2H43A

Crystal structure of human fragment d complexed with ala-his-arg-pro-amide
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
70
structure length
70
Chain Sequence
b'VIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKDLLP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrinogen alpha chain
publication title Differences in Binding Specificity for the Homologous gamma- and beta-Chain "Holes" on Fibrinogen: Exclusive Binding of Ala-His-Arg-Pro-amide by the beta-Chain Hole.
pubmed doi rcsb
molecule tags Blood clotting
total genus 24
structure length 70
sequence length 70
chains with identical sequence D
ec nomenclature
pdb deposition date 2006-05-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2h43A00
1JY3O 3HUSC 1T3UA 3E1IA 1RE3A 2OYIC 1JY2P 1FZEA 1W2EA 1FZAA 1RF0A 1N86A 2HLOA 1FZCA 2A45I 1JY3P 2HODA 2FFDA 3GHGA 2A45H 1FZFA 1LWUA 2Q9IA 1FZCB 1RF1A 1LT9A 1M1JA 1RE4A 3GHGB 2HPCA 1RE3C 2FFDB 2HODB 3BVHA 2OYHA 1LT9B 1JY2N 1LWUB 1LTJA 1M1JB 1RF0C 1N73A 2HPCB 1RF1B 2A45G 1FZCC 1FZGA 2FFDC 3HUSA 1N73B 3GHGC 2OYHB 1LWUC 1FZBA 1LTJB 3H32A 2XNXA 1RF1C 1JY3N 1JY2O 1LT9C 1M1JC 1RE4C 3HUSB 2OYIA 2OYIB 2H43A 2OYHC 3H32B 2Z4EA 1N73C 1LTJC
chains in the Genus database with same CATH superfamily
1G2CA 3L74E 1K05A 2E75D 2C0XA 1NTMG 1L4AC 3L72E 1VPCA 4H13C 3AEFC 2A06G 1U7MA 2YXQB 3N4XA 2FYNB 1EQ7A 3SWFA 1LWUC 1A02F 1HWTC 3CCSP 3L75G 2KZIA 1AQ5A 4IL6E 1GK6A 1G1IA 4GIFA 3V2PA 4YTPC 4B86A 1RQVA 2KXPB 2B87A 1N86A 2FXOA 2WQYC 1VQ9P 1P84D 1EZVE 3LIEA 3WU2H 1S4XA 3F5HA 2FXMA 2M5AB 3H1LE 2UWJE 1SQQG 1NOHA 4H0LC 1IK7A 5APSA 4U3FE 2Q1KA 4R4LA 1Y9BA 2WSEJ 2CK3H 3A3YB 1L0LD 5AW7B 2I1KA 1BCCD 2JDIH 2V7QJ 1EDLA 4L73A 3GMAA 3M9QA 3RBZA 2OYIB 5AVWB 2M3EA 1LTJC 1AFOA 1YBKA 1YTZT 2WT7A 1N7LA 1D7MA 1PV3A 3C1LA 2ITAA 2M0BA 1YQ4C 1FDOA 2JR8A 2FYUD 3LIDA 1LNQA 3Q5RA 2FKWB 2GUSA 1OFCX 3L70G 1GU5A 2V7QH 1M57D 2AXTE 1JY2P 1VQLP 4GOEA 3ABVC 3CPWO 4LLHA 2QJPB 1FZFA 2VRSA 2Y0EA 1FZCB 1RE3C 3HD7A 3BRTB 1RF1C 1URQA 4HB1A 1BGYD 1KTMA 2B9BA 1USDA 2IBZI 3H1KJ 5DJTB 4W7ZA 2OYHB 3GF7A 2ZYGA 1RE4C 1QL2A 1SQPG 3CCRP 5B66H 2Z5IA 1OVVA 2KNCB 5AVZB 5CJ0A 3PRJA 3VMAA 4WY4D 1FOSE 3M0AA 2O01J 3AEGC 2GA1A 1NTME 1KILC 1L0LG 2ZYAA 3CCUP 3FWLA 1BCCG 1M1JC 1KQFB 2A06E 1FE6A 1L4AA 1CI6A 4I7ZC 3AE9C 4IL6X 3L36A 3S1KA 3IAOA 1BDCA 2HLOA 1L0LK 5CCHD 3L75E 1LWUA 3TGUD 2FYUG 5E79H 1BE3J 4N78E 3C9IA 3R4YA 5C39A 2FYUK 2D2CC 5TISE 1VQ6P 3L4FA 1FJKA 1MZ9A 1NTZD 1SQQE 3CWBD 3CCVP 3H32A 5CJ4A 3VYIA 3Q3DA 5KKZC 2KS1A 2OTJP 1PIXA 1VQPP 2XV5A 1KQLA 1BGYG 3MIWA 5AVVB 2A45I 1MV8A 4PV1C 4WY4B 3HE5B 1ZP0C 5AW0B 3MD0A 1LTJA 3A2AA 1QEXA 3RK3D 4EDFA 3MZWB 5AW6B 3G9RA 4TLFA 5CMZA 4W7YA 3A0HE 1KYOE 1KFMA 1KB9E 3AE2C 3L70E 4DCKA 3M06A 2N9YB 2WITA 3F89A 5DJUB 3EQ2A 2E42A 3ITKA 5KLVD 1T2KD 1G2CB 2YKOA 3AECC 4ZKPA 4Y99C 2GM4A 2Q9IA 1RF1A 3M9HA 3AE1C 2R3SA 3TGUG 1MFZA 4WBAA 1MFTA 1AQTA 3CX5H 3CCQP 3WMM0 3CMEP 1IJDB 1W2EA 1P84E 2I8DA 5AW4B 5KLIC 2B87B 2AEFA 3H1IJ 1RE4A 1KMIZ 2YXRB 3MTUE 5AVXB 3RK3B 3QH9A 1H89A 3HD7D 4IFDK 1NTZG 1NTKD 3MUDC 3CWBG 3G3ZA 1FDIA 2ZJSE 1URQD 2YNYA 3A5TA 4GT1A 3K5BA 2WSCJ 1L0LE 4D6TD 3LW5H 1BCCE 3VP8A 3IN6A 1LT1A 1KILA 1NTZK 4XE5B 2MJZA 2P1JA 4UB8E 1M1JA 2BCCJ 1JM0A 3KYQA 2JWDA 1ZXGA 4M3LA 5BU5A 2B88A 3B4SA 3BRVB 1IFMA 3OJAB 2FYUE 3A0BE 2WT7B 3CLQA 3JCUH 4PD4D 1WRGA 3BASA 1SQXJ 2QG4A 2YMKA 1YIJP 3RL0C 3NXSA 5CHXA 3BATA 4O9BA 2C0WA 3D71A 5KAIH 1ZRTD 5KAFH 1IZNB 1L4AD 4H13D 1FDMA 4ASVA 3CI9A 1SQVJ 1RF0C 3P8CD 3HD7B 1Q82Q 2RKLA 1BGYE 5KLVK 5M1BA 2ZYDA 1OVRA 1JMMA 1URQB 4L75A 3FXEA 1VDFA 2LKMA 5L8RJ 3EFFK 4JBZA 2R5BA 1JEKA 1PGPA 4H44B 1UIXA 3M91A 2HFED 2RMZA 4OWFA 2XKMA 2KK7A 4H0LD 2QJKC 1T2KC 2KLUA 1AA0A 3KZIE 1SQBJ 2XU6A 1SFCD 3TF5A 4D6TG 1JUNA 3D6ZA 2XZRA 1Q81Q 2QRXA 1NTKK 3M0DA 3PTZA 1BDDA 1WMKA 1KV4A 5AVSB 3O8ZA 1VQKP 2WWWA 1DD3A 1H0TB 2IPPA 2WSSH 3TGUE 2G3AA 1J1DC 1K73Q 2Q3EA 2KB7P 2CPSA 3CXHE 3CMAP 3I56P 1JCDA 3I55P 2H88C 1GL2C 3AE4C 2LR2A 3SFDC 2JO1A 1KZUB 1NTZE 2O1KA 3CWBE 4ASWA 1L0NJ 3MUDA 4I2LC 4LGDE 2WSFJ 2H8PD 5TJHA 2P67A 3H1KD 3CCMP 3H32B 4RJTA 2GUVA 3CX5I 2N1TC 1LTTC 3AEBC 3W67A 3E7KA 4IL6H 2K9JA 3HTKB 4K35A 2HODB 2ZVNB 1FC2C 3U59A 1T3JA 3N7NA 2W27A 5AVUB 1AVYA 2WSFH 2E74B 2NPSC 1JY3P 2CPBA 3IR9A 1DEEG 1KILD 1BSHA 2P58A 5KLVE 1PGJA 5GTIE 3VN0A 1S5LE 3H1HJ 1VL2A 1BE3D 1JMBA 1LGHB 2OARA 1RF0A 3TNUA 2A45H 2HR3A 5BU8B 3KDPB 4L76A 1GZLA 1KFNA 3GHGC 3P7KA 1S2EA 3NMDA 1XTCC 2D2CD 1YHQP 2AXTH 3FX0A 2IX7C 1NTKE 4BRYB 1E79H 1SFCC 3S9OA 1KORA 1X0TA 2Y9ZA 4D6TE 3H1KG 2E75B 1KQSO 4PV1D 2H7HA 1S9KD 1NTMJ 2E76D 2HYNA 4C7NA 5EFWB 3FGAD 1M1JB 3B5NC 3WUTA 1YJ9P 5B5EE 3V6IA 1DIPA 4PD4E 1T6AA 1FZEA 3L75J 2ZT9C 1MKMA 1M8OB 2J59M 1HGZA 2YKPA 1GK4A 1GL2A 1ZRTE 1T8ZA 1YITP 1IFPA 3V2NA 1RQUA 3L37A 3OW2O 1PP9D 1QGKB 3SWYA 1H8AA 3ZDMA 3VMZA 4QMAA 1Z56A 2YO2A 1BE3G 1NKZB 3P8CE 1SQQJ 1KN7A 2POHA 4W80A 5KKZB 1IC2A 3TSIA 2FFDC 3T97A 3H1ID 2N1TA 3P8MC 3L71D 1M1KQ 4ZNCA 4PV1B 2IZ1A 1RHZB 2PFXA 1IO4A 2IYOA 5TISH 1IK9A 2QM7A 1SLQA 1JY2O 1S5LX 2BCCD 1N2DC 5H2FE 3V2RA 2NPSA 3V2QA 3SFEC 3L35A 1TU3F 1LTAC 1GDTA 2QA4P 5K5GB 4KT0J 4ZKUA 1HVVA 3L70J 2BEQD 5AW5B 3L73J 3VOPA 2P7JA 5APVA 1EZVI 1SS1A 2JKVA 3CXHD 2O1JA 5CBNA 2KLVA 1YTZI 4DOJA 3GHGA 5APTA 3A0HH 3H1JJ 2QEXP 1HF9A 1X9VA 1QVFO 2HPCA 1KYOH 5CBOA 1CW5A 1EDJA 3RL0D 1KB9H 1OW8A 1HJBA 2KI7B 2W90A 4DJGA 2H43A 1HUCA 1ZR4A 2KIKA 2PAJA 1SQVD 1Q2NA 1EC5A 3TK1A 5AVQB 4HJGH 5KLIB 1PP9G 1SFCA 2KOGA 1SQPJ 3V4QA 4XFJA 1YQ3C 3PJSK 2OYOA 2JJLA 3H1KE 3I5CA 2E76C 4WVZA 1H88A 1X8YA 2OYHC 1NWQA 2K3RA 3EFGA 3HUSC 2KP8A 3L71G 4C7RA 2IBZD 3B5NA 3NTNA 2AEJA 1P84H 1NVOA 1JY2N 2K1AA 1SQBD 3V5BA 3VP9A 3G4SP 2JP3A 3M0DC 3D70A 3RBXA 1OX3A 3USSA 2ZFCA 1KILE 3GW6A 2FBWC 2OQQA 3WUUA 1N7SC 3FWNA 1VQOP 3CCLP 5AVYB 3VMYA 4UB8H 2FY8A 1BE3E 1J1EC 2K37A 3BCCD 3LW5J 1Q7YQ 1R5SA 2P2UA 2FFDA 3A0BH 4DZOA 1NGMB 3TNUB 3PLNA 2Y0DA 1SQXK 1GL2D 2NZ2A 2XDJA 1USEA 2G8YA 2C9NY 1SQVG 4OH8B 3AE5C 4IFMA 2LXCB 1DH3A 4KJMA 3RK2C 1NAFA 1YI2P 2B89A 1SQVK 4OVNF 2N1TD 1PGOA 1S9KE 4C46A 4CPGA 1X22A 3FXDA 4UB6E 1Q86Q 2BASA 3CCEP 2IBZG 4Y28J 3PHLA 4C7NB 5AVRB 1FZBA 2HG5D 2WPQA 4GOFA 2YIUB 1HH0A 2O3JA 3TGUJ 3EWKA 2NPSD 3HE4A 3W68A 1J1DB 5KLVG 1L2PA 1PFIA 2YMYA 3H1HD 1XTGB 2QJYB 1NJIQ 3KZIH 1PPJD 1SQBK 4OGQC 1PP9E 1QL1A 3KHUA 1GL2B 3O6QA 1JTHA 3SWKA 4Z1MH 2IFNA 4AUWA 3BCCG 1NU1J 2R32A 3IFMA 1LJ2A 2R5DA 1LTIC 1KYOI 2OYHA 3H1IE 1PGQA 2Q6QA 1KB9I 3HUSA 2QE7H 3L71E 3CXHH 3T97B 1N73C 1NTKG 3CD6P 2KNCA 3WUVA 2Q7CA 5KJ7C 5APXA 4EYYQ 1NYHA 1HJ0A 1VF5C 2BCCE 5CCGC 1L0NK 1AJYA 3L74J 2MKVA 3GLMA 3CCJP 1L4AB 1CI6B 2W83C 3L72J 4H13B 1N7SA 2ZAEB 2IZ0A 1FZAA 1ZV8A 1IFDA 1VQNP 1ZLLA 2YO3A 1P84I 3B5ND 1RH5B 1DX7A 1ZW0A 1LWUB 1LT9C 1KD1Q 1JB0J 2RH0A 3SSUA 3VMXA 3JSVC 2ZT9D 3CL3D 2FXPA 4RESB 2N9BA 3GHGB 2HPCB 3H1HG 1SQVE 1W5CE 1ZR2A 1PPJG 3H1LJ 3G71P 1Y8AA 4H0LB 3OAKA 2KS1B 5GTIH 4U3FJ 1S5LH 1SFCB 2JEEA 4U7JA 2E43A 1KQGB 4H44C 4TT3H 1Q90D 1LTJB 1YJWP 4PJ0E 1QVGO 1IFNA 3B71A 5AW3B 2M8RA 1QLED 2IBZE 4JQ0D 3P32A 2OGUA 2Q5UA 1OZHA 1SQBE 2KSJA 3L73D 3AE7C 1R8EA 2LXBA 5GTHE 2RN0A 5APWA 2J5UA 2K9YA 5KTBA 1N8RQ 2ZT9B 3Q5SA 1OW7A 3HRNA 3CC2P 2PP6A 1RF1B 3BCCE 3V4WA 1GU4A 1NTMK 3H1JD 5B5EH 2FYZA 2WTYA 1K9MQ 4PD4H 2I1JA 3TYYA 1DD4A 2FFDB 3BVHA 2JWAA 1N73A 5BVZA 1L0NE 1SQPD 1PL5A 1CSBA 5KJ7A 1KC8Q 1JY3O 2OTLP 1ZN5A 1JCCA 1YJNP 5CCGA 1VQ5P 4BXLA 1KILB 4R4MA 1HTLC 1SQQK 3H6PA 2IYPA 4I7ZB 1VQ4P 1EDIA 3CXHI 4EOTA 2KYVA 1RY3A 3CX5D 2QM8A 1EXJA 3E1IA 1K8AQ 2R3CA 1GW3A 3WU2E 2E74C 1ZOYC 1LT9A 2WZ7A 1M56D 3QWOC 2FYNC 2WSEH 1LTSC 2AXCA 1OWAA 2ZXXA 3L73G 1UIIA 1A02J 3H1HE 5H2FH 2D2CB 3VTPC 3HE4B 1PPJE 1DEBA 1N7SD 2Y0CA 1OXZA 4JF7A 3O6QB 1JTHB 3KPEA 1NHLA 1EDKA 3H1JG 4DT0A 2PRRA 2BEZF 2E76B 2XNDH 2WPRA 1JO5A 1PZQA 3M9BA 1S1CX 2YKQA 2Z5HA 1JY3N 3HUSB 2W6AA 1U57A 2OYIC 1SP4A 1GW4A 2K88A 2Q3IA 5AVTB 2E75C 3NFQA 1FJPA 3RK2D 1SQPK 4I6MC 1YYCA 2WVRA 3G6EP 3PH0A 4RO0A 1VQ8P 2E5TA 1H0TA 1SQXD 4Y99B 3U1AA 3R2PA 1N7SB 1NH4A 4YPCA 5APQA 4N6JA 2QJPC 4K3AA 1FZCC 1J1EB 5B66E 3MGNA 3JC22 2O01H 4I1LA 1LP1A 4NPFX 2QIWA 3KXDA 1E5WA 4GODA 3PP5A 4OGQD 1VQMP 1NU1D 1QX8A 2W8ZA 4IOIH 4JYBA 1M7LA 4YXWH 1L0LJ 3H1IG 3Q2YA 1BCCJ 4WWIA 3HTKA 2W6JH 4PD4I 3RK2B 2HODA 4WB4A 5E79E 1MUUA 2IFMA 2K9JB 2V4HA 1NO4A 2XNXA 2J58A 4GDOA 2FYUJ 5KJ7D 2BCCG 2WPSA 3L74D 2L5GB 1VF5D 3L72D 1G1JA 3RL0B 5CCGD 3L73E 4HKZH 2NRGA 4XA4A 2AEMA 4AQRD 1RE3A 1GD2E 3S4RA 1J2JB 4AYCA 1SQXG 3TDKA 2L91A 1IFJA 1GMJA 4OGQB 1S72P 4UB6H 1PP9J 4N3YB 3H1JE 3CC4P 1BGYJ 3E1RA 3MHVA 1EZVD 2M5AA 1L0ND 1LTBC 2KSEA 3RL0g 1HGVA 2DW3A 5AW1B 1W2BO 3H1LD 1FBMA 4L74A 3KQGA 4LC1A 4BRYA 2E5YA 1SQPE 2ZVOB 3GG2A 4U3FD 3L71J 4WY4C 1N73B 2IDBA 2KZJA 3D6YA 2OYIA 3Q1MA 4ZMDA 4JPZB 2QJKB 1NU1G 2W6BA 3C8VA 3Q5PA 2SPZA 4HH2A 1SVFA 1OMIA 1M90Q 1VF5B 5AW8B 1NU1K 4H44D 5CCHC 3B8EB 3CX5E 1BSNA 4RKUJ 1S3JA 1R5LA 4MN4C 1SQBG 1AVOA 4JYCA 3IF4A 1FZCA 3GF3A 3L74G 4KHXA 2QSIA 2WSCH 1LT9B 2KUBA 1AV1A 4HYTB 3L72G 3AE8C 2M3BA 2R44A 2Z4EA 1NTZJ 4EI2A 3U1CA 3CWBJ 1OVUA 5AW9B 1IFIA 3AE6C 5APYA 1JNMA 3AEDC 3RGUA 3RK3C 1JOCA 3H25A 2N1TB 3JCUE 1EZVG 1L0NG 1U7JA 1NKNA 1ZMEC 4EIJA 2ZXEB 3H1LG 1GTWA 3CC7P 5KAIE 3AE3C 3AEAC 5KAFE 4U3FG 1NTMD 2A06D 3A7OA 2NPSB 1HBWA 4GKGA 2OTKE 3UIAA 5KLVJ 2C9LY 2WPVB 2A45G 3L75D 1WT6A 1FZGA 1X79B 1SQXE 1FAVA 1FU1A 2O01N 4N78D 1LTGC 1T3UA 4PJ0H 2YIUC 2QVAA 2E74D 3BCCJ 2PGDA 2QJYC 4IFFA 1SQQD 3HD7C 1OW6A 3OA7A 4BWNA 2WMMA 3AEEC 5AW2B 1LP1B 2P10A 1URQC 5GTHH 1CZQA 1EXIA 5APUA 4WY4A 1NTKJ 1NU1E 3HE5A 1OIPA 1NAYA 1Y47A 2H89C 4D6TJ 1FS0E 1FOSF 5CCHA 4A7PA 4NPDA 3RK3E 2Y9YA 1KYOD 3B5NB 4YXDC 1KB9D 4NPEA 3II6A 3MP7B 1K04A 3L70D 1VQ7P
chains in the Genus database with same CATH topology
1JMMA 1G2CA 1JTHB 1URQB 3KPEA 3M0DC 1NHLA 1VDFA 2C0XA 2LKMA 1L4AC 2R5BA 2ZFCA 1VPCA 3N4XA 1N7SC 2WPRA 1JO5A 5AVYB 1EQ7A 3VMYA 3M91A 3M9BA 2HFED 3SWFA 1LWUC 2YKQA 2Z5HA 1JY3N 2XKMA 3HUSB 1A02F 1HWTC 1J1EC 2W6AA 1AQ5A 1GK6A 2OYIC 1T2KC 1G1IA 1SP4A 4GIFA 3V2PA 2P2UA 1GW4A 2Q3IA 5AVTB 4B86A 1N86A 3NFQA 2XU6A 2FFDA 1SFCD 4DZOA 1FJPA 3RK2D 3TNUB 1JUNA 1SQPK 2XZRA 4I6MC 3LIEA 1NTKK 1YYCA 3M0DA 5AVSB 1SQXK 2FXMA 1GL2D 3O8ZA 2XDJA 4Y99B 1NOHA 2WWWA 2C9NY 4OH8B 3U1AA 2IPPA 4IFMA 5APSA 3R2PA 1N7SB 1DH3A 1NH4A 1J1DC 3A3YB 5AW7B 2I1KA 5APQA 4N6JA 2KB7P 3RK2C 2CPSA 1FZCC 1J1EB 1NAFA 1SQVK 1JCDA 3M9QA 2OYIB 3MGNA 5AVWB 1LTJC 1AFOA 2O01H 1YTZT 1GL2C 2N1TD 4I1LA 2WT7A 1N7LA 1E5WA 1S9KE 4C46A 3PP5A 1KZUB 2O1KA 3LIDA 2BASA 3MUDA 4I2LC 4LGDE 2FKWB 2GUSA 4C7NB 5AVRB 1FZBA 2H8PD 2HG5D 2P67A 2WPQA 4JYBA 3H32B 1M7LA 2GUVA 1GU5A 1HH0A 2NPSD 1JY2P 2N1TC 3HE4A 1LTTC 1J1DB 3HTKA 1PFIA 2YMYA 4LLHA 3RK2B 2HODA 4WB4A 3HTKB 1FZFA 2VRSA 1FZCB 1XTGB 1MUUA 2IFMA 1RE3C 2HODB 3HD7A 1SQBK 3BRTB 1NO4A 1QL1A 2XNXA 1GL2B 1RF1C 3U59A 1T3JA 1JTHA 1URQA 2J58A 3N7NA 2W27A 2IFNA 4AUWA 5KJ7D 5AVUB 2WPSA 2WSFH 2R32A 3IFMA 2NPSC 2L5GB 2R5DA 1JY3P 2CPBA 1LTIC 4W7ZA 1G1JA 3IR9A 1KILD 3RL0B 5CCGD 2OYHA 3HUSA 4XA4A 2OYHB 1RE4C 4AQRD 1QL2A 3VN0A 1N73C 1RE3A 1GD2E 2Z5IA 2Q7CA 1LGHB 1J2JB 2OARA 4AYCA 5AVZB 1RF0A 5KJ7C 1IFJA 5APXA 3TNUA 5CJ0A 2A45H 5BU8B 3KDPB 4WY4D 1FOSE 1GZLA 4N3YB 3M0AA 1KFNA 1KILC 5CCGC 3GHGC 1L0NK 3P7KA 3NMDA 1M1JC 1L4AA 1CI6A 1XTCC 1LTBC 1L4AB 1CI6B 1HGVA 3L36A 5AW1B 1N7SA 1FZAA 1FBMA 2HLOA 3KQGA 1L0LK 1ZV8A 4LC1A 1IFDA 5CCHD 2IX7C 1ZLLA 1LWUA 2YO3A 3B5ND 1DX7A 1SFCC 1LWUB 4WY4C 1N73B 4N78E 1LT9C 2OYIA 2W6BA 3C9IA 4HH2A 3VMXA 2FYUK 1SVFA 3CL3D 2H7HA 1S9KD 3L4FA 4RESB 1FJKA 1MZ9A 2N9BA 3GHGB 5AW8B 1NU1K 2HYNA 4C7NA 5CCHC 1M1JB 2HPCB 3B5NC 3B8EB 1ZR2A 3H32A 5CJ4A 3VYIA 3OAKA 1FZEA 2XV5A 1KQLA 4JYCA 3MIWA 5AVVB 1FZCA 2A45I 1SFCB 2JEEA 1MV8A 4WY4B 2J59M 2E43A 4KHXA 2WSCH 3HE5B 5AW0B 1HGZA 3MD0A 1LT9B 1LTJA 2YKPA 1GK4A 1GL2A 3A2AA 4HYTB 1T8ZA 3RK3D 1LTJB 2M3BA 1IFNA 5AW6B 3V2NA 2Z4EA 3L37A 5AW3B 2M8RA 5CMZA 3SWYA 1H8AA 4W7YA 3VMZA 3U1CA 1Z56A 1KFMA 2YO2A 5AW9B 1NKZB 1IFIA 3P32A 3P8CE 2Q5UA 5APYA 2POHA 3M06A 4W80A 2WITA 1JNMA 1IC2A 3TSIA 2FFDC 3EQ2A 2E42A 2KSJA 3T97A 2N1TA 3P8MC 3RK3C 1T2KD 1JOCA 2N1TB 5APWA 1G2CB 2YKOA 4ZKPA 5KTBA 4Y99C 1NKNA 3HRNA 4EIJA 2GM4A 2Q9IA 1RF1A 1IO4A 2ZXEB 3M9HA 2PP6A 1GTWA 1RF1B 1GU4A 3V4WA 1IK9A 2QM7A 1NTMK 1SLQA 1MFZA 1JY2O 4WBAA 1N2DC 3V2RA 2NPSA 3V2QA 3WMM0 3A7OA 2FYZA 1IJDB 2NPSB 3L35A 2WTYA 1GDTA 1LTAC 1HBWA 1W2EA 4ZKUA 1HVVA 4GKGA 2I1JA 5AW4B 3TYYA 5AW5B 3VOPA 1RE4A 2P7JA 2FFDB 3UIAA 3BVHA 2C9LY 1N73A 5APVA 5BVZA 2A45G 3MTUE 1WT6A 5AVXB 3RK3B 1X79B 1FZGA 1H89A 3HD7D 4IFDK 1CSBA 1FAVA 1FU1A 2O1JA 5KJ7A 3G3ZA 4N78D 1JY3O 1LTGC 1URQD 1T3UA 2YNYA 1ZN5A 3A5TA 4GT1A 2KLVA 1JCCA 3LW5H 1YTZI 3VP8A 1KILA 1NTZK 4XE5B 3GHGA 5APTA 4DOJA 2MJZA 5CCGA 2P1JA 1X9VA 1M1JA 2HPCA 1KILB 1CW5A 3RL0D 3KYQA 1HTLC 1SQQK 3H6PA 4IFFA 1HJBA 5BU5A 4M3LA 2H43A 1HUCA 3HD7C 2PAJA 4EOTA 1ZR4A 2KYVA 3BRVB 1IFMA 3OA7A 3TK1A 1RY3A 3OJAB 5AVQB 2QM8A 5AW2B 3E1IA 2WT7B 1URQC 3CLQA 1CZQA 1SFCA 2KOGA 2R3CA 3V4QA 5APUA 1WRGA 4WY4A 1GW3A 3HE5A 3BASA 1LT9A 2WZ7A 2JJLA 3I5CA 3RL0C 1H88A 3NXSA 5CHXA 2WSEH 3BATA 4O9BA 2C0WA 1LTSC 1X8YA 2OYHC 1NWQA 3EFGA 1OWAA 3HUSC 1L4AD 1A02J 2KP8A 1FOSF 5CCHA 3VTPC 3HE4B 4C7RA 1FDMA 1DEBA 1N7SD 3B5NA 1OXZA 3NTNA 3CI9A 3B5NB 1JY2N 1RF0C 3P8CD 3II6A 3HD7B 4JF7A 3V5BA 3VP9A 5KLVK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JY3 O;  3HUS C;  1T3U A;  3E1I A;  1RE3 A;  2OYI C;  1JY2 P;  1FZE A;  1W2E A;  1FZA A;  1RF0 A;  1N86 A;  2HLO A;  1FZC A;  2A45 I;  1JY3 P;  2HOD A;  2FFD A;  3GHG A;  2A45 H;  1FZF A;  1LWU A;  2Q9I A;  1FZC B;  1RF1 A;  1LT9 A;  1M1J A;  1RE4 A;  3GHG B;  2HPC A;  1RE3 C;  2FFD B;  2HOD B;  3BVH A;  2OYH A;  1LT9 B;  1JY2 N;  1LWU B;  1LTJ A;  1M1J B;  1RF0 C;  1N73 A;  2HPC B;  1RF1 B;  2A45 G;  1FZC C;  1FZG A;  2FFD C;  3HUS A;  1N73 B;  3GHG C;  2OYH B;  1LWU C;  1FZB A;  1LTJ B;  3H32 A;  2XNX A;  1RF1 C;  1JY3 N;  1JY2 O;  1LT9 C;  1M1J C;  1RE4 C;  3HUS B;  2OYI A;  2OYI B;  2H43 A;  2OYH C;  3H32 B;  2Z4E A;  1N73 C;  1LTJ C; 
#chains in the Genus database with same CATH topology
 1G2C A;  3L74 E;  1K05 A;  2E75 D;  2C0X A;  1NTM G;  1L4A C;  3L72 E;  1VPC A;  4H13 C;  3AEF C;  2A06 G;  1U7M A;  2YXQ B;  3N4X A;  2FYN B;  1EQ7 A;  3SWF A;  1LWU C;  1A02 F;  1HWT C;  3CCS P;  3L75 G;  2KZI A;  1AQ5 A;  4IL6 E;  1GK6 A;  1G1I A;  4GIF A;  3V2P A;  4YTP C;  4B86 A;  1RQV A;  2KXP B;  2B87 A;  1N86 A;  2FXO A;  2WQY C;  1VQ9 P;  1P84 D;  1EZV E;  3LIE A;  3WU2 H;  1S4X A;  3F5H A;  2FXM A;  2M5A B;  3H1L E;  2UWJ E;  1SQQ G;  1NOH A;  4H0L C;  1IK7 A;  5APS A;  4U3F E;  2Q1K A;  4R4L A;  1Y9B A;  2WSE J;  2CK3 H;  3A3Y B;  1L0L D;  5AW7 B;  2I1K A;  1BCC D;  2JDI H;  2V7Q J;  1EDL A;  4L73 A;  3GMA A;  3M9Q A;  3RBZ A;  2OYI B;  5AVW B;  2M3E A;  1LTJ C;  1AFO A;  1YBK A;  1YTZ T;  2WT7 A;  1N7L A;  1D7M A;  1PV3 A;  3C1L A;  2ITA A;  2M0B A;  1YQ4 C;  1FDO A;  2JR8 A;  2FYU D;  3LID A;  1LNQ A;  3Q5R A;  2FKW B;  2GUS A;  1OFC X;  3L70 G;  1GU5 A;  2V7Q H;  1M57 D;  2AXT E;  1JY2 P;  1VQL P;  4GOE A;  3ABV C;  3CPW O;  4LLH A;  2QJP B;  1FZF A;  2VRS A;  2Y0E A;  1FZC B;  1RE3 C;  3HD7 A;  3BRT B;  1RF1 C;  1URQ A;  4HB1 A;  1BGY D;  1KTM A;  2B9B A;  1USD A;  2IBZ I;  3H1K J;  5DJT B;  4W7Z A;  2OYH B;  3GF7 A;  2ZYG A;  1RE4 C;  1QL2 A;  1SQP G;  3CCR P;  5B66 H;  2Z5I A;  1OVV A;  2KNC B;  5AVZ B;  5CJ0 A;  3PRJ A;  3VMA A;  4WY4 D;  1FOS E;  3M0A A;  2O01 J;  3AEG C;  2GA1 A;  1NTM E;  1KIL C;  1L0L G;  2ZYA A;  3CCU P;  3FWL A;  1BCC G;  1M1J C;  1KQF B;  2A06 E;  1FE6 A;  1L4A A;  1CI6 A;  4I7Z C;  3AE9 C;  4IL6 X;  3L36 A;  3S1K A;  3IAO A;  1BDC A;  2HLO A;  1L0L K;  5CCH D;  3L75 E;  1LWU A;  3TGU D;  2FYU G;  5E79 H;  1BE3 J;  4N78 E;  3C9I A;  3R4Y A;  5C39 A;  2FYU K;  2D2C C;  5TIS E;  1VQ6 P;  3L4F A;  1FJK A;  1MZ9 A;  1NTZ D;  1SQQ E;  3CWB D;  3CCV P;  3H32 A;  5CJ4 A;  3VYI A;  3Q3D A;  5KKZ C;  2KS1 A;  2OTJ P;  1PIX A;  1VQP P;  2XV5 A;  1KQL A;  1BGY G;  3MIW A;  5AVV B;  2A45 I;  1MV8 A;  4PV1 C;  4WY4 B;  3HE5 B;  1ZP0 C;  5AW0 B;  3MD0 A;  1LTJ A;  3A2A A;  1QEX A;  3RK3 D;  4EDF A;  3MZW B;  5AW6 B;  3G9R A;  4TLF A;  5CMZ A;  4W7Y A;  3A0H E;  1KYO E;  1KFM A;  1KB9 E;  3AE2 C;  3L70 E;  4DCK A;  3M06 A;  2N9Y B;  2WIT A;  3F89 A;  5DJU B;  3EQ2 A;  2E42 A;  3ITK A;  5KLV D;  1T2K D;  1G2C B;  2YKO A;  3AEC C;  4ZKP A;  4Y99 C;  2GM4 A;  2Q9I A;  1RF1 A;  3M9H A;  3AE1 C;  2R3S A;  3TGU G;  1MFZ A;  4WBA A;  1MFT A;  1AQT A;  3CX5 H;  3CCQ P;  3WMM 0;  3CME P;  1IJD B;  1W2E A;  1P84 E;  2I8D A;  5AW4 B;  5KLI C;  2B87 B;  2AEF A;  3H1I J;  1RE4 A;  1KMI Z;  2YXR B;  3MTU E;  5AVX B;  3RK3 B;  3QH9 A;  1H89 A;  3HD7 D;  4IFD K;  1NTZ G;  1NTK D;  3MUD C;  3CWB G;  3G3Z A;  1FDI A;  2ZJS E;  1URQ D;  2YNY A;  3A5T A;  4GT1 A;  3K5B A;  2WSC J;  1L0L E;  4D6T D;  3LW5 H;  1BCC E;  3VP8 A;  3IN6 A;  1LT1 A;  1KIL A;  1NTZ K;  4XE5 B;  2MJZ A;  2P1J A;  4UB8 E;  1M1J A;  2BCC J;  1JM0 A;  3KYQ A;  2JWD A;  1ZXG A;  4M3L A;  5BU5 A;  2B88 A;  3B4S A;  3BRV B;  1IFM A;  3OJA B;  2FYU E;  3A0B E;  2WT7 B;  3CLQ A;  3JCU H;  4PD4 D;  1WRG A;  3BAS A;  1SQX J;  2QG4 A;  2YMK A;  1YIJ P;  3RL0 C;  3NXS A;  5CHX A;  3BAT A;  4O9B A;  2C0W A;  3D71 A;  5KAI H;  1ZRT D;  5KAF H;  1IZN B;  1L4A D;  4H13 D;  1FDM A;  4ASV A;  3CI9 A;  1SQV J;  1RF0 C;  3P8C D;  3HD7 B;  1Q82 Q;  2RKL A;  1BGY E;  5KLV K;  5M1B A;  2ZYD A;  1OVR A;  1JMM A;  1URQ B;  4L75 A;  3FXE A;  1VDF A;  2LKM A;  5L8R J;  3EFF K;  4JBZ A;  2R5B A;  1JEK A;  1PGP A;  4H44 B;  1UIX A;  3M91 A;  2HFE D;  2RMZ A;  4OWF A;  2XKM A;  2KK7 A;  4H0L D;  2QJK C;  1T2K C;  2KLU A;  1AA0 A;  3KZI E;  1SQB J;  2XU6 A;  1SFC D;  3TF5 A;  4D6T G;  1JUN A;  3D6Z A;  2XZR A;  1Q81 Q;  2QRX A;  1NTK K;  3M0D A;  3PTZ A;  1BDD A;  1WMK A;  1KV4 A;  5AVS B;  3O8Z A;  1VQK P;  2WWW A;  1DD3 A;  1H0T B;  2IPP A;  2WSS H;  3TGU E;  2G3A A;  1J1D C;  1K73 Q;  2Q3E A;  2KB7 P;  2CPS A;  3CXH E;  3CMA P;  3I56 P;  1JCD A;  3I55 P;  2H88 C;  1GL2 C;  3AE4 C;  2LR2 A;  3SFD C;  2JO1 A;  1KZU B;  1NTZ E;  2O1K A;  3CWB E;  4ASW A;  1L0N J;  3MUD A;  4I2L C;  4LGD E;  2WSF J;  2H8P D;  5TJH A;  2P67 A;  3H1K D;  3CCM P;  3H32 B;  4RJT A;  2GUV A;  3CX5 I;  2N1T C;  1LTT C;  3AEB C;  3W67 A;  3E7K A;  4IL6 H;  2K9J A;  3HTK B;  4K35 A;  2HOD B;  2ZVN B;  1FC2 C;  3U59 A;  1T3J A;  3N7N A;  2W27 A;  5AVU B;  1AVY A;  2WSF H;  2E74 B;  2NPS C;  1JY3 P;  2CPB A;  3IR9 A;  1DEE G;  1KIL D;  1BSH A;  2P58 A;  5KLV E;  1PGJ A;  5GTI E;  3VN0 A;  1S5L E;  3H1H J;  1VL2 A;  1BE3 D;  1JMB A;  1LGH B;  2OAR A;  1RF0 A;  3TNU A;  2A45 H;  2HR3 A;  5BU8 B;  3KDP B;  4L76 A;  1GZL A;  1KFN A;  3GHG C;  3P7K A;  1S2E A;  3NMD A;  1XTC C;  2D2C D;  1YHQ P;  2AXT H;  3FX0 A;  2IX7 C;  1NTK E;  4BRY B;  1E79 H;  1SFC C;  3S9O A;  1KOR A;  1X0T A;  2Y9Z A;  4D6T E;  3H1K G;  2E75 B;  1KQS O;  4PV1 D;  2H7H A;  1S9K D;  1NTM J;  2E76 D;  2HYN A;  4C7N A;  5EFW B;  3FGA D;  1M1J B;  3B5N C;  3WUT A;  1YJ9 P;  5B5E E;  3V6I A;  1DIP A;  4PD4 E;  1T6A A;  1FZE A;  3L75 J;  2ZT9 C;  1MKM A;  1M8O B;  2J59 M;  1HGZ A;  2YKP A;  1GK4 A;  1GL2 A;  1ZRT E;  1T8Z A;  1YIT P;  1IFP A;  3V2N A;  1RQU A;  3L37 A;  3OW2 O;  1PP9 D;  1QGK B;  3SWY A;  1H8A A;  3ZDM A;  3VMZ A;  4QMA A;  1Z56 A;  2YO2 A;  1BE3 G;  1NKZ B;  3P8C E;  1SQQ J;  1KN7 A;  2POH A;  4W80 A;  5KKZ B;  1IC2 A;  3TSI A;  2FFD C;  3T97 A;  3H1I D;  2N1T A;  3P8M C;  3L71 D;  1M1K Q;  4ZNC A;  4PV1 B;  2IZ1 A;  1RHZ B;  2PFX A;  1IO4 A;  2IYO A;  5TIS H;  1IK9 A;  2QM7 A;  1SLQ A;  1JY2 O;  1S5L X;  2BCC D;  1N2D C;  5H2F E;  3V2R A;  2NPS A;  3V2Q A;  3SFE C;  3L35 A;  1TU3 F;  1LTA C;  1GDT A;  2QA4 P;  5K5G B;  4KT0 J;  4ZKU A;  1HVV A;  3L70 J;  2BEQ D;  5AW5 B;  3L73 J;  3VOP A;  2P7J A;  5APV A;  1EZV I;  1SS1 A;  2JKV A;  3CXH D;  2O1J A;  5CBN A;  2KLV A;  1YTZ I;  4DOJ A;  3GHG A;  5APT A;  3A0H H;  3H1J J;  2QEX P;  1HF9 A;  1X9V A;  1QVF O;  2HPC A;  1KYO H;  5CBO A;  1CW5 A;  1EDJ A;  3RL0 D;  1KB9 H;  1OW8 A;  1HJB A;  2KI7 B;  2W90 A;  4DJG A;  2H43 A;  1HUC A;  1ZR4 A;  2KIK A;  2PAJ A;  1SQV D;  1Q2N A;  1EC5 A;  3TK1 A;  5AVQ B;  4HJG H;  5KLI B;  1PP9 G;  1SFC A;  2KOG A;  1SQP J;  3V4Q A;  4XFJ A;  1YQ3 C;  3PJS K;  2OYO A;  2JJL A;  3H1K E;  3I5C A;  2E76 C;  4WVZ A;  1H88 A;  1X8Y A;  2OYH C;  1NWQ A;  2K3R A;  3EFG A;  3HUS C;  2KP8 A;  3L71 G;  4C7R A;  2IBZ D;  3B5N A;  3NTN A;  2AEJ A;  1P84 H;  1NVO A;  1JY2 N;  2K1A A;  1SQB D;  3V5B A;  3VP9 A;  3G4S P;  2JP3 A;  3M0D C;  3D70 A;  3RBX A;  1OX3 A;  3USS A;  2ZFC A;  1KIL E;  3GW6 A;  2FBW C;  2OQQ A;  3WUU A;  1N7S C;  3FWN A;  1VQO P;  3CCL P;  5AVY B;  3VMY A;  4UB8 H;  2FY8 A;  1BE3 E;  1J1E C;  2K37 A;  3BCC D;  3LW5 J;  1Q7Y Q;  1R5S A;  2P2U A;  2FFD A;  3A0B H;  4DZO A;  1NGM B;  3TNU B;  3PLN A;  2Y0D A;  1SQX K;  1GL2 D;  2NZ2 A;  2XDJ A;  1USE A;  2G8Y A;  2C9N Y;  1SQV G;  4OH8 B;  3AE5 C;  4IFM A;  2LXC B;  1DH3 A;  4KJM A;  3RK2 C;  1NAF A;  1YI2 P;  2B89 A;  1SQV K;  4OVN F;  2N1T D;  1PGO A;  1S9K E;  4C46 A;  4CPG A;  1X22 A;  3FXD A;  4UB6 E;  1Q86 Q;  2BAS A;  3CCE P;  2IBZ G;  4Y28 J;  3PHL A;  4C7N B;  5AVR B;  1FZB A;  2HG5 D;  2WPQ A;  4GOF A;  2YIU B;  1HH0 A;  2O3J A;  3TGU J;  3EWK A;  2NPS D;  3HE4 A;  3W68 A;  1J1D B;  5KLV G;  1L2P A;  1PFI A;  2YMY A;  3H1H D;  1XTG B;  2QJY B;  1NJI Q;  3KZI H;  1PPJ D;  1SQB K;  4OGQ C;  1PP9 E;  1QL1 A;  3KHU A;  1GL2 B;  3O6Q A;  1JTH A;  3SWK A;  4Z1M H;  2IFN A;  4AUW A;  3BCC G;  1NU1 J;  2R32 A;  3IFM A;  1LJ2 A;  2R5D A;  1LTI C;  1KYO I;  2OYH A;  3H1I E;  1PGQ A;  2Q6Q A;  1KB9 I;  3HUS A;  2QE7 H;  3L71 E;  3CXH H;  3T97 B;  1N73 C;  1NTK G;  3CD6 P;  2KNC A;  3WUV A;  2Q7C A;  5KJ7 C;  5APX A;  4EYY Q;  1NYH A;  1HJ0 A;  1VF5 C;  2BCC E;  5CCG C;  1L0N K;  1AJY A;  3L74 J;  2MKV A;  3GLM A;  3CCJ P;  1L4A B;  1CI6 B;  2W83 C;  3L72 J;  4H13 B;  1N7S A;  2ZAE B;  2IZ0 A;  1FZA A;  1ZV8 A;  1IFD A;  1VQN P;  1ZLL A;  2YO3 A;  1P84 I;  3B5N D;  1RH5 B;  1DX7 A;  1ZW0 A;  1LWU B;  1LT9 C;  1KD1 Q;  1JB0 J;  2RH0 A;  3SSU A;  3VMX A;  3JSV C;  2ZT9 D;  3CL3 D;  2FXP A;  4RES B;  2N9B A;  3GHG B;  2HPC B;  3H1H G;  1SQV E;  1W5C E;  1ZR2 A;  1PPJ G;  3H1L J;  3G71 P;  1Y8A A;  4H0L B;  3OAK A;  2KS1 B;  5GTI H;  4U3F J;  1S5L H;  1SFC B;  2JEE A;  4U7J A;  2E43 A;  1KQG B;  4H44 C;  4TT3 H;  1Q90 D;  1LTJ B;  1YJW P;  4PJ0 E;  1QVG O;  1IFN A;  3B71 A;  5AW3 B;  2M8R A;  1QLE D;  2IBZ E;  4JQ0 D;  3P32 A;  2OGU A;  2Q5U A;  1OZH A;  1SQB E;  2KSJ A;  3L73 D;  3AE7 C;  1R8E A;  2LXB A;  5GTH E;  2RN0 A;  5APW A;  2J5U A;  2K9Y A;  5KTB A;  1N8R Q;  2ZT9 B;  3Q5S A;  1OW7 A;  3HRN A;  3CC2 P;  2PP6 A;  1RF1 B;  3BCC E;  3V4W A;  1GU4 A;  1NTM K;  3H1J D;  5B5E H;  2FYZ A;  2WTY A;  1K9M Q;  4PD4 H;  2I1J A;  3TYY A;  1DD4 A;  2FFD B;  3BVH A;  2JWA A;  1N73 A;  5BVZ A;  1L0N E;  1SQP D;  1PL5 A;  1CSB A;  5KJ7 A;  1KC8 Q;  1JY3 O;  2OTL P;  1ZN5 A;  1JCC A;  1YJN P;  5CCG A;  1VQ5 P;  4BXL A;  1KIL B;  4R4M A;  1HTL C;  1SQQ K;  3H6P A;  2IYP A;  4I7Z B;  1VQ4 P;  1EDI A;  3CXH I;  4EOT A;  2KYV A;  1RY3 A;  3CX5 D;  2QM8 A;  1EXJ A;  3E1I A;  1K8A Q;  2R3C A;  1GW3 A;  3WU2 E;  2E74 C;  1ZOY C;  1LT9 A;  2WZ7 A;  1M56 D;  3QWO C;  2FYN C;  2WSE H;  1LTS C;  2AXC A;  1OWA A;  2ZXX A;  3L73 G;  1UII A;  1A02 J;  3H1H E;  5H2F H;  2D2C B;  3VTP C;  3HE4 B;  1PPJ E;  1DEB A;  1N7S D;  2Y0C A;  1OXZ A;  4JF7 A;  3O6Q B;  1JTH B;  3KPE A;  1NHL A;  1EDK A;  3H1J G;  4DT0 A;  2PRR A;  2BEZ F;  2E76 B;  2XND H;  2WPR A;  1JO5 A;  1PZQ A;  3M9B A;  1S1C X;  2YKQ A;  2Z5H A;  1JY3 N;  3HUS B;  2W6A A;  1U57 A;  2OYI C;  1SP4 A;  1GW4 A;  2K88 A;  2Q3I A;  5AVT B;  2E75 C;  3NFQ A;  1FJP A;  3RK2 D;  1SQP K;  4I6M C;  1YYC A;  2WVR A;  3G6E P;  3PH0 A;  4RO0 A;  1VQ8 P;  2E5T A;  1H0T A;  1SQX D;  4Y99 B;  3U1A A;  3R2P A;  1N7S B;  1NH4 A;  4YPC A;  5APQ A;  4N6J A;  2QJP C;  4K3A A;  1FZC C;  1J1E B;  5B66 E;  3MGN A;  3JC2 2;  2O01 H;  4I1L A;  1LP1 A;  4NPF X;  2QIW A;  3KXD A;  1E5W A;  4GOD A;  3PP5 A;  4OGQ D;  1VQM P;  1NU1 D;  1QX8 A;  2W8Z A;  4IOI H;  4JYB A;  1M7L A;  4YXW H;  1L0L J;  3H1I G;  3Q2Y A;  1BCC J;  4WWI A;  3HTK A;  2W6J H;  4PD4 I;  3RK2 B;  2HOD A;  4WB4 A;  5E79 E;  1MUU A;  2IFM A;  2K9J B;  2V4H A;  1NO4 A;  2XNX A;  2J58 A;  4GDO A;  2FYU J;  5KJ7 D;  2BCC G;  2WPS A;  3L74 D;  2L5G B;  1VF5 D;  3L72 D;  1G1J A;  3RL0 B;  5CCG D;  3L73 E;  4HKZ H;  2NRG A;  4XA4 A;  2AEM A;  4AQR D;  1RE3 A;  1GD2 E;  3S4R A;  1J2J B;  4AYC A;  1SQX G;  3TDK A;  2L91 A;  1IFJ A;  1GMJ A;  4OGQ B;  1S72 P;  4UB6 H;  1PP9 J;  4N3Y B;  3H1J E;  3CC4 P;  1BGY J;  3E1R A;  3MHV A;  1EZV D;  2M5A A;  1L0N D;  1LTB C;  2KSE A;  3RL0 g;  1HGV A;  2DW3 A;  5AW1 B;  1W2B O;  3H1L D;  1FBM A;  4L74 A;  3KQG A;  4LC1 A;  4BRY A;  2E5Y A;  1SQP E;  2ZVO B;  3GG2 A;  4U3F D;  3L71 J;  4WY4 C;  1N73 B;  2IDB A;  2KZJ A;  3D6Y A;  2OYI A;  3Q1M A;  4ZMD A;  4JPZ B;  2QJK B;  1NU1 G;  2W6B A;  3C8V A;  3Q5P A;  2SPZ A;  4HH2 A;  1SVF A;  1OMI A;  1M90 Q;  1VF5 B;  5AW8 B;  1NU1 K;  4H44 D;  5CCH C;  3B8E B;  3CX5 E;  1BSN A;  4RKU J;  1S3J A;  1R5L A;  4MN4 C;  1SQB G;  1AVO A;  4JYC A;  3IF4 A;  1FZC A;  3GF3 A;  3L74 G;  4KHX A;  2QSI A;  2WSC H;  1LT9 B;  2KUB A;  1AV1 A;  4HYT B;  3L72 G;  3AE8 C;  2M3B A;  2R44 A;  2Z4E A;  1NTZ J;  4EI2 A;  3U1C A;  3CWB J;  1OVU A;  5AW9 B;  1IFI A;  3AE6 C;  5APY A;  1JNM A;  3AED C;  3RGU A;  3RK3 C;  1JOC A;  3H25 A;  2N1T B;  3JCU E;  1EZV G;  1L0N G;  1U7J A;  1NKN A;  1ZME C;  4EIJ A;  2ZXE B;  3H1L G;  1GTW A;  3CC7 P;  5KAI E;  3AE3 C;  3AEA C;  5KAF E;  4U3F G;  1NTM D;  2A06 D;  3A7O A;  2NPS B;  1HBW A;  4GKG A;  2OTK E;  3UIA A;  5KLV J;  2C9L Y;  2WPV B;  2A45 G;  3L75 D;  1WT6 A;  1FZG A;  1X79 B;  1SQX E;  1FAV A;  1FU1 A;  2O01 N;  4N78 D;  1LTG C;  1T3U A;  4PJ0 H;  2YIU C;  2QVA A;  2E74 D;  3BCC J;  2PGD A;  2QJY C;  4IFF A;  1SQQ D;  3HD7 C;  1OW6 A;  3OA7 A;  4BWN A;  2WMM A;  3AEE C;  5AW2 B;  1LP1 B;  2P10 A;  1URQ C;  5GTH H;  1CZQ A;  1EXI A;  5APU A;  4WY4 A;  1NTK J;  1NU1 E;  3HE5 A;  1OIP A;  1NAY A;  1Y47 A;  2H89 C;  4D6T J;  1FS0 E;  1FOS F;  5CCH A;  4A7P A;  4NPD A;  3RK3 E;  2Y9Y A;  1KYO D;  3B5N B;  4YXD C;  1KB9 D;  4NPE A;  3II6 A;  3MP7 B;  1K04 A;  3L70 D;  1VQ7 P; 
#chains in the Genus database with same CATH homology
 1JMM A;  1G2C A;  1JTH B;  1URQ B;  3KPE A;  3M0D C;  1NHL A;  1VDF A;  2C0X A;  2LKM A;  1L4A C;  2R5B A;  2ZFC A;  1VPC A;  3N4X A;  1N7S C;  2WPR A;  1JO5 A;  5AVY B;  1EQ7 A;  3VMY A;  3M91 A;  3M9B A;  2HFE D;  3SWF A;  1LWU C;  2YKQ A;  2Z5H A;  1JY3 N;  2XKM A;  3HUS B;  1A02 F;  1HWT C;  1J1E C;  2W6A A;  1AQ5 A;  1GK6 A;  2OYI C;  1T2K C;  1G1I A;  1SP4 A;  4GIF A;  3V2P A;  2P2U A;  1GW4 A;  2Q3I A;  5AVT B;  4B86 A;  1N86 A;  3NFQ A;  2XU6 A;  2FFD A;  1SFC D;  4DZO A;  1FJP A;  3RK2 D;  3TNU B;  1JUN A;  1SQP K;  2XZR A;  4I6M C;  3LIE A;  1NTK K;  1YYC A;  3M0D A;  5AVS B;  1SQX K;  2FXM A;  1GL2 D;  3O8Z A;  2XDJ A;  4Y99 B;  1NOH A;  2WWW A;  2C9N Y;  4OH8 B;  3U1A A;  2IPP A;  4IFM A;  5APS A;  3R2P A;  1N7S B;  1DH3 A;  1NH4 A;  1J1D C;  3A3Y B;  5AW7 B;  2I1K A;  5APQ A;  4N6J A;  2KB7 P;  3RK2 C;  2CPS A;  1FZC C;  1J1E B;  1NAF A;  1SQV K;  1JCD A;  3M9Q A;  2OYI B;  3MGN A;  5AVW B;  1LTJ C;  1AFO A;  2O01 H;  1YTZ T;  1GL2 C;  2N1T D;  4I1L A;  2WT7 A;  1N7L A;  1E5W A;  1S9K E;  4C46 A;  3PP5 A;  1KZU B;  2O1K A;  3LID A;  2BAS A;  3MUD A;  4I2L C;  4LGD E;  2FKW B;  2GUS A;  4C7N B;  5AVR B;  1FZB A;  2H8P D;  2HG5 D;  2P67 A;  2WPQ A;  4JYB A;  3H32 B;  1M7L A;  2GUV A;  1GU5 A;  1HH0 A;  2NPS D;  1JY2 P;  2N1T C;  3HE4 A;  1LTT C;  1J1D B;  3HTK A;  1PFI A;  2YMY A;  4LLH A;  3RK2 B;  2HOD A;  4WB4 A;  3HTK B;  1FZF A;  2VRS A;  1FZC B;  1XTG B;  1MUU A;  2IFM A;  1RE3 C;  2HOD B;  3HD7 A;  1SQB K;  3BRT B;  1NO4 A;  1QL1 A;  2XNX A;  1GL2 B;  1RF1 C;  3U59 A;  1T3J A;  1JTH A;  1URQ A;  2J58 A;  3N7N A;  2W27 A;  2IFN A;  4AUW A;  5KJ7 D;  5AVU B;  2WPS A;  2WSF H;  2R32 A;  3IFM A;  2NPS C;  2L5G B;  2R5D A;  1JY3 P;  2CPB A;  1LTI C;  4W7Z A;  1G1J A;  3IR9 A;  1KIL D;  3RL0 B;  5CCG D;  2OYH A;  3HUS A;  4XA4 A;  2OYH B;  1RE4 C;  4AQR D;  1QL2 A;  3VN0 A;  1N73 C;  1RE3 A;  1GD2 E;  2Z5I A;  2Q7C A;  1LGH B;  1J2J B;  2OAR A;  4AYC A;  5AVZ B;  1RF0 A;  5KJ7 C;  1IFJ A;  5APX A;  3TNU A;  5CJ0 A;  2A45 H;  5BU8 B;  3KDP B;  4WY4 D;  1FOS E;  1GZL A;  4N3Y B;  3M0A A;  1KFN A;  1KIL C;  5CCG C;  3GHG C;  1L0N K;  3P7K A;  3NMD A;  1M1J C;  1L4A A;  1CI6 A;  1XTC C;  1LTB C;  1L4A B;  1CI6 B;  1HGV A;  3L36 A;  5AW1 B;  1N7S A;  1FZA A;  1FBM A;  2HLO A;  3KQG A;  1L0L K;  1ZV8 A;  4LC1 A;  1IFD A;  5CCH D;  2IX7 C;  1ZLL A;  1LWU A;  2YO3 A;  3B5N D;  1DX7 A;  1SFC C;  1LWU B;  4WY4 C;  1N73 B;  4N78 E;  1LT9 C;  2OYI A;  2W6B A;  3C9I A;  4HH2 A;  3VMX A;  2FYU K;  1SVF A;  3CL3 D;  2H7H A;  1S9K D;  3L4F A;  4RES B;  1FJK A;  1MZ9 A;  2N9B A;  3GHG B;  5AW8 B;  1NU1 K;  2HYN A;  4C7N A;  5CCH C;  1M1J B;  2HPC B;  3B5N C;  3B8E B;  1ZR2 A;  3H32 A;  5CJ4 A;  3VYI A;  3OAK A;  1FZE A;  2XV5 A;  1KQL A;  4JYC A;  3MIW A;  5AVV B;  1FZC A;  2A45 I;  1SFC B;  2JEE A;  1MV8 A;  4WY4 B;  2J59 M;  2E43 A;  4KHX A;  2WSC H;  3HE5 B;  5AW0 B;  1HGZ A;  3MD0 A;  1LT9 B;  1LTJ A;  2YKP A;  1GK4 A;  1GL2 A;  3A2A A;  4HYT B;  1T8Z A;  3RK3 D;  1LTJ B;  2M3B A;  1IFN A;  5AW6 B;  3V2N A;  2Z4E A;  3L37 A;  5AW3 B;  2M8R A;  5CMZ A;  3SWY A;  1H8A A;  4W7Y A;  3VMZ A;  3U1C A;  1Z56 A;  1KFM A;  2YO2 A;  5AW9 B;  1NKZ B;  1IFI A;  3P32 A;  3P8C E;  2Q5U A;  5APY A;  2POH A;  3M06 A;  4W80 A;  2WIT A;  1JNM A;  1IC2 A;  3TSI A;  2FFD C;  3EQ2 A;  2E42 A;  2KSJ A;  3T97 A;  2N1T A;  3P8M C;  3RK3 C;  1T2K D;  1JOC A;  2N1T B;  5APW A;  1G2C B;  2YKO A;  4ZKP A;  5KTB A;  4Y99 C;  1NKN A;  3HRN A;  4EIJ A;  2GM4 A;  2Q9I A;  1RF1 A;  1IO4 A;  2ZXE B;  3M9H A;  2PP6 A;  1GTW A;  1RF1 B;  1GU4 A;  3V4W A;  1IK9 A;  2QM7 A;  1NTM K;  1SLQ A;  1MFZ A;  1JY2 O;  4WBA A;  1N2D C;  3V2R A;  2NPS A;  3V2Q A;  3WMM 0;  3A7O A;  2FYZ A;  1IJD B;  2NPS B;  3L35 A;  2WTY A;  1GDT A;  1LTA C;  1HBW A;  1W2E A;  4ZKU A;  1HVV A;  4GKG A;  2I1J A;  5AW4 B;  3TYY A;  5AW5 B;  3VOP A;  1RE4 A;  2P7J A;  2FFD B;  3UIA A;  3BVH A;  2C9L Y;  1N73 A;  5APV A;  5BVZ A;  2A45 G;  3MTU E;  1WT6 A;  5AVX B;  3RK3 B;  1X79 B;  1FZG A;  1H89 A;  3HD7 D;  4IFD K;  1CSB A;  1FAV A;  1FU1 A;  2O1J A;  5KJ7 A;  3G3Z A;  4N78 D;  1JY3 O;  1LTG C;  1URQ D;  1T3U A;  2YNY A;  1ZN5 A;  3A5T A;  4GT1 A;  2KLV A;  1JCC A;  3LW5 H;  1YTZ I;  3VP8 A;  1KIL A;  1NTZ K;  4XE5 B;  3GHG A;  5APT A;  4DOJ A;  2MJZ A;  5CCG A;  2P1J A;  1X9V A;  1M1J A;  2HPC A;  1KIL B;  1CW5 A;  3RL0 D;  3KYQ A;  1HTL C;  1SQQ K;  3H6P A;  4IFF A;  1HJB A;  5BU5 A;  4M3L A;  2H43 A;  1HUC A;  3HD7 C;  2PAJ A;  4EOT A;  1ZR4 A;  2KYV A;  3BRV B;  1IFM A;  3OA7 A;  3TK1 A;  1RY3 A;  3OJA B;  5AVQ B;  2QM8 A;  5AW2 B;  3E1I A;  2WT7 B;  1URQ C;  3CLQ A;  1CZQ A;  1SFC A;  2KOG A;  2R3C A;  3V4Q A;  5APU A;  1WRG A;  4WY4 A;  1GW3 A;  3HE5 A;  3BAS A;  1LT9 A;  2WZ7 A;  2JJL A;  3I5C A;  3RL0 C;  1H88 A;  3NXS A;  5CHX A;  2WSE H;  3BAT A;  4O9B A;  2C0W A;  1LTS C;  1X8Y A;  2OYH C;  1NWQ A;  3EFG A;  1OWA A;  3HUS C;  1L4A D;  1A02 J;  2KP8 A;  1FOS F;  5CCH A;  3VTP C;  3HE4 B;  4C7R A;  1FDM A;  1DEB A;  1N7S D;  3B5N A;  1OXZ A;  3NTN A;  3CI9 A;  3B5N B;  1JY2 N;  1RF0 C;  3P8C D;  3II6 A;  3HD7 B;  4JF7 A;  3V5B A;  3VP9 A;  5KLV K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...