2H43A

Crystal structure of human fragment d complexed with ala-his-arg-pro-amide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Differences in Binding Specificity for the Homologous gamma- and beta-Chain "Holes" on Fibrinogen: Exclusive Binding of Ala-His-Arg-Pro-amide by the beta-Chain Hole.
pubmed doi rcsb
molecule tags Blood clotting
total genus 24
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2h43A00
1JY2N 1W2EA 3H32B 3GHGA 3BVHA 1FZCC 1LTJC 1N73A 1M1JA 1LWUA 1RE4C 1FZGA 3GHGB 2Z4EA 2FFDC 1JY2P 1FZBA 1N73B 1M1JB 1RE3C 1LWUB 1T3UA 2OYIC 1FZFA 1RF0C 1FZAA 1JY3N 1N86A 2A45I 3HUSA 3GHGC 1JY2O 1M1JC 1RF1A 1N73C 2XNXA 2HPCA 1LWUC 1JY3P 1FZEA 1RF1B 3HUSB 1LT9A 2A45G 2HODA 2OYHA 3E1IA 2H43A 1FZCA 2HPCB 2Q9IA 2A45H 1LT9B 1LTJA 2HODB 2OYHB 1FZCB 1LTJB 1RE4A 3HUSC 1JY3O 2FFDA 2OYIA 2HLOA 1RF1C 3H32A 2FFDB 1RE3A 1LT9C 1RF0A 2OYHC 2OYIB
chains in the Genus database with same CATH superfamily
1IFNA 4EYYQ 1L4AB 2WWWA 1JMMA 1CZQA 2PGDA 1L0LK 2A06G 1AA0A 2ZAEB 2WSEH 2KS1A 1NTKG 4NPEA 3FWLA 2QVAA 2XU6A 1OVVA 1GZLA 2FFDC 2E5YA 2I1JA 2NRGA 4K3AA 3PRJA 3HE5B 2KSEA 5TISE 2W6BA 1RHZB 1KB9E 5BVZA 1PGPA 5KJ7A 4IFDK 1BE3J 1NTKD 2QEXP 1GU4A 2N1TA 1SP4A 3QWOC 2KLVA 1SQXJ 4PJ0E 3HE4B 2B89A 2L5GB 1LTGC 3CC4P 1PP9J 2KI7B 2Q7CA 2VRSA 2P2UA 3BRVB 2YKQA 1JO5A 4I1LA 1JY2O 1BSNA 1MKMA 1FZEA 1VQ6P 3WUTA 4WY4A 2WSFH 4C46A 4ZKPA 2KOGA 1A02J 3RK3E 1L2PA 1ZMEC 1BSHA 1S3JA 4H0LC 3LIDA 4W7ZA 1KILC 2QM8A 2GA1A 3A0BE 1OX3A 1RE4A 4C7NA 2Y0CA 5KAFH 2N9BA 4D6TE 1S5LE 1BDCA 1JY3N 3H1LJ 2C0XA 5AVUB 1N73C 2W8ZA 1YQ3C 3VN0A 5APSA 1NKZB 2E42A 4I6MC 3V5BA 1IJDB 2K37A 3RL0C 3I56P 1KYOH 4UB6H 4GT1A 2E43A 5B5EH 1XTGB 1X8YA 1E5WA 4GIFA 3CD6P 2P7JA 1RE3A 1VQMP 1Q2NA 1K05A 2M0BA 2FYNC 1VPCA 3VP8A 3H25A 2Q5UA 1EZVG 2HR3A 3WU2H 1BCCJ 1ZN5A 3O6QA 2D2CC 2ZVOB 2IZ1A 5APVA 5DJUB 2FKWB 3LIEA 4ASWA 3T97A 2QA4P 3IF4A 2BEZF 2YXQB 3CXHE 1KTMA 1BGYG 1RQVA 2FXOA 2YIUC 2QM7A 4W7YA 4BXLA 4RJTA 3VP9A 2RMZA 3CCVP 1SQBG 5AVRB 2HLOA 1N7SA 1N2DC 3CWBG 1GK6A 1KQGB 3ITKA 3MUDA 3HTKB 4JBZA 1KILB 1VDFA 1M57D 2FYUK 2Q3IA 1SQBD 1FZCB 4BRYA 2E76B 2WMMA 1KYOI 2R44A 1L0LG 2OGUA 1W5CE 1DEEG 3Q5PA 4YXDC 3CWBD 1S2EA 4L76A 4DT0A 3CX5E 3B5NC 2LXBA 4U3FE 1K73Q 2Q9IA 2QJYC 1LTJA 4U7JA 3L74E 5KLVG 1NTZJ 1JB0J 2ZJSE 1GDTA 1M56D 1ZRTE 2PRRA 1L0NJ 3UIAA 2E76D 4GKGA 3PLNA 1OW8A 2AEMA 1J2JB 1IFMA 3CXHD 1SQQE 3V4WA 1AQ5A 2WTYA 2FYNB 3L70G 2JKVA 3C8VA 3M9QA 5KLVD 2KZIA 3TNUB 3D70A 2IPPA 3MZWB 3FXDA 1NO4A 2B87B 2D2CB 2WT7B 1NTKK 1SQPG 5AW3B 2IBZG 2NPSC 1DD4A 2KNCB 3HD7A 1HVVA 2YNYA 2O3JA 3S4RA 1K8AQ 3L70D 4EDFA 5KAFE 1EXIA 4JPZB 4Y99C 3L72J 4N78E 3AEFC 2P58A 1FS0E 2QJPC 1KFNA 4ZNCA 1MFTA 1SQPD 5BU5A 2IBZD 1ZLLA 3CC2P 1U57A 4DCKA 5GTHE 3N7NA 1YITP 2WPQA 3TGUJ 3S9OA 2QSIA 4JF7A 3CX5D 1BE3E 3H1JJ 2BEQD 2QJKB 5B66H 2GM4A 2HODA 5B5EE 1SQXE 2P10A 1EDIA 3BCCJ 3L71G 1RQUA 1JM0A 1H0TB 1ZRTD 2BCCG 1IK7A 1U7JA 2Q3EA 3RGUA 5CCHD 1KN7A 4HB1A 1SQVG 2R5BA 3B4SA 1FDIA 5AVTB 3I55P 3B5NB 2KXPB 1G2CA 2QJYB 1PP9E 1SQQD 2O01H 2HPCA 2JR8A 2V7QJ 3FX0A 1FOSE 3EQ2A 3P7KA 3MIWA 2PAJA 2N1TD 4WY4B 3F5HA 3L71D 3SWKA 3CL3D 1SQVD 1R5LA 4NPFX 1P84D 3JSVC 2CPBA 5AVWB 4HYTB 1YQ4C 1ZR4A 1VQPP 1S4XA 1PFIA 3FXEA 2RN0A 4N3YB 1OFCX 3NXSA 1NGMB 1Q7YQ 3L75J 1NU1J 1T3UA 2NPSB 1H8AA 4WY4D 1YTZT 4C7RA 2RH0A 1LP1A 1PPJG 3H1LE 3GMAA 2KB7P 4A7PA 3V2PA 2QJPB 4WBAA 1QVFO 1DEBA 4RKUJ 1SQXD 1KQLA 3EWKA 4PD4H 3AE9C 3H1KJ 1PPJD 3AEBC 2DW3A 3V4QA 3GHGB 3Q5RA 3CCLP 1M1JC 5AVZB 3TK1A 2LR2A 3HUSC 3NFQA 2SPZA 1BCCE 1T6AA 5AW4B 1N73A 2KYVA 2WQYC 2YMKA 1JY2P 3VMZA 3WMM0 1SQBK 2WSCJ 3ZDMA 3G6EP 3EFFK 3FGAD 3KZIE 2H8PD 1Y47A 3AECC 1G1JA 3E1RA 3H1LD 3A2AA 4IFFA 3TDKA 2C0WA 1CI6A 2WPSA 1SFCA 5AVXB 2YMYA 2AEJA 1FOSF 3MGNA 4PD4I 1T3JA 1EDJA 3BVHA 5H2FE 1NTME 1T2KD 2AXTH 3AE1C 1EZVI 2W83C 1UIIA 1G1IA 1LTSC 2Z5HA 1K9MQ 4K35A 2B88A 3SWYA 1N7SD 4YTPC 5KLVK 1M1KQ 2P67A 1LTJB 2E74B 2IFMA 5CHXA 1HJBA 2O1JA 2W27A 2P1JA 2OTLP 4HH2A 1OW7A 2M5AB 1N86A 1NTZE 4XA4A 1LTBC 3S1KA 1YTZI 1L0NE 1ZOYC 5AVQB 4DJGA 3AE3C 1SQPK 2KK7A 1M1JB 3B8EB 3KDPB 3L73J 1NKNA 2KUBA 2E74D 3Q2YA 3H6PA 2NZ2A 3HUSB 4KJMA 2K9JB 4UB8H 5CCGC 4M3LA 1SLQA 2WSCH 1LTAC 3H1HJ 3EFGA 1ZR2A 2OYIB 1Y8AA 4LC1A 2YKPA 3M9BA 3H1IJ 1Y9BA 5APYA 3L72E 2J59M 1NTMD 1Q90D 2FYUJ 2JWAA 2V4HA 1JTHA 1LT9C 2XKMA 1JY2N 1FZCC 1SQQK 2E76C 3CCEP 1KC8Q 3M91A 1KB9D 1KFMA 3NTNA 5TJHA 1P84H 3TGUE 1GK4A 3SFDC 1SQVK 3H1JE 5BU8B 2WITA 1FC2C 3BCCE 3RK3B 2IBZI 1FU1A 3CPWO 3I5CA 4W80A 1KMIZ 1JMBA 1URQA 3U1AA 1Z56A 5AW0B 4QMAA 5AW6B 3G4SP 1YJ9P 1RF0A 4YXWH 1IFDA 1S1CX 2YO2A 3GLMA 2QE7H 1NAFA 3OJAB 1QL2A 3LW5J 3B71A 2M8RA 1KV4A 3E7KA 1NTKJ 3PJSK 4D6TG 1MZ9A 3RK3D 1SQXK 3V6IA 3H32B 1HGZA 3M0DA 3PTZA 1VQ5P 4R4LA 3L72D 1OVRA 1YIJP 1USEA 3CCSP 2A45G 3L75E 1NU1E 5CCHC 1HH0A 5K5GB 4D6TD 3TYYA 1VF5B 3V2NA 3IR9A 1P84I 1FAVA 3A5TA 3A0HH 3C1LA 1KQFB 4IFMA 4NPDA 2YO3A 3SSUA 2N1TC 3G3ZA 4B86A 5EFWB 1NJIQ 1JUNA 2M3BA 2QRXA 2OYHA 2QJKC 1LT9B 2KP8A 4I2LC 3BCCD 3II6A 1GL2B 4WVZA 5AVVB 3H1KE 1S72P 5CCGD 1EQ7A 1L4AA 4JYBA 3RK2B 4PV1B 1RF1A 4TT3H 2R5DA 1VF5D 3E1IA 1KORA 5CBNA 1GTWA 3IN6A 5E79H 4WY4C 2O01J 2IX7C 1IFPA 1LWUB 3HE5A 2JWDA 1NVOA 1DD3A 2W6JH 1GL2D 2IFNA 4IOIH 3FWNA 2ZYAA 3LW5H 5M1BA 3D6YA 5AW9B 3RK2D 1PGOA 3MHVA 5KKZB 4PV1D 3V2RA 1W2BO 1RE4C 2K3RA 1YI2P 3HE4A 1NU1D 3L75D 3Q1MA 4RESB 2RKLA 2O01N 3K5BA 2OTKE 3V2QA 1SFCB 4EOTA 2YKOA 1KZUB 2KS1B 3WUVA 2OARA 2OYOA 2H88C 1AVYA 2N9YB 4U3FG 3CCRP 2WVRA 3CMAP 2H7HA 1DH3A 3L74G 3BASA 3SWFA 3R2PA 3VTPC 1VQKP 2JJLA 1VQOP 2I1KA 4I7ZC 4OGQD 5APQA 1AVOA 4KT0J 1E79H 2N1TB 1RE3C 4EIJA 4U3FD 3GHGC 1KYOE 1GU5A 1SFCD 4UB6E 1SQQG 3AE6C 3KYQA 2C9LY 1EDKA 2I8DA 2K9YA 3L74D 2PP6A 3M9HA 1KQSO 3JC22 2WZ7A 3F89A 4RO0A 2G3AA 2Y9YA 2XV5A 5CJ4A 1R5SA 2B9BA 1BGYJ 1NTMK 3TSIA 1HBWA 2L91A 3WU2E 4GODA 5KJ7D 1SQBJ 3KXDA 1T2KC 2ZT9D 2FFDA 2O1KA 1FJPA 3L73E 5C39A 3VOPA 1MV8A 1IZNB 1OW6A 3CWBJ 4PJ0H 1N7SC 3AEEC 3H1HE 2HYNA 1X9VA 2QIWA 4ZMDA 1NTZK 3MUDC 1L0LJ 4N78D 2LXCB 1BE3G 3H1IE 4XFJA 3A3YB 4C7NB 3A0HE 2FYUE 1SQXG 1VQNP 2ZYDA 4TLFA 2XNDH 1S5LX 1K04A 1IFJA 5KLVJ 3KHUA 4XE5B 3M0AA 1PZQA 1HUCA 1BE3D 1IFIA 1LTJC 4GOFA 2E74C 1PP9G 3AEAC 1FZFA 2HG5D 3GF7A 3AEGC 2FY8A 2E75B 1IK9A 4BWNA 2JO1A 2C9NY 2J5UA 5CBOA 4I7ZB 1D7MA 2KZJA 3L70J 3M06A 3NMDA 5E79E 1KB9I 1S5LH 1PP9D 2AEFA 1KILA 1CSBA 1SQPJ 1OZHA 3Q5SA 2Z5IA 3L73D 3TF5A 3WUUA 1FZCA 3O6QB 1GW4A 2WPVB 3T97B 2A06E 3U59A 3H1HD 2FYZA 2E75D 1NTKE 1WRGA 2JEEA 2OYIC 5KAIH 1SVFA 1JOCA 3H1LG 1VQ4P 2W6AA 3D71A 1U7MA 3AEDC 1AFOA 1QVGO 1N7SB 2Y0EA 3AE7C 1H88A 2K88A 5KLIB 4WWIA 5AVSB 1H89A 4O9BA 4L73A 1M90Q 3L71J 1J1EC 2BCCJ 3TNUA 1X79B 3ABVC 4BRYB 1SQVJ 3CXHH 2B87A 1WT6A 2WT7A 3GG2A 2H89C 2KNCA 5B66E 3RK3C 1RF1B 1BCCG 1PIXA 1DX7A 1NU1K 1A02F 1YJWP 2KLUA 3A7OA 4H44C 5CCHA 2A45I 1PL5A 2CK3H 2J58A 4IL6X 2A06D 1BCCD 1OMIA 2H43A 3P8MC 1XTCC 3IAOA 1L4AD 1JCDA 2IZ0A 2FXPA 4OH8B 3AE4C 4R4MA 4EI2A 3CX5H 1LTTC 2OQQA 3HD7B 1NTMG 1H0TA 2ZYGA 5AW7B 4YPCA 1S9KE 4IL6H 1T8ZA 2ZXEB 1KD1Q 1NHLA 1EXJA 2KIKA 1VF5C 3B5NA 4GDOA 3AE2C 4H13B 3W67A 5L8RJ 2R3CA 1FE6A 3CXHI 5AVYB 1NWQA 1JY3O 1YJNP 3L35A 1FDMA 3KQGA 1NTZG 3PHLA 1GL2C 3HD7D 1UIXA 2ZFCA 1L0NG 4PD4E 1FJKA 1J1EB 3RK2C 2ITAA 1QEXA 2R32A 4PV1C 2HODB 1EZVE 3Q3DA 4H13D 3CCUP 3JCUH 1ZP0C 1N7LA 1NTZD 2NPSA 3W68A 4MN4C 3OW2O 1HGVA 3P8CE 3CCJP 2CPSA 1L0ND 1LWUC 4Z1MH 1G2CB 2HPCB 1BGYE 2M3EA 5APUA 5GTIH 2FFDB 5GTHH 4H44B 3CX5I 1SQBE 4CPGA 1HF9A 5KKZC 5KAIE 3L72G 1OIPA 1OVUA 1OXZA 1USDA 3CWBE 1S9KD 2WSSH 1VQLP 5AW2B 4OGQC 1LNQA 3BRTB 3GHGA 3O8ZA 1LTIC 4Y28J 1SFCC 1NOHA 2W90A 3TGUG 3HRNA 1KILE 2R3SA 1PV3A 1QGKB 1L0LE 3H1JG 2ZXXA 3R4YA 1VQ8P 1IC2A 4H44D 3RL0g 1M7LA 3IFMA 2QG4A 4JYCA 1LP1B 3BCCG 1TU3F 4AQRD 4PD4D 1FZGA 5CMZA 2AXTE 3CCMP 5KJ7C 3TGUD 3P32A 5KLVE 1NAYA 1EZVD 3CCQP 2ZT9C 3H1JD 3C9IA 3PP5A 4HKZH 5CJ0A 1EDLA 2LKMA 4ZKUA 3P8CD 2FBWC 4H0LB 3L4FA 2FXMA 1JCCA 3L70E 1BGYD 1SS1A 1NTMJ 3AE5C 1FDOA 4OWFA 1Q82Q 3GF3A 2E5TA 1HWTC 1SQPE 3CI9A 2IBZE 4L75A 2UWJE 3OAKA 5AW8B 1MFZA 1N73B 2GUSA 3L75G 1NU1G 4AYCA 2BASA 1RY3A 1GD2E 3N4XA 3U1CA 1VQ7P 2JP3A 4H0LD 2ZVNB 1ZV8A 4UB8E 3VMAA 3L37A 1KILD 4IL6E 1L0LD 3RL0B 3MP7B 2IYOA 3SFEC 2M5AA 4DOJA 3BATA 3VMXA 5DJTB 4OGQB 1WMKA 3VMYA 3H1KG 3GW6A 1AQTA 1QL1A 1CI6B 5AW5B 1QX8A 1AV1A 1M1JA 3L71E 2BCCE 3HUSA 2K9JA 1SQVE 1P84E 3KPEA 3USSA 3RL0D 3H1KD 1ZXGA 2E75C 2OYIA 2XNXA 3KZIH 1URQC 1W2EA 1DIPA 3JCUE 1PGJA 2Z4EA 2YIUB 2ZT9B 3OA7A 1RF0C 1AJYA 2YXRB 3PH0A 4D6TJ 1HJ0A 1RH5B 1EC5A 5GTIE 2D2CD 1HTLC 5H2FH 1OWAA 2XDJA 5APWA 1FBMA 1CW5A 3M0DC 4HJGH 2GUVA 2IDBA 5TISH 1IO4A 1KB9H 2XZRA 4AUWA 3CLQA 1PPJE 1MUUA 3G9RA 2WPRA 1LGHB 2Y0DA 1Q81Q 5KLIC 1GMJA 1GW3A 1QLED 2JDIH 1J1DC 1JEKA 3MTUE 1NYHA 3L36A 2OYHC 2BCCD 1JTHB 1L0NK 1N8RQ 2KSJA 3CC7P 1FZAA 1L4AC 1JNMA 1PGQA 3RBXA 1RF1C 3H32A 2Q6QA 3B5ND 2G8YA 4N6JA 1BDDA 1KYOD 4GOEA 4LGDE 2WSEJ 5CCGA 2Y9ZA 3L73G 4WB4A 2OTJP 3A0BH 1URQB 4Y99B 5AW1B 3H1HG 1M8OB 2PFXA 2Q1KA 3HTKA 1YHQP 5APXA 3VYIA 1LT9A 3H1IG 5APTA 1Q86Q 1ZW0A 1GL2A 1LT1A 2FYUG 1YBKA 2NPSD 4KHXA 2A45H 4ASVA 3HD7C 4LLHA 1NH4A 3MD0A 4U3FJ 1VQ9P 2IYPA 4DZOA 1URQD 3QH9A 3G71P 1X22A 3L74J 3D6ZA 4H13C 2HFED 3H1ID 3CMEP 2AXCA 2FYUD 2V7QH 2POHA 1X0TA 1LWUA 1FZBA 5KTBA 4JQ0D 1YYCA 2WSFJ 1LJ2A 4L74A 1SQQJ 2MJZA 1JY3P 1R8EA 1J1DB 1VL2A 2MKVA 2OYHB 2K1AA 3RBZA 3AE8C 4OVNF
chains in the Genus database with same CATH topology
3CL3D 1IFNA 4WY4C 2IX7C 1N7LA 2NPSA 1LWUB 1HGVA 1L4AB 3P8CE 3HE5A 2WWWA 1JMMA 2CPBA 2CPSA 5AVWB 1CZQA 1GL2D 1LWUC 4HYTB 1G2CB 2IFNA 1L0LK 1ZR4A 2HPCB 1PFIA 3LW5H 2WSEH 5APUA 5AW9B 3RK2D 2FFDB 2XU6A 4N3YB 3NXSA 1GZLA 3V2RA 1RE4C 2FFDC 2I1JA 1T3UA 3HE4A 2NPSB 1H8AA 4RESB 4WY4D 3HE5B 1OXZA 1YTZT 4C7RA 1S9KD 2W6BA 5AW2B 5BVZA 3V2QA 5KJ7A 4IFDK 1SFCB 4EOTA 2YKOA 1KZUB 1GU4A 2OARA 3BRTB 3GHGA 2KB7P 3O8ZA 3V2PA 1LTIC 2N1TA 4WBAA 1SP4A 1SFCC 2KLVA 1DEBA 1NOHA 3HRNA 1KQLA 3HE4B 2H7HA 1IC2A 2L5GB 1LTGC 1DH3A 3BASA 3SWFA 1M7LA 3IFMA 4JYCA 3R2PA 3VTPC 2JJLA 2I1KA 3V4QA 2Q7CA 2VRSA 2P2UA 5APQA 4AQRD 1FZGA 3GHGB 5CMZA 2N1TB 1RE3C 4EIJA 5KJ7C 3BRVB 3P32A 2YKQA 1JO5A 4I1LA 3GHGC 1JY2O 1M1JC 1SFCD 1GU5A 3C9IA 1FZEA 3KYQA 5AVZB 2C9LY 3PP5A 3TK1A 2PP6A 3M9HA 5CJ0A 4WY4A 3HUSC 2WSFH 2LKMA 2WZ7A 3NFQA 4ZKUA 3P8CD 4C46A 2XV5A 4ZKPA 2KOGA 5CJ4A 5AW4B 1A02J 1N73A 2KYVA 3L4FA 1JY2P 3VMZA 2FXMA 3WMM0 1JCCA 1NTMK 1SQBK 3TSIA 3LIDA 4W7ZA 1HBWA 5KJ7D 1KILC 2QM8A 1HWTC 1T2KC 1RE4A 2FFDA 3CI9A 2O1KA 1FJPA 4C7NA 3VOPA 1MV8A 2H8PD 3OAKA 2N9BA 5AW8B 1MFZA 1N73B 2GUSA 1N7SC 1G1JA 4AYCA 2BASA 1JY3N 1RY3A 1GD2E 2C0XA 5AVUB 2HYNA 3N4XA 1X9VA 3A2AA 4IFFA 3U1CA 1N73C 2C0WA 1NTZK 1ZV8A 1CI6A 2WPSA 1SFCA 3VN0A 5APSA 5AVXB 1NKZB 2YMYA 3L37A 4N78D 1KILD 1FOSF 2E42A 3MGNA 1T3JA 3A3YB 3BVHA 3RL0B 1T2KD 4C7NB 4I6MC 3V5BA 1IJDB 1G1IA 1LTSC 2Z5HA 4DOJA 3RL0C 3BATA 2E43A 4GT1A 3SWYA 3VMXA 1N7SD 5KLVK 1XTGB 3VMYA 2P67A 1X8YA 1LTJB 1QL1A 1E5WA 4GIFA 1CI6B 2P7JA 1IFJA 2IFMA 1RE3A 5CHXA 4XE5B 1HJBA 5AW5B 2O1JA 3M0AA 1HUCA 2W27A 2P1JA 1IFIA 1LTJC 4HH2A 1M1JA 1VPCA 3VP8A 2Q5UA 1FZFA 2HG5D 1N86A 3HUSA 4XA4A 1IK9A 1ZN5A 3KPEA 1LTBC 5APVA 3RL0D 2FKWB 3LIEA 1YTZI 2C9NY 3T97A 2OYIA 5AVQB 2XNXA 3M06A 1URQC 3NMDA 1W2EA 1SQPK 2Z4EA 1M1JB 1KILA 3OA7A 1CSBA 1RF0C 3B8EB 3KDPB 1NKNA 2QM7A 3H6PA 2Z5IA 4W7YA 3HUSB 1FZCA 3VP9A 5CCGC 1GW4A 5AVRB 4M3LA 2HLOA 1N7SA 1SLQA 2WSCH 1N2DC 1LTAC 1HTLC 3EFGA 1ZR2A 2OYIB 3U59A 1OWAA 2FYZA 1WRGA 1GK6A 2JEEA 2OYIC 2XDJA 4LC1A 5APWA 1FBMA 3HTKB 3MUDA 1KILB 1SVFA 1CW5A 3M0DC 2YKPA 1JOCA 1VDFA 3M9BA 2FYUK 2GUVA 2Q3IA 2W6AA 5APYA 1IO4A 2J59M 2XZRA 1AFOA 1FZCB 4AUWA 1JTHA 1LT9C 2XKMA 1JY2N 1N7SB 3CLQA 1H88A 1FZCC 1SQQK 1MUUA 2WPRA 5AVSB 1LGHB 3M91A 1KFMA 1H89A 3NTNA 1GW3A 4O9BA 1GK4A 3B5NC 2Q9IA 1LTJA 1J1EC 1SQVK 1J1DC 3MTUE 5BU8B 3TNUA 1X79B 3L36A 2OYHC 1JTHB 1L0NK 1GDTA 1WT6A 2WITA 3RK3B 2KSJA 2WT7A 1FZAA 3UIAA 1FU1A 4GKGA 3I5CA 1L4AC 3RK3C 4W80A 1RF1B 1URQA 3U1AA 1Z56A 1JNMA 1J2JB 1IFMA 1DX7A 5AW0B 1RF1C 1NU1K 3H32A 3V4WA 1A02F 1AQ5A 5AW6B 2WTYA 1RF0A 3B5ND 3M9QA 1IFDA 3TNUB 4N6JA 3A7OA 2YO2A 2IPPA 1NAFA 1NO4A 3OJAB 1QL2A 4LGDE 5CCHA 5CCGA 2WT7B 2A45I 1NTKK 5AW3B 2J58A 2M8RA 2NPSC 3HD7A 4WB4A 1HVVA 2H43A 2YNYA 1XTCC 3P8MC 1URQB 1L4AD 1MZ9A 4Y99B 5AW1B 3RK3D 1SQXK 1JCDA 3H32B 1HGZA 3M0DA 4Y99C 4N78E 3HTKA 1KFNA 5APXA 4OH8B 3VYIA 5BU5A 1LTTC 1LT9A 2A45G 3HD7B 5APTA 1ZLLA 5CCHC 1HH0A 1GL2A 5AW7B 2NPSD 4KHXA 1S9KE 2A45H 3TYYA 3HD7C 3N7NA 3V2NA 4LLHA 1T8ZA 2ZXEB 3IR9A 1NH4A 1FAVA 2WPQA 3MD0A 1NHLA 4JF7A 3A5TA 4IFMA 3B5NA 4DZOA 1URQD 2YO3A 2N1TC 3G3ZA 4B86A 2GM4A 2R3CA 1JUNA 2M3BA 2HODA 2OYHA 2HFED 1LT9B 5AVYB 2KP8A 1NWQA 4I2LC 1JY3O 3II6A 1GL2B 3L35A 1FDMA 3KQGA 5AVVB 2POHA 5CCHD 5CCGD 1EQ7A 1LWUA 1L4AA 2R5BA 4JYBA 1FZBA 1GL2C 5KTBA 3RK2B 3HD7D 5AVTB 1YYCA 2ZFCA 3B5NB 2MJZA 1G2CA 1RF1A 1FJKA 2O01H 1J1EB 2HPCA 3RK2C 1JY3P 2R5DA 1J1DB 1FOSE 3EQ2A 3E1IA 3P7KA 2R32A 3MIWA 2HODB 2PAJA 2OYHB 2N1TD 4WY4B 1GTWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY2 N;  1W2E A;  3H32 B;  3GHG A;  3BVH A;  1FZC C;  1LTJ C;  1N73 A;  1M1J A;  1LWU A;  1RE4 C;  1FZG A;  3GHG B;  2Z4E A;  2FFD C;  1JY2 P;  1FZB A;  1N73 B;  1M1J B;  1RE3 C;  1LWU B;  1T3U A;  2OYI C;  1FZF A;  1RF0 C;  1FZA A;  1JY3 N;  1N86 A;  2A45 I;  3HUS A;  3GHG C;  1JY2 O;  1M1J C;  1RF1 A;  1N73 C;  2XNX A;  2HPC A;  1LWU C;  1JY3 P;  1FZE A;  1RF1 B;  3HUS B;  1LT9 A;  2A45 G;  2HOD A;  2OYH A;  3E1I A;  2H43 A;  1FZC A;  2HPC B;  2Q9I A;  2A45 H;  1LT9 B;  1LTJ A;  2HOD B;  2OYH B;  1FZC B;  1LTJ B;  1RE4 A;  3HUS C;  1JY3 O;  2FFD A;  2OYI A;  2HLO A;  1RF1 C;  3H32 A;  2FFD B;  1RE3 A;  1LT9 C;  1RF0 A;  2OYH C;  2OYI B; 
#chains in the Genus database with same CATH topology
 1IFN A;  4EYY Q;  1L4A B;  2WWW A;  1JMM A;  1CZQ A;  2PGD A;  1L0L K;  2A06 G;  1AA0 A;  2ZAE B;  2WSE H;  2KS1 A;  1NTK G;  4NPE A;  3FWL A;  2QVA A;  2XU6 A;  1OVV A;  1GZL A;  2FFD C;  2E5Y A;  2I1J A;  2NRG A;  4K3A A;  3PRJ A;  3HE5 B;  2KSE A;  5TIS E;  2W6B A;  1RHZ B;  1KB9 E;  5BVZ A;  1PGP A;  5KJ7 A;  4IFD K;  1BE3 J;  1NTK D;  2QEX P;  1GU4 A;  2N1T A;  1SP4 A;  3QWO C;  2KLV A;  1SQX J;  4PJ0 E;  3HE4 B;  2B89 A;  2L5G B;  1LTG C;  3CC4 P;  1PP9 J;  2KI7 B;  2Q7C A;  2VRS A;  2P2U A;  3BRV B;  2YKQ A;  1JO5 A;  4I1L A;  1JY2 O;  1BSN A;  1MKM A;  1FZE A;  1VQ6 P;  3WUT A;  4WY4 A;  2WSF H;  4C46 A;  4ZKP A;  2KOG A;  1A02 J;  3RK3 E;  1L2P A;  1ZME C;  1BSH A;  1S3J A;  4H0L C;  3LID A;  4W7Z A;  1KIL C;  2QM8 A;  2GA1 A;  3A0B E;  1OX3 A;  1RE4 A;  4C7N A;  2Y0C A;  5KAF H;  2N9B A;  4D6T E;  1S5L E;  1BDC A;  1JY3 N;  3H1L J;  2C0X A;  5AVU B;  1N73 C;  2W8Z A;  1YQ3 C;  3VN0 A;  5APS A;  1NKZ B;  2E42 A;  4I6M C;  3V5B A;  1IJD B;  2K37 A;  3RL0 C;  3I56 P;  1KYO H;  4UB6 H;  4GT1 A;  2E43 A;  5B5E H;  1XTG B;  1X8Y A;  1E5W A;  4GIF A;  3CD6 P;  2P7J A;  1RE3 A;  1VQM P;  1Q2N A;  1K05 A;  2M0B A;  2FYN C;  1VPC A;  3VP8 A;  3H25 A;  2Q5U A;  1EZV G;  2HR3 A;  3WU2 H;  1BCC J;  1ZN5 A;  3O6Q A;  2D2C C;  2ZVO B;  2IZ1 A;  5APV A;  5DJU B;  2FKW B;  3LIE A;  4ASW A;  3T97 A;  2QA4 P;  3IF4 A;  2BEZ F;  2YXQ B;  3CXH E;  1KTM A;  1BGY G;  1RQV A;  2FXO A;  2YIU C;  2QM7 A;  4W7Y A;  4BXL A;  4RJT A;  3VP9 A;  2RMZ A;  3CCV P;  1SQB G;  5AVR B;  2HLO A;  1N7S A;  1N2D C;  3CWB G;  1GK6 A;  1KQG B;  3ITK A;  3MUD A;  3HTK B;  4JBZ A;  1KIL B;  1VDF A;  1M57 D;  2FYU K;  2Q3I A;  1SQB D;  1FZC B;  4BRY A;  2E76 B;  2WMM A;  1KYO I;  2R44 A;  1L0L G;  2OGU A;  1W5C E;  1DEE G;  3Q5P A;  4YXD C;  3CWB D;  1S2E A;  4L76 A;  4DT0 A;  3CX5 E;  3B5N C;  2LXB A;  4U3F E;  1K73 Q;  2Q9I A;  2QJY C;  1LTJ A;  4U7J A;  3L74 E;  5KLV G;  1NTZ J;  1JB0 J;  2ZJS E;  1GDT A;  1M56 D;  1ZRT E;  2PRR A;  1L0N J;  3UIA A;  2E76 D;  4GKG A;  3PLN A;  1OW8 A;  2AEM A;  1J2J B;  1IFM A;  3CXH D;  1SQQ E;  3V4W A;  1AQ5 A;  2WTY A;  2FYN B;  3L70 G;  2JKV A;  3C8V A;  3M9Q A;  5KLV D;  2KZI A;  3TNU B;  3D70 A;  2IPP A;  3MZW B;  3FXD A;  1NO4 A;  2B87 B;  2D2C B;  2WT7 B;  1NTK K;  1SQP G;  5AW3 B;  2IBZ G;  2NPS C;  1DD4 A;  2KNC B;  3HD7 A;  1HVV A;  2YNY A;  2O3J A;  3S4R A;  1K8A Q;  3L70 D;  4EDF A;  5KAF E;  1EXI A;  4JPZ B;  4Y99 C;  3L72 J;  4N78 E;  3AEF C;  2P58 A;  1FS0 E;  2QJP C;  1KFN A;  4ZNC A;  1MFT A;  1SQP D;  5BU5 A;  2IBZ D;  1ZLL A;  3CC2 P;  1U57 A;  4DCK A;  5GTH E;  3N7N A;  1YIT P;  2WPQ A;  3TGU J;  3S9O A;  2QSI A;  4JF7 A;  3CX5 D;  1BE3 E;  3H1J J;  2BEQ D;  2QJK B;  5B66 H;  2GM4 A;  2HOD A;  5B5E E;  1SQX E;  2P10 A;  1EDI A;  3BCC J;  3L71 G;  1RQU A;  1JM0 A;  1H0T B;  1ZRT D;  2BCC G;  1IK7 A;  1U7J A;  2Q3E A;  3RGU A;  5CCH D;  1KN7 A;  4HB1 A;  1SQV G;  2R5B A;  3B4S A;  1FDI A;  5AVT B;  3I55 P;  3B5N B;  2KXP B;  1G2C A;  2QJY B;  1PP9 E;  1SQQ D;  2O01 H;  2HPC A;  2JR8 A;  2V7Q J;  3FX0 A;  1FOS E;  3EQ2 A;  3P7K A;  3MIW A;  2PAJ A;  2N1T D;  4WY4 B;  3F5H A;  3L71 D;  3SWK A;  3CL3 D;  1SQV D;  1R5L A;  4NPF X;  1P84 D;  3JSV C;  2CPB A;  5AVW B;  4HYT B;  1YQ4 C;  1ZR4 A;  1VQP P;  1S4X A;  1PFI A;  3FXE A;  2RN0 A;  4N3Y B;  1OFC X;  3NXS A;  1NGM B;  1Q7Y Q;  3L75 J;  1NU1 J;  1T3U A;  2NPS B;  1H8A A;  4WY4 D;  1YTZ T;  4C7R A;  2RH0 A;  1LP1 A;  1PPJ G;  3H1L E;  3GMA A;  2KB7 P;  4A7P A;  3V2P A;  2QJP B;  4WBA A;  1QVF O;  1DEB A;  4RKU J;  1SQX D;  1KQL A;  3EWK A;  4PD4 H;  3AE9 C;  3H1K J;  1PPJ D;  3AEB C;  2DW3 A;  3V4Q A;  3GHG B;  3Q5R A;  3CCL P;  1M1J C;  5AVZ B;  3TK1 A;  2LR2 A;  3HUS C;  3NFQ A;  2SPZ A;  1BCC E;  1T6A A;  5AW4 B;  1N73 A;  2KYV A;  2WQY C;  2YMK A;  1JY2 P;  3VMZ A;  3WMM 0;  1SQB K;  2WSC J;  3ZDM A;  3G6E P;  3EFF K;  3FGA D;  3KZI E;  2H8P D;  1Y47 A;  3AEC C;  1G1J A;  3E1R A;  3H1L D;  3A2A A;  4IFF A;  3TDK A;  2C0W A;  1CI6 A;  2WPS A;  1SFC A;  5AVX B;  2YMY A;  2AEJ A;  1FOS F;  3MGN A;  4PD4 I;  1T3J A;  1EDJ A;  3BVH A;  5H2F E;  1NTM E;  1T2K D;  2AXT H;  3AE1 C;  1EZV I;  2W83 C;  1UII A;  1G1I A;  1LTS C;  2Z5H A;  1K9M Q;  4K35 A;  2B88 A;  3SWY A;  1N7S D;  4YTP C;  5KLV K;  1M1K Q;  2P67 A;  1LTJ B;  2E74 B;  2IFM A;  5CHX A;  1HJB A;  2O1J A;  2W27 A;  2P1J A;  2OTL P;  4HH2 A;  1OW7 A;  2M5A B;  1N86 A;  1NTZ E;  4XA4 A;  1LTB C;  3S1K A;  1YTZ I;  1L0N E;  1ZOY C;  5AVQ B;  4DJG A;  3AE3 C;  1SQP K;  2KK7 A;  1M1J B;  3B8E B;  3KDP B;  3L73 J;  1NKN A;  2KUB A;  2E74 D;  3Q2Y A;  3H6P A;  2NZ2 A;  3HUS B;  4KJM A;  2K9J B;  4UB8 H;  5CCG C;  4M3L A;  1SLQ A;  2WSC H;  1LTA C;  3H1H J;  3EFG A;  1ZR2 A;  2OYI B;  1Y8A A;  4LC1 A;  2YKP A;  3M9B A;  3H1I J;  1Y9B A;  5APY A;  3L72 E;  2J59 M;  1NTM D;  1Q90 D;  2FYU J;  2JWA A;  2V4H A;  1JTH A;  1LT9 C;  2XKM A;  1JY2 N;  1FZC C;  1SQQ K;  2E76 C;  3CCE P;  1KC8 Q;  3M91 A;  1KB9 D;  1KFM A;  3NTN A;  5TJH A;  1P84 H;  3TGU E;  1GK4 A;  3SFD C;  1SQV K;  3H1J E;  5BU8 B;  2WIT A;  1FC2 C;  3BCC E;  3RK3 B;  2IBZ I;  1FU1 A;  3CPW O;  3I5C A;  4W80 A;  1KMI Z;  1JMB A;  1URQ A;  3U1A A;  1Z56 A;  5AW0 B;  4QMA A;  5AW6 B;  3G4S P;  1YJ9 P;  1RF0 A;  4YXW H;  1IFD A;  1S1C X;  2YO2 A;  3GLM A;  2QE7 H;  1NAF A;  3OJA B;  1QL2 A;  3LW5 J;  3B71 A;  2M8R A;  1KV4 A;  3E7K A;  1NTK J;  3PJS K;  4D6T G;  1MZ9 A;  3RK3 D;  1SQX K;  3V6I A;  3H32 B;  1HGZ A;  3M0D A;  3PTZ A;  1VQ5 P;  4R4L A;  3L72 D;  1OVR A;  1YIJ P;  1USE A;  3CCS P;  2A45 G;  3L75 E;  1NU1 E;  5CCH C;  1HH0 A;  5K5G B;  4D6T D;  3TYY A;  1VF5 B;  3V2N A;  3IR9 A;  1P84 I;  1FAV A;  3A5T A;  3A0H H;  3C1L A;  1KQF B;  4IFM A;  4NPD A;  2YO3 A;  3SSU A;  2N1T C;  3G3Z A;  4B86 A;  5EFW B;  1NJI Q;  1JUN A;  2M3B A;  2QRX A;  2OYH A;  2QJK C;  1LT9 B;  2KP8 A;  4I2L C;  3BCC D;  3II6 A;  1GL2 B;  4WVZ A;  5AVV B;  3H1K E;  1S72 P;  5CCG D;  1EQ7 A;  1L4A A;  4JYB A;  3RK2 B;  4PV1 B;  1RF1 A;  4TT3 H;  2R5D A;  1VF5 D;  3E1I A;  1KOR A;  5CBN A;  1GTW A;  3IN6 A;  5E79 H;  4WY4 C;  2O01 J;  2IX7 C;  1IFP A;  1LWU B;  3HE5 A;  2JWD A;  1NVO A;  1DD3 A;  2W6J H;  1GL2 D;  2IFN A;  4IOI H;  3FWN A;  2ZYA A;  3LW5 H;  5M1B A;  3D6Y A;  5AW9 B;  3RK2 D;  1PGO A;  3MHV A;  5KKZ B;  4PV1 D;  3V2R A;  1W2B O;  1RE4 C;  2K3R A;  1YI2 P;  3HE4 A;  1NU1 D;  3L75 D;  3Q1M A;  4RES B;  2RKL A;  2O01 N;  3K5B A;  2OTK E;  3V2Q A;  1SFC B;  4EOT A;  2YKO A;  1KZU B;  2KS1 B;  3WUV A;  2OAR A;  2OYO A;  2H88 C;  1AVY A;  2N9Y B;  4U3F G;  3CCR P;  2WVR A;  3CMA P;  2H7H A;  1DH3 A;  3L74 G;  3BAS A;  3SWF A;  3R2P A;  3VTP C;  1VQK P;  2JJL A;  1VQO P;  2I1K A;  4I7Z C;  4OGQ D;  5APQ A;  1AVO A;  4KT0 J;  1E79 H;  2N1T B;  1RE3 C;  4EIJ A;  4U3F D;  3GHG C;  1KYO E;  1GU5 A;  1SFC D;  4UB6 E;  1SQQ G;  3AE6 C;  3KYQ A;  2C9L Y;  1EDK A;  2I8D A;  2K9Y A;  3L74 D;  2PP6 A;  3M9H A;  1KQS O;  3JC2 2;  2WZ7 A;  3F89 A;  4RO0 A;  2G3A A;  2Y9Y A;  2XV5 A;  5CJ4 A;  1R5S A;  2B9B A;  1BGY J;  1NTM K;  3TSI A;  1HBW A;  2L91 A;  3WU2 E;  4GOD A;  5KJ7 D;  1SQB J;  3KXD A;  1T2K C;  2ZT9 D;  2FFD A;  2O1K A;  1FJP A;  3L73 E;  5C39 A;  3VOP A;  1MV8 A;  1IZN B;  1OW6 A;  3CWB J;  4PJ0 H;  1N7S C;  3AEE C;  3H1H E;  2HYN A;  1X9V A;  2QIW A;  4ZMD A;  1NTZ K;  3MUD C;  1L0L J;  4N78 D;  2LXC B;  1BE3 G;  3H1I E;  4XFJ A;  3A3Y B;  4C7N B;  3A0H E;  2FYU E;  1SQX G;  1VQN P;  2ZYD A;  4TLF A;  2XND H;  1S5L X;  1K04 A;  1IFJ A;  5KLV J;  3KHU A;  4XE5 B;  3M0A A;  1PZQ A;  1HUC A;  1BE3 D;  1IFI A;  1LTJ C;  4GOF A;  2E74 C;  1PP9 G;  3AEA C;  1FZF A;  2HG5 D;  3GF7 A;  3AEG C;  2FY8 A;  2E75 B;  1IK9 A;  4BWN A;  2JO1 A;  2C9N Y;  2J5U A;  5CBO A;  4I7Z B;  1D7M A;  2KZJ A;  3L70 J;  3M06 A;  3NMD A;  5E79 E;  1KB9 I;  1S5L H;  1PP9 D;  2AEF A;  1KIL A;  1CSB A;  1SQP J;  1OZH A;  3Q5S A;  2Z5I A;  3L73 D;  3TF5 A;  3WUU A;  1FZC A;  3O6Q B;  1GW4 A;  2WPV B;  3T97 B;  2A06 E;  3U59 A;  3H1H D;  2FYZ A;  2E75 D;  1NTK E;  1WRG A;  2JEE A;  2OYI C;  5KAI H;  1SVF A;  1JOC A;  3H1L G;  1VQ4 P;  2W6A A;  3D71 A;  1U7M A;  3AED C;  1AFO A;  1QVG O;  1N7S B;  2Y0E A;  3AE7 C;  1H88 A;  2K88 A;  5KLI B;  4WWI A;  5AVS B;  1H89 A;  4O9B A;  4L73 A;  1M90 Q;  3L71 J;  1J1E C;  2BCC J;  3TNU A;  1X79 B;  3ABV C;  4BRY B;  1SQV J;  3CXH H;  2B87 A;  1WT6 A;  2WT7 A;  3GG2 A;  2H89 C;  2KNC A;  5B66 E;  3RK3 C;  1RF1 B;  1BCC G;  1PIX A;  1DX7 A;  1NU1 K;  1A02 F;  1YJW P;  2KLU A;  3A7O A;  4H44 C;  5CCH A;  2A45 I;  1PL5 A;  2CK3 H;  2J58 A;  4IL6 X;  2A06 D;  1BCC D;  1OMI A;  2H43 A;  3P8M C;  1XTC C;  3IAO A;  1L4A D;  1JCD A;  2IZ0 A;  2FXP A;  4OH8 B;  3AE4 C;  4R4M A;  4EI2 A;  3CX5 H;  1LTT C;  2OQQ A;  3HD7 B;  1NTM G;  1H0T A;  2ZYG A;  5AW7 B;  4YPC A;  1S9K E;  4IL6 H;  1T8Z A;  2ZXE B;  1KD1 Q;  1NHL A;  1EXJ A;  2KIK A;  1VF5 C;  3B5N A;  4GDO A;  3AE2 C;  4H13 B;  3W67 A;  5L8R J;  2R3C A;  1FE6 A;  3CXH I;  5AVY B;  1NWQ A;  1JY3 O;  1YJN P;  3L35 A;  1FDM A;  3KQG A;  1NTZ G;  3PHL A;  1GL2 C;  3HD7 D;  1UIX A;  2ZFC A;  1L0N G;  4PD4 E;  1FJK A;  1J1E B;  3RK2 C;  2ITA A;  1QEX A;  2R32 A;  4PV1 C;  2HOD B;  1EZV E;  3Q3D A;  4H13 D;  3CCU P;  3JCU H;  1ZP0 C;  1N7L A;  1NTZ D;  2NPS A;  3W68 A;  4MN4 C;  3OW2 O;  1HGV A;  3P8C E;  3CCJ P;  2CPS A;  1L0N D;  1LWU C;  4Z1M H;  1G2C B;  2HPC B;  1BGY E;  2M3E A;  5APU A;  5GTI H;  2FFD B;  5GTH H;  4H44 B;  3CX5 I;  1SQB E;  4CPG A;  1HF9 A;  5KKZ C;  5KAI E;  3L72 G;  1OIP A;  1OVU A;  1OXZ A;  1USD A;  3CWB E;  1S9K D;  2WSS H;  1VQL P;  5AW2 B;  4OGQ C;  1LNQ A;  3BRT B;  3GHG A;  3O8Z A;  1LTI C;  4Y28 J;  1SFC C;  1NOH A;  2W90 A;  3TGU G;  3HRN A;  1KIL E;  2R3S A;  1PV3 A;  1QGK B;  1L0L E;  3H1J G;  2ZXX A;  3R4Y A;  1VQ8 P;  1IC2 A;  4H44 D;  3RL0 g;  1M7L A;  3IFM A;  2QG4 A;  4JYC A;  1LP1 B;  3BCC G;  1TU3 F;  4AQR D;  4PD4 D;  1FZG A;  5CMZ A;  2AXT E;  3CCM P;  5KJ7 C;  3TGU D;  3P32 A;  5KLV E;  1NAY A;  1EZV D;  3CCQ P;  2ZT9 C;  3H1J D;  3C9I A;  3PP5 A;  4HKZ H;  5CJ0 A;  1EDL A;  2LKM A;  4ZKU A;  3P8C D;  2FBW C;  4H0L B;  3L4F A;  2FXM A;  1JCC A;  3L70 E;  1BGY D;  1SS1 A;  1NTM J;  3AE5 C;  1FDO A;  4OWF A;  1Q82 Q;  3GF3 A;  2E5T A;  1HWT C;  1SQP E;  3CI9 A;  2IBZ E;  4L75 A;  2UWJ E;  3OAK A;  5AW8 B;  1MFZ A;  1N73 B;  2GUS A;  3L75 G;  1NU1 G;  4AYC A;  2BAS A;  1RY3 A;  1GD2 E;  3N4X A;  3U1C A;  1VQ7 P;  2JP3 A;  4H0L D;  2ZVN B;  1ZV8 A;  4UB8 E;  3VMA A;  3L37 A;  1KIL D;  4IL6 E;  1L0L D;  3RL0 B;  3MP7 B;  2IYO A;  3SFE C;  2M5A A;  4DOJ A;  3BAT A;  3VMX A;  5DJT B;  4OGQ B;  1WMK A;  3VMY A;  3H1K G;  3GW6 A;  1AQT A;  1QL1 A;  1CI6 B;  5AW5 B;  1QX8 A;  1AV1 A;  1M1J A;  3L71 E;  2BCC E;  3HUS A;  2K9J A;  1SQV E;  1P84 E;  3KPE A;  3USS A;  3RL0 D;  3H1K D;  1ZXG A;  2E75 C;  2OYI A;  2XNX A;  3KZI H;  1URQ C;  1W2E A;  1DIP A;  3JCU E;  1PGJ A;  2Z4E A;  2YIU B;  2ZT9 B;  3OA7 A;  1RF0 C;  1AJY A;  2YXR B;  3PH0 A;  4D6T J;  1HJ0 A;  1RH5 B;  1EC5 A;  5GTI E;  2D2C D;  1HTL C;  5H2F H;  1OWA A;  2XDJ A;  5APW A;  1FBM A;  1CW5 A;  3M0D C;  4HJG H;  2GUV A;  2IDB A;  5TIS H;  1IO4 A;  1KB9 H;  2XZR A;  4AUW A;  3CLQ A;  1PPJ E;  1MUU A;  3G9R A;  2WPR A;  1LGH B;  2Y0D A;  1Q81 Q;  5KLI C;  1GMJ A;  1GW3 A;  1QLE D;  2JDI H;  1J1D C;  1JEK A;  3MTU E;  1NYH A;  3L36 A;  2OYH C;  2BCC D;  1JTH B;  1L0N K;  1N8R Q;  2KSJ A;  3CC7 P;  1FZA A;  1L4A C;  1JNM A;  1PGQ A;  3RBX A;  1RF1 C;  3H32 A;  2Q6Q A;  3B5N D;  2G8Y A;  4N6J A;  1BDD A;  1KYO D;  4GOE A;  4LGD E;  2WSE J;  5CCG A;  2Y9Z A;  3L73 G;  4WB4 A;  2OTJ P;  3A0B H;  1URQ B;  4Y99 B;  5AW1 B;  3H1H G;  1M8O B;  2PFX A;  2Q1K A;  3HTK A;  1YHQ P;  5APX A;  3VYI A;  1LT9 A;  3H1I G;  5APT A;  1Q86 Q;  1ZW0 A;  1GL2 A;  1LT1 A;  2FYU G;  1YBK A;  2NPS D;  4KHX A;  2A45 H;  4ASV A;  3HD7 C;  4LLH A;  1NH4 A;  3MD0 A;  4U3F J;  1VQ9 P;  2IYP A;  4DZO A;  1URQ D;  3QH9 A;  3G71 P;  1X22 A;  3L74 J;  3D6Z A;  4H13 C;  2HFE D;  3H1I D;  3CME P;  2AXC A;  2FYU D;  2V7Q H;  2POH A;  1X0T A;  1LWU A;  1FZB A;  5KTB A;  4JQ0 D;  1YYC A;  2WSF J;  1LJ2 A;  4L74 A;  1SQQ J;  2MJZ A;  1JY3 P;  1R8E A;  1J1D B;  1VL2 A;  2MKV A;  2OYH B;  2K1A A;  3RBZ A;  3AE8 C;  4OVN F; 
#chains in the Genus database with same CATH homology
 3CL3 D;  1IFN A;  4WY4 C;  2IX7 C;  1N7L A;  2NPS A;  1LWU B;  1HGV A;  1L4A B;  3P8C E;  3HE5 A;  2WWW A;  1JMM A;  2CPB A;  2CPS A;  5AVW B;  1CZQ A;  1GL2 D;  1LWU C;  4HYT B;  1G2C B;  2IFN A;  1L0L K;  1ZR4 A;  2HPC B;  1PFI A;  3LW5 H;  2WSE H;  5APU A;  5AW9 B;  3RK2 D;  2FFD B;  2XU6 A;  4N3Y B;  3NXS A;  1GZL A;  3V2R A;  1RE4 C;  2FFD C;  2I1J A;  1T3U A;  3HE4 A;  2NPS B;  1H8A A;  4RES B;  4WY4 D;  3HE5 B;  1OXZ A;  1YTZ T;  4C7R A;  1S9K D;  2W6B A;  5AW2 B;  5BVZ A;  3V2Q A;  5KJ7 A;  4IFD K;  1SFC B;  4EOT A;  2YKO A;  1KZU B;  1GU4 A;  2OAR A;  3BRT B;  3GHG A;  2KB7 P;  3O8Z A;  3V2P A;  1LTI C;  2N1T A;  4WBA A;  1SP4 A;  1SFC C;  2KLV A;  1DEB A;  1NOH A;  3HRN A;  1KQL A;  3HE4 B;  2H7H A;  1IC2 A;  2L5G B;  1LTG C;  1DH3 A;  3BAS A;  3SWF A;  1M7L A;  3IFM A;  4JYC A;  3R2P A;  3VTP C;  2JJL A;  2I1K A;  3V4Q A;  2Q7C A;  2VRS A;  2P2U A;  5APQ A;  4AQR D;  1FZG A;  3GHG B;  5CMZ A;  2N1T B;  1RE3 C;  4EIJ A;  5KJ7 C;  3BRV B;  3P32 A;  2YKQ A;  1JO5 A;  4I1L A;  3GHG C;  1JY2 O;  1M1J C;  1SFC D;  1GU5 A;  3C9I A;  1FZE A;  3KYQ A;  5AVZ B;  2C9L Y;  3PP5 A;  3TK1 A;  2PP6 A;  3M9H A;  5CJ0 A;  4WY4 A;  3HUS C;  2WSF H;  2LKM A;  2WZ7 A;  3NFQ A;  4ZKU A;  3P8C D;  4C46 A;  2XV5 A;  4ZKP A;  2KOG A;  5CJ4 A;  5AW4 B;  1A02 J;  1N73 A;  2KYV A;  3L4F A;  1JY2 P;  3VMZ A;  2FXM A;  3WMM 0;  1JCC A;  1NTM K;  1SQB K;  3TSI A;  3LID A;  4W7Z A;  1HBW A;  5KJ7 D;  1KIL C;  2QM8 A;  1HWT C;  1T2K C;  1RE4 A;  2FFD A;  3CI9 A;  2O1K A;  1FJP A;  4C7N A;  3VOP A;  1MV8 A;  2H8P D;  3OAK A;  2N9B A;  5AW8 B;  1MFZ A;  1N73 B;  2GUS A;  1N7S C;  1G1J A;  4AYC A;  2BAS A;  1JY3 N;  1RY3 A;  1GD2 E;  2C0X A;  5AVU B;  2HYN A;  3N4X A;  1X9V A;  3A2A A;  4IFF A;  3U1C A;  1N73 C;  2C0W A;  1NTZ K;  1ZV8 A;  1CI6 A;  2WPS A;  1SFC A;  3VN0 A;  5APS A;  5AVX B;  1NKZ B;  2YMY A;  3L37 A;  4N78 D;  1KIL D;  1FOS F;  2E42 A;  3MGN A;  1T3J A;  3A3Y B;  3BVH A;  3RL0 B;  1T2K D;  4C7N B;  4I6M C;  3V5B A;  1IJD B;  1G1I A;  1LTS C;  2Z5H A;  4DOJ A;  3RL0 C;  3BAT A;  2E43 A;  4GT1 A;  3SWY A;  3VMX A;  1N7S D;  5KLV K;  1XTG B;  3VMY A;  2P67 A;  1X8Y A;  1LTJ B;  1QL1 A;  1E5W A;  4GIF A;  1CI6 B;  2P7J A;  1IFJ A;  2IFM A;  1RE3 A;  5CHX A;  4XE5 B;  1HJB A;  5AW5 B;  2O1J A;  3M0A A;  1HUC A;  2W27 A;  2P1J A;  1IFI A;  1LTJ C;  4HH2 A;  1M1J A;  1VPC A;  3VP8 A;  2Q5U A;  1FZF A;  2HG5 D;  1N86 A;  3HUS A;  4XA4 A;  1IK9 A;  1ZN5 A;  3KPE A;  1LTB C;  5APV A;  3RL0 D;  2FKW B;  3LIE A;  1YTZ I;  2C9N Y;  3T97 A;  2OYI A;  5AVQ B;  2XNX A;  3M06 A;  1URQ C;  3NMD A;  1W2E A;  1SQP K;  2Z4E A;  1M1J B;  1KIL A;  3OA7 A;  1CSB A;  1RF0 C;  3B8E B;  3KDP B;  1NKN A;  2QM7 A;  3H6P A;  2Z5I A;  4W7Y A;  3HUS B;  1FZC A;  3VP9 A;  5CCG C;  1GW4 A;  5AVR B;  4M3L A;  2HLO A;  1N7S A;  1SLQ A;  2WSC H;  1N2D C;  1LTA C;  1HTL C;  3EFG A;  1ZR2 A;  2OYI B;  3U59 A;  1OWA A;  2FYZ A;  1WRG A;  1GK6 A;  2JEE A;  2OYI C;  2XDJ A;  4LC1 A;  5APW A;  1FBM A;  3HTK B;  3MUD A;  1KIL B;  1SVF A;  1CW5 A;  3M0D C;  2YKP A;  1JOC A;  1VDF A;  3M9B A;  2FYU K;  2GUV A;  2Q3I A;  2W6A A;  5APY A;  1IO4 A;  2J59 M;  2XZR A;  1AFO A;  1FZC B;  4AUW A;  1JTH A;  1LT9 C;  2XKM A;  1JY2 N;  1N7S B;  3CLQ A;  1H88 A;  1FZC C;  1SQQ K;  1MUU A;  2WPR A;  5AVS B;  1LGH B;  3M91 A;  1KFM A;  1H89 A;  3NTN A;  1GW3 A;  4O9B A;  1GK4 A;  3B5N C;  2Q9I A;  1LTJ A;  1J1E C;  1SQV K;  1J1D C;  3MTU E;  5BU8 B;  3TNU A;  1X79 B;  3L36 A;  2OYH C;  1JTH B;  1L0N K;  1GDT A;  1WT6 A;  2WIT A;  3RK3 B;  2KSJ A;  2WT7 A;  1FZA A;  3UIA A;  1FU1 A;  4GKG A;  3I5C A;  1L4A C;  3RK3 C;  4W80 A;  1RF1 B;  1URQ A;  3U1A A;  1Z56 A;  1JNM A;  1J2J B;  1IFM A;  1DX7 A;  5AW0 B;  1RF1 C;  1NU1 K;  3H32 A;  3V4W A;  1A02 F;  1AQ5 A;  5AW6 B;  2WTY A;  1RF0 A;  3B5N D;  3M9Q A;  1IFD A;  3TNU B;  4N6J A;  3A7O A;  2YO2 A;  2IPP A;  1NAF A;  1NO4 A;  3OJA B;  1QL2 A;  4LGD E;  5CCH A;  5CCG A;  2WT7 B;  2A45 I;  1NTK K;  5AW3 B;  2J58 A;  2M8R A;  2NPS C;  3HD7 A;  4WB4 A;  1HVV A;  2H43 A;  2YNY A;  1XTC C;  3P8M C;  1URQ B;  1L4A D;  1MZ9 A;  4Y99 B;  5AW1 B;  3RK3 D;  1SQX K;  1JCD A;  3H32 B;  1HGZ A;  3M0D A;  4Y99 C;  4N78 E;  3HTK A;  1KFN A;  5APX A;  4OH8 B;  3VYI A;  5BU5 A;  1LTT C;  1LT9 A;  2A45 G;  3HD7 B;  5APT A;  1ZLL A;  5CCH C;  1HH0 A;  1GL2 A;  5AW7 B;  2NPS D;  4KHX A;  1S9K E;  2A45 H;  3TYY A;  3HD7 C;  3N7N A;  3V2N A;  4LLH A;  1T8Z A;  2ZXE B;  3IR9 A;  1NH4 A;  1FAV A;  2WPQ A;  3MD0 A;  1NHL A;  4JF7 A;  3A5T A;  4IFM A;  3B5N A;  4DZO A;  1URQ D;  2YO3 A;  2N1T C;  3G3Z A;  4B86 A;  2GM4 A;  2R3C A;  1JUN A;  2M3B A;  2HOD A;  2OYH A;  2HFE D;  1LT9 B;  5AVY B;  2KP8 A;  1NWQ A;  4I2L C;  1JY3 O;  3II6 A;  1GL2 B;  3L35 A;  1FDM A;  3KQG A;  5AVV B;  2POH A;  5CCH D;  5CCG D;  1EQ7 A;  1LWU A;  1L4A A;  2R5B A;  4JYB A;  1FZB A;  1GL2 C;  5KTB A;  3RK2 B;  3HD7 D;  5AVT B;  1YYC A;  2ZFC A;  3B5N B;  2MJZ A;  1G2C A;  1RF1 A;  1FJK A;  2O01 H;  1J1E B;  2HPC A;  3RK2 C;  1JY3 P;  2R5D A;  1J1D B;  1FOS E;  3EQ2 A;  3E1I A;  3P7K A;  2R32 A;  3MIW A;  2HOD B;  2PAJ A;  2OYH B;  2N1T D;  4WY4 B;  1GTW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...