2WPRA

Salmonella enterica sada 483-523 fused to gcn4 adaptors (sadak3b-v1, out-of-register fusion)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
97
structure length
97
Chain Sequence
IEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
molecule tags Membrane protein
molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
total genus 46
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wprA00
1MV8A 2R32A 5AVVB 5AW0B 4KHXA 2WPSA 3M06A 1GTWA 3T97A 4DZOA 2XZRA 3HE5B 1YYCA 5AVRB 1SP4A 3P32A 2R3CA 1FOSE 2E43A 3NTNA 3SWFA 1GU5A 2R5DA 3M0DA 3M9BA 5AW2B 3V4WA 3L37A 2IPPA 3KDPB 3MD0A 3TNUA 1NWQA 2C9NY 3TK1A 1T2KC 2YNYA 1OWAA 3V5BA 2H7HA 3KQGA 5AW1B 4EOTA 5AVWB 2QM7A 3O8ZA 3M91A 5CMZA 3VYIA 1OXZA 1IO4A 3A2AA 5AW6B 1CSBA 5APWA 2P7JA 1GK6A 1H89A 2Z5HA 5AVQB 2JJLA 5APTA 4B86A 3HTKA 5AVXB 2P67A 3MGNA 1S9KD 4C46A 3I5CA 5APQA 1H8AA 1HUCA 1CI6A 5AW7B 5AVUB 3VMXA 5APUA 3HE4B 3VMZA 5AVZB 1S9KE 3M9HA 1H88A 2Q5UA 3L36A 2KP8A 4I6MC 4I2LC 3B8EB 1CI6B 1SLQA 2Q3IA 4C7NA 2WPRA 2XV5A 1G2CB 4JYCA 2R5BA 4RESB 3IR9A 3V4QA 5APVA 5AW5B 4AUWA 2Z5IA 5AVSB 3VTPC 1KQLA 1NAFA 2XU6A 1MFZA 2WTYA 3OAKA 3UIAA 3P8MC 4LC1A 2WPQA 3VN0A 1HWTC 1GK4A 1GZLA 2QM8A 2W6AA 3A5TA 5AW9B 2BASA 1GD2E 2VRSA 2ZXEB 4JYBA 4M3LA 2Q7CA 1FOSF 1X8YA 3TYYA 5AVYB 2YO3A 2ZFCA 2WT7B 1DH3A 4C7NB 2YO2A 2N9BA 3NXSA 5AW8B 3HE4A 3LIEA 2E42A 4GKGA 4GT1A 5AW3B 5APXA 1HJBA 4HYTB 3A7OA 5AVTB 3L35A 1J2JB 4AYCA 1GU4A 1A02F 5APYA 1FAVA 1CZQA 3TNUB 2WT7A 2WWWA 1A02J 3P7KA 5APSA 2W27A 1HBWA 2P2UA 5AW4B 4AQRD 4XE5B 3NMDA 3HE5A 3NFQA 1T2KD 3LIDA 3M0AA 3A3YB 1JUNA 2C9LY 1JNMA 3VMYA 1MUUA
chains in the Genus database with same CATH superfamily
4UB6H 3GHGB 4IL6H 2L91A 1AVOA 2PAJA 2MJZA 4H0LD 3PHLA 1BSHA 1SQXK 3BRTB 1M1JB 3M06A 3CPWO 1FZCA 1EXJA 4MN4C 4H13C 3WU2E 1OVUA 1USDA 2O01N 1VQ9P 3I55P 4Z1MH 2AEFA 1QGKB 3P32A 3AE8C 3N7NA 4GOEA 2R3CA 4O9BA 2OQQA 5B66H 3PLNA 5KKZC 1FJKA 1YI2P 1VQ8P 3CC2P 1W2EA 2D2CB 3M9BA 1X0TA 2A45G 1L0NJ 1J1EB 3EFGA 1N86A 3HD7B 2KLUA 1NTZG 4L76A 1KQSO 1U57A 3AE1C 3TK1A 1T2KC 1W2BO 2ZAEB 1S5LX 2GA1A 1LTAC 3KYQA 3L71E 2KLVA 2FYUG 3KQGA 4HKZH 1JM0A 1HTLC 4PV1C 5AW1B 2QJYC 1BDDA 1NTMG 3FWNA 4BXLA 4EOTA 1YJNP 1KB9H 3CXHD 2H43A 3JSVC 1E79H 3L75E 2A06G 2OTJP 4WWIA 3H1IJ 3CI9A 3V6IA 1JY2O 4IFFA 2XKMA 3GMAA 3CCSP 1SS1A 2OTLP 1SQBG 1M1JA 1LWUC 2O01H 1H89A 5CHXA 3SWKA 4DJGA 1JY3O 3CWBJ 3D70A 3T97B 1RF1A 2IYOA 2FYUK 2Y0CA 2ZXXA 3M9QA 3AE5C 5KJ7D 2B87A 2IFMA 2P67A 2B87B 3IFMA 2JKVA 1USEA 1RH5B 2N1TA 1DX7A 2KB7P 4DCKA 1ZRTD 1L0ND 1HUCA 3RL0C 1KTMA 1CI6A 2R44A 3KZIH 3LW5J 2JWAA 1JTHB 2POHA 3AEEC 3VMAA 2FFDA 2W90A 1J1DB 1SQBK 1SQBD 2PGDA 2NZ2A 3L70D 2N1TD 3ITKA 3W67A 2KSEA 1UIIA 3A0HH 3BCCD 1H88A 4RO0A 1PPJG 5KJ7A 2WSEH 2V4HA 4BRYB 1DEBA 4I6MC 2A06E 4U3FD 1OFCX 1L0NK 1SLQA 1YTZT 4H0LB 5B5EE 3CCVP 3AE9C 4U3FE 5KLVG 1ZR4A 1JY3P 2XV5A 1G2CB 2KZJA 4JYCA 2R5BA 1L4AC 1IFNA 3CWBD 4RESB 2Q9IA 3L73G 2YIUB 2LKMA 1GL2A 4JQ0D 5APVA 1EDIA 2H89C 2W83C 2Z5IA 4AUWA 1SQPD 4H44B 5AVSB 1KFNA 2HPCB 4OVNF 1AQ5A 2ITAA 2WSCH 3HD7D 5TISH 3TGUE 1IFMA 4WY4D 2AXCA 1L0LE 4JBZA 3RBXA 1NKZB 3UIAA 5GTIE 3CX5E 1PP9J 4LC1A 2Y9YA 5CBOA 3Q5PA 2O1KA 1GK4A 1EZVD 1NTME 2W6AA 2Y0EA 3PTZA 3AEBC 3V2QA 3A5TA 3D71A 4ASWA 1RF0A 1GD2E 1FS0E 2E74C 1LTJC 1NTZK 1X8YA 3TYYA 5AVYB 2BEQD 1YQ4C 1K04A 2YO3A 3USSA 3S1KA 1IFJA 1Q81Q 1NTKE 2YO2A 1KB9D 3CXHH 3PH0A 2MKVA 2QEXP 2AEJA 3MIWA 3SWYA 1JO5A 2E42A 3R4YA 1NU1E 5APXA 2DW3A 4H13D 1EZVG 1WMKA 2K1AA 1DD3A 3AEGC 4AYCA 1BDCA 3CX5I 1CZQA 1ZP0C 2I1KA 1YTZI 2QJKC 2WWWA 5GTIH 3L75G 1OW8A 2HODA 3WUUA 1BE3G 1SFCB 2W27A 1L0LG 3AE7C 1PZQA 1SQQG 5AW4B 5TISE 4AQRD 2OYHA 1PPJD 5GTHE 4YXDC 4OH8B 1ZW0A 1JY3N 2E5TA 3B4SA 1D7MA 3LIDA 1GL2B 1KYOD 2B89A 5CCHC 1T2KD 1JNMA 4N6JA 3CCJP 2ZVOB 3C9IA 2K3RA 2NPSC 3G3ZA 1KB9E 3R2PA 1N7SB 3CC7P 2K88A 2LXCB 3L72G 3PRJA 2R32A 1RF0C 5KLVD 1PIXA 2GUSA 3SFEC 1RQVA 1AV1A 2WPSA 3RK3D 3WUVA 3ABVC 1KFMA 3B71A 4WB4A 2E76B 2XZRA 2KYVA 1DEEG 1SQQD 1EQ7A 1ZLLA 2PFXA 2WSEJ 2QG4A 5BU5A 4ZNCA 1SQXG 1FOSE 2E43A 1NOHA 3BCCE 4N78E 1GU5A 4HJGH 5AW2B 4YXWH 3A0HE 1LT9C 1KQGB 3KDPB 3L37A 4TLFA 3V2PA 1N73B 3U59A 3Q1MA 1SQVJ 1HVVA 3LW5H 5L8RJ 1URQB 4IOIH 4RKUJ 1OWAA 1SQQE 1L4AA 3QH9A 1KQFB 2OYIA 2FYZA 3GF7A 2FKWB 1S72P 2IZ0A 2WZ7A 1OW6A 1SQXJ 1E5WA 1FE6A 3AECC 5AVWB 3M91A 1MZ9A 4D6TE 5CBNA 1VQNP 1NTZD 1RY3A 1SQXE 1NHLA 1ZOYC 2KIKA 2KZIA 3H1IE 3P8CE 1MFTA 4UB8E 2HPCA 3H1JG 2FY8A 5AW6B 5CCHA 4LLHA 3H32A 2GUVA 1SFCA 5APWA 1VQPP 2P7JA 2ZT9D 1GK6A 2OYHC 2IBZD 2E75C 1S4XA 2QSIA 2B9BA 1FDIA 2WSFH 2M5AA 2Y9ZA 3FWLA 3JC22 4EYYQ 2ZYAA 1P84I 1GW3A 1LT9B 1PPJE 1ZV8A 3H1HJ 1L4AD 2AXTE 2C0WA 1S5LE 3I5CA 4C46A 2KS1B 5APQA 3TF5A 1X22A 1H8AA 1VL2A 4W7ZA 1NU1D 1ZR2A 2KXPB 3CCQP 2I1JA 2FYNC 3AE3C 3VMXA 3VMZA 2FYNB 5AVZB 4H44D 2OYOA 2Q3EA 1LP1B 1NTKG 1YQ3C 2M5AB 3G9RA 3W68A 2Q5UA 2KP8A 1H0TB 2KNCA 3H1JE 2RKLA 2NPSA 1VPCA 3BASA 4K35A 1NAYA 1T6AA 1RHZB 3CLQA 3KXDA 1CI6B 3L72E 4JPZB 3B5NA 5B5EH 3CXHE 3L72J 1K05A 2KOGA 1T8ZA 2WPRA 2E75B 1SQXD 1NTZE 3P8CD 4IL6E 1SFCC 5E79H 1IJDB 4C7RA 3H1HE 3IN6A 4U3FG 5C39A 3H1KE 5KLVE 1KYOI 2H88C 2QJKB 1EC5A 2W6JH 3H1LE 3L74G 4PD4E 2IX7C 2YXRB 1BSNA 2K9JB 3CCLP 1PFIA 1NAFA 2AXTH 2WQYC 3HRNA 1MFZA 2FXOA 1G2CA 2Q1KA 3L70J 2OARA 3FXDA 2WPQA 2ZVNB 1URQC 3H1LD 2HFED 3P8MC 4GOFA 1GZLA 1L0NE 4A7PA 1FBMA 1LTBC 1HWTC 3U1AA 1N73C 1FC2C 4ZMDA 2BEZF 1EDJA 4JYBA 1R5LA 4M3LA 4RJTA 2E74B 4L73A 5BU8B 1SQVE 1FOSF 1DIPA 2ZFCA 2WT7B 4L75A 1KYOE 2IZ1A 2JEEA 1DH3A 4UB8H 1BE3E 1SQVD 2E76C 1PGJA 3LIEA 3ZDMA 2SPZA 3H1ID 5KAIH 3H1HG 2ZYGA 1VQKP 5AW3B 4EDFA 1QL1A 3H1LG 4KT0J 2YKPA 2LR2A 3MHVA 2Q6QA 3MTUE 1KORA 3A7OA 3F89A 1IFDA 1N7SC 2RH0A 1L0LK 4HYTB 1YJ9P 1FAVA 2HLOA 1NU1G 1ZN5A 1SQPJ 1N7SA 2M3EA 2NPSB 3GHGA 3M0DC 4PJ0E 4W7YA 1EZVE 1GL2C 1NTMK 1NTMD 1RE4A 2YIUC 3CCEP 1YITP 3F5HA 3G71P 1IFIA 4NPFX 5DJUB 1VQ6P 1VF5D 4XE5B 4HH2A 1VQ4P 3MZWB 3HE5A 3NFQA 5KAIE 3H1LJ 3AEDC 1QVFO 2OGUA 2N9YB 2UWJE 1LT1A 2P58A 1SQQK 3SFDC 2WMMA 1BE3D 2KS1A 1MUUA 3FXEA 1N7LA 3O6QB 4XFJA 3CMAP 5AVVB 1RQUA 1S5LH 1L2PA 1NU1K 2OTKE 1TU3F 3BATA 1VQLP 1URQA 1JTHA 1J1DC 2KUBA 4DZOA 3S4RA 3RK3E 3C8VA 4BWNA 1YYCA 4EIJA 1SP4A 3L72D 3HTKB 1AVYA 3RL0D 3SWFA 1BCCJ 5CCGA 1R8EA 1LTJB 2R5DA 3EWKA 3BRVB 3TSIA 2QRXA 5KAFH 3Q5SA 2FXPA 3MD0A 3TNUA 3K5BA 2L5GB 4N78D 1NWQA 3BCCG 2C9NY 2A45I 1KV4A 1N8RQ 3V5BA 2OYHB 2QVAA 1G1IA 4IFMA 1FZFA 1NH4A 1IZNB 2QM7A 1EZVI 4WVZA 4XA4A 1NKNA 2G3AA 1OVVA 2M8RA 3TGUJ 4H44C 1OXZA 2WVRA 1WT6A 3VYIA 5B66E 2IBZE 1L0LJ 2M3BA 3RL0g 1SQVG 2O01J 2YKOA 4PJ0H 1NO4A 3WU2H 3H6PA 1JMBA 3H1IG 2HG5D 2J5UA 4DOJA 1VQ5P 2QJYB 1L4AB 1KD1Q 1RE3A 1BGYG 2IDBA 4PV1B 2Z5HA 3CCUP 2YKQA 1QX8A 1NYHA 4OWFA 4H0LC 5APTA 5CJ4A 1LP1A 3HTKA 3L73J 4U3FJ 4U7JA 3HD7C 5AVXB 1PP9G 1LTIC 1Z56A 1LJ2A 3C1LA 3L4FA 1CW5A 2D2CC 1M57D 3OJAB 1Q7YQ 1M56D 3CL3D 2IBZG 1K9MQ 3II6A 1NTZJ 1FZBA 3E1RA 5AW7B 1JEKA 5KLVK 1Y8AA 3AE2C 2H7HA 3EQ2A 1M90Q 2QE7H 5APUA 3HE4B 2E74D 2CK3H 3TGUG 5GTHH 2CPSA 1RE4C 2WSFJ 3RL0B 1S2EA 1G1JA 1YBKA 3TDKA 1XTGB 5TJHA 3GHGC 1JCCA 1SQPK 4PV1D 1YIJP 3L74E 4I2LC 1OMIA 1URQD 3WMM0 1YHQP 1BGYJ 1KILD 3RGUA 1FJPA 2M0BA 2W6BA 4TT3H 1GMJA 1YJWP 2GM4A 1FDOA 2Q3IA 4D6TD 3Q3DA 1P84H 4PD4I 1KILE 4I1LA 4C7NA 1PV3A 1OX3A 2A06D 3VP9A 1LWUB 1SQVK 5M1BA 1FZGA 2ZJSE 3GG2A 3V4QA 1QLED 2PP6A 3A0BH 4GIFA 3TGUD 2Z4EA 1QVGO 1Q2NA 1L0LD 3L71D 3KZIE 1OW7A 1SQQJ 3V2NA 1FZEA 1JCDA 1KQLA 1OZHA 5KJ7C 3HD7A 4R4MA 1PL5A 3L75J 3MUDA 2XU6A 3CC4P 1BCCD 2JP3A 2WTYA 1NU1J 3B5ND 3CCMP 2B88A 1UIXA 3OAKA 5DJTB 2NPSD 1S3JA 5CJ0A 4GODA 2I8DA 4JF7A 3VN0A 2AEMA 2WPVB 2QM8A 1M7LA 1PGOA 2RN0A 1ZMEC 1J1EC 1Y47A 1S1CX 1LTSC 3JCUE 2N1TC 2K9JA 2Q7CA 2P10A 5BVZA 1P84D 3L71G 1BGYD 1WRGA 4ZKUA 1QEXA 5KKZB 3RBZA 1VQOP 3G6EP 2IFNA 4C7NB 1NVOA 4D6TJ 1RF1C 2N9BA 3NXSA 5AW8B 2XNDH 3HE4A 1BCCG 1RE3C 3AEFC 4H13B 1M1JC 4W80A 4OGQB 2QJPB 5KLIC 2WSSH 3FGAD 2KK7A 1T3UA 2W8ZA 3H25A 1A02F 1OVRA 1PP9E 1J2JB 1IFPA 1LTJA 2A45H 2FBWC 3CWBG 1AQTA 4OGQD 3TNUB 2XDJA 1VDFA 2E5YA 2LXBA 3L73D 4NPDA 1KMIZ 2WT7A 1JOCA 3BCCJ 4I7ZB 3BVHA 3PJSK 1VQ7P 1X79B 3H1JJ 4Y28J 1R5SA 1ZXGA 3NMDA 3RK2C 3Q2YA 1BCCE 1M8OB 3MUDC 4GDOA 3A3YB 1M1KQ 1JUNA 2C9LY 4BRYA 2WITA 5CCGC 4WY4B 2ZT9C 1MV8A 1XTCC 3H1KG 4D6TG 2JWDA 4WBAA 4UB6E 3OW2O 5AW0B 1JY2P 2NRGA 1KN7A 4KHXA 1P84E 1GTWA 4ASVA 3T97A 1FZCC 3HE5B 2BCCD 1IK9A 5AVRB 3KPEA 3S9OA 2FYUD 2XNXA 3NTNA 1FU1A 3M0DA 1EXIA 3V4WA 2IPPA 3OA7A 1LNQA 1AFOA 2FYUE 1FZAA 2WSCJ 3H1KD 3EFFK 3RK3B 1HF9A 2J58A 2YNYA 2D2CD 3HUSC 3L73E 3VP8A 3D6YA 4PD4D 2FFDC 2OYIB 3HUSA 3V2RA 1X9VA 3D6ZA 2V7QH 5H2FE 1NTKJ 2RMZA 1PGPA 2BCCG 3CXHI 3O8ZA 1Q86Q 4LGDE 1VF5B 5CMZA 4WY4A 1JMMA 1BE3J 3IAOA 1IO4A 1SQBJ 1GW4A 3A2AA 1CSBA 5CCHD 3GW6A 1KZUB 3I56P 3CCRP 3L74D 2OYIC 1KILC 2JR8A 1LWUA 1SVFA 4QMAA 5AVQB 3Q5RA 2JJLA 2JO1A 2BCCJ 4B86A 3RK3C 1BGYE 2KSJA 1S9KD 3MGNA 3FX0A 3L70G 3A0BE 3CX5D 2HYNA 2YMKA 1MKMA 3B5NB 4Y99B 3PP5A 3U1CA 2YXQB 5AVUB 1JY2N 1Y9BA 1FZCB 1KYOH 2HR3A 1PP9D 2O3JA 4DT0A 1S9KE 1NGMB 1GDTA 3M9HA 3CX5H 1N2DC 1IK7A 3B5NC 4NPEA 4Y99C 4L74A 1AA0A 2K9YA 3L36A 2KNCB 1NJIQ 1H0TA 3B8EB 3KHUA 2E76D 3WUTA 2JDIH 3H1HD 4IL6X 2HODB 1HGVA 1HGZA 1JB0J 4IFDK 3CWBE 1SQPG 1W5CE 2ZYDA 1KILA 3RK2B 1KILB 2R3SA 3H1JD 4K3AA 1N7SD 4CPGA 3IR9A 3GF3A 3SSUA 4YPCA 2V7QJ 4I7ZC 3JCUH 1GL2D 2E75D 1NTKK 5AW5B 1HJ0A 2YMYA 3CD6P 1SQBE 3VTPC 2H8PD 1LTTC 1VF5C 5E79E 3O6QA 3H32B 1LGHB 5KLIB 2QJPC 4OGQC 3N4XA 1SQPE 2KI7B 3GLMA 4YTPC 1EDKA 2FFDB 1AJYA 1EDLA 3HUSB 1U7JA 2CPBA 3QWOC 1RF1B 5AW9B 2BCCE 1ZRTE 2BASA 1NTMJ 3RK2D 2VRSA 5K5GB 5KTBA 3VOPA 3G4SP 2ZXEB 2N1TB 1K73Q 2FYUJ 3AEAC 5KLVJ 2G8YA 1NTKD 1OIPA 1PGQA 2Y0DA 3AE4C 3L71J 5CCGD 3H1KJ 4ZKPA 1Q82Q 5EFWB 5H2FH 1IC2A 1T3JA 3L75D 3MP7B 4GKGA 4GT1A 1DD4A 4R4LA 5KAFE 2IYPA 1HJBA 3AE6C 5AVTB 3L35A 2ZT9B 3L70E 4WY4C 1SFCD 5APYA 4N3YB 2J59M 3CMEP 1FDMA 1N73A 1K8AQ 2P1JA 2PRRA 3IF4A 3E1IA 1A02J 1HH0A 3P7KA 5APSA 1LTGC 1HBWA 1U7MA 2P2UA 2QIWA 1L0NG 1KB9I 3E7KA 4EI2A 2IBZI 4HB1A 4KJMA 3L74J 2K37A 1KC8Q 3M0AA 1Q90D 2C0XA 4PD4H 1GU4A 2O1JA 1LT9A 1QL2A 1VQMP 3VMYA 2FXMA 2QA4P
chains in the Genus database with same CATH topology
3GHGB 2PAJA 2MJZA 1SQXK 3BRTB 1M1JB 3M06A 1FZCA 3P32A 3N7NA 4O9BA 2R3CA 1FJKA 1W2EA 3M9BA 2A45G 1J1EB 3EFGA 1N86A 3HD7B 3TK1A 1T2KC 1LTAC 3KYQA 2KLVA 2H7HA 3KQGA 5AW1B 1HTLC 4EOTA 2H43A 3CI9A 1JY2O 4IFFA 2XKMA 1M1JA 1LWUC 2O01H 1H89A 5CHXA 1JY3O 1RF1A 2FYUK 3M9QA 5KJ7D 2IFMA 2P67A 3IFMA 2N1TA 1DX7A 2KB7P 1HUCA 3RL0C 1CI6A 1JTHB 2POHA 2FFDA 1J1DB 1SQBK 2N1TD 1H88A 5KJ7A 2WSEH 1DEBA 4I6MC 1L0NK 1SLQA 1YTZT 1ZR4A 1JY3P 2XV5A 1G2CB 4JYCA 2R5BA 1L4AC 1IFNA 4RESB 2Q9IA 2LKMA 1GL2A 5APVA 4AUWA 2Z5IA 5AVSB 1KFNA 2HPCB 1AQ5A 2WSCH 3HD7D 1IFMA 4WY4D 2OYHC 3UIAA 1NKZB 4LC1A 2O1KA 1GK4A 2W6AA 3A5TA 3V2QA 1GD2E 1RF0A 1LTJC 1NTZK 1X8YA 3TYYA 5AVYB 2YO3A 1IFJA 2YO2A 3MIWA 3SWYA 1JO5A 2E42A 5APXA 4AYCA 1CZQA 2I1KA 1YTZI 2WWWA 2HODA 2W27A 1SFCB 2OYHA 5AW4B 4AQRD 4OH8B 1JY3N 1T2KD 3LIDA 1GL2B 5CCHC 1JNMA 4N6JA 3C9IA 3R2PA 2NPSC 3G3ZA 1N7SB 2R32A 1RF0C 2GUSA 2WPSA 3RK3D 1KFMA 4WB4A 2XZRA 2KYVA 1ZLLA 1EQ7A 5BU5A 1FOSE 2E43A 1NOHA 4N78E 1GU5A 5AW2B 1LT9C 3KDPB 3L37A 3V2PA 1N73B 3U59A 1HVVA 3LW5H 1URQB 1OWAA 1L4AA 2OYIA 2FYZA 2FKWB 2WZ7A 5AVWB 1E5WA 3M91A 1MZ9A 3P8CE 1RY3A 1NHLA 2HPCA 5AW6B 5CCHA 4LLHA 3H32A 2GUVA 1SFCA 5APWA 2P7JA 1GK6A 2WSFH 1GW3A 1LT9B 1ZV8A 1L4AD 2C0WA 3I5CA 4C46A 5APQA 1H8AA 4W7ZA 1ZR2A 2I1JA 3VMXA 3VMZA 5AVZB 2Q5UA 2KP8A 2NPSA 1VPCA 3BASA 3CLQA 1CI6B 3B5NA 2KOGA 1T8ZA 2WPRA 3P8CD 1SFCC 4C7RA 1IJDB 2IX7C 1NAFA 3HRNA 1MFZA 1G2CA 3P8MC 2OARA 2WPQA 1URQC 1HWTC 2HFED 1GZLA 1FBMA 1LTBC 3U1AA 1N73C 4JYBA 4M3LA 5BU8B 1FOSF 2ZFCA 2WT7B 2JEEA 1DH3A 3LIEA 5AW3B 1QL1A 2YKPA 3MTUE 4HYTB 3A7OA 1GU4A 1IFDA 1N7SC 1GDTA 1L0LK 2NPSB 3M0DC 3GHGA 1FAVA 1ZN5A 2HLOA 1N7SA 4W7YA 1RE4A 1GL2C 1NTMK 1IFIA 4XE5B 4HH2A 3HE5A 3NFQA 1SQQK 1MUUA 1N7LA 5AVVB 1NU1K 3BATA 1URQA 1JTHA 1J1DC 4DZOA 4EIJA 1YYCA 1SP4A 3HTKB 3RL0D 3SWFA 5CCGA 1LTJB 2R5DA 3TSIA 3BRVB 1PFIA 1NWQA 2C9NY 3MD0A 3TNUA 4N78D 2L5GB 2A45I 3V5BA 2OYHB 1G1IA 4IFMA 1FZFA 1NH4A 2QM7A 4XA4A 1NKNA 2M8RA 3VYIA 1OXZA 1WT6A 2M3BA 2YKOA 1NO4A 3H6PA 4DOJA 2HG5D 1L4AB 1RE3A 2Z5HA 2YKQA 5APTA 5CJ4A 3HTKA 5AVXB 3HD7C 1LTIC 1Z56A 1CW5A 3L4FA 3OJAB 3CL3D 3II6A 1FZBA 5KLVK 5AW7B 3EQ2A 5APUA 3HE4B 2CPSA 1RE4C 3RL0B 1G1JA 1XTGB 3GHGC 1JCCA 1SQPK 4I2LC 1URQD 3WMM0 1FJPA 1KILD 2W6BA 2GM4A 2Q3IA 4C7NA 4I1LA 3VP9A 1LWUB 1SQVK 1FZGA 3V4QA 2PP6A 4GIFA 2Z4EA 3V2NA 1FZEA 1JCDA 1KQLA 5KJ7C 3HD7A 3MUDA 2XU6A 2WTYA 3B5ND 3OAKA 2NPSD 5CJ0A 3VN0A 4JF7A 2QM8A 1M7LA 1J1EC 1LTSC 2N1TC 2Q7CA 5BVZA 4ZKUA 1WRGA 2IFNA 4C7NB 1RF1C 2N9BA 3NXSA 5AW8B 3HE4A 1RE3C 1M1JC 4W80A 1T3UA 1A02F 1LTJA 1J2JB 2A45H 3TNUB 2XDJA 1VDFA 2WT7A 1JOCA 3BVHA 1X79B 3RK2C 3NMDA 3A3YB 1JUNA 2C9LY 2WITA 5CCGC 4WY4B 1MV8A 1XTCC 4WBAA 5AW0B 1JY2P 4KHXA 1GTWA 3T97A 1FZCC 3HE5B 1IK9A 5AVRB 3KPEA 2XNXA 3NTNA 1FU1A 3M0DA 3V4WA 2IPPA 3OA7A 1AFOA 1FZAA 3RK3B 2J58A 2YNYA 3HUSC 3VP8A 2FFDC 2OYIB 3HUSA 3V2RA 1X9VA 3O8ZA 4LGDE 5CMZA 4WY4A 1JMMA 1IO4A 3A2AA 1GW4A 5CCHD 1CSBA 1KZUB 2OYIC 1KILC 1LWUA 1SVFA 5AVQB 2JJLA 4B86A 3RK3C 2KSJA 1S9KD 3MGNA 2HYNA 3B5NB 4Y99B 3PP5A 3U1CA 5AVUB 1JY2N 1FZCB 1S9KE 3M9HA 1N2DC 3B5NC 4Y99C 3L36A 3B8EB 2HODB 1HGVA 1HGZA 4IFDK 1KILA 3RK2B 1KILB 1N7SD 3IR9A 1GL2D 1NTKK 5AW5B 2YMYA 3VTPC 2H8PD 1LTTC 3H32B 1LGHB 3N4XA 2FFDB 3HUSB 1RF1B 2CPBA 5AW9B 5KTBA 2BASA 3RK2D 2VRSA 3VOPA 2ZXEB 2N1TB 5CCGD 4ZKPA 1IC2A 1T3JA 4GKGA 4GT1A 1HJBA 5AVTB 3L35A 4WY4C 1SFCD 5APYA 4N3YB 2J59M 1FDMA 1N73A 2P1JA 3E1IA 1A02J 1HH0A 3P7KA 5APSA 1LTGC 1HBWA 2P2UA 3M0AA 2C0XA 2O1JA 1LT9A 1QL2A 3VMYA 2FXMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MV8 A;  2R32 A;  5AVV B;  5AW0 B;  4KHX A;  2WPS A;  3M06 A;  1GTW A;  3T97 A;  4DZO A;  2XZR A;  3HE5 B;  1YYC A;  5AVR B;  1SP4 A;  3P32 A;  2R3C A;  1FOS E;  2E43 A;  3NTN A;  3SWF A;  1GU5 A;  2R5D A;  3M0D A;  3M9B A;  5AW2 B;  3V4W A;  3L37 A;  2IPP A;  3KDP B;  3MD0 A;  3TNU A;  1NWQ A;  2C9N Y;  3TK1 A;  1T2K C;  2YNY A;  1OWA A;  3V5B A;  2H7H A;  3KQG A;  5AW1 B;  4EOT A;  5AVW B;  2QM7 A;  3O8Z A;  3M91 A;  5CMZ A;  3VYI A;  1OXZ A;  1IO4 A;  3A2A A;  5AW6 B;  1CSB A;  5APW A;  2P7J A;  1GK6 A;  1H89 A;  2Z5H A;  5AVQ B;  2JJL A;  5APT A;  4B86 A;  3HTK A;  5AVX B;  2P67 A;  3MGN A;  1S9K D;  4C46 A;  3I5C A;  5APQ A;  1H8A A;  1HUC A;  1CI6 A;  5AW7 B;  5AVU B;  3VMX A;  5APU A;  3HE4 B;  3VMZ A;  5AVZ B;  1S9K E;  3M9H A;  1H88 A;  2Q5U A;  3L36 A;  2KP8 A;  4I6M C;  4I2L C;  3B8E B;  1CI6 B;  1SLQ A;  2Q3I A;  4C7N A;  2WPR A;  2XV5 A;  1G2C B;  4JYC A;  2R5B A;  4RES B;  3IR9 A;  3V4Q A;  5APV A;  5AW5 B;  4AUW A;  2Z5I A;  5AVS B;  3VTP C;  1KQL A;  1NAF A;  2XU6 A;  1MFZ A;  2WTY A;  3OAK A;  3UIA A;  3P8M C;  4LC1 A;  2WPQ A;  3VN0 A;  1HWT C;  1GK4 A;  1GZL A;  2QM8 A;  2W6A A;  3A5T A;  5AW9 B;  2BAS A;  1GD2 E;  2VRS A;  2ZXE B;  4JYB A;  4M3L A;  2Q7C A;  1FOS F;  1X8Y A;  3TYY A;  5AVY B;  2YO3 A;  2ZFC A;  2WT7 B;  1DH3 A;  4C7N B;  2YO2 A;  2N9B A;  3NXS A;  5AW8 B;  3HE4 A;  3LIE A;  2E42 A;  4GKG A;  4GT1 A;  5AW3 B;  5APX A;  1HJB A;  4HYT B;  3A7O A;  5AVT B;  3L35 A;  1J2J B;  4AYC A;  1GU4 A;  1A02 F;  5APY A;  1FAV A;  1CZQ A;  3TNU B;  2WT7 A;  2WWW A;  1A02 J;  3P7K A;  5APS A;  2W27 A;  1HBW A;  2P2U A;  5AW4 B;  4AQR D;  4XE5 B;  3NMD A;  3HE5 A;  3NFQ A;  1T2K D;  3LID A;  3M0A A;  3A3Y B;  1JUN A;  2C9L Y;  1JNM A;  3VMY A;  1MUU A; 
#chains in the Genus database with same CATH topology
 4UB6 H;  3GHG B;  4IL6 H;  2L91 A;  1AVO A;  2PAJ A;  2MJZ A;  4H0L D;  3PHL A;  1BSH A;  1SQX K;  3BRT B;  1M1J B;  3M06 A;  3CPW O;  1FZC A;  1EXJ A;  4MN4 C;  4H13 C;  3WU2 E;  1OVU A;  1USD A;  2O01 N;  1VQ9 P;  3I55 P;  4Z1M H;  2AEF A;  1QGK B;  3P32 A;  3AE8 C;  3N7N A;  4GOE A;  2R3C A;  4O9B A;  2OQQ A;  5B66 H;  3PLN A;  5KKZ C;  1FJK A;  1YI2 P;  1VQ8 P;  3CC2 P;  1W2E A;  2D2C B;  3M9B A;  1X0T A;  2A45 G;  1L0N J;  1J1E B;  3EFG A;  1N86 A;  3HD7 B;  2KLU A;  1NTZ G;  4L76 A;  1KQS O;  1U57 A;  3AE1 C;  3TK1 A;  1T2K C;  1W2B O;  2ZAE B;  1S5L X;  2GA1 A;  1LTA C;  3KYQ A;  3L71 E;  2KLV A;  2FYU G;  3KQG A;  4HKZ H;  1JM0 A;  1HTL C;  4PV1 C;  5AW1 B;  2QJY C;  1BDD A;  1NTM G;  3FWN A;  4BXL A;  4EOT A;  1YJN P;  1KB9 H;  3CXH D;  2H43 A;  3JSV C;  1E79 H;  3L75 E;  2A06 G;  2OTJ P;  4WWI A;  3H1I J;  3CI9 A;  3V6I A;  1JY2 O;  4IFF A;  2XKM A;  3GMA A;  3CCS P;  1SS1 A;  2OTL P;  1SQB G;  1M1J A;  1LWU C;  2O01 H;  1H89 A;  5CHX A;  3SWK A;  4DJG A;  1JY3 O;  3CWB J;  3D70 A;  3T97 B;  1RF1 A;  2IYO A;  2FYU K;  2Y0C A;  2ZXX A;  3M9Q A;  3AE5 C;  5KJ7 D;  2B87 A;  2IFM A;  2P67 A;  2B87 B;  3IFM A;  2JKV A;  1USE A;  1RH5 B;  2N1T A;  1DX7 A;  2KB7 P;  4DCK A;  1ZRT D;  1L0N D;  1HUC A;  3RL0 C;  1KTM A;  1CI6 A;  2R44 A;  3KZI H;  3LW5 J;  2JWA A;  1JTH B;  2POH A;  3AEE C;  3VMA A;  2FFD A;  2W90 A;  1J1D B;  1SQB K;  1SQB D;  2PGD A;  2NZ2 A;  3L70 D;  2N1T D;  3ITK A;  3W67 A;  2KSE A;  1UII A;  3A0H H;  3BCC D;  1H88 A;  4RO0 A;  1PPJ G;  5KJ7 A;  2WSE H;  2V4H A;  4BRY B;  1DEB A;  4I6M C;  2A06 E;  4U3F D;  1OFC X;  1L0N K;  1SLQ A;  1YTZ T;  4H0L B;  5B5E E;  3CCV P;  3AE9 C;  4U3F E;  5KLV G;  1ZR4 A;  1JY3 P;  2XV5 A;  1G2C B;  2KZJ A;  4JYC A;  2R5B A;  1L4A C;  1IFN A;  3CWB D;  4RES B;  2Q9I A;  3L73 G;  2YIU B;  2LKM A;  1GL2 A;  4JQ0 D;  5APV A;  1EDI A;  2H89 C;  2W83 C;  2Z5I A;  4AUW A;  1SQP D;  4H44 B;  5AVS B;  1KFN A;  2HPC B;  4OVN F;  1AQ5 A;  2ITA A;  2WSC H;  3HD7 D;  5TIS H;  3TGU E;  1IFM A;  4WY4 D;  2AXC A;  1L0L E;  4JBZ A;  3RBX A;  1NKZ B;  3UIA A;  5GTI E;  3CX5 E;  1PP9 J;  4LC1 A;  2Y9Y A;  5CBO A;  3Q5P A;  2O1K A;  1GK4 A;  1EZV D;  1NTM E;  2W6A A;  2Y0E A;  3PTZ A;  3AEB C;  3V2Q A;  3A5T A;  3D71 A;  4ASW A;  1RF0 A;  1GD2 E;  1FS0 E;  2E74 C;  1LTJ C;  1NTZ K;  1X8Y A;  3TYY A;  5AVY B;  2BEQ D;  1YQ4 C;  1K04 A;  2YO3 A;  3USS A;  3S1K A;  1IFJ A;  1Q81 Q;  1NTK E;  2YO2 A;  1KB9 D;  3CXH H;  3PH0 A;  2MKV A;  2QEX P;  2AEJ A;  3MIW A;  3SWY A;  1JO5 A;  2E42 A;  3R4Y A;  1NU1 E;  5APX A;  2DW3 A;  4H13 D;  1EZV G;  1WMK A;  2K1A A;  1DD3 A;  3AEG C;  4AYC A;  1BDC A;  3CX5 I;  1CZQ A;  1ZP0 C;  2I1K A;  1YTZ I;  2QJK C;  2WWW A;  5GTI H;  3L75 G;  1OW8 A;  2HOD A;  3WUU A;  1BE3 G;  1SFC B;  2W27 A;  1L0L G;  3AE7 C;  1PZQ A;  1SQQ G;  5AW4 B;  5TIS E;  4AQR D;  2OYH A;  1PPJ D;  5GTH E;  4YXD C;  4OH8 B;  1ZW0 A;  1JY3 N;  2E5T A;  3B4S A;  1D7M A;  3LID A;  1GL2 B;  1KYO D;  2B89 A;  5CCH C;  1T2K D;  1JNM A;  4N6J A;  3CCJ P;  2ZVO B;  3C9I A;  2K3R A;  2NPS C;  3G3Z A;  1KB9 E;  3R2P A;  1N7S B;  3CC7 P;  2K88 A;  2LXC B;  3L72 G;  3PRJ A;  2R32 A;  1RF0 C;  5KLV D;  1PIX A;  2GUS A;  3SFE C;  1RQV A;  1AV1 A;  2WPS A;  3RK3 D;  3WUV A;  3ABV C;  1KFM A;  3B71 A;  4WB4 A;  2E76 B;  2XZR A;  2KYV A;  1DEE G;  1SQQ D;  1EQ7 A;  1ZLL A;  2PFX A;  2WSE J;  2QG4 A;  5BU5 A;  4ZNC A;  1SQX G;  1FOS E;  2E43 A;  1NOH A;  3BCC E;  4N78 E;  1GU5 A;  4HJG H;  5AW2 B;  4YXW H;  3A0H E;  1LT9 C;  1KQG B;  3KDP B;  3L37 A;  4TLF A;  3V2P A;  1N73 B;  3U59 A;  3Q1M A;  1SQV J;  1HVV A;  3LW5 H;  5L8R J;  1URQ B;  4IOI H;  4RKU J;  1OWA A;  1SQQ E;  1L4A A;  3QH9 A;  1KQF B;  2OYI A;  2FYZ A;  3GF7 A;  2FKW B;  1S72 P;  2IZ0 A;  2WZ7 A;  1OW6 A;  1SQX J;  1E5W A;  1FE6 A;  3AEC C;  5AVW B;  3M91 A;  1MZ9 A;  4D6T E;  5CBN A;  1VQN P;  1NTZ D;  1RY3 A;  1SQX E;  1NHL A;  1ZOY C;  2KIK A;  2KZI A;  3H1I E;  3P8C E;  1MFT A;  4UB8 E;  2HPC A;  3H1J G;  2FY8 A;  5AW6 B;  5CCH A;  4LLH A;  3H32 A;  2GUV A;  1SFC A;  5APW A;  1VQP P;  2P7J A;  2ZT9 D;  1GK6 A;  2OYH C;  2IBZ D;  2E75 C;  1S4X A;  2QSI A;  2B9B A;  1FDI A;  2WSF H;  2M5A A;  2Y9Z A;  3FWL A;  3JC2 2;  4EYY Q;  2ZYA A;  1P84 I;  1GW3 A;  1LT9 B;  1PPJ E;  1ZV8 A;  3H1H J;  1L4A D;  2AXT E;  2C0W A;  1S5L E;  3I5C A;  4C46 A;  2KS1 B;  5APQ A;  3TF5 A;  1X22 A;  1H8A A;  1VL2 A;  4W7Z A;  1NU1 D;  1ZR2 A;  2KXP B;  3CCQ P;  2I1J A;  2FYN C;  3AE3 C;  3VMX A;  3VMZ A;  2FYN B;  5AVZ B;  4H44 D;  2OYO A;  2Q3E A;  1LP1 B;  1NTK G;  1YQ3 C;  2M5A B;  3G9R A;  3W68 A;  2Q5U A;  2KP8 A;  1H0T B;  2KNC A;  3H1J E;  2RKL A;  2NPS A;  1VPC A;  3BAS A;  4K35 A;  1NAY A;  1T6A A;  1RHZ B;  3CLQ A;  3KXD A;  1CI6 B;  3L72 E;  4JPZ B;  3B5N A;  5B5E H;  3CXH E;  3L72 J;  1K05 A;  2KOG A;  1T8Z A;  2WPR A;  2E75 B;  1SQX D;  1NTZ E;  3P8C D;  4IL6 E;  1SFC C;  5E79 H;  1IJD B;  4C7R A;  3H1H E;  3IN6 A;  4U3F G;  5C39 A;  3H1K E;  5KLV E;  1KYO I;  2H88 C;  2QJK B;  1EC5 A;  2W6J H;  3H1L E;  3L74 G;  4PD4 E;  2IX7 C;  2YXR B;  1BSN A;  2K9J B;  3CCL P;  1PFI A;  1NAF A;  2AXT H;  2WQY C;  3HRN A;  1MFZ A;  2FXO A;  1G2C A;  2Q1K A;  3L70 J;  2OAR A;  3FXD A;  2WPQ A;  2ZVN B;  1URQ C;  3H1L D;  2HFE D;  3P8M C;  4GOF A;  1GZL A;  1L0N E;  4A7P A;  1FBM A;  1LTB C;  1HWT C;  3U1A A;  1N73 C;  1FC2 C;  4ZMD A;  2BEZ F;  1EDJ A;  4JYB A;  1R5L A;  4M3L A;  4RJT A;  2E74 B;  4L73 A;  5BU8 B;  1SQV E;  1FOS F;  1DIP A;  2ZFC A;  2WT7 B;  4L75 A;  1KYO E;  2IZ1 A;  2JEE A;  1DH3 A;  4UB8 H;  1BE3 E;  1SQV D;  2E76 C;  1PGJ A;  3LIE A;  3ZDM A;  2SPZ A;  3H1I D;  5KAI H;  3H1H G;  2ZYG A;  1VQK P;  5AW3 B;  4EDF A;  1QL1 A;  3H1L G;  4KT0 J;  2YKP A;  2LR2 A;  3MHV A;  2Q6Q A;  3MTU E;  1KOR A;  3A7O A;  3F89 A;  1IFD A;  1N7S C;  2RH0 A;  1L0L K;  4HYT B;  1YJ9 P;  1FAV A;  2HLO A;  1NU1 G;  1ZN5 A;  1SQP J;  1N7S A;  2M3E A;  2NPS B;  3GHG A;  3M0D C;  4PJ0 E;  4W7Y A;  1EZV E;  1GL2 C;  1NTM K;  1NTM D;  1RE4 A;  2YIU C;  3CCE P;  1YIT P;  3F5H A;  3G71 P;  1IFI A;  4NPF X;  5DJU B;  1VQ6 P;  1VF5 D;  4XE5 B;  4HH2 A;  1VQ4 P;  3MZW B;  3HE5 A;  3NFQ A;  5KAI E;  3H1L J;  3AED C;  1QVF O;  2OGU A;  2N9Y B;  2UWJ E;  1LT1 A;  2P58 A;  1SQQ K;  3SFD C;  2WMM A;  1BE3 D;  2KS1 A;  1MUU A;  3FXE A;  1N7L A;  3O6Q B;  4XFJ A;  3CMA P;  5AVV B;  1RQU A;  1S5L H;  1L2P A;  1NU1 K;  2OTK E;  1TU3 F;  3BAT A;  1VQL P;  1URQ A;  1JTH A;  1J1D C;  2KUB A;  4DZO A;  3S4R A;  3RK3 E;  3C8V A;  4BWN A;  1YYC A;  4EIJ A;  1SP4 A;  3L72 D;  3HTK B;  1AVY A;  3RL0 D;  3SWF A;  1BCC J;  5CCG A;  1R8E A;  1LTJ B;  2R5D A;  3EWK A;  3BRV B;  3TSI A;  2QRX A;  5KAF H;  3Q5S A;  2FXP A;  3MD0 A;  3TNU A;  3K5B A;  2L5G B;  4N78 D;  1NWQ A;  3BCC G;  2C9N Y;  2A45 I;  1KV4 A;  1N8R Q;  3V5B A;  2OYH B;  2QVA A;  1G1I A;  4IFM A;  1FZF A;  1NH4 A;  1IZN B;  2QM7 A;  1EZV I;  4WVZ A;  4XA4 A;  1NKN A;  2G3A A;  1OVV A;  2M8R A;  3TGU J;  4H44 C;  1OXZ A;  2WVR A;  1WT6 A;  3VYI A;  5B66 E;  2IBZ E;  1L0L J;  2M3B A;  3RL0 g;  1SQV G;  2O01 J;  2YKO A;  4PJ0 H;  1NO4 A;  3WU2 H;  3H6P A;  1JMB A;  3H1I G;  2HG5 D;  2J5U A;  4DOJ A;  1VQ5 P;  2QJY B;  1L4A B;  1KD1 Q;  1RE3 A;  1BGY G;  2IDB A;  4PV1 B;  2Z5H A;  3CCU P;  2YKQ A;  1QX8 A;  1NYH A;  4OWF A;  4H0L C;  5APT A;  5CJ4 A;  1LP1 A;  3HTK A;  3L73 J;  4U3F J;  4U7J A;  3HD7 C;  5AVX B;  1PP9 G;  1LTI C;  1Z56 A;  1LJ2 A;  3C1L A;  3L4F A;  1CW5 A;  2D2C C;  1M57 D;  3OJA B;  1Q7Y Q;  1M56 D;  3CL3 D;  2IBZ G;  1K9M Q;  3II6 A;  1NTZ J;  1FZB A;  3E1R A;  5AW7 B;  1JEK A;  5KLV K;  1Y8A A;  3AE2 C;  2H7H A;  3EQ2 A;  1M90 Q;  2QE7 H;  5APU A;  3HE4 B;  2E74 D;  2CK3 H;  3TGU G;  5GTH H;  2CPS A;  1RE4 C;  2WSF J;  3RL0 B;  1S2E A;  1G1J A;  1YBK A;  3TDK A;  1XTG B;  5TJH A;  3GHG C;  1JCC A;  1SQP K;  4PV1 D;  1YIJ P;  3L74 E;  4I2L C;  1OMI A;  1URQ D;  3WMM 0;  1YHQ P;  1BGY J;  1KIL D;  3RGU A;  1FJP A;  2M0B A;  2W6B A;  4TT3 H;  1GMJ A;  1YJW P;  2GM4 A;  1FDO A;  2Q3I A;  4D6T D;  3Q3D A;  1P84 H;  4PD4 I;  1KIL E;  4I1L A;  4C7N A;  1PV3 A;  1OX3 A;  2A06 D;  3VP9 A;  1LWU B;  1SQV K;  5M1B A;  1FZG A;  2ZJS E;  3GG2 A;  3V4Q A;  1QLE D;  2PP6 A;  3A0B H;  4GIF A;  3TGU D;  2Z4E A;  1QVG O;  1Q2N A;  1L0L D;  3L71 D;  3KZI E;  1OW7 A;  1SQQ J;  3V2N A;  1FZE A;  1JCD A;  1KQL A;  1OZH A;  5KJ7 C;  3HD7 A;  4R4M A;  1PL5 A;  3L75 J;  3MUD A;  2XU6 A;  3CC4 P;  1BCC D;  2JP3 A;  2WTY A;  1NU1 J;  3B5N D;  3CCM P;  2B88 A;  1UIX A;  3OAK A;  5DJT B;  2NPS D;  1S3J A;  5CJ0 A;  4GOD A;  2I8D A;  4JF7 A;  3VN0 A;  2AEM A;  2WPV B;  2QM8 A;  1M7L A;  1PGO A;  2RN0 A;  1ZME C;  1J1E C;  1Y47 A;  1S1C X;  1LTS C;  3JCU E;  2N1T C;  2K9J A;  2Q7C A;  2P10 A;  5BVZ A;  1P84 D;  3L71 G;  1BGY D;  1WRG A;  4ZKU A;  1QEX A;  5KKZ B;  3RBZ A;  1VQO P;  3G6E P;  2IFN A;  4C7N B;  1NVO A;  4D6T J;  1RF1 C;  2N9B A;  3NXS A;  5AW8 B;  2XND H;  3HE4 A;  1BCC G;  1RE3 C;  3AEF C;  4H13 B;  1M1J C;  4W80 A;  4OGQ B;  2QJP B;  5KLI C;  2WSS H;  3FGA D;  2KK7 A;  1T3U A;  2W8Z A;  3H25 A;  1A02 F;  1OVR A;  1PP9 E;  1J2J B;  1IFP A;  1LTJ A;  2A45 H;  2FBW C;  3CWB G;  1AQT A;  4OGQ D;  3TNU B;  2XDJ A;  1VDF A;  2E5Y A;  2LXB A;  3L73 D;  4NPD A;  1KMI Z;  2WT7 A;  1JOC A;  3BCC J;  4I7Z B;  3BVH A;  3PJS K;  1VQ7 P;  1X79 B;  3H1J J;  4Y28 J;  1R5S A;  1ZXG A;  3NMD A;  3RK2 C;  3Q2Y A;  1BCC E;  1M8O B;  3MUD C;  4GDO A;  3A3Y B;  1M1K Q;  1JUN A;  2C9L Y;  4BRY A;  2WIT A;  5CCG C;  4WY4 B;  2ZT9 C;  1MV8 A;  1XTC C;  3H1K G;  4D6T G;  2JWD A;  4WBA A;  4UB6 E;  3OW2 O;  5AW0 B;  1JY2 P;  2NRG A;  1KN7 A;  4KHX A;  1P84 E;  1GTW A;  4ASV A;  3T97 A;  1FZC C;  3HE5 B;  2BCC D;  1IK9 A;  5AVR B;  3KPE A;  3S9O A;  2FYU D;  2XNX A;  3NTN A;  1FU1 A;  3M0D A;  1EXI A;  3V4W A;  2IPP A;  3OA7 A;  1LNQ A;  1AFO A;  2FYU E;  1FZA A;  2WSC J;  3H1K D;  3EFF K;  3RK3 B;  1HF9 A;  2J58 A;  2YNY A;  2D2C D;  3HUS C;  3L73 E;  3VP8 A;  3D6Y A;  4PD4 D;  2FFD C;  2OYI B;  3HUS A;  3V2R A;  1X9V A;  3D6Z A;  2V7Q H;  5H2F E;  1NTK J;  2RMZ A;  1PGP A;  2BCC G;  3CXH I;  3O8Z A;  1Q86 Q;  4LGD E;  1VF5 B;  5CMZ A;  4WY4 A;  1JMM A;  1BE3 J;  3IAO A;  1IO4 A;  1SQB J;  1GW4 A;  3A2A A;  1CSB A;  5CCH D;  3GW6 A;  1KZU B;  3I56 P;  3CCR P;  3L74 D;  2OYI C;  1KIL C;  2JR8 A;  1LWU A;  1SVF A;  4QMA A;  5AVQ B;  3Q5R A;  2JJL A;  2JO1 A;  2BCC J;  4B86 A;  3RK3 C;  1BGY E;  2KSJ A;  1S9K D;  3MGN A;  3FX0 A;  3L70 G;  3A0B E;  3CX5 D;  2HYN A;  2YMK A;  1MKM A;  3B5N B;  4Y99 B;  3PP5 A;  3U1C A;  2YXQ B;  5AVU B;  1JY2 N;  1Y9B A;  1FZC B;  1KYO H;  2HR3 A;  1PP9 D;  2O3J A;  4DT0 A;  1S9K E;  1NGM B;  1GDT A;  3M9H A;  3CX5 H;  1N2D C;  1IK7 A;  3B5N C;  4NPE A;  4Y99 C;  4L74 A;  1AA0 A;  2K9Y A;  3L36 A;  2KNC B;  1NJI Q;  1H0T A;  3B8E B;  3KHU A;  2E76 D;  3WUT A;  2JDI H;  3H1H D;  4IL6 X;  2HOD B;  1HGV A;  1HGZ A;  1JB0 J;  4IFD K;  3CWB E;  1SQP G;  1W5C E;  2ZYD A;  1KIL A;  3RK2 B;  1KIL B;  2R3S A;  3H1J D;  4K3A A;  1N7S D;  4CPG A;  3IR9 A;  3GF3 A;  3SSU A;  4YPC A;  2V7Q J;  4I7Z C;  3JCU H;  1GL2 D;  2E75 D;  1NTK K;  5AW5 B;  1HJ0 A;  2YMY A;  3CD6 P;  1SQB E;  3VTP C;  2H8P D;  1LTT C;  1VF5 C;  5E79 E;  3O6Q A;  3H32 B;  1LGH B;  5KLI B;  2QJP C;  4OGQ C;  3N4X A;  1SQP E;  2KI7 B;  3GLM A;  4YTP C;  1EDK A;  2FFD B;  1AJY A;  1EDL A;  3HUS B;  1U7J A;  2CPB A;  3QWO C;  1RF1 B;  5AW9 B;  2BCC E;  1ZRT E;  2BAS A;  1NTM J;  3RK2 D;  2VRS A;  5K5G B;  5KTB A;  3VOP A;  3G4S P;  2ZXE B;  2N1T B;  1K73 Q;  2FYU J;  3AEA C;  5KLV J;  2G8Y A;  1NTK D;  1OIP A;  1PGQ A;  2Y0D A;  3AE4 C;  3L71 J;  5CCG D;  3H1K J;  4ZKP A;  1Q82 Q;  5EFW B;  5H2F H;  1IC2 A;  1T3J A;  3L75 D;  3MP7 B;  4GKG A;  4GT1 A;  1DD4 A;  4R4L A;  5KAF E;  2IYP A;  1HJB A;  3AE6 C;  5AVT B;  3L35 A;  2ZT9 B;  3L70 E;  4WY4 C;  1SFC D;  5APY A;  4N3Y B;  2J59 M;  3CME P;  1FDM A;  1N73 A;  1K8A Q;  2P1J A;  2PRR A;  3IF4 A;  3E1I A;  1A02 J;  1HH0 A;  3P7K A;  5APS A;  1LTG C;  1HBW A;  1U7M A;  2P2U A;  2QIW A;  1L0N G;  1KB9 I;  3E7K A;  4EI2 A;  2IBZ I;  4HB1 A;  4KJM A;  3L74 J;  2K37 A;  1KC8 Q;  3M0A A;  1Q90 D;  2C0X A;  4PD4 H;  1GU4 A;  2O1J A;  1LT9 A;  1QL2 A;  1VQM P;  3VMY A;  2FXM A;  2QA4 P; 
#chains in the Genus database with same CATH homology
 3GHG B;  2PAJ A;  2MJZ A;  1SQX K;  3BRT B;  1M1J B;  3M06 A;  1FZC A;  3P32 A;  3N7N A;  4O9B A;  2R3C A;  1FJK A;  1W2E A;  3M9B A;  2A45 G;  1J1E B;  3EFG A;  1N86 A;  3HD7 B;  3TK1 A;  1T2K C;  1LTA C;  3KYQ A;  2KLV A;  2H7H A;  3KQG A;  5AW1 B;  1HTL C;  4EOT A;  2H43 A;  3CI9 A;  1JY2 O;  4IFF A;  2XKM A;  1M1J A;  1LWU C;  2O01 H;  1H89 A;  5CHX A;  1JY3 O;  1RF1 A;  2FYU K;  3M9Q A;  5KJ7 D;  2IFM A;  2P67 A;  3IFM A;  2N1T A;  1DX7 A;  2KB7 P;  1HUC A;  3RL0 C;  1CI6 A;  1JTH B;  2POH A;  2FFD A;  1J1D B;  1SQB K;  2N1T D;  1H88 A;  5KJ7 A;  2WSE H;  1DEB A;  4I6M C;  1L0N K;  1SLQ A;  1YTZ T;  1ZR4 A;  1JY3 P;  2XV5 A;  1G2C B;  4JYC A;  2R5B A;  1L4A C;  1IFN A;  4RES B;  2Q9I A;  2LKM A;  1GL2 A;  5APV A;  4AUW A;  2Z5I A;  5AVS B;  1KFN A;  2HPC B;  1AQ5 A;  2WSC H;  3HD7 D;  1IFM A;  4WY4 D;  2OYH C;  3UIA A;  1NKZ B;  4LC1 A;  2O1K A;  1GK4 A;  2W6A A;  3A5T A;  3V2Q A;  1GD2 E;  1RF0 A;  1LTJ C;  1NTZ K;  1X8Y A;  3TYY A;  5AVY B;  2YO3 A;  1IFJ A;  2YO2 A;  3MIW A;  3SWY A;  1JO5 A;  2E42 A;  5APX A;  4AYC A;  1CZQ A;  2I1K A;  1YTZ I;  2WWW A;  2HOD A;  2W27 A;  1SFC B;  2OYH A;  5AW4 B;  4AQR D;  4OH8 B;  1JY3 N;  1T2K D;  3LID A;  1GL2 B;  5CCH C;  1JNM A;  4N6J A;  3C9I A;  3R2P A;  2NPS C;  3G3Z A;  1N7S B;  2R32 A;  1RF0 C;  2GUS A;  2WPS A;  3RK3 D;  1KFM A;  4WB4 A;  2XZR A;  2KYV A;  1ZLL A;  1EQ7 A;  5BU5 A;  1FOS E;  2E43 A;  1NOH A;  4N78 E;  1GU5 A;  5AW2 B;  1LT9 C;  3KDP B;  3L37 A;  3V2P A;  1N73 B;  3U59 A;  1HVV A;  3LW5 H;  1URQ B;  1OWA A;  1L4A A;  2OYI A;  2FYZ A;  2FKW B;  2WZ7 A;  5AVW B;  1E5W A;  3M91 A;  1MZ9 A;  3P8C E;  1RY3 A;  1NHL A;  2HPC A;  5AW6 B;  5CCH A;  4LLH A;  3H32 A;  2GUV A;  1SFC A;  5APW A;  2P7J A;  1GK6 A;  2WSF H;  1GW3 A;  1LT9 B;  1ZV8 A;  1L4A D;  2C0W A;  3I5C A;  4C46 A;  5APQ A;  1H8A A;  4W7Z A;  1ZR2 A;  2I1J A;  3VMX A;  3VMZ A;  5AVZ B;  2Q5U A;  2KP8 A;  2NPS A;  1VPC A;  3BAS A;  3CLQ A;  1CI6 B;  3B5N A;  2KOG A;  1T8Z A;  2WPR A;  3P8C D;  1SFC C;  4C7R A;  1IJD B;  2IX7 C;  1NAF A;  3HRN A;  1MFZ A;  1G2C A;  3P8M C;  2OAR A;  2WPQ A;  1URQ C;  1HWT C;  2HFE D;  1GZL A;  1FBM A;  1LTB C;  3U1A A;  1N73 C;  4JYB A;  4M3L A;  5BU8 B;  1FOS F;  2ZFC A;  2WT7 B;  2JEE A;  1DH3 A;  3LIE A;  5AW3 B;  1QL1 A;  2YKP A;  3MTU E;  4HYT B;  3A7O A;  1GU4 A;  1IFD A;  1N7S C;  1GDT A;  1L0L K;  2NPS B;  3M0D C;  3GHG A;  1FAV A;  1ZN5 A;  2HLO A;  1N7S A;  4W7Y A;  1RE4 A;  1GL2 C;  1NTM K;  1IFI A;  4XE5 B;  4HH2 A;  3HE5 A;  3NFQ A;  1SQQ K;  1MUU A;  1N7L A;  5AVV B;  1NU1 K;  3BAT A;  1URQ A;  1JTH A;  1J1D C;  4DZO A;  4EIJ A;  1YYC A;  1SP4 A;  3HTK B;  3RL0 D;  3SWF A;  5CCG A;  1LTJ B;  2R5D A;  3TSI A;  3BRV B;  1PFI A;  1NWQ A;  2C9N Y;  3MD0 A;  3TNU A;  4N78 D;  2L5G B;  2A45 I;  3V5B A;  2OYH B;  1G1I A;  4IFM A;  1FZF A;  1NH4 A;  2QM7 A;  4XA4 A;  1NKN A;  2M8R A;  3VYI A;  1OXZ A;  1WT6 A;  2M3B A;  2YKO A;  1NO4 A;  3H6P A;  4DOJ A;  2HG5 D;  1L4A B;  1RE3 A;  2Z5H A;  2YKQ A;  5APT A;  5CJ4 A;  3HTK A;  5AVX B;  3HD7 C;  1LTI C;  1Z56 A;  1CW5 A;  3L4F A;  3OJA B;  3CL3 D;  3II6 A;  1FZB A;  5KLV K;  5AW7 B;  3EQ2 A;  5APU A;  3HE4 B;  2CPS A;  1RE4 C;  3RL0 B;  1G1J A;  1XTG B;  3GHG C;  1JCC A;  1SQP K;  4I2L C;  1URQ D;  3WMM 0;  1FJP A;  1KIL D;  2W6B A;  2GM4 A;  2Q3I A;  4C7N A;  4I1L A;  3VP9 A;  1LWU B;  1SQV K;  1FZG A;  3V4Q A;  2PP6 A;  4GIF A;  2Z4E A;  3V2N A;  1FZE A;  1JCD A;  1KQL A;  5KJ7 C;  3HD7 A;  3MUD A;  2XU6 A;  2WTY A;  3B5N D;  3OAK A;  2NPS D;  5CJ0 A;  3VN0 A;  4JF7 A;  2QM8 A;  1M7L A;  1J1E C;  1LTS C;  2N1T C;  2Q7C A;  5BVZ A;  4ZKU A;  1WRG A;  2IFN A;  4C7N B;  1RF1 C;  2N9B A;  3NXS A;  5AW8 B;  3HE4 A;  1RE3 C;  1M1J C;  4W80 A;  1T3U A;  1A02 F;  1LTJ A;  1J2J B;  2A45 H;  3TNU B;  2XDJ A;  1VDF A;  2WT7 A;  1JOC A;  3BVH A;  1X79 B;  3RK2 C;  3NMD A;  3A3Y B;  1JUN A;  2C9L Y;  2WIT A;  5CCG C;  4WY4 B;  1MV8 A;  1XTC C;  4WBA A;  5AW0 B;  1JY2 P;  4KHX A;  1GTW A;  3T97 A;  1FZC C;  3HE5 B;  1IK9 A;  5AVR B;  3KPE A;  2XNX A;  3NTN A;  1FU1 A;  3M0D A;  3V4W A;  2IPP A;  3OA7 A;  1AFO A;  1FZA A;  3RK3 B;  2J58 A;  2YNY A;  3HUS C;  3VP8 A;  2FFD C;  2OYI B;  3HUS A;  3V2R A;  1X9V A;  3O8Z A;  4LGD E;  5CMZ A;  4WY4 A;  1JMM A;  1IO4 A;  3A2A A;  1GW4 A;  5CCH D;  1CSB A;  1KZU B;  2OYI C;  1KIL C;  1LWU A;  1SVF A;  5AVQ B;  2JJL A;  4B86 A;  3RK3 C;  2KSJ A;  1S9K D;  3MGN A;  2HYN A;  3B5N B;  4Y99 B;  3PP5 A;  3U1C A;  5AVU B;  1JY2 N;  1FZC B;  1S9K E;  3M9H A;  1N2D C;  3B5N C;  4Y99 C;  3L36 A;  3B8E B;  2HOD B;  1HGV A;  1HGZ A;  4IFD K;  1KIL A;  3RK2 B;  1KIL B;  1N7S D;  3IR9 A;  1GL2 D;  1NTK K;  5AW5 B;  2YMY A;  3VTP C;  2H8P D;  1LTT C;  3H32 B;  1LGH B;  3N4X A;  2FFD B;  3HUS B;  1RF1 B;  2CPB A;  5AW9 B;  5KTB A;  2BAS A;  3RK2 D;  2VRS A;  3VOP A;  2ZXE B;  2N1T B;  5CCG D;  4ZKP A;  1IC2 A;  1T3J A;  4GKG A;  4GT1 A;  1HJB A;  5AVT B;  3L35 A;  4WY4 C;  1SFC D;  5APY A;  4N3Y B;  2J59 M;  1FDM A;  1N73 A;  2P1J A;  3E1I A;  1A02 J;  1HH0 A;  3P7K A;  5APS A;  1LTG C;  1HBW A;  2P2U A;  3M0A A;  2C0X A;  2O1J A;  1LT9 A;  1QL2 A;  3VMY A;  2FXM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...