1SQQG

Crystal structure analysis of bovine bc1 with methoxy acrylate stilbene (moas)
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
75
structure length
75
Chain Sequence
GRQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome-c reductase complex core protein I, mit
publication title Crystallographic studies of quinol oxidation site inhibitors: a modified classification of inhibitors for the cytochrome bc(1) complex.
pubmed doi rcsb
total genus 15
structure length 75
sequence length 75
ec nomenclature
pdb deposition date 2004-03-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1sqqG00
3H1JG 5KLVG 1L0LG 3H1LG 3L74G 3L75G 1KYOH 4U3FG 1NTZG 3L70G 3L73G 1NTKG 4D6TG 1SQVG 2FYUG 1SQPG 3CX5H 1PP9G 3L72G 1NU1G 2BCCG 3L71G 4PD4H 3BCCG 1SQQG 1PPJG 1BGYG 3H1HG 1SQXG 3CXHH 1BCCG 1KB9H 1EZVG 3H1IG 1P84H 3CWBG 2A06G 1L0NG 1NTMG 1SQBG 2IBZG 3TGUG 1BE3G 3H1KG
chains in the Genus database with same CATH superfamily
2OYHA 1DX7A 4PV1D 1GL2A 3U1CA 2KK7A 1NU1G 2KOGA 1S5LH 4DCKA 3IAOA 4XE5B 4I7ZC 3A3YB 4BWNA 2XNXA 2E75D 1LT9B 2OARA 3FWNA 2Y0CA 1YI2P 1Z56A 1UIXA 2P58A 5APWA 2BASA 2Q9IA 1PPJG 2HODA 3AE7C 2QJKB 4UB6H 1FZEA 1N2DC 1RF1B 1PGJA 2YMYA 1S5LE 2QA4P 1VQMP 3BASA 1PPJE 3U1AA 1SQXD 3EFFK 4HKZH 1ZP0C 2K3RA 3TK1A 1LT1A 2IYOA 1WT6A 2N1TA 2IZ1A 1SQVK 3G9RA 1G1JA 2R5DA 2FFDA 1JOCA 2A45I 4UB6E 3E1IA 1FZCA 3LW5H 2JWAA 1GU4A 1JO5A 5KAIH 1N8RQ 4YXWH 4DJGA 1LP1A 1GW3A 3C8VA 3CL3D 1L2PA 4RKUJ 3WUTA 4B86A 2XZRA 1M7LA 1MFTA 3M0DA 3H25A 1NTMD 1X9VA 2ZT9D 2FXMA 3M9BA 1G2CB 1HTLC 3AE5C 3TYYA 3VP8A 2BEQD 2WSSH 4YXDC 1GK4A 5KAIE 3D71A 3JCUE 2WPRA 1FE6A 2B88A 3GMAA 4GOFA 2HPCA 4H44B 4GIFA 4EIJA 1VQLP 1Q86Q 1LP1B 1NGMB 2KSEA 1VQNP 4L75A 1FDMA 1FJKA 1S5LX 1QEXA 2WSCJ 1LTTC 1GTWA 1ZMEC 3IN6A 1SS1A 2Z5IA 2E76B 2J5UA 4JYCA 3L73J 1FZFA 5AVRB 3II6A 4KHXA 1LTBC 2YKPA 3CX5H 5AW4B 4N78D 2IFNA 3AEAC 1OVRA 3D70A 4U3FJ 1JY3O 1GMJA 2L5GB 2Y9ZA 2FYZA 1KMIZ 1NTZG 1JEKA 1BCCD 3CWBD 2W8ZA 1FZGA 3H1IJ 1NKZB 3H1KJ 3MD0A 3L75D 1WMKA 3CX5E 1S9KE 1NTKD 2FYUD 1Y8AA 3TGUG 2FBWC 2YXQB 5AVWB 5CMZA 1IFIA 3Q5SA 3RK3E 2OYOA 3R4YA 1X0TA 1M1JC 3RK2B 1Y9BA 3OJAB 1URQB 3CCVP 1SQBD 1EC5A 2NPSB 3HE5B 1FU1A 2OTLP 3L74D 3P32A 1LTSC 3L73E 1XTGB 3P8CE 4LGDE 3CCEP 4PD4D 5BU5A 2JR8A 1JY2P 1PGOA 3A2AA 2MKVA 1AVYA 2W83C 3LIEA 1IC2A 2R3SA 1RE4A 5TJHA 3FX0A 3KDPB 2C9LY 2BCCG 3GLMA 3HUSB 2FXPA 1LGHB 4U3FE 5CJ4A 4WBAA 1CZQA 2DW3A 1NU1D 5AVZB 1SQXJ 4I2LC 5KLIC 3A0HH 1WRGA 3H1IE 3VMXA 3H1KE 3KPEA 4K3AA 3KXDA 3CCUP 2NRGA 3EQ2A 1N7LA 1HH0A 2E43A 5CCHC 1SQQD 3L37A 5AVSB 3PJSK 5E79H 1BGYG 3V2PA 1ZRTE 2XU6A 1JY2N 1HWTC 2I1KA 3A0HE 4AQRD 2WMMA 1ZR4A 3R2PA 1BGYE 2A45H 3CI9A 2O3JA 1NTMJ 2I8DA 2ZYDA 3M9QA 5TISE 5GTHH 2B89A 2Y0DA 1DIPA 1AA0A 2C0WA 5KKZC 1SQPD 2OYIB 5E79E 2A45G 1RE3C 1U57A 3HD7C 1SQXE 2LXBA 4BXLA 4H13B 2RN0A 1OMIA 2KIKA 5B5EH 1EZVG 5CCHD 3TF5A 2D2CC 2KNCA 2YO3A 3IFMA 1N73C 5CBOA 1KD1Q 5GTHE 1YBKA 3H1HE 2SPZA 1SQVG 1VQ5P 1HJ0A 1KFNA 3VMZA 1J1EB 3AE8C 1L0NJ 2WSEJ 1GK6A 1QVFO 2O01N 2PFXA 2YXRB 3NTNA 1BE3G 5AW3B 2J58A 3S9OA 1L0LG 2M0BA 1K05A 5B5EE 1T3UA 1S4XA 3CCQP 1J2JB 5AVQB 1A02F 2WPVB 1H0TA 1NTZK 3HD7D 3H1LD 4M3LA 3JSVC 1FC2C 2KXPB 1FDIA 1NWQA 2WSEH 3L4FA 4I6MC 1KN7A 4D6TG 3MIWA 2LKMA 5AVYB 1BCCJ 2JP3A 3CWBJ 1U7MA 2D2CD 4PJ0H 1Q2NA 3SWFA 2C9NY 2PP6A 3C1LA 3WUUA 2V4HA 3WU2H 3L75J 2Z4EA 2FYNB 2QJYC 2IBZI 2FYUJ 3L72J 5KLVG 3V4WA 2V7QJ 4EDFA 1SFCC 3AEEC 1L0NE 2G3AA 1T2KC 1SQBJ 1H0TB 1VQ7P 2OTKE 1Q7YQ 3USSA 3L74J 3CCJP 2B87B 1MUUA 4PJ0E 2KSJA 5DJUB 2KLVA 3WU2E 3GW6A 4N78E 2Q6QA 3W68A 4IFFA 1JUNA 3TGUD 2GA1A 5APXA 2ZFCA 3RL0C 4H0LC 4HB1A 5H2FH 1M1JA 2H43A 1VQOP 1BSNA 1YJ9P 3HRNA 2IZ0A 2JO1A 2HFED 3B5NB 2BEZF 1NU1J 3P8MC 2O1KA 3HE4A 3TNUA 3L71D 2R32A 3B8EB 2IDBA 5BU8B 1R5LA 2H7HA 1USEA 3GHGB 4JPZB 3OA7A 1DD3A 1J1DB 4BRYA 3L70D 1N7SC 4IL6E 4N3YB 3L72E 1L4AD 3CC7P 2Y0EA 1T2KD 1SQQJ 1JY3N 5H2FE 5KJ7D 1PP9G 3EWKA 1BSHA 1JM0A 5B66H 3KQGA 3L74E 4OGQC 4EI2A 1PP9E 3HTKB 3RL0D 4H0LD 4IFMA 1LTIC 2WT7A 2A06E 3S4RA 3V4QA 3BCCG 5CCHA 4JF7A 4OVNF 2WITA 3OAKA 2ZT9C 1SQPJ 2YIUB 3SFDC 2HYNA 4K35A 5B66E 1Q81Q 2OYHB 3AEDC 3CMAP 4C7NA 3BCCE 3PH0A 2XKMA 2Z5HA 4WVZA 1GL2B 1N7SD 5GTIE 4LLHA 1AVOA 2E5YA 3KYQA 1IZNB 2ZVOB 5CHXA 1VF5C 1KV4A 1NAYA 2IPPA 2WZ7A 1SQQE 4NPFX 1M56D 2E74B 4YPCA 1RF0C 4OGQD 2WT7B 2CPBA 3IR9A 1RE3A 2K9JA 2HODB 4A7PA 3HD7A 1L0LK 3JCUH 2B9BA 1HBWA 3NFQA 2LXCB 1H88A 1N73A 1LTGC 1HJBA 4ZMDA 2N1TB 1M1KQ 3H1LJ 1PFIA 1SQVD 1SQPE 2FFDB 1MKMA 4IFDK 1FZCB 1P84D 1FS0E 5KKZB 1E79H 1L0NK 1VF5D 2ZXEB 5KLVK 3H1JD 1QL2A 2OQQA 4NPDA 2HLOA 1K73Q 2H89C 3PHLA 2RH0A 4RESB 1LJ2A 2ZVNB 2IYPA 2CPSA 1Q90D 2QJPB 3S1KA 4JQ0D 3AE1C 2P1JA 2K88A 2W6AA 2KB7P 2N9YB 1PZQA 1ZR2A 3TDKA 2P10A 3MHVA 3RK3B 2Q7CA 3QH9A 4ZNCA 1YITP 2HPCB 3TGUJ 4GODA 4UB8H 4Y99B 2PGDA 1SFCA 2K1AA 3KZIH 4R4MA 2WSCH 5AW2B 2JKVA 3V2QA 3VN0A 3L71J 2XDJA 3TSIA 1OW7A 4JYBA 1VQPP 3MTUE 2G8YA 1S2EA 3JC22 1T6AA 2IBZE 3AE3C 3L36A 2M5AA 2KYVA 3L70J 2KI7B 3BRVB 4EOTA 2WVRA 1AV1A 1JMBA 2W27A 1KILD 4UB8E 3P7KA 3L73G 1EXIA 1GDTA 1LWUC 3KZIE 4WY4C 3VP9A 4DZOA 1SP4A 3O8ZA 2KLUA 3GG2A 1HF9A 1U7JA 1GD2E 2ZAEB 5AW6B 4ASWA 2QRXA 5KAFH 5CCGC 3VYIA 3CXHD 4U3FG 1GW4A 4PV1B 5M1BA 4U7JA 1N7SA 4PD4I 1RQUA 1M90Q 3F5HA 4JBZA 3D6YA 3CLQA 4ZKUA 3KHUA 1KYOD 3ABVC 1LT9C 3A0BH 1YJNP 1HGZA 5DJTB 3H1IG 3H1KG 2E75B 1QL1A 2QJKC 3L71E 2FY8A 1RF1C 1HVVA 2ZXXA 1MZ9A 2IX7C 5AW7B 5APTA 2WSFJ 5KAFE 2GUVA 3M06A 2Q3EA 3BRTB 2RMZA 3L70E 3QWOC 4GT1A 4RO0A 4WY4D 3T97A 1PPJD 3MGNA 1VQ6P 3A0BE 5TISH 4LC1A 5CCGD 3RBZA 1NYHA 5APVA 1ZN5A 4RJTA 1JCDA 5EFWB 2ZYAA 2C0XA 3CD6P 1KQGB 4N6JA 3G6EP 5BVZA 4I7ZB 1VPCA 3AE2C 1NO4A 4W80A 5APQA 1SQXG 2J59M 1RF0A 2P67A 3CCLP 2QIWA 2KS1A 1AQ5A 4CPGA 3G3ZA 1LTJC 2AEJA 2OTJP 2ZT9B 1T8ZA 2P2UA 1XTCC 3H1HG 3H32A 3H1JJ 3CCSP 4H44C 1JMMA 3U59A 1EDIA 3Q2YA 3L35A 1EXJA 3V2NA 4GDOA 2YNYA 1E5WA 5AVUB 1VDFA 1JTHA 1DEEG 2PAJA 2KS1B 3BVHA 1QX8A 2E76C 4TLFA 1IFNA 1NTME 2FXOA 4XFJA 1S3JA 4TT3H 1OWAA 3AEFC 2KNCB 2UWJE 1Y47A 3SWYA 4H44D 4AYCA 2I1JA 2FKWB 3B4SA 4NPEA 1L0NG 1NTKJ 4ASVA 3NXSA 2KUBA 1JY3P 4ZKPA 1QGKB 3CC4P 1L4AC 2QVAA 2E76D 3FWLA 1VQ4P 5KJ7C 1NTZD 3CMEP 1YTZI 3RK2C 2KP8A 3AE9C 3MZWB 1HGVA 1URQC 2NPSC 3NMDA 2O1JA 4OH8B 5KTBA 4IL6H 4GKGA 3BATA 3SSUA 2V7QH 1BCCG 4IOIH 1YQ3C 5APYA 1LWUA 1VL2A 3P8CD 4WY4A 3O6QA 1T3JA 4O9BA 1YIJP 1OW6A 3HUSC 1R5SA 3A5TA 3OW2O 1BCCE 1OXZA 3L72G 1DH3A 3CWBE 4I1LA 2WTYA 4PD4H 1K8AQ 4QMAA 2K9YA 3AECC 3L75E 1IK7A 1NTKE 2KZIA 2FYUE 1IFPA 2AXTH 3E7KA 2BCCD 3L74G 3I5CA 1LT9A 3G4SP 2Q3IA 1BDCA 3RK2D 1URQD 1H89A 1SQBE 3F89A 3PP5A 2NPSD 1RF1A 3AEBC 3M0AA 2A06G 1M1JB 1EDJA 4PD4E 5GTIH 1IFMA 3CXHE 5AW8B 2AEMA 4C7RA 1SQXK 2YKQA 3HE4B 1KQFB 3TNUB 3GF3A 2AXTE 1KYOE 1ZRTD 4XA4A 4BRYB 1NU1E 1SLQA 1BGYD 2LR2A 1AJYA 2W90A 2OYIC 1IK9A 1SQQG 4EYYQ 2GM4A 2VRSA 3VOPA 1DD4A 1IJDB 3LW5J 1K04A 1NH4A 4H13C 5AW0B 5KLIB 2WQYC 2JJLA 1HUCA 2O01J 3CCRP 1NJIQ 1NTMK 1KQSO 1G2CA 2M3BA 1LTJA 2YO2A 1PGPA 2POHA 1J1EC 4IL6X 2YKOA 1X79B 2QEXP 1OX3A 3H1HD 4C7NB 1NKNA 1SQPG 1EZVD 1DEBA 3VTPC 4L73A 3Q5RA 5CBNA 2ZJSE 2R5BA 1EZVI 2O01H 2Q1KA 3CCMP 1KB9D 3SWKA 4H13D 1TU3F 1KB9I 2NZ2A 1BE3D 1P84I 2K9JB 1LTJB 3HD7B 1IFJA 1L0LD 2CK3H 1W2BO 1VQKP 5L8RJ 4GOEA 4L76A 1EQ7A 1KFMA 3RBXA 2FYNC 2D2CB 2E42A 2WWWA 3RGUA 1N73B 1KILC 3M9HA 1LNQA 1W2EA 1NTZJ 5APSA 2RKLA 4D6TD 1YYCA 1ZXGA 3H1LG 2QE7H 1YTZT 3N4XA 3AEGC 1L0ND 3G71P 1JCCA 1FOSE 3V2RA 3C9IA 1W5CE 1YQ4C 1JB0J 5KLVD 1NTKK 3H1LE 2FYUK 1FBMA 3WMM0 1L4AA 2IBZG 1K9MQ 4L74A 1NOHA 5APUA 5KJ7A 1QVGO 1URQA 1SQBK 1N86A 2HR3A 1RH5B 3K5BA 3B5NC 2R3CA 2NPSA 3HE5A 3MUDC 3VMAA 3MP7B 2PRRA 1OW8A 1USDA 3GHGC 2BCCJ 3EFGA 1J1DC 2QJYB 1EDLA 3HUSA 2JEEA 3AE4C 3V6IA 1NTZE 4C46A 1SFCB 1NU1K 3RL0g 1L4AB 3L72D 1AQTA 3Q5PA 1PL5A 2QM8A 3ZDMA 5AVXB 2JDIH 3CXHI 1IO4A 3L71G 3TGUE 1OZHA 3SFEC 3PTZA 2Y9YA 2M5AB 1KYOI 1PP9D 3B5ND 1IFDA 1SQQK 3L70G 1BGYJ 3RL0B 1KQLA 4H0LB 1MFZA 2WPSA 2A06D 2YIUC 2W6BA 1RHZB 2OYHC 1BDDA 1GL2C 3FGAD 2BCCE 3V5BA 4DT0A 3BCCD 4HJGH 3GF7A 1N7SB 3D6ZA 1OVVA 2QSIA 3M91A 3PRJA 2MJZA 2E74C 2ITAA 1RQVA 1SQPK 2OYIA 3B71A 2WSFH 2H88C 1NHLA 3LIDA 3E1RA 1NAFA 1PGQA 1ZLLA 2ZYGA 3H1HJ 1ZW0A 5AW1B 4OGQB 4AUWA 2L91A 1JNMA 1PV3A 1GZLA 1VQ9P 2R44A 3ITKA 4KT0J 1SQVJ 2AXCA 2H8PD 5C39A 2KZJA 3T97B 2N1TC 1NVOA 3H6PA 1FJPA 3PLNA 1GL2D 3I56P 2W6JH 2FFDC 2YMKA 5AVTB 1BE3J 4DOJA 1FZCC 1L0LJ 2QG4A 2WPQA 1CW5A 4W7YA 3FXEA 1D7MA 3AE6C 2E74D 1VF5B 1KB9H 5AW5B 1FZBA 2QJPC 1P84H 5AW9B 3M0DC 2HG5D 1NTMG 4D6TJ 2GUSA 1KTMA 1EZVE 3Q1MA 1MV8A 2P7JA 2QM7A 2AEFA 2XNDH 1ZOYC 3W67A 3H32B 3FXDA 2N1TD 3RK3C 5KLVJ 1R8EA 1FDOA 1SQVE 1PIXA 3H1JG 3IF4A 3A7OA 1KILA 4Y99C 1KB9E 5AVVB 1KZUB 3I55P 3UIAA 1P84E 2K37A 1AFOA 1G1IA 2E5TA 1BE3E 3Q3DA 3H1JE 1L0LE 1GU5A 2B87A 1OVUA 3WUVA 1JTHB 1UIIA 1VQ8P 1S1CX 1LTAC 1X22A 1CI6A 2N9BA 4Y28J 2IBZD 1M8OB 1RY3A 2XV5A 1S9KD 3CX5D 3CPWO 4D6TE 3B5NA 1KC8Q 1S72P 1FAVA 3MUDA 1M57D 1KILB 4HYTB 3CX5I 4WWIA 5CJ0A 2M8RA 3RK3D 1OIPA 1SVFA 3GHGA 1KORA 2Q5UA 4R4LA 4PV1C 5KLVE 3CWBG 1Q82Q 3L73D 1OFCX 1EDKA 4KJMA 1PP9J 4HH2A 1X8YA 3L75G 1H8AA 1NTKG 2FYUG 1CI6B 1FZAA 3N7NA 3CC2P 5CCGA 1QLED 2E75C 3CXHH 4Z1MH 2JWDA 4MN4C 2OGUA 4U3FD 4YTPC 1SQBG 3HTKA 1KYOH 1KILE 3BCCJ 1YHQP 1CSBA 1FOSF 5K5GB 4W7ZA 2IFMA 1JY2O 3H1ID 3H1KD 1ZV8A 1A02J 3VMYA 4OWFA 1LWUB 1RE4C 2M3EA 1SFCD 4WY4B 1YJWP 4WB4A 3O6QB
chains in the Genus database with same CATH topology
3H1JG 5KLVG 1L0LG 3H1LG 3L74G 3L75G 1KYOH 4U3FG 1NTZG 3L70G 3L73G 1NTKG 4D6TG 1SQVG 2FYUG 1SQPG 3CX5H 1PP9G 3L72G 1NU1G 2BCCG 3L71G 4PD4H 3BCCG 1SQQG 1PPJG 1BGYG 3H1HG 1SQXG 3CXHH 1BCCG 1KB9H 1EZVG 3H1IG 1P84H 3CWBG 2A06G 1L0NG 1NTMG 1SQBG 2IBZG 3TGUG 1BE3G 3H1KG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1J G;  5KLV G;  1L0L G;  3H1L G;  3L74 G;  3L75 G;  1KYO H;  4U3F G;  1NTZ G;  3L70 G;  3L73 G;  1NTK G;  4D6T G;  1SQV G;  2FYU G;  1SQP G;  3CX5 H;  1PP9 G;  3L72 G;  1NU1 G;  2BCC G;  3L71 G;  4PD4 H;  3BCC G;  1SQQ G;  1PPJ G;  1BGY G;  3H1H G;  1SQX G;  3CXH H;  1BCC G;  1KB9 H;  1EZV G;  3H1I G;  1P84 H;  3CWB G;  2A06 G;  1L0N G;  1NTM G;  1SQB G;  2IBZ G;  3TGU G;  1BE3 G;  3H1K G; 
#chains in the Genus database with same CATH topology
 2OYH A;  1DX7 A;  4PV1 D;  1GL2 A;  3U1C A;  2KK7 A;  1NU1 G;  2KOG A;  1S5L H;  4DCK A;  3IAO A;  4XE5 B;  4I7Z C;  3A3Y B;  4BWN A;  2XNX A;  2E75 D;  1LT9 B;  2OAR A;  3FWN A;  2Y0C A;  1YI2 P;  1Z56 A;  1UIX A;  2P58 A;  5APW A;  2BAS A;  2Q9I A;  1PPJ G;  2HOD A;  3AE7 C;  2QJK B;  4UB6 H;  1FZE A;  1N2D C;  1RF1 B;  1PGJ A;  2YMY A;  1S5L E;  2QA4 P;  1VQM P;  3BAS A;  1PPJ E;  3U1A A;  1SQX D;  3EFF K;  4HKZ H;  1ZP0 C;  2K3R A;  3TK1 A;  1LT1 A;  2IYO A;  1WT6 A;  2N1T A;  2IZ1 A;  1SQV K;  3G9R A;  1G1J A;  2R5D A;  2FFD A;  1JOC A;  2A45 I;  4UB6 E;  3E1I A;  1FZC A;  3LW5 H;  2JWA A;  1GU4 A;  1JO5 A;  5KAI H;  1N8R Q;  4YXW H;  4DJG A;  1LP1 A;  1GW3 A;  3C8V A;  3CL3 D;  1L2P A;  4RKU J;  3WUT A;  4B86 A;  2XZR A;  1M7L A;  1MFT A;  3M0D A;  3H25 A;  1NTM D;  1X9V A;  2ZT9 D;  2FXM A;  3M9B A;  1G2C B;  1HTL C;  3AE5 C;  3TYY A;  3VP8 A;  2BEQ D;  2WSS H;  4YXD C;  1GK4 A;  5KAI E;  3D71 A;  3JCU E;  2WPR A;  1FE6 A;  2B88 A;  3GMA A;  4GOF A;  2HPC A;  4H44 B;  4GIF A;  4EIJ A;  1VQL P;  1Q86 Q;  1LP1 B;  1NGM B;  2KSE A;  1VQN P;  4L75 A;  1FDM A;  1FJK A;  1S5L X;  1QEX A;  2WSC J;  1LTT C;  1GTW A;  1ZME C;  3IN6 A;  1SS1 A;  2Z5I A;  2E76 B;  2J5U A;  4JYC A;  3L73 J;  1FZF A;  5AVR B;  3II6 A;  4KHX A;  1LTB C;  2YKP A;  3CX5 H;  5AW4 B;  4N78 D;  2IFN A;  3AEA C;  1OVR A;  3D70 A;  4U3F J;  1JY3 O;  1GMJ A;  2L5G B;  2Y9Z A;  2FYZ A;  1KMI Z;  1NTZ G;  1JEK A;  1BCC D;  3CWB D;  2W8Z A;  1FZG A;  3H1I J;  1NKZ B;  3H1K J;  3MD0 A;  3L75 D;  1WMK A;  3CX5 E;  1S9K E;  1NTK D;  2FYU D;  1Y8A A;  3TGU G;  2FBW C;  2YXQ B;  5AVW B;  5CMZ A;  1IFI A;  3Q5S A;  3RK3 E;  2OYO A;  3R4Y A;  1X0T A;  1M1J C;  3RK2 B;  1Y9B A;  3OJA B;  1URQ B;  3CCV P;  1SQB D;  1EC5 A;  2NPS B;  3HE5 B;  1FU1 A;  2OTL P;  3L74 D;  3P32 A;  1LTS C;  3L73 E;  1XTG B;  3P8C E;  4LGD E;  3CCE P;  4PD4 D;  5BU5 A;  2JR8 A;  1JY2 P;  1PGO A;  3A2A A;  2MKV A;  1AVY A;  2W83 C;  3LIE A;  1IC2 A;  2R3S A;  1RE4 A;  5TJH A;  3FX0 A;  3KDP B;  2C9L Y;  2BCC G;  3GLM A;  3HUS B;  2FXP A;  1LGH B;  4U3F E;  5CJ4 A;  4WBA A;  1CZQ A;  2DW3 A;  1NU1 D;  5AVZ B;  1SQX J;  4I2L C;  5KLI C;  3A0H H;  1WRG A;  3H1I E;  3VMX A;  3H1K E;  3KPE A;  4K3A A;  3KXD A;  3CCU P;  2NRG A;  3EQ2 A;  1N7L A;  1HH0 A;  2E43 A;  5CCH C;  1SQQ D;  3L37 A;  5AVS B;  3PJS K;  5E79 H;  1BGY G;  3V2P A;  1ZRT E;  2XU6 A;  1JY2 N;  1HWT C;  2I1K A;  3A0H E;  4AQR D;  2WMM A;  1ZR4 A;  3R2P A;  1BGY E;  2A45 H;  3CI9 A;  2O3J A;  1NTM J;  2I8D A;  2ZYD A;  3M9Q A;  5TIS E;  5GTH H;  2B89 A;  2Y0D A;  1DIP A;  1AA0 A;  2C0W A;  5KKZ C;  1SQP D;  2OYI B;  5E79 E;  2A45 G;  1RE3 C;  1U57 A;  3HD7 C;  1SQX E;  2LXB A;  4BXL A;  4H13 B;  2RN0 A;  1OMI A;  2KIK A;  5B5E H;  1EZV G;  5CCH D;  3TF5 A;  2D2C C;  2KNC A;  2YO3 A;  3IFM A;  1N73 C;  5CBO A;  1KD1 Q;  5GTH E;  1YBK A;  3H1H E;  2SPZ A;  1SQV G;  1VQ5 P;  1HJ0 A;  1KFN A;  3VMZ A;  1J1E B;  3AE8 C;  1L0N J;  2WSE J;  1GK6 A;  1QVF O;  2O01 N;  2PFX A;  2YXR B;  3NTN A;  1BE3 G;  5AW3 B;  2J58 A;  3S9O A;  1L0L G;  2M0B A;  1K05 A;  5B5E E;  1T3U A;  1S4X A;  3CCQ P;  1J2J B;  5AVQ B;  1A02 F;  2WPV B;  1H0T A;  1NTZ K;  3HD7 D;  3H1L D;  4M3L A;  3JSV C;  1FC2 C;  2KXP B;  1FDI A;  1NWQ A;  2WSE H;  3L4F A;  4I6M C;  1KN7 A;  4D6T G;  3MIW A;  2LKM A;  5AVY B;  1BCC J;  2JP3 A;  3CWB J;  1U7M A;  2D2C D;  4PJ0 H;  1Q2N A;  3SWF A;  2C9N Y;  2PP6 A;  3C1L A;  3WUU A;  2V4H A;  3WU2 H;  3L75 J;  2Z4E A;  2FYN B;  2QJY C;  2IBZ I;  2FYU J;  3L72 J;  5KLV G;  3V4W A;  2V7Q J;  4EDF A;  1SFC C;  3AEE C;  1L0N E;  2G3A A;  1T2K C;  1SQB J;  1H0T B;  1VQ7 P;  2OTK E;  1Q7Y Q;  3USS A;  3L74 J;  3CCJ P;  2B87 B;  1MUU A;  4PJ0 E;  2KSJ A;  5DJU B;  2KLV A;  3WU2 E;  3GW6 A;  4N78 E;  2Q6Q A;  3W68 A;  4IFF A;  1JUN A;  3TGU D;  2GA1 A;  5APX A;  2ZFC A;  3RL0 C;  4H0L C;  4HB1 A;  5H2F H;  1M1J A;  2H43 A;  1VQO P;  1BSN A;  1YJ9 P;  3HRN A;  2IZ0 A;  2JO1 A;  2HFE D;  3B5N B;  2BEZ F;  1NU1 J;  3P8M C;  2O1K A;  3HE4 A;  3TNU A;  3L71 D;  2R32 A;  3B8E B;  2IDB A;  5BU8 B;  1R5L A;  2H7H A;  1USE A;  3GHG B;  4JPZ B;  3OA7 A;  1DD3 A;  1J1D B;  4BRY A;  3L70 D;  1N7S C;  4IL6 E;  4N3Y B;  3L72 E;  1L4A D;  3CC7 P;  2Y0E A;  1T2K D;  1SQQ J;  1JY3 N;  5H2F E;  5KJ7 D;  1PP9 G;  3EWK A;  1BSH A;  1JM0 A;  5B66 H;  3KQG A;  3L74 E;  4OGQ C;  4EI2 A;  1PP9 E;  3HTK B;  3RL0 D;  4H0L D;  4IFM A;  1LTI C;  2WT7 A;  2A06 E;  3S4R A;  3V4Q A;  3BCC G;  5CCH A;  4JF7 A;  4OVN F;  2WIT A;  3OAK A;  2ZT9 C;  1SQP J;  2YIU B;  3SFD C;  2HYN A;  4K35 A;  5B66 E;  1Q81 Q;  2OYH B;  3AED C;  3CMA P;  4C7N A;  3BCC E;  3PH0 A;  2XKM A;  2Z5H A;  4WVZ A;  1GL2 B;  1N7S D;  5GTI E;  4LLH A;  1AVO A;  2E5Y A;  3KYQ A;  1IZN B;  2ZVO B;  5CHX A;  1VF5 C;  1KV4 A;  1NAY A;  2IPP A;  2WZ7 A;  1SQQ E;  4NPF X;  1M56 D;  2E74 B;  4YPC A;  1RF0 C;  4OGQ D;  2WT7 B;  2CPB A;  3IR9 A;  1RE3 A;  2K9J A;  2HOD B;  4A7P A;  3HD7 A;  1L0L K;  3JCU H;  2B9B A;  1HBW A;  3NFQ A;  2LXC B;  1H88 A;  1N73 A;  1LTG C;  1HJB A;  4ZMD A;  2N1T B;  1M1K Q;  3H1L J;  1PFI A;  1SQV D;  1SQP E;  2FFD B;  1MKM A;  4IFD K;  1FZC B;  1P84 D;  1FS0 E;  5KKZ B;  1E79 H;  1L0N K;  1VF5 D;  2ZXE B;  5KLV K;  3H1J D;  1QL2 A;  2OQQ A;  4NPD A;  2HLO A;  1K73 Q;  2H89 C;  3PHL A;  2RH0 A;  4RES B;  1LJ2 A;  2ZVN B;  2IYP A;  2CPS A;  1Q90 D;  2QJP B;  3S1K A;  4JQ0 D;  3AE1 C;  2P1J A;  2K88 A;  2W6A A;  2KB7 P;  2N9Y B;  1PZQ A;  1ZR2 A;  3TDK A;  2P10 A;  3MHV A;  3RK3 B;  2Q7C A;  3QH9 A;  4ZNC A;  1YIT P;  2HPC B;  3TGU J;  4GOD A;  4UB8 H;  4Y99 B;  2PGD A;  1SFC A;  2K1A A;  3KZI H;  4R4M A;  2WSC H;  5AW2 B;  2JKV A;  3V2Q A;  3VN0 A;  3L71 J;  2XDJ A;  3TSI A;  1OW7 A;  4JYB A;  1VQP P;  3MTU E;  2G8Y A;  1S2E A;  3JC2 2;  1T6A A;  2IBZ E;  3AE3 C;  3L36 A;  2M5A A;  2KYV A;  3L70 J;  2KI7 B;  3BRV B;  4EOT A;  2WVR A;  1AV1 A;  1JMB A;  2W27 A;  1KIL D;  4UB8 E;  3P7K A;  3L73 G;  1EXI A;  1GDT A;  1LWU C;  3KZI E;  4WY4 C;  3VP9 A;  4DZO A;  1SP4 A;  3O8Z A;  2KLU A;  3GG2 A;  1HF9 A;  1U7J A;  1GD2 E;  2ZAE B;  5AW6 B;  4ASW A;  2QRX A;  5KAF H;  5CCG C;  3VYI A;  3CXH D;  4U3F G;  1GW4 A;  4PV1 B;  5M1B A;  4U7J A;  1N7S A;  4PD4 I;  1RQU A;  1M90 Q;  3F5H A;  4JBZ A;  3D6Y A;  3CLQ A;  4ZKU A;  3KHU A;  1KYO D;  3ABV C;  1LT9 C;  3A0B H;  1YJN P;  1HGZ A;  5DJT B;  3H1I G;  3H1K G;  2E75 B;  1QL1 A;  2QJK C;  3L71 E;  2FY8 A;  1RF1 C;  1HVV A;  2ZXX A;  1MZ9 A;  2IX7 C;  5AW7 B;  5APT A;  2WSF J;  5KAF E;  2GUV A;  3M06 A;  2Q3E A;  3BRT B;  2RMZ A;  3L70 E;  3QWO C;  4GT1 A;  4RO0 A;  4WY4 D;  3T97 A;  1PPJ D;  3MGN A;  1VQ6 P;  3A0B E;  5TIS H;  4LC1 A;  5CCG D;  3RBZ A;  1NYH A;  5APV A;  1ZN5 A;  4RJT A;  1JCD A;  5EFW B;  2ZYA A;  2C0X A;  3CD6 P;  1KQG B;  4N6J A;  3G6E P;  5BVZ A;  4I7Z B;  1VPC A;  3AE2 C;  1NO4 A;  4W80 A;  5APQ A;  1SQX G;  2J59 M;  1RF0 A;  2P67 A;  3CCL P;  2QIW A;  2KS1 A;  1AQ5 A;  4CPG A;  3G3Z A;  1LTJ C;  2AEJ A;  2OTJ P;  2ZT9 B;  1T8Z A;  2P2U A;  1XTC C;  3H1H G;  3H32 A;  3H1J J;  3CCS P;  4H44 C;  1JMM A;  3U59 A;  1EDI A;  3Q2Y A;  3L35 A;  1EXJ A;  3V2N A;  4GDO A;  2YNY A;  1E5W A;  5AVU B;  1VDF A;  1JTH A;  1DEE G;  2PAJ A;  2KS1 B;  3BVH A;  1QX8 A;  2E76 C;  4TLF A;  1IFN A;  1NTM E;  2FXO A;  4XFJ A;  1S3J A;  4TT3 H;  1OWA A;  3AEF C;  2KNC B;  2UWJ E;  1Y47 A;  3SWY A;  4H44 D;  4AYC A;  2I1J A;  2FKW B;  3B4S A;  4NPE A;  1L0N G;  1NTK J;  4ASV A;  3NXS A;  2KUB A;  1JY3 P;  4ZKP A;  1QGK B;  3CC4 P;  1L4A C;  2QVA A;  2E76 D;  3FWL A;  1VQ4 P;  5KJ7 C;  1NTZ D;  3CME P;  1YTZ I;  3RK2 C;  2KP8 A;  3AE9 C;  3MZW B;  1HGV A;  1URQ C;  2NPS C;  3NMD A;  2O1J A;  4OH8 B;  5KTB A;  4IL6 H;  4GKG A;  3BAT A;  3SSU A;  2V7Q H;  1BCC G;  4IOI H;  1YQ3 C;  5APY A;  1LWU A;  1VL2 A;  3P8C D;  4WY4 A;  3O6Q A;  1T3J A;  4O9B A;  1YIJ P;  1OW6 A;  3HUS C;  1R5S A;  3A5T A;  3OW2 O;  1BCC E;  1OXZ A;  3L72 G;  1DH3 A;  3CWB E;  4I1L A;  2WTY A;  4PD4 H;  1K8A Q;  4QMA A;  2K9Y A;  3AEC C;  3L75 E;  1IK7 A;  1NTK E;  2KZI A;  2FYU E;  1IFP A;  2AXT H;  3E7K A;  2BCC D;  3L74 G;  3I5C A;  1LT9 A;  3G4S P;  2Q3I A;  1BDC A;  3RK2 D;  1URQ D;  1H89 A;  1SQB E;  3F89 A;  3PP5 A;  2NPS D;  1RF1 A;  3AEB C;  3M0A A;  2A06 G;  1M1J B;  1EDJ A;  4PD4 E;  5GTI H;  1IFM A;  3CXH E;  5AW8 B;  2AEM A;  4C7R A;  1SQX K;  2YKQ A;  3HE4 B;  1KQF B;  3TNU B;  3GF3 A;  2AXT E;  1KYO E;  1ZRT D;  4XA4 A;  4BRY B;  1NU1 E;  1SLQ A;  1BGY D;  2LR2 A;  1AJY A;  2W90 A;  2OYI C;  1IK9 A;  1SQQ G;  4EYY Q;  2GM4 A;  2VRS A;  3VOP A;  1DD4 A;  1IJD B;  3LW5 J;  1K04 A;  1NH4 A;  4H13 C;  5AW0 B;  5KLI B;  2WQY C;  2JJL A;  1HUC A;  2O01 J;  3CCR P;  1NJI Q;  1NTM K;  1KQS O;  1G2C A;  2M3B A;  1LTJ A;  2YO2 A;  1PGP A;  2POH A;  1J1E C;  4IL6 X;  2YKO A;  1X79 B;  2QEX P;  1OX3 A;  3H1H D;  4C7N B;  1NKN A;  1SQP G;  1EZV D;  1DEB A;  3VTP C;  4L73 A;  3Q5R A;  5CBN A;  2ZJS E;  2R5B A;  1EZV I;  2O01 H;  2Q1K A;  3CCM P;  1KB9 D;  3SWK A;  4H13 D;  1TU3 F;  1KB9 I;  2NZ2 A;  1BE3 D;  1P84 I;  2K9J B;  1LTJ B;  3HD7 B;  1IFJ A;  1L0L D;  2CK3 H;  1W2B O;  1VQK P;  5L8R J;  4GOE A;  4L76 A;  1EQ7 A;  1KFM A;  3RBX A;  2FYN C;  2D2C B;  2E42 A;  2WWW A;  3RGU A;  1N73 B;  1KIL C;  3M9H A;  1LNQ A;  1W2E A;  1NTZ J;  5APS A;  2RKL A;  4D6T D;  1YYC A;  1ZXG A;  3H1L G;  2QE7 H;  1YTZ T;  3N4X A;  3AEG C;  1L0N D;  3G71 P;  1JCC A;  1FOS E;  3V2R A;  3C9I A;  1W5C E;  1YQ4 C;  1JB0 J;  5KLV D;  1NTK K;  3H1L E;  2FYU K;  1FBM A;  3WMM 0;  1L4A A;  2IBZ G;  1K9M Q;  4L74 A;  1NOH A;  5APU A;  5KJ7 A;  1QVG O;  1URQ A;  1SQB K;  1N86 A;  2HR3 A;  1RH5 B;  3K5B A;  3B5N C;  2R3C A;  2NPS A;  3HE5 A;  3MUD C;  3VMA A;  3MP7 B;  2PRR A;  1OW8 A;  1USD A;  3GHG C;  2BCC J;  3EFG A;  1J1D C;  2QJY B;  1EDL A;  3HUS A;  2JEE A;  3AE4 C;  3V6I A;  1NTZ E;  4C46 A;  1SFC B;  1NU1 K;  3RL0 g;  1L4A B;  3L72 D;  1AQT A;  3Q5P A;  1PL5 A;  2QM8 A;  3ZDM A;  5AVX B;  2JDI H;  3CXH I;  1IO4 A;  3L71 G;  3TGU E;  1OZH A;  3SFE C;  3PTZ A;  2Y9Y A;  2M5A B;  1KYO I;  1PP9 D;  3B5N D;  1IFD A;  1SQQ K;  3L70 G;  1BGY J;  3RL0 B;  1KQL A;  4H0L B;  1MFZ A;  2WPS A;  2A06 D;  2YIU C;  2W6B A;  1RHZ B;  2OYH C;  1BDD A;  1GL2 C;  3FGA D;  2BCC E;  3V5B A;  4DT0 A;  3BCC D;  4HJG H;  3GF7 A;  1N7S B;  3D6Z A;  1OVV A;  2QSI A;  3M91 A;  3PRJ A;  2MJZ A;  2E74 C;  2ITA A;  1RQV A;  1SQP K;  2OYI A;  3B71 A;  2WSF H;  2H88 C;  1NHL A;  3LID A;  3E1R A;  1NAF A;  1PGQ A;  1ZLL A;  2ZYG A;  3H1H J;  1ZW0 A;  5AW1 B;  4OGQ B;  4AUW A;  2L91 A;  1JNM A;  1PV3 A;  1GZL A;  1VQ9 P;  2R44 A;  3ITK A;  4KT0 J;  1SQV J;  2AXC A;  2H8P D;  5C39 A;  2KZJ A;  3T97 B;  2N1T C;  1NVO A;  3H6P A;  1FJP A;  3PLN A;  1GL2 D;  3I56 P;  2W6J H;  2FFD C;  2YMK A;  5AVT B;  1BE3 J;  4DOJ A;  1FZC C;  1L0L J;  2QG4 A;  2WPQ A;  1CW5 A;  4W7Y A;  3FXE A;  1D7M A;  3AE6 C;  2E74 D;  1VF5 B;  1KB9 H;  5AW5 B;  1FZB A;  2QJP C;  1P84 H;  5AW9 B;  3M0D C;  2HG5 D;  1NTM G;  4D6T J;  2GUS A;  1KTM A;  1EZV E;  3Q1M A;  1MV8 A;  2P7J A;  2QM7 A;  2AEF A;  2XND H;  1ZOY C;  3W67 A;  3H32 B;  3FXD A;  2N1T D;  3RK3 C;  5KLV J;  1R8E A;  1FDO A;  1SQV E;  1PIX A;  3H1J G;  3IF4 A;  3A7O A;  1KIL A;  4Y99 C;  1KB9 E;  5AVV B;  1KZU B;  3I55 P;  3UIA A;  1P84 E;  2K37 A;  1AFO A;  1G1I A;  2E5T A;  1BE3 E;  3Q3D A;  3H1J E;  1L0L E;  1GU5 A;  2B87 A;  1OVU A;  3WUV A;  1JTH B;  1UII A;  1VQ8 P;  1S1C X;  1LTA C;  1X22 A;  1CI6 A;  2N9B A;  4Y28 J;  2IBZ D;  1M8O B;  1RY3 A;  2XV5 A;  1S9K D;  3CX5 D;  3CPW O;  4D6T E;  3B5N A;  1KC8 Q;  1S72 P;  1FAV A;  3MUD A;  1M57 D;  1KIL B;  4HYT B;  3CX5 I;  4WWI A;  5CJ0 A;  2M8R A;  3RK3 D;  1OIP A;  1SVF A;  3GHG A;  1KOR A;  2Q5U A;  4R4L A;  4PV1 C;  5KLV E;  3CWB G;  1Q82 Q;  3L73 D;  1OFC X;  1EDK A;  4KJM A;  1PP9 J;  4HH2 A;  1X8Y A;  3L75 G;  1H8A A;  1NTK G;  2FYU G;  1CI6 B;  1FZA A;  3N7N A;  3CC2 P;  5CCG A;  1QLE D;  2E75 C;  3CXH H;  4Z1M H;  2JWD A;  4MN4 C;  2OGU A;  4U3F D;  4YTP C;  1SQB G;  3HTK A;  1KYO H;  1KIL E;  3BCC J;  1YHQ P;  1CSB A;  1FOS F;  5K5G B;  4W7Z A;  2IFM A;  1JY2 O;  3H1I D;  3H1K D;  1ZV8 A;  1A02 J;  3VMY A;  4OWF A;  1LWU B;  1RE4 C;  2M3E A;  1SFC D;  4WY4 B;  1YJW P;  4WB4 A;  3O6Q B; 
#chains in the Genus database with same CATH homology
 3H1J G;  5KLV G;  1L0L G;  3H1L G;  3L74 G;  3L75 G;  1KYO H;  4U3F G;  1NTZ G;  3L70 G;  3L73 G;  1NTK G;  4D6T G;  1SQV G;  2FYU G;  1SQP G;  3CX5 H;  1PP9 G;  3L72 G;  1NU1 G;  2BCC G;  3L71 G;  4PD4 H;  3BCC G;  1SQQ G;  1PPJ G;  1BGY G;  3H1H G;  1SQX G;  3CXH H;  1BCC G;  1KB9 H;  1EZV G;  3H1I G;  1P84 H;  3CWB G;  2A06 G;  1L0N G;  1NTM G;  1SQB G;  2IBZ G;  3TGU G;  1BE3 G;  3H1K G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...