1SQQG

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqqG00
1KYOH 1PPJG 1NTMG 3H1LG 3L73G 3CWBG 3H1HG 3L75G 4D6TG 3CXHH 1SQQG 1BE3G 1NTZG 3H1JG 1L0NG 3CX5H 4PD4H 3TGUG 3L72G 5KLVG 1SQXG 2FYUG 1NU1G 1BCCG 3H1KG 1P84H 3L74G 3L70G 3H1IG 3L71G 1NTKG 2A06G 1SQVG 1L0LG 1EZVG 1BGYG 1PP9G 2BCCG 2IBZG 4U3FG 1KB9H 1SQPG 3BCCG 1SQBG
chains in the Genus database with same CATH superfamily
1LJ2A 2IX7C 2E5YA 3V2PA 5KLVJ 1E5WA 1EQ7A 3L75G 1KYOE 4AYCA 5CJ4A 3CCSP 2CPBA 1U7MA 2M3BA 1HVVA 4N78D 1L0NG 3SWYA 1SQPE 4H0LC 1M1KQ 3N7NA 4PD4E 3L72E 3VMAA 2N1TB 2JR8A 1NTMK 1PP9J 1OX3A 1X0TA 5CCHC 1L0LE 3LIDA 1IJDB 1CSBA 2O1KA 4WB4A 1KN7A 1H0TB 2QM8A 5AVRB 1LT1A 3MD0A 1Q90D 1HGZA 2ZVNB 1ZP0C 2V7QJ 3I56P 3G71P 1ZR2A 1K73Q 2IFNA 1FDMA 1NU1K 2M3EA 4K35A 1JY3O 4U3FE 1S9KE 2KS1A 3MIWA 1EZVG 3MHVA 2O01H 1JEKA 4W7ZA 4OWFA 1K8AQ 3HE4B 3V5BA 2WT7A 1NTZK 2IBZG 2J5UA 2AEMA 2NPSA 1A02J 3QH9A 2OARA 3HD7C 3AEAC 2HYNA 2FYUJ 2NZ2A 3AECC 3KHUA 1IFDA 1JTHA 1KILE 2XNDH 3EFFK 5B66E 3L72J 2XV5A 1EXIA 1JB0J 4L73A 1X9VA 3LW5H 2FYUE 1CI6A 2HLOA 3TDKA 1NOHA 4RO0A 3VMYA 5KTBA 1R5LA 1PGPA 2W90A 1KB9D 1G2CA 2GUVA 2N1TC 4O9BA 4WY4C 4HYTB 2LXCB 4LLHA 1P84E 5AW6B 1NU1G 1SFCA 3CPWO 4C7NB 1HH0A 1SQXD 4U3FJ 2QSIA 5KLIB 3L74G 1QVGO 5L8RJ 4UB6E 4LC1A 1N7SD 3H1IG 3AE8C 3ITKA 3CCMP 3TSIA 1ZV8A 2E76C 3G4SP 2IYOA 4QMAA 1YI2P 2WVRA 1FZFA 3MUDA 4L74A 3RL0D 3VTPC 1KQLA 3C8VA 1MV8A 2Y0DA 3RK2D 5B5EE 4D6TD 1Y9BA 4YTPC 1L0NE 2D2CB 2KLVA 3U1CA 2BASA 2Y9YA 2KUBA 3H1IE 3CCQP 1U7JA 3HUSB 5APQA 1SQBG 1VQ5P 3Q5RA 3P7KA 1VQ7P 1N2DC 3AE6C 3V6IA 4Y99B 3AE4C 2O3JA 3KZIE 1Q7YQ 4WY4D 1URQD 2L91A 2PFXA 2D2CC 2WSCJ 1NWQA 2W83C 3H1KJ 1X79B 3GG2A 2K9JB 3L70J 3Q5PA 4XFJA 1CZQA 3CCVP 2QJKB 1IK9A 3GLMA 4D6TE 1LWUC 3CI9A 1YTZT 2OQQA 3HD7D 2E74C 2YO3A 1JMBA 5GTIE 3C9IA 1NTZJ 1PGJA 5DJUB 2A06E 5CBNA 1EZVE 5EFWB 1WMKA 5AW8B 4B86A 1SQBK 4A7PA 1N7LA 3FX0A 4YXDC 4H13B 4ZKUA 2B87B 3CXHE 3H1JD 3AE7C 1GL2D 2R5BA 4IL6X 4L76A 4TLFA 4H0LB 4C46A 1NJIQ 1W5CE 3EQ2A 4KHXA 1L4AA 4BRYB 1KB9E 1L2PA 1LWUB 2OYHA 1SQQD 3S9OA 1J1EC 2O1JA 1DIPA 2FYNB 1JM0A 4KT0J 1OW7A 2ZFCA 1VQ4P 2WWWA 1BDDA 1BE3G 2K9JA 1NTKJ 2L5GB 3O6QB 4D6TJ 5H2FE 2B87A 3B5NC 1OW6A 3AEBC 1G1JA 5AVTB 1DH3A 1VQ9P 4OGQB 4TT3H 2LXBA 3RK3E 1VL2A 1SQVD 2RH0A 4EDFA 2OTKE 1BCCG 1GW3A 1ZOYC 5M1BA 4H44B 1D7MA 4GODA 1IO4A 1KTMA 3RK3B 3BCCD 3CWBJ 1JY3P 1RE4A 3P8CE 5CCHA 2R32A 4GKGA 2HR3A 2QRXA 3H1HE 1HBWA 1L4AD 3L74D 2KLUA 3M0DC 1OIPA 3OJAB 2WSEJ 3H1ID 3OAKA 5TISH 4GOEA 1GL2A 2OYIC 2WPSA 4OH8B 1E79H 3CWBD 1NVOA 1JCCA 3M9BA 4UB6H 2WSCH 5KJ7A 1NTME 2JEEA 3IF4A 5GTHE 1FC2C 2YXQB 2Q1KA 3CWBG 1RF1A 1FZBA 2ZT9B 3A3YB 5KAFE 3CXHH 3M06A 4D6TG 1QLED 3SFDC 1HTLC 1M56D 2KSEA 3HD7A 2IFMA 1N8RQ 1AQTA 1FZAA 3NTNA 5CJ0A 2ZT9D 2QM7A 2B88A 2KZIA 2W6BA 3AEGC 3JC22 3K5BA 1P84H 1AV1A 1FU1A 1LTSC 1NO4A 1AFOA 1KFMA 3FWLA 4WY4A 1EZVD 2P10A 4GDOA 1IFIA 2YKOA 3VYIA 4GOFA 2OTJP 4EIJA 1YIJP 1PPJD 2PP6A 1SQQE 1SFCC 1L0LG 5AW0B 1BGYG 3T97B 3D70A 2V7QH 3L71E 5AVWB 3B5NA 5AW7B 1LTGC 1W2BO 1L0LD 1BGYD 2YMYA 2XNXA 3GMAA 5APSA 3H1LE 5TJHA 1JUNA 1FZCC 2E75D 4HB1A 3L36A 5GTIH 1RF0C 1ZRTE 3H1KE 3NMDA 4XA4A 5AW1B 2NPSB 3CLQA 5BU5A 3H1JG 1S72P 4PD4H 3VMXA 1N7SA 2WPQA 1U57A 1VDFA 1SQXG 3B8EB 1SFCD 3CX5E 4JF7A 1IFMA 4OGQC 3JSVC 4BXLA 2N9YB 1MFZA 1YJ9P 1L0LJ 2Z5IA 2QG4A 3V2QA 4ZMDA 5KJ7C 4AUWA 3P8CD 3HTKA 2E76B 2CPSA 1SQPD 1GL2B 1M1JC 1VQLP 4PV1B 4N78E 2I8DA 5E79E 1SQVG 4ASWA 1KD1Q 1G2CB 4U7JA 1FE6A 1GMJA 1TU3F 3AEDC 5AVZB 1J1DB 2C0WA 3M91A 4JPZB 3TF5A 4U3FG 2M0BA 1FOSE 2XU6A 1SQPJ 3BCCG 4Z1MH 2ZJSE 3PTZA 2I1KA 2P1JA 1NTZE 4H44C 1ZW0A 5B66H 1L0NJ 1H88A 1SQXJ 4U3FD 2RMZA 1NTMG 3U1AA 2B9BA 4RJTA 2B89A 2W6AA 1Q82Q 2WMMA 2FFDC 3VN0A 2K3RA 3L74J 1GW4A 2QE7H 3CL3D 3MUDC 1USDA 3IAOA 3KDPB 2P58A 1EZVI 5CBOA 1SQBE 1VQMP 2C9NY 1KV4A 3CCUP 1IFNA 3CXHI 2KI7B 2XKMA 2MJZA 1FZCA 1PPJE 3CCRP 3A2AA 4ZKPA 2ZVOB 3H1LD 1GU4A 1JMMA 3GF7A 2E74D 1BGYE 3VMZA 4C7RA 1HJ0A 1N7SC 2GA1A 2ZYAA 2NRGA 2A45G 1CI6B 3PH0A 1SQXK 1J1DC 2WPRA 2G8YA 1KILB 3GF3A 1LWUA 2HODB 2QIWA 1DD4A 3JCUE 2FFDB 5GTHH 1OVUA 3KQGA 3SWKA 1NAYA 2FYZA 1WT6A 2E5TA 2FXPA 4DT0A 5CCGA 1DD3A 5KLVG 2R3CA 2V4HA 3V4WA 3PRJA 3L73E 5KLVD 1S2EA 1FDIA 1KYOI 2RN0A 4RKUJ 1USEA 5APXA 2I1JA 2K37A 1JOCA 3HTKB 4W80A 4GT1A 3VOPA 3P8MC 4ASVA 2BCCD 2YNYA 4Y28J 3Q2YA 2OYHC 1AQ5A 1CW5A 3R2PA 1OZHA 3HE4A 1SLQA 1JY2P 2JKVA 3E7KA 3GHGB 1GD2E 1K04A 1T3UA 3A0BH 3PJSK 3H6PA 1GU5A 1QEXA 1YTZI 1VQNP 2Y0EA 3A7OA 3OW2O 1SQPG 3Q5SA 3PLNA 2WZ7A 5KAFH 1FBMA 3BASA 2FXOA 2IBZI 5KLIC 1Q86Q 2N9BA 5KLVK 1PGOA 1IC2A 3BRVB 2FYNC 3H1HG 3MP7B 3L71J 1NTMJ 3HE5B 2AEJA 2BCCE 1KYOD 2KNCB 3GHGC 4GIFA 1KZUB 4IFFA 1S5LH 3P32A 5KKZB 1SQBD 2K88A 4I6MC 4DOJA 3EWKA 4EI2A 1BE3E 2Q3EA 2WITA 1NU1J 1RF0A 2M5AB 1JO5A 4IFDK 4BRYA 2OYHB 4EOTA 1P84I 5B5EH 3F89A 1YQ3C 1YITP 1PFIA 2WSFJ 3T97A 5APUA 3JCUH 1AVOA 2KNCA 2FFDA 5BVZA 3QWOC 1J1EB 1LTAC 1SQVE 1SQVK 5CHXA 2OYOA 2HODA 3L73G 3MZWB 3W68A 1FZGA 3G6EP 3RK2B 1T2KD 1KMIZ 4PD4I 3CMAP 1H8AA 3BRTB 2Y0CA 2KB7P 3H1LJ 4H0LD 1OW8A 2IBZE 3CX5H 3RK3C 1OMIA 2YXRB 1HGVA 3CWBE 1P84D 2P2UA 2KOGA 1YJWP 3CC4P 1SQXE 2IZ0A 3AE2C 1NKNA 3E1RA 1RF1B 3I55P 3H1KG 2KZJA 2MKVA 1FOSF 1SP4A 1RH5B 1N73B 4H13D 2OGUA 1GL2C 1GZLA 1LTJC 1ZRTD 2ZYGA 3H1KD 2PAJA 4I7ZC 4NPDA 2OYIA 3WU2H 1DEBA 1KILC 1NAFA 1YHQP 2N1TA 1SQBJ 1RF1C 1FJPA 2Q7CA 2SPZA 3RBZA 3AE5C 1PP9G 2E76D 2ZXXA 2BCCG 3HE5A 3TGUD 1LT9B 1IK7A 3AE3C 1URQC 5H2FH 3B5ND 2VRSA 4PV1D 2AXTH 5AVVB 2E43A 1KILA 4YPCA 2W8ZA 3KYQA 3HUSA 3H1HJ 2JWDA 3AEEC 2H8PD 2JJLA 4WWIA 2W6JH 3H32A 1SVFA 2JP3A 1KB9I 2QJYB 3S4RA 1RE3C 2GUSA 2FYUG 2ZXEB 2R5DA 3V2RA 1KC8Q 3V2NA 4I1LA 1L0LK 1PL5A 1Q2NA 2OYIB 2IZ1A 3IFMA 5APTA 3W67A 1VQOP 2H89C 2JO1A 2KK7A 5AVQB 1L4AC 5TISE 1BGYJ 2A06D 1ZR4A 4C7NA 2K9YA 2YMKA 1KQSO 2Z5HA 2A06G 3L73J 1NTKD 2LR2A 2QEXP 1N7SB 3D71A 5KJ7D 2AEFA 1OWAA 1PZQA 1S1CX 2RKLA 4HKZH 5KAIH 1NYHA 1URQB 2IDBA 4IFMA 3A5TA 3N4XA 1FZCB 3D6YA 4N6JA 1NH4A 4WVZA 2YIUB 5AVXB 1K9MQ 1PPJG 1QX8A 1XTCC 2J59M 2QJKC 1L4AB 2Q5UA 1NU1D 1RQVA 3B71A 1BCCE 3PP5A 5CCHD 1SQPK 2FXMA 3USSA 3AEFC 5AW2B 2H43A 3WUVA 3TYYA 1R8EA 5E79H 2HFED 3O6QA 1NTZD 1Y8AA 1QL2A 2ZYDA 3A0HE 3PHLA 1KQFB 1BDCA 1NTKK 2Q6QA 1NTKE 4WY4B 1LTBC 4M3LA 1JTHB 4Y99C 1GK6A 1LTIC 3L71G 1OVVA 1RY3A 2M5AA 3L70D 5C39A 2AXTE 2J58A 2P7JA 4UB8E 4HJGH 4W7YA 1KFNA 1JCDA 1NU1E 3WUUA 3CCEP 2QJPB 1AJYA 1PIXA 5APYA 4JYBA 1VF5B 3MGNA 4MN4C 2OTLP 2UWJE 1YBKA 5AW9B 3L74E 4RESB 4IOIH 2XDJA 2BCCJ 1S3JA 4LGDE 1OVRA 2R3SA 1A02F 1HUCA 1FZEA 1JY2N 1EDIA 2FYUK 3L35A 1PV3A 1RQUA 2KXPB 1SFCB 3LW5J 3LIEA 1VF5D 4OGQD 3Q3DA 2O01N 1T2KC 2YIUC 2C0XA 3TGUG 4CPGA 1EDJA 3SFEC 3M0DA 1IFPA 4NPEA 1BCCJ 1LTJA 2QA4P 3BCCJ 2QJPC 2NPSC 1L0ND 2WSEH 1S5LE 1S5LX 1FJKA 1QL1A 5AW4B 1M90Q 1NHLA 5BU8B 2BEZF 2AXCA 3F5HA 1GK4A 3KPEA 2A45I 2JDIH 1BE3J 2C9LY 3IR9A 1LP1B 3H25A 1UIXA 3IN6A 3RK2C 1SS1A 1URQA 4R4LA 3SSUA 4DCKA 5AW5B 2FYUD 3NXSA 1FAVA 1MFTA 1LNQA 1KILD 1VQKP 1G1IA 3GW6A 4OVNF 3FWNA 1BE3D 3WUTA 1KB9H 3R4YA 3CD6P 2WSSH 3D6ZA 5AVUB 1AA0A 1M7LA 1W2EA 3U59A 1L0NK 1QGKB 1VF5C 4PJ0E 3FGAD 3V4QA 2HPCA 2HPCB 1KYOH 1PP9E 2IPPA 2N1TD 2W27A 3A0HH 2YKPA 1T3JA 2YO2A 2PRRA 3H1LG 3KXDA 4K3AA 4AQRD 5K5GB 3Q1MA 1JY2O 1EXJA 3NFQA 2R44A 4JYCA 1Z56A 2GM4A 1T6AA 1Q81Q 2PGDA 2G3AA 5DJTB 5AVSB 1MUUA 1OFCX 3UIAA 3M9HA 3WMM0 1T8ZA 4WBAA 1JNMA 3CC2P 3HRNA 1VQ6P 1ZN5A 1UIIA 1KQGB 3S1KA 1XTGB 2Q9IA 2FKWB 2KP8A 1SQQK 3RL0C 3CXHD 3WU2E 1S4XA 1EDKA 2E74B 1X22A 1VPCA 3L70E 4ZNCA 4I7ZB 2WTYA 1VQ8P 4YXWH 1YQ4C 2WT7B 1N73C 1PP9D 3L37A 1ZXGA 2WPVB 5CMZA 2KS1B 1AVYA 2E75B 3L75D 1J2JB 2QJYC 3O8ZA 3B4SA 2KSJA 3RBXA 3RK3D 2POHA 3A0BE 1RHZB 2NPSD 3TNUA 1YJNP 4DJGA 1GDTA 3KZIH 2H88C 1SQVJ 2JWAA 3G9RA 2QVAA 4BWNA 1N73A 4HH2A 4N3YB 1M1JA 2KIKA 3CX5I 3RL0g 3CCLP 5KKZC 3MTUE 1M8OB 1LT9A 2HG5D 4UB8H 1JY3N 3H1IJ 4NPFX 1FDOA 3ZDMA 1R5SA 1LTTC 1RE4C 2FBWC 3B5NB 5AVYB 3L72G 3C1LA 3G3ZA 3H32B 4L75A 2E75C 3RGUA 3BVHA 2BEQD 3CC7P 1DX7A 1H89A 3OA7A 1WRGA 2DW3A 2A45H 3H1JE 3L72D 5APVA 1HF9A 3H1HD 3RL0B 3L75E 1ZMEC 1LP1A 3AE9C 3H1JJ 1DEEG 2IBZD 2O01J 4PD4D 2LKMA 3L4FA 3M9QA 2ITAA 3CMEP 2Y9ZA 1NTKG 3BATA 1BSNA 3II6A 1SQQJ 4IL6H 2P67A 4KJMA 1BSHA 5AW3B 3CCJP 5APWA 4DZOA 4H13C 2XZRA 1HWTC 5CCGC 3SWFA 3AE1C 1NKZB 1RE3A 1IFJA 4PJ0H 1HJBA 2IYPA 4JQ0D 1S9KD 5KAIE 4XE5B 2YKQA 2ZT9C 1YYCA 2WQYC 2D2CD 1SQQG 1LGHB 3BCCE 3FXEA 4PV1C 1NTZG 2Z4EA 1Y47A 2Q3IA 1FS0E 1X8YA 1LTJB 3FXDA 1PGQA 3L75J 4H44D 1MZ9A 1QVFO 3E1IA 3L73D 3ABVC 5KLVE 3VP8A 1GTWA 3TGUE 1IZNB 1K05A 1OXZA 2M8RA 4R4MA 3L71D 4JBZA 5CCGD 2CK3H 3HUSC 3L70G 3TGUJ 1BCCD 2WSFH 3TNUB 1H0TA 1N86A 3TK1A 2H7HA 1MKMA 1ZLLA 2ZAEB 3I5CA 3VP9A 1LT9C 1NTMD 2E42A 3HD7B 4I2LC 3GHGA 1VQPP 1EC5A 3EFGA 3CX5D 1M57D 4IL6E 4EYYQ 3M0AA 1EDLA 1M1JB 1NGMB 1KORA 2FY8A 2K1AA 2KYVA
chains in the Genus database with same CATH topology
1KYOH 1PPJG 1NTMG 3H1LG 3L73G 3CWBG 3H1HG 3L75G 4D6TG 3CXHH 1SQQG 1BE3G 1NTZG 3H1JG 1L0NG 3CX5H 4PD4H 3TGUG 3L72G 5KLVG 1SQXG 2FYUG 1NU1G 1BCCG 3H1KG 1P84H 3L74G 3L70G 3H1IG 3L71G 1NTKG 2A06G 1SQVG 1L0LG 1EZVG 1BGYG 1PP9G 2BCCG 2IBZG 4U3FG 1KB9H 1SQPG 3BCCG 1SQBG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1KYO H;  1PPJ G;  1NTM G;  3H1L G;  3L73 G;  3CWB G;  3H1H G;  3L75 G;  4D6T G;  3CXH H;  1SQQ G;  1BE3 G;  1NTZ G;  3H1J G;  1L0N G;  3CX5 H;  4PD4 H;  3TGU G;  3L72 G;  5KLV G;  1SQX G;  2FYU G;  1NU1 G;  1BCC G;  3H1K G;  1P84 H;  3L74 G;  3L70 G;  3H1I G;  3L71 G;  1NTK G;  2A06 G;  1SQV G;  1L0L G;  1EZV G;  1BGY G;  1PP9 G;  2BCC G;  2IBZ G;  4U3F G;  1KB9 H;  1SQP G;  3BCC G;  1SQB G; 
#chains in the Genus database with same CATH topology
 1LJ2 A;  2IX7 C;  2E5Y A;  3V2P A;  5KLV J;  1E5W A;  1EQ7 A;  3L75 G;  1KYO E;  4AYC A;  5CJ4 A;  3CCS P;  2CPB A;  1U7M A;  2M3B A;  1HVV A;  4N78 D;  1L0N G;  3SWY A;  1SQP E;  4H0L C;  1M1K Q;  3N7N A;  4PD4 E;  3L72 E;  3VMA A;  2N1T B;  2JR8 A;  1NTM K;  1PP9 J;  1OX3 A;  1X0T A;  5CCH C;  1L0L E;  3LID A;  1IJD B;  1CSB A;  2O1K A;  4WB4 A;  1KN7 A;  1H0T B;  2QM8 A;  5AVR B;  1LT1 A;  3MD0 A;  1Q90 D;  1HGZ A;  2ZVN B;  1ZP0 C;  2V7Q J;  3I56 P;  3G71 P;  1ZR2 A;  1K73 Q;  2IFN A;  1FDM A;  1NU1 K;  2M3E A;  4K35 A;  1JY3 O;  4U3F E;  1S9K E;  2KS1 A;  3MIW A;  1EZV G;  3MHV A;  2O01 H;  1JEK A;  4W7Z A;  4OWF A;  1K8A Q;  3HE4 B;  3V5B A;  2WT7 A;  1NTZ K;  2IBZ G;  2J5U A;  2AEM A;  2NPS A;  1A02 J;  3QH9 A;  2OAR A;  3HD7 C;  3AEA C;  2HYN A;  2FYU J;  2NZ2 A;  3AEC C;  3KHU A;  1IFD A;  1JTH A;  1KIL E;  2XND H;  3EFF K;  5B66 E;  3L72 J;  2XV5 A;  1EXI A;  1JB0 J;  4L73 A;  1X9V A;  3LW5 H;  2FYU E;  1CI6 A;  2HLO A;  3TDK A;  1NOH A;  4RO0 A;  3VMY A;  5KTB A;  1R5L A;  1PGP A;  2W90 A;  1KB9 D;  1G2C A;  2GUV A;  2N1T C;  4O9B A;  4WY4 C;  4HYT B;  2LXC B;  4LLH A;  1P84 E;  5AW6 B;  1NU1 G;  1SFC A;  3CPW O;  4C7N B;  1HH0 A;  1SQX D;  4U3F J;  2QSI A;  5KLI B;  3L74 G;  1QVG O;  5L8R J;  4UB6 E;  4LC1 A;  1N7S D;  3H1I G;  3AE8 C;  3ITK A;  3CCM P;  3TSI A;  1ZV8 A;  2E76 C;  3G4S P;  2IYO A;  4QMA A;  1YI2 P;  2WVR A;  1FZF A;  3MUD A;  4L74 A;  3RL0 D;  3VTP C;  1KQL A;  3C8V A;  1MV8 A;  2Y0D A;  3RK2 D;  5B5E E;  4D6T D;  1Y9B A;  4YTP C;  1L0N E;  2D2C B;  2KLV A;  3U1C A;  2BAS A;  2Y9Y A;  2KUB A;  3H1I E;  3CCQ P;  1U7J A;  3HUS B;  5APQ A;  1SQB G;  1VQ5 P;  3Q5R A;  3P7K A;  1VQ7 P;  1N2D C;  3AE6 C;  3V6I A;  4Y99 B;  3AE4 C;  2O3J A;  3KZI E;  1Q7Y Q;  4WY4 D;  1URQ D;  2L91 A;  2PFX A;  2D2C C;  2WSC J;  1NWQ A;  2W83 C;  3H1K J;  1X79 B;  3GG2 A;  2K9J B;  3L70 J;  3Q5P A;  4XFJ A;  1CZQ A;  3CCV P;  2QJK B;  1IK9 A;  3GLM A;  4D6T E;  1LWU C;  3CI9 A;  1YTZ T;  2OQQ A;  3HD7 D;  2E74 C;  2YO3 A;  1JMB A;  5GTI E;  3C9I A;  1NTZ J;  1PGJ A;  5DJU B;  2A06 E;  5CBN A;  1EZV E;  5EFW B;  1WMK A;  5AW8 B;  4B86 A;  1SQB K;  4A7P A;  1N7L A;  3FX0 A;  4YXD C;  4H13 B;  4ZKU A;  2B87 B;  3CXH E;  3H1J D;  3AE7 C;  1GL2 D;  2R5B A;  4IL6 X;  4L76 A;  4TLF A;  4H0L B;  4C46 A;  1NJI Q;  1W5C E;  3EQ2 A;  4KHX A;  1L4A A;  4BRY B;  1KB9 E;  1L2P A;  1LWU B;  2OYH A;  1SQQ D;  3S9O A;  1J1E C;  2O1J A;  1DIP A;  2FYN B;  1JM0 A;  4KT0 J;  1OW7 A;  2ZFC A;  1VQ4 P;  2WWW A;  1BDD A;  1BE3 G;  2K9J A;  1NTK J;  2L5G B;  3O6Q B;  4D6T J;  5H2F E;  2B87 A;  3B5N C;  1OW6 A;  3AEB C;  1G1J A;  5AVT B;  1DH3 A;  1VQ9 P;  4OGQ B;  4TT3 H;  2LXB A;  3RK3 E;  1VL2 A;  1SQV D;  2RH0 A;  4EDF A;  2OTK E;  1BCC G;  1GW3 A;  1ZOY C;  5M1B A;  4H44 B;  1D7M A;  4GOD A;  1IO4 A;  1KTM A;  3RK3 B;  3BCC D;  3CWB J;  1JY3 P;  1RE4 A;  3P8C E;  5CCH A;  2R32 A;  4GKG A;  2HR3 A;  2QRX A;  3H1H E;  1HBW A;  1L4A D;  3L74 D;  2KLU A;  3M0D C;  1OIP A;  3OJA B;  2WSE J;  3H1I D;  3OAK A;  5TIS H;  4GOE A;  1GL2 A;  2OYI C;  2WPS A;  4OH8 B;  1E79 H;  3CWB D;  1NVO A;  1JCC A;  3M9B A;  4UB6 H;  2WSC H;  5KJ7 A;  1NTM E;  2JEE A;  3IF4 A;  5GTH E;  1FC2 C;  2YXQ B;  2Q1K A;  3CWB G;  1RF1 A;  1FZB A;  2ZT9 B;  3A3Y B;  5KAF E;  3CXH H;  3M06 A;  4D6T G;  1QLE D;  3SFD C;  1HTL C;  1M56 D;  2KSE A;  3HD7 A;  2IFM A;  1N8R Q;  1AQT A;  1FZA A;  3NTN A;  5CJ0 A;  2ZT9 D;  2QM7 A;  2B88 A;  2KZI A;  2W6B A;  3AEG C;  3JC2 2;  3K5B A;  1P84 H;  1AV1 A;  1FU1 A;  1LTS C;  1NO4 A;  1AFO A;  1KFM A;  3FWL A;  4WY4 A;  1EZV D;  2P10 A;  4GDO A;  1IFI A;  2YKO A;  3VYI A;  4GOF A;  2OTJ P;  4EIJ A;  1YIJ P;  1PPJ D;  2PP6 A;  1SQQ E;  1SFC C;  1L0L G;  5AW0 B;  1BGY G;  3T97 B;  3D70 A;  2V7Q H;  3L71 E;  5AVW B;  3B5N A;  5AW7 B;  1LTG C;  1W2B O;  1L0L D;  1BGY D;  2YMY A;  2XNX A;  3GMA A;  5APS A;  3H1L E;  5TJH A;  1JUN A;  1FZC C;  2E75 D;  4HB1 A;  3L36 A;  5GTI H;  1RF0 C;  1ZRT E;  3H1K E;  3NMD A;  4XA4 A;  5AW1 B;  2NPS B;  3CLQ A;  5BU5 A;  3H1J G;  1S72 P;  4PD4 H;  3VMX A;  1N7S A;  2WPQ A;  1U57 A;  1VDF A;  1SQX G;  3B8E B;  1SFC D;  3CX5 E;  4JF7 A;  1IFM A;  4OGQ C;  3JSV C;  4BXL A;  2N9Y B;  1MFZ A;  1YJ9 P;  1L0L J;  2Z5I A;  2QG4 A;  3V2Q A;  4ZMD A;  5KJ7 C;  4AUW A;  3P8C D;  3HTK A;  2E76 B;  2CPS A;  1SQP D;  1GL2 B;  1M1J C;  1VQL P;  4PV1 B;  4N78 E;  2I8D A;  5E79 E;  1SQV G;  4ASW A;  1KD1 Q;  1G2C B;  4U7J A;  1FE6 A;  1GMJ A;  1TU3 F;  3AED C;  5AVZ B;  1J1D B;  2C0W A;  3M91 A;  4JPZ B;  3TF5 A;  4U3F G;  2M0B A;  1FOS E;  2XU6 A;  1SQP J;  3BCC G;  4Z1M H;  2ZJS E;  3PTZ A;  2I1K A;  2P1J A;  1NTZ E;  4H44 C;  1ZW0 A;  5B66 H;  1L0N J;  1H88 A;  1SQX J;  4U3F D;  2RMZ A;  1NTM G;  3U1A A;  2B9B A;  4RJT A;  2B89 A;  2W6A A;  1Q82 Q;  2WMM A;  2FFD C;  3VN0 A;  2K3R A;  3L74 J;  1GW4 A;  2QE7 H;  3CL3 D;  3MUD C;  1USD A;  3IAO A;  3KDP B;  2P58 A;  1EZV I;  5CBO A;  1SQB E;  1VQM P;  2C9N Y;  1KV4 A;  3CCU P;  1IFN A;  3CXH I;  2KI7 B;  2XKM A;  2MJZ A;  1FZC A;  1PPJ E;  3CCR P;  3A2A A;  4ZKP A;  2ZVO B;  3H1L D;  1GU4 A;  1JMM A;  3GF7 A;  2E74 D;  1BGY E;  3VMZ A;  4C7R A;  1HJ0 A;  1N7S C;  2GA1 A;  2ZYA A;  2NRG A;  2A45 G;  1CI6 B;  3PH0 A;  1SQX K;  1J1D C;  2WPR A;  2G8Y A;  1KIL B;  3GF3 A;  1LWU A;  2HOD B;  2QIW A;  1DD4 A;  3JCU E;  2FFD B;  5GTH H;  1OVU A;  3KQG A;  3SWK A;  1NAY A;  2FYZ A;  1WT6 A;  2E5T A;  2FXP A;  4DT0 A;  5CCG A;  1DD3 A;  5KLV G;  2R3C A;  2V4H A;  3V4W A;  3PRJ A;  3L73 E;  5KLV D;  1S2E A;  1FDI A;  1KYO I;  2RN0 A;  4RKU J;  1USE A;  5APX A;  2I1J A;  2K37 A;  1JOC A;  3HTK B;  4W80 A;  4GT1 A;  3VOP A;  3P8M C;  4ASV A;  2BCC D;  2YNY A;  4Y28 J;  3Q2Y A;  2OYH C;  1AQ5 A;  1CW5 A;  3R2P A;  1OZH A;  3HE4 A;  1SLQ A;  1JY2 P;  2JKV A;  3E7K A;  3GHG B;  1GD2 E;  1K04 A;  1T3U A;  3A0B H;  3PJS K;  3H6P A;  1GU5 A;  1QEX A;  1YTZ I;  1VQN P;  2Y0E A;  3A7O A;  3OW2 O;  1SQP G;  3Q5S A;  3PLN A;  2WZ7 A;  5KAF H;  1FBM A;  3BAS A;  2FXO A;  2IBZ I;  5KLI C;  1Q86 Q;  2N9B A;  5KLV K;  1PGO A;  1IC2 A;  3BRV B;  2FYN C;  3H1H G;  3MP7 B;  3L71 J;  1NTM J;  3HE5 B;  2AEJ A;  2BCC E;  1KYO D;  2KNC B;  3GHG C;  4GIF A;  1KZU B;  4IFF A;  1S5L H;  3P32 A;  5KKZ B;  1SQB D;  2K88 A;  4I6M C;  4DOJ A;  3EWK A;  4EI2 A;  1BE3 E;  2Q3E A;  2WIT A;  1NU1 J;  1RF0 A;  2M5A B;  1JO5 A;  4IFD K;  4BRY A;  2OYH B;  4EOT A;  1P84 I;  5B5E H;  3F89 A;  1YQ3 C;  1YIT P;  1PFI A;  2WSF J;  3T97 A;  5APU A;  3JCU H;  1AVO A;  2KNC A;  2FFD A;  5BVZ A;  3QWO C;  1J1E B;  1LTA C;  1SQV E;  1SQV K;  5CHX A;  2OYO A;  2HOD A;  3L73 G;  3MZW B;  3W68 A;  1FZG A;  3G6E P;  3RK2 B;  1T2K D;  1KMI Z;  4PD4 I;  3CMA P;  1H8A A;  3BRT B;  2Y0C A;  2KB7 P;  3H1L J;  4H0L D;  1OW8 A;  2IBZ E;  3CX5 H;  3RK3 C;  1OMI A;  2YXR B;  1HGV A;  3CWB E;  1P84 D;  2P2U A;  2KOG A;  1YJW P;  3CC4 P;  1SQX E;  2IZ0 A;  3AE2 C;  1NKN A;  3E1R A;  1RF1 B;  3I55 P;  3H1K G;  2KZJ A;  2MKV A;  1FOS F;  1SP4 A;  1RH5 B;  1N73 B;  4H13 D;  2OGU A;  1GL2 C;  1GZL A;  1LTJ C;  1ZRT D;  2ZYG A;  3H1K D;  2PAJ A;  4I7Z C;  4NPD A;  2OYI A;  3WU2 H;  1DEB A;  1KIL C;  1NAF A;  1YHQ P;  2N1T A;  1SQB J;  1RF1 C;  1FJP A;  2Q7C A;  2SPZ A;  3RBZ A;  3AE5 C;  1PP9 G;  2E76 D;  2ZXX A;  2BCC G;  3HE5 A;  3TGU D;  1LT9 B;  1IK7 A;  3AE3 C;  1URQ C;  5H2F H;  3B5N D;  2VRS A;  4PV1 D;  2AXT H;  5AVV B;  2E43 A;  1KIL A;  4YPC A;  2W8Z A;  3KYQ A;  3HUS A;  3H1H J;  2JWD A;  3AEE C;  2H8P D;  2JJL A;  4WWI A;  2W6J H;  3H32 A;  1SVF A;  2JP3 A;  1KB9 I;  2QJY B;  3S4R A;  1RE3 C;  2GUS A;  2FYU G;  2ZXE B;  2R5D A;  3V2R A;  1KC8 Q;  3V2N A;  4I1L A;  1L0L K;  1PL5 A;  1Q2N A;  2OYI B;  2IZ1 A;  3IFM A;  5APT A;  3W67 A;  1VQO P;  2H89 C;  2JO1 A;  2KK7 A;  5AVQ B;  1L4A C;  5TIS E;  1BGY J;  2A06 D;  1ZR4 A;  4C7N A;  2K9Y A;  2YMK A;  1KQS O;  2Z5H A;  2A06 G;  3L73 J;  1NTK D;  2LR2 A;  2QEX P;  1N7S B;  3D71 A;  5KJ7 D;  2AEF A;  1OWA A;  1PZQ A;  1S1C X;  2RKL A;  4HKZ H;  5KAI H;  1NYH A;  1URQ B;  2IDB A;  4IFM A;  3A5T A;  3N4X A;  1FZC B;  3D6Y A;  4N6J A;  1NH4 A;  4WVZ A;  2YIU B;  5AVX B;  1K9M Q;  1PPJ G;  1QX8 A;  1XTC C;  2J59 M;  2QJK C;  1L4A B;  2Q5U A;  1NU1 D;  1RQV A;  3B71 A;  1BCC E;  3PP5 A;  5CCH D;  1SQP K;  2FXM A;  3USS A;  3AEF C;  5AW2 B;  2H43 A;  3WUV A;  3TYY A;  1R8E A;  5E79 H;  2HFE D;  3O6Q A;  1NTZ D;  1Y8A A;  1QL2 A;  2ZYD A;  3A0H E;  3PHL A;  1KQF B;  1BDC A;  1NTK K;  2Q6Q A;  1NTK E;  4WY4 B;  1LTB C;  4M3L A;  1JTH B;  4Y99 C;  1GK6 A;  1LTI C;  3L71 G;  1OVV A;  1RY3 A;  2M5A A;  3L70 D;  5C39 A;  2AXT E;  2J58 A;  2P7J A;  4UB8 E;  4HJG H;  4W7Y A;  1KFN A;  1JCD A;  1NU1 E;  3WUU A;  3CCE P;  2QJP B;  1AJY A;  1PIX A;  5APY A;  4JYB A;  1VF5 B;  3MGN A;  4MN4 C;  2OTL P;  2UWJ E;  1YBK A;  5AW9 B;  3L74 E;  4RES B;  4IOI H;  2XDJ A;  2BCC J;  1S3J A;  4LGD E;  1OVR A;  2R3S A;  1A02 F;  1HUC A;  1FZE A;  1JY2 N;  1EDI A;  2FYU K;  3L35 A;  1PV3 A;  1RQU A;  2KXP B;  1SFC B;  3LW5 J;  3LIE A;  1VF5 D;  4OGQ D;  3Q3D A;  2O01 N;  1T2K C;  2YIU C;  2C0X A;  3TGU G;  4CPG A;  1EDJ A;  3SFE C;  3M0D A;  1IFP A;  4NPE A;  1BCC J;  1LTJ A;  2QA4 P;  3BCC J;  2QJP C;  2NPS C;  1L0N D;  2WSE H;  1S5L E;  1S5L X;  1FJK A;  1QL1 A;  5AW4 B;  1M90 Q;  1NHL A;  5BU8 B;  2BEZ F;  2AXC A;  3F5H A;  1GK4 A;  3KPE A;  2A45 I;  2JDI H;  1BE3 J;  2C9L Y;  3IR9 A;  1LP1 B;  3H25 A;  1UIX A;  3IN6 A;  3RK2 C;  1SS1 A;  1URQ A;  4R4L A;  3SSU A;  4DCK A;  5AW5 B;  2FYU D;  3NXS A;  1FAV A;  1MFT A;  1LNQ A;  1KIL D;  1VQK P;  1G1I A;  3GW6 A;  4OVN F;  3FWN A;  1BE3 D;  3WUT A;  1KB9 H;  3R4Y A;  3CD6 P;  2WSS H;  3D6Z A;  5AVU B;  1AA0 A;  1M7L A;  1W2E A;  3U59 A;  1L0N K;  1QGK B;  1VF5 C;  4PJ0 E;  3FGA D;  3V4Q A;  2HPC A;  2HPC B;  1KYO H;  1PP9 E;  2IPP A;  2N1T D;  2W27 A;  3A0H H;  2YKP A;  1T3J A;  2YO2 A;  2PRR A;  3H1L G;  3KXD A;  4K3A A;  4AQR D;  5K5G B;  3Q1M A;  1JY2 O;  1EXJ A;  3NFQ A;  2R44 A;  4JYC A;  1Z56 A;  2GM4 A;  1T6A A;  1Q81 Q;  2PGD A;  2G3A A;  5DJT B;  5AVS B;  1MUU A;  1OFC X;  3UIA A;  3M9H A;  3WMM 0;  1T8Z A;  4WBA A;  1JNM A;  3CC2 P;  3HRN A;  1VQ6 P;  1ZN5 A;  1UII A;  1KQG B;  3S1K A;  1XTG B;  2Q9I A;  2FKW B;  2KP8 A;  1SQQ K;  3RL0 C;  3CXH D;  3WU2 E;  1S4X A;  1EDK A;  2E74 B;  1X22 A;  1VPC A;  3L70 E;  4ZNC A;  4I7Z B;  2WTY A;  1VQ8 P;  4YXW H;  1YQ4 C;  2WT7 B;  1N73 C;  1PP9 D;  3L37 A;  1ZXG A;  2WPV B;  5CMZ A;  2KS1 B;  1AVY A;  2E75 B;  3L75 D;  1J2J B;  2QJY C;  3O8Z A;  3B4S A;  2KSJ A;  3RBX A;  3RK3 D;  2POH A;  3A0B E;  1RHZ B;  2NPS D;  3TNU A;  1YJN P;  4DJG A;  1GDT A;  3KZI H;  2H88 C;  1SQV J;  2JWA A;  3G9R A;  2QVA A;  4BWN A;  1N73 A;  4HH2 A;  4N3Y B;  1M1J A;  2KIK A;  3CX5 I;  3RL0 g;  3CCL P;  5KKZ C;  3MTU E;  1M8O B;  1LT9 A;  2HG5 D;  4UB8 H;  1JY3 N;  3H1I J;  4NPF X;  1FDO A;  3ZDM A;  1R5S A;  1LTT C;  1RE4 C;  2FBW C;  3B5N B;  5AVY B;  3L72 G;  3C1L A;  3G3Z A;  3H32 B;  4L75 A;  2E75 C;  3RGU A;  3BVH A;  2BEQ D;  3CC7 P;  1DX7 A;  1H89 A;  3OA7 A;  1WRG A;  2DW3 A;  2A45 H;  3H1J E;  3L72 D;  5APV A;  1HF9 A;  3H1H D;  3RL0 B;  3L75 E;  1ZME C;  1LP1 A;  3AE9 C;  3H1J J;  1DEE G;  2IBZ D;  2O01 J;  4PD4 D;  2LKM A;  3L4F A;  3M9Q A;  2ITA A;  3CME P;  2Y9Z A;  1NTK G;  3BAT A;  1BSN A;  3II6 A;  1SQQ J;  4IL6 H;  2P67 A;  4KJM A;  1BSH A;  5AW3 B;  3CCJ P;  5APW A;  4DZO A;  4H13 C;  2XZR A;  1HWT C;  5CCG C;  3SWF A;  3AE1 C;  1NKZ B;  1RE3 A;  1IFJ A;  4PJ0 H;  1HJB A;  2IYP A;  4JQ0 D;  1S9K D;  5KAI E;  4XE5 B;  2YKQ A;  2ZT9 C;  1YYC A;  2WQY C;  2D2C D;  1SQQ G;  1LGH B;  3BCC E;  3FXE A;  4PV1 C;  1NTZ G;  2Z4E A;  1Y47 A;  2Q3I A;  1FS0 E;  1X8Y A;  1LTJ B;  3FXD A;  1PGQ A;  3L75 J;  4H44 D;  1MZ9 A;  1QVF O;  3E1I A;  3L73 D;  3ABV C;  5KLV E;  3VP8 A;  1GTW A;  3TGU E;  1IZN B;  1K05 A;  1OXZ A;  2M8R A;  4R4M A;  3L71 D;  4JBZ A;  5CCG D;  2CK3 H;  3HUS C;  3L70 G;  3TGU J;  1BCC D;  2WSF H;  3TNU B;  1H0T A;  1N86 A;  3TK1 A;  2H7H A;  1MKM A;  1ZLL A;  2ZAE B;  3I5C A;  3VP9 A;  1LT9 C;  1NTM D;  2E42 A;  3HD7 B;  4I2L C;  3GHG A;  1VQP P;  1EC5 A;  3EFG A;  3CX5 D;  1M57 D;  4IL6 E;  4EYY Q;  3M0A A;  1EDL A;  1M1J B;  1NGM B;  1KOR A;  2FY8 A;  2K1A A;  2KYV A; 
#chains in the Genus database with same CATH homology
 1KYO H;  1PPJ G;  1NTM G;  3H1L G;  3L73 G;  3CWB G;  3H1H G;  3L75 G;  4D6T G;  3CXH H;  1SQQ G;  1BE3 G;  1NTZ G;  3H1J G;  1L0N G;  3CX5 H;  4PD4 H;  3TGU G;  3L72 G;  5KLV G;  1SQX G;  2FYU G;  1NU1 G;  1BCC G;  3H1K G;  1P84 H;  3L74 G;  3L70 G;  3H1I G;  3L71 G;  1NTK G;  2A06 G;  1SQV G;  1L0L G;  1EZV G;  1BGY G;  1PP9 G;  2BCC G;  2IBZ G;  4U3F G;  1KB9 H;  1SQP G;  3BCC G;  1SQB G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...