2WPRA

Salmonella enterica sada 483-523 fused to gcn4 adaptors (sadak3b-v1, out-of-register fusion)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
97
structure length
97
Chain Sequence
IEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
total genus 46
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wprA00
3M0AA 1CI6A 1GK6A 5AVWB 3VYIA 1T2KD 2VRSA 3P8MC 5APUA 3TYYA 2KP8A 3HTKA 1J2JB 5APQA 5AW6B 5AVZB 1T2KC 2Z5IA 3V5BA 2H7HA 3T97A 4JYBA 5AVUB 2R32A 3M06A 1NWQA 1HBWA 4HYTB 5APYA 3I5CA 2WTYA 1A02F 2W6AA 2WWWA 2YO3A 4GT1A 3VTPC 3M91A 2R3CA 2WT7A 3A2AA 3A7OA 5AVVB 4C7NA 1GZLA 5AVXB 1DH3A 1GD2E 2XV5A 1FAVA 1CZQA 4I2LC 4DZOA 3TNUA 3B8EB 2Z5HA 5CMZA 1SLQA 5AVTB 1H88A 3V4WA 3P7KA 3P32A 1GK4A 2ZXEB 5AVSB 5AW2B 5AW9B 2WPRA 5APVA 5AW8B 2JJLA 2E43A 2E42A 2Q3IA 2WPSA 3OAKA 3NXSA 3VMXA 3HE5B 1CI6B 3VMZA 3NFQA 4AQRD 1HWTC 1H89A 2XU6A 2C9LY 5AW7B 1OWAA 4GKGA 1JUNA 4JYCA 1S9KD 4LC1A 5APTA 1X8YA 3HE4A 2P2UA 3L35A 1OXZA 2XZRA 3IR9A 5APXA 2QM7A 3NMDA 1JNMA 3VMYA 3MD0A 1MFZA 3A5TA 3KDPB 4M3LA 3L37A 2R5BA 2Q7CA 1H8AA 2P7JA 5AVRB 2YO2A 5AVQB 3O8ZA 1A02J 1CSBA 4B86A 1S9KE 1HUCA 2QM8A 3LIDA 2W27A 3M9HA 1YYCA 2N9BA 2P67A 3TK1A 4XE5B 3TNUB 2C9NY 2IPPA 1HJBA 3SWFA 5AW1B 4AUWA 4AYCA 2YNYA 5AVYB 3VN0A 1GU5A 1FOSE 5AW3B 3M9BA 1GTWA 1FOSF 3NTNA 5APSA 5AW5B 2ZFCA 3LIEA 3UIAA 2Q5UA 3V4QA 2R5DA 1MV8A 4KHXA 3A3YB 3L36A 1SP4A 3M0DA 4RESB 4EOTA 2BASA 2WT7B 5APWA 1NAFA 3MGNA 4C7NB 1KQLA 3KQGA 5AW0B 5AW4B 1MUUA 1GU4A 1IO4A 3HE4B 2WPQA 4I6MC 1G2CB 4C46A 3HE5A
chains in the Genus database with same CATH superfamily
1S4XA 1KYOD 1URQD 3VYIA 4I1LA 1L0LE 2YKOA 2BCCJ 1Z56A 1RY3A 1MFTA 1T2KC 1URQA 1SFCC 1A02F 3AEEC 3M91A 2JWAA 2ZAEB 3HD7B 5CJ4A 2IBZE 5L8RJ 1KQSO 2KB7P 2WSCJ 2ITAA 2W8ZA 2N9YB 1L0ND 1L0NG 1JCDA 2O01N 1FZFA 1USDA 3GW6A 2E75B 1KB9H 2H88C 1KB9I 1JM0A 1PGPA 1LTSC 3H1KD 4JF7A 2XZRA 5B5EE 3H1KG 2ZYGA 1BSHA 1YBKA 2WITA 3TNUB 1KTMA 3WU2E 4OGQC 4AUWA 1FJPA 4AYCA 3ABVC 4K3AA 1EXJA 3W67A 4ASVA 1SQBJ 1HJ0A 3V2RA 5C39A 3B5ND 2QJYB 3L72D 1EZVI 3L72G 2WSSH 3TF5A 3B5NA 1E79H 3KQGA 3L73E 4KJMA 1SQVD 1SQVG 1G2CB 4WWIA 2XDJA 1GK6A 2QJPB 1R8EA 1K04A 4ZMDA 4LLHA 4L76A 2V4HA 5KLVJ 5DJTB 2OTJP 1SQQK 1Y8AA 4XA4A 1KILD 1NTZD 4H0LC 2FFDB 2K1AA 1NTZG 1K9MQ 2O01H 2E74B 3B71A 2ZXEB 1KILA 3L71J 2WPRA 2V7QH 2WPSA 1VPCA 1JCCA 1PIXA 1CI6B 5M1BA 3CCEP 3ZDMA 1KMIZ 1S9KD 5APTA 1X8YA 2P2UA 3CWBE 2WSFH 1KB9E 4ZNCA 3A5TA 4CPGA 1M1KQ 1FZAA 2CK3H 2CPSA 1EQ7A 1BSNA 2W27A 3RL0C 3II6A 4IFMA 2KSJA 1VL2A 4ASWA 3IF4A 2W83C 2M5AA 2J5UA 2FYUE 3FXEA 1NGMB 1EZVE 1WT6A 1GW3A 3HD7C 1UIIA 1BE3E 2WPQA 3L4FA 3U59A 1YQ3C 1RHZB 3VMAA 3I55P 2Y0CA 1NTKE 4PV1B 1S5LX 2OTKE 4BRYA 2OYHA 2FYNB 1QVFO 2RKLA 2YMKA 5B66H 1SQXD 2JR8A 1SQXG 3CXHH 1SQPJ 2E75C 2RMZA 1BGYE 5AVVB 4C7NA 1L0NK 1M1JB 1J1DB 4U3FJ 3G71P 2IFMA 3Q5RA 1OFCX 2PP6A 1OVUA 2E43A 3PTZA 4LGDE 2NRGA 2K88A 1W2BO 3VMXA 1QX8A 1PP9D 1JTHA 1HWTC 2C9LY 3K5BA 3HTKB 1BCCE 3L35A 3AEGC 3NMDA 5KLIB 1MFZA 4N6JA 3HRNA 4PJ0H 1JB0J 2QIWA 2HLOA 2I8DA 1IFPA 2BCCD 1G1IA 2Y0DA 2BCCG 2W90A 4XE5B 3SWFA 5DJUB 4A7PA 2B87B 2QJPC 2P10A 1FDMA 3VN0A 4WY4D 3HUSB 1SQVK 4IL6X 3L75E 3Q5PA 1LGHB 1HVVA 2QG4A 3GHGB 1X0TA 3M0DA 1M57D 1NKNA 4WY4A 3L70E 3H1JJ 1IO4A 3HE4B 2FFDC 1LTGC 1SVFA 2VRSA 3TYYA 3H1LE 1GL2B 5AVZB 3CX5D 4N78E 1NTZK 2R32A 1IFDA 3L73J 2R3CA 1GZLA 1FAVA 3KYQA 1KILC 1VF5D 4O9BA 3RK2D 1EDJA 4K35A 1LP1A 1SQBD 1DD4A 1LTJB 2PRRA 1SQBG 1DIPA 1VQPP 1GDTA 1RE4C 1QL2A 2FY8A 1PZQA 1PL5A 1SFCB 2B88A 4GODA 4H44B 4PJ0E 1WMKA 5KLVD 2E76B 5AW1B 5KLVG 3CWBJ 2DW3A 2YXRB 4UB8H 1Q81Q 2Q5UA 2Q1KA 5H2FH 2WT7B 2FXMA 5AW0B 2HG5D 3G4SP 1KD1Q 3RK3B 5AVQB 1M1JC 3L71D 5AVWB 3L71G 3CCMP 1J1DC 2OYHC 1SQXK 2FYUJ 2N1TD 2HPCB 4GOEA 4PD4I 3KXDA 3VTPC 2GUVA 4RKUJ 3C1LA 1D7MA 1PGOA 1LWUC 1W5CE 4OGQB 3D6YA 1NTKJ 2M3EA 2G3AA 2W6BA 5KLIC 3RBZA 2YKPA 3RBXA 4L75A 5AW9B 2RN0A 3TGUE 3HE5B 1KC8Q 3VMZA 1H89A 1IFNA 3HUSC 1OXZA 2UWJE 3CCUP 5AVRB 3GHGC 2JEEA 3M9QA 2HODA 1HGVA 2FXPA 1VQ8P 4ZKPA 3TDKA 1GU5A 1GL2C 3A0HH 3M0DC 1GTWA 1KYOH 3CLQA 1KYOI 1SQPD 2M8RA 3LW5J 3AE9C 3V4QA 1SQPG 1FZCA 2A06E 2L5GB 1H0TA 1NAFA 4U3FD 2Z4EA 4N3YB 5H2FE 2B9BA 4U3FG 3R4YA 3Q2YA 3KZIE 2IZ0A 3FWNA 5E79H 3H1HE 1QGKB 4BWNA 1G1JA 2ZT9B 1J2JB 3BCCJ 3CCVP 2HR3A 1OW7A 1FBMA 2H7HA 3A0BH 3L70J 1LTJC 4GT1A 3RL0B 4Y28J 3A2AA 4PD4E 3O6QB 1SQQE 3AE1C 1YHQP 3MTUE 1CZQA 2L91A 3BRVB 1SQBK 5CMZA 2IZ1A 1KORA 2HYNA 2Q3EA 1VQ7P 2KIKA 4H44C 3N7NA 2K9JA 5KJ7D 1VDFA 2E76C 1OW6A 3CPWO 5CCGD 3V2NA 2QM7A 4EYYQ 3H1JD 3PH0A 5KJ7A 1URQB 3H1JG 1H8AA 2KNCA 5CCGA 1LNQA 3M9HA 2P67A 1NH4A 2WSEJ 3H1IE 3JCUH 3RK3C 2Q9IA 1ZP0C 3L73D 3NTNA 3L73G 1Y9BA 1P84D 3VP8A 2XNDH 2ZVNB 1KYOE 5KKZC 2BEQD 1VQ4P 2WMMA 1FZBA 4L73A 3MIWA 1YI2P 1NTME 5E79E 1YJNP 1FDIA 2I1KA 1HBWA 1NWQA 2N1TC 3A0BE 4EI2A 3GF7A 1ZN5A 2FKWB 1FJKA 3H32A 1L0NE 1LT9A 3MUDA 4DZOA 2GUSA 2JKVA 3QH9A 1NU1J 2YXQB 3AECC 3S4RA 3B5NB 3CWBD 5AW8B 2JJLA 3SWKA 2KI7B 3Q5SA 1OMIA 3CWBG 3H1KE 1VQ6P 2NPSD 1FZGA 1PGJA 1S5LH 2AEFA 4TLFA 1NJIQ 1JMBA 1LTIC 2NPSA 1E5WA 2I1JA 5TJHA 2Q7CA 1AFOA 1VQOP 3P8CD 1SQPK 3L72E 2FYUD 2FYUG 2NZ2A 1EZVD 1T3UA 3GLMA 1EZVG 5KTBA 2D2CD 3AE5C 2ZT9C 1FZEA 3JCUE 1KV4A 1FZCC 1KILB 4W7ZA 4IFFA 1SQVE 3PHLA 4IFDK 3CC4P 1RH5B 1NTKD 3WMM0 1NTKG 1BDCA 3JC22 2PGDA 2QJKC 1JY3O 2JP3A 1QEXA 1FDOA 3AEFC 5GTIH 4R4LA 1YJ9P 2LKMA 3ITKA 1YTZT 3EQ2A 1KILE 1U7JA 1NTZE 3M06A 4HYTB 4OH8B 1ZR4A 1OIPA 1LTTC 1IFJA 3F89A 3BRTB 1DH3A 1RF0A 2KLVA 2M5AB 4XFJA 1VQLP 5AVTB 1S1CX 4HH2A 1ZW0A 1URQC 4MN4C 3RGUA 2WVRA 5AW2B 5CCHD 2O1JA 1IJDB 2FYZA 4DCKA 3CXHI 1LTAC 5CCHA 5KJ7C 2QA4P 4H13D 2OYIA 1L0LJ 4BRYB 1W2EA 2OYHB 3G6EP 5BU5A 3KDPB 4M3LA 4D6TE 1A02J 1CSBA 3OW2O 3CC2P 2IYPA 2QVAA 2OYOA 3RL0g 3OJAB 3BCCD 1ZXGA 2IDBA 1DEBA 3BCCG 2QE7H 1LWUB 2WSCH 3L70D 3L70G 5AW3B 4R4MA 2M0BA 3A3YB 3CX5H 2Q6QA 1YTZI 3PLNA 2KLUA 2Y9YA 3I56P 1OVVA 1S3JA 2KP8A 1SQXE 3OA7A 5GTIE 3B5NC 5APYA 2OQQA 3CMEP 1JY3P 1JMMA 3BATA 2XV5A 2KYVA 3IFMA 1NTMJ 1YQ4C 3V4WA 3Q3DA 1RF1A 1PP9E 4WY4B 4DJGA 3FWLA 3OAKA 2IX7C 2Y0EA 5AW7B 1OWAA 5B66E 1NAYA 3CXHE 2MJZA 2BCCE 4UB6H 3SWYA 1ZV8A 3VMYA 1UIXA 3GF3A 2R5BA 4DOJA 1RE3A 1RQUA 1HUCA 2QM8A 2KXPB 5K5GB 2YIUC 1N73A 1FU1A 1NTKK 1FOSE 4YTPC 3E7KA 1FOSF 3C8VA 1N2DC 1LP1B 1NYHA 1VF5B 2ZVOB 2BASA 3RK2B 1PGQA 1PV3A 1SFCA 1HF9A 1NU1D 4BXLA 4I6MC 1NU1G 3PRJA 1VQKP 5AW6B 4YXDC 1USEA 3FX0A 4ZKUA 2GA1A 2KOGA 2WT7A 4NPFX 1OX3A 1MKMA 1SQBE 1N7LA 1M90Q 3IAOA 5KKZB 1JY2O 5CCHC 4EDFA 2OYIC 2YKQA 1BE3J 1IK9A 1ZRTD 2CPBA 4WVZA 1IFIA 4JPZB 3RK3E 1EXIA 3MD0A 1ZMEC 4H13C 1L2PA 1JEKA 2RH0A 1X22A 1U57A 4UB6E 4B86A 1AA0A 1ZLLA 2N1TB 2KSEA 3FGAD 3Q1MA 1BGYJ 2IPPA 1L4AD 3R2PA 2A45G 3L74E 2O1KA 4D6TJ 1QLED 2PFXA 2R5DA 1XTCC 2K9YA 1L4AA 2O01J 3L71E 3VP9A 1RQVA 4WBAA 2V7QJ 4H0LD 1MUUA 3QWOC 2QRXA 1HH0A 4L74A 1BCCJ 3MHVA 1K8AQ 3P8MC 2QEXP 3E1IA 1IK7A 4PD4D 2WSFJ 2E5TA 4WY4C 4UB8E 3T97A 2HODB 1KQGB 1LTBC 1Q7YQ 3VOPA 1EDKA 1L0LD 2YO3A 1L0LG 1GMJA 1PPJE 1JO5A 4I2LC 1SLQA 3CCJP 3F5HA 1FZCB 3L75J 1H0TB 1KN7A 1S72P 2KS1A 2IBZD 2IBZG 1N7SD 1X79B 4IOIH 3AE7C 1JUNA 2H89C 2QJKB 3H1LJ 1N7SA 1RE3C 3IR9A 1PP9J 1CW5A 1NKZB 2P1JA 1JY2P 1VF5C 4JBZA 1N73C 2W6JH 3D6ZA 1U7MA 1P84H 4KT0J 3RK2C 3LIDA 3HD7D 1P84I 1SQPE 2LR2A 2OARA 3HD7A 4JQ0D 4OWFA 2C0WA 4U3FE 4I7ZB 1IZNB 3AE2C 1NU1K 5KLVK 3L36A 4RESB 2K9JB 2E75D 1NTMD 5AW4B 1NTMG 4HKZH 1GU4A 2QSIA 1SS1A 1YJWP 1Q90D 1DX7A 1VQ9P 5APQA 2KNCB 4JYBA 3A0HE 1OZHA 3TNUA 1J1EB 1OVRA 1H88A 3AEAC 3KHUA 5TISH 1GK4A 1K05A 4NPEA 3H1JE 3NFQA 4JYCA 1Q82Q 1PFIA 1G2CA 4DT0A 2IFNA 2AXTH 1FE6A 3CC7P 1KB9D 1FC2C 3H32B 1LT9B 2POHA 1P84E 2WQYC 4Y99B 2YNYA 5AVYB 2E74D 4W7YA 1L4AC 3W68A 1HTLC 2FFDA 3CCSP 2ZFCA 3C9IA 3TGUJ 1KZUB 2H43A 2NPSB 2ZYDA 1CI6A 1L0LK 3IN6A 3L74J 1M7LA 1X9VA 3G9RA 3G3ZA 1BE3D 1NVOA 1BE3G 2BEZF 2WTYA 2WWWA 3CMAP 2YIUB 3MP7B 2JO1A 3A7OA 3LW5H 2ZYAA 1HGZA 5CJ0A 2M3BA 1BGYD 1RE4A 2D2CB 3GG2A 3AE6C 1BGYG 3BASA 5TISE 5APVA 1DD3A 2E42A 2SPZA 3AEDC 4D6TD 4IL6H 4RJTA 4D6TG 2XNXA 4AQRD 1N7SC 2XU6A 1AV1A 4PV1D 3KPEA 1Y47A 3SSUA 3AEBC 3H1HJ 4LC1A 3P8CE 4I7ZC 2B89A 1JY2N 2LXCB 3U1AA 3O8ZA 1QL1A 4GDOA 1BCCD 2AXTE 1S9KE 1BCCG 1VQMP 1EC5A 3TK1A 1SQQJ 5EFWB 2R44A 1S5LE 1VQ5P 1NTMK 1M1JA 5APSA 5CCGC 1FS0E 3LIEA 2R3SA 4NPDA 3MGNA 1LJ2A 1XTGB 4C7NB 1KQLA 3AE8C 2AEJA 3L75D 4W80A 1VQNP 1R5SA 3CI9A 3CCLP 3L75G 3WUUA 2OYIB 1R5LA 1J1EC 4HB1A 1LWUA 1AVOA 3HTKA 3BVHA 4H13B 1GW4A 3I5CA 1OW8A 2WSEH 3H1LD 1JTHB 3H1LG 3CX5I 1PP9G 1WRGA 3H1IJ 4N78D 1NO4A 3B4SA 2QJYC 2B87A 1NOHA 4Z1MH 3HUSA 1N8RQ 3PP5A 3CXHD 3GHGA 2Q3IA 1IFMA 3NXSA 1LT9C 1TU3F 3MUDC 2GM4A 1GL2D 4Y99C 2ZXXA 4IL6E 3HE4A 2WZ7A 1JNMA 1AQTA 3BCCE 1GL2A 3E1RA 5CHXA 2N9BA 1M8OB 2OTLP 1AJYA 1L0NJ 2NPSC 1K73Q 1RF1B 1Q86Q 2E74C 4EIJA 2FYUK 4EOTA 3H1KJ 3U1CA 4WB4A 1EDIA 1LTJA 3D70A 4OVNF 3M0AA 1T2KD 3GMAA 5APUA 1EDLA 2Z5IA 1SFCD 3AE4C 2KZIA 2D2CC 1N86A 3MZWB 4H44D 2E5YA 1BDDA 1N73B 4YPCA 2E76D 2PAJA 1Q2NA 2LXBA 1KFNA 4TT3H 3L72J 1GD2E 1LT1A 2JDIH 3CX5E 2IYOA 3B8EB 2AEMA 2G8YA 1KFMA 1SQVJ 5AVSB 5GTHH 1YIJP 5BVZA 3V6IA 3RK3D 1RF0C 5CBOA 4GKGA 2KK7A 3TGUD 1AVYA 2FXOA 4PV1C 1NHLA 1AQ5A 3TGUG 5APXA 2A45H 2A45I 5KAFH 3L37A 3EFGA 2FYNC 1T3JA 1NTZJ 1DEEG 3KZIH 3L74D 1IC2A 1YYCA 3L74G 2HPCA 4OGQD 5KAIH 1ZOYC 2C9NY 1HJBA 1M56D 3CCQP 1NU1E 5KLVE 4QMAA 1SP4A 2KZJA 4PD4H 3WUTA 3JSVC 4RO0A 1T6AA 1T8ZA 2HFED 4C7RA 2N1TA 3AE3C 2J58A 3HE5A 2A06D 2A06G 2WPVB 3CL3D 1PPJD 3V5BA 1PPJG 2MKVA 2H8PD 3H25A 5AVUB 2C0XA 3H1HD 2W6AA 3H1HG 2IBZI 1QVGO 3S9OA 5AVXB 3S1KA 2Z5HA 1L4AB 2XKMA 3P7KA 1SQQD 1MZ9A 3P32A 1SQQG 1S2EA 1ZRTE 2O3JA 2ZJSE 3USSA 5CBNA 3EWKA 5GTHE 3SFEC 1JY3N 5BU8B 2ZT9D 5B5EH 4H0LB 1RF1C 4U7JA 1SQXJ 3T97B 3EFFK 2P7JA 2YO2A 2OGUA 1ZR2A 3RL0D 2YMYA 5KAFE 3WU2H 3TSIA 3V2QA 3WUVA 3D71A 5KAIE 3O6QA 1KQFB 2KUBA 2K3RA 3H6PA 4YXWH 3M9BA 3SFDC 2FBWC 5AW5B 2KS1B 3V2PA 3UIAA 3CD6P 2AXCA 3CCRP 3PJSK 1MV8A 3H1ID 1JOCA 2K37A 2P58A 4KHXA 1YITP 3H1IG 3N4XA 4GOFA 2Y9ZA 5APWA 4HJGH 3FXDA 4GIFA 2JWDA 2J59M 1N7SB 4C46A
chains in the Genus database with same CATH topology
1CI6A 1URQD 5AVWB 4I1LA 3VYIA 1L0LK 1J1DC 2YKOA 1M7LA 1SQXK 2OYHC 1Z56A 1RY3A 2KP8A 1X9VA 3OA7A 1T2KC 3G3ZA 2N1TD 3B5NC 2HPCB 1URQA 1SFCC 5APYA 2WTYA 1A02F 2WWWA 3VTPC 3M91A 3A7OA 2GUVA 1JY3P 1JMMA 3HD7B 1LWUC 3BATA 2XV5A 5CJ4A 2KYVA 3LW5H 2KB7P 2W6BA 3IFMA 3V4WA 1HGZA 5CJ0A 2M3BA 1RF1A 1RE4A 2YKPA 4WY4B 5AW9B 3BASA 1JCDA 5APVA 2E42A 1FZFA 3OAKA 2IX7C 3HE5B 3VMZA 2XNXA 4AQRD 1N7SC 1H89A 2XU6A 5AW7B 1OWAA 3KPEA 1IFNA 4LC1A 1LTSC 2MJZA 4JF7A 3P8CE 3HUSC 1OXZA 2XZRA 3SWYA 1ZV8A 3VMYA 2R5BA 1JY2N 4DOJA 5AVRB 3U1AA 3GHGC 3O8ZA 1RE3A 1QL1A 2JEEA 3M9QA 1S9KE 1HUCA 2QM8A 2HODA 1HGVA 1N73A 1FU1A 2WITA 3TK1A 3TNUB 4ZKPA 4AUWA 4AYCA 1FJPA 1NTKK 1GU5A 1FOSE 3V2RA 1NTMK 1M1JA 1GL2C 3B5ND 3M0DC 1GTWA 1FOSF 3CLQA 1N2DC 5APSA 5CCGC 2M8RA 3LIEA 3V4QA 1FZCA 2L5GB 2BASA 3RK2B 1NAFA 3MGNA 2Z4EA 4N3YB 1XTGB 3B5NA 4C7NB 1KQLA 3KQGA 1SFCA 4W80A 3CI9A 2OYIB 4I6MC 1G2CB 2XDJA 1GK6A 1G1JA 1J1EC 1LWUA 3HTKA 1J2JB 5AW6B 3BVHA 4LLHA 2H7HA 1FBMA 4ZKUA 1GW4A 2KOGA 3I5CA 2WSEH 1LTJC 4GT1A 1JTHB 3RL0B 2WT7A 3A2AA 1SQQK 4XA4A 1WRGA 4N78D 1KILD 3MTUE 1CZQA 2FFDB 3BRVB 1NO4A 1SQBK 5CMZA 2O01H 1NOHA 2HYNA 1N7LA 3HUSA 2ZXEB 1KILA 2WPRA 3PP5A 1JY2O 3GHGA 2Q3IA 2WPSA 1VPCA 1IFMA 3N7NA 5CCHC 1JCCA 3NXSA 1LT9C 5KJ7D 1CI6B 2OYIC 1VDFA 2YKQA 2GM4A 1GL2D 4Y99C 1IK9A 1S9KD 5CCGD 5APTA 1X8YA 3V2NA 3HE4A 2P2UA 2WZ7A 2WSFH 2CPBA 1IFIA 2QM7A 1JNMA 3MD0A 5KJ7A 3A5TA 1URQB 1H8AA 1FZAA 1GL2A 4B86A 5CCGA 5CHXA 2CPSA 1EQ7A 1ZLLA 2W27A 3M9HA 2N1TB 2N9BA 3RL0C 2P67A 3II6A 4IFMA 1NH4A 2IPPA 2KSJA 2NPSC 1L4AD 3RK3C 2Q9IA 3R2PA 2A45G 1RF1B 3NTNA 2O1KA 4EIJA 3VP8A 2FYUK 2R5DA 1XTCC 1L4AA 3VP9A 4EOTA 1WT6A 1FZBA 4WBAA 3U1CA 4WB4A 1MUUA 1GW3A 3MIWA 1LTJA 3HD7C 2WPQA 1HH0A 3L4FA 3U59A 4C46A 3M0AA 1T2KD 3P8MC 5APUA 3E1IA 2Z5IA 1SFCD 1N86A 4WY4C 3T97A 2I1KA 2OYHA 2HODB 1LTBC 1HBWA 1NWQA 3VOPA 1N73B 2N1TC 2PAJA 2YO3A 1KFNA 1ZN5A 5AVVB 4C7NA 2FKWB 1FJKA 1L0NK 3H32A 1GD2E 1JO5A 1LT9A 1M1JB 3MUDA 4I2LC 4DZOA 3B8EB 1KFMA 1J1DB 1SLQA 2GUSA 1FZCB 2IFMA 5AVSB 3B5NB 2PP6A 5AW8B 2JJLA 2E43A 5BVZA 4LGDE 2NPSD 3RK3D 1N7SD 1FZGA 3VMXA 1RF0C 1X79B 1JTHA 1HWTC 2C9LY 4GKGA 1JUNA 3HTKB 3L35A 1LTIC 2NPSA 1E5WA 1N7SA 1NHLA 1RE3C 3IR9A 1AQ5A 5APXA 3NMDA 2A45H 2I1JA 1MFZA 2A45I 1CW5A 3L37A 1NKZB 3EFGA 2Q7CA 2P1JA 1AFOA 4N6JA 3HRNA 5AVQB 1T3JA 1JY2P 1N73C 2HLOA 3RK2C 3LIDA 3HD7D 1IC2A 3P8CD 1YYCA 2HPCA 1G1IA 1SQPK 4XE5B 2C9NY 1HJBA 3SWFA 1T3UA 2OARA 5KTBA 1FDMA 3HD7A 3VN0A 4WY4D 1FZEA 2C0WA 3HUSB 1FZCC 1KILB 1SQVK 4W7ZA 4IFFA 1LGHB 1NU1K 1HVVA 5KLVK 3GHGB 3L36A 1SP4A 3M0DA 4RESB 1NKNA 4IFDK 4WY4A 3WMM0 1T8ZA 5AW4B 2HFED 4C7RA 2N1TA 1GU4A 1IO4A 3HE4B 2J58A 3HE5A 1JY3O 2FFDC 1LTGC 1SVFA 2VRSA 1DX7A 3TYYA 1GL2B 5APQA 3CL3D 2LKMA 5AVZB 1YTZT 3V5BA 3EQ2A 2H8PD 4N78E 1NTZK 4JYBA 5AVUB 2C0XA 2R32A 3M06A 4HYTB 4OH8B 1IFDA 2W6AA 1ZR4A 2R3CA 1LTTC 1IFJA 1GZLA 5AVXB 3BRTB 1DH3A 1RF0A 1FAVA 2KLVA 3TNUA 2Z5HA 3KYQA 5AVTB 1J1EB 1KILC 1H88A 1L4AB 2XKMA 4HH2A 3P7KA 1URQC 4O9BA 3RK2D 1MZ9A 3P32A 1GK4A 5AW2B 5CCHD 2O1JA 1IJDB 1LTJB 2FYZA 1JY3N 5BU8B 3NFQA 1LTAC 5CCHA 4JYCA 5KJ7C 1PFIA 1GDTA 1RF1C 2OYIA 1RE4C 1G2CA 1W2EA 1QL2A 2OYHB 2IFNA 5BU5A 3KDPB 4M3LA 2P7JA 2YO2A 1ZR2A 1M1JC 1A02J 1CSBA 3RL0D 2YMYA 1SFCB 3TSIA 3H32B 3OJAB 1LT9B 2POHA 3V2QA 1DEBA 5AW1B 4Y99B 2YNYA 1LWUB 2WSCH 5AVYB 4W7YA 3H6PA 5AW3B 1L4AC 3M9BA 1HTLC 2FFDA 5AW5B 2ZFCA 3C9IA 3V2PA 3UIAA 2Q5UA 1MV8A 4KHXA 1JOCA 3A3YB 3N4XA 2WT7B 5APWA 1KZUB 2H43A 2FXMA 5AW0B 2HG5D 1YTZI 4GIFA 2J59M 2NPSB 3RK3B 1N7SB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0A A;  1CI6 A;  1GK6 A;  5AVW B;  3VYI A;  1T2K D;  2VRS A;  3P8M C;  5APU A;  3TYY A;  2KP8 A;  3HTK A;  1J2J B;  5APQ A;  5AW6 B;  5AVZ B;  1T2K C;  2Z5I A;  3V5B A;  2H7H A;  3T97 A;  4JYB A;  5AVU B;  2R32 A;  3M06 A;  1NWQ A;  1HBW A;  4HYT B;  5APY A;  3I5C A;  2WTY A;  1A02 F;  2W6A A;  2WWW A;  2YO3 A;  4GT1 A;  3VTP C;  3M91 A;  2R3C A;  2WT7 A;  3A2A A;  3A7O A;  5AVV B;  4C7N A;  1GZL A;  5AVX B;  1DH3 A;  1GD2 E;  2XV5 A;  1FAV A;  1CZQ A;  4I2L C;  4DZO A;  3TNU A;  3B8E B;  2Z5H A;  5CMZ A;  1SLQ A;  5AVT B;  1H88 A;  3V4W A;  3P7K A;  3P32 A;  1GK4 A;  2ZXE B;  5AVS B;  5AW2 B;  5AW9 B;  2WPR A;  5APV A;  5AW8 B;  2JJL A;  2E43 A;  2E42 A;  2Q3I A;  2WPS A;  3OAK A;  3NXS A;  3VMX A;  3HE5 B;  1CI6 B;  3VMZ A;  3NFQ A;  4AQR D;  1HWT C;  1H89 A;  2XU6 A;  2C9L Y;  5AW7 B;  1OWA A;  4GKG A;  1JUN A;  4JYC A;  1S9K D;  4LC1 A;  5APT A;  1X8Y A;  3HE4 A;  2P2U A;  3L35 A;  1OXZ A;  2XZR A;  3IR9 A;  5APX A;  2QM7 A;  3NMD A;  1JNM A;  3VMY A;  3MD0 A;  1MFZ A;  3A5T A;  3KDP B;  4M3L A;  3L37 A;  2R5B A;  2Q7C A;  1H8A A;  2P7J A;  5AVR B;  2YO2 A;  5AVQ B;  3O8Z A;  1A02 J;  1CSB A;  4B86 A;  1S9K E;  1HUC A;  2QM8 A;  3LID A;  2W27 A;  3M9H A;  1YYC A;  2N9B A;  2P67 A;  3TK1 A;  4XE5 B;  3TNU B;  2C9N Y;  2IPP A;  1HJB A;  3SWF A;  5AW1 B;  4AUW A;  4AYC A;  2YNY A;  5AVY B;  3VN0 A;  1GU5 A;  1FOS E;  5AW3 B;  3M9B A;  1GTW A;  1FOS F;  3NTN A;  5APS A;  5AW5 B;  2ZFC A;  3LIE A;  3UIA A;  2Q5U A;  3V4Q A;  2R5D A;  1MV8 A;  4KHX A;  3A3Y B;  3L36 A;  1SP4 A;  3M0D A;  4RES B;  4EOT A;  2BAS A;  2WT7 B;  5APW A;  1NAF A;  3MGN A;  4C7N B;  1KQL A;  3KQG A;  5AW0 B;  5AW4 B;  1MUU A;  1GU4 A;  1IO4 A;  3HE4 B;  2WPQ A;  4I6M C;  1G2C B;  4C46 A;  3HE5 A; 
#chains in the Genus database with same CATH topology
 1S4X A;  1KYO D;  1URQ D;  3VYI A;  4I1L A;  1L0L E;  2YKO A;  2BCC J;  1Z56 A;  1RY3 A;  1MFT A;  1T2K C;  1URQ A;  1SFC C;  1A02 F;  3AEE C;  3M91 A;  2JWA A;  2ZAE B;  3HD7 B;  5CJ4 A;  2IBZ E;  5L8R J;  1KQS O;  2KB7 P;  2WSC J;  2ITA A;  2W8Z A;  2N9Y B;  1L0N D;  1L0N G;  1JCD A;  2O01 N;  1FZF A;  1USD A;  3GW6 A;  2E75 B;  1KB9 H;  2H88 C;  1KB9 I;  1JM0 A;  1PGP A;  1LTS C;  3H1K D;  4JF7 A;  2XZR A;  5B5E E;  3H1K G;  2ZYG A;  1BSH A;  1YBK A;  2WIT A;  3TNU B;  1KTM A;  3WU2 E;  4OGQ C;  4AUW A;  1FJP A;  4AYC A;  3ABV C;  4K3A A;  1EXJ A;  3W67 A;  4ASV A;  1SQB J;  1HJ0 A;  3V2R A;  5C39 A;  3B5N D;  2QJY B;  3L72 D;  1EZV I;  3L72 G;  2WSS H;  3TF5 A;  3B5N A;  1E79 H;  3KQG A;  3L73 E;  4KJM A;  1SQV D;  1SQV G;  1G2C B;  4WWI A;  2XDJ A;  1GK6 A;  2QJP B;  1R8E A;  1K04 A;  4ZMD A;  4LLH A;  4L76 A;  2V4H A;  5KLV J;  5DJT B;  2OTJ P;  1SQQ K;  1Y8A A;  4XA4 A;  1KIL D;  1NTZ D;  4H0L C;  2FFD B;  2K1A A;  1NTZ G;  1K9M Q;  2O01 H;  2E74 B;  3B71 A;  2ZXE B;  1KIL A;  3L71 J;  2WPR A;  2V7Q H;  2WPS A;  1VPC A;  1JCC A;  1PIX A;  1CI6 B;  5M1B A;  3CCE P;  3ZDM A;  1KMI Z;  1S9K D;  5APT A;  1X8Y A;  2P2U A;  3CWB E;  2WSF H;  1KB9 E;  4ZNC A;  3A5T A;  4CPG A;  1M1K Q;  1FZA A;  2CK3 H;  2CPS A;  1EQ7 A;  1BSN A;  2W27 A;  3RL0 C;  3II6 A;  4IFM A;  2KSJ A;  1VL2 A;  4ASW A;  3IF4 A;  2W83 C;  2M5A A;  2J5U A;  2FYU E;  3FXE A;  1NGM B;  1EZV E;  1WT6 A;  1GW3 A;  3HD7 C;  1UII A;  1BE3 E;  2WPQ A;  3L4F A;  3U59 A;  1YQ3 C;  1RHZ B;  3VMA A;  3I55 P;  2Y0C A;  1NTK E;  4PV1 B;  1S5L X;  2OTK E;  4BRY A;  2OYH A;  2FYN B;  1QVF O;  2RKL A;  2YMK A;  5B66 H;  1SQX D;  2JR8 A;  1SQX G;  3CXH H;  1SQP J;  2E75 C;  2RMZ A;  1BGY E;  5AVV B;  4C7N A;  1L0N K;  1M1J B;  1J1D B;  4U3F J;  3G71 P;  2IFM A;  3Q5R A;  1OFC X;  2PP6 A;  1OVU A;  2E43 A;  3PTZ A;  4LGD E;  2NRG A;  2K88 A;  1W2B O;  3VMX A;  1QX8 A;  1PP9 D;  1JTH A;  1HWT C;  2C9L Y;  3K5B A;  3HTK B;  1BCC E;  3L35 A;  3AEG C;  3NMD A;  5KLI B;  1MFZ A;  4N6J A;  3HRN A;  4PJ0 H;  1JB0 J;  2QIW A;  2HLO A;  2I8D A;  1IFP A;  2BCC D;  1G1I A;  2Y0D A;  2BCC G;  2W90 A;  4XE5 B;  3SWF A;  5DJU B;  4A7P A;  2B87 B;  2QJP C;  2P10 A;  1FDM A;  3VN0 A;  4WY4 D;  3HUS B;  1SQV K;  4IL6 X;  3L75 E;  3Q5P A;  1LGH B;  1HVV A;  2QG4 A;  3GHG B;  1X0T A;  3M0D A;  1M57 D;  1NKN A;  4WY4 A;  3L70 E;  3H1J J;  1IO4 A;  3HE4 B;  2FFD C;  1LTG C;  1SVF A;  2VRS A;  3TYY A;  3H1L E;  1GL2 B;  5AVZ B;  3CX5 D;  4N78 E;  1NTZ K;  2R32 A;  1IFD A;  3L73 J;  2R3C A;  1GZL A;  1FAV A;  3KYQ A;  1KIL C;  1VF5 D;  4O9B A;  3RK2 D;  1EDJ A;  4K35 A;  1LP1 A;  1SQB D;  1DD4 A;  1LTJ B;  2PRR A;  1SQB G;  1DIP A;  1VQP P;  1GDT A;  1RE4 C;  1QL2 A;  2FY8 A;  1PZQ A;  1PL5 A;  1SFC B;  2B88 A;  4GOD A;  4H44 B;  4PJ0 E;  1WMK A;  5KLV D;  2E76 B;  5AW1 B;  5KLV G;  3CWB J;  2DW3 A;  2YXR B;  4UB8 H;  1Q81 Q;  2Q5U A;  2Q1K A;  5H2F H;  2WT7 B;  2FXM A;  5AW0 B;  2HG5 D;  3G4S P;  1KD1 Q;  3RK3 B;  5AVQ B;  1M1J C;  3L71 D;  5AVW B;  3L71 G;  3CCM P;  1J1D C;  2OYH C;  1SQX K;  2FYU J;  2N1T D;  2HPC B;  4GOE A;  4PD4 I;  3KXD A;  3VTP C;  2GUV A;  4RKU J;  3C1L A;  1D7M A;  1PGO A;  1LWU C;  1W5C E;  4OGQ B;  3D6Y A;  1NTK J;  2M3E A;  2G3A A;  2W6B A;  5KLI C;  3RBZ A;  2YKP A;  3RBX A;  4L75 A;  5AW9 B;  2RN0 A;  3TGU E;  3HE5 B;  1KC8 Q;  3VMZ A;  1H89 A;  1IFN A;  3HUS C;  1OXZ A;  2UWJ E;  3CCU P;  5AVR B;  3GHG C;  2JEE A;  3M9Q A;  2HOD A;  1HGV A;  2FXP A;  1VQ8 P;  4ZKP A;  3TDK A;  1GU5 A;  1GL2 C;  3A0H H;  3M0D C;  1GTW A;  1KYO H;  3CLQ A;  1KYO I;  1SQP D;  2M8R A;  3LW5 J;  3AE9 C;  3V4Q A;  1SQP G;  1FZC A;  2A06 E;  2L5G B;  1H0T A;  1NAF A;  4U3F D;  2Z4E A;  4N3Y B;  5H2F E;  2B9B A;  4U3F G;  3R4Y A;  3Q2Y A;  3KZI E;  2IZ0 A;  3FWN A;  5E79 H;  3H1H E;  1QGK B;  4BWN A;  1G1J A;  2ZT9 B;  1J2J B;  3BCC J;  3CCV P;  2HR3 A;  1OW7 A;  1FBM A;  2H7H A;  3A0B H;  3L70 J;  1LTJ C;  4GT1 A;  3RL0 B;  4Y28 J;  3A2A A;  4PD4 E;  3O6Q B;  1SQQ E;  3AE1 C;  1YHQ P;  3MTU E;  1CZQ A;  2L91 A;  3BRV B;  1SQB K;  5CMZ A;  2IZ1 A;  1KOR A;  2HYN A;  2Q3E A;  1VQ7 P;  2KIK A;  4H44 C;  3N7N A;  2K9J A;  5KJ7 D;  1VDF A;  2E76 C;  1OW6 A;  3CPW O;  5CCG D;  3V2N A;  2QM7 A;  4EYY Q;  3H1J D;  3PH0 A;  5KJ7 A;  1URQ B;  3H1J G;  1H8A A;  2KNC A;  5CCG A;  1LNQ A;  3M9H A;  2P67 A;  1NH4 A;  2WSE J;  3H1I E;  3JCU H;  3RK3 C;  2Q9I A;  1ZP0 C;  3L73 D;  3NTN A;  3L73 G;  1Y9B A;  1P84 D;  3VP8 A;  2XND H;  2ZVN B;  1KYO E;  5KKZ C;  2BEQ D;  1VQ4 P;  2WMM A;  1FZB A;  4L73 A;  3MIW A;  1YI2 P;  1NTM E;  5E79 E;  1YJN P;  1FDI A;  2I1K A;  1HBW A;  1NWQ A;  2N1T C;  3A0B E;  4EI2 A;  3GF7 A;  1ZN5 A;  2FKW B;  1FJK A;  3H32 A;  1L0N E;  1LT9 A;  3MUD A;  4DZO A;  2GUS A;  2JKV A;  3QH9 A;  1NU1 J;  2YXQ B;  3AEC C;  3S4R A;  3B5N B;  3CWB D;  5AW8 B;  2JJL A;  3SWK A;  2KI7 B;  3Q5S A;  1OMI A;  3CWB G;  3H1K E;  1VQ6 P;  2NPS D;  1FZG A;  1PGJ A;  1S5L H;  2AEF A;  4TLF A;  1NJI Q;  1JMB A;  1LTI C;  2NPS A;  1E5W A;  2I1J A;  5TJH A;  2Q7C A;  1AFO A;  1VQO P;  3P8C D;  1SQP K;  3L72 E;  2FYU D;  2FYU G;  2NZ2 A;  1EZV D;  1T3U A;  3GLM A;  1EZV G;  5KTB A;  2D2C D;  3AE5 C;  2ZT9 C;  1FZE A;  3JCU E;  1KV4 A;  1FZC C;  1KIL B;  4W7Z A;  4IFF A;  1SQV E;  3PHL A;  4IFD K;  3CC4 P;  1RH5 B;  1NTK D;  3WMM 0;  1NTK G;  1BDC A;  3JC2 2;  2PGD A;  2QJK C;  1JY3 O;  2JP3 A;  1QEX A;  1FDO A;  3AEF C;  5GTI H;  4R4L A;  1YJ9 P;  2LKM A;  3ITK A;  1YTZ T;  3EQ2 A;  1KIL E;  1U7J A;  1NTZ E;  3M06 A;  4HYT B;  4OH8 B;  1ZR4 A;  1OIP A;  1LTT C;  1IFJ A;  3F89 A;  3BRT B;  1DH3 A;  1RF0 A;  2KLV A;  2M5A B;  4XFJ A;  1VQL P;  5AVT B;  1S1C X;  4HH2 A;  1ZW0 A;  1URQ C;  4MN4 C;  3RGU A;  2WVR A;  5AW2 B;  5CCH D;  2O1J A;  1IJD B;  2FYZ A;  4DCK A;  3CXH I;  1LTA C;  5CCH A;  5KJ7 C;  2QA4 P;  4H13 D;  2OYI A;  1L0L J;  4BRY B;  1W2E A;  2OYH B;  3G6E P;  5BU5 A;  3KDP B;  4M3L A;  4D6T E;  1A02 J;  1CSB A;  3OW2 O;  3CC2 P;  2IYP A;  2QVA A;  2OYO A;  3RL0 g;  3OJA B;  3BCC D;  1ZXG A;  2IDB A;  1DEB A;  3BCC G;  2QE7 H;  1LWU B;  2WSC H;  3L70 D;  3L70 G;  5AW3 B;  4R4M A;  2M0B A;  3A3Y B;  3CX5 H;  2Q6Q A;  1YTZ I;  3PLN A;  2KLU A;  2Y9Y A;  3I56 P;  1OVV A;  1S3J A;  2KP8 A;  1SQX E;  3OA7 A;  5GTI E;  3B5N C;  5APY A;  2OQQ A;  3CME P;  1JY3 P;  1JMM A;  3BAT A;  2XV5 A;  2KYV A;  3IFM A;  1NTM J;  1YQ4 C;  3V4W A;  3Q3D A;  1RF1 A;  1PP9 E;  4WY4 B;  4DJG A;  3FWL A;  3OAK A;  2IX7 C;  2Y0E A;  5AW7 B;  1OWA A;  5B66 E;  1NAY A;  3CXH E;  2MJZ A;  2BCC E;  4UB6 H;  3SWY A;  1ZV8 A;  3VMY A;  1UIX A;  3GF3 A;  2R5B A;  4DOJ A;  1RE3 A;  1RQU A;  1HUC A;  2QM8 A;  2KXP B;  5K5G B;  2YIU C;  1N73 A;  1FU1 A;  1NTK K;  1FOS E;  4YTP C;  3E7K A;  1FOS F;  3C8V A;  1N2D C;  1LP1 B;  1NYH A;  1VF5 B;  2ZVO B;  2BAS A;  3RK2 B;  1PGQ A;  1PV3 A;  1SFC A;  1HF9 A;  1NU1 D;  4BXL A;  4I6M C;  1NU1 G;  3PRJ A;  1VQK P;  5AW6 B;  4YXD C;  1USE A;  3FX0 A;  4ZKU A;  2GA1 A;  2KOG A;  2WT7 A;  4NPF X;  1OX3 A;  1MKM A;  1SQB E;  1N7L A;  1M90 Q;  3IAO A;  5KKZ B;  1JY2 O;  5CCH C;  4EDF A;  2OYI C;  2YKQ A;  1BE3 J;  1IK9 A;  1ZRT D;  2CPB A;  4WVZ A;  1IFI A;  4JPZ B;  3RK3 E;  1EXI A;  3MD0 A;  1ZME C;  4H13 C;  1L2P A;  1JEK A;  2RH0 A;  1X22 A;  1U57 A;  4UB6 E;  4B86 A;  1AA0 A;  1ZLL A;  2N1T B;  2KSE A;  3FGA D;  3Q1M A;  1BGY J;  2IPP A;  1L4A D;  3R2P A;  2A45 G;  3L74 E;  2O1K A;  4D6T J;  1QLE D;  2PFX A;  2R5D A;  1XTC C;  2K9Y A;  1L4A A;  2O01 J;  3L71 E;  3VP9 A;  1RQV A;  4WBA A;  2V7Q J;  4H0L D;  1MUU A;  3QWO C;  2QRX A;  1HH0 A;  4L74 A;  1BCC J;  3MHV A;  1K8A Q;  3P8M C;  2QEX P;  3E1I A;  1IK7 A;  4PD4 D;  2WSF J;  2E5T A;  4WY4 C;  4UB8 E;  3T97 A;  2HOD B;  1KQG B;  1LTB C;  1Q7Y Q;  3VOP A;  1EDK A;  1L0L D;  2YO3 A;  1L0L G;  1GMJ A;  1PPJ E;  1JO5 A;  4I2L C;  1SLQ A;  3CCJ P;  3F5H A;  1FZC B;  3L75 J;  1H0T B;  1KN7 A;  1S72 P;  2KS1 A;  2IBZ D;  2IBZ G;  1N7S D;  1X79 B;  4IOI H;  3AE7 C;  1JUN A;  2H89 C;  2QJK B;  3H1L J;  1N7S A;  1RE3 C;  3IR9 A;  1PP9 J;  1CW5 A;  1NKZ B;  2P1J A;  1JY2 P;  1VF5 C;  4JBZ A;  1N73 C;  2W6J H;  3D6Z A;  1U7M A;  1P84 H;  4KT0 J;  3RK2 C;  3LID A;  3HD7 D;  1P84 I;  1SQP E;  2LR2 A;  2OAR A;  3HD7 A;  4JQ0 D;  4OWF A;  2C0W A;  4U3F E;  4I7Z B;  1IZN B;  3AE2 C;  1NU1 K;  5KLV K;  3L36 A;  4RES B;  2K9J B;  2E75 D;  1NTM D;  5AW4 B;  1NTM G;  4HKZ H;  1GU4 A;  2QSI A;  1SS1 A;  1YJW P;  1Q90 D;  1DX7 A;  1VQ9 P;  5APQ A;  2KNC B;  4JYB A;  3A0H E;  1OZH A;  3TNU A;  1J1E B;  1OVR A;  1H88 A;  3AEA C;  3KHU A;  5TIS H;  1GK4 A;  1K05 A;  4NPE A;  3H1J E;  3NFQ A;  4JYC A;  1Q82 Q;  1PFI A;  1G2C A;  4DT0 A;  2IFN A;  2AXT H;  1FE6 A;  3CC7 P;  1KB9 D;  1FC2 C;  3H32 B;  1LT9 B;  2POH A;  1P84 E;  2WQY C;  4Y99 B;  2YNY A;  5AVY B;  2E74 D;  4W7Y A;  1L4A C;  3W68 A;  1HTL C;  2FFD A;  3CCS P;  2ZFC A;  3C9I A;  3TGU J;  1KZU B;  2H43 A;  2NPS B;  2ZYD A;  1CI6 A;  1L0L K;  3IN6 A;  3L74 J;  1M7L A;  1X9V A;  3G9R A;  3G3Z A;  1BE3 D;  1NVO A;  1BE3 G;  2BEZ F;  2WTY A;  2WWW A;  3CMA P;  2YIU B;  3MP7 B;  2JO1 A;  3A7O A;  3LW5 H;  2ZYA A;  1HGZ A;  5CJ0 A;  2M3B A;  1BGY D;  1RE4 A;  2D2C B;  3GG2 A;  3AE6 C;  1BGY G;  3BAS A;  5TIS E;  5APV A;  1DD3 A;  2E42 A;  2SPZ A;  3AED C;  4D6T D;  4IL6 H;  4RJT A;  4D6T G;  2XNX A;  4AQR D;  1N7S C;  2XU6 A;  1AV1 A;  4PV1 D;  3KPE A;  1Y47 A;  3SSU A;  3AEB C;  3H1H J;  4LC1 A;  3P8C E;  4I7Z C;  2B89 A;  1JY2 N;  2LXC B;  3U1A A;  3O8Z A;  1QL1 A;  4GDO A;  1BCC D;  2AXT E;  1S9K E;  1BCC G;  1VQM P;  1EC5 A;  3TK1 A;  1SQQ J;  5EFW B;  2R44 A;  1S5L E;  1VQ5 P;  1NTM K;  1M1J A;  5APS A;  5CCG C;  1FS0 E;  3LIE A;  2R3S A;  4NPD A;  3MGN A;  1LJ2 A;  1XTG B;  4C7N B;  1KQL A;  3AE8 C;  2AEJ A;  3L75 D;  4W80 A;  1VQN P;  1R5S A;  3CI9 A;  3CCL P;  3L75 G;  3WUU A;  2OYI B;  1R5L A;  1J1E C;  4HB1 A;  1LWU A;  1AVO A;  3HTK A;  3BVH A;  4H13 B;  1GW4 A;  3I5C A;  1OW8 A;  2WSE H;  3H1L D;  1JTH B;  3H1L G;  3CX5 I;  1PP9 G;  1WRG A;  3H1I J;  4N78 D;  1NO4 A;  3B4S A;  2QJY C;  2B87 A;  1NOH A;  4Z1M H;  3HUS A;  1N8R Q;  3PP5 A;  3CXH D;  3GHG A;  2Q3I A;  1IFM A;  3NXS A;  1LT9 C;  1TU3 F;  3MUD C;  2GM4 A;  1GL2 D;  4Y99 C;  2ZXX A;  4IL6 E;  3HE4 A;  2WZ7 A;  1JNM A;  1AQT A;  3BCC E;  1GL2 A;  3E1R A;  5CHX A;  2N9B A;  1M8O B;  2OTL P;  1AJY A;  1L0N J;  2NPS C;  1K73 Q;  1RF1 B;  1Q86 Q;  2E74 C;  4EIJ A;  2FYU K;  4EOT A;  3H1K J;  3U1C A;  4WB4 A;  1EDI A;  1LTJ A;  3D70 A;  4OVN F;  3M0A A;  1T2K D;  3GMA A;  5APU A;  1EDL A;  2Z5I A;  1SFC D;  3AE4 C;  2KZI A;  2D2C C;  1N86 A;  3MZW B;  4H44 D;  2E5Y A;  1BDD A;  1N73 B;  4YPC A;  2E76 D;  2PAJ A;  1Q2N A;  2LXB A;  1KFN A;  4TT3 H;  3L72 J;  1GD2 E;  1LT1 A;  2JDI H;  3CX5 E;  2IYO A;  3B8E B;  2AEM A;  2G8Y A;  1KFM A;  1SQV J;  5AVS B;  5GTH H;  1YIJ P;  5BVZ A;  3V6I A;  3RK3 D;  1RF0 C;  5CBO A;  4GKG A;  2KK7 A;  3TGU D;  1AVY A;  2FXO A;  4PV1 C;  1NHL A;  1AQ5 A;  3TGU G;  5APX A;  2A45 H;  2A45 I;  5KAF H;  3L37 A;  3EFG A;  2FYN C;  1T3J A;  1NTZ J;  1DEE G;  3KZI H;  3L74 D;  1IC2 A;  1YYC A;  3L74 G;  2HPC A;  4OGQ D;  5KAI H;  1ZOY C;  2C9N Y;  1HJB A;  1M56 D;  3CCQ P;  1NU1 E;  5KLV E;  4QMA A;  1SP4 A;  2KZJ A;  4PD4 H;  3WUT A;  3JSV C;  4RO0 A;  1T6A A;  1T8Z A;  2HFE D;  4C7R A;  2N1T A;  3AE3 C;  2J58 A;  3HE5 A;  2A06 D;  2A06 G;  2WPV B;  3CL3 D;  1PPJ D;  3V5B A;  1PPJ G;  2MKV A;  2H8P D;  3H25 A;  5AVU B;  2C0X A;  3H1H D;  2W6A A;  3H1H G;  2IBZ I;  1QVG O;  3S9O A;  5AVX B;  3S1K A;  2Z5H A;  1L4A B;  2XKM A;  3P7K A;  1SQQ D;  1MZ9 A;  3P32 A;  1SQQ G;  1S2E A;  1ZRT E;  2O3J A;  2ZJS E;  3USS A;  5CBN A;  3EWK A;  5GTH E;  3SFE C;  1JY3 N;  5BU8 B;  2ZT9 D;  5B5E H;  4H0L B;  1RF1 C;  4U7J A;  1SQX J;  3T97 B;  3EFF K;  2P7J A;  2YO2 A;  2OGU A;  1ZR2 A;  3RL0 D;  2YMY A;  5KAF E;  3WU2 H;  3TSI A;  3V2Q A;  3WUV A;  3D71 A;  5KAI E;  3O6Q A;  1KQF B;  2KUB A;  2K3R A;  3H6P A;  4YXW H;  3M9B A;  3SFD C;  2FBW C;  5AW5 B;  2KS1 B;  3V2P A;  3UIA A;  3CD6 P;  2AXC A;  3CCR P;  3PJS K;  1MV8 A;  3H1I D;  1JOC A;  2K37 A;  2P58 A;  4KHX A;  1YIT P;  3H1I G;  3N4X A;  4GOF A;  2Y9Z A;  5APW A;  4HJG H;  3FXD A;  4GIF A;  2JWD A;  2J59 M;  1N7S B;  4C46 A; 
#chains in the Genus database with same CATH homology
 1CI6 A;  1URQ D;  5AVW B;  4I1L A;  3VYI A;  1L0L K;  1J1D C;  2YKO A;  1M7L A;  1SQX K;  2OYH C;  1Z56 A;  1RY3 A;  2KP8 A;  1X9V A;  3OA7 A;  1T2K C;  3G3Z A;  2N1T D;  3B5N C;  2HPC B;  1URQ A;  1SFC C;  5APY A;  2WTY A;  1A02 F;  2WWW A;  3VTP C;  3M91 A;  3A7O A;  2GUV A;  1JY3 P;  1JMM A;  3HD7 B;  1LWU C;  3BAT A;  2XV5 A;  5CJ4 A;  2KYV A;  3LW5 H;  2KB7 P;  2W6B A;  3IFM A;  3V4W A;  1HGZ A;  5CJ0 A;  2M3B A;  1RF1 A;  1RE4 A;  2YKP A;  4WY4 B;  5AW9 B;  3BAS A;  1JCD A;  5APV A;  2E42 A;  1FZF A;  3OAK A;  2IX7 C;  3HE5 B;  3VMZ A;  2XNX A;  4AQR D;  1N7S C;  1H89 A;  2XU6 A;  5AW7 B;  1OWA A;  3KPE A;  1IFN A;  4LC1 A;  1LTS C;  2MJZ A;  4JF7 A;  3P8C E;  3HUS C;  1OXZ A;  2XZR A;  3SWY A;  1ZV8 A;  3VMY A;  2R5B A;  1JY2 N;  4DOJ A;  5AVR B;  3U1A A;  3GHG C;  3O8Z A;  1RE3 A;  1QL1 A;  2JEE A;  3M9Q A;  1S9K E;  1HUC A;  2QM8 A;  2HOD A;  1HGV A;  1N73 A;  1FU1 A;  2WIT A;  3TK1 A;  3TNU B;  4ZKP A;  4AUW A;  4AYC A;  1FJP A;  1NTK K;  1GU5 A;  1FOS E;  3V2R A;  1NTM K;  1M1J A;  1GL2 C;  3B5N D;  3M0D C;  1GTW A;  1FOS F;  3CLQ A;  1N2D C;  5APS A;  5CCG C;  2M8R A;  3LIE A;  3V4Q A;  1FZC A;  2L5G B;  2BAS A;  3RK2 B;  1NAF A;  3MGN A;  2Z4E A;  4N3Y B;  1XTG B;  3B5N A;  4C7N B;  1KQL A;  3KQG A;  1SFC A;  4W80 A;  3CI9 A;  2OYI B;  4I6M C;  1G2C B;  2XDJ A;  1GK6 A;  1G1J A;  1J1E C;  1LWU A;  3HTK A;  1J2J B;  5AW6 B;  3BVH A;  4LLH A;  2H7H A;  1FBM A;  4ZKU A;  1GW4 A;  2KOG A;  3I5C A;  2WSE H;  1LTJ C;  4GT1 A;  1JTH B;  3RL0 B;  2WT7 A;  3A2A A;  1SQQ K;  4XA4 A;  1WRG A;  4N78 D;  1KIL D;  3MTU E;  1CZQ A;  2FFD B;  3BRV B;  1NO4 A;  1SQB K;  5CMZ A;  2O01 H;  1NOH A;  2HYN A;  1N7L A;  3HUS A;  2ZXE B;  1KIL A;  2WPR A;  3PP5 A;  1JY2 O;  3GHG A;  2Q3I A;  2WPS A;  1VPC A;  1IFM A;  3N7N A;  5CCH C;  1JCC A;  3NXS A;  1LT9 C;  5KJ7 D;  1CI6 B;  2OYI C;  1VDF A;  2YKQ A;  2GM4 A;  1GL2 D;  4Y99 C;  1IK9 A;  1S9K D;  5CCG D;  5APT A;  1X8Y A;  3V2N A;  3HE4 A;  2P2U A;  2WZ7 A;  2WSF H;  2CPB A;  1IFI A;  2QM7 A;  1JNM A;  3MD0 A;  5KJ7 A;  3A5T A;  1URQ B;  1H8A A;  1FZA A;  1GL2 A;  4B86 A;  5CCG A;  5CHX A;  2CPS A;  1EQ7 A;  1ZLL A;  2W27 A;  3M9H A;  2N1T B;  2N9B A;  3RL0 C;  2P67 A;  3II6 A;  4IFM A;  1NH4 A;  2IPP A;  2KSJ A;  2NPS C;  1L4A D;  3RK3 C;  2Q9I A;  3R2P A;  2A45 G;  1RF1 B;  3NTN A;  2O1K A;  4EIJ A;  3VP8 A;  2FYU K;  2R5D A;  1XTC C;  1L4A A;  3VP9 A;  4EOT A;  1WT6 A;  1FZB A;  4WBA A;  3U1C A;  4WB4 A;  1MUU A;  1GW3 A;  3MIW A;  1LTJ A;  3HD7 C;  2WPQ A;  1HH0 A;  3L4F A;  3U59 A;  4C46 A;  3M0A A;  1T2K D;  3P8M C;  5APU A;  3E1I A;  2Z5I A;  1SFC D;  1N86 A;  4WY4 C;  3T97 A;  2I1K A;  2OYH A;  2HOD B;  1LTB C;  1HBW A;  1NWQ A;  3VOP A;  1N73 B;  2N1T C;  2PAJ A;  2YO3 A;  1KFN A;  1ZN5 A;  5AVV B;  4C7N A;  2FKW B;  1FJK A;  1L0N K;  3H32 A;  1GD2 E;  1JO5 A;  1LT9 A;  1M1J B;  3MUD A;  4I2L C;  4DZO A;  3B8E B;  1KFM A;  1J1D B;  1SLQ A;  2GUS A;  1FZC B;  2IFM A;  5AVS B;  3B5N B;  2PP6 A;  5AW8 B;  2JJL A;  2E43 A;  5BVZ A;  4LGD E;  2NPS D;  3RK3 D;  1N7S D;  1FZG A;  3VMX A;  1RF0 C;  1X79 B;  1JTH A;  1HWT C;  2C9L Y;  4GKG A;  1JUN A;  3HTK B;  3L35 A;  1LTI C;  2NPS A;  1E5W A;  1N7S A;  1NHL A;  1RE3 C;  3IR9 A;  1AQ5 A;  5APX A;  3NMD A;  2A45 H;  2I1J A;  1MFZ A;  2A45 I;  1CW5 A;  3L37 A;  1NKZ B;  3EFG A;  2Q7C A;  2P1J A;  1AFO A;  4N6J A;  3HRN A;  5AVQ B;  1T3J A;  1JY2 P;  1N73 C;  2HLO A;  3RK2 C;  3LID A;  3HD7 D;  1IC2 A;  3P8C D;  1YYC A;  2HPC A;  1G1I A;  1SQP K;  4XE5 B;  2C9N Y;  1HJB A;  3SWF A;  1T3U A;  2OAR A;  5KTB A;  1FDM A;  3HD7 A;  3VN0 A;  4WY4 D;  1FZE A;  2C0W A;  3HUS B;  1FZC C;  1KIL B;  1SQV K;  4W7Z A;  4IFF A;  1LGH B;  1NU1 K;  1HVV A;  5KLV K;  3GHG B;  3L36 A;  1SP4 A;  3M0D A;  4RES B;  1NKN A;  4IFD K;  4WY4 A;  3WMM 0;  1T8Z A;  5AW4 B;  2HFE D;  4C7R A;  2N1T A;  1GU4 A;  1IO4 A;  3HE4 B;  2J58 A;  3HE5 A;  1JY3 O;  2FFD C;  1LTG C;  1SVF A;  2VRS A;  1DX7 A;  3TYY A;  1GL2 B;  5APQ A;  3CL3 D;  2LKM A;  5AVZ B;  1YTZ T;  3V5B A;  3EQ2 A;  2H8P D;  4N78 E;  1NTZ K;  4JYB A;  5AVU B;  2C0X A;  2R32 A;  3M06 A;  4HYT B;  4OH8 B;  1IFD A;  2W6A A;  1ZR4 A;  2R3C A;  1LTT C;  1IFJ A;  1GZL A;  5AVX B;  3BRT B;  1DH3 A;  1RF0 A;  1FAV A;  2KLV A;  3TNU A;  2Z5H A;  3KYQ A;  5AVT B;  1J1E B;  1KIL C;  1H88 A;  1L4A B;  2XKM A;  4HH2 A;  3P7K A;  1URQ C;  4O9B A;  3RK2 D;  1MZ9 A;  3P32 A;  1GK4 A;  5AW2 B;  5CCH D;  2O1J A;  1IJD B;  1LTJ B;  2FYZ A;  1JY3 N;  5BU8 B;  3NFQ A;  1LTA C;  5CCH A;  4JYC A;  5KJ7 C;  1PFI A;  1GDT A;  1RF1 C;  2OYI A;  1RE4 C;  1G2C A;  1W2E A;  1QL2 A;  2OYH B;  2IFN A;  5BU5 A;  3KDP B;  4M3L A;  2P7J A;  2YO2 A;  1ZR2 A;  1M1J C;  1A02 J;  1CSB A;  3RL0 D;  2YMY A;  1SFC B;  3TSI A;  3H32 B;  3OJA B;  1LT9 B;  2POH A;  3V2Q A;  1DEB A;  5AW1 B;  4Y99 B;  2YNY A;  1LWU B;  2WSC H;  5AVY B;  4W7Y A;  3H6P A;  5AW3 B;  1L4A C;  3M9B A;  1HTL C;  2FFD A;  5AW5 B;  2ZFC A;  3C9I A;  3V2P A;  3UIA A;  2Q5U A;  1MV8 A;  4KHX A;  1JOC A;  3A3Y B;  3N4X A;  2WT7 B;  5APW A;  1KZU B;  2H43 A;  2FXM A;  5AW0 B;  2HG5 D;  1YTZ I;  4GIF A;  2J59 M;  2NPS B;  3RK3 B;  1N7S B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...