2WPRA

Salmonella enterica sada 483-523 fused to gcn4 adaptors (sadak3b-v1, out-of-register fusion)
Total Genus 46
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
46
sequence length
97
structure length
97
Chain Sequence
IEDKIEEILSKIYHIENEIARIKKLIEKVDQNTADITTNTNSINQNTTDIATNTTNINNLSDSITTLMKQIEDKIEEILSKIYHIENEIARIKKLIK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Membrane protein
molecule keywords TRIMERIC AUTOTRANSPORTER ADHESIN FRAGMENT
publication title A Coiled-Coil Motif that Sequesters Ions to the Hydrophobic Core.
pubmed doi rcsb
source organism Salmonella enterica subsp. enterica serovar typhimurium
total genus 46
structure length 97
sequence length 97
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-08-09
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2wprA00
4C46A 1SLQA 3HE4A 4I2LC 4JYBA 4AQRD 2Q3IA 1HUCA 3P8MC 1HWTC 2VRSA 3L37A 4RESB 5AVRB 2XZRA 4B86A 2R5BA 2C9LY 2E43A 3LIEA 5AW1B 5AW7B 3M9BA 2QM8A 4DZOA 3A5TA 2KP8A 5AVYB 1X8YA 1S9KD 1GU5A 3V5BA 1GK6A 2Q7CA 1IO4A 5AW9B 3M0AA 1A02F 3VYIA 1MUUA 4GKGA 3B8EB 5AVZB 2WT7A 2Q5UA 3NFQA 4KHXA 1H8AA 1CI6B 2Z5IA 3HE5B 5AVVB 3M06A 1T2KD 2YO2A 1HBWA 3A7OA 1MV8A 5AVTB 2WTYA 1NWQA 2JJLA 3NXSA 3V4QA 4C7NA 3P7KA 2ZFCA 2H7HA 2ZXEB 3NMDA 1J2JB 5AW5B 1GZLA 1T2KC 4AUWA 3A2AA 3LIDA 3MD0A 5AW8B 3O8ZA 4GT1A 2WPQA 2XU6A 3VTPC 4HYTB 5AVXB 2R32A 4M3LA 3VMXA 5CMZA 5AW2B 3TYYA 3M9HA 3OAKA 4I6MC 5APXA 3SWFA 1GU4A 2C9NY 3HE5A 2YNYA 3V4WA 3M91A 5AW6B 3UIAA 3M0DA 5AVUB 1DH3A 3HTKA 1FAVA 5APVA 3VMYA 4AYCA 4EOTA 1OXZA 1S9KE 1HJBA 2W27A 2N9BA 5AVWB 5AW0B 3IR9A 1JNMA 1GK4A 2WPSA 2XV5A 2WT7B 3TNUB 2BASA 5AW4B 3L35A 3HE4B 5AW3B 3VMZA 5APYA 2IPPA 1H89A 2R5DA 1GD2E 2E42A 5APWA 3TK1A 3VN0A 1FOSE 4LC1A 3T97A 4C7NB 5AVQB 5APTA 2QM7A 1CSBA 3MGNA 1CI6A 2WWWA 3P32A 3A3YB 5APUA 4JYCA 2P7JA 3L36A 2R3CA 1G2CB 1KQLA 3KDPB 2WPRA 1OWAA 1NAFA 2YO3A 5APQA 2W6AA 5AVSB 1A02J 1GTWA 1H88A 1MFZA 3I5CA 2Z5HA 3NTNA 1SP4A 2P2UA 3KQGA 1CZQA 4XE5B 1FOSF 1YYCA 3TNUA 2P67A 1JUNA 5APSA
chains in the Genus database with same CATH superfamily
3ZDMA 1L0LK 4L76A 1KYOE 5KKZB 1SQQK 5KJ7A 1VQ8P 4HB1A 4WY4C 3H1HG 2FXMA 2Q7CA 1L0NE 3FWLA 2WT7A 2NPSB 1IFIA 1VQ6P 1N7SA 3CX5H 3P7KA 2ZXEB 1MKMA 3BRTB 1ZLLA 3LIDA 2OYHA 2OTLP 2KSEA 3GG2A 1QLED 1L4AB 3RK2D 5AVXB 2D2CB 3VMXA 1VQ9P 1EZVE 1NGMB 3CCJP 3WMM0 3H1IE 3L74G 4AYCA 3CX5D 2N9BA 4R4MA 5KJ7C 3VN0A 4W7ZA 2E5YA 1KB9E 1CSBA 1CI6A 1NO4A 2O01H 3A0HE 1TU3F 5APQA 4I7ZC 3HUSA 1X0TA 4H13C 2QEXP 1JY2P 5DJUB 1AA0A 1ZP0C 3L37A 1SQXD 1OW6A 1URQD 2LKMA 4H0LC 1GU5A 1LJ2A 4KJMA 2N1TA 1FDMA 1ZW0A 1N7LA 3TSIA 2FYUE 1IK9A 1PPJD 2WSFJ 3GHGB 2O1JA 3SFDC 2K1AA 4WBAA 3CL3D 1NTKG 1KILB 5M1BA 1AV1A 3PP5A 4D6TG 1Q82Q 3CXHI 1BCCD 3RGUA 3B5NA 1QEXA 3RBXA 2WSFH 4ZKPA 2Z4EA 5AW6B 1N73A 3HTKA 3HUSC 2KB7P 1S9KE 1LTGC 1JNMA 1VF5B 1LTJA 2KS1A 4O9BA 3H1JG 3CCSP 5APWA 2V4HA 4K3AA 3H1HE 1Q2NA 3KXDA 2AXTE 2E76B 3KHUA 2ZVNB 3RBZA 2N1TB 1L0LG 2H8PD 1J1EB 3Q5RA 1GTWA 1FDIA 3H32A 1SQQG 3D6ZA 3TNUA 5CCHA 1SQXK 3A0BE 2MJZA 5KAIH 1VQ7P 1OIPA 1M56D 3B5NC 3AECC 3L72G 1RF0A 4JPZB 1YTZT 5K5GB 1YJ9P 1SFCC 1X22A 3G4SP 3L74E 3NFQA 1Q7YQ 1NTZD 1LP1B 1T2KD 3BCCJ 1N73B 2WTYA 2SPZA 3GF7A 1OVRA 4PD4I 1FDOA 2W83C 1J2JB 1LTJC 4TT3H 1NKNA 1YJNP 4IFFA 1OMIA 2FKWB 2XU6A 2R44A 1JO5A 1BSNA 4UB6E 1VQLP 2BCCG 4I6MC 1EC5A 1PP9E 4Y99B 1SQPD 1YITP 3R2PA 1N8RQ 3D6YA 2D2CD 3GLMA 2IDBA 1HGZA 5AW0B 3FGAD 3TNUB 4N78D 1NU1G 1GL2B 3CCRP 2HLOA 4GOEA 1SQBD 1E79H 1XTGB 2A45G 1M1JA 2OYOA 3PH0A 4OWFA 2BEQD 1OVUA 5CHXA 1A02J 3L73D 2P2UA 1Z56A 3G9RA 2IZ0A 1SLQA 2WVRA 3MP7B 4HH2A 3P8MC 1NTKE 1LWUB 4D6TE 5L8RJ 5GTIE 4MN4C 2KI7B 2KP8A 3C9IA 4YXDC 1N7SD 1NTKJ 1NTZK 4D6TJ 3L70D 1JCCA 5B5EE 1NTMD 1M7LA 2Y0EA 2ZFCA 1FZBA 5KLIB 1GZLA 3KPEA 4GT1A 1S4XA 3AE7C 2FYNB 4L75A 1ZRTE 3OW2O 1OW8A 2B89A 2ZVOB 1FE6A 1KC8Q 1M1JC 1KILD 1SQPK 3RK2C 3P8CD 3H1JJ 3MZWB 1SQQE 5APVA 4DCKA 1HVVA 1P84E 2WITA 1UIIA 2XV5A 2W6JH 5B66H 4H44B 2YIUC 3BRVB 1L0LJ 1SQBK 1WMKA 1SQQJ 3CC4P 1VF5D 2JWAA 1VQPP 4JYCA 2R3CA 2O01N 1ZXGA 5AVSB 1VQKP 3CC2P 4C7RA 2E76D 4YXWH 2KNCA 4XE5B 2N1TD 2KXPB 2XNXA 3L72J 5EFWB 1VDFA 2VRSA 1PPJG 2FXOA 3CWBJ 2BCCE 1GK6A 3GW6A 4K35A 3KZIH 3AEBC 1RF1A 1IO4A 2YMKA 1URQC 1AVYA 5AW9B 3CCVP 2QJKC 2HR3A 5AVZB 3T97B 2V7QJ 1JY3O 2ZYDA 2JWDA 1NTMK 2M5AB 4PV1B 1LT9A 2BCCJ 1BCCG 1NU1E 2JP3A 3LW5H 3AEEC 3CCLP 1U57A 5TISH 3A2AA 3D71A 3MD0A 4JQ0D 1L2PA 3MHVA 1FJPA 5KLVJ 1KV4A 1CW5A 1T8ZA 3OAKA 1GDTA 1VPCA 5E79E 4PJ0H 3N7NA 3N4XA 4XFJA 1OXZA 5CJ4A 1VQ4P 3ITKA 2RN0A 2ZYGA 3V2NA 2JEEA 1AQ5A 2Y0CA 3CLQA 2L5GB 2IYOA 1LNQA 2HPCB 2NPSA 3G6EP 1EDKA 1KQGB 2LXCB 1RF1B 2IBZI 1IFJA 3B71A 1GL2D 2E74B 1OWAA 1JOCA 1H0TB 1R5SA 3TGUD 1VL2A 1L4AA 3R4YA 5KAFH 5BU5A 5KLVD 5GTHH 5CBOA 2R5BA 2I8DA 1FZAA 2B87B 4HKZH 1NTZG 2OYIB 3MUDC 1SQVK 2KSJA 3SWKA 2QSIA 1VQOP 2WZ7A 1MV8A 3L71J 2H7HA 4Y28J 5AW5B 2ZAEB 1T2KC 4AUWA 1SQPG 1K8AQ 2H88C 3VTPC 1ZV8A 3H1KD 1FC2C 2FFDA 4IFMA 5APXA 3VP9A 3SWFA 2M0BA 2RH0A 1W2BO 2Q3EA 1QVFO 2ITAA 2WQYC 1M90Q 1LTTC 3V2RA 1AVOA 1Y8AA 1SQBG 3ABVC 1MZ9A 4DJGA 3CX5I 2D2CC 3BCCG 2K9JB 1M1KQ 1PPJE 1SQXJ 1G1JA 3L73G 4H44D 4KT0J 2O01J 3GHGA 1IFDA 1FZGA 3L71D 2M3EA 3RK3E 1PGJA 1KILA 1KYOH 2QIWA 1BCCE 3L75D 5KLVK 2W90A 1HUCA 1ZMEC 2OQQA 1DEEG 3CXHE 1NTMG 1BCCJ 2FFDB 1A02F 1ZN5A 1IFPA 1N7SC 1KYOD 2K3RA 1PV3A 2KOGA 3M06A 2KIKA 3IFMA 2JJLA 2OYHC 1FU1A 3U1CA 1QL1A 1L0ND 2ZYAA 2KLUA 2BEZF 3C1LA 1K73Q 1HGVA 4HYTB 3CCQP 2CPSA 1GU4A 1WRGA 1SVFA 2ZT9C 4ASWA 4H0LB 3VMYA 3CCEP 3Q1MA 1J1DB 2BASA 4BRYB 5TJHA 1KB9H 4I1LA 1NTZE 1WT6A 2C0XA 2PFXA 1DD4A 3WUUA 2JDIH 3H1ID 1RHZB 1LP1A 3F5HA 3A0HH 3O6QB 3W67A 3IN6A 2FY8A 1KQLA 3KDPB 4OGQC 1VF5C 3IF4A 1M57D 1NTZJ 3II6A 2AEMA 1JY2N 2K37A 3I56P 2CK3H 3WU2E 1RQVA 2KLVA 2E74D 4PD4E 1KB9D 1VQNP 2GM4A 3H6PA 1SQPE 2C9LY 2XZRA 2WSEJ 2N1TC 1N2DC 5AVYB 1J1EC 3V5BA 1M8OB 2H43A 1EXIA 4GKGA 2Q1KA 1FS0E 3B8EB 4ZNCA 2GUSA 2LR2A 4NPFX 1SQPJ 1G1IA 4IL6E 4BXLA 1GL2A 3NXSA 2WSEH 3BCCE 2E75B 1L0NK 2Q6QA 3L73E 4UB8H 3HD7B 3K5BA 2QRXA 4M3LA 1SQBJ 3C8VA 5CMZA 2QG4A 3GMAA 1D7MA 1N73C 3CWBG 3HE5A 2N9YB 1JCDA 1LWUA 2WMMA 3L73J 3FX0A 2P1JA 2NPSD 1EXJA 4RJTA 3VMZA 1HH0A 1BE3D 1PGOA 2AXTH 1GD2E 2IZ1A 2J5UA 2O3JA 1HTLC 3TDKA 3OA7A 4JF7A 4Y99C 1Q81Q 5APTA 1NTME 2QM7A 3E7KA 3TGUG 2I1JA 1L4AD 3A3YB 2I1KA 5KLVG 4OH8B 4ASVA 4RKUJ 5CCHC 2IBZG 1LTSC 2HG5D 3L70J 1GL2C 1JUNA 5APSA 1NTMJ 2QA4P 1KN7A 3P8CE 3LIEA 3EQ2A 1RF0C 1VQ5P 1G2CA 4L74A 2XKMA 1FZFA 2KUBA 4TLFA 1PL5A 3HE5B 2W6BA 1LWUC 1KFMA 5AVVB 3V6IA 2YO2A 2M8RA 5AVTB 3H1KG 3QWOC 1KZUB 3SSUA 4UB6H 3AE6C 4N3YB 1Q86Q 5B66E 2ZXXA 3W68A 2C9NY 1IFMA 3MIWA 5KLIC 5AVUB 1DH3A 3E1RA 3H1JE 2DW3A 5AVWB 3IR9A 2WPSA 2IYPA 5AW4B 2PRRA 4H0LD 3L71G 1L0LE 3T97A 1PP9D 1JMBA 2WWWA 2IX7C 3L75G 2M5AA 5APUA 1G2CB 1SQVJ 4H44C 3OJAB 1YHQP 1MFZA 2Z5HA 3NTNA 3KZIE 1NKZB 1LT1A 2KZIA 2Q9IA 4WB4A 3S1KA 3PTZA 2YKOA 1U7JA 1YBKA 3HRNA 3L72E 5H2FH 3CD6P 1HJ0A 1GMJA 5TISE 1SQXG 3CWBE 3M0AA 2IFNA 2Q5UA 4NPDA 3VMAA 1L0NG 1YQ3C 1YIJP 3Q3DA 3A7OA 1JY2O 3EFGA 3LW5J 3JCUH 3NMDA 2HPCA 3SWYA 4QMAA 4GODA 2XNDH 1LTBC 5AW8B 2Y9YA 2P10A 1H0TA 3TGUE 3CI9A 1OX3A 1SQVD 2E75D 5KLVE 2QJPB 2IBZE 3PLNA 1BDCA 3HD7D 3CC7P 3AE8C 3B4SA 3H25A 1FZCA 3TGUJ 2B87A 2IFMA 1URQB 2OYIA 1K04A 3PRJA 3H1LJ 5CCGA 1LTIC 3CPWO 1FJKA 1JEKA 4C7NB 1U7MA 1KFNA 1IFNA 1XTCC 4GOFA 1HF9A 1H88A 1RE4A 2KK7A 3H1KE 2HYNA 3RL0B 1S1CX 3HE4A 3U59A 4HJGH 1VQMP 3RK3B 3G3ZA 2O1KA 5AW1B 2A06D 1RF1C 4DZOA 2E74C 1IJDB 3H1KJ 3D70A 4ZMDA 1LT9C 3H1LD 3MTUE 4EYYQ 1JMMA 1KQFB 2K9JA 1S2EA 1HBWA 1UIXA 1T3UA 3V4QA 2Y9ZA 3GF3A 1FZCB 2KZJA 1PGPA 2OYIC 1EQ7A 3CX5E 3L71E 1S5LH 3L75E 2K88A 3M9HA 1GW3A 5KKZC 2YNYA 1BE3G 1FAVA 2B88A 3L75J 3V2QA 3AEDC 3HE4B 3F89A 2QJYB 4U3FD 2PAJA 2C0WA 2AEJA 2NPSC 2J58A 4LC1A 1YJWP 3Q2YA 1SQXE 1BGYD 4WY4B 2OGUA 2YMYA 2HODA 1KORA 1L4AC 3I5CA 4YTPC 1FOSF 1DX7A 2OTKE 2W8ZA 1NHLA 5AVRB 1L0NJ 3A5TA 1K05A 1QGKB 1NAYA 3JSVC 3V2PA 1OFCX 4BRYA 4R4LA 1PZQA 1PGQA 1KYOI 3O6QA 1JTHB 2PP6A 3L70G 2FFDC 1NYHA 3Q5SA 4DT0A 4EDFA 3H1IJ 3TYYA 3U1AA 3CMAP 1R5LA 1NU1K 3TF5A 3M91A 4NPEA 4EOTA 2HODB 1PP9G 2WT7B 4I7ZB 4PV1D 2IPPA 4H13B 1N7SB 1AFOA 3GHGC 3BATA 2K9YA 1EZVI 1RH5B 3QH9A 1YI2P 2OYHB 2WPRA 1KILC 1J1DC 1JY3P 3FXEA 1QX8A 1EZVD 3WUTA 3HD7A 2G8YA 4JYBA 3CCUP 2L91A 1OW7A 4IOIH 3L4FA 4B86A 2E43A 1S5LX 3M9BA 2ZJSE 1R8EA 2ZT9B 1KB9I 3RL0D 3CXHH 3RK3D 2FYUJ 2P58A 5KAIE 4UB8E 1BE3E 1H8AA 1CI6B 1SFCA 2E76C 2GUVA 2JO1A 2QVAA 1NWQA 1SQVG 4Z1MH 4CPGA 1W2EA 4L73A 3HUSB 4OGQB 3CXHD 2M3BA 1BE3J 3KYQA 4N78E 2R32A 1K9MQ 4GIFA 1T6AA 1SQBE 2YXRB 5CCGD 3V4WA 2OARA 1DD3A 2E75C 1T3JA 1IZNB 1JY3N 2W27A 4W7YA 3HD7C 1BDDA 1RY3A 3L35A 1QL2A 5AW3B 3H1HJ 5APYA 1N86A 2FYUD 1H89A 3Q5PA 1FOSE 3CCMP 3E1IA 5AVQB 2UWJE 3P32A 4YPCA 2H89C 5CJ0A 3B5NB 2A06G 3WU2H 1CZQA 4PD4H 1USDA 5CBNA 4WY4D 1SFCB 2Q3IA 3L70E 4RESB 3HTKB 2E42A 1X8YA 3H1LG 1S9KD 1LTJB 2KS1B 1ZOYC 1FBMA 3L74J 1NH4A 3VYIA 1MUUA 3AE5C 2YKQA 4IL6H 2FXPA 3BASA 2WPVB 4PD4D 1QVGO 3H1HD 3A0BH 1KILE 3S4RA 1MFTA 3H32B 2AXCA 3CMEP 3O8ZA 1PP9J 1PIXA 2RKLA 2HFED 4RO0A 4LLHA 3VP8A 4LGDE 4U3FG 3AE1C 1SS1A 3UIAA 3BCCD 3M0DA 4OVNF 5KJ7D 1BGYG 2FYUK 2J59M 3TK1A 3L74D 3AEGC 1LTAC 1BSHA 2JKVA 3MGNA 3EWKA 2LXBA 2FBWC 1AQTA 4H13D 2G3AA 2YO3A 5H2FE 1RQUA 2FYNC 4N6JA 2B9BA 2OTJP 1KTMA 1SQVE 1YYCA 2P67A 4I2LC 2QE7H 2RMZA 2Y0DA 1ZR2A 2WSCJ 2R3SA 1EDLA 4GDOA 5AW7B 3I55P 1GW4A 1KMIZ 1LGHB 3JCUE 2PGDA 1IK7A 1Q90D 3S9OA 4EIJA 2ZT9D 1URQA 4KHXA 2Z5IA 3M0DC 3AE4C 5GTIH 1M1JB 2WSCH 3RK2B 3PHLA 4C7NA 2JR8A 1YTZI 3FWNA 1AJYA 2WPQA 4DOJA 1RE3A 3USSA 4W80A 2YIUB 5B5EH 1E5WA 2WSSH 4OGQD 1NTKD 5BVZA 5C39A 4A7PA 4D6TD 1OVVA 2CPBA 2A06E 1X9VA 4PJ0E 3RL0g 1DIPA 3AE3C 3SFEC 2R5DA 2QJPC 3H1LE 1S72P 3EFFK 4PV1C 4IL6X 1X79B 1EZVG 2P7JA 3L36A 3H1JD 1P84H 1USEA 1NAFA 4BWNA 2W6AA 3H1IG 5KTBA 2MKVA 4ZKUA 1ZRTD 3KQGA 2QJKB 1P84I 3AE9C 4C46A 3AEFC 2GA1A 4JBZA 1KD1Q 1L0LD 4AQRD 1EDIA 1HWTC 1ZR4A 5KAFE 1NOHA 3PJSK 1PFIA 3B5ND 1SQQD 2QM8A 1NVOA 3AEAC 5GTHE 1FZEA 1RE3C 1SFCD 1IC2A 1P84D 2FYZA 3IAOA 4XA4A 3RL0C 4U3FE 3MUDA 3AE2C 1EDJA 2V7QH 3RK3C 1NJIQ 1S5LE 1Y47A 1NU1J 4IFDK 2E5TA 1KQSO 3L72D 1BGYE 3M9QA 4U7JA 4WVZA 2KNCB 4U3FJ 3WUVA 1DEBA 4WY4A 3CWBD 2AEFA 1S3JA 3VOPA 5AW2B 1NTKK 2NRGA 1BGYJ 2NZ2A 2KYVA 5CCHD 2POHA 1FZCC 2FYUG 1JB0J 2YXQB 2YKPA 1HJBA 4EI2A 2BCCD 1GK4A 5CCGC 2A45H 1JM0A 5DJTB 3FXDA 5E79H 1OZHA 4WWIA 1LT9B 2A45I 2IBZD 3G71P 1W5CE 1NU1D 2XDJA 3JC22 1RE4C 3BVHA 5BU8B 1YQ4C 2QJYC 1JTHA 1SP4A 1Y9BA
chains in the Genus database with same CATH topology
2N1TD 2XNXA 1L0LK 3HD7A 4JYBA 1VDFA 3P8CE 2VRSA 3L4FA 4B86A 2E43A 3LIEA 1SQQK 5KJ7A 3M9BA 3EQ2A 4WY4C 3RL0D 1RF0C 2FXMA 3RK3D 1GK6A 2Q7CA 1RF1A 1G2CA 1IO4A 1URQC 2XKMA 5AW9B 1FZFA 5AVZB 2WT7A 1JY3O 1H8AA 1CI6B 3HE5B 2W6BA 2NPSB 1LWUC 1KFMA 5AVVB 1IFIA 1NTMK 2YO2A 1SFCA 2M8RA 5AVTB 2GUVA 1N7SA 1NWQA 1LT9A 3P7KA 2ZXEB 3LW5H 1W2EA 3HUSB 3A2AA 3BRTB 1KZUB 1ZLLA 3LIDA 3MD0A 2M3BA 2OYHA 4N3YB 3KYQA 1FJPA 1L4AB 3RK2D 1CW5A 4N78E 5AVXB 2R32A 3VMXA 1T8ZA 4GIFA 3OAKA 3WMM0 1GDTA 1VPCA 2C9NY 1IFMA 3MIWA 5CCGD 3V4WA 3N7NA 2OARA 5AVUB 3N4XA 1DH3A 1T3JA 4AYCA 1OXZA 1JY3N 5CJ4A 2W27A 2N9BA 5AVWB 3IR9A 4W7YA 2WPSA 3HD7C 1RY3A 5AW4B 3L35A 1QL2A 5AW3B 5APYA 1N86A 3V2NA 1H89A 2JEEA 5KJ7C 3VN0A 1FOSE 4W7ZA 1AQ5A 3CLQA 2L5GB 3T97A 3E1IA 5AVQB 2HPCB 1CSBA 1CI6A 2WWWA 3P32A 1NO4A 2IX7C 2NPSA 2O01H 5APUA 1RF1B 1G2CB 1IFJA 1GL2D 1OWAA 1JOCA 5APQA 5CJ0A 3OJAB 1MFZA 3HUSA 2Z5HA 3B5NB 3NTNA 1CZQA 1NKZB 2Q9IA 1L4AA 4WY4D 1JY2P 4WB4A 5BU5A 1SFCB 2Q3IA 3L37A 2YKOA 3HTKB 4RESB 2E42A 2R5BA 1FZAA 1URQD 3HRNA 2LKMA 1X8YA 1S9KD 1GU5A 2OYIB 1LTJB 2N1TA 1FBMA 1FDMA 3M0AA 1NH4A 1SQVK 3VYIA 1MUUA 1N7LA 2KSJA 3TSIA 1IK9A 2YKQA 2IFNA 2Q5UA 3BASA 2WZ7A 3GHGB 3A7OA 1MV8A 1JY2O 2O1JA 3EFGA 2H7HA 3NMDA 2HPCA 3SWYA 5AW5B 4WBAA 3H32B 3CL3D 1T2KC 4AUWA 1LTBC 5AW8B 1KILB 3O8ZA 3PP5A 3VTPC 1ZV8A 3CI9A 2FFDA 3B5NA 4IFMA 5APXA 3VP9A 3SWFA 2HFED 4LLHA 3VP8A 4LGDE 2WSFH 4ZKPA 2Z4EA 3HD7D 3UIAA 5AW6B 1N73A 3M0DA 3HTKA 1LTTC 2KB7P 3HUSC 3V2RA 1S9KE 1LTGC 1FZCA 5KJ7D 1JNMA 2IFMA 1MZ9A 1URQB 2OYIA 1LTJA 2FYUK 4O9BA 5CCGA 2J59M 5APWA 3TK1A 1LTIC 1G1JA 1FJKA 1LTAC 4C7NB 3MGNA 1KFNA 3GHGA 2N1TB 1IFDA 1IFNA 1XTCC 1FZGA 2H8PD 2YO3A 1J1EB 1GTWA 1H88A 4N6JA 3H32A 1RE4A 2HYNA 1KILA 3RL0B 1YYCA 3TNUA 2P67A 3HE4A 5CCHA 5KLVK 3U59A 4I2LC 3RK3B 1ZR2A 1HUCA 3G3ZA 1SQXK 2O1KA 5AW1B 5AW7B 2MJZA 1RF1C 1GW4A 4DZOA 1LGHB 1IJDB 3B5NC 2FFDB 1A02F 1RF0A 1ZN5A 1YTZT 4EIJA 1SFCC 1URQA 3NFQA 4KHXA 1N7SC 1LT9C 2Z5IA 3MTUE 3M0DC 1JMMA 2KOGA 3M06A 1T2KD 1HBWA 1M1JB 2WSCH 1N73B 3IFMA 3RK2B 2WTYA 2JJLA 1T3UA 3V4QA 4C7NA 2OYHC 1FU1A 1J2JB 2OYIC 1FZCB 1EQ7A 1LTJC 3U1CA 1NKNA 1YTZI 1QL1A 4IFFA 2WPQA 2FKWB 2XU6A 4DOJA 1RE3A 1HGVA 4HYTB 4W80A 1JO5A 2CPSA 3M9HA 4I6MC 1GU4A 1GW3A 1E5WA 5BVZA 4Y99B 3R2PA 1WRGA 2YNYA 2CPBA 1SVFA 1X9VA 1FAVA 3VMYA 1HGZA 5AW0B 3V2QA 1J1DB 3TNUB 2BASA 3HE4B 4N78D 1JUNA 2R5DA 4I1LA 2PAJA 2C0XA 1GL2B 1WT6A 2C0WA 2NPSC 2J58A 2HLOA 4LC1A 1XTGB 1X79B 2A45G 1M1JA 2P7JA 3L36A 4WY4B 1KQLA 3KDPB 1NAFA 2YMYA 5CHXA 2W6AA 1A02J 2HODA 1L4AC 3I5CA 5KTBA 4ZKUA 2P2UA 3II6A 3KQGA 1Z56A 1JY2N 1FOSF 4C46A 1SLQA 1DX7A 2KLVA 4HH2A 4AQRD 3P8MC 1NHLA 2GM4A 1HWTC 3H6PA 2C9LY 5AVRB 1LWUB 2XZRA 1ZR4A 1NOHA 1PFIA 3B5ND 2N1TC 2QM8A 1N2DC 3A5TA 2KP8A 1FZEA 1RE3C 5AVYB 1J1EC 1SFCD 1IC2A 3C9IA 3V5BA 1N7SD 2FYZA 2H43A 4XA4A 3V2PA 3RL0C 4GKGA 3MUDA 3B8EB 2GUSA 1NTZK 3RK3C 1G1IA 4IFDK 1JCCA 1GL2A 3NXSA 1M7LA 2WSEH 2ZFCA 3M9QA 1FZBA 1GZLA 1JTHB 3KPEA 1L0NK 2PP6A 2FFDC 4GT1A 1DEBA 4WY4A 3HD7B 3VOPA 4M3LA 5CMZA 5AW2B 3TYYA 3U1AA 1NTKK 1M1JC 1N73C 1KILD 1SQPK 3RK2C 3P8CD 2KYVA 3HE5A 5CCHD 1NU1K 2POHA 1FZCC 3M91A 1JCDA 1LWUA 5APVA 4EOTA 2HODB 2YKPA 1HJBA 1HVVA 1GK4A 5CCGC 2WITA 2XV5A 2P1JA 2NPSD 2WT7B 2A45H 3VMZA 3BRVB 2IPPA 1HH0A 1GD2E 1HTLC 1N7SB 1SQBK 3OA7A 1LT9B 4JF7A 4Y99C 1AFOA 3GHGC 2A45I 3BATA 2QM7A 5APTA 2I1JA 1L4AD 3A3YB 2I1KA 2OYHB 2XDJA 4JYCA 2R3CA 1RE4C 2WPRA 4OH8B 5BU8B 3BVHA 1KILC 5AVSB 1J1DC 5CCHC 1JY3P 1JTHA 1LTSC 4C7RA 1SP4A 2HG5D 4XE5B 1GL2C 5APSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C46 A;  1SLQ A;  3HE4 A;  4I2L C;  4JYB A;  4AQR D;  2Q3I A;  1HUC A;  3P8M C;  1HWT C;  2VRS A;  3L37 A;  4RES B;  5AVR B;  2XZR A;  4B86 A;  2R5B A;  2C9L Y;  2E43 A;  3LIE A;  5AW1 B;  5AW7 B;  3M9B A;  2QM8 A;  4DZO A;  3A5T A;  2KP8 A;  5AVY B;  1X8Y A;  1S9K D;  1GU5 A;  3V5B A;  1GK6 A;  2Q7C A;  1IO4 A;  5AW9 B;  3M0A A;  1A02 F;  3VYI A;  1MUU A;  4GKG A;  3B8E B;  5AVZ B;  2WT7 A;  2Q5U A;  3NFQ A;  4KHX A;  1H8A A;  1CI6 B;  2Z5I A;  3HE5 B;  5AVV B;  3M06 A;  1T2K D;  2YO2 A;  1HBW A;  3A7O A;  1MV8 A;  5AVT B;  2WTY A;  1NWQ A;  2JJL A;  3NXS A;  3V4Q A;  4C7N A;  3P7K A;  2ZFC A;  2H7H A;  2ZXE B;  3NMD A;  1J2J B;  5AW5 B;  1GZL A;  1T2K C;  4AUW A;  3A2A A;  3LID A;  3MD0 A;  5AW8 B;  3O8Z A;  4GT1 A;  2WPQ A;  2XU6 A;  3VTP C;  4HYT B;  5AVX B;  2R32 A;  4M3L A;  3VMX A;  5CMZ A;  5AW2 B;  3TYY A;  3M9H A;  3OAK A;  4I6M C;  5APX A;  3SWF A;  1GU4 A;  2C9N Y;  3HE5 A;  2YNY A;  3V4W A;  3M91 A;  5AW6 B;  3UIA A;  3M0D A;  5AVU B;  1DH3 A;  3HTK A;  1FAV A;  5APV A;  3VMY A;  4AYC A;  4EOT A;  1OXZ A;  1S9K E;  1HJB A;  2W27 A;  2N9B A;  5AVW B;  5AW0 B;  3IR9 A;  1JNM A;  1GK4 A;  2WPS A;  2XV5 A;  2WT7 B;  3TNU B;  2BAS A;  5AW4 B;  3L35 A;  3HE4 B;  5AW3 B;  3VMZ A;  5APY A;  2IPP A;  1H89 A;  2R5D A;  1GD2 E;  2E42 A;  5APW A;  3TK1 A;  3VN0 A;  1FOS E;  4LC1 A;  3T97 A;  4C7N B;  5AVQ B;  5APT A;  2QM7 A;  1CSB A;  3MGN A;  1CI6 A;  2WWW A;  3P32 A;  3A3Y B;  5APU A;  4JYC A;  2P7J A;  3L36 A;  2R3C A;  1G2C B;  1KQL A;  3KDP B;  2WPR A;  1OWA A;  1NAF A;  2YO3 A;  5APQ A;  2W6A A;  5AVS B;  1A02 J;  1GTW A;  1H88 A;  1MFZ A;  3I5C A;  2Z5H A;  3NTN A;  1SP4 A;  2P2U A;  3KQG A;  1CZQ A;  4XE5 B;  1FOS F;  1YYC A;  3TNU A;  2P67 A;  1JUN A;  5APS A; 
#chains in the Genus database with same CATH topology
 3ZDM A;  1L0L K;  4L76 A;  1KYO E;  5KKZ B;  1SQQ K;  5KJ7 A;  1VQ8 P;  4HB1 A;  4WY4 C;  3H1H G;  2FXM A;  2Q7C A;  1L0N E;  3FWL A;  2WT7 A;  2NPS B;  1IFI A;  1VQ6 P;  1N7S A;  3CX5 H;  3P7K A;  2ZXE B;  1MKM A;  3BRT B;  1ZLL A;  3LID A;  2OYH A;  2OTL P;  2KSE A;  3GG2 A;  1QLE D;  1L4A B;  3RK2 D;  5AVX B;  2D2C B;  3VMX A;  1VQ9 P;  1EZV E;  1NGM B;  3CCJ P;  3WMM 0;  3H1I E;  3L74 G;  4AYC A;  3CX5 D;  2N9B A;  4R4M A;  5KJ7 C;  3VN0 A;  4W7Z A;  2E5Y A;  1KB9 E;  1CSB A;  1CI6 A;  1NO4 A;  2O01 H;  3A0H E;  1TU3 F;  5APQ A;  4I7Z C;  3HUS A;  1X0T A;  4H13 C;  2QEX P;  1JY2 P;  5DJU B;  1AA0 A;  1ZP0 C;  3L37 A;  1SQX D;  1OW6 A;  1URQ D;  2LKM A;  4H0L C;  1GU5 A;  1LJ2 A;  4KJM A;  2N1T A;  1FDM A;  1ZW0 A;  1N7L A;  3TSI A;  2FYU E;  1IK9 A;  1PPJ D;  2WSF J;  3GHG B;  2O1J A;  3SFD C;  2K1A A;  4WBA A;  3CL3 D;  1NTK G;  1KIL B;  5M1B A;  1AV1 A;  3PP5 A;  4D6T G;  1Q82 Q;  3CXH I;  1BCC D;  3RGU A;  3B5N A;  1QEX A;  3RBX A;  2WSF H;  4ZKP A;  2Z4E A;  5AW6 B;  1N73 A;  3HTK A;  3HUS C;  2KB7 P;  1S9K E;  1LTG C;  1JNM A;  1VF5 B;  1LTJ A;  2KS1 A;  4O9B A;  3H1J G;  3CCS P;  5APW A;  2V4H A;  4K3A A;  3H1H E;  1Q2N A;  3KXD A;  2AXT E;  2E76 B;  3KHU A;  2ZVN B;  3RBZ A;  2N1T B;  1L0L G;  2H8P D;  1J1E B;  3Q5R A;  1GTW A;  1FDI A;  3H32 A;  1SQQ G;  3D6Z A;  3TNU A;  5CCH A;  1SQX K;  3A0B E;  2MJZ A;  5KAI H;  1VQ7 P;  1OIP A;  1M56 D;  3B5N C;  3AEC C;  3L72 G;  1RF0 A;  4JPZ B;  1YTZ T;  5K5G B;  1YJ9 P;  1SFC C;  1X22 A;  3G4S P;  3L74 E;  3NFQ A;  1Q7Y Q;  1NTZ D;  1LP1 B;  1T2K D;  3BCC J;  1N73 B;  2WTY A;  2SPZ A;  3GF7 A;  1OVR A;  4PD4 I;  1FDO A;  2W83 C;  1J2J B;  1LTJ C;  4TT3 H;  1NKN A;  1YJN P;  4IFF A;  1OMI A;  2FKW B;  2XU6 A;  2R44 A;  1JO5 A;  1BSN A;  4UB6 E;  1VQL P;  2BCC G;  4I6M C;  1EC5 A;  1PP9 E;  4Y99 B;  1SQP D;  1YIT P;  3R2P A;  1N8R Q;  3D6Y A;  2D2C D;  3GLM A;  2IDB A;  1HGZ A;  5AW0 B;  3FGA D;  3TNU B;  4N78 D;  1NU1 G;  1GL2 B;  3CCR P;  2HLO A;  4GOE A;  1SQB D;  1E79 H;  1XTG B;  2A45 G;  1M1J A;  2OYO A;  3PH0 A;  4OWF A;  2BEQ D;  1OVU A;  5CHX A;  1A02 J;  3L73 D;  2P2U A;  1Z56 A;  3G9R A;  2IZ0 A;  1SLQ A;  2WVR A;  3MP7 B;  4HH2 A;  3P8M C;  1NTK E;  1LWU B;  4D6T E;  5L8R J;  5GTI E;  4MN4 C;  2KI7 B;  2KP8 A;  3C9I A;  4YXD C;  1N7S D;  1NTK J;  1NTZ K;  4D6T J;  3L70 D;  1JCC A;  5B5E E;  1NTM D;  1M7L A;  2Y0E A;  2ZFC A;  1FZB A;  5KLI B;  1GZL A;  3KPE A;  4GT1 A;  1S4X A;  3AE7 C;  2FYN B;  4L75 A;  1ZRT E;  3OW2 O;  1OW8 A;  2B89 A;  2ZVO B;  1FE6 A;  1KC8 Q;  1M1J C;  1KIL D;  1SQP K;  3RK2 C;  3P8C D;  3H1J J;  3MZW B;  1SQQ E;  5APV A;  4DCK A;  1HVV A;  1P84 E;  2WIT A;  1UII A;  2XV5 A;  2W6J H;  5B66 H;  4H44 B;  2YIU C;  3BRV B;  1L0L J;  1SQB K;  1WMK A;  1SQQ J;  3CC4 P;  1VF5 D;  2JWA A;  1VQP P;  4JYC A;  2R3C A;  2O01 N;  1ZXG A;  5AVS B;  1VQK P;  3CC2 P;  4C7R A;  2E76 D;  4YXW H;  2KNC A;  4XE5 B;  2N1T D;  2KXP B;  2XNX A;  3L72 J;  5EFW B;  1VDF A;  2VRS A;  1PPJ G;  2FXO A;  3CWB J;  2BCC E;  1GK6 A;  3GW6 A;  4K35 A;  3KZI H;  3AEB C;  1RF1 A;  1IO4 A;  2YMK A;  1URQ C;  1AVY A;  5AW9 B;  3CCV P;  2QJK C;  2HR3 A;  5AVZ B;  3T97 B;  2V7Q J;  1JY3 O;  2ZYD A;  2JWD A;  1NTM K;  2M5A B;  4PV1 B;  1LT9 A;  2BCC J;  1BCC G;  1NU1 E;  2JP3 A;  3LW5 H;  3AEE C;  3CCL P;  1U57 A;  5TIS H;  3A2A A;  3D71 A;  3MD0 A;  4JQ0 D;  1L2P A;  3MHV A;  1FJP A;  5KLV J;  1KV4 A;  1CW5 A;  1T8Z A;  3OAK A;  1GDT A;  1VPC A;  5E79 E;  4PJ0 H;  3N7N A;  3N4X A;  4XFJ A;  1OXZ A;  5CJ4 A;  1VQ4 P;  3ITK A;  2RN0 A;  2ZYG A;  3V2N A;  2JEE A;  1AQ5 A;  2Y0C A;  3CLQ A;  2L5G B;  2IYO A;  1LNQ A;  2HPC B;  2NPS A;  3G6E P;  1EDK A;  1KQG B;  2LXC B;  1RF1 B;  2IBZ I;  1IFJ A;  3B71 A;  1GL2 D;  2E74 B;  1OWA A;  1JOC A;  1H0T B;  1R5S A;  3TGU D;  1VL2 A;  1L4A A;  3R4Y A;  5KAF H;  5BU5 A;  5KLV D;  5GTH H;  5CBO A;  2R5B A;  2I8D A;  1FZA A;  2B87 B;  4HKZ H;  1NTZ G;  2OYI B;  3MUD C;  1SQV K;  2KSJ A;  3SWK A;  2QSI A;  1VQO P;  2WZ7 A;  1MV8 A;  3L71 J;  2H7H A;  4Y28 J;  5AW5 B;  2ZAE B;  1T2K C;  4AUW A;  1SQP G;  1K8A Q;  2H88 C;  3VTP C;  1ZV8 A;  3H1K D;  1FC2 C;  2FFD A;  4IFM A;  5APX A;  3VP9 A;  3SWF A;  2M0B A;  2RH0 A;  1W2B O;  2Q3E A;  1QVF O;  2ITA A;  2WQY C;  1M90 Q;  1LTT C;  3V2R A;  1AVO A;  1Y8A A;  1SQB G;  3ABV C;  1MZ9 A;  4DJG A;  3CX5 I;  2D2C C;  3BCC G;  2K9J B;  1M1K Q;  1PPJ E;  1SQX J;  1G1J A;  3L73 G;  4H44 D;  4KT0 J;  2O01 J;  3GHG A;  1IFD A;  1FZG A;  3L71 D;  2M3E A;  3RK3 E;  1PGJ A;  1KIL A;  1KYO H;  2QIW A;  1BCC E;  3L75 D;  5KLV K;  2W90 A;  1HUC A;  1ZME C;  2OQQ A;  1DEE G;  3CXH E;  1NTM G;  1BCC J;  2FFD B;  1A02 F;  1ZN5 A;  1IFP A;  1N7S C;  1KYO D;  2K3R A;  1PV3 A;  2KOG A;  3M06 A;  2KIK A;  3IFM A;  2JJL A;  2OYH C;  1FU1 A;  3U1C A;  1QL1 A;  1L0N D;  2ZYA A;  2KLU A;  2BEZ F;  3C1L A;  1K73 Q;  1HGV A;  4HYT B;  3CCQ P;  2CPS A;  1GU4 A;  1WRG A;  1SVF A;  2ZT9 C;  4ASW A;  4H0L B;  3VMY A;  3CCE P;  3Q1M A;  1J1D B;  2BAS A;  4BRY B;  5TJH A;  1KB9 H;  4I1L A;  1NTZ E;  1WT6 A;  2C0X A;  2PFX A;  1DD4 A;  3WUU A;  2JDI H;  3H1I D;  1RHZ B;  1LP1 A;  3F5H A;  3A0H H;  3O6Q B;  3W67 A;  3IN6 A;  2FY8 A;  1KQL A;  3KDP B;  4OGQ C;  1VF5 C;  3IF4 A;  1M57 D;  1NTZ J;  3II6 A;  2AEM A;  1JY2 N;  2K37 A;  3I56 P;  2CK3 H;  3WU2 E;  1RQV A;  2KLV A;  2E74 D;  4PD4 E;  1KB9 D;  1VQN P;  2GM4 A;  3H6P A;  1SQP E;  2C9L Y;  2XZR A;  2WSE J;  2N1T C;  1N2D C;  5AVY B;  1J1E C;  3V5B A;  1M8O B;  2H43 A;  1EXI A;  4GKG A;  2Q1K A;  1FS0 E;  3B8E B;  4ZNC A;  2GUS A;  2LR2 A;  4NPF X;  1SQP J;  1G1I A;  4IL6 E;  4BXL A;  1GL2 A;  3NXS A;  2WSE H;  3BCC E;  2E75 B;  1L0N K;  2Q6Q A;  3L73 E;  4UB8 H;  3HD7 B;  3K5B A;  2QRX A;  4M3L A;  1SQB J;  3C8V A;  5CMZ A;  2QG4 A;  3GMA A;  1D7M A;  1N73 C;  3CWB G;  3HE5 A;  2N9Y B;  1JCD A;  1LWU A;  2WMM A;  3L73 J;  3FX0 A;  2P1J A;  2NPS D;  1EXJ A;  4RJT A;  3VMZ A;  1HH0 A;  1BE3 D;  1PGO A;  2AXT H;  1GD2 E;  2IZ1 A;  2J5U A;  2O3J A;  1HTL C;  3TDK A;  3OA7 A;  4JF7 A;  4Y99 C;  1Q81 Q;  5APT A;  1NTM E;  2QM7 A;  3E7K A;  3TGU G;  2I1J A;  1L4A D;  3A3Y B;  2I1K A;  5KLV G;  4OH8 B;  4ASV A;  4RKU J;  5CCH C;  2IBZ G;  1LTS C;  2HG5 D;  3L70 J;  1GL2 C;  1JUN A;  5APS A;  1NTM J;  2QA4 P;  1KN7 A;  3P8C E;  3LIE A;  3EQ2 A;  1RF0 C;  1VQ5 P;  1G2C A;  4L74 A;  2XKM A;  1FZF A;  2KUB A;  4TLF A;  1PL5 A;  3HE5 B;  2W6B A;  1LWU C;  1KFM A;  5AVV B;  3V6I A;  2YO2 A;  2M8R A;  5AVT B;  3H1K G;  3QWO C;  1KZU B;  3SSU A;  4UB6 H;  3AE6 C;  4N3Y B;  1Q86 Q;  5B66 E;  2ZXX A;  3W68 A;  2C9N Y;  1IFM A;  3MIW A;  5KLI C;  5AVU B;  1DH3 A;  3E1R A;  3H1J E;  2DW3 A;  5AVW B;  3IR9 A;  2WPS A;  2IYP A;  5AW4 B;  2PRR A;  4H0L D;  3L71 G;  1L0L E;  3T97 A;  1PP9 D;  1JMB A;  2WWW A;  2IX7 C;  3L75 G;  2M5A A;  5APU A;  1G2C B;  1SQV J;  4H44 C;  3OJA B;  1YHQ P;  1MFZ A;  2Z5H A;  3NTN A;  3KZI E;  1NKZ B;  1LT1 A;  2KZI A;  2Q9I A;  4WB4 A;  3S1K A;  3PTZ A;  2YKO A;  1U7J A;  1YBK A;  3HRN A;  3L72 E;  5H2F H;  3CD6 P;  1HJ0 A;  1GMJ A;  5TIS E;  1SQX G;  3CWB E;  3M0A A;  2IFN A;  2Q5U A;  4NPD A;  3VMA A;  1L0N G;  1YQ3 C;  1YIJ P;  3Q3D A;  3A7O A;  1JY2 O;  3EFG A;  3LW5 J;  3JCU H;  3NMD A;  2HPC A;  3SWY A;  4QMA A;  4GOD A;  2XND H;  1LTB C;  5AW8 B;  2Y9Y A;  2P10 A;  1H0T A;  3TGU E;  3CI9 A;  1OX3 A;  1SQV D;  2E75 D;  5KLV E;  2QJP B;  2IBZ E;  3PLN A;  1BDC A;  3HD7 D;  3CC7 P;  3AE8 C;  3B4S A;  3H25 A;  1FZC A;  3TGU J;  2B87 A;  2IFM A;  1URQ B;  2OYI A;  1K04 A;  3PRJ A;  3H1L J;  5CCG A;  1LTI C;  3CPW O;  1FJK A;  1JEK A;  4C7N B;  1U7M A;  1KFN A;  1IFN A;  1XTC C;  4GOF A;  1HF9 A;  1H88 A;  1RE4 A;  2KK7 A;  3H1K E;  2HYN A;  3RL0 B;  1S1C X;  3HE4 A;  3U59 A;  4HJG H;  1VQM P;  3RK3 B;  3G3Z A;  2O1K A;  5AW1 B;  2A06 D;  1RF1 C;  4DZO A;  2E74 C;  1IJD B;  3H1K J;  3D70 A;  4ZMD A;  1LT9 C;  3H1L D;  3MTU E;  4EYY Q;  1JMM A;  1KQF B;  2K9J A;  1S2E A;  1HBW A;  1UIX A;  1T3U A;  3V4Q A;  2Y9Z A;  3GF3 A;  1FZC B;  2KZJ A;  1PGP A;  2OYI C;  1EQ7 A;  3CX5 E;  3L71 E;  1S5L H;  3L75 E;  2K88 A;  3M9H A;  1GW3 A;  5KKZ C;  2YNY A;  1BE3 G;  1FAV A;  2B88 A;  3L75 J;  3V2Q A;  3AED C;  3HE4 B;  3F89 A;  2QJY B;  4U3F D;  2PAJ A;  2C0W A;  2AEJ A;  2NPS C;  2J58 A;  4LC1 A;  1YJW P;  3Q2Y A;  1SQX E;  1BGY D;  4WY4 B;  2OGU A;  2YMY A;  2HOD A;  1KOR A;  1L4A C;  3I5C A;  4YTP C;  1FOS F;  1DX7 A;  2OTK E;  2W8Z A;  1NHL A;  5AVR B;  1L0N J;  3A5T A;  1K05 A;  1QGK B;  1NAY A;  3JSV C;  3V2P A;  1OFC X;  4BRY A;  4R4L A;  1PZQ A;  1PGQ A;  1KYO I;  3O6Q A;  1JTH B;  2PP6 A;  3L70 G;  2FFD C;  1NYH A;  3Q5S A;  4DT0 A;  4EDF A;  3H1I J;  3TYY A;  3U1A A;  3CMA P;  1R5L A;  1NU1 K;  3TF5 A;  3M91 A;  4NPE A;  4EOT A;  2HOD B;  1PP9 G;  2WT7 B;  4I7Z B;  4PV1 D;  2IPP A;  4H13 B;  1N7S B;  1AFO A;  3GHG C;  3BAT A;  2K9Y A;  1EZV I;  1RH5 B;  3QH9 A;  1YI2 P;  2OYH B;  2WPR A;  1KIL C;  1J1D C;  1JY3 P;  3FXE A;  1QX8 A;  1EZV D;  3WUT A;  3HD7 A;  2G8Y A;  4JYB A;  3CCU P;  2L91 A;  1OW7 A;  4IOI H;  3L4F A;  4B86 A;  2E43 A;  1S5L X;  3M9B A;  2ZJS E;  1R8E A;  2ZT9 B;  1KB9 I;  3RL0 D;  3CXH H;  3RK3 D;  2FYU J;  2P58 A;  5KAI E;  4UB8 E;  1BE3 E;  1H8A A;  1CI6 B;  1SFC A;  2E76 C;  2GUV A;  2JO1 A;  2QVA A;  1NWQ A;  1SQV G;  4Z1M H;  4CPG A;  1W2E A;  4L73 A;  3HUS B;  4OGQ B;  3CXH D;  2M3B A;  1BE3 J;  3KYQ A;  4N78 E;  2R32 A;  1K9M Q;  4GIF A;  1T6A A;  1SQB E;  2YXR B;  5CCG D;  3V4W A;  2OAR A;  1DD3 A;  2E75 C;  1T3J A;  1IZN B;  1JY3 N;  2W27 A;  4W7Y A;  3HD7 C;  1BDD A;  1RY3 A;  3L35 A;  1QL2 A;  5AW3 B;  3H1H J;  5APY A;  1N86 A;  2FYU D;  1H89 A;  3Q5P A;  1FOS E;  3CCM P;  3E1I A;  5AVQ B;  2UWJ E;  3P32 A;  4YPC A;  2H89 C;  5CJ0 A;  3B5N B;  2A06 G;  3WU2 H;  1CZQ A;  4PD4 H;  1USD A;  5CBN A;  4WY4 D;  1SFC B;  2Q3I A;  3L70 E;  4RES B;  3HTK B;  2E42 A;  1X8Y A;  3H1L G;  1S9K D;  1LTJ B;  2KS1 B;  1ZOY C;  1FBM A;  3L74 J;  1NH4 A;  3VYI A;  1MUU A;  3AE5 C;  2YKQ A;  4IL6 H;  2FXP A;  3BAS A;  2WPV B;  4PD4 D;  1QVG O;  3H1H D;  3A0B H;  1KIL E;  3S4R A;  1MFT A;  3H32 B;  2AXC A;  3CME P;  3O8Z A;  1PP9 J;  1PIX A;  2RKL A;  2HFE D;  4RO0 A;  4LLH A;  3VP8 A;  4LGD E;  4U3F G;  3AE1 C;  1SS1 A;  3UIA A;  3BCC D;  3M0D A;  4OVN F;  5KJ7 D;  1BGY G;  2FYU K;  2J59 M;  3TK1 A;  3L74 D;  3AEG C;  1LTA C;  1BSH A;  2JKV A;  3MGN A;  3EWK A;  2LXB A;  2FBW C;  1AQT A;  4H13 D;  2G3A A;  2YO3 A;  5H2F E;  1RQU A;  2FYN C;  4N6J A;  2B9B A;  2OTJ P;  1KTM A;  1SQV E;  1YYC A;  2P67 A;  4I2L C;  2QE7 H;  2RMZ A;  2Y0D A;  1ZR2 A;  2WSC J;  2R3S A;  1EDL A;  4GDO A;  5AW7 B;  3I55 P;  1GW4 A;  1KMI Z;  1LGH B;  3JCU E;  2PGD A;  1IK7 A;  1Q90 D;  3S9O A;  4EIJ A;  2ZT9 D;  1URQ A;  4KHX A;  2Z5I A;  3M0D C;  3AE4 C;  5GTI H;  1M1J B;  2WSC H;  3RK2 B;  3PHL A;  4C7N A;  2JR8 A;  1YTZ I;  3FWN A;  1AJY A;  2WPQ A;  4DOJ A;  1RE3 A;  3USS A;  4W80 A;  2YIU B;  5B5E H;  1E5W A;  2WSS H;  4OGQ D;  1NTK D;  5BVZ A;  5C39 A;  4A7P A;  4D6T D;  1OVV A;  2CPB A;  2A06 E;  1X9V A;  4PJ0 E;  3RL0 g;  1DIP A;  3AE3 C;  3SFE C;  2R5D A;  2QJP C;  3H1L E;  1S72 P;  3EFF K;  4PV1 C;  4IL6 X;  1X79 B;  1EZV G;  2P7J A;  3L36 A;  3H1J D;  1P84 H;  1USE A;  1NAF A;  4BWN A;  2W6A A;  3H1I G;  5KTB A;  2MKV A;  4ZKU A;  1ZRT D;  3KQG A;  2QJK B;  1P84 I;  3AE9 C;  4C46 A;  3AEF C;  2GA1 A;  4JBZ A;  1KD1 Q;  1L0L D;  4AQR D;  1EDI A;  1HWT C;  1ZR4 A;  5KAF E;  1NOH A;  3PJS K;  1PFI A;  3B5N D;  1SQQ D;  2QM8 A;  1NVO A;  3AEA C;  5GTH E;  1FZE A;  1RE3 C;  1SFC D;  1IC2 A;  1P84 D;  2FYZ A;  3IAO A;  4XA4 A;  3RL0 C;  4U3F E;  3MUD A;  3AE2 C;  1EDJ A;  2V7Q H;  3RK3 C;  1NJI Q;  1S5L E;  1Y47 A;  1NU1 J;  4IFD K;  2E5T A;  1KQS O;  3L72 D;  1BGY E;  3M9Q A;  4U7J A;  4WVZ A;  2KNC B;  4U3F J;  3WUV A;  1DEB A;  4WY4 A;  3CWB D;  2AEF A;  1S3J A;  3VOP A;  5AW2 B;  1NTK K;  2NRG A;  1BGY J;  2NZ2 A;  2KYV A;  5CCH D;  2POH A;  1FZC C;  2FYU G;  1JB0 J;  2YXQ B;  2YKP A;  1HJB A;  4EI2 A;  2BCC D;  1GK4 A;  5CCG C;  2A45 H;  1JM0 A;  5DJT B;  3FXD A;  5E79 H;  1OZH A;  4WWI A;  1LT9 B;  2A45 I;  2IBZ D;  3G71 P;  1W5C E;  1NU1 D;  2XDJ A;  3JC2 2;  1RE4 C;  3BVH A;  5BU8 B;  1YQ4 C;  2QJY C;  1JTH A;  1SP4 A;  1Y9B A; 
#chains in the Genus database with same CATH homology
 2N1T D;  2XNX A;  1L0L K;  3HD7 A;  4JYB A;  1VDF A;  3P8C E;  2VRS A;  3L4F A;  4B86 A;  2E43 A;  3LIE A;  1SQQ K;  5KJ7 A;  3M9B A;  3EQ2 A;  4WY4 C;  3RL0 D;  1RF0 C;  2FXM A;  3RK3 D;  1GK6 A;  2Q7C A;  1RF1 A;  1G2C A;  1IO4 A;  1URQ C;  2XKM A;  5AW9 B;  1FZF A;  5AVZ B;  2WT7 A;  1JY3 O;  1H8A A;  1CI6 B;  3HE5 B;  2W6B A;  2NPS B;  1LWU C;  1KFM A;  5AVV B;  1IFI A;  1NTM K;  2YO2 A;  1SFC A;  2M8R A;  5AVT B;  2GUV A;  1N7S A;  1NWQ A;  1LT9 A;  3P7K A;  2ZXE B;  3LW5 H;  1W2E A;  3HUS B;  3A2A A;  3BRT B;  1KZU B;  1ZLL A;  3LID A;  3MD0 A;  2M3B A;  2OYH A;  4N3Y B;  3KYQ A;  1FJP A;  1L4A B;  3RK2 D;  1CW5 A;  4N78 E;  5AVX B;  2R32 A;  3VMX A;  1T8Z A;  4GIF A;  3OAK A;  3WMM 0;  1GDT A;  1VPC A;  2C9N Y;  1IFM A;  3MIW A;  5CCG D;  3V4W A;  3N7N A;  2OAR A;  5AVU B;  3N4X A;  1DH3 A;  1T3J A;  4AYC A;  1OXZ A;  1JY3 N;  5CJ4 A;  2W27 A;  2N9B A;  5AVW B;  3IR9 A;  4W7Y A;  2WPS A;  3HD7 C;  1RY3 A;  5AW4 B;  3L35 A;  1QL2 A;  5AW3 B;  5APY A;  1N86 A;  3V2N A;  1H89 A;  2JEE A;  5KJ7 C;  3VN0 A;  1FOS E;  4W7Z A;  1AQ5 A;  3CLQ A;  2L5G B;  3T97 A;  3E1I A;  5AVQ B;  2HPC B;  1CSB A;  1CI6 A;  2WWW A;  3P32 A;  1NO4 A;  2IX7 C;  2NPS A;  2O01 H;  5APU A;  1RF1 B;  1G2C B;  1IFJ A;  1GL2 D;  1OWA A;  1JOC A;  5APQ A;  5CJ0 A;  3OJA B;  1MFZ A;  3HUS A;  2Z5H A;  3B5N B;  3NTN A;  1CZQ A;  1NKZ B;  2Q9I A;  1L4A A;  4WY4 D;  1JY2 P;  4WB4 A;  5BU5 A;  1SFC B;  2Q3I A;  3L37 A;  2YKO A;  3HTK B;  4RES B;  2E42 A;  2R5B A;  1FZA A;  1URQ D;  3HRN A;  2LKM A;  1X8Y A;  1S9K D;  1GU5 A;  2OYI B;  1LTJ B;  2N1T A;  1FBM A;  1FDM A;  3M0A A;  1NH4 A;  1SQV K;  3VYI A;  1MUU A;  1N7L A;  2KSJ A;  3TSI A;  1IK9 A;  2YKQ A;  2IFN A;  2Q5U A;  3BAS A;  2WZ7 A;  3GHG B;  3A7O A;  1MV8 A;  1JY2 O;  2O1J A;  3EFG A;  2H7H A;  3NMD A;  2HPC A;  3SWY A;  5AW5 B;  4WBA A;  3H32 B;  3CL3 D;  1T2K C;  4AUW A;  1LTB C;  5AW8 B;  1KIL B;  3O8Z A;  3PP5 A;  3VTP C;  1ZV8 A;  3CI9 A;  2FFD A;  3B5N A;  4IFM A;  5APX A;  3VP9 A;  3SWF A;  2HFE D;  4LLH A;  3VP8 A;  4LGD E;  2WSF H;  4ZKP A;  2Z4E A;  3HD7 D;  3UIA A;  5AW6 B;  1N73 A;  3M0D A;  3HTK A;  1LTT C;  2KB7 P;  3HUS C;  3V2R A;  1S9K E;  1LTG C;  1FZC A;  5KJ7 D;  1JNM A;  2IFM A;  1MZ9 A;  1URQ B;  2OYI A;  1LTJ A;  2FYU K;  4O9B A;  5CCG A;  2J59 M;  5APW A;  3TK1 A;  1LTI C;  1G1J A;  1FJK A;  1LTA C;  4C7N B;  3MGN A;  1KFN A;  3GHG A;  2N1T B;  1IFD A;  1IFN A;  1XTC C;  1FZG A;  2H8P D;  2YO3 A;  1J1E B;  1GTW A;  1H88 A;  4N6J A;  3H32 A;  1RE4 A;  2HYN A;  1KIL A;  3RL0 B;  1YYC A;  3TNU A;  2P67 A;  3HE4 A;  5CCH A;  5KLV K;  3U59 A;  4I2L C;  3RK3 B;  1ZR2 A;  1HUC A;  3G3Z A;  1SQX K;  2O1K A;  5AW1 B;  5AW7 B;  2MJZ A;  1RF1 C;  1GW4 A;  4DZO A;  1LGH B;  1IJD B;  3B5N C;  2FFD B;  1A02 F;  1RF0 A;  1ZN5 A;  1YTZ T;  4EIJ A;  1SFC C;  1URQ A;  3NFQ A;  4KHX A;  1N7S C;  1LT9 C;  2Z5I A;  3MTU E;  3M0D C;  1JMM A;  2KOG A;  3M06 A;  1T2K D;  1HBW A;  1M1J B;  2WSC H;  1N73 B;  3IFM A;  3RK2 B;  2WTY A;  2JJL A;  1T3U A;  3V4Q A;  4C7N A;  2OYH C;  1FU1 A;  1J2J B;  2OYI C;  1FZC B;  1EQ7 A;  1LTJ C;  3U1C A;  1NKN A;  1YTZ I;  1QL1 A;  4IFF A;  2WPQ A;  2FKW B;  2XU6 A;  4DOJ A;  1RE3 A;  1HGV A;  4HYT B;  4W80 A;  1JO5 A;  2CPS A;  3M9H A;  4I6M C;  1GU4 A;  1GW3 A;  1E5W A;  5BVZ A;  4Y99 B;  3R2P A;  1WRG A;  2YNY A;  2CPB A;  1SVF A;  1X9V A;  1FAV A;  3VMY A;  1HGZ A;  5AW0 B;  3V2Q A;  1J1D B;  3TNU B;  2BAS A;  3HE4 B;  4N78 D;  1JUN A;  2R5D A;  4I1L A;  2PAJ A;  2C0X A;  1GL2 B;  1WT6 A;  2C0W A;  2NPS C;  2J58 A;  2HLO A;  4LC1 A;  1XTG B;  1X79 B;  2A45 G;  1M1J A;  2P7J A;  3L36 A;  4WY4 B;  1KQL A;  3KDP B;  1NAF A;  2YMY A;  5CHX A;  2W6A A;  1A02 J;  2HOD A;  1L4A C;  3I5C A;  5KTB A;  4ZKU A;  2P2U A;  3II6 A;  3KQG A;  1Z56 A;  1JY2 N;  1FOS F;  4C46 A;  1SLQ A;  1DX7 A;  2KLV A;  4HH2 A;  4AQR D;  3P8M C;  1NHL A;  2GM4 A;  1HWT C;  3H6P A;  2C9L Y;  5AVR B;  1LWU B;  2XZR A;  1ZR4 A;  1NOH A;  1PFI A;  3B5N D;  2N1T C;  2QM8 A;  1N2D C;  3A5T A;  2KP8 A;  1FZE A;  1RE3 C;  5AVY B;  1J1E C;  1SFC D;  1IC2 A;  3C9I A;  3V5B A;  1N7S D;  2FYZ A;  2H43 A;  4XA4 A;  3V2P A;  3RL0 C;  4GKG A;  3MUD A;  3B8E B;  2GUS A;  1NTZ K;  3RK3 C;  1G1I A;  4IFD K;  1JCC A;  1GL2 A;  3NXS A;  1M7L A;  2WSE H;  2ZFC A;  3M9Q A;  1FZB A;  1GZL A;  1JTH B;  3KPE A;  1L0N K;  2PP6 A;  2FFD C;  4GT1 A;  1DEB A;  4WY4 A;  3HD7 B;  3VOP A;  4M3L A;  5CMZ A;  5AW2 B;  3TYY A;  3U1A A;  1NTK K;  1M1J C;  1N73 C;  1KIL D;  1SQP K;  3RK2 C;  3P8C D;  2KYV A;  3HE5 A;  5CCH D;  1NU1 K;  2POH A;  1FZC C;  3M91 A;  1JCD A;  1LWU A;  5APV A;  4EOT A;  2HOD B;  2YKP A;  1HJB A;  1HVV A;  1GK4 A;  5CCG C;  2WIT A;  2XV5 A;  2P1J A;  2NPS D;  2WT7 B;  2A45 H;  3VMZ A;  3BRV B;  2IPP A;  1HH0 A;  1GD2 E;  1HTL C;  1N7S B;  1SQB K;  3OA7 A;  1LT9 B;  4JF7 A;  4Y99 C;  1AFO A;  3GHG C;  2A45 I;  3BAT A;  2QM7 A;  5APT A;  2I1J A;  1L4A D;  3A3Y B;  2I1K A;  2OYH B;  2XDJ A;  4JYC A;  2R3C A;  1RE4 C;  2WPR A;  4OH8 B;  5BU8 B;  3BVH A;  1KIL C;  5AVS B;  1J1D C;  5CCH C;  1JY3 P;  1JTH A;  1LTS C;  4C7R A;  1SP4 A;  2HG5 D;  4XE5 B;  1GL2 C;  5APS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...