1SQQG

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqqG00
3CWBG 4D6TG 1KB9H 3L70G 2BCCG 1SQPG 5KLVG 1BE3G 1NTKG 1SQQG 3BCCG 3CXHH 4U3FG 1EZVG 3H1KG 3L72G 1NTZG 3H1LG 2A06G 1L0NG 2IBZG 1PPJG 1NU1G 3L73G 3L71G 4PD4H 1SQXG 2FYUG 1NTMG 3H1JG 1BCCG 1L0LG 3L75G 3L74G 3H1HG 1SQBG 3H1IG 3TGUG 1KYOH 3CX5H 1SQVG 1BGYG 1P84H 1PP9G
chains in the Genus database with same CATH superfamily
3RBXA 3H6PA 3Q5PA 3M91A 2G3AA 3CMAP 3QWOC 4H0LC 4BXLA 1HJ0A 5TISH 3QH9A 1LGHB 1JY2P 1NTKG 4YPCA 1VQ6P 4HYTB 2E76B 1NU1K 3G3ZA 1PGJA 3GF3A 5H2FE 1YTZI 1QVGO 1BCCE 1GL2A 2OTLP 1YHQP 2IX7C 3S9OA 1ZW0A 1PP9G 3WUTA 2WWWA 4PJ0H 2KNCB 3W68A 1M1KQ 4U3FE 1BE3G 2KP8A 3BCCG 1Y9BA 2HPCA 1LT9C 2Y0EA 1NYHA 1VDFA 4HKZH 1BE3D 3TGUE 2Q5UA 5AW8B 2KIKA 1KD1Q 2HODA 1K9MQ 1KB9H 1YQ3C 3BATA 3L75J 4Y28J 5KAIE 3CXHE 1E79H 5C39A 1HGVA 1YJWP 1RQVA 1HH0A 3P8MC 3II6A 1FZFA 3A3YB 1JEKA 4WWIA 4D6TG 3SWKA 3P7KA 1VF5D 3CCQP 1N73B 2C0WA 1KQSO 1SQXK 3L36A 4XA4A 5APXA 2HODB 1JMBA 3CCJP 3H1LG 1LTIC 1NVOA 4OGQB 2FFDC 5APUA 3D6YA 1S3JA 2WT7B 2Y0DA 3H1LD 3O6QB 1HUCA 5AW6B 5TISE 3USSA 1LTBC 1ZP0C 3AE6C 4ZNCA 3L4FA 1FZCC 1OVRA 1HBWA 1SQPJ 2P67A 2NPSB 2YIUC 3JCUH 5CCHD 5KAFE 1M7LA 2JP3A 2ZVNB 1M1JC 1RF1B 2P58A 4R4MA 1L0LK 3RK2D 3RK3E 1OVVA 3CWBD 5CCHC 2IBZE 3L75E 1LT1A 1KB9I 3NXSA 2BEZF 3RK3B 1NAYA 1RE3A 4TT3H 2E76D 3L74J 3AEEC 2QJKB 3FX0A 1H89A 3U59A 1ZV8A 1BCCG 1Q2NA 2GUVA 2OYHB 1VQNP 4DZOA 4GT1A 2QIWA 2E76C 1JMMA 4KHXA 4U3FG 1AVOA 4YXDC 2K9YA 2QJPB 3FWNA 3D70A 1BSHA 1GTWA 1JY3P 4U3FD 3TGUG 3TYYA 1USDA 1HVVA 1SQPE 2E74B 3MHVA 1NTMD 3V4WA 1QGKB 1LWUA 3CMEP 1MZ9A 4W7ZA 3PP5A 3P8CE 5APSA 1DD4A 4M3LA 3CXHD 3L72J 2WPRA 1VQPP 2N9YB 1L0NJ 3MZWB 5AW4B 1FOSF 3L74E 1N73C 2IFMA 1RF0C 1IFPA 1X22A 3AEBC 1LJ2A 1P84E 2SPZA 5B5EH 4OGQC 3IF4A 3E1IA 2YXQB 5AW7B 2H89C 4DOJA 3I5CA 5GTHH 2NPSD 1HWTC 3CCMP 1EZVI 2KZIA 1FDMA 3RBZA 2R3CA 1NU1J 2PRRA 4CPGA 1VQ9P 2OTJP 2NPSC 5APTA 3HD7B 1SQBK 5AVZB 2ZXXA 2IBZG 3CC7P 2LXCB 3L75G 2E42A 2KLVA 3PLNA 1KILB 1KYOH 1IZNB 1RF1C 3G9RA 3RGUA 3RK3D 3HE4A 1PGPA 4C7NA 2IBZD 4R4LA 1RY3A 1LTGC 3L72E 3B8EB 1PP9J 4JQ0D 1URQB 2FYUE 3RK3C 1ZOYC 3B5ND 3HRNA 4JBZA 4BRYB 3I55P 4GOEA 3Q1MA 3G71P 2KB7P 2M8RA 2QJKC 1T6AA 2OYHC 1PL5A 3HE4B 4U7JA 1NGMB 2W6JH 2O1KA 3MGNA 1Z56A 3C8VA 2QJPC 3M0DC 1R8EA 2D2CD 2E74D 2Q7CA 1SQPG 3V2RA 1SQXJ 4I2LC 3V5BA 3H1JJ 1LT9A 1RE3C 1VQMP 2M3EA 1NU1E 3GLMA 1SQPD 1IFIA 2E74C 1MKMA 4ASWA 2KK7A 1QX8A 1IFMA 2Q3IA 2V4HA 3RL0g 5AVWB 4UB6E 2K37A 3P8CD 4B86A 2FXPA 4N6JA 2GM4A 1BGYJ 2JWAA 3HUSB 1KYOI 3L35A 1FZGA 3L74G 4LC1A 4JF7A 1PP9E 5AVQB 3CPWO 2M3BA 1H0TA 5L8RJ 1YQ4C 1IO4A 5APWA 1L0LJ 4AUWA 2FFDA 3EQ2A 2POHA 1P84D 4AYCA 5CCGC 1JOCA 2JWDA 2YKOA 3KDPB 1YI2P 1GU5A 3VOPA 4IL6X 2JEEA 1EZVG 1FZCA 3OJAB 3AE1C 1SQXE 2ZFCA 1CW5A 3H1JE 5E79H 4EYYQ 3Q2YA 3CX5H 5AVVB 2Y0CA 3LIDA 1M1JA 3AE7C 2KS1A 5AVUB 1VF5B 2WVRA 5APQA 3HD7C 1M56D 3PTZA 1DD3A 5CCHA 1T2KD 2J58A 3L72G 3LW5H 1KILC 2A06E 3CL3D 1L0NG 1BDCA 1SQVK 2KI7B 4A7PA 1BGYE 5APYA 3WU2H 3L72D 4L75A 2FXMA 1FZCB 2FY8A 2M5AB 1T2KC 3KYQA 3SWYA 4EDFA 2FYUD 2YIUB 3RL0D 4Z1MH 1URQC 1BSNA 3H1ID 1KTMA 3VN0A 1M1JB 4GDOA 1L0LE 1HJBA 4OVNF 5CJ0A 3N4XA 2Y9ZA 3PHLA 2KSEA 1FDIA 2OTKE 2KNCA 3RK2B 1AV1A 1NU1G 1RE4C 3EFFK 3NFQA 1NOHA 2O1JA 1GMJA 4W80A 4WVZA 2K88A 1VQ8P 1GK6A 4JPZB 1ZRTE 1IFJA 1ZR4A 1R5SA 1NU1D 5AVXB 2YO2A 2O3JA 2PP6A 1FAVA 3CX5I 2JDIH 5KLVK 2NRGA 1KMIZ 2QA4P 3M9HA 5E79E 1NTKD 3E7KA 2HYNA 3HUSC 2GA1A 1KQGB 1LTJB 5B66H 1AQTA 1SQBJ 4GIFA 1PP9D 2B89A 2WPSA 5GTIH 1N73A 2CK3H 1RF0A 1JCDA 1DEEG 3BCCD 1YJ9P 2A45H 1L4AD 2YKPA 1Y47A 4DCKA 1NTZK 2FKWB 1VQ5P 1VL2A 4L73A 5AVRB 1T8ZA 2WT7A 2PGDA 4IL6H 3O6QA 1SQXG 3H1JG 2OYIB 2C0XA 5AW3B 5M1BA 2E5TA 4EI2A 1LNQA 3A0HH 2C9NY 1OWAA 2NPSA 1VQOP 2O01N 4WB4A 4D6TD 2A06G 3A0BH 3L71G 3CLQA 1QL2A 2H8PD 1VF5C 1RF1A 1KORA 3SFEC 2RH0A 2B88A 1BGYG 1VPCA 1PGOA 2A06D 3OA7A 2K3RA 5KJ7D 2Z5HA 3V2NA 4PD4H 3AE9C 1L0LG 1SQBE 2QM7A 1N86A 4C7RA 1PZQA 3H1KJ 2ZYDA 1FS0E 4PJ0E 5KLIB 2OYHA 3MTUE 5AVYB 1FDOA 3TNUB 1XTGB 5AW1B 1JY3N 1S5LX 5BVZA 2WQYC 2A45I 3HTKA 1MFTA 3M0DA 1NKZB 1W5CE 1OW8A 1KB9E 3RK2C 2KOGA 2YMKA 2JJLA 3U1CA 1YJNP 3S4RA 1S9KE 3B5NB 2ZT9D 2AEMA 4Y99B 5CBNA 3KXDA 2XNDH 3KQGA 2P7JA 1KC8Q 2QRXA 4AQRD 1BCCD 3A0HE 2P10A 5AW0B 3HTKB 3TDKA 1M57D 2W27A 1GZLA 2BEQD 3A0BE 3AE8C 2R32A 2KLUA 5APVA 2QJYB 2AEFA 3H32B 1QVFO 1LTJC 3M9BA 2D2CB 4QMAA 3H1KE 3TGUD 2XNXA 2N1TB 4PD4I 1EDJA 1SQVJ 1PPJG 2Q3EA 3P32A 2ZYAA 1Q81Q 2WSSH 5CCGA 3GHGA 2L5GB 4GODA 1LTSC 2FYZA 2ITAA 3JCUE 2JKVA 2UWJE 3BRTB 1GL2D 1FJKA 2QSIA 1AA0A 2RN0A 2OYIC 1NTMK 4C46A 2I1KA 2WPQA 1IFNA 2B9BA 3WUVA 4MN4C 3HD7A 4XFJA 2LXBA 2AXTH 1KILA 1AVYA 3GHGB 5CHXA 2XU6A 2OYOA 1J1EC 1LTTC 3L70J 1EDLA 4UB8H 1SQBG 1Q90D 1S2EA 3CCUP 1ZLLA 5AW5B 1N2DC 1URQA 1NWQA 2V7QH 3Q5RA 4WY4D 4BRYA 2Z4EA 2CPSA 1SQBD 1EZVE 4KT0J 3IR9A 1M8OB 5KLVJ 2P1JA 4L74A 3CI9A 1H88A 3IN6A 1D7MA 1X0TA 1DIPA 5KLIC 3AEAC 4I7ZB 2V7QJ 1FZBA 1BDDA 1SP4A 3L75D 4ASVA 3K5BA 1RE4A 1EXIA 1L0NE 2W6AA 2IZ1A 4NPFX 4NPEA 1KB9D 2E75D 2WSFH 3KHUA 1NO4A 3VP9A 4PV1D 2FYNB 4HB1A 1NTZJ 2I8DA 3RL0B 2WSEH 1JNMA 1S9KD 1KN7A 3B5NC 4Y99C 1UIIA 1W2BO 2WSFJ 1AQ5A 2QE7H 3HUSA 2J5UA 5B5EE 2YKQA 3H1KG 2N1TD 3SWFA 1KZUB 1OZHA 2QJYC 2ZJSE 4K35A 5CBOA 1Q82Q 5GTHE 3V2PA 4IFDK 1TU3F 2D2CC 4DJGA 3F5HA 5KLVE 3H1KD 3AECC 2N1TC 3GMAA 5KKZB 1OW6A 3L71J 3M06A 1LP1B 1PGQA 1FU1A 1S1CX 4I6MC 5BU5A 1SQQK 1KYOE 2W90A 4H44B 2PFXA 4JYCA 1GU4A 1RHZB 3L74D 3KZIH 1NTZE 2LKMA 1K8AQ 2M0BA 1K05A 1VQ7P 1XTCC 3GHGC 5AVSB 1QEXA 1L4AB 1JTHB 1FBMA 1N8RQ 1FOSE 1PFIA 2M5AA 3CWBJ 2C9LY 3U1AA 1SFCB 1SQVG 1EZVD 2B87A 4H13D 1SVFA 4RESB 2QM8A 5H2FH 2E5YA 2KYVA 3L71E 4I7ZC 2FXOA 2BCCJ 5CJ4A 5DJUB 3VMZA 1YTZT 1WT6A 1L0ND 3LIEA 1A02F 1JY2N 3L73J 3LW5J 1EDIA 3Q5SA 2B87B 4RJTA 1MUUA 1USEA 2IYOA 5CMZA 2FYNC 3RL0C 3ABVC 1J1DB 3L70G 5KAIH 3CXHH 1NTMJ 1X79B 1JY3O 1OW7A 2FYUK 4O9BA 1G1JA 4TLFA 1KQLA 2YXRB 2AEJA 3VYIA 1LTJA 4EIJA 1HF9A 3CWBE 5KLVG 1JCCA 3TF5A 5AW9B 1KFNA 4H0LD 1YIJP 5KLVD 1ZR2A 3CCEP 1DH3A 5KKZC 1OXZA 1S72P 1AFOA 2ZT9B 1FZAA 1HTLC 3T97A 3M0AA 3M9QA 3CX5E 2BCCE 2ZAEB 2Q9IA 2H43A 4H44D 2OYIA 1IFDA 1T3JA 1NTZG 3C1LA 2QVAA 3L73E 1KYOD 5KAFH 4H44C 3TSIA 4IFFA 2QEXP 1NTZD 1NTKK 3WU2E 3OAKA 3V4QA 2W6BA 3T97B 3NTNA 1NTME 1PPJE 5KTBA 1EXJA 1L4AC 1A02J 3N7NA 1SFCD 2G8YA 3D71A 1L2PA 1R5LA 3CXHI 4K3AA 3PH0A 1GL2B 1SQXD 3H1JD 4ZKPA 1ZMEC 1SFCC 2WITA 1IJDB 4WY4A 1S4XA 2LR2A 1PV3A 1OIPA 3TNUA 1J1EB 2HPCB 1Q86Q 1UIXA 3V2QA 2O01H 3L71D 4N78E 2OGUA 2H7HA 1BGYD 3FXDA 1ZN5A 3WUUA 3A7OA 3SFDC 2R5BA 3GG2A 1YYCA 1N7SD 1H8AA 2O01J 5KJ7C 3MUDC 4BWNA 4WY4B 3B5NA 1L0LD 2CPBA 5AVTB 5DJTB 4ZMDA 5B66E 3B71A 1N7SC 4LGDE 2YO3A 1J1DC 1YITP 1PIXA 5GTIE 1CI6A 2K9JA 3VTPC 2XZRA 1SQQJ 3CWBG 1ZXGA 2MJZA 1KQFB 1JM0A 1M90Q 2IBZI 2GUSA 2RKLA 2JR8A 3H32A 3ZDMA 1NKNA 1CZQA 3V6IA 3UIAA 2KUBA 1ZRTD 4IL6E 1Q7YQ 3CC4P 2E75B 3GF7A 2N1TA 3Q3DA 1P84H 3HE5A 1JUNA 4PV1B 1G2CA 5AW2B 4LLHA 2BCCG 2IDBA 4HH2A 5TJHA 1VQKP 2VRSA 3AEFC 1CI6B 2K9JB 4IOIH 1FZEA 2ZT9C 1YBKA 3CX5D 2BCCD 1X8YA 3L73G 1DEBA 2IFNA 2WSCH 3AE5C 1U7MA 2HG5D 2WPVB 3L73D 1G1IA 1OFCX 3ITKA 2K1AA 3CCLP 2BASA 3I56P 3H1HJ 3HE5B 1G2CB 1OVUA 1NTMG 2WSCJ 2HFED 3H25A 4PD4E 4NPDA 1HGZA 3CCRP 1DX7A 2KXPB 1PPJD 1SQQE 2H88C 1GK4A 3MD0A 3PRJA 3O8ZA 3GW6A 2XV5A 1GL2C 3BVHA 1K04A 1X9VA 3JC22 3MIWA 2WZ7A 1OX3A 2FYUJ 3H1IJ 4OGQD 1P84I 1N7LA 4N78D 3VMXA 1FE6A 3AEGC 2W83C 2YMYA 1LWUB 3S1KA 4OH8B 4OWFA 1GDTA 1EQ7A 1KFMA 1RQUA 4JYBA 4RO0A 2W8ZA 1LTAC 1Y8AA 3H1HE 3A5TA 3VP8A 1SQVE 4WY4C 2IZ0A 1S5LH 4H13B 3AEDC 4N3YB 3SSUA 3W67A 1VQ4P 4RKUJ 1KILE 2HLOA 1WMKA 4UB6H 2QG4A 2A45G 1SLQA 1GW3A 2IPPA 4YXWH 3PJSK 1NTKJ 1JY2O 2PAJA 1GW4A 4EOTA 1IK7A 1MFZA 4DT0A 1NH4A 2E75C 2OQQA 4PV1C 1EDKA 3VMAA 3B4SA 1BE3J 3H1IE 1LP1A 3BCCJ 3L70E 3CCVP 2J59M 2WSEJ 1CSBA 1NJIQ 2AXCA 2AXTE 1U57A 2MKVA 5K5GB 4C7NB 3JSVC 2YNYA 1KV4A 2IYPA 4GKGA 4UB8E 3FWLA 4KJMA 2JO1A 2L91A 1FJPA 2KSJA 3TK1A 1RH5B 1SQQG 2XKMA 2Z5IA 4H0LB 4PD4D 2HR3A 1GD2E 1WRGA 2Q6QA 1L4AA 4D6TJ 3MP7B 1JTHA 2ZYGA 1NAFA 4XE5B 1NHLA 1SQQD 1SQPK 3BASA 3AE4C 2R44A 1S5LE 3H1LJ 1NTKE 3WMM0 3R4YA 1IC2A 1SFCA 3A2AA 3R2PA 4WBAA 1JO5A 1J2JB 1K73Q 5BU8B 1LT9B 3F89A 2ZVOB 1BE3E 3IAOA 3BCCE 3FGAD 5CCGD 3G6EP 1QLED 2NZ2A 3NMDA 2ZXEB 4I1LA 1SS1A 3KPEA 1AJYA 1LWUC 3H1HG 2FBWC 5KJ7A 3MUDA 2Y9YA 2WMMA 2R5DA 1JB0J 1FC2C 3H1HD 3FXEA 2E43A 1U7JA 5EFWB 1N7SA 1SQVD 3VMYA 3L37A 3CD6P 3HD7D 2I1JA 1H0TB 2N9BA 2DW3A 3BRVB 4IFMA 4H13C 1KILD 3IFMA 4D6TE 2OARA 1MV8A 3AE3C 2FFDB 2R3SA 4L76A 3AE2C 3EWKA 1BCCJ 3CCSP 3H1LE 4GOFA 4ZKUA 1URQD 2FYUG 3CC2P 1E5WA 2Q1KA 2P2UA 4U3FJ 3H1IG 1N7SB 2RMZA 1W2EA 2XDJA 1QL1A 4W7YA 1IK9A 3G4SP 1L0NK 1OMIA 3E1RA 3TGUJ 2KS1B 3KZIE 4HJGH 2WTYA 3D6ZA 3L70D 3OW2O 3EFGA 1T3UA 2KZJA 4YTPC 1EC5A 1VQLP 3C9IA
chains in the Genus database with same CATH topology
3CWBG 4D6TG 1KB9H 3L70G 2BCCG 1SQPG 5KLVG 1BE3G 1NTKG 1SQQG 3BCCG 3CXHH 4U3FG 1EZVG 3H1KG 3L72G 1NTZG 3H1LG 2A06G 1L0NG 2IBZG 1PPJG 1NU1G 3L73G 3L71G 4PD4H 1SQXG 2FYUG 1NTMG 3H1JG 1BCCG 1L0LG 3L75G 3L74G 3H1HG 1SQBG 3H1IG 3TGUG 1KYOH 3CX5H 1SQVG 1BGYG 1P84H 1PP9G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3CWB G;  4D6T G;  1KB9 H;  3L70 G;  2BCC G;  1SQP G;  5KLV G;  1BE3 G;  1NTK G;  1SQQ G;  3BCC G;  3CXH H;  4U3F G;  1EZV G;  3H1K G;  3L72 G;  1NTZ G;  3H1L G;  2A06 G;  1L0N G;  2IBZ G;  1PPJ G;  1NU1 G;  3L73 G;  3L71 G;  4PD4 H;  1SQX G;  2FYU G;  1NTM G;  3H1J G;  1BCC G;  1L0L G;  3L75 G;  3L74 G;  3H1H G;  1SQB G;  3H1I G;  3TGU G;  1KYO H;  3CX5 H;  1SQV G;  1BGY G;  1P84 H;  1PP9 G; 
#chains in the Genus database with same CATH topology
 3RBX A;  3H6P A;  3Q5P A;  3M91 A;  2G3A A;  3CMA P;  3QWO C;  4H0L C;  4BXL A;  1HJ0 A;  5TIS H;  3QH9 A;  1LGH B;  1JY2 P;  1NTK G;  4YPC A;  1VQ6 P;  4HYT B;  2E76 B;  1NU1 K;  3G3Z A;  1PGJ A;  3GF3 A;  5H2F E;  1YTZ I;  1QVG O;  1BCC E;  1GL2 A;  2OTL P;  1YHQ P;  2IX7 C;  3S9O A;  1ZW0 A;  1PP9 G;  3WUT A;  2WWW A;  4PJ0 H;  2KNC B;  3W68 A;  1M1K Q;  4U3F E;  1BE3 G;  2KP8 A;  3BCC G;  1Y9B A;  2HPC A;  1LT9 C;  2Y0E A;  1NYH A;  1VDF A;  4HKZ H;  1BE3 D;  3TGU E;  2Q5U A;  5AW8 B;  2KIK A;  1KD1 Q;  2HOD A;  1K9M Q;  1KB9 H;  1YQ3 C;  3BAT A;  3L75 J;  4Y28 J;  5KAI E;  3CXH E;  1E79 H;  5C39 A;  1HGV A;  1YJW P;  1RQV A;  1HH0 A;  3P8M C;  3II6 A;  1FZF A;  3A3Y B;  1JEK A;  4WWI A;  4D6T G;  3SWK A;  3P7K A;  1VF5 D;  3CCQ P;  1N73 B;  2C0W A;  1KQS O;  1SQX K;  3L36 A;  4XA4 A;  5APX A;  2HOD B;  1JMB A;  3CCJ P;  3H1L G;  1LTI C;  1NVO A;  4OGQ B;  2FFD C;  5APU A;  3D6Y A;  1S3J A;  2WT7 B;  2Y0D A;  3H1L D;  3O6Q B;  1HUC A;  5AW6 B;  5TIS E;  3USS A;  1LTB C;  1ZP0 C;  3AE6 C;  4ZNC A;  3L4F A;  1FZC C;  1OVR A;  1HBW A;  1SQP J;  2P67 A;  2NPS B;  2YIU C;  3JCU H;  5CCH D;  5KAF E;  1M7L A;  2JP3 A;  2ZVN B;  1M1J C;  1RF1 B;  2P58 A;  4R4M A;  1L0L K;  3RK2 D;  3RK3 E;  1OVV A;  3CWB D;  5CCH C;  2IBZ E;  3L75 E;  1LT1 A;  1KB9 I;  3NXS A;  2BEZ F;  3RK3 B;  1NAY A;  1RE3 A;  4TT3 H;  2E76 D;  3L74 J;  3AEE C;  2QJK B;  3FX0 A;  1H89 A;  3U59 A;  1ZV8 A;  1BCC G;  1Q2N A;  2GUV A;  2OYH B;  1VQN P;  4DZO A;  4GT1 A;  2QIW A;  2E76 C;  1JMM A;  4KHX A;  4U3F G;  1AVO A;  4YXD C;  2K9Y A;  2QJP B;  3FWN A;  3D70 A;  1BSH A;  1GTW A;  1JY3 P;  4U3F D;  3TGU G;  3TYY A;  1USD A;  1HVV A;  1SQP E;  2E74 B;  3MHV A;  1NTM D;  3V4W A;  1QGK B;  1LWU A;  3CME P;  1MZ9 A;  4W7Z A;  3PP5 A;  3P8C E;  5APS A;  1DD4 A;  4M3L A;  3CXH D;  3L72 J;  2WPR A;  1VQP P;  2N9Y B;  1L0N J;  3MZW B;  5AW4 B;  1FOS F;  3L74 E;  1N73 C;  2IFM A;  1RF0 C;  1IFP A;  1X22 A;  3AEB C;  1LJ2 A;  1P84 E;  2SPZ A;  5B5E H;  4OGQ C;  3IF4 A;  3E1I A;  2YXQ B;  5AW7 B;  2H89 C;  4DOJ A;  3I5C A;  5GTH H;  2NPS D;  1HWT C;  3CCM P;  1EZV I;  2KZI A;  1FDM A;  3RBZ A;  2R3C A;  1NU1 J;  2PRR A;  4CPG A;  1VQ9 P;  2OTJ P;  2NPS C;  5APT A;  3HD7 B;  1SQB K;  5AVZ B;  2ZXX A;  2IBZ G;  3CC7 P;  2LXC B;  3L75 G;  2E42 A;  2KLV A;  3PLN A;  1KIL B;  1KYO H;  1IZN B;  1RF1 C;  3G9R A;  3RGU A;  3RK3 D;  3HE4 A;  1PGP A;  4C7N A;  2IBZ D;  4R4L A;  1RY3 A;  1LTG C;  3L72 E;  3B8E B;  1PP9 J;  4JQ0 D;  1URQ B;  2FYU E;  3RK3 C;  1ZOY C;  3B5N D;  3HRN A;  4JBZ A;  4BRY B;  3I55 P;  4GOE A;  3Q1M A;  3G71 P;  2KB7 P;  2M8R A;  2QJK C;  1T6A A;  2OYH C;  1PL5 A;  3HE4 B;  4U7J A;  1NGM B;  2W6J H;  2O1K A;  3MGN A;  1Z56 A;  3C8V A;  2QJP C;  3M0D C;  1R8E A;  2D2C D;  2E74 D;  2Q7C A;  1SQP G;  3V2R A;  1SQX J;  4I2L C;  3V5B A;  3H1J J;  1LT9 A;  1RE3 C;  1VQM P;  2M3E A;  1NU1 E;  3GLM A;  1SQP D;  1IFI A;  2E74 C;  1MKM A;  4ASW A;  2KK7 A;  1QX8 A;  1IFM A;  2Q3I A;  2V4H A;  3RL0 g;  5AVW B;  4UB6 E;  2K37 A;  3P8C D;  4B86 A;  2FXP A;  4N6J A;  2GM4 A;  1BGY J;  2JWA A;  3HUS B;  1KYO I;  3L35 A;  1FZG A;  3L74 G;  4LC1 A;  4JF7 A;  1PP9 E;  5AVQ B;  3CPW O;  2M3B A;  1H0T A;  5L8R J;  1YQ4 C;  1IO4 A;  5APW A;  1L0L J;  4AUW A;  2FFD A;  3EQ2 A;  2POH A;  1P84 D;  4AYC A;  5CCG C;  1JOC A;  2JWD A;  2YKO A;  3KDP B;  1YI2 P;  1GU5 A;  3VOP A;  4IL6 X;  2JEE A;  1EZV G;  1FZC A;  3OJA B;  3AE1 C;  1SQX E;  2ZFC A;  1CW5 A;  3H1J E;  5E79 H;  4EYY Q;  3Q2Y A;  3CX5 H;  5AVV B;  2Y0C A;  3LID A;  1M1J A;  3AE7 C;  2KS1 A;  5AVU B;  1VF5 B;  2WVR A;  5APQ A;  3HD7 C;  1M56 D;  3PTZ A;  1DD3 A;  5CCH A;  1T2K D;  2J58 A;  3L72 G;  3LW5 H;  1KIL C;  2A06 E;  3CL3 D;  1L0N G;  1BDC A;  1SQV K;  2KI7 B;  4A7P A;  1BGY E;  5APY A;  3WU2 H;  3L72 D;  4L75 A;  2FXM A;  1FZC B;  2FY8 A;  2M5A B;  1T2K C;  3KYQ A;  3SWY A;  4EDF A;  2FYU D;  2YIU B;  3RL0 D;  4Z1M H;  1URQ C;  1BSN A;  3H1I D;  1KTM A;  3VN0 A;  1M1J B;  4GDO A;  1L0L E;  1HJB A;  4OVN F;  5CJ0 A;  3N4X A;  2Y9Z A;  3PHL A;  2KSE A;  1FDI A;  2OTK E;  2KNC A;  3RK2 B;  1AV1 A;  1NU1 G;  1RE4 C;  3EFF K;  3NFQ A;  1NOH A;  2O1J A;  1GMJ A;  4W80 A;  4WVZ A;  2K88 A;  1VQ8 P;  1GK6 A;  4JPZ B;  1ZRT E;  1IFJ A;  1ZR4 A;  1R5S A;  1NU1 D;  5AVX B;  2YO2 A;  2O3J A;  2PP6 A;  1FAV A;  3CX5 I;  2JDI H;  5KLV K;  2NRG A;  1KMI Z;  2QA4 P;  3M9H A;  5E79 E;  1NTK D;  3E7K A;  2HYN A;  3HUS C;  2GA1 A;  1KQG B;  1LTJ B;  5B66 H;  1AQT A;  1SQB J;  4GIF A;  1PP9 D;  2B89 A;  2WPS A;  5GTI H;  1N73 A;  2CK3 H;  1RF0 A;  1JCD A;  1DEE G;  3BCC D;  1YJ9 P;  2A45 H;  1L4A D;  2YKP A;  1Y47 A;  4DCK A;  1NTZ K;  2FKW B;  1VQ5 P;  1VL2 A;  4L73 A;  5AVR B;  1T8Z A;  2WT7 A;  2PGD A;  4IL6 H;  3O6Q A;  1SQX G;  3H1J G;  2OYI B;  2C0X A;  5AW3 B;  5M1B A;  2E5T A;  4EI2 A;  1LNQ A;  3A0H H;  2C9N Y;  1OWA A;  2NPS A;  1VQO P;  2O01 N;  4WB4 A;  4D6T D;  2A06 G;  3A0B H;  3L71 G;  3CLQ A;  1QL2 A;  2H8P D;  1VF5 C;  1RF1 A;  1KOR A;  3SFE C;  2RH0 A;  2B88 A;  1BGY G;  1VPC A;  1PGO A;  2A06 D;  3OA7 A;  2K3R A;  5KJ7 D;  2Z5H A;  3V2N A;  4PD4 H;  3AE9 C;  1L0L G;  1SQB E;  2QM7 A;  1N86 A;  4C7R A;  1PZQ A;  3H1K J;  2ZYD A;  1FS0 E;  4PJ0 E;  5KLI B;  2OYH A;  3MTU E;  5AVY B;  1FDO A;  3TNU B;  1XTG B;  5AW1 B;  1JY3 N;  1S5L X;  5BVZ A;  2WQY C;  2A45 I;  3HTK A;  1MFT A;  3M0D A;  1NKZ B;  1W5C E;  1OW8 A;  1KB9 E;  3RK2 C;  2KOG A;  2YMK A;  2JJL A;  3U1C A;  1YJN P;  3S4R A;  1S9K E;  3B5N B;  2ZT9 D;  2AEM A;  4Y99 B;  5CBN A;  3KXD A;  2XND H;  3KQG A;  2P7J A;  1KC8 Q;  2QRX A;  4AQR D;  1BCC D;  3A0H E;  2P10 A;  5AW0 B;  3HTK B;  3TDK A;  1M57 D;  2W27 A;  1GZL A;  2BEQ D;  3A0B E;  3AE8 C;  2R32 A;  2KLU A;  5APV A;  2QJY B;  2AEF A;  3H32 B;  1QVF O;  1LTJ C;  3M9B A;  2D2C B;  4QMA A;  3H1K E;  3TGU D;  2XNX A;  2N1T B;  4PD4 I;  1EDJ A;  1SQV J;  1PPJ G;  2Q3E A;  3P32 A;  2ZYA A;  1Q81 Q;  2WSS H;  5CCG A;  3GHG A;  2L5G B;  4GOD A;  1LTS C;  2FYZ A;  2ITA A;  3JCU E;  2JKV A;  2UWJ E;  3BRT B;  1GL2 D;  1FJK A;  2QSI A;  1AA0 A;  2RN0 A;  2OYI C;  1NTM K;  4C46 A;  2I1K A;  2WPQ A;  1IFN A;  2B9B A;  3WUV A;  4MN4 C;  3HD7 A;  4XFJ A;  2LXB A;  2AXT H;  1KIL A;  1AVY A;  3GHG B;  5CHX A;  2XU6 A;  2OYO A;  1J1E C;  1LTT C;  3L70 J;  1EDL A;  4UB8 H;  1SQB G;  1Q90 D;  1S2E A;  3CCU P;  1ZLL A;  5AW5 B;  1N2D C;  1URQ A;  1NWQ A;  2V7Q H;  3Q5R A;  4WY4 D;  4BRY A;  2Z4E A;  2CPS A;  1SQB D;  1EZV E;  4KT0 J;  3IR9 A;  1M8O B;  5KLV J;  2P1J A;  4L74 A;  3CI9 A;  1H88 A;  3IN6 A;  1D7M A;  1X0T A;  1DIP A;  5KLI C;  3AEA C;  4I7Z B;  2V7Q J;  1FZB A;  1BDD A;  1SP4 A;  3L75 D;  4ASV A;  3K5B A;  1RE4 A;  1EXI A;  1L0N E;  2W6A A;  2IZ1 A;  4NPF X;  4NPE A;  1KB9 D;  2E75 D;  2WSF H;  3KHU A;  1NO4 A;  3VP9 A;  4PV1 D;  2FYN B;  4HB1 A;  1NTZ J;  2I8D A;  3RL0 B;  2WSE H;  1JNM A;  1S9K D;  1KN7 A;  3B5N C;  4Y99 C;  1UII A;  1W2B O;  2WSF J;  1AQ5 A;  2QE7 H;  3HUS A;  2J5U A;  5B5E E;  2YKQ A;  3H1K G;  2N1T D;  3SWF A;  1KZU B;  1OZH A;  2QJY C;  2ZJS E;  4K35 A;  5CBO A;  1Q82 Q;  5GTH E;  3V2P A;  4IFD K;  1TU3 F;  2D2C C;  4DJG A;  3F5H A;  5KLV E;  3H1K D;  3AEC C;  2N1T C;  3GMA A;  5KKZ B;  1OW6 A;  3L71 J;  3M06 A;  1LP1 B;  1PGQ A;  1FU1 A;  1S1C X;  4I6M C;  5BU5 A;  1SQQ K;  1KYO E;  2W90 A;  4H44 B;  2PFX A;  4JYC A;  1GU4 A;  1RHZ B;  3L74 D;  3KZI H;  1NTZ E;  2LKM A;  1K8A Q;  2M0B A;  1K05 A;  1VQ7 P;  1XTC C;  3GHG C;  5AVS B;  1QEX A;  1L4A B;  1JTH B;  1FBM A;  1N8R Q;  1FOS E;  1PFI A;  2M5A A;  3CWB J;  2C9L Y;  3U1A A;  1SFC B;  1SQV G;  1EZV D;  2B87 A;  4H13 D;  1SVF A;  4RES B;  2QM8 A;  5H2F H;  2E5Y A;  2KYV A;  3L71 E;  4I7Z C;  2FXO A;  2BCC J;  5CJ4 A;  5DJU B;  3VMZ A;  1YTZ T;  1WT6 A;  1L0N D;  3LIE A;  1A02 F;  1JY2 N;  3L73 J;  3LW5 J;  1EDI A;  3Q5S A;  2B87 B;  4RJT A;  1MUU A;  1USE A;  2IYO A;  5CMZ A;  2FYN C;  3RL0 C;  3ABV C;  1J1D B;  3L70 G;  5KAI H;  3CXH H;  1NTM J;  1X79 B;  1JY3 O;  1OW7 A;  2FYU K;  4O9B A;  1G1J A;  4TLF A;  1KQL A;  2YXR B;  2AEJ A;  3VYI A;  1LTJ A;  4EIJ A;  1HF9 A;  3CWB E;  5KLV G;  1JCC A;  3TF5 A;  5AW9 B;  1KFN A;  4H0L D;  1YIJ P;  5KLV D;  1ZR2 A;  3CCE P;  1DH3 A;  5KKZ C;  1OXZ A;  1S72 P;  1AFO A;  2ZT9 B;  1FZA A;  1HTL C;  3T97 A;  3M0A A;  3M9Q A;  3CX5 E;  2BCC E;  2ZAE B;  2Q9I A;  2H43 A;  4H44 D;  2OYI A;  1IFD A;  1T3J A;  1NTZ G;  3C1L A;  2QVA A;  3L73 E;  1KYO D;  5KAF H;  4H44 C;  3TSI A;  4IFF A;  2QEX P;  1NTZ D;  1NTK K;  3WU2 E;  3OAK A;  3V4Q A;  2W6B A;  3T97 B;  3NTN A;  1NTM E;  1PPJ E;  5KTB A;  1EXJ A;  1L4A C;  1A02 J;  3N7N A;  1SFC D;  2G8Y A;  3D71 A;  1L2P A;  1R5L A;  3CXH I;  4K3A A;  3PH0 A;  1GL2 B;  1SQX D;  3H1J D;  4ZKP A;  1ZME C;  1SFC C;  2WIT A;  1IJD B;  4WY4 A;  1S4X A;  2LR2 A;  1PV3 A;  1OIP A;  3TNU A;  1J1E B;  2HPC B;  1Q86 Q;  1UIX A;  3V2Q A;  2O01 H;  3L71 D;  4N78 E;  2OGU A;  2H7H A;  1BGY D;  3FXD A;  1ZN5 A;  3WUU A;  3A7O A;  3SFD C;  2R5B A;  3GG2 A;  1YYC A;  1N7S D;  1H8A A;  2O01 J;  5KJ7 C;  3MUD C;  4BWN A;  4WY4 B;  3B5N A;  1L0L D;  2CPB A;  5AVT B;  5DJT B;  4ZMD A;  5B66 E;  3B71 A;  1N7S C;  4LGD E;  2YO3 A;  1J1D C;  1YIT P;  1PIX A;  5GTI E;  1CI6 A;  2K9J A;  3VTP C;  2XZR A;  1SQQ J;  3CWB G;  1ZXG A;  2MJZ A;  1KQF B;  1JM0 A;  1M90 Q;  2IBZ I;  2GUS A;  2RKL A;  2JR8 A;  3H32 A;  3ZDM A;  1NKN A;  1CZQ A;  3V6I A;  3UIA A;  2KUB A;  1ZRT D;  4IL6 E;  1Q7Y Q;  3CC4 P;  2E75 B;  3GF7 A;  2N1T A;  3Q3D A;  1P84 H;  3HE5 A;  1JUN A;  4PV1 B;  1G2C A;  5AW2 B;  4LLH A;  2BCC G;  2IDB A;  4HH2 A;  5TJH A;  1VQK P;  2VRS A;  3AEF C;  1CI6 B;  2K9J B;  4IOI H;  1FZE A;  2ZT9 C;  1YBK A;  3CX5 D;  2BCC D;  1X8Y A;  3L73 G;  1DEB A;  2IFN A;  2WSC H;  3AE5 C;  1U7M A;  2HG5 D;  2WPV B;  3L73 D;  1G1I A;  1OFC X;  3ITK A;  2K1A A;  3CCL P;  2BAS A;  3I56 P;  3H1H J;  3HE5 B;  1G2C B;  1OVU A;  1NTM G;  2WSC J;  2HFE D;  3H25 A;  4PD4 E;  4NPD A;  1HGZ A;  3CCR P;  1DX7 A;  2KXP B;  1PPJ D;  1SQQ E;  2H88 C;  1GK4 A;  3MD0 A;  3PRJ A;  3O8Z A;  3GW6 A;  2XV5 A;  1GL2 C;  3BVH A;  1K04 A;  1X9V A;  3JC2 2;  3MIW A;  2WZ7 A;  1OX3 A;  2FYU J;  3H1I J;  4OGQ D;  1P84 I;  1N7L A;  4N78 D;  3VMX A;  1FE6 A;  3AEG C;  2W83 C;  2YMY A;  1LWU B;  3S1K A;  4OH8 B;  4OWF A;  1GDT A;  1EQ7 A;  1KFM A;  1RQU A;  4JYB A;  4RO0 A;  2W8Z A;  1LTA C;  1Y8A A;  3H1H E;  3A5T A;  3VP8 A;  1SQV E;  4WY4 C;  2IZ0 A;  1S5L H;  4H13 B;  3AED C;  4N3Y B;  3SSU A;  3W67 A;  1VQ4 P;  4RKU J;  1KIL E;  2HLO A;  1WMK A;  4UB6 H;  2QG4 A;  2A45 G;  1SLQ A;  1GW3 A;  2IPP A;  4YXW H;  3PJS K;  1NTK J;  1JY2 O;  2PAJ A;  1GW4 A;  4EOT A;  1IK7 A;  1MFZ A;  4DT0 A;  1NH4 A;  2E75 C;  2OQQ A;  4PV1 C;  1EDK A;  3VMA A;  3B4S A;  1BE3 J;  3H1I E;  1LP1 A;  3BCC J;  3L70 E;  3CCV P;  2J59 M;  2WSE J;  1CSB A;  1NJI Q;  2AXC A;  2AXT E;  1U57 A;  2MKV A;  5K5G B;  4C7N B;  3JSV C;  2YNY A;  1KV4 A;  2IYP A;  4GKG A;  4UB8 E;  3FWL A;  4KJM A;  2JO1 A;  2L91 A;  1FJP A;  2KSJ A;  3TK1 A;  1RH5 B;  1SQQ G;  2XKM A;  2Z5I A;  4H0L B;  4PD4 D;  2HR3 A;  1GD2 E;  1WRG A;  2Q6Q A;  1L4A A;  4D6T J;  3MP7 B;  1JTH A;  2ZYG A;  1NAF A;  4XE5 B;  1NHL A;  1SQQ D;  1SQP K;  3BAS A;  3AE4 C;  2R44 A;  1S5L E;  3H1L J;  1NTK E;  3WMM 0;  3R4Y A;  1IC2 A;  1SFC A;  3A2A A;  3R2P A;  4WBA A;  1JO5 A;  1J2J B;  1K73 Q;  5BU8 B;  1LT9 B;  3F89 A;  2ZVO B;  1BE3 E;  3IAO A;  3BCC E;  3FGA D;  5CCG D;  3G6E P;  1QLE D;  2NZ2 A;  3NMD A;  2ZXE B;  4I1L A;  1SS1 A;  3KPE A;  1AJY A;  1LWU C;  3H1H G;  2FBW C;  5KJ7 A;  3MUD A;  2Y9Y A;  2WMM A;  2R5D A;  1JB0 J;  1FC2 C;  3H1H D;  3FXE A;  2E43 A;  1U7J A;  5EFW B;  1N7S A;  1SQV D;  3VMY A;  3L37 A;  3CD6 P;  3HD7 D;  2I1J A;  1H0T B;  2N9B A;  2DW3 A;  3BRV B;  4IFM A;  4H13 C;  1KIL D;  3IFM A;  4D6T E;  2OAR A;  1MV8 A;  3AE3 C;  2FFD B;  2R3S A;  4L76 A;  3AE2 C;  3EWK A;  1BCC J;  3CCS P;  3H1L E;  4GOF A;  4ZKU A;  1URQ D;  2FYU G;  3CC2 P;  1E5W A;  2Q1K A;  2P2U A;  4U3F J;  3H1I G;  1N7S B;  2RMZ A;  1W2E A;  2XDJ A;  1QL1 A;  4W7Y A;  1IK9 A;  3G4S P;  1L0N K;  1OMI A;  3E1R A;  3TGU J;  2KS1 B;  3KZI E;  4HJG H;  2WTY A;  3D6Z A;  3L70 D;  3OW2 O;  3EFG A;  1T3U A;  2KZJ A;  4YTP C;  1EC5 A;  1VQL P;  3C9I A; 
#chains in the Genus database with same CATH homology
 3CWB G;  4D6T G;  1KB9 H;  3L70 G;  2BCC G;  1SQP G;  5KLV G;  1BE3 G;  1NTK G;  1SQQ G;  3BCC G;  3CXH H;  4U3F G;  1EZV G;  3H1K G;  3L72 G;  1NTZ G;  3H1L G;  2A06 G;  1L0N G;  2IBZ G;  1PPJ G;  1NU1 G;  3L73 G;  3L71 G;  4PD4 H;  1SQX G;  2FYU G;  1NTM G;  3H1J G;  1BCC G;  1L0L G;  3L75 G;  3L74 G;  3H1H G;  1SQB G;  3H1I G;  3TGU G;  1KYO H;  3CX5 H;  1SQV G;  1BGY G;  1P84 H;  1PP9 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...