1N86A

Crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrin alpha/alpha-E chain
total genus 21
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n86A00
1M1JA 2OYHA 2OYIC 2A45I 1RE4C 1RF1C 1N73A 1JY2P 3GHGC 1W2EA 1LT9A 1RF1B 1M1JB 3BVHA 2OYHB 2HLOA 1LT9C 2Z4EA 1FZEA 1FZFA 1FZCA 2HPCA 1LT9B 3HUSC 2H43A 2FFDB 2HODA 2OYIB 3HUSB 2FFDC 1FZCB 1N73C 3GHGB 1FZGA 2A45G 2HPCB 2FFDA 3H32B 1M1JC 2HODB 1FZAA 1FZBA 2OYIA 1JY3P 1LTJB 3E1IA 1RF0A 1FZCC 3HUSA 1T3UA 1N86A 1RE3A 3GHGA 1JY3O 3H32A 1LTJC 1JY2O 1LWUA 1RE3C 2Q9IA 1RF1A 1LTJA 1LWUC 1RF0C 2XNXA 1JY2N 2OYHC 1N73B 1JY3N 1LWUB 1RE4A 2A45H
chains in the Genus database with same CATH superfamily
3PLNA 3RGUA 1WT6A 3RK3C 1N7LA 3A5TA 1RF1C 1SQXJ 2KNCB 3K5BA 4HKZH 4IOIH 1W2EA 1PP9J 2FYNC 1L4AD 1GW3A 1VF5B 2K9JB 3B4SA 3O6QB 1L0LJ 3M9HA 4H0LC 4PD4D 4A7PA 1G1JA 2I1JA 3TGUE 2A06E 1JOCA 3KZIH 3O6QA 4JYBA 4H44B 1Q7YQ 1VQ4P 1N7SB 1AFOA 1SQVE 1L0NK 5EFWB 4GDOA 1KYOH 1L2PA 3RL0B 3USSA 3Q5SA 5AW0B 5E79H 1N86A 1M7LA 4YPCA 2D2CD 3QWOC 2JDIH 5AW4B 2ZVNB 3CCEP 2CK3H 4D6TE 2PAJA 1K73Q 1KN7A 1NOHA 1P84I 3H1JG 4W80A 4L75A 2E76B 1BSNA 1PPJG 3EFGA 4U3FE 3R2PA 1FAVA 1AQTA 1IK7A 2IBZG 2WVRA 3L73G 2LXCB 3L75J 4OH8B 4HB1A 1L0LG 1MZ9A 3RK3B 1RF1B 1NTKD 1IFNA 2NZ2A 3I5CA 3H1IJ 5TJHA 4I6MC 3CCSP 1J1EB 1T3JA 1PGJA 2W8ZA 3AE6C 3N7NA 4IL6E 5KKZC 1YQ4C 2NPSB 2NRGA 3JSVC 5CCHC 1OMIA 1YIJP 2OTJP 1AQ5A 1NH4A 1SLQA 1QLED 1R5SA 1YQ3C 2KLUA 3H1KG 1LTBC 1TU3F 3IAOA 3L72G 3H1JJ 3AE9C 4NPDA 3L71D 3V5BA 2HPCB 1BDCA 1ZP0C 3C1LA 1BCCE 1YTZI 2WSEH 3AEGC 5KLVK 3G71P 1VQOP 1KD1Q 1JMBA 5KLVG 1X9VA 2QA4P 5AVUB 2K88A 4WWIA 1LWUA 3RL0C 5KJ7D 3W68A 2R32A 1EXIA 1CW5A 3HD7C 2QJKB 2OYHC 5CCGA 3A7OA 1R5LA 4U3FJ 1BE3E 3RK3E 3CCQP 2M5AA 4N6JA 1ZW0A 1BCCD 2W6BA 1JTHA 3G4SP 2O01N 2WPSA 2Y0DA 3HTKA 1HVVA 1SQVJ 2N1TB 3IFMA 4OGQC 3Q2YA 1PFIA 3CWBJ 1LT9A 1Q2NA 3V2NA 1LT9C 4JYCA 3N4XA 2J5UA 1YJNP 5KLVJ 1H88A 1EXJA 1QL2A 2KP8A 2ITAA 2BEQD 3OW2O 2WPRA 2PRRA 3IR9A 2KS1A 2IFMA 3B5NC 3H32B 1LTTC 3MIWA 4H0LD 3AEEC 3VYIA 1Q81Q 1BSHA 3T97A 1VQ5P 1CI6B 1LTJC 2V4HA 4YTPC 2G3AA 1NTKG 1MUUA 1QEXA 2RMZA 1W2BO 3T97B 1SQQK 2O1KA 5B5EE 3P7KA 1JO5A 1BGYG 1LTIC 3M9BA 5DJTB 3L73D 1SP4A 1SVFA 2JEEA 2IZ1A 2JP3A 4D6TG 5E79E 2AXTH 3SWKA 2KSJA 2ZT9C 3FGAD 1YBKA 3H1JE 3ITKA 1KILD 2IDBA 3MP7B 4PJ0E 1P84H 3H1LG 5AVVB 1CZQA 3LIDA 1T2KD 3CD6P 2YKOA 5TISH 1RY3A 4Y99C 3Q5RA 1JB0J 1H0TA 3VMAA 4H13B 3CC2P 1VQMP 3B5NA 2OYIB 4OGQB 4H13C 2YNYA 2FFDC 5GTIE 2H88C 1SQPG 1BGYJ 4L73A 1E5WA 1VL2A 3GW6A 4ZNCA 1KILA 3VP8A 1NTZK 1GU4A 1NU1J 1OVRA 3RBXA 3L72E 1A02F 2DW3A 2KK7A 3S1KA 4I7ZC 3CCJP 2XKMA 3RK2B 1GL2A 1FJKA 1GK4A 2IFNA 2KI7B 3A2AA 3O8ZA 4R4LA 2W27A 2YKQA 2W6AA 3L37A 4RO0A 3BCCG 4BXLA 1NTZD 2WSEJ 1N8RQ 1IC2A 1DD4A 2OYOA 2Q6QA 5TISE 2E42A 2FYUJ 1P84E 3H1IG 1L0NG 1EZVE 2WSFH 3OJAB 1VQNP 1SQBD 1KYOE 3TGUJ 1N7SA 1NAFA 3CC7P 1NTMK 4AUWA 2WPQA 3L74G 1PV3A 4UB8E 1YTZT 2M8RA 4L76A 2WPVB 1NU1K 1J1DC 1IFJA 1U57A 1YYCA 2O01H 3E7KA 3MGNA 3H1HD 2POHA 1S9KD 1FZBA 3KPEA 4XA4A 3HE5A 1AV1A 3E1IA 2R5DA 3L75D 4NPEA 4XE5B 1KB9D 3P8CE 4R4MA 5H2FH 3U1AA 4N78D 1FE6A 4JPZB 3SWYA 4EYYQ 1SQBE 2B88A 2XDJA 2FBWC 1EZVD 5AW7B 3VMXA 2AXTE 5APQA 3TSIA 2LR2A 2E74C 2C0WA 3VN0A 3HD7B 2FYUK 3M0AA 2A45I 3CL3D 1M56D 1RE4C 3L71E 3L74J 1BGYE 2H89C 4B86A 1YITP 3KQGA 3V2PA 5C39A 3VMYA 1IFIA 2FYUD 2IYOA 2K37A 2WQYC 1BCCJ 2PGDA 1KQLA 2N1TC 1SQVK 2YO2A 4GIFA 4L74A 1YHQP 1S4XA 1NTZJ 1KORA 3FX0A 1NKNA 5KAFH 3HUSC 5L8RJ 2GUSA 1J1EC 2ZT9D 5CCHD 3CXHE 1SQPJ 4UB6E 1N2DC 3SFDC 2FYZA 3AEFC 1N73C 2W90A 1S3JA 2HYNA 2E74D 1QX8A 1S72P 1NVOA 1S5LX 1NU1D 1PGOA 1KILC 2JJLA 1T3UA 2Q3IA 2YKPA 3L35A 1NJIQ 2ZYDA 4PD4E 3L74D 1URQA 1LJ2A 2W6JH 1KTMA 4Y99B 3FWNA 4LLHA 5AW5B 3BATA 3NXSA 1L0ND 2GA1A 3H1ID 3M91A 1PL5A 2A45H 2P2UA 5APYA 2IX7C 2KUBA 3TDKA 1Y47A 4CPGA 4D6TJ 1GTWA 3WUTA 1HF9A 1NYHA 1PPJE 2BCCJ 1MFTA 1NTZG 3KHUA 4U3FG 3L36A 3VOPA 2KSEA 3RBZA 1JTHB 3RL0g 3CX5I 5CCGC 1LNQA 3TGUD 5KLVE 1FZFA 1L0LE 2D2CC 3U59A 1JM0A 1LT9B 1GZLA 2O1JA 3L73J 3G9RA 4QMAA 3AE8C 1SFCB 1X22A 2J59M 3OA7A 4RJTA 1A02J 1JCCA 1NTKK 1JMMA 1FZGA 2A45G 1PGQA 3EQ2A 5AW2B 2JR8A 5KLIB 4PV1D 2AEJA 1IFDA 1SQPD 2Y0EA 1HGVA 3WMM0 5KTBA 1OXZA 1RE3A 4NPFX 4OGQD 2KB7P 1L4AC 1MFZA 2FY8A 2Q9IA 1LT1A 2L5GB 1FDIA 2B87A 5AVQB 1H89A 1DX7A 1M1KQ 1IFMA 1KZUB 3SWFA 4OVNF 5B66E 1ZOYC 1KB9H 1XTGB 2B87B 2Z5IA 4DJGA 2KZIA 3AE5C 1SQXD 1K05A 4IL6X 3MHVA 1FDOA 2K9YA 3GHGC 3CWBD 4H44D 3B5NB 1M1JB 1N7SD 2N9BA 2NPSC 3CLQA 3BCCD 1BGYD 1FZCA 1ZMEC 2QJYC 3RL0D 2H43A 1LP1A 3VP9A 2O01J 3PH0A 2QEXP 4GT1A 2M3BA 2GUVA 3TNUA 1FZCB 3NFQA 4OWFA 3SSUA 1DEEG 2BEZF 1SQQE 2I1KA 3H1HJ 5CJ4A 1GU5A 3AEAC 2LKMA 1RF0A 3HUSA 4WY4A 4BRYB 1T8ZA 3L75E 3HE4B 3L71J 2QJPB 1ZN5A 1ZRTD 1JCDA 4GKGA 1LTJA 1SQBJ 2QRXA 3F89A 1JY2N 2AEMA 3CCRP 2YIUB 4I7ZB 2O3JA 3D70A 1RE4A 1GDTA 2HG5D 1ZR2A 1KYOD 3L70D 2G8YA 2BCCD 2OQQA 3BRTB 3LIEA 1MV8A 5KAIE 3PRJA 4DCKA 2WT7A 1URQD 1Q82Q 3BVHA 4D6TD 1G2CA 2Z4EA 1FOSE 3I55P 3VMZA 1OX3A 1USDA 2WSCH 1IO4A 1DIPA 1DD3A 2ZJSE 3A0HE 1YI2P 1RHZB 3C9IA 1G2CB 2YXQB 3M9QA 4HH2A 1VQ8P 2OARA 1USEA 1OVUA 1SQVD 2FXMA 2IBZI 5KLVD 4N3YB 4GODA 1NAYA 4UB6H 4HYTB 4TLFA 1AVOA 1PP9E 1ZXGA 4ZMDA 1JUNA 1GD2E 1WMKA 2WSFJ 3EWKA 5KAFE 4IFMA 1X0TA 1RE3C 3TK1A 1QL1A 1S2EA 3HE5B 1FOSF 1EDIA 2Y9YA 2VRSA 2Y0CA 3PHLA 1L0NE 1GK6A 1SQVG 1KC8Q 2D2CB 3CMEP 3MTUE 1NTME 1L0LD 3M0DA 2OYHA 3E1RA 1N73A 1KV4A 3CX5E 1D7MA 1NU1E 1PP9D 1KMIZ 3II6A 2QJKC 2R5BA 2PFXA 5APVA 1PPJD 1BCCG 2OYHB 1VQ9P 3CC4P 1HJ0A 3H1JD 3CMAP 1YJWP 2BCCG 3L70G 2LXBA 2HPCA 1GMJA 3LW5H 3NTNA 5BU5A 3H1IE 3CXHD 4LGDE 5K5GB 2FFDB 1E79H 1SQBK 1S5LE 3VTPC 1VQ6P 2KOGA 3CCLP 4XFJA 5AVWB 2NPSD 1LTGC 3M06A 1OIPA 3L74E 2FKWB 1JY3P 1NTKJ 3PJSK 2Q7CA 2AEFA 3KYQA 2ZVOB 3L71G 5DJUB 1NGMB 4KJMA 3CPWO 1KFNA 3H1KD 1JY2O 1FBMA 2SPZA 1UIXA 2XU6A 4RKUJ 3GF7A 4W7ZA 5M1BA 4YXDC 2QIWA 1DH3A 2N1TD 1VQKP 2C9NY 1LWUB 2JO1A 1FC2C 1URQB 2IPPA 1KB9I 2M0BA 4H13D 2B9BA 3L4FA 2HFED 1EDJA 3B71A 4JQ0D 2P10A 2WWWA 3GMAA 3QH9A 3A0BH 2E5TA 4WBAA 1R8EA 4EDFA 1QVGO 2QE7H 2Q3EA 2KZJA 2E76D 2IBZD 1DEBA 1Z56A 4ASWA 2I8DA 1K04A 2N1TA 2P67A 2FXOA 5APWA 1ZR4A 2ZYAA 4C7NA 1OZHA 3P8MC 1BE3D 3RK3D 1KQSO 1CI6A 2YIUC 2HODB 5GTIH 2C9LY 4C7NB 1P84D 2CPBA 3PP5A 5AVXB 3V4WA 3CWBE 5CBOA 2WITA 3HRNA 1KB9E 3P8CD 5B5EH 1SQXE 3V6IA 4ZKUA 5AW8B 3H32A 2QVAA 3UIAA 1JNMA 1S9KE 3H1LE 4WB4A 1PP9G 3JCUH 1QGKB 4KHXA 2XNDH 1J2JB 1NHLA 3GF3A 3L72J 4K35A 2IZ0A 3FWLA 1Q90D 2P1JA 1OW7A 1S1CX 5AW1B 3MZWB 4LC1A 4BWNA 5GTHE 1LGHB 5BU8B 5AVTB 2KXPB 4HJGH 2E5YA 1EZVI 2P58A 3TGUG 1SQPE 1NTKE 3IF4A 5KJ7C 5AVYB 2OTKE 4EI2A 1EC5A 2C0XA 2N9YB 4EIJA 2QG4A 1FJPA 1NTZE 2P7JA 2RN0A 2W83C 3EFFK 3M0DC 4AYCA 1CSBA 3CCVP 3AE7C 2E75B 1PGPA 2FXPA 2YMKA 3L70E 3AE4C 3KDPB 1LP1B 1IJDB 2OGUA 1VQPP 1U7JA 1HJBA 1QVFO 2Q5UA 3P32A 2UWJE 4DT0A 1RH5B 1OFCX 2QM7A 2K1AA 2QJYB 3AEBC 3CXHH 4AQRD 1K8AQ 4IFDK 2MJZA 1RF0C 2IBZE 3A0HH 4H44C 3FXEA 4TT3H 5AVZB 3D71A 2K3RA 3FXDA 4GOFA 4H0LB 4ASVA 3H1KJ 4C46A 3CCMP 2A06D 1OW6A 1MKMA 2PP6A 3C8VA 3MD0A 2K9JA 4M3LA 1GL2B 5CMZA 1SQQD 1OVVA 3RK2D 2KIKA 1VF5C 3D6ZA 1HH0A 1JY2P 2Z5HA 3V4QA 4I1LA 2BASA 3CCUP 4PV1C 2E43A 1BDDA 2ZXEB 3CXHI 1FZEA 2E74B 2L91A 3WUVA 2WT7B 1JEKA 3BCCE 1HBWA 1M8OB 2Q1KA 3L73E 1X8YA 1IZNB 4PD4I 1XTCC 1SS1A 4O9BA 2YXRB 3JCUE 4RESB 2E76C 3S4RA 1K9MQ 4WY4D 3SFEC 1EQ7A 1EZVG 3F5HA 4K3AA 1AJYA 2FYUE 2WMMA 4GOEA 2IYPA 2JKVA 2KLVA 1L4AA 1IK9A 1BE3J 2RKLA 4UB8H 3RK2C 3HD7A 1T2KC 3D6YA 4YXWH 5AW3B 1LWUC 3CWBG 1H8AA 2HR3A 3H1KE 3WU2H 1SQXG 1L4AB 5AVRB 3V2RA 1N73B 2KYVA 3BASA 1RF1A 1VQLP 1ZLLA 3AE2C 3U1CA 1NTMD 3AE1C 3NMDA 1FS0E 4N78E 3H6PA 3HD7D 1SQBG 2NPSA 1GL2C 2RH0A 3A0BE 2E75D 1SQQJ 3GLMA 3H1HE 1YJ9P 5B66H 2FYNB 3Q3DA 2ZYGA 2ZFCA 3H25A 2V7QJ 3WUUA 1KYOI 4PJ0H 5CBNA 1HWTC 3WU2E 5APUA 1UIIA 3G3ZA 1PIXA 3CX5D 2QSIA 2FFDA 1FZAA 1ZV8A 2WSSH 3S9OA 3G6EP 1N7SC 3Q5PA 1EDKA 1Q86Q 1M90Q 1U7MA 4C7RA 2M5AB 3Q1MA 2R3SA 1NTMJ 2JWDA 1KQGB 3H1LJ 3LW5J 1GL2D 1M57D 2QM8A 3PTZA 4U3FD 3ZDMA 1JY3N 3B5ND 2H7HA 2H8PD 1VPCA 1AA0A 2M3EA 4PD4H 1X79B 2ZAEB 4Z1MH 3I56P 2XV5A 3AEDC 3B8EB 1FU1A 3MUDA 4KT0J 2AXCA 1PZQA 2B89A 3MUDC 2CPSA 1G1IA 3AECC 1NWQA 5AVSB 1Y9BA 1NTMG 2A06G 2R3CA 4MN4C 5KLIC 1SFCA 3HTKB 4WY4C 3KZIE 3H1LD 5APXA 1ZRTE 3OAKA 4DOJA 1NU1G 3JC22 3TYYA 2HODA 2YMYA 1S5LH 1VF5D 1GW4A 2ZXXA 3BCCJ 1Y8AA 2V7QH 2BCCE 1NO4A 1WRGA 2GM4A 1RQUA 1URQC 5AW9B 1FZCC 1L0LK 2J58A 1HUCA 1LTAC 2ZT9B 1KILE 2KS1B 5AW6B 1T6AA 2XZRA 3CX5H 2XNXA 2FYUG 4PV1B 2WSCJ 5CCHA 2QJPC 2Y9ZA 5CJ0A 2OTLP 4ZKPA 5APTA 1M1JA 2OYIC 5H2FE 1SFCC 3L70J 1VDFA 2R44A 4I2LC 1EDLA 2YO3A 1SQQG 4U7JA 2HLOA 2JWAA 1KFMA 5BVZA 1W5CE 1FDMA 5GTHH 1IFPA 3A3YB 4Y28J 3L75G 4DZOA 5KJ7A 1SQXK 1OW8A 3GG2A 2WZ7A 3H1HG 3KXDA 1AVYA 1OWAA 3HUSB 1H0TB 3GHGB 1LTSC 3IN6A 4JF7A 1M1JC 2E75C 5CHXA 3R4YA 4IFFA 3AE3C 2OYIA 1LTJB 3TNUB 3BRVB 3GHGA 1BE3G 4W7YA 1JY3O 1RQVA 1SFCD 1L0NJ 3ABVC 5APSA 3V2QA 5KAIH 3TF5A 2WTYA 1KILB 1HGZA 1VQ7P 1J1DB 1SQPK 5CCGD 4IL6H 3CI9A 2MKVA 4WY4B 4WVZA 3L72D 2KNCA 1KQFB 3HE4A 3W67A 4BRYA 4JBZA 1HTLC 5KKZB 1NKZB 4EOTA
chains in the Genus database with same CATH topology
1WT6A 3RK3C 1N7LA 3A5TA 1RF1C 1W2EA 1L4AD 1GW3A 3M9HA 1G1JA 2I1JA 1JOCA 4JYBA 1N7SB 1AFOA 1L0NK 3RL0B 5AW0B 1N86A 1M7LA 5AW4B 2PAJA 1NOHA 4W80A 3EFGA 3R2PA 1FAVA 4OH8B 1MZ9A 3RK3B 1RF1B 1IFNA 3I5CA 4I6MC 1J1EB 1T3JA 3N7NA 2NPSB 1AQ5A 1NH4A 1SLQA 3V5BA 1LTBC 2HPCB 1YTZI 2WSEH 5KLVK 1X9VA 5AVUB 1LWUA 3RL0C 5KJ7D 2R32A 1CW5A 3HD7C 2OYHC 5CCGA 3A7OA 4N6JA 2W6BA 1JTHA 2WPSA 3HTKA 3IFMA 1HVVA 2N1TB 1PFIA 3V2NA 1LT9A 1LT9C 4JYCA 3N4XA 1H88A 1QL2A 2KP8A 2WPRA 3IR9A 2IFMA 3B5NC 3H32B 1LTTC 3MIWA 3VYIA 3T97A 1CI6B 1LTJC 1MUUA 1SQQK 2O1KA 1JO5A 3P7KA 1LTIC 3M9BA 1SP4A 1SVFA 2JEEA 2KSJA 5CCHC 1KILD 5AVVB 3LIDA 1CZQA 1T2KD 2YKOA 1RY3A 4Y99C 3B5NA 2OYIB 2YNYA 2FFDC 1E5WA 1KILA 3VP8A 1NTZK 1GU4A 1A02F 2XKMA 3RK2B 1GL2A 1FJKA 1GK4A 2IFNA 3A2AA 3O8ZA 2W27A 2YKQA 2W6AA 3L37A 1IC2A 2E42A 3OJAB 2WSFH 1N7SA 1NAFA 1NTMK 2WPQA 1YTZT 2M8RA 1NU1K 1J1DC 1IFJA 1YYCA 2O01H 3MGNA 2POHA 1S9KD 1FZBA 3KPEA 4XA4A 3HE5A 3E1IA 4XE5B 2R5DA 4DOJA 3P8CE 3U1AA 4N78D 3SWYA 2XDJA 5AW7B 3VMXA 3TSIA 5APQA 2C0WA 3VN0A 3HD7B 2FYUK 3M0AA 2A45I 3CL3D 1RE4C 4B86A 3KQGA 3V2PA 3VMYA 1IFIA 2YO2A 1KQLA 2N1TC 1SQVK 4GIFA 1NKNA 3HUSC 2GUSA 1J1EC 5CCHD 1N2DC 1N73C 2FYZA 2HYNA 3L35A 2JJLA 1KILC 1T3UA 2Q3IA 2YKPA 1URQA 4Y99B 4LLHA 5AW5B 3BATA 3NXSA 3M91A 5APYA 2P2UA 2A45H 2IX7C 1GTWA 3VOPA 3L36A 1JTHB 5CCGC 1FZFA 3U59A 1LT9B 2O1JA 1GZLA 3OA7A 1SFCB 2J59M 1A02J 1JCCA 1NTKK 1JMMA 1FZGA 2A45G 3EQ2A 5AW2B 1IFDA 1HGVA 3WMM0 5KTBA 1OXZA 1RE3A 2KB7P 1L4AC 1MFZA 2Q9IA 2L5GB 5AVQB 1H89A 1DX7A 1IFMA 1KZUB 3SWFA 1XTGB 2Z5IA 3GHGC 3B5NB 1M1JB 1N7SD 2N9BA 2NPSC 3CLQA 1FZCA 3RL0D 2H43A 3VP9A 4GT1A 2M3BA 2GUVA 3TNUA 1FZCB 3NFQA 2I1KA 5CJ4A 1GU5A 2LKMA 1RF0A 3HUSA 4WY4A 1T8ZA 3HE4B 1ZN5A 1JCDA 4GKGA 1LTJA 1JY2N 1RE4A 1GDTA 2HG5D 1ZR2A 3LIEA 3BRTB 2WT7A 1MV8A 1URQD 3BVHA 1G2CA 2Z4EA 1FOSE 3VMZA 2WSCH 1IO4A 3C9IA 1G2CB 3M9QA 4HH2A 2OARA 2FXMA 4N3YB 4HYTB 1JUNA 1GD2E 3TK1A 1FOSF 4IFMA 1RE3C 1QL1A 3HE5B 2VRSA 1GK6A 3MTUE 2OYHA 3M0DA 1N73A 3II6A 5APVA 2OYHB 2R5BA 2HPCA 2FFDB 3LW5H 3NTNA 5BU5A 4LGDE 1SQBK 3VTPC 2KOGA 5AVWB 2NPSD 1LTGC 3M06A 2FKWB 1JY3P 2Q7CA 3KYQA 1KFNA 1JY2O 1FBMA 2XU6A 1DH3A 4AUWA 4W7ZA 2N1TD 2C9NY 1LWUB 1URQB 2IPPA 3L4FA 2HFED 2WWWA 4WBAA 1DEBA 1Z56A 2N1TA 2P67A 5APWA 1ZR4A 4C7NA 3P8MC 3RK3D 1CI6A 2HODB 2C9LY 4C7NB 2CPBA 3PP5A 5AVXB 3V4WA 2WITA 3HRNA 3P8CD 4ZKUA 5AW8B 3H32A 1JNMA 3UIAA 1S9KE 4WB4A 4KHXA 1J2JB 1NHLA 2P1JA 5AW1B 4LC1A 1LGHB 5BU8B 5AVTB 5KJ7C 5AVYB 2C0XA 4EIJA 1FJPA 2P7JA 3M0DC 4AYCA 1CSBA 3KDPB 1IJDB 1HJBA 2Q5UA 3P32A 4AQRD 4IFDK 2QM7A 2MJZA 1RF0C 5AVZB 4C46A 4M3LA 2PP6A 3MD0A 5CMZA 1GL2B 3RK2D 1HH0A 1JY2P 2Z5HA 3V4QA 4I1LA 2BASA 2E43A 2ZXEB 1FZEA 2WT7B 1HBWA 1X8YA 1XTCC 4O9BA 4RESB 4WY4D 1EQ7A 2KLVA 1L4AA 1IK9A 3RK2C 3HD7A 1T2KC 5AW3B 1LWUC 1H8AA 1N73B 3V2RA 1L4AB 5AVRB 2KYVA 3BASA 1RF1A 1ZLLA 3U1CA 3NMDA 4N78E 3H6PA 3HD7D 2NPSA 1GL2C 2ZFCA 1HWTC 5APUA 3G3ZA 2FFDA 1FZAA 1ZV8A 1N7SC 4C7RA 2H7HA 1GL2D 2QM8A 1JY3N 3B5ND 2H8PD 1VPCA 1X79B 2XV5A 3B8EB 1FU1A 3MUDA 2CPSA 1G1IA 1NWQA 5AVSB 2R3CA 1SFCA 3HTKB 4WY4C 5APXA 3OAKA 3TYYA 2HODA 2YMYA 1GW4A 1NO4A 1WRGA 2GM4A 5AW9B 1URQC 1FZCC 1L0LK 2J58A 1HUCA 1LTAC 5AW6B 2XZRA 2XNXA 5CCHA 5CJ0A 4ZKPA 5APTA 1M1JA 2OYIC 1SFCC 1VDFA 4I2LC 2YO3A 2HLOA 1KFMA 5BVZA 1FDMA 3A3YB 4DZOA 5KJ7A 1SQXK 2WZ7A 1OWAA 3HUSB 3GHGB 1LTSC 4JF7A 1M1JC 2OYIA 5CHXA 4IFFA 1LTJB 3TNUB 3BRVB 3GHGA 5APSA 4W7YA 1JY3O 1SFCD 3V2QA 2WTYA 1KILB 1HGZA 1J1DB 1SQPK 5CCGD 3CI9A 4WY4B 3HE4A 1HTLC 1NKZB 4EOTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1M1J A;  2OYH A;  2OYI C;  2A45 I;  1RE4 C;  1RF1 C;  1N73 A;  1JY2 P;  3GHG C;  1W2E A;  1LT9 A;  1RF1 B;  1M1J B;  3BVH A;  2OYH B;  2HLO A;  1LT9 C;  2Z4E A;  1FZE A;  1FZF A;  1FZC A;  2HPC A;  1LT9 B;  3HUS C;  2H43 A;  2FFD B;  2HOD A;  2OYI B;  3HUS B;  2FFD C;  1FZC B;  1N73 C;  3GHG B;  1FZG A;  2A45 G;  2HPC B;  2FFD A;  3H32 B;  1M1J C;  2HOD B;  1FZA A;  1FZB A;  2OYI A;  1JY3 P;  1LTJ B;  3E1I A;  1RF0 A;  1FZC C;  3HUS A;  1T3U A;  1N86 A;  1RE3 A;  3GHG A;  1JY3 O;  3H32 A;  1LTJ C;  1JY2 O;  1LWU A;  1RE3 C;  2Q9I A;  1RF1 A;  1LTJ A;  1LWU C;  1RF0 C;  2XNX A;  1JY2 N;  2OYH C;  1N73 B;  1JY3 N;  1LWU B;  1RE4 A;  2A45 H; 
#chains in the Genus database with same CATH topology
 3PLN A;  3RGU A;  1WT6 A;  3RK3 C;  1N7L A;  3A5T A;  1RF1 C;  1SQX J;  2KNC B;  3K5B A;  4HKZ H;  4IOI H;  1W2E A;  1PP9 J;  2FYN C;  1L4A D;  1GW3 A;  1VF5 B;  2K9J B;  3B4S A;  3O6Q B;  1L0L J;  3M9H A;  4H0L C;  4PD4 D;  4A7P A;  1G1J A;  2I1J A;  3TGU E;  2A06 E;  1JOC A;  3KZI H;  3O6Q A;  4JYB A;  4H44 B;  1Q7Y Q;  1VQ4 P;  1N7S B;  1AFO A;  1SQV E;  1L0N K;  5EFW B;  4GDO A;  1KYO H;  1L2P A;  3RL0 B;  3USS A;  3Q5S A;  5AW0 B;  5E79 H;  1N86 A;  1M7L A;  4YPC A;  2D2C D;  3QWO C;  2JDI H;  5AW4 B;  2ZVN B;  3CCE P;  2CK3 H;  4D6T E;  2PAJ A;  1K73 Q;  1KN7 A;  1NOH A;  1P84 I;  3H1J G;  4W80 A;  4L75 A;  2E76 B;  1BSN A;  1PPJ G;  3EFG A;  4U3F E;  3R2P A;  1FAV A;  1AQT A;  1IK7 A;  2IBZ G;  2WVR A;  3L73 G;  2LXC B;  3L75 J;  4OH8 B;  4HB1 A;  1L0L G;  1MZ9 A;  3RK3 B;  1RF1 B;  1NTK D;  1IFN A;  2NZ2 A;  3I5C A;  3H1I J;  5TJH A;  4I6M C;  3CCS P;  1J1E B;  1T3J A;  1PGJ A;  2W8Z A;  3AE6 C;  3N7N A;  4IL6 E;  5KKZ C;  1YQ4 C;  2NPS B;  2NRG A;  3JSV C;  5CCH C;  1OMI A;  1YIJ P;  2OTJ P;  1AQ5 A;  1NH4 A;  1SLQ A;  1QLE D;  1R5S A;  1YQ3 C;  2KLU A;  3H1K G;  1LTB C;  1TU3 F;  3IAO A;  3L72 G;  3H1J J;  3AE9 C;  4NPD A;  3L71 D;  3V5B A;  2HPC B;  1BDC A;  1ZP0 C;  3C1L A;  1BCC E;  1YTZ I;  2WSE H;  3AEG C;  5KLV K;  3G71 P;  1VQO P;  1KD1 Q;  1JMB A;  5KLV G;  1X9V A;  2QA4 P;  5AVU B;  2K88 A;  4WWI A;  1LWU A;  3RL0 C;  5KJ7 D;  3W68 A;  2R32 A;  1EXI A;  1CW5 A;  3HD7 C;  2QJK B;  2OYH C;  5CCG A;  3A7O A;  1R5L A;  4U3F J;  1BE3 E;  3RK3 E;  3CCQ P;  2M5A A;  4N6J A;  1ZW0 A;  1BCC D;  2W6B A;  1JTH A;  3G4S P;  2O01 N;  2WPS A;  2Y0D A;  3HTK A;  1HVV A;  1SQV J;  2N1T B;  3IFM A;  4OGQ C;  3Q2Y A;  1PFI A;  3CWB J;  1LT9 A;  1Q2N A;  3V2N A;  1LT9 C;  4JYC A;  3N4X A;  2J5U A;  1YJN P;  5KLV J;  1H88 A;  1EXJ A;  1QL2 A;  2KP8 A;  2ITA A;  2BEQ D;  3OW2 O;  2WPR A;  2PRR A;  3IR9 A;  2KS1 A;  2IFM A;  3B5N C;  3H32 B;  1LTT C;  3MIW A;  4H0L D;  3AEE C;  3VYI A;  1Q81 Q;  1BSH A;  3T97 A;  1VQ5 P;  1CI6 B;  1LTJ C;  2V4H A;  4YTP C;  2G3A A;  1NTK G;  1MUU A;  1QEX A;  2RMZ A;  1W2B O;  3T97 B;  1SQQ K;  2O1K A;  5B5E E;  3P7K A;  1JO5 A;  1BGY G;  1LTI C;  3M9B A;  5DJT B;  3L73 D;  1SP4 A;  1SVF A;  2JEE A;  2IZ1 A;  2JP3 A;  4D6T G;  5E79 E;  2AXT H;  3SWK A;  2KSJ A;  2ZT9 C;  3FGA D;  1YBK A;  3H1J E;  3ITK A;  1KIL D;  2IDB A;  3MP7 B;  4PJ0 E;  1P84 H;  3H1L G;  5AVV B;  1CZQ A;  3LID A;  1T2K D;  3CD6 P;  2YKO A;  5TIS H;  1RY3 A;  4Y99 C;  3Q5R A;  1JB0 J;  1H0T A;  3VMA A;  4H13 B;  3CC2 P;  1VQM P;  3B5N A;  2OYI B;  4OGQ B;  4H13 C;  2YNY A;  2FFD C;  5GTI E;  2H88 C;  1SQP G;  1BGY J;  4L73 A;  1E5W A;  1VL2 A;  3GW6 A;  4ZNC A;  1KIL A;  3VP8 A;  1NTZ K;  1GU4 A;  1NU1 J;  1OVR A;  3RBX A;  3L72 E;  1A02 F;  2DW3 A;  2KK7 A;  3S1K A;  4I7Z C;  3CCJ P;  2XKM A;  3RK2 B;  1GL2 A;  1FJK A;  1GK4 A;  2IFN A;  2KI7 B;  3A2A A;  3O8Z A;  4R4L A;  2W27 A;  2YKQ A;  2W6A A;  3L37 A;  4RO0 A;  3BCC G;  4BXL A;  1NTZ D;  2WSE J;  1N8R Q;  1IC2 A;  1DD4 A;  2OYO A;  2Q6Q A;  5TIS E;  2E42 A;  2FYU J;  1P84 E;  3H1I G;  1L0N G;  1EZV E;  2WSF H;  3OJA B;  1VQN P;  1SQB D;  1KYO E;  3TGU J;  1N7S A;  1NAF A;  3CC7 P;  1NTM K;  4AUW A;  2WPQ A;  3L74 G;  1PV3 A;  4UB8 E;  1YTZ T;  2M8R A;  4L76 A;  2WPV B;  1NU1 K;  1J1D C;  1IFJ A;  1U57 A;  1YYC A;  2O01 H;  3E7K A;  3MGN A;  3H1H D;  2POH A;  1S9K D;  1FZB A;  3KPE A;  4XA4 A;  3HE5 A;  1AV1 A;  3E1I A;  2R5D A;  3L75 D;  4NPE A;  4XE5 B;  1KB9 D;  3P8C E;  4R4M A;  5H2F H;  3U1A A;  4N78 D;  1FE6 A;  4JPZ B;  3SWY A;  4EYY Q;  1SQB E;  2B88 A;  2XDJ A;  2FBW C;  1EZV D;  5AW7 B;  3VMX A;  2AXT E;  5APQ A;  3TSI A;  2LR2 A;  2E74 C;  2C0W A;  3VN0 A;  3HD7 B;  2FYU K;  3M0A A;  2A45 I;  3CL3 D;  1M56 D;  1RE4 C;  3L71 E;  3L74 J;  1BGY E;  2H89 C;  4B86 A;  1YIT P;  3KQG A;  3V2P A;  5C39 A;  3VMY A;  1IFI A;  2FYU D;  2IYO A;  2K37 A;  2WQY C;  1BCC J;  2PGD A;  1KQL A;  2N1T C;  1SQV K;  2YO2 A;  4GIF A;  4L74 A;  1YHQ P;  1S4X A;  1NTZ J;  1KOR A;  3FX0 A;  1NKN A;  5KAF H;  3HUS C;  5L8R J;  2GUS A;  1J1E C;  2ZT9 D;  5CCH D;  3CXH E;  1SQP J;  4UB6 E;  1N2D C;  3SFD C;  2FYZ A;  3AEF C;  1N73 C;  2W90 A;  1S3J A;  2HYN A;  2E74 D;  1QX8 A;  1S72 P;  1NVO A;  1S5L X;  1NU1 D;  1PGO A;  1KIL C;  2JJL A;  1T3U A;  2Q3I A;  2YKP A;  3L35 A;  1NJI Q;  2ZYD A;  4PD4 E;  3L74 D;  1URQ A;  1LJ2 A;  2W6J H;  1KTM A;  4Y99 B;  3FWN A;  4LLH A;  5AW5 B;  3BAT A;  3NXS A;  1L0N D;  2GA1 A;  3H1I D;  3M91 A;  1PL5 A;  2A45 H;  2P2U A;  5APY A;  2IX7 C;  2KUB A;  3TDK A;  1Y47 A;  4CPG A;  4D6T J;  1GTW A;  3WUT A;  1HF9 A;  1NYH A;  1PPJ E;  2BCC J;  1MFT A;  1NTZ G;  3KHU A;  4U3F G;  3L36 A;  3VOP A;  2KSE A;  3RBZ A;  1JTH B;  3RL0 g;  3CX5 I;  5CCG C;  1LNQ A;  3TGU D;  5KLV E;  1FZF A;  1L0L E;  2D2C C;  3U59 A;  1JM0 A;  1LT9 B;  1GZL A;  2O1J A;  3L73 J;  3G9R A;  4QMA A;  3AE8 C;  1SFC B;  1X22 A;  2J59 M;  3OA7 A;  4RJT A;  1A02 J;  1JCC A;  1NTK K;  1JMM A;  1FZG A;  2A45 G;  1PGQ A;  3EQ2 A;  5AW2 B;  2JR8 A;  5KLI B;  4PV1 D;  2AEJ A;  1IFD A;  1SQP D;  2Y0E A;  1HGV A;  3WMM 0;  5KTB A;  1OXZ A;  1RE3 A;  4NPF X;  4OGQ D;  2KB7 P;  1L4A C;  1MFZ A;  2FY8 A;  2Q9I A;  1LT1 A;  2L5G B;  1FDI A;  2B87 A;  5AVQ B;  1H89 A;  1DX7 A;  1M1K Q;  1IFM A;  1KZU B;  3SWF A;  4OVN F;  5B66 E;  1ZOY C;  1KB9 H;  1XTG B;  2B87 B;  2Z5I A;  4DJG A;  2KZI A;  3AE5 C;  1SQX D;  1K05 A;  4IL6 X;  3MHV A;  1FDO A;  2K9Y A;  3GHG C;  3CWB D;  4H44 D;  3B5N B;  1M1J B;  1N7S D;  2N9B A;  2NPS C;  3CLQ A;  3BCC D;  1BGY D;  1FZC A;  1ZME C;  2QJY C;  3RL0 D;  2H43 A;  1LP1 A;  3VP9 A;  2O01 J;  3PH0 A;  2QEX P;  4GT1 A;  2M3B A;  2GUV A;  3TNU A;  1FZC B;  3NFQ A;  4OWF A;  3SSU A;  1DEE G;  2BEZ F;  1SQQ E;  2I1K A;  3H1H J;  5CJ4 A;  1GU5 A;  3AEA C;  2LKM A;  1RF0 A;  3HUS A;  4WY4 A;  4BRY B;  1T8Z A;  3L75 E;  3HE4 B;  3L71 J;  2QJP B;  1ZN5 A;  1ZRT D;  1JCD A;  4GKG A;  1LTJ A;  1SQB J;  2QRX A;  3F89 A;  1JY2 N;  2AEM A;  3CCR P;  2YIU B;  4I7Z B;  2O3J A;  3D70 A;  1RE4 A;  1GDT A;  2HG5 D;  1ZR2 A;  1KYO D;  3L70 D;  2G8Y A;  2BCC D;  2OQQ A;  3BRT B;  3LIE A;  1MV8 A;  5KAI E;  3PRJ A;  4DCK A;  2WT7 A;  1URQ D;  1Q82 Q;  3BVH A;  4D6T D;  1G2C A;  2Z4E A;  1FOS E;  3I55 P;  3VMZ A;  1OX3 A;  1USD A;  2WSC H;  1IO4 A;  1DIP A;  1DD3 A;  2ZJS E;  3A0H E;  1YI2 P;  1RHZ B;  3C9I A;  1G2C B;  2YXQ B;  3M9Q A;  4HH2 A;  1VQ8 P;  2OAR A;  1USE A;  1OVU A;  1SQV D;  2FXM A;  2IBZ I;  5KLV D;  4N3Y B;  4GOD A;  1NAY A;  4UB6 H;  4HYT B;  4TLF A;  1AVO A;  1PP9 E;  1ZXG A;  4ZMD A;  1JUN A;  1GD2 E;  1WMK A;  2WSF J;  3EWK A;  5KAF E;  4IFM A;  1X0T A;  1RE3 C;  3TK1 A;  1QL1 A;  1S2E A;  3HE5 B;  1FOS F;  1EDI A;  2Y9Y A;  2VRS A;  2Y0C A;  3PHL A;  1L0N E;  1GK6 A;  1SQV G;  1KC8 Q;  2D2C B;  3CME P;  3MTU E;  1NTM E;  1L0L D;  3M0D A;  2OYH A;  3E1R A;  1N73 A;  1KV4 A;  3CX5 E;  1D7M A;  1NU1 E;  1PP9 D;  1KMI Z;  3II6 A;  2QJK C;  2R5B A;  2PFX A;  5APV A;  1PPJ D;  1BCC G;  2OYH B;  1VQ9 P;  3CC4 P;  1HJ0 A;  3H1J D;  3CMA P;  1YJW P;  2BCC G;  3L70 G;  2LXB A;  2HPC A;  1GMJ A;  3LW5 H;  3NTN A;  5BU5 A;  3H1I E;  3CXH D;  4LGD E;  5K5G B;  2FFD B;  1E79 H;  1SQB K;  1S5L E;  3VTP C;  1VQ6 P;  2KOG A;  3CCL P;  4XFJ A;  5AVW B;  2NPS D;  1LTG C;  3M06 A;  1OIP A;  3L74 E;  2FKW B;  1JY3 P;  1NTK J;  3PJS K;  2Q7C A;  2AEF A;  3KYQ A;  2ZVO B;  3L71 G;  5DJU B;  1NGM B;  4KJM A;  3CPW O;  1KFN A;  3H1K D;  1JY2 O;  1FBM A;  2SPZ A;  1UIX A;  2XU6 A;  4RKU J;  3GF7 A;  4W7Z A;  5M1B A;  4YXD C;  2QIW A;  1DH3 A;  2N1T D;  1VQK P;  2C9N Y;  1LWU B;  2JO1 A;  1FC2 C;  1URQ B;  2IPP A;  1KB9 I;  2M0B A;  4H13 D;  2B9B A;  3L4F A;  2HFE D;  1EDJ A;  3B71 A;  4JQ0 D;  2P10 A;  2WWW A;  3GMA A;  3QH9 A;  3A0B H;  2E5T A;  4WBA A;  1R8E A;  4EDF A;  1QVG O;  2QE7 H;  2Q3E A;  2KZJ A;  2E76 D;  2IBZ D;  1DEB A;  1Z56 A;  4ASW A;  2I8D A;  1K04 A;  2N1T A;  2P67 A;  2FXO A;  5APW A;  1ZR4 A;  2ZYA A;  4C7N A;  1OZH A;  3P8M C;  1BE3 D;  3RK3 D;  1KQS O;  1CI6 A;  2YIU C;  2HOD B;  5GTI H;  2C9L Y;  4C7N B;  1P84 D;  2CPB A;  3PP5 A;  5AVX B;  3V4W A;  3CWB E;  5CBO A;  2WIT A;  3HRN A;  1KB9 E;  3P8C D;  5B5E H;  1SQX E;  3V6I A;  4ZKU A;  5AW8 B;  3H32 A;  2QVA A;  3UIA A;  1JNM A;  1S9K E;  3H1L E;  4WB4 A;  1PP9 G;  3JCU H;  1QGK B;  4KHX A;  2XND H;  1J2J B;  1NHL A;  3GF3 A;  3L72 J;  4K35 A;  2IZ0 A;  3FWL A;  1Q90 D;  2P1J A;  1OW7 A;  1S1C X;  5AW1 B;  3MZW B;  4LC1 A;  4BWN A;  5GTH E;  1LGH B;  5BU8 B;  5AVT B;  2KXP B;  4HJG H;  2E5Y A;  1EZV I;  2P58 A;  3TGU G;  1SQP E;  1NTK E;  3IF4 A;  5KJ7 C;  5AVY B;  2OTK E;  4EI2 A;  1EC5 A;  2C0X A;  2N9Y B;  4EIJ A;  2QG4 A;  1FJP A;  1NTZ E;  2P7J A;  2RN0 A;  2W83 C;  3EFF K;  3M0D C;  4AYC A;  1CSB A;  3CCV P;  3AE7 C;  2E75 B;  1PGP A;  2FXP A;  2YMK A;  3L70 E;  3AE4 C;  3KDP B;  1LP1 B;  1IJD B;  2OGU A;  1VQP P;  1U7J A;  1HJB A;  1QVF O;  2Q5U A;  3P32 A;  2UWJ E;  4DT0 A;  1RH5 B;  1OFC X;  2QM7 A;  2K1A A;  2QJY B;  3AEB C;  3CXH H;  4AQR D;  1K8A Q;  4IFD K;  2MJZ A;  1RF0 C;  2IBZ E;  3A0H H;  4H44 C;  3FXE A;  4TT3 H;  5AVZ B;  3D71 A;  2K3R A;  3FXD A;  4GOF A;  4H0L B;  4ASV A;  3H1K J;  4C46 A;  3CCM P;  2A06 D;  1OW6 A;  1MKM A;  2PP6 A;  3C8V A;  3MD0 A;  2K9J A;  4M3L A;  1GL2 B;  5CMZ A;  1SQQ D;  1OVV A;  3RK2 D;  2KIK A;  1VF5 C;  3D6Z A;  1HH0 A;  1JY2 P;  2Z5H A;  3V4Q A;  4I1L A;  2BAS A;  3CCU P;  4PV1 C;  2E43 A;  1BDD A;  2ZXE B;  3CXH I;  1FZE A;  2E74 B;  2L91 A;  3WUV A;  2WT7 B;  1JEK A;  3BCC E;  1HBW A;  1M8O B;  2Q1K A;  3L73 E;  1X8Y A;  1IZN B;  4PD4 I;  1XTC C;  1SS1 A;  4O9B A;  2YXR B;  3JCU E;  4RES B;  2E76 C;  3S4R A;  1K9M Q;  4WY4 D;  3SFE C;  1EQ7 A;  1EZV G;  3F5H A;  4K3A A;  1AJY A;  2FYU E;  2WMM A;  4GOE A;  2IYP A;  2JKV A;  2KLV A;  1L4A A;  1IK9 A;  1BE3 J;  2RKL A;  4UB8 H;  3RK2 C;  3HD7 A;  1T2K C;  3D6Y A;  4YXW H;  5AW3 B;  1LWU C;  3CWB G;  1H8A A;  2HR3 A;  3H1K E;  3WU2 H;  1SQX G;  1L4A B;  5AVR B;  3V2R A;  1N73 B;  2KYV A;  3BAS A;  1RF1 A;  1VQL P;  1ZLL A;  3AE2 C;  3U1C A;  1NTM D;  3AE1 C;  3NMD A;  1FS0 E;  4N78 E;  3H6P A;  3HD7 D;  1SQB G;  2NPS A;  1GL2 C;  2RH0 A;  3A0B E;  2E75 D;  1SQQ J;  3GLM A;  3H1H E;  1YJ9 P;  5B66 H;  2FYN B;  3Q3D A;  2ZYG A;  2ZFC A;  3H25 A;  2V7Q J;  3WUU A;  1KYO I;  4PJ0 H;  5CBN A;  1HWT C;  3WU2 E;  5APU A;  1UII A;  3G3Z A;  1PIX A;  3CX5 D;  2QSI A;  2FFD A;  1FZA A;  1ZV8 A;  2WSS H;  3S9O A;  3G6E P;  1N7S C;  3Q5P A;  1EDK A;  1Q86 Q;  1M90 Q;  1U7M A;  4C7R A;  2M5A B;  3Q1M A;  2R3S A;  1NTM J;  2JWD A;  1KQG B;  3H1L J;  3LW5 J;  1GL2 D;  1M57 D;  2QM8 A;  3PTZ A;  4U3F D;  3ZDM A;  1JY3 N;  3B5N D;  2H7H A;  2H8P D;  1VPC A;  1AA0 A;  2M3E A;  4PD4 H;  1X79 B;  2ZAE B;  4Z1M H;  3I56 P;  2XV5 A;  3AED C;  3B8E B;  1FU1 A;  3MUD A;  4KT0 J;  2AXC A;  1PZQ A;  2B89 A;  3MUD C;  2CPS A;  1G1I A;  3AEC C;  1NWQ A;  5AVS B;  1Y9B A;  1NTM G;  2A06 G;  2R3C A;  4MN4 C;  5KLI C;  1SFC A;  3HTK B;  4WY4 C;  3KZI E;  3H1L D;  5APX A;  1ZRT E;  3OAK A;  4DOJ A;  1NU1 G;  3JC2 2;  3TYY A;  2HOD A;  2YMY A;  1S5L H;  1VF5 D;  1GW4 A;  2ZXX A;  3BCC J;  1Y8A A;  2V7Q H;  2BCC E;  1NO4 A;  1WRG A;  2GM4 A;  1RQU A;  1URQ C;  5AW9 B;  1FZC C;  1L0L K;  2J58 A;  1HUC A;  1LTA C;  2ZT9 B;  1KIL E;  2KS1 B;  5AW6 B;  1T6A A;  2XZR A;  3CX5 H;  2XNX A;  2FYU G;  4PV1 B;  2WSC J;  5CCH A;  2QJP C;  2Y9Z A;  5CJ0 A;  2OTL P;  4ZKP A;  5APT A;  1M1J A;  2OYI C;  5H2F E;  1SFC C;  3L70 J;  1VDF A;  2R44 A;  4I2L C;  1EDL A;  2YO3 A;  1SQQ G;  4U7J A;  2HLO A;  2JWA A;  1KFM A;  5BVZ A;  1W5C E;  1FDM A;  5GTH H;  1IFP A;  3A3Y B;  4Y28 J;  3L75 G;  4DZO A;  5KJ7 A;  1SQX K;  1OW8 A;  3GG2 A;  2WZ7 A;  3H1H G;  3KXD A;  1AVY A;  1OWA A;  3HUS B;  1H0T B;  3GHG B;  1LTS C;  3IN6 A;  4JF7 A;  1M1J C;  2E75 C;  5CHX A;  3R4Y A;  4IFF A;  3AE3 C;  2OYI A;  1LTJ B;  3TNU B;  3BRV B;  3GHG A;  1BE3 G;  4W7Y A;  1JY3 O;  1RQV A;  1SFC D;  1L0N J;  3ABV C;  5APS A;  3V2Q A;  5KAI H;  3TF5 A;  2WTY A;  1KIL B;  1HGZ A;  1VQ7 P;  1J1D B;  1SQP K;  5CCG D;  4IL6 H;  3CI9 A;  2MKV A;  4WY4 B;  4WVZ A;  3L72 D;  2KNC A;  1KQF B;  3HE4 A;  3W67 A;  4BRY A;  4JBZ A;  1HTL C;  5KKZ B;  1NKZ B;  4EOT A; 
#chains in the Genus database with same CATH homology
 1WT6 A;  3RK3 C;  1N7L A;  3A5T A;  1RF1 C;  1W2E A;  1L4A D;  1GW3 A;  3M9H A;  1G1J A;  2I1J A;  1JOC A;  4JYB A;  1N7S B;  1AFO A;  1L0N K;  3RL0 B;  5AW0 B;  1N86 A;  1M7L A;  5AW4 B;  2PAJ A;  1NOH A;  4W80 A;  3EFG A;  3R2P A;  1FAV A;  4OH8 B;  1MZ9 A;  3RK3 B;  1RF1 B;  1IFN A;  3I5C A;  4I6M C;  1J1E B;  1T3J A;  3N7N A;  2NPS B;  1AQ5 A;  1NH4 A;  1SLQ A;  3V5B A;  1LTB C;  2HPC B;  1YTZ I;  2WSE H;  5KLV K;  1X9V A;  5AVU B;  1LWU A;  3RL0 C;  5KJ7 D;  2R32 A;  1CW5 A;  3HD7 C;  2OYH C;  5CCG A;  3A7O A;  4N6J A;  2W6B A;  1JTH A;  2WPS A;  3HTK A;  3IFM A;  1HVV A;  2N1T B;  1PFI A;  3V2N A;  1LT9 A;  1LT9 C;  4JYC A;  3N4X A;  1H88 A;  1QL2 A;  2KP8 A;  2WPR A;  3IR9 A;  2IFM A;  3B5N C;  3H32 B;  1LTT C;  3MIW A;  3VYI A;  3T97 A;  1CI6 B;  1LTJ C;  1MUU A;  1SQQ K;  2O1K A;  1JO5 A;  3P7K A;  1LTI C;  3M9B A;  1SP4 A;  1SVF A;  2JEE A;  2KSJ A;  5CCH C;  1KIL D;  5AVV B;  3LID A;  1CZQ A;  1T2K D;  2YKO A;  1RY3 A;  4Y99 C;  3B5N A;  2OYI B;  2YNY A;  2FFD C;  1E5W A;  1KIL A;  3VP8 A;  1NTZ K;  1GU4 A;  1A02 F;  2XKM A;  3RK2 B;  1GL2 A;  1FJK A;  1GK4 A;  2IFN A;  3A2A A;  3O8Z A;  2W27 A;  2YKQ A;  2W6A A;  3L37 A;  1IC2 A;  2E42 A;  3OJA B;  2WSF H;  1N7S A;  1NAF A;  1NTM K;  2WPQ A;  1YTZ T;  2M8R A;  1NU1 K;  1J1D C;  1IFJ A;  1YYC A;  2O01 H;  3MGN A;  2POH A;  1S9K D;  1FZB A;  3KPE A;  4XA4 A;  3HE5 A;  3E1I A;  4XE5 B;  2R5D A;  4DOJ A;  3P8C E;  3U1A A;  4N78 D;  3SWY A;  2XDJ A;  5AW7 B;  3VMX A;  3TSI A;  5APQ A;  2C0W A;  3VN0 A;  3HD7 B;  2FYU K;  3M0A A;  2A45 I;  3CL3 D;  1RE4 C;  4B86 A;  3KQG A;  3V2P A;  3VMY A;  1IFI A;  2YO2 A;  1KQL A;  2N1T C;  1SQV K;  4GIF A;  1NKN A;  3HUS C;  2GUS A;  1J1E C;  5CCH D;  1N2D C;  1N73 C;  2FYZ A;  2HYN A;  3L35 A;  2JJL A;  1KIL C;  1T3U A;  2Q3I A;  2YKP A;  1URQ A;  4Y99 B;  4LLH A;  5AW5 B;  3BAT A;  3NXS A;  3M91 A;  5APY A;  2P2U A;  2A45 H;  2IX7 C;  1GTW A;  3VOP A;  3L36 A;  1JTH B;  5CCG C;  1FZF A;  3U59 A;  1LT9 B;  2O1J A;  1GZL A;  3OA7 A;  1SFC B;  2J59 M;  1A02 J;  1JCC A;  1NTK K;  1JMM A;  1FZG A;  2A45 G;  3EQ2 A;  5AW2 B;  1IFD A;  1HGV A;  3WMM 0;  5KTB A;  1OXZ A;  1RE3 A;  2KB7 P;  1L4A C;  1MFZ A;  2Q9I A;  2L5G B;  5AVQ B;  1H89 A;  1DX7 A;  1IFM A;  1KZU B;  3SWF A;  1XTG B;  2Z5I A;  3GHG C;  3B5N B;  1M1J B;  1N7S D;  2N9B A;  2NPS C;  3CLQ A;  1FZC A;  3RL0 D;  2H43 A;  3VP9 A;  4GT1 A;  2M3B A;  2GUV A;  3TNU A;  1FZC B;  3NFQ A;  2I1K A;  5CJ4 A;  1GU5 A;  2LKM A;  1RF0 A;  3HUS A;  4WY4 A;  1T8Z A;  3HE4 B;  1ZN5 A;  1JCD A;  4GKG A;  1LTJ A;  1JY2 N;  1RE4 A;  1GDT A;  2HG5 D;  1ZR2 A;  3LIE A;  3BRT B;  2WT7 A;  1MV8 A;  1URQ D;  3BVH A;  1G2C A;  2Z4E A;  1FOS E;  3VMZ A;  2WSC H;  1IO4 A;  3C9I A;  1G2C B;  3M9Q A;  4HH2 A;  2OAR A;  2FXM A;  4N3Y B;  4HYT B;  1JUN A;  1GD2 E;  3TK1 A;  1FOS F;  4IFM A;  1RE3 C;  1QL1 A;  3HE5 B;  2VRS A;  1GK6 A;  3MTU E;  2OYH A;  3M0D A;  1N73 A;  3II6 A;  5APV A;  2OYH B;  2R5B A;  2HPC A;  2FFD B;  3LW5 H;  3NTN A;  5BU5 A;  4LGD E;  1SQB K;  3VTP C;  2KOG A;  5AVW B;  2NPS D;  1LTG C;  3M06 A;  2FKW B;  1JY3 P;  2Q7C A;  3KYQ A;  1KFN A;  1JY2 O;  1FBM A;  2XU6 A;  1DH3 A;  4AUW A;  4W7Z A;  2N1T D;  2C9N Y;  1LWU B;  1URQ B;  2IPP A;  3L4F A;  2HFE D;  2WWW A;  4WBA A;  1DEB A;  1Z56 A;  2N1T A;  2P67 A;  5APW A;  1ZR4 A;  4C7N A;  3P8M C;  3RK3 D;  1CI6 A;  2HOD B;  2C9L Y;  4C7N B;  2CPB A;  3PP5 A;  5AVX B;  3V4W A;  2WIT A;  3HRN A;  3P8C D;  4ZKU A;  5AW8 B;  3H32 A;  1JNM A;  3UIA A;  1S9K E;  4WB4 A;  4KHX A;  1J2J B;  1NHL A;  2P1J A;  5AW1 B;  4LC1 A;  1LGH B;  5BU8 B;  5AVT B;  5KJ7 C;  5AVY B;  2C0X A;  4EIJ A;  1FJP A;  2P7J A;  3M0D C;  4AYC A;  1CSB A;  3KDP B;  1IJD B;  1HJB A;  2Q5U A;  3P32 A;  4AQR D;  4IFD K;  2QM7 A;  2MJZ A;  1RF0 C;  5AVZ B;  4C46 A;  4M3L A;  2PP6 A;  3MD0 A;  5CMZ A;  1GL2 B;  3RK2 D;  1HH0 A;  1JY2 P;  2Z5H A;  3V4Q A;  4I1L A;  2BAS A;  2E43 A;  2ZXE B;  1FZE A;  2WT7 B;  1HBW A;  1X8Y A;  1XTC C;  4O9B A;  4RES B;  4WY4 D;  1EQ7 A;  2KLV A;  1L4A A;  1IK9 A;  3RK2 C;  3HD7 A;  1T2K C;  5AW3 B;  1LWU C;  1H8A A;  1N73 B;  3V2R A;  1L4A B;  5AVR B;  2KYV A;  3BAS A;  1RF1 A;  1ZLL A;  3U1C A;  3NMD A;  4N78 E;  3H6P A;  3HD7 D;  2NPS A;  1GL2 C;  2ZFC A;  1HWT C;  5APU A;  3G3Z A;  2FFD A;  1FZA A;  1ZV8 A;  1N7S C;  4C7R A;  2H7H A;  1GL2 D;  2QM8 A;  1JY3 N;  3B5N D;  2H8P D;  1VPC A;  1X79 B;  2XV5 A;  3B8E B;  1FU1 A;  3MUD A;  2CPS A;  1G1I A;  1NWQ A;  5AVS B;  2R3C A;  1SFC A;  3HTK B;  4WY4 C;  5APX A;  3OAK A;  3TYY A;  2HOD A;  2YMY A;  1GW4 A;  1NO4 A;  1WRG A;  2GM4 A;  5AW9 B;  1URQ C;  1FZC C;  1L0L K;  2J58 A;  1HUC A;  1LTA C;  5AW6 B;  2XZR A;  2XNX A;  5CCH A;  5CJ0 A;  4ZKP A;  5APT A;  1M1J A;  2OYI C;  1SFC C;  1VDF A;  4I2L C;  2YO3 A;  2HLO A;  1KFM A;  5BVZ A;  1FDM A;  3A3Y B;  4DZO A;  5KJ7 A;  1SQX K;  2WZ7 A;  1OWA A;  3HUS B;  3GHG B;  1LTS C;  4JF7 A;  1M1J C;  2OYI A;  5CHX A;  4IFF A;  1LTJ B;  3TNU B;  3BRV B;  3GHG A;  5APS A;  4W7Y A;  1JY3 O;  1SFC D;  3V2Q A;  2WTY A;  1KIL B;  1HGZ A;  1J1D B;  1SQP K;  5CCG D;  3CI9 A;  4WY4 B;  3HE4 A;  1HTL C;  1NKZ B;  4EOT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...