1N86A

Crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
b'IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrin alpha/alpha-E chain
molecule tags Blood clotting
publication title The crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface.
pubmed doi rcsb
total genus 21
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n86A00
3H32A 2OYHA 1JY2P 1LT9A 1RF0C 2OYIA 1FZCC 2A45I 1LT9B 3HUSC 2FFDC 1RF1C 1FZBA 2HLOA 1LTJC 1RE3C 2HPCB 1T3UA 2HPCA 2OYIB 1M1JC 1RF1A 3HUSA 2FFDA 1RF0A 1FZCA 1M1JA 2XNXA 1LT9C 1M1JB 1N86A 3H32B 3HUSB 2Z4EA 2FFDB 2OYHC 1LTJB 1LTJA 1RE3A 2H43A 1JY3P 1W2EA 2OYHB 2A45G 2HODA 2OYIC 2HODB 1N73C 1JY3N 1JY2N 2A45H 1LWUA 3E1IA 1FZAA 1LWUB 3BVHA 1RE4A 1FZEA 1RE4C 1FZGA 1LWUC 3GHGB 1FZFA 1FZCB 3GHGA 1N73A 1JY3O 2Q9IA 1RF1B 1JY2O 3GHGC 1N73B
chains in the Genus database with same CATH superfamily
1IC2A 3B4SA 1GW3A 2KSEA 4I6MC 5B66E 1Q81Q 1HUCA 4AUWA 2AXTH 3HTKB 3CCUP 4OGQD 1S9KD 5E79H 3OW2O 1LT9B 3CCMP 1KMIZ 5AW4B 2KB7P 4RJTA 2HLOA 2KLVA 3BASA 2KI7B 1KQFB 1ZOYC 2K88A 1FDOA 1R8EA 1KILA 2KSJA 5CCGC 4PV1B 4TLFA 1NAFA 1T3JA 2YMKA 3M9BA 1SQPD 3AE7C 1HTLC 4D6TJ 5AW6B 2MKVA 1JY3P 3N4XA 1Q7YQ 1EC5A 1BE3D 5TJHA 1JY3N 1W2BO 1K73Q 2B88A 3E1IA 1VPCA 3C8VA 3HD7B 3VMXA 1FZEA 1YJWP 4PD4I 3D70A 5AW1B 3VMAA 1N73A 1JY3O 1CI6A 4ASWA 3HE5A 5AVTB 3VTPC 2M3BA 1ZW0A 1L0ND 3EQ2A 1FZCC 4WB4A 4LC1A 4XA4A 2NPSD 1FZBA 3SFEC 2QA4P 2HPCB 3WUTA 3L71J 2BCCJ 4GT1A 2AEJA 4A7PA 3O8ZA 1ZRTD 4L75A 5KAFE 5H2FE 2BCCG 1NGMB 3AEBC 1LT9C 2MJZA 3MUDC 1EZVE 4XE5B 4NPDA 2ZJSE 2OTLP 1DX7A 2KOGA 1G2CA 1S5LX 5AW8B 2H43A 1W2EA 4WBAA 2Q7CA 3R2PA 1SVFA 1CZQA 5AVRB 1FC2C 4D6TD 3H1IJ 2PRRA 2L91A 2QEXP 2RN0A 2P10A 1ZRTE 3AEAC 1L2PA 3AE5C 2YNYA 1RHZB 2C0XA 2YKQA 3SWFA 2PGDA 1IJDB 3AE2C 1SQXE 3H1LJ 2O3JA 2R5BA 4ZMDA 3USSA 1FAVA 3HD7C 1NYHA 1U7MA 2Y9ZA 1LT9A 3MUDA 3QH9A 1RQVA 3HUSC 2CPSA 5AVVB 4PD4E 2XZRA 4BRYB 3JC22 4HB1A 4PJ0H 2IPPA 1KB9H 3IFMA 1R5LA 1SQPJ 2N1TD 1ZP0C 2N9YB 3L4FA 4L74A 4UB8E 3L74E 1NU1G 5AVWB 4K35A 3RL0B 3TGUE 3CWBG 1FZCA 1KB9E 2WSFH 1RQUA 1LNQA 3WUUA 4DJGA 1SQPG 1S2EA 3U1AA 1SFCB 1NTMJ 1SQBE 2QM8A 4U3FD 2LKMA 2BEQD 1SQPE 5AW3B 1NTMG 3AE8C 2B87B 1K9MQ 3S1KA 1FZAA 1MZ9A 4W7YA 2Y0EA 1KORA 1IFNA 5AVQB 1VQOP 4GDOA 2WSSH 2G3AA 1ZLLA 4BWNA 1Y9BA 3OAKA 5GTHH 2XDJA 3RK2D 4BXLA 2KIKA 4KHXA 1S9KE 2LXCB 1E5WA 3GMAA 2KZIA 4C46A 1HWTC 1OW8A 1BDCA 1DD3A 2WT7B 1T8ZA 2PP6A 4HKZH 1EQ7A 2FYUD 3BCCJ 3II6A 4U3FJ 5C39A 2FKWB 3A0BH 3CXHE 1NTKD 2JEEA 4ZKUA 5KKZB 1L4AA 1FOSE 1KILB 1KILD 1M1JC 2RMZA 4R4MA 3VP9A 1NHLA 1FE6A 2N1TC 3EFFK 4Y28J 3I56P 1AQ5A 3HUSB 1K04A 1FJKA 2G8YA 3O6QB 4C7RA 4EDFA 1GMJA 1J2JB 3KZIH 3L74J 1JM0A 3V6IA 1OXZA 1L0NK 2JP3A 2KLUA 1QGKB 1KN7A 3A0HE 4O9BA 3CCEP 1N2DC 2YIUB 1PP9J 2BCCE 3PHLA 5TISE 5CCHD 5KLVJ 1RH5B 1S5LE 1SQQJ 2QJKC 2J58A 1SFCC 2Y0DA 1M56D 4N78E 3W68A 2W83C 1A02F 5AW7B 1GDTA 2Q9IA 3G3ZA 1HGZA 2FYUE 2E75B 1S5LH 1OWAA 1BGYD 1OW6A 3M0DC 4PD4H 2NZ2A 1PIXA 2QSIA 1GW4A 3RGUA 2D2CD 3H6PA 3D71A 2J5UA 3E1RA 4IFFA 1LT1A 3MP7B 3EFGA 3V2RA 1URQB 2P1JA 3CC2P 2K37A 1OVRA 3H1KE 1P84E 5KLVG 3RBXA 2DW3A 3H1LG 2HYNA 5B5EE 2FXPA 3H1HE 1QX8A 2XNDH 4JPZB 1YTZI 3B8EB 2JKVA 3TK1A 3G71P 3VMZA 5KKZC 3AEEC 2IBZD 3AEFC 2OYHB 1VQ7P 3BRVB 3IN6A 1ZR4A 5AVYB 3P8MC 3GF7A 5AVZB 5KJ7D 3L74D 5KAIH 1DIPA 3LIDA 2IFMA 3FXDA 1N8RQ 4I2LC 4TT3H 1X8YA 2RKLA 3L35A 3N7NA 1H89A 1G1IA 1HGVA 2KYVA 1YQ3C 4H0LB 3V2PA 2KUBA 2ZVOB 2YIUC 3H32A 4OGQB 1SP4A 2AXCA 2M5AA 3C1LA 5L8RJ 1M8OB 4YPCA 1JO5A 1U7JA 1S3JA 2JJLA 4PJ0E 1VQ9P 1KC8Q 4Z1MH 2E75D 1IFPA 2PFXA 1KYOD 1KFMA 1RE3C 1L0NG 3Q3DA 1DH3A 2L5GB 2UWJE 1E79H 3KDPB 2GUSA 2IBZG 1H88A 2OYIB 3HUSA 1VQ6P 1HF9A 1CSBA 4L76A 1HVVA 2KNCB 2B89A 2M3EA 3AE9C 4H13B 1RE3A 1OFCX 3CD6P 1VQPP 1H8AA 3KPEA 3A3YB 1SQQD 3NTNA 3U59A 2WMMA 2W90A 1EZVD 1KFNA 5KAIE 4AYCA 1GL2D 1IFMA 2A45H 2V7QJ 3BRTB 1X79B 3GLMA 2WT7A 3H1HG 3CCJP 3G4SP 1BCCJ 3TYYA 3H1JE 1FZGA 2A06E 4D6TG 2K9YA 2R3SA 2WSEH 2JWDA 1U57A 3RK3E 1ZXGA 2E76D 2IX7C 2FYZA 2QVAA 1DD4A 2K9JA 4OWFA 1PGPA 3L72G 1MUUA 2KS1A 2YXRB 3AE3C 4IL6E 1TU3F 2R3CA 3CX5H 3L71E 3PP5A 2Z5HA 3CXHI 4UB8H 1HJ0A 1X9VA 1ZV8A 2FYUK 1LTTC 4ZNCA 3CCLP 2FYUG 2E74D 4ZKPA 2GUVA 4OGQC 1SLQA 1JCDA 4DCKA 1L0LE 5CJ4A 1WMKA 1KYOI 1RF0A 2H8PD 2QRXA 1N86A 2JDIH 2OTKE 1NTME 1ZN5A 1BE3E 2WPVB 2K9JB 1PGOA 4HJGH 4K3AA 1LTJA 3TGUG 3H1JG 4MN4C 5DJTB 5CCGD 2B87A 1NTZD 3HTKA 3M0AA 3F89A 2O1KA 5CMZA 3WU2H 2OYIC 1L0LJ 1VQMP 3WMM0 5AVXB 3L74G 3P8CD 5CBNA 3L72D 3D6YA 1OVUA 4H13C 1JTHB 1FZFA 3GHGA 3GF3A 3V5BA 3HD7D 1LJ2A 2QE7H 1FS0E 3I55P 2H89C 1KQGB 1MKMA 3L70J 3P32A 3VYIA 1N73B 3M06A 4YTPC 1GK6A 3M9QA 3TDKA 5BVZA 5AW2B 1N7SB 3H1IG 1JNMA 4N6JA 5AVUB 1NH4A 1URQA 1P84I 1EDJA 1OZHA 3RL0C 3KYQA 2P58A 2P7JA 3L75J 2CK3H 5AW0B 1NTZG 3FGAD 3B5NA 2FFDA 4NPFX 1XTCC 1X0TA 3NMDA 1AV1A 1M1JA 2ITAA 4EYYQ 3ITKA 5CBOA 3CI9A 1YIJP 4DT0A 5KAFH 1SQBK 2OQQA 4JYBA 1J1DB 1NKNA 1BCCD 4KT0J 2H7HA 1QVFO 3KXDA 4BRYA 1PP9E 3Q1MA 2QIWA 4PV1D 1N7LA 3WUVA 3L73J 1JTHA 1NWQA 2WSCJ 2FYNB 1IFJA 2OTJP 1L0LD 3H1ID 2LXBA 1M57D 3L75D 4JQ0D 1CI6B 1NU1J 3PJSK 2P67A 3H1LE 5GTHE 1JY2P 3H1KG 1EZVI 1KZUB 1Z56A 3L71D 3CC4P 1BSHA 4GOEA 1S4XA 1VQLP 1KTMA 1FBMA 2QJPB 2JWAA 3ABVC 1LTJC 4IFMA 2HPCA 2N1TB 5E79E 3RL0D 4H44B 1BSNA 3H1JD 2O01N 5APTA 4W7ZA 3TGUJ 2ZXEB 2M5AB 5H2FH 1H0TB 1NVOA 4UB6H 3FXEA 5KLVD 2WPSA 4M3LA 1HH0A 4WY4A 1SQQE 2WTYA 2C9LY 5CCHC 2QJKB 4OVNF 3CWBE 1EZVG 4GOFA 1KQSO 3A0HH 4H0LD 1PFIA 2GA1A 1OIPA 1M7LA 1LWUC 1YYCA 1J1DC 3PTZA 3M9HA 2W6BA 4AQRD 1IFIA 1Y47A 1KYOE 4IL6H 1ZMEC 4WY4D 2D2CB 1GU5A 1VDFA 1NU1D 3T97A 1PPJG 1S1CX 4RKUJ 2O01H 4I7ZB 2OYIA 3CX5D 1SQXG 1PPJE 1P84H 1Q90D 1T3UA 2J59M 2WSEJ 2M8RA 4U3FG 4Y99B 1LTAC 1SQVK 2W6AA 2YO2A 3PLNA 2JO1A 4W80A 4DZOA 3Q2YA 1K05A 3V2NA 3QWOC 4EI2A 3U1CA 4GODA 2OYHC 1LTJB 1D7MA 1IK7A 1XTGB 2I1JA 2IYOA 1OX3A 2KNCA 2XKMA 1OVVA 1UIIA 2A45G 2IBZE 4H44C 4KJMA 2HODB 4RESB 5KJ7C 2ZT9D 5KLVK 3CPWO 3MHVA 2WQYC 3E7KA 1EDLA 1X22A 1YHQP 1DEBA 2O01J 3M0DA 1PV3A 1SQBG 2PAJA 3A7OA 4H0LC 3TSIA 5B66H 1PPJD 2H88C 5TISH 3H1KD 3GW6A 2E74B 2ZAEB 2QJYB 3CX5E 3L36A 1SQPK 3L75G 4YXDC 4IFDK 2KS1B 3BCCD 1JMBA 2OYHA 1VF5D 1KYOH 1Q82Q 3M91A 5CCGA 3RK2B 5AVSB 2YMYA 5GTIE 1RY3A 1MFTA 2OYOA 3PH0A 3CXHH 1IO4A 3Q5RA 3CX5I 1RF1A 3PRJA 4OH8B 1URQD 3CWBD 5KLIB 3H25A 1BE3J 3H32B 1FU1A 4U7JA 2KZJA 1L4AC 2BCCD 2Q3IA 4ASVA 4IOIH 3W67A 4C7NB 1N7SA 2AEMA 1PP9D 2I8DA 2IZ0A 1KB9I 1W5CE 2NRGA 2W6JH 1GL2C 1BCCE 1SQVG 3AE1C 2R32A 4H13D 3KHUA 3AEGC 1Y8AA 2ZT9C 3LW5J 1YQ4C 5APWA 3CCSP 3Q5PA 2E76C 3HE5B 4DOJA 2FBWC 3GG2A 3RK3B 3HE4B 1RF1B 3GHGC 1FDMA 2KK7A 3CXHD 3VN0A 1T2KC 1SQBJ 2P2UA 2NPSC 4CPGA 2POHA 1EDKA 2R44A 1HJBA 3H1LD 1IZNB 3L72J 2ZYAA 2E74C 4EOTA 3L75E 2W27A 3NFQA 1PP9G 1JMMA 1AVYA 2Q6QA 3L70D 1SQVD 3L73D 1FDIA 1NAYA 2XNXA 3EWKA 4IL6X 3P8CE 5M1BA 4L73A 3SWKA 1NTZK 2XV5A 4PV1C 5APYA 4NPEA 3CC7P 1NU1K 1KD1Q 1NTZE 1G1JA 1QEXA 1YJ9P 1SQXJ 1SQBD 2ZVNB 4U3FE 1CW5A 5KLIC 3T97B 3L73E 4N3YB 1NTMD 4WWIA 3BVHA 1FOSF 1KB9D 3UIAA 1SQVE 3L70E 1R5SA 3CCRP 3BCCG 3CL3D 3JSVC 1AQTA 1ZR2A 1NTKJ 2ZFCA 1AA0A 1K8AQ 1VQKP 3VOPA 3R4YA 1N7SC 4PD4D 1L0LG 2ZT9B 3A2AA 3JCUE 3FWNA 1QLED 2IBZI 2RH0A 2V7QH 3A0BE 3B5NC 4RO0A 2V4HA 3RK3C 2FFDC 1RF1C 1SQXD 2IDBA 4I1LA 3K5BA 4JYCA 1NKZB 4EIJA 3JCUH 1YI2P 3L72E 1SQQG 5DJUB 2FXOA 2FYUJ 2IYPA 2OGUA 1H0TA 2E42A 2Z5IA 3WU2E 3RL0g 5APUA 1IFDA 3KZIE 3VP8A 3ZDMA 2NPSA 1SQQK 1QL2A 4GKGA 2A06G 4D6TE 1YITP 1M1KQ 1VF5B 2HODA 1AFOA 1BGYJ 4WY4B 3S4RA 2K3RA 3MTUE 3CCVP 3IF4A 2FYNC 2IZ1A 1J1EB 1GU4A 1RE4C 1NTZJ 2BASA 3HD7A 3P7KA 5APQA 1L0LK 2OARA 2LR2A 3OA7A 3TF5A 2YKOA 1KV4A 1EDIA 1OW7A 1GL2A 1PGQA 2WSFJ 1USEA 2XU6A 4JBZA 3SFDC 5BU8B 1GTWA 1WT6A 4GIFA 1N7SD 1SS1A 2QJPC 3FX0A 3BCCE 1RF0C 1L0NE 3MIWA 3AEDC 3CLQA 3L70G 1NO4A 2C0WA 2Q3EA 1AVOA 2HR3A 3V4QA 5GTIH 2E5TA 3B5ND 3RK3D 2A06D 3A5TA 3G6EP 3IAOA 1NTKK 2FY8A 2IFNA 2E43A 1HBWA 4UB6E 1YTZT 3L73G 3LIEA 1L0NJ 3B5NB 3FWLA 1LTBC 3MGNA 2FFDB 2R5DA 4QMAA 1LP1B 1JEKA 1LTIC 4WVZA 1OMIA 1SFCD 3NXSA 1JY2N 5CHXA 1LWUB 3TNUA 1RE4A 3H1HD 2VRSA 1T6AA 3S9OA 1M90Q 4JF7A 3SWYA 1AJYA 1S72P 2Y9YA 2M0BA 1DEEG 1VF5C 2YO3A 3BATA 5CCHA 1JY2O 3RBZA 5KJ7A 2D2CC 4WY4C 4C7NA 3AECC 1SFCA 5APXA 2Q5UA 1JUNA 1NU1E 2HG5D 2WVRA 4YXWH 3VMYA 1J1EC 2WWWA 4I7ZC 1N73C 3B71A 2WPQA 2WZ7A 5EFWB 3LW5H 2Y0CA 1BDDA 1SQXK 2HFED 5BU5A 4Y99C 2JR8A 3H1KJ 1VQ5P 1GK4A 1IK9A 3SSUA 2O1JA 1L4AD 2KXPB 1LGHB 1BCCG 1PZQA 3HE4A 1EXIA 2N1TA 3H1HJ 4XFJA 1KILC 1M1JB 5K5GB 5KTBA 5AW5B 5CJ0A 1FJPA 1JOCA 1GD2E 3CMAP 4B86A 5KLVE 3MD0A 5B5EH 2C9NY 2I1KA 2WPRA 3V4WA 1UIXA 3IR9A 1LWUA 1NTMK 1PGJA 1MV8A 1PL5A 4R4LA 5AW9B 3TNUB 2FXMA 1P84D 1MFZA 3CWBJ 1YBKA 5APVA 2GM4A 2QJYC 2WSCH 3L71G 1KILE 1VQ8P 2K1AA 3F5HA 1Q2NA 1G2CB 3MZWB 1LP1A 4LLHA 2AXTE 3Q5SA 2E75C 2CPBA 1BGYE 1NTKG 3RK2C 3AE4C 1LTSC 2KP8A 2YKPA 2ZYGA 2A45I 5APSA 1A02J 1VQNP 3OJAB 2YXQB 1JB0J 3H1IE 3L37A 4N78D 3CMEP 3C9IA 1QL1A 4HH2A 1YJNP 1NOHA 1URQC 1Q86Q 2SPZA 1L4AB 2BEZF 2E5YA 3AE6C 3HRNA 1VQ4P 3I5CA 3V2QA 2Z4EA 1KQLA 1GL2B 2ZXXA 4LGDE 3O6QA 1QVGO 1JCCA 1NJIQ 3G9RA 1GZLA 2WITA 2ZYDA 4HYTB 1SQVJ 1VL2A 1WRGA 1LTGC 2N9BA 2Q1KA 2E76B 2QM7A 3H1JJ 3KQGA 3CCQP 4H44D 2W8ZA 1USDA 3GHGB 1NTKE 1BGYG 2B9BA 3TGUD 3D6ZA 1BE3G 2AEFA 1FZCB 1EXJA 1T2KD 2NPSB 2QG4A
chains in the Genus database with same CATH topology
1IC2A 4I6MC 1GW3A 1HUCA 4AUWA 3HTKB 1S9KD 1LT9B 5AW4B 2KB7P 2HLOA 2KLVA 3BASA 1KILA 2KSJA 5CCGC 1NAFA 1T3JA 3M9BA 1HTLC 5AW6B 1JY3P 3N4XA 1JY3N 3E1IA 1VPCA 3HD7B 3VMXA 1FZEA 5AW1B 1N73A 1JY3O 1CI6A 3HE5A 5AVTB 3VTPC 2M3BA 3EQ2A 1FZCC 4WB4A 4LC1A 4XA4A 2NPSD 1FZBA 2HPCB 4GT1A 3O8ZA 1LT9C 2MJZA 4XE5B 2KOGA 1G2CA 5AW8B 2H43A 1W2EA 4WBAA 2Q7CA 3R2PA 1SVFA 1CZQA 5AVRB 2YNYA 2C0XA 2YKQA 3SWFA 1IJDB 2R5BA 1FAVA 3HD7C 1LT9A 3MUDA 3HUSC 2CPSA 5AVVB 2XZRA 2IPPA 3IFMA 2N1TD 3L4FA 5AVWB 3RL0B 1FZCA 2WSFH 3U1AA 1SFCB 2QM8A 2LKMA 5AW3B 1FZAA 1MZ9A 4W7YA 1IFNA 5AVQB 1ZLLA 3OAKA 3RK2D 2XDJA 4KHXA 1S9KE 1E5WA 4C46A 1HWTC 2WT7B 1T8ZA 2PP6A 1EQ7A 3II6A 2FKWB 2JEEA 4ZKUA 1L4AA 1FOSE 1KILB 1KILD 1M1JC 3VP9A 1AQ5A 1NHLA 2N1TC 3HUSB 1FJKA 4C7RA 1J2JB 1OXZA 1L0NK 4O9BA 1N2DC 5CCHD 2J58A 1SFCC 4N78E 1A02F 5AW7B 2Q9IA 3G3ZA 1HGZA 1OWAA 3M0DC 1GW4A 3H6PA 4IFFA 3EFGA 3V2RA 1URQB 2P1JA 2HYNA 1YTZI 3B8EB 3TK1A 3VMZA 2OYHB 3BRVB 1ZR4A 3P8MC 5AVZB 5KJ7D 3LIDA 2IFMA 4I2LC 1X8YA 3N7NA 3L35A 1H89A 1G1IA 1HGVA 2KYVA 3V2PA 3H32A 1SP4A 1JO5A 2JJLA 1KFMA 1DH3A 1RE3C 2L5GB 1H88A 3KDPB 2GUSA 2OYIB 3HUSA 1CSBA 1HVVA 1RE3A 1H8AA 3KPEA 3A3YB 3U59A 3NTNA 4AYCA 1KFNA 1N73C 1GL2D 1IFMA 2A45H 3BRTB 2WT7A 1X79B 2C9LY 3TYYA 1FZGA 2WSEH 2IX7C 2FYZA 1MUUA 2R3CA 2GM4A 3PP5A 2Z5HA 1X9VA 1ZV8A 2FYUK 1LTTC 4ZKPA 2GUVA 1SLQA 1JCDA 5CJ4A 1RF0A 2H8PD 1N86A 1ZN5A 3WMM0 1GDTA 5CCGD 1LTJA 3HTKA 2OYIC 2O1KA 5CMZA 5AVXB 3P8CD 1JTHB 1FZFA 3GHGA 3V5BA 3HD7D 1N73B 3P32A 3VYIA 3M06A 1GK6A 3M9QA 5BVZA 5AW2B 1N7SB 1JNMA 4N6JA 5AVUB 1NH4A 1URQA 3RL0C 3KYQA 2P7JA 5AW0B 3B5NA 2FFDA 1XTCC 3NMDA 1M1JA 3CI9A 1SQBK 4JYBA 1J1DB 1NKNA 2H7HA 1N7LA 1JTHA 1NWQA 1IFJA 1CI6B 2P67A 1JY2P 1KZUB 1Z56A 1FBMA 1LTJC 4IFMA 2HPCA 2N1TB 3RL0D 5APTA 4W7ZA 2ZXEB 2WPSA 4M3LA 1HH0A 4WY4A 2WTYA 5CCHC 1PFIA 1M7LA 1LWUC 1YYCA 1J1DC 3M9HA 2W6BA 4AQRD 1IFIA 4WY4D 1GU5A 1VDFA 3T97A 2OYIA 2O01H 1T3UA 2J59M 2M8RA 4Y99B 1LTAC 1SQVK 2W6AA 2YO2A 4W80A 4DZOA 3V2NA 3U1CA 2OYHC 1LTJB 2I1JA 1XTGB 2XKMA 2A45G 5KLVK 4RESB 2HODB 5KJ7C 1DEBA 3M0DA 3TSIA 2PAJA 3A7OA 4IFDK 3L36A 1SQPK 2OYHA 3M91A 5CCGA 3RK2B 5AVSB 2YMYA 1RY3A 1IO4A 1RF1A 4OH8B 1URQD 3H32B 1FU1A 1L4AC 2Q3IA 4C7NB 1N7SA 1GL2C 2R32A 5APWA 3HE5B 4DOJA 3RK3B 1RF1B 1FDMA 3HE4B 3GHGC 3VN0A 1T2KC 2P2UA 2NPSC 2POHA 1HJBA 4EOTA 2W27A 3NFQA 1JMMA 2XNXA 3P8CE 1NTZK 2XV5A 5APYA 1NU1K 1G1JA 1CW5A 4N3YB 1FOSF 3BVHA 3UIAA 3CL3D 1ZR2A 2ZFCA 3VOPA 1N7SC 3A2AA 5AVYB 3B5NC 3RK3C 2FFDC 1RF1C 4I1LA 1JUNA 4JYCA 4EIJA 1NKZB 2E42A 2Z5IA 5APUA 1IFDA 3VP8A 2NPSA 1SQQK 1QL2A 4GKGA 2HODA 1AFOA 4WY4B 3MTUE 1J1EB 1GU4A 1RE4C 2BASA 3HD7A 3P7KA 5APQA 1L0LK 2OARA 3OA7A 2YKOA 2XU6A 1GL2A 5BU8B 1GTWA 1WT6A 4GIFA 1N7SD 3MIWA 1RF0C 5APSA 3CLQA 1NO4A 2C0WA 3V4QA 3B5ND 3RK3D 3A5TA 1NTKK 2IFNA 2E43A 1HBWA 1YTZT 3LIEA 3MGNA 3B5NB 2FFDB 1LTBC 2R5DA 1LTIC 1SFCD 3NXSA 1JY2N 5CHXA 1LWUB 3TNUA 1RE4A 2VRSA 4JF7A 3SWYA 3BATA 5CCHA 2YO3A 5KJ7A 1JY2O 4C7NA 4WY4C 1SFCA 5APXA 2Q5UA 2HG5D 3VMYA 1J1EC 2WWWA 2WPQA 2WZ7A 3LW5H 1SQXK 2HFED 5BU5A 4Y99C 1GK4A 1IK9A 2O1JA 1L4AD 1LGHB 3HE4A 2N1TA 1KILC 1M1JB 5KTBA 5AW5B 5CJ0A 1FJPA 1JOCA 1GD2E 4B86A 3MD0A 2C9NY 2I1KA 2WPRA 3V4WA 1DX7A 3IR9A 1LWUA 1NTMK 3TNUB 1MV8A 5AW9B 2FXMA 1MFZA 5APVA 2WSCH 1G2CB 4LLHA 2CPBA 3RK2C 1LTSC 2KP8A 2YKPA 1A02J 2A45I 3OJAB 3L37A 4N78D 3C9IA 1QL1A 4HH2A 1NOHA 1URQC 1L4AB 3HRNA 3I5CA 3V2QA 2Z4EA 1KQLA 1GL2B 4LGDE 1JCCA 1GZLA 2WITA 4HYTB 2N9BA 3M0AA 1WRGA 1LTGC 2QM7A 3KQGA 3GHGB 1FZCB 1T2KD 2NPSB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H32 A;  2OYH A;  1JY2 P;  1LT9 A;  1RF0 C;  2OYI A;  1FZC C;  2A45 I;  1LT9 B;  3HUS C;  2FFD C;  1RF1 C;  1FZB A;  2HLO A;  1LTJ C;  1RE3 C;  2HPC B;  1T3U A;  2HPC A;  2OYI B;  1M1J C;  1RF1 A;  3HUS A;  2FFD A;  1RF0 A;  1FZC A;  1M1J A;  2XNX A;  1LT9 C;  1M1J B;  1N86 A;  3H32 B;  3HUS B;  2Z4E A;  2FFD B;  2OYH C;  1LTJ B;  1LTJ A;  1RE3 A;  2H43 A;  1JY3 P;  1W2E A;  2OYH B;  2A45 G;  2HOD A;  2OYI C;  2HOD B;  1N73 C;  1JY3 N;  1JY2 N;  2A45 H;  1LWU A;  3E1I A;  1FZA A;  1LWU B;  3BVH A;  1RE4 A;  1FZE A;  1RE4 C;  1FZG A;  1LWU C;  3GHG B;  1FZF A;  1FZC B;  3GHG A;  1N73 A;  1JY3 O;  2Q9I A;  1RF1 B;  1JY2 O;  3GHG C;  1N73 B; 
#chains in the Genus database with same CATH topology
 1IC2 A;  3B4S A;  1GW3 A;  2KSE A;  4I6M C;  5B66 E;  1Q81 Q;  1HUC A;  4AUW A;  2AXT H;  3HTK B;  3CCU P;  4OGQ D;  1S9K D;  5E79 H;  3OW2 O;  1LT9 B;  3CCM P;  1KMI Z;  5AW4 B;  2KB7 P;  4RJT A;  2HLO A;  2KLV A;  3BAS A;  2KI7 B;  1KQF B;  1ZOY C;  2K88 A;  1FDO A;  1R8E A;  1KIL A;  2KSJ A;  5CCG C;  4PV1 B;  4TLF A;  1NAF A;  1T3J A;  2YMK A;  3M9B A;  1SQP D;  3AE7 C;  1HTL C;  4D6T J;  5AW6 B;  2MKV A;  1JY3 P;  3N4X A;  1Q7Y Q;  1EC5 A;  1BE3 D;  5TJH A;  1JY3 N;  1W2B O;  1K73 Q;  2B88 A;  3E1I A;  1VPC A;  3C8V A;  3HD7 B;  3VMX A;  1FZE A;  1YJW P;  4PD4 I;  3D70 A;  5AW1 B;  3VMA A;  1N73 A;  1JY3 O;  1CI6 A;  4ASW A;  3HE5 A;  5AVT B;  3VTP C;  2M3B A;  1ZW0 A;  1L0N D;  3EQ2 A;  1FZC C;  4WB4 A;  4LC1 A;  4XA4 A;  2NPS D;  1FZB A;  3SFE C;  2QA4 P;  2HPC B;  3WUT A;  3L71 J;  2BCC J;  4GT1 A;  2AEJ A;  4A7P A;  3O8Z A;  1ZRT D;  4L75 A;  5KAF E;  5H2F E;  2BCC G;  1NGM B;  3AEB C;  1LT9 C;  2MJZ A;  3MUD C;  1EZV E;  4XE5 B;  4NPD A;  2ZJS E;  2OTL P;  1DX7 A;  2KOG A;  1G2C A;  1S5L X;  5AW8 B;  2H43 A;  1W2E A;  4WBA A;  2Q7C A;  3R2P A;  1SVF A;  1CZQ A;  5AVR B;  1FC2 C;  4D6T D;  3H1I J;  2PRR A;  2L91 A;  2QEX P;  2RN0 A;  2P10 A;  1ZRT E;  3AEA C;  1L2P A;  3AE5 C;  2YNY A;  1RHZ B;  2C0X A;  2YKQ A;  3SWF A;  2PGD A;  1IJD B;  3AE2 C;  1SQX E;  3H1L J;  2O3J A;  2R5B A;  4ZMD A;  3USS A;  1FAV A;  3HD7 C;  1NYH A;  1U7M A;  2Y9Z A;  1LT9 A;  3MUD A;  3QH9 A;  1RQV A;  3HUS C;  2CPS A;  5AVV B;  4PD4 E;  2XZR A;  4BRY B;  3JC2 2;  4HB1 A;  4PJ0 H;  2IPP A;  1KB9 H;  3IFM A;  1R5L A;  1SQP J;  2N1T D;  1ZP0 C;  2N9Y B;  3L4F A;  4L74 A;  4UB8 E;  3L74 E;  1NU1 G;  5AVW B;  4K35 A;  3RL0 B;  3TGU E;  3CWB G;  1FZC A;  1KB9 E;  2WSF H;  1RQU A;  1LNQ A;  3WUU A;  4DJG A;  1SQP G;  1S2E A;  3U1A A;  1SFC B;  1NTM J;  1SQB E;  2QM8 A;  4U3F D;  2LKM A;  2BEQ D;  1SQP E;  5AW3 B;  1NTM G;  3AE8 C;  2B87 B;  1K9M Q;  3S1K A;  1FZA A;  1MZ9 A;  4W7Y A;  2Y0E A;  1KOR A;  1IFN A;  5AVQ B;  1VQO P;  4GDO A;  2WSS H;  2G3A A;  1ZLL A;  4BWN A;  1Y9B A;  3OAK A;  5GTH H;  2XDJ A;  3RK2 D;  4BXL A;  2KIK A;  4KHX A;  1S9K E;  2LXC B;  1E5W A;  3GMA A;  2KZI A;  4C46 A;  1HWT C;  1OW8 A;  1BDC A;  1DD3 A;  2WT7 B;  1T8Z A;  2PP6 A;  4HKZ H;  1EQ7 A;  2FYU D;  3BCC J;  3II6 A;  4U3F J;  5C39 A;  2FKW B;  3A0B H;  3CXH E;  1NTK D;  2JEE A;  4ZKU A;  5KKZ B;  1L4A A;  1FOS E;  1KIL B;  1KIL D;  1M1J C;  2RMZ A;  4R4M A;  3VP9 A;  1NHL A;  1FE6 A;  2N1T C;  3EFF K;  4Y28 J;  3I56 P;  1AQ5 A;  3HUS B;  1K04 A;  1FJK A;  2G8Y A;  3O6Q B;  4C7R A;  4EDF A;  1GMJ A;  1J2J B;  3KZI H;  3L74 J;  1JM0 A;  3V6I A;  1OXZ A;  1L0N K;  2JP3 A;  2KLU A;  1QGK B;  1KN7 A;  3A0H E;  4O9B A;  3CCE P;  1N2D C;  2YIU B;  1PP9 J;  2BCC E;  3PHL A;  5TIS E;  5CCH D;  5KLV J;  1RH5 B;  1S5L E;  1SQQ J;  2QJK C;  2J58 A;  1SFC C;  2Y0D A;  1M56 D;  4N78 E;  3W68 A;  2W83 C;  1A02 F;  5AW7 B;  1GDT A;  2Q9I A;  3G3Z A;  1HGZ A;  2FYU E;  2E75 B;  1S5L H;  1OWA A;  1BGY D;  1OW6 A;  3M0D C;  4PD4 H;  2NZ2 A;  1PIX A;  2QSI A;  1GW4 A;  3RGU A;  2D2C D;  3H6P A;  3D71 A;  2J5U A;  3E1R A;  4IFF A;  1LT1 A;  3MP7 B;  3EFG A;  3V2R A;  1URQ B;  2P1J A;  3CC2 P;  2K37 A;  1OVR A;  3H1K E;  1P84 E;  5KLV G;  3RBX A;  2DW3 A;  3H1L G;  2HYN A;  5B5E E;  2FXP A;  3H1H E;  1QX8 A;  2XND H;  4JPZ B;  1YTZ I;  3B8E B;  2JKV A;  3TK1 A;  3G71 P;  3VMZ A;  5KKZ C;  3AEE C;  2IBZ D;  3AEF C;  2OYH B;  1VQ7 P;  3BRV B;  3IN6 A;  1ZR4 A;  5AVY B;  3P8M C;  3GF7 A;  5AVZ B;  5KJ7 D;  3L74 D;  5KAI H;  1DIP A;  3LID A;  2IFM A;  3FXD A;  1N8R Q;  4I2L C;  4TT3 H;  1X8Y A;  2RKL A;  3L35 A;  3N7N A;  1H89 A;  1G1I A;  1HGV A;  2KYV A;  1YQ3 C;  4H0L B;  3V2P A;  2KUB A;  2ZVO B;  2YIU C;  3H32 A;  4OGQ B;  1SP4 A;  2AXC A;  2M5A A;  3C1L A;  5L8R J;  1M8O B;  4YPC A;  1JO5 A;  1U7J A;  1S3J A;  2JJL A;  4PJ0 E;  1VQ9 P;  1KC8 Q;  4Z1M H;  2E75 D;  1IFP A;  2PFX A;  1KYO D;  1KFM A;  1RE3 C;  1L0N G;  3Q3D A;  1DH3 A;  2L5G B;  2UWJ E;  1E79 H;  3KDP B;  2GUS A;  2IBZ G;  1H88 A;  2OYI B;  3HUS A;  1VQ6 P;  1HF9 A;  1CSB A;  4L76 A;  1HVV A;  2KNC B;  2B89 A;  2M3E A;  3AE9 C;  4H13 B;  1RE3 A;  1OFC X;  3CD6 P;  1VQP P;  1H8A A;  3KPE A;  3A3Y B;  1SQQ D;  3NTN A;  3U59 A;  2WMM A;  2W90 A;  1EZV D;  1KFN A;  5KAI E;  4AYC A;  1GL2 D;  1IFM A;  2A45 H;  2V7Q J;  3BRT B;  1X79 B;  3GLM A;  2WT7 A;  3H1H G;  3CCJ P;  3G4S P;  1BCC J;  3TYY A;  3H1J E;  1FZG A;  2A06 E;  4D6T G;  2K9Y A;  2R3S A;  2WSE H;  2JWD A;  1U57 A;  3RK3 E;  1ZXG A;  2E76 D;  2IX7 C;  2FYZ A;  2QVA A;  1DD4 A;  2K9J A;  4OWF A;  1PGP A;  3L72 G;  1MUU A;  2KS1 A;  2YXR B;  3AE3 C;  4IL6 E;  1TU3 F;  2R3C A;  3CX5 H;  3L71 E;  3PP5 A;  2Z5H A;  3CXH I;  4UB8 H;  1HJ0 A;  1X9V A;  1ZV8 A;  2FYU K;  1LTT C;  4ZNC A;  3CCL P;  2FYU G;  2E74 D;  4ZKP A;  2GUV A;  4OGQ C;  1SLQ A;  1JCD A;  4DCK A;  1L0L E;  5CJ4 A;  1WMK A;  1KYO I;  1RF0 A;  2H8P D;  2QRX A;  1N86 A;  2JDI H;  2OTK E;  1NTM E;  1ZN5 A;  1BE3 E;  2WPV B;  2K9J B;  1PGO A;  4HJG H;  4K3A A;  1LTJ A;  3TGU G;  3H1J G;  4MN4 C;  5DJT B;  5CCG D;  2B87 A;  1NTZ D;  3HTK A;  3M0A A;  3F89 A;  2O1K A;  5CMZ A;  3WU2 H;  2OYI C;  1L0L J;  1VQM P;  3WMM 0;  5AVX B;  3L74 G;  3P8C D;  5CBN A;  3L72 D;  3D6Y A;  1OVU A;  4H13 C;  1JTH B;  1FZF A;  3GHG A;  3GF3 A;  3V5B A;  3HD7 D;  1LJ2 A;  2QE7 H;  1FS0 E;  3I55 P;  2H89 C;  1KQG B;  1MKM A;  3L70 J;  3P32 A;  3VYI A;  1N73 B;  3M06 A;  4YTP C;  1GK6 A;  3M9Q A;  3TDK A;  5BVZ A;  5AW2 B;  1N7S B;  3H1I G;  1JNM A;  4N6J A;  5AVU B;  1NH4 A;  1URQ A;  1P84 I;  1EDJ A;  1OZH A;  3RL0 C;  3KYQ A;  2P58 A;  2P7J A;  3L75 J;  2CK3 H;  5AW0 B;  1NTZ G;  3FGA D;  3B5N A;  2FFD A;  4NPF X;  1XTC C;  1X0T A;  3NMD A;  1AV1 A;  1M1J A;  2ITA A;  4EYY Q;  3ITK A;  5CBO A;  3CI9 A;  1YIJ P;  4DT0 A;  5KAF H;  1SQB K;  2OQQ A;  4JYB A;  1J1D B;  1NKN A;  1BCC D;  4KT0 J;  2H7H A;  1QVF O;  3KXD A;  4BRY A;  1PP9 E;  3Q1M A;  2QIW A;  4PV1 D;  1N7L A;  3WUV A;  3L73 J;  1JTH A;  1NWQ A;  2WSC J;  2FYN B;  1IFJ A;  2OTJ P;  1L0L D;  3H1I D;  2LXB A;  1M57 D;  3L75 D;  4JQ0 D;  1CI6 B;  1NU1 J;  3PJS K;  2P67 A;  3H1L E;  5GTH E;  1JY2 P;  3H1K G;  1EZV I;  1KZU B;  1Z56 A;  3L71 D;  3CC4 P;  1BSH A;  4GOE A;  1S4X A;  1VQL P;  1KTM A;  1FBM A;  2QJP B;  2JWA A;  3ABV C;  1LTJ C;  4IFM A;  2HPC A;  2N1T B;  5E79 E;  3RL0 D;  4H44 B;  1BSN A;  3H1J D;  2O01 N;  5APT A;  4W7Z A;  3TGU J;  2ZXE B;  2M5A B;  5H2F H;  1H0T B;  1NVO A;  4UB6 H;  3FXE A;  5KLV D;  2WPS A;  4M3L A;  1HH0 A;  4WY4 A;  1SQQ E;  2WTY A;  2C9L Y;  5CCH C;  2QJK B;  4OVN F;  3CWB E;  1EZV G;  4GOF A;  1KQS O;  3A0H H;  4H0L D;  1PFI A;  2GA1 A;  1OIP A;  1M7L A;  1LWU C;  1YYC A;  1J1D C;  3PTZ A;  3M9H A;  2W6B A;  4AQR D;  1IFI A;  1Y47 A;  1KYO E;  4IL6 H;  1ZME C;  4WY4 D;  2D2C B;  1GU5 A;  1VDF A;  1NU1 D;  3T97 A;  1PPJ G;  1S1C X;  4RKU J;  2O01 H;  4I7Z B;  2OYI A;  3CX5 D;  1SQX G;  1PPJ E;  1P84 H;  1Q90 D;  1T3U A;  2J59 M;  2WSE J;  2M8R A;  4U3F G;  4Y99 B;  1LTA C;  1SQV K;  2W6A A;  2YO2 A;  3PLN A;  2JO1 A;  4W80 A;  4DZO A;  3Q2Y A;  1K05 A;  3V2N A;  3QWO C;  4EI2 A;  3U1C A;  4GOD A;  2OYH C;  1LTJ B;  1D7M A;  1IK7 A;  1XTG B;  2I1J A;  2IYO A;  1OX3 A;  2KNC A;  2XKM A;  1OVV A;  1UII A;  2A45 G;  2IBZ E;  4H44 C;  4KJM A;  2HOD B;  4RES B;  5KJ7 C;  2ZT9 D;  5KLV K;  3CPW O;  3MHV A;  2WQY C;  3E7K A;  1EDL A;  1X22 A;  1YHQ P;  1DEB A;  2O01 J;  3M0D A;  1PV3 A;  1SQB G;  2PAJ A;  3A7O A;  4H0L C;  3TSI A;  5B66 H;  1PPJ D;  2H88 C;  5TIS H;  3H1K D;  3GW6 A;  2E74 B;  2ZAE B;  2QJY B;  3CX5 E;  3L36 A;  1SQP K;  3L75 G;  4YXD C;  4IFD K;  2KS1 B;  3BCC D;  1JMB A;  2OYH A;  1VF5 D;  1KYO H;  1Q82 Q;  3M91 A;  5CCG A;  3RK2 B;  5AVS B;  2YMY A;  5GTI E;  1RY3 A;  1MFT A;  2OYO A;  3PH0 A;  3CXH H;  1IO4 A;  3Q5R A;  3CX5 I;  1RF1 A;  3PRJ A;  4OH8 B;  1URQ D;  3CWB D;  5KLI B;  3H25 A;  1BE3 J;  3H32 B;  1FU1 A;  4U7J A;  2KZJ A;  1L4A C;  2BCC D;  2Q3I A;  4ASV A;  4IOI H;  3W67 A;  4C7N B;  1N7S A;  2AEM A;  1PP9 D;  2I8D A;  2IZ0 A;  1KB9 I;  1W5C E;  2NRG A;  2W6J H;  1GL2 C;  1BCC E;  1SQV G;  3AE1 C;  2R32 A;  4H13 D;  3KHU A;  3AEG C;  1Y8A A;  2ZT9 C;  3LW5 J;  1YQ4 C;  5APW A;  3CCS P;  3Q5P A;  2E76 C;  3HE5 B;  4DOJ A;  2FBW C;  3GG2 A;  3RK3 B;  3HE4 B;  1RF1 B;  3GHG C;  1FDM A;  2KK7 A;  3CXH D;  3VN0 A;  1T2K C;  1SQB J;  2P2U A;  2NPS C;  4CPG A;  2POH A;  1EDK A;  2R44 A;  1HJB A;  3H1L D;  1IZN B;  3L72 J;  2ZYA A;  2E74 C;  4EOT A;  3L75 E;  2W27 A;  3NFQ A;  1PP9 G;  1JMM A;  1AVY A;  2Q6Q A;  3L70 D;  1SQV D;  3L73 D;  1FDI A;  1NAY A;  2XNX A;  3EWK A;  4IL6 X;  3P8C E;  5M1B A;  4L73 A;  3SWK A;  1NTZ K;  2XV5 A;  4PV1 C;  5APY A;  4NPE A;  3CC7 P;  1NU1 K;  1KD1 Q;  1NTZ E;  1G1J A;  1QEX A;  1YJ9 P;  1SQX J;  1SQB D;  2ZVN B;  4U3F E;  1CW5 A;  5KLI C;  3T97 B;  3L73 E;  4N3Y B;  1NTM D;  4WWI A;  3BVH A;  1FOS F;  1KB9 D;  3UIA A;  1SQV E;  3L70 E;  1R5S A;  3CCR P;  3BCC G;  3CL3 D;  3JSV C;  1AQT A;  1ZR2 A;  1NTK J;  2ZFC A;  1AA0 A;  1K8A Q;  1VQK P;  3VOP A;  3R4Y A;  1N7S C;  4PD4 D;  1L0L G;  2ZT9 B;  3A2A A;  3JCU E;  3FWN A;  1QLE D;  2IBZ I;  2RH0 A;  2V7Q H;  3A0B E;  3B5N C;  4RO0 A;  2V4H A;  3RK3 C;  2FFD C;  1RF1 C;  1SQX D;  2IDB A;  4I1L A;  3K5B A;  4JYC A;  1NKZ B;  4EIJ A;  3JCU H;  1YI2 P;  3L72 E;  1SQQ G;  5DJU B;  2FXO A;  2FYU J;  2IYP A;  2OGU A;  1H0T A;  2E42 A;  2Z5I A;  3WU2 E;  3RL0 g;  5APU A;  1IFD A;  3KZI E;  3VP8 A;  3ZDM A;  2NPS A;  1SQQ K;  1QL2 A;  4GKG A;  2A06 G;  4D6T E;  1YIT P;  1M1K Q;  1VF5 B;  2HOD A;  1AFO A;  1BGY J;  4WY4 B;  3S4R A;  2K3R A;  3MTU E;  3CCV P;  3IF4 A;  2FYN C;  2IZ1 A;  1J1E B;  1GU4 A;  1RE4 C;  1NTZ J;  2BAS A;  3HD7 A;  3P7K A;  5APQ A;  1L0L K;  2OAR A;  2LR2 A;  3OA7 A;  3TF5 A;  2YKO A;  1KV4 A;  1EDI A;  1OW7 A;  1GL2 A;  1PGQ A;  2WSF J;  1USE A;  2XU6 A;  4JBZ A;  3SFD C;  5BU8 B;  1GTW A;  1WT6 A;  4GIF A;  1N7S D;  1SS1 A;  2QJP C;  3FX0 A;  3BCC E;  1RF0 C;  1L0N E;  3MIW A;  3AED C;  3CLQ A;  3L70 G;  1NO4 A;  2C0W A;  2Q3E A;  1AVO A;  2HR3 A;  3V4Q A;  5GTI H;  2E5T A;  3B5N D;  3RK3 D;  2A06 D;  3A5T A;  3G6E P;  3IAO A;  1NTK K;  2FY8 A;  2IFN A;  2E43 A;  1HBW A;  4UB6 E;  1YTZ T;  3L73 G;  3LIE A;  1L0N J;  3B5N B;  3FWL A;  1LTB C;  3MGN A;  2FFD B;  2R5D A;  4QMA A;  1LP1 B;  1JEK A;  1LTI C;  4WVZ A;  1OMI A;  1SFC D;  3NXS A;  1JY2 N;  5CHX A;  1LWU B;  3TNU A;  1RE4 A;  3H1H D;  2VRS A;  1T6A A;  3S9O A;  1M90 Q;  4JF7 A;  3SWY A;  1AJY A;  1S72 P;  2Y9Y A;  2M0B A;  1DEE G;  1VF5 C;  2YO3 A;  3BAT A;  5CCH A;  1JY2 O;  3RBZ A;  5KJ7 A;  2D2C C;  4WY4 C;  4C7N A;  3AEC C;  1SFC A;  5APX A;  2Q5U A;  1JUN A;  1NU1 E;  2HG5 D;  2WVR A;  4YXW H;  3VMY A;  1J1E C;  2WWW A;  4I7Z C;  1N73 C;  3B71 A;  2WPQ A;  2WZ7 A;  5EFW B;  3LW5 H;  2Y0C A;  1BDD A;  1SQX K;  2HFE D;  5BU5 A;  4Y99 C;  2JR8 A;  3H1K J;  1VQ5 P;  1GK4 A;  1IK9 A;  3SSU A;  2O1J A;  1L4A D;  2KXP B;  1LGH B;  1BCC G;  1PZQ A;  3HE4 A;  1EXI A;  2N1T A;  3H1H J;  4XFJ A;  1KIL C;  1M1J B;  5K5G B;  5KTB A;  5AW5 B;  5CJ0 A;  1FJP A;  1JOC A;  1GD2 E;  3CMA P;  4B86 A;  5KLV E;  3MD0 A;  5B5E H;  2C9N Y;  2I1K A;  2WPR A;  3V4W A;  1UIX A;  3IR9 A;  1LWU A;  1NTM K;  1PGJ A;  1MV8 A;  1PL5 A;  4R4L A;  5AW9 B;  3TNU B;  2FXM A;  1P84 D;  1MFZ A;  3CWB J;  1YBK A;  5APV A;  2GM4 A;  2QJY C;  2WSC H;  3L71 G;  1KIL E;  1VQ8 P;  2K1A A;  3F5H A;  1Q2N A;  1G2C B;  3MZW B;  1LP1 A;  4LLH A;  2AXT E;  3Q5S A;  2E75 C;  2CPB A;  1BGY E;  1NTK G;  3RK2 C;  3AE4 C;  1LTS C;  2KP8 A;  2YKP A;  2ZYG A;  2A45 I;  5APS A;  1A02 J;  1VQN P;  3OJA B;  2YXQ B;  1JB0 J;  3H1I E;  3L37 A;  4N78 D;  3CME P;  3C9I A;  1QL1 A;  4HH2 A;  1YJN P;  1NOH A;  1URQ C;  1Q86 Q;  2SPZ A;  1L4A B;  2BEZ F;  2E5Y A;  3AE6 C;  3HRN A;  1VQ4 P;  3I5C A;  3V2Q A;  2Z4E A;  1KQL A;  1GL2 B;  2ZXX A;  4LGD E;  3O6Q A;  1QVG O;  1JCC A;  1NJI Q;  3G9R A;  1GZL A;  2WIT A;  2ZYD A;  4HYT B;  1SQV J;  1VL2 A;  1WRG A;  1LTG C;  2N9B A;  2Q1K A;  2E76 B;  2QM7 A;  3H1J J;  3KQG A;  3CCQ P;  4H44 D;  2W8Z A;  1USD A;  3GHG B;  1NTK E;  1BGY G;  2B9B A;  3TGU D;  3D6Z A;  1BE3 G;  2AEF A;  1FZC B;  1EXJ A;  1T2K D;  2NPS B;  2QG4 A; 
#chains in the Genus database with same CATH homology
 1IC2 A;  4I6M C;  1GW3 A;  1HUC A;  4AUW A;  3HTK B;  1S9K D;  1LT9 B;  5AW4 B;  2KB7 P;  2HLO A;  2KLV A;  3BAS A;  1KIL A;  2KSJ A;  5CCG C;  1NAF A;  1T3J A;  3M9B A;  1HTL C;  5AW6 B;  1JY3 P;  3N4X A;  1JY3 N;  3E1I A;  1VPC A;  3HD7 B;  3VMX A;  1FZE A;  5AW1 B;  1N73 A;  1JY3 O;  1CI6 A;  3HE5 A;  5AVT B;  3VTP C;  2M3B A;  3EQ2 A;  1FZC C;  4WB4 A;  4LC1 A;  4XA4 A;  2NPS D;  1FZB A;  2HPC B;  4GT1 A;  3O8Z A;  1LT9 C;  2MJZ A;  4XE5 B;  2KOG A;  1G2C A;  5AW8 B;  2H43 A;  1W2E A;  4WBA A;  2Q7C A;  3R2P A;  1SVF A;  1CZQ A;  5AVR B;  2YNY A;  2C0X A;  2YKQ A;  3SWF A;  1IJD B;  2R5B A;  1FAV A;  3HD7 C;  1LT9 A;  3MUD A;  3HUS C;  2CPS A;  5AVV B;  2XZR A;  2IPP A;  3IFM A;  2N1T D;  3L4F A;  5AVW B;  3RL0 B;  1FZC A;  2WSF H;  3U1A A;  1SFC B;  2QM8 A;  2LKM A;  5AW3 B;  1FZA A;  1MZ9 A;  4W7Y A;  1IFN A;  5AVQ B;  1ZLL A;  3OAK A;  3RK2 D;  2XDJ A;  4KHX A;  1S9K E;  1E5W A;  4C46 A;  1HWT C;  2WT7 B;  1T8Z A;  2PP6 A;  1EQ7 A;  3II6 A;  2FKW B;  2JEE A;  4ZKU A;  1L4A A;  1FOS E;  1KIL B;  1KIL D;  1M1J C;  3VP9 A;  1AQ5 A;  1NHL A;  2N1T C;  3HUS B;  1FJK A;  4C7R A;  1J2J B;  1OXZ A;  1L0N K;  4O9B A;  1N2D C;  5CCH D;  2J58 A;  1SFC C;  4N78 E;  1A02 F;  5AW7 B;  2Q9I A;  3G3Z A;  1HGZ A;  1OWA A;  3M0D C;  1GW4 A;  3H6P A;  4IFF A;  3EFG A;  3V2R A;  1URQ B;  2P1J A;  2HYN A;  1YTZ I;  3B8E B;  3TK1 A;  3VMZ A;  2OYH B;  3BRV B;  1ZR4 A;  3P8M C;  5AVZ B;  5KJ7 D;  3LID A;  2IFM A;  4I2L C;  1X8Y A;  3N7N A;  3L35 A;  1H89 A;  1G1I A;  1HGV A;  2KYV A;  3V2P A;  3H32 A;  1SP4 A;  1JO5 A;  2JJL A;  1KFM A;  1DH3 A;  1RE3 C;  2L5G B;  1H88 A;  3KDP B;  2GUS A;  2OYI B;  3HUS A;  1CSB A;  1HVV A;  1RE3 A;  1H8A A;  3KPE A;  3A3Y B;  3U59 A;  3NTN A;  4AYC A;  1KFN A;  1N73 C;  1GL2 D;  1IFM A;  2A45 H;  3BRT B;  2WT7 A;  1X79 B;  2C9L Y;  3TYY A;  1FZG A;  2WSE H;  2IX7 C;  2FYZ A;  1MUU A;  2R3C A;  2GM4 A;  3PP5 A;  2Z5H A;  1X9V A;  1ZV8 A;  2FYU K;  1LTT C;  4ZKP A;  2GUV A;  1SLQ A;  1JCD A;  5CJ4 A;  1RF0 A;  2H8P D;  1N86 A;  1ZN5 A;  3WMM 0;  1GDT A;  5CCG D;  1LTJ A;  3HTK A;  2OYI C;  2O1K A;  5CMZ A;  5AVX B;  3P8C D;  1JTH B;  1FZF A;  3GHG A;  3V5B A;  3HD7 D;  1N73 B;  3P32 A;  3VYI A;  3M06 A;  1GK6 A;  3M9Q A;  5BVZ A;  5AW2 B;  1N7S B;  1JNM A;  4N6J A;  5AVU B;  1NH4 A;  1URQ A;  3RL0 C;  3KYQ A;  2P7J A;  5AW0 B;  3B5N A;  2FFD A;  1XTC C;  3NMD A;  1M1J A;  3CI9 A;  1SQB K;  4JYB A;  1J1D B;  1NKN A;  2H7H A;  1N7L A;  1JTH A;  1NWQ A;  1IFJ A;  1CI6 B;  2P67 A;  1JY2 P;  1KZU B;  1Z56 A;  1FBM A;  1LTJ C;  4IFM A;  2HPC A;  2N1T B;  3RL0 D;  5APT A;  4W7Z A;  2ZXE B;  2WPS A;  4M3L A;  1HH0 A;  4WY4 A;  2WTY A;  5CCH C;  1PFI A;  1M7L A;  1LWU C;  1YYC A;  1J1D C;  3M9H A;  2W6B A;  4AQR D;  1IFI A;  4WY4 D;  1GU5 A;  1VDF A;  3T97 A;  2OYI A;  2O01 H;  1T3U A;  2J59 M;  2M8R A;  4Y99 B;  1LTA C;  1SQV K;  2W6A A;  2YO2 A;  4W80 A;  4DZO A;  3V2N A;  3U1C A;  2OYH C;  1LTJ B;  2I1J A;  1XTG B;  2XKM A;  2A45 G;  5KLV K;  4RES B;  2HOD B;  5KJ7 C;  1DEB A;  3M0D A;  3TSI A;  2PAJ A;  3A7O A;  4IFD K;  3L36 A;  1SQP K;  2OYH A;  3M91 A;  5CCG A;  3RK2 B;  5AVS B;  2YMY A;  1RY3 A;  1IO4 A;  1RF1 A;  4OH8 B;  1URQ D;  3H32 B;  1FU1 A;  1L4A C;  2Q3I A;  4C7N B;  1N7S A;  1GL2 C;  2R32 A;  5APW A;  3HE5 B;  4DOJ A;  3RK3 B;  1RF1 B;  1FDM A;  3HE4 B;  3GHG C;  3VN0 A;  1T2K C;  2P2U A;  2NPS C;  2POH A;  1HJB A;  4EOT A;  2W27 A;  3NFQ A;  1JMM A;  2XNX A;  3P8C E;  1NTZ K;  2XV5 A;  5APY A;  1NU1 K;  1G1J A;  1CW5 A;  4N3Y B;  1FOS F;  3BVH A;  3UIA A;  3CL3 D;  1ZR2 A;  2ZFC A;  3VOP A;  1N7S C;  3A2A A;  5AVY B;  3B5N C;  3RK3 C;  2FFD C;  1RF1 C;  4I1L A;  1JUN A;  4JYC A;  4EIJ A;  1NKZ B;  2E42 A;  2Z5I A;  5APU A;  1IFD A;  3VP8 A;  2NPS A;  1SQQ K;  1QL2 A;  4GKG A;  2HOD A;  1AFO A;  4WY4 B;  3MTU E;  1J1E B;  1GU4 A;  1RE4 C;  2BAS A;  3HD7 A;  3P7K A;  5APQ A;  1L0L K;  2OAR A;  3OA7 A;  2YKO A;  2XU6 A;  1GL2 A;  5BU8 B;  1GTW A;  1WT6 A;  4GIF A;  1N7S D;  3MIW A;  1RF0 C;  5APS A;  3CLQ A;  1NO4 A;  2C0W A;  3V4Q A;  3B5N D;  3RK3 D;  3A5T A;  1NTK K;  2IFN A;  2E43 A;  1HBW A;  1YTZ T;  3LIE A;  3MGN A;  3B5N B;  2FFD B;  1LTB C;  2R5D A;  1LTI C;  1SFC D;  3NXS A;  1JY2 N;  5CHX A;  1LWU B;  3TNU A;  1RE4 A;  2VRS A;  4JF7 A;  3SWY A;  3BAT A;  5CCH A;  2YO3 A;  5KJ7 A;  1JY2 O;  4C7N A;  4WY4 C;  1SFC A;  5APX A;  2Q5U A;  2HG5 D;  3VMY A;  1J1E C;  2WWW A;  2WPQ A;  2WZ7 A;  3LW5 H;  1SQX K;  2HFE D;  5BU5 A;  4Y99 C;  1GK4 A;  1IK9 A;  2O1J A;  1L4A D;  1LGH B;  3HE4 A;  2N1T A;  1KIL C;  1M1J B;  5KTB A;  5AW5 B;  5CJ0 A;  1FJP A;  1JOC A;  1GD2 E;  4B86 A;  3MD0 A;  2C9N Y;  2I1K A;  2WPR A;  3V4W A;  1DX7 A;  3IR9 A;  1LWU A;  1NTM K;  3TNU B;  1MV8 A;  5AW9 B;  2FXM A;  1MFZ A;  5APV A;  2WSC H;  1G2C B;  4LLH A;  2CPB A;  3RK2 C;  1LTS C;  2KP8 A;  2YKP A;  1A02 J;  2A45 I;  3OJA B;  3L37 A;  4N78 D;  3C9I A;  1QL1 A;  4HH2 A;  1NOH A;  1URQ C;  1L4A B;  3HRN A;  3I5C A;  3V2Q A;  2Z4E A;  1KQL A;  1GL2 B;  4LGD E;  1JCC A;  1GZL A;  2WIT A;  4HYT B;  2N9B A;  3M0A A;  1WRG A;  1LTG C;  2QM7 A;  3KQG A;  3GHG B;  1FZC B;  1T2K D;  2NPS B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...