  1KN7 A;  4M3L A;  1KQG B;  4UB8 H;  1A02 F;  2ZT9 C;  1PP9 D;  5KLI C;  4ZKP A;  1DH3 A;  2I1J A;  1NH4 A;  2Y9Z A;  2OAR A;  4DT0 A;  3H1J J;  4AUW A;  2RMZ A;  2D2C C;  1DIP A;  1Q2N A;  3AEA C;  1YQ4 C;  3JSV C;  3L73 D;  1Q82 Q;  1JTH A;  3H1I G;  4PD4 H;  3V2Q A;  1EQ7 A;  5AW3 B;  2LXB A;  1PL5 A;  2FYU E;  4U3F D;  1G2C B;  3AE8 C;  2WPV B;  4ASV A;  3E1R A;  1HVV A;  1NU1 G;  3VMX A;  3W67 A;  2BCC J;  4RKU J;  1VQ4 P;  4YXD C;  2OYO A;  2YIU C;  3WMM 0;  2FXO A;  3CC4 P;  1LTI C;  2H7H A;  3Q2Y A;  2XDJ A;  4GOE A;  2NPS B;  1FZE A;  1L4A D;  1T3U A;  2FYN B;  2QJK B;  3H1J D;  4LGD E;  3TDK A;  4IL6 X;  1Y47 A;  1OW8 A;  1P84 I;  2YMY A;  3PLN A;  3TF5 A;  2RH0 A;  3B5N B;  2DW3 A;  1K73 Q;  2ZJS E;  2WSS H;  3MUD A;  3CCQ P;  3CWB J;  3AED C;  3BCC J;  3MUD C;  1S72 P;  1P84 D;  4H0L D;  3USS A;  1NTZ J;  1S2E A;  1KIL B;  2BCC D;  2HPC A;  4PD4 I;  3PHL A;  1LTG C;  2N9B A;  1S5L H;  1NTZ K;  3H32 A;  2ZAE B;  2V7Q J;  4PD4 D;  5B66 E;  5KLV J;  1Q7Y Q;  1PPJ D;  1NJI Q;  4OGQ C;  4H13 B;  5GTI E;  3AE2 C;  4ZNC A;  4PV1 C;  2E74 D;  1LTB C;  1VL2 A;  3C8V A;  1IFP A;  1L0L E;  3AE9 C;  2IBZ G;  3O6Q A;  1VQ8 P;  2R5D A;  2KUB A;  5KLV K;  3FXD A;  1SFC A;  2QJP B;  3CWB D;  1SFC C;  4W80 A;  1FZG A;  3L72 G;  1LNQ A;  1Q81 Q;  4ZMD A;  1NTZ D;  1FU1 A;  2G8Y A;  1SQQ G;  2C0W A;  5AVW B;  1YJN P;  5APW A;  1IFN A;  1QL1 A;  3SFD C;  1J1D C;  3M9H A;  4D6T G;  1K8A Q;  1NOH A;  1YBK A;  5KLV D;  2ZT9 B;  5KLI B;  1E5W A;  1SQB E;  1N8R Q;  2WQY C;  5GTH H;  3H1K J;  2H88 C;  1JCD A;  3B8E B;  2D2C B;  2H43 A;  1LTJ A;  2ZXE B;  4K3A A;  3SWY A;  3ITK A;  3H6P A;  1LTJ C;  1JTH B;  1NTK K;  1KQL A;  3BAT A;  3JC2 2;  1T2K C;  1PP9 E;  3SWF A;  3HE4 A;  4XA4 A;  1UII A;  1GDT A;  4WWI A;  1PIX A;  4OH8 B;  4LC1 A;  1IO4 A;  3L73 E;  3S9O A;  1GW3 A;  3A0B H;  3P7K A;  2PAJ A;  4RES B;  2YIU B;  3A0H E;  4GOF A;  1YTZ T;  1JOC A;  2WIT A;  4KHX A;  4AYC A;  3AE1 C;  5AW4 B;  1OWA A;  1LWU B;  3VMA A;  5KKZ C;  4YPC A;  3WU2 E;  4EDF A;  1VQ7 P;  4R4L A;  2WPS A;  3H1K D;  2GUS A;  2R3C A;  2AEM A;  1HF9 A;  3L75 G;  2YXR B;  2WWW A;  4XE5 B;  1PFI A;  1SQV G;  1RF0 A;  4UB6 E;  1YJ9 P;  5APU A;  1N7L A;  1RF0 C;  2L5G B;  1ZME C;  5AVU B;  1EXJ A;  1HJB A;  3BRT B;  3H1J E;  3MHV A;  3AE7 C;  3CME P;  4JYC A;  3M0A A;  3A2A A;  3CL3 D;  3EFF K;  3KHU A;  2HPC B;  2JKV A;  2P2U A;  2QE7 H;  2WSC J;  2G3A A;  1ZXG A;  1EDI A;  3R2P A;  2A06 G;  3H32 B;  3M06 A;  3NXS A;  4UB8 E;  4OGQ B;  1M56 D;  4PV1 B;  2H8P D;  2BCC E;  3V2N A;  1NO4 A;  3EWK A;  2M5A A;  2ZVN B;  5AVZ B;  3GF7 A;  5AVR B;  3GHG A;  1RE4 A;  3SWK A;  2Y0D A;  2W83 C;  1VQ9 P;  3GHG C;  5AW2 B;  1M8O B;  1RE4 C;  3K5B A;  2QVA A;  1SFC B;  4NPD A;  4PD4 E;  1U7J A;  3A5T A;  2NRG A;  1SLQ A;  3AEF C;  2Q1K A;  1VQP P;  3L70 D;  1WT6 A;  1W2E A;  3HE5 B;  5KJ7 D;  2GA1 A;  2V4H A;  2E75 B;  2OYH A;  4Y28 J;  3FXE A;  5DJT B;  1YIJ P;  4U7J A;  2OYH C;  1N73 A;  3CWB E;  1VQ6 P;  2NPS D;  1N73 C;  4IFF A;  2QEX P;  1KOR A;  1LT9 B;  1FZC A;  5TJH A;  1OW6 A;  1FZC C;  2YNY A;  5AW7 B;  1BCC G;  2FXP A;  5KAF H;  1SQQ J;  3B5N D;  3AE3 C;  1GL2 A;  2OQQ A;  3PP5 A;  4HH2 A;  1GL2 C;  2HFE D;  5KLV E;  4D6T J;  2O01 J;  2WZ7 A;  2MKV A;  3CCE P;  2IBZ I;  1FE6 A;  1Z56 A;  2C0X A;  2ZVO B;  3HE4 B;  5KAI H;  1Y9B A;  4A7P A;  2E43 A;  4GOD A;  4DOJ A;  2IBZ D;  3QWO C;  1HH0 A;  1CI6 A;  1S5L E;  3LIE A;  1JB0 J;  2B87 A;  5KKZ B;  1BE3 D;  3OJA B;  2QM7 A;  2POH A;  4PJ0 H;  3E7K A;  2KSE A;  1PV3 A;  2XND H;  2P58 A;  1M1J A;  3T97 A;  2H89 C;  1YIT P;  1SP4 A;  1M1J C;  3HD7 A;  2GUV A;  4D6T D;  1AVY A;  3HD7 C;  3AEE C;  1UIX A;  1L0N G;  1NTK E;  5AW0 B;  3NFQ A;  4GDO A;  3U1C A;  1KTM A;  2QA4 P;  2RN0 A;  2KB7 P;  1SQV J;  2ZT9 D;  1YHQ P;  1QX8 A;  5AVY B;  3H1H J;  4QMA A;  1GMJ A;  1JY3 N;  3IR9 A;  2D2C D;  1BDC A;  3AE6 C;  1K04 A;  5GTH E;  3G3Z A;  2M5A B;  3RK3 C;  1P84 H;  1VDF A;  3R4Y A;  4HB1 A;  3GHG B;  3UIA A;  3FX0 A;  3CCL P;  1BGY J;  1KC8 Q;  1NTM G;  1M1K Q;  1SQP J;  2W6B A;  3MGN A;  1IFM A;  1N7S A;  4KT0 J;  2CPS A;  3FWL A;  1N7S C;  3P32 A;  1JY2 N;  1FOS F;  1SQP K;  3A0B E;  3PRJ A;  5CCH D;  1VQM P;  1NWQ A;  3PH0 A;  3H1H D;  4I7Z B;  1MFZ A;  1GD2 E;  3V6I A;  1SQX G;  3L71 D;  1N2D C;  5BVZ A;  4DJG A;  3L70 E;  3IAO A;  1JNM A;  3CCU P;  4LLH A;  1U57 A;  5APT A;  2JP3 A;  4Z1M H;  4I1L A;  3AEB C;  2JDI H;  4JF7 A;  2LXC B;  1S3J A;  1GL2 B;  2FBW C;  1BGY D;  1OFC X;  2W90 A;  1SQP D;  2KZJ A;  1EZV I;  3V2P A;  2ZFC A;  2V7Q H;  3G6E P;  2FYU G;  1BCC J;  1W2B O;  2HLO A;  1AJY A;  3LID A;  2XU6 A;  1L2P A;  3TGU E;  1YQ3 C;  2YMK A;  2FFD B;  1EZV D;  2KS1 A;  1CI6 B;  1S9K E;  4OGQ D;  3V4W A;  4PV1 D;  1KIL E;  2UWJ E;  4H44 C;  4K35 A;  4YXW H;  2B87 B;  3VN0 A;  1H89 A;  4BRY A;  2Q6Q A;  1GK4 A;  1JM0 A;  1SFC D;  1M1J B;  2JWA A;  3B4S A;  3L35 A;  2KLV A;  1BE3 E;  1G1J A;  2KNC A;  1YYC A;  4R4M A;  2BAS A;  4MN4 C;  2OTJ P;  2ZYG A;  1FZF A;  2PGD A;  2E75 D;  2WSF H;  1NHL A;  3EQ2 A;  1H0T A;  4H0L C;  3V4Q A;  3JCU E;  5AVV B;  3L74 J;  4GT1 A;  3BCC D;  1LP1 A;  1KQF B;  3AE4 C;  2CPB A;  2E5Y A;  1L0N J;  2FXM A;  3RK2 C;  2LR2 A;  2B88 A;  1Y8A A;  2B89 A;  1PGP A;  3CI9 A;  4NPF X;  2QIW A;  3RL0 C;  2KYV A;  1AQ5 A;  3H1L J;  5KAF E;  3RK3 B;  1T2K D;  2Z5H A;  2WSF J;  2RKL A;  1L0L G;  3OAK A;  3KDP B;  2P67 A;  4NPE A;  3G9R A;  2WT7 A;  3CCV P;  2IDB A;  2W27 A;  2K88 A;  2N1T A;  4WBA A;  2M0B A;  5KAI E;  1Q86 Q;  1N7S B;  2N1T C;  1PGO A;  3L74 D;  5CBN A;  3FWN A;  4AQR D;  1FAV A;  3KZI H;  3WUU A;  3MTU E;  5AVX B;  1VQL P;  4PJ0 E;  1SQB G;  3VMY A;  3KPE A;  4XFJ A;  2IFM A;  3H1I J;  3C1L A;  3H1L D;  1NGM B;  4IFD K;  3H1H E;  4U3F E;  3GLM A;  2L91 A;  1ZRT D;  2IZ0 A;  2YKQ A;  1J2J B;  3L71 E;  2JR8 A;  3A7O A;  4JYB A;  1QVG O;  2QSI A;  4N3Y B;  2WSC H;  1SQX J;  4C7N A;  1NU1 J;  1PP9 G;  2QG4 A;  2QJY C;  3F5H A;  4WY4 A;  1MZ9 A;  2PP6 A;  3LW5 J;  4WY4 C;  1OX3 A;  2Q9I A;  3U1A A;  1BGY E;  1ZW0 A;  1NU1 K;  3L73 G;  2IFN A;  2A45 G;  1SS1 A;  2Q5U A;  2KI7 B;  1HBW A;  1SQP E;  1KFN A;  1DEB A;  2KS1 B;  5B5E H;  4H44 B;  1SVF A;  3H25 A;  3P8M C;  2Q7C A;  4WB4 A;  3L37 A;  2XZR A;  2FY8 A;  1FDM A;  1IFI A;  4BRY B;  3H1I D;  2FYU J;  4I2L C;  4YTP C;  2ZXX A;  1EZV E;  2YKP A;  2WMM A;  1RF1 A;  1X0T A;  1P84 E; 
#chains in the Genus database with same CATH homology
 3EFG A;  3OJA B;  4DZO A;  2QM7 A;  2POH A;  1HVV A;  1FOS E;  3VMX A;  1URQ A;  3IFM A;  1RF1 C;  2GM4 A;  2E42 A;  1URQ C;  3NMD A;  5BU8 B;  2QM8 A;  3WMM 0;  4N6J A;  1FJK A;  1YTZ I;  5CJ0 A;  1M1J A;  3T97 A;  1LTI C;  2H7H A;  1SP4 A;  1LT9 A;  1M1J C;  3HD7 A;  3TNU A;  2GUV A;  2XDJ A;  1IJD B;  1JCC A;  1LT9 C;  2NPS B;  1FZE A;  3O8Z A;  3HD7 C;  2HYN A;  1L4A D;  1T3U A;  3VMZ A;  5AW5 B;  3P8C D;  4LGD E;  5AW8 B;  3VTP C;  3U59 A;  5AW0 B;  3NFQ A;  3U1C A;  3BVH A;  5CCG A;  5CHX A;  5AVT B;  1ZR2 A;  3II6 A;  5CCG C;  3LW5 H;  2YMY A;  4N78 D;  1ZLL A;  3B5N B;  2KB7 P;  1IFD A;  3VYI A;  2O01 H;  1X9V A;  5AW1 B;  3M91 A;  3MUD A;  3VP8 A;  4WY4 D;  4O9B A;  1GL2 D;  1J1D B;  3RL0 B;  1NTM K;  5AVY B;  1LGH B;  4B86 A;  1JY3 N;  1KIL B;  2HPC A;  3IR9 A;  4ZKU A;  1IFJ A;  3MD0 A;  1LTG C;  2N9B A;  3G3Z A;  4GKG A;  2HOD A;  2M3B A;  2Z4E A;  1NTZ K;  3H32 A;  3RK3 C;  1CSB A;  1VDF A;  1J1E C;  2N1T B;  3GHG B;  3UIA A;  1LTJ B;  4EOT A;  1SQX K;  1LTB C;  2R5B A;  2W6B A;  1SQQ K;  3MGN A;  1HUC A;  1JY3 O;  1IFM A;  3TK1 A;  1N7S A;  1URQ D;  2R5D A;  1ZV8 A;  5KLV K;  2CPS A;  2O1J A;  1N7S C;  1SFC A;  3P32 A;  5APY A;  1JY2 N;  1FOS F;  3HUS A;  1X8Y A;  1SQP K;  1SFC C;  2C9N Y;  4Y99 C;  4W80 A;  1FZG A;  3HUS C;  1H88 A;  1HTL C;  5CCH D;  1NWQ A;  1JO5 A;  1GW4 A;  3HD7 D;  1L4A B;  1MFZ A;  1FU1 A;  1GD2 E;  5APV A;  1N2D C;  5CJ4 A;  1GU5 A;  2IX7 C;  5BVZ A;  1T3J A;  1JNM A;  2C0W A;  5AVW B;  5APW A;  2FYU K;  4LLH A;  5APS A;  5CCG D;  1IFN A;  1QL1 A;  5APT A;  1J1D C;  1GK6 A;  3M9H A;  1NKN A;  1XTC C;  1NOH A;  3HTK A;  4I1L A;  1KIL A;  1DX7 A;  1JY2 O;  4JF7 A;  1MV8 A;  4WY4 B;  1KIL C;  1GL2 B;  3CLQ A;  1E5W A;  1H8A A;  1NKZ B;  3N7N A;  2I1K A;  4EIJ A;  2YO2 A;  1JCD A;  3B8E B;  3M9B A;  2H43 A;  2OYI B;  2M8R A;  2MJZ A;  3V2P A;  2P7J A;  4IFM A;  1FZA A;  2ZFC A;  1HGZ A;  4W7Z A;  1LTJ A;  2ZXE B;  3TYY A;  3SWY A;  3H6P A;  1LTJ C;  1JTH B;  2HLO A;  1NTK K;  3RK2 B;  1KQL A;  3V2R A;  3BAT A;  2FKW B;  2XU6 A;  3LID A;  3RK3 D;  1T2K C;  2YKO A;  2WPR A;  3SWF A;  2FFD B;  3HE4 A;  1CI6 B;  4XA4 A;  1S9K E;  5APX A;  1WRG A;  3V4W A;  1MUU A;  2J59 M;  1JY3 P;  2XV5 A;  1GDT A;  4C46 A;  2XNX A;  1FZB A;  2VRS A;  4OH8 B;  4LC1 A;  1IO4 A;  2XKM A;  1GW3 A;  3VN0 A;  1H89 A;  1SQV K;  3P7K A;  2PAJ A;  4RES B;  2WSE H;  1N7S D;  1G2C A;  1GK4 A;  1YTZ T;  1JOC A;  2WIT A;  2WT7 B;  1SFC D;  4KHX A;  4AYC A;  5AW4 B;  1M1J B;  1OWA A;  1OXZ A;  1LWU B;  3L35 A;  2HG5 D;  2KLV A;  3TNU B;  4C7R A;  2WPS A;  4GIF A;  2GUS A;  1RE3 A;  1KZU B;  1G1J A;  2R3C A;  5KJ7 A;  1RY3 A;  1YYC A;  1RE3 C;  1XTG B;  5KJ7 C;  2BAS A;  2WWW A;  4XE5 B;  1FZF A;  3A3Y B;  5AVQ B;  2KOG A;  3E1I A;  2WSF H;  1NHL A;  1PFI A;  1JY2 P;  1RF0 A;  2NPS A;  3EQ2 A;  5APU A;  1N7L A;  1RF0 C;  2A45 I;  2NPS C;  2L5G B;  3V4Q A;  5AVU B;  5AVV B;  1L0L K;  1S9K D;  4GT1 A;  1HJB A;  3BRT B;  3VOP A;  2OYH B;  5BU5 A;  1KIL D;  2KP8 A;  3P8C E;  2LKM A;  1N73 B;  5CMZ A;  1A02 J;  3MIW A;  4JYC A;  2FYZ A;  3M0A A;  2CPB A;  3A2A A;  3B5N A;  3CL3 D;  3NTN A;  2FXM A;  4W7Y A;  3B5N C;  2HPC B;  3RK2 C;  2P2U A;  3I5C A;  2FFD A;  4N78 E;  1IK9 A;  1N86 A;  1FZC B;  4HYT B;  1X79 B;  2JEE A;  2FFD C;  3L36 A;  3CI9 A;  3R2P A;  2HOD B;  3RL0 C;  2KYV A;  1AQ5 A;  4C7N B;  3RK3 B;  1T2K D;  3M9Q A;  3VP9 A;  2YO3 A;  2Z5H A;  1J1E B;  3H32 B;  2JJL A;  1HGV A;  3M06 A;  3OAK A;  2A45 H;  3NXS A;  3KDP B;  2P67 A;  3KQG A;  5APQ A;  2H8P D;  1HWT C;  2R32 A;  3V2N A;  2C9L Y;  1NO4 A;  1ZR4 A;  1QL2 A;  2W6A A;  2WT7 A;  1IC2 A;  2WTY A;  5AVZ B;  5AVR B;  1LWU A;  1SQB K;  2W27 A;  5CCH A;  2N1T A;  4WBA A;  5AW9 B;  3GHG A;  1RE4 A;  5AVS B;  1LWU C;  1N7S B;  5CCH C;  2N1T C;  3GHG C;  5AW2 B;  1RE4 C;  1SFC B;  4Y99 B;  3L4F A;  3M0D A;  3A5T A;  1CW5 A;  3HUS B;  1LTT C;  2WPQ A;  1FBM A;  1SLQ A;  3M0D C;  1G1I A;  4AQR D;  1FAV A;  3MTU E;  5AVX B;  1WT6 A;  1W2E A;  3HE5 B;  1M7L A;  5KJ7 D;  1CZQ A;  1RF1 B;  3KYQ A;  1GTW A;  2OYH A;  1URQ B;  2Z5I A;  2Q3I A;  1VPC A;  3VMY A;  3KPE A;  5AW6 B;  2IFM A;  1N73 A;  2OYH C;  1L4A A;  1KFM A;  2P1J A;  3V5B A;  2NPS D;  1N73 C;  1L4A C;  4IFF A;  4IFD K;  1ZN5 A;  3HTK B;  1GZL A;  3HRN A;  3C9I A;  3TSI A;  1LT9 B;  2IPP A;  2YKQ A;  1FZC A;  3HD7 B;  1J2J B;  4JYB A;  3A7O A;  2KSJ A;  4N3Y B;  2WSC H;  1FZC C;  1AFO A;  2YNY A;  5AW7 B;  4C7N A;  2J58 A;  3B5N D;  3RK2 D;  4WY4 A;  3OA7 A;  5KTB A;  1GL2 A;  4M3L A;  1MZ9 A;  2PP6 A;  1JUN A;  4WY4 C;  3PP5 A;  1A02 F;  4HH2 A;  4ZKP A;  1GL2 C;  2Q9I A;  1JMM A;  3RL0 D;  2HFE D;  1DH3 A;  2I1J A;  1NH4 A;  2WZ7 A;  3U1A A;  1NAF A;  2OYI A;  1NU1 K;  4I6M C;  2OAR A;  2IFN A;  3BAS A;  2A45 G;  4AUW A;  1Z56 A;  2Q5U A;  1HBW A;  1T8Z A;  3BRV B;  2C0X A;  2OYI C;  1KFN A;  1DEB A;  3HE4 B;  2O1K A;  1SVF A;  1JTH A;  3P8M C;  2E43 A;  2Q7C A;  1GU4 A;  4DOJ A;  4WB4 A;  3V2Q A;  1LTS C;  1EQ7 A;  3L37 A;  5AW3 B;  1HH0 A;  2XZR A;  1CI6 A;  1FDM A;  1LTA C;  1IFI A;  2N1T D;  4I2L C;  3LIE A;  1G2C B;  3HE5 A;  1L0N K;  2YKP A;  3N4X A;  1RF1 A;  1FJP A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...