1N86A

Crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title The crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface.
pubmed doi rcsb
molecule tags Blood clotting
molecule keywords Fibrin alpha/alpha-E chain
total genus 21
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n86A00
1FZGA 2H43A 1LTJC 1FZCB 2HLOA 2HODA 3GHGC 1RF0A 3GHGB 1N73B 2A45I 2OYHC 1RF0C 1LWUA 2XNXA 3HUSA 2A45H 2HPCB 1LWUC 3HUSC 1N86A 1FZCA 1N73C 2OYHB 1FZCC 1LTJB 3E1IA 2FFDC 1LT9C 1JY2O 1RE3A 3H32A 1JY3N 1RF1B 2Z4EA 2HODB 1FZBA 1W2EA 3GHGA 3H32B 1JY3P 1JY2N 1M1JB 1JY2P 2A45G 3HUSB 2OYIB 1M1JC 1FZFA 1LTJA 1M1JA 1N73A 2OYHA 1RE4A 2OYIA 2HPCA 2Q9IA 1RE4C 2OYIC 1RE3C 1FZAA 2FFDB 1RF1A 1JY3O 1RF1C 2FFDA 1LT9A 1T3UA 1LWUB 1FZEA 3BVHA 1LT9B
chains in the Genus database with same CATH superfamily
3L37A 5DJUB 1VPCA 2FXPA 2JDIH 3D6ZA 3V4WA 2B87B 2YXRB 4W80A 3NTNA 1K05A 3VOPA 2KIKA 4H13D 5B5EH 5KJ7A 3WUVA 1KB9H 1LTIC 1N73C 5APYA 2O01N 2WVRA 3L71J 1LNQA 2WPRA 1NTME 1DEEG 1L0NJ 4YXDC 2P67A 1J1DC 3AE5C 3EFFK 4XFJA 1JOCA 5AW1B 1M90Q 3TGUG 2FBWC 1MV8A 5AVRB 1SQPG 2G8YA 3VMYA 2FXOA 1YTZT 4H0LC 1D7MA 2KXPB 3RGUA 2FYZA 3L73J 1BDCA 2FYUK 2IFNA 3KXDA 1DIPA 3L73G 1VF5C 1KFMA 1P84I 1IFIA 1KB9D 2WITA 2ZYGA 3H1JJ 5CJ0A 1S5LH 4C46A 3Q2YA 2G3AA 1HJBA 1BDDA 3LIDA 1T2KD 1ZMEC 5CBOA 3MIWA 5AW3B 4WB4A 5AW2B 1S9KD 2ZT9D 4U3FJ 5TISE 2Q1KA 1SQVK 2K88A 1J2JB 4L74A 2KS1B 2Y0CA 4GT1A 3KDPB 4BRYA 5KAIE 4D6TG 2M8RA 3F5HA 4PD4I 1ZR2A 3JC22 4MN4C 2KI7B 2MKVA 2Z4EA 1OW6A 5KAIH 4D6TJ 1NGMB 4R4LA 5AVQB 1LTJA 1KORA 2P10A 1FS0E 1LGHB 3AEBC 1FDIA 3NXSA 5CHXA 3PJSK 1CSBA 4IL6H 1NTZG 3V4QA 2H7HA 2KK7A 2M3BA 2HPCA 2YIUC 3B5NA 1SQBK 3CWBJ 3PP5A 1FZAA 4IL6E 3JCUH 3ZDMA 1RF1A 3TGUJ 2BEZF 3KYQA 2FY8A 1E79H 5AW5B 5CJ4A 4Z1MH 1KQLA 1IFPA 1LT9B 3HE5A 4RO0A 3BCCE 4JF7A 5H2FE 1YHQP 4GOEA 2ZAEB 1AFOA 1KTMA 1M57D 4JQ0D 1YJ9P 4H0LD 2VRSA 3P8MC 2FXMA 1FZCA 3MUDC 1HWTC 1SQVJ 2O3JA 4ASVA 3AEEC 2QM7A 4PV1D 2E43A 1SQVD 3M9QA 3EFGA 1JY3N 2Q5UA 3TK1A 2BCCD 1H0TB 2KOGA 1LTAC 1YQ4C 4GKGA 2K9YA 1K04A 1JY2N 1YYCA 3TDKA 1S9KE 1PV3A 4UB6H 5BU8B 2A06D 2KUBA 1QX8A 3P8CD 3C8VA 3FWLA 5APVA 2ZJSE 3T97B 4UB6E 4B86A 2FYUJ 2RN0A 3Q5RA 1ZXGA 4LGDE 3O6QA 1MFZA 4RESB 2R44A 2M3EA 1PGPA 4HB1A 1EDJA 2WTYA 1ZRTD 1NTKJ 1OFCX 1NU1G 1L0ND 3M0DA 5KKZB 1GL2B 1NKNA 5CCHA 5KLVG 1VQ8P 2A06G 2J5UA 4ZNCA 2NZ2A 1JO5A 5APXA 3H1LJ 2A45H 1CI6A 1LTBC 1NVOA 1OXZA 2O1KA 3JCUE 3GG2A 3RK2B 3O8ZA 2LXCB 2QVAA 3CLQA 1OX3A 1BGYJ 1OVRA 1ZRTE 3GF3A 3AE7C 5AVUB 4D6TD 5CBNA 2HG5D 2KLVA 1AJYA 2KS1A 2AXTE 3CXHH 1VF5B 3L71E 3U1CA 1W2EA 1LTSC 3L70J 1PPJG 1SQXG 2IZ0A 1X79B 1PGJA 3V2NA 3VN0A 3Q5PA 2XU6A 3RL0B 1VQ4P 3D6YA 3IAOA 1EZVD 3R2PA 2E74C 4DOJA 5AW6B 1SS1A 3P7KA 1H8AA 2Y9ZA 2OYIA 2MJZA 3S9OA 1FJKA 3R4YA 4YPCA 2DW3A 1M8OB 1OVUA 2JO1A 2WSEH 2BASA 4UB8H 5APQA 4AYCA 1N7SC 4LLHA 1QVFO 3AEDC 2HODA 3RL0D 3RK2C 2Q6QA 1BGYE 1YBKA 3BCCD 3HUSC 1FDOA 1U7MA 3P32A 5BU5A 1X8YA 1M56D 2O1JA 1OW7A 1S2EA 2K9JB 3M06A 3U59A 1IFJA 3VP8A 3G6EP 3GW6A 4D6TE 2WSFJ 1SQBD 2B9BA 3H32A 2RH0A 3IF4A 1CZQA 3RBZA 5AW7B 2XV5A 4I1LA 1KV4A 1NU1J 3E1RA 4BXLA 3CI9A 4H44C 1VQ9P 1GU4A 2XKMA 2E74D 2Q9IA 2PFXA 5KLVD 2PP6A 3F89A 2HYNA 2JP3A 3H6PA 2ZVNB 4WY4B 3MUDA 5E79E 5APWA 4DJGA 4TT3H 1VQMP 1KD1Q 1P84E 4U3FD 5AW8B 1OWAA 1T3UA 3A7OA 4BRYB 1YIJP 5KLIC 1N7SA 1RH5B 1M7LA 1P84H 1R5LA 4PV1C 2OARA 3HE4A 4DT0A 1RF0A 2M5AA 2XNXA 1VQ6P 1A02J 3TGUD 3A3YB 1SQXJ 4WY4A 3Q1MA 1Q7YQ 3L71D 2H89C 1PPJD 1SQXD 2N1TB 2R5DA 2W27A 3A0BH 4PV1B 3W68A 1VQPP 1LT9C 3BCCJ 3L74D 4QMAA 1NTMG 3V2PA 2JWAA 1K9MQ 1QLED 1S72P 2V4HA 2ZYAA 1W5CE 1E5WA 1N8RQ 3WU2E 1BE3G 2WT7B 1N7LA 1W2BO 1FZBA 1NTKK 2E76C 2YIUB 1M1JB 1L0NK 3MTUE 4U7JA 1LTGC 2FYUE 3MP7B 3BATA 1SQQJ 1PP9D 3CD6P 1KQGB 1Q90D 1L4AC 5AVYB 4HYTB 3OW2O 1QL1A 1GMJA 3L75E 1S4XA 4KJMA 1OVVA 3MZWB 3V6IA 1AVYA 1CI6B 4OGQC 3W67A 2D2CC 3L70D 1PPJE 1MFTA 1SQXE 2B87A 1G2CA 2HLOA 2HR3A 2W90A 4RKUJ 5B5EE 1FOSE 1RF0C 2IBZE 3QWOC 1JMBA 1SFCD 3L35A 1VQ7P 1YI2P 2C9NY 4WY4C 2R5BA 1SQQD 3M9HA 1DEBA 4EIJA 1KILB 2ZXEB 4BWNA 3L72E 1N7SB 3BASA 3WUTA 5GTIE 2KSJA 4ZMDA 1JCDA 1BE3E 3H1LE 1L2PA 2K1AA 1JY3P 5KLVE 4L76A 5APUA 1NTKD 1KC8Q 1NOHA 4H13C 1IK7A 4H44D 1VL2A 1RE4A 2FYNC 2GUSA 3AE3C 1S5LX 1G1IA 2ZFCA 3L75J 2B88A 1DX7A 3M0AA 1MKMA 1H0TA 1RF1C 3D70A 2BEQD 1FZEA 2IZ1A 3TNUA 1GTWA 1NTMJ 2C9LY 4IFDK 3GHGB 3T97A 2D2CD 1URQC 2WSCH 1BGYD 2ZT9C 1Y9BA 3SFEC 3H1KG 4N78D 2I8DA 3AE1C 1FZCC 5K5GB 2AEMA 1L4AD 1SQQK 1SQBG 1N7SD 3BRTB 4AQRD 2FYNB 3L73E 2Q3EA 1L0LJ 3L74G 4PD4D 2Q7CA 3CPWO 3RK2D 2WPQA 2QJKC 1H89A 1JEKA 2A45G 2E76D 2FYUG 1Q86Q 2ZXXA 1R8EA 3JSVC 1EZVE 5AW0B 1YTZI 3FXEA 2XZRA 3QH9A 4L73A 1RE4C 1VQLP 2LR2A 3KPEA 4YTPC 1ZR4A 2JR8A 1NHLA 1DD3A 3KHUA 1P84D 3AE8C 4U3FE 1NU1E 1LT9A 4U3FG 1DD4A 1K8AQ 3VP9A 4AUWA 1UIIA 1KFNA 2RMZA 2BCCJ 3H1LG 3M0DC 4DCKA 4N78E 1EDLA 2OYIC 3K5BA 1K73Q 1NH4A 1VQKP 1JUNA 1YJWP 1URQA 3B5ND 3CWBG 3II6A 3PH0A 4PJ0H 5AW4B 2E5YA 5KKZC 3TF5A 3GF7A 1AQ5A 1FOSF 4PJ0E 3RK3E 1LTJB 1GW4A 1GK6A 1NTMD 2ZYDA 3E7KA 1NAFA 3N7NA 5TJHA 2IYPA 2R32A 1SQBE 2Z5HA 4N6JA 3BRVB 1RHZB 1SQPJ 1HH0A 2Y0EA 2HODB 3CXHI 1URQD 1L0LD 1PIXA 3H1IJ 1LP1A 3L71G 3RK3C 4NPEA 3ITKA 4JYCA 2E42A 1Y47A 3C9IA 3CWBD 3CWBE 2KNCB 2WPSA 1FBMA 1GW3A 2LXBA 2N9YB 1IFMA 2YKQA 3L73D 4IOIH 1GK4A 3G9RA 4PD4E 5AVXB 5C39A 4K3AA 5AVWB 1CW5A 1BSNA 2K3RA 1NKZB 1TU3F 1SQVE 1ZN5A 3CXHD 5DJTB 3CCQP 2POHA 4WWIA 3CX5I 2UWJE 1EZVG 1EZVI 1G1JA 2AEJA 2P58A 4GODA 1BSHA 2CPSA 3H1IE 4I6MC 4C7NB 3A5TA 2W83C 2WZ7A 1KB9I 4JYBA 1X0TA 1KILD 3CMEP 3SSUA 3WUUA 1HUCA 2GUVA 2P7JA 3AEGC 3V5BA 4GOFA 3O6QB 1IJDB 3HE4B 1FZGA 2C0WA 2NPSD 2I1KA 2IPPA 2PGDA 1T3JA 3Q5SA 1H88A 2L91A 1NTKE 3HD7A 3H1ID 2IBZG 2QEXP 2E5TA 1G2CB 3CC2P 5KLVJ 3CC4P 5AVTB 3HTKB 2KYVA 3FX0A 3LW5H 1JNMA 2H8PD 4GIFA 3I56P 4Y99C 5KLVK 5CMZA 1J1DB 1JY3O 2W6JH 1KMIZ 1QL2A 2YKOA 3L4FA 3MHVA 1JY2P 2QJPC 3HUSB 2FKWB 2RKLA 2AXCA 2E75B 1S3JA 2KNCA 2O01H 3RBXA 5CCHC 3H1JE 3GHGC 5L8RJ 1N73B 3H1JD 2OYHC 1Z56A 3M9BA 3D71A 2E75C 1A02F 2ZT9B 3H1IG 3SWYA 1NTZE 4NPFX 3UIAA 1URQB 1VDFA 2K9JA 3H1HJ 2OTJP 2QM8A 1KN7A 2PRRA 1L0LE 1FJPA 3OA7A 1IO4A 1SQXK 1EXJA 3SWKA 1RE3A 3CCSP 1SQVG 3GLMA 1AV1A 2N1TA 4PD4H 3A0HE 2JKVA 4H0LB 4OVNF 4Y99B 4H13B 1NWQA 1SQQG 2AXTH 3RL0C 1HJ0A 1HBWA 3A0HH 3H1JG 3KZIH 5KAFH 1T2KC 1FZFA 2SPZA 2WT7A 3OAKA 5H2FH 4W7YA 4O9BA 3KZIE 3G3ZA 5KAFE 2QRXA 1NU1D 3IN6A 4ZKUA 1EC5A 3A2AA 1L4AA 3CXHE 5CCGA 2H88C 1ZW0A 2KLUA 1ZP0C 1NTZK 1T8ZA 3H1HE 4LC1A 1NTMK 5M1BA 1LJ2A 5B66E 3CX5D 2JJLA 1GZLA 5AVVB 2N1TD 2V7QH 3G71P 1Q81Q 1YQ3C 1QEXA 1NTZJ 1NTKG 1PP9G 1SQPK 2KP8A 2M5AB 2R3CA 2WSFH 3AEAC 3B5NB 3PHLA 3A0BE 3MD0A 4M3LA 2IBZD 1XTGB 3I5CA 4I7ZB 2ZVOB 3S1KA 1N73A 2IFMA 3HD7D 1R5SA 2P1JA 4K35A 2P2UA 3H1HD 2QJYB 4I2LC 2WSSH 1WT6A 3WU2H 3CCEP 2WWWA 3L72D 5BVZA 3CCRP 3TNUB 2N9BA 4OWFA 1USEA 2KZIA 3VMAA 2M0BA 3GHGA 2KZJA 3CCUP 3CCVP 1VQ5P 1EXIA 1OZHA 1SFCA 3L70G 3EWKA 2E75D 4HKZH 2C0XA 2K37A 2QE7H 1GU5A 1KYOD 1U57A 2YKPA 3Q3DA 1EQ7A 1RE3C 3WMM0 3C1LA 3PLNA 2N1TC 3RK3D 1KB9E 1OMIA 1PZQA 1PL5A 2JEEA 3L74E 5KTBA 1BCCD 4NPDA 2AEFA 1SVFA 2H43A 4L75A 1L0LK 1QVGO 2WSEJ 4I7ZC 1SQPD 2L5GB 3L36A 3I55P 1VF5D 1BE3D 1ZV8A 5GTIH 1ZLLA 3CCMP 1YITP 3H25A 3V2RA 2NPSB 3RL0g 3FGAD 1U7JA 4JPZB 3VMXA 3SWFA 3TYYA 1PP9J 1ZOYC 3VYIA 1IK9A 4EI2A 2CPBA 5AVZB 3NFQA 3HTKA 1IFDA 1FC2C 3H1KD 4OGQD 3MGNA 3L70E 4WY4D 1BGYG 3CC7P 2IDBA 1SFCC 2OYHA 1HGVA 4Y28J 4EOTA 1GD2E 3CX5E 1KYOH 5KJ7D 2QJKB 4ASWA 1IZNB 4UB8E 5AVSB 3ABVC 1KYOI 3N4XA 4HH2A 1AVOA 1QGKB 1KILA 3HRNA 3BVHA 2QG4A 2V7QJ 1FU1A 4EDFA 4N3YB 4GDOA 1FZCB 1J1EB 2A45I 1OW8A 2PAJA 1LWUA 2Y9YA 1T6AA 2J59M 2WQYC 3CCLP 4C7RA 2FYUD 1RQUA 3B4SA 4JBZA 1LTTC 2YMKA 2YO3A 1BE3J 2FFDC 4RJTA 1AQTA 1Y8AA 2CK3H 2QJPB 1NU1K 1S1CX 3H1HG 3LIEA 5CCHD 1KQSO 1FDMA 5E79H 1RF1B 3L75G 2O01J 4IFMA 2E74B 3CCJP 3BCCG 2Q3IA 2Z5IA 3AE6C 3M91A 1Q2NA 1PGOA 1USDA 2ITAA 2LKMA 2QIWA 3HE5B 2XDJA 2IYOA 3OJAB 1SLQA 4IFFA 5AW9B 3H1LD 5GTHH 1SQBJ 1BCCG 1N2DC 4A7PA 2QA4P 3TSIA 5GTHE 2FFDB 1WMKA 3AE4C 3H1KJ 1UIXA 3FWNA 4OH8B 4TLFA 1HF9A 2GM4A 3SFDC 1M1KQ 1GDTA 3AEFC 1IFNA 1JCCA 2W6AA 1KILC 1FE6A 4HJGH 2NRGA 1VQOP 1J1EC 1RQVA 2KSEA 2J58A 1Q82Q 2D2CB 3CX5H 4OGQB 1WRGA 1LWUC 4WBAA 1BCCE 2HPCB 4W7ZA 1PGQA 2IX7C 3LW5J 5CCGD 1NJIQ 3IR9A 3L72G 1X22A 2BCCG 3U1AA 2YO2A 1GL2C 4CPGA 1KILE 1HGZA 1KYOE 1L4AB 1LT1A 1SP4A 3B71A 1JM0A 1DH3A 3V2QA 1SFCB 1KZUB 3FXDA 3H32B 2WMMA 3PTZA 2OYIB 1HVVA 3PRJA 1M1JC 3IFMA 3AECC 1FAVA 1JTHA 1NAYA 2Y0DA 3HD7C 1KQFB 1NO4A 3H1KE 1L0NG 4XA4A 2HFED 1OIPA 3KQGA 3VTPC 2E76B 3CMAP 1EDIA 2R3SA 4WVZA 5KJ7C 2NPSC 3RK3B 2BCCE 2WSCJ 5APSA 1MZ9A 2I1JA 2OGUA 1X9VA 3TGUE 1SQQE 1EDKA 1JMMA 1LTJC 2W6BA 1BCCJ 2A06E 2IBZI 2YNYA 3P8CE 3G4SP 1SQPE 3HUSA 4C7NA 5KLIB 2GA1A 1LP1B 1N86A 3B5NC 3EQ2A 3B8EB 1L0LG 3L74J 4KT0J 3E1IA 3AE2C 4XE5B 5EFWB 2YXQB 3L75D 2W8ZA 5B66H 1RY3A 1VQNP 3VMZA 1GL2A 1MUUA 2WPVB 2OTLP 1PFIA 1IC2A 5APTA 3AE9C 3GMAA 1S5LE 3HD7B 1PP9E 4ZKPA 1XTCC 1JB0J 2YMYA 2KB7P 1M1JA 3NMDA 3CL3D 1NYHA 1AA0A 3L72J 4H44B 2OYHB 2B89A 1L0NE 2OQQA 4EYYQ 1GL2D 4R4MA 3S4RA 2JWDA 4IL6X 2OYOA 4KHXA 2QJYC 2QSIA 3USSA 5CCGC 4DZOA 5TISH 1YJNP 2NPSA 2FFDA 1HTLC 1JTHB 1LWUB 1NTZD 2XNDH 4YXWH 1JY2O 2OTKE
chains in the Genus database with same CATH topology
3L37A 1VPCA 3V4WA 4W80A 3NTNA 3VOPA 5KJ7A 1N73C 2OYHB 1LTIC 5APYA 2WPRA 2P67A 1J1DC 5AW1B 1JOCA 1MV8A 5AVRB 3VMYA 1YTZT 2FYZA 2FYUK 2IFNA 1KFMA 2WITA 1IFIA 4C46A 5CJ0A 1HJBA 3LIDA 1T2KD 3MIWA 5AW3B 4WB4A 5AW2B 1S9KD 1SQVK 1J2JB 4GT1A 3KDPB 1ZR2A 2M8RA 2Z4EA 5AVQB 1LTJA 1LGHB 3NXSA 5CHXA 3V4QA 4B86A 2H7HA 1CSBA 2M3BA 2HPCA 3B5NA 1SQBK 3PP5A 1FZAA 1RF1A 3KYQA 5AW5B 5CJ4A 1KQLA 1LT9B 4JF7A 2VRSA 3P8MC 2FXMA 1FZCA 1HWTC 2E43A 2QM7A 3M9QA 3EFGA 1JY3N 2Q5UA 3TK1A 2KOGA 1LTAC 4GKGA 1JY2N 1YYCA 1S9KE 5BU8B 3P8CD 5APVA 4LGDE 4RESB 1MFZA 2WTYA 3M0DA 1GL2B 1NKNA 1JO5A 5APXA 2A45H 1CI6A 1LTBC 1OXZA 2O1KA 3RK2B 3O8ZA 3CLQA 5AVUB 2HG5D 2KLVA 3U1CA 1W2EA 1LTSC 3V2NA 3VN0A 1X79B 2XU6A 3RL0B 3R2PA 4DOJA 5AW6B 3P7KA 1H8AA 2OYIA 2MJZA 1FJKA 2WSEH 2BASA 5APQA 4AYCA 1N7SC 4LLHA 3RL0D 2HODA 3RK2C 3HUSC 3P32A 5BU5A 1X8YA 2O1JA 3M06A 3U59A 1IFJA 3VP8A 3H32A 1CZQA 5AW7B 2XV5A 4I1LA 3CI9A 1GU4A 2XKMA 2Q9IA 2PP6A 2HYNA 3H6PA 3MUDA 5APWA 5AW8B 1OWAA 1T3UA 3A7OA 1N7SA 1M7LA 2OARA 3HE4A 1RF0A 2XNXA 1A02J 3A3YB 4WY4A 2W27A 2N1TB 2R5DA 1LT9C 3V2PA 1E5WA 2WT7B 1N7LA 1FZBA 1NTKK 3MTUE 1M1JB 1L0NK 1LTGC 3BATA 1L4AC 5AVYB 4HYTB 1QL1A 1CI6B 1FOSE 2HLOA 1G2CA 1RF0C 3L35A 1SFCD 2C9NY 4WY4C 2R5BA 3M9HA 1DEBA 4EIJA 1KILB 2ZXEB 1N7SB 3BASA 2KSJA 1JCDA 1JY3P 5APUA 1NOHA 1RE4A 2GUSA 1DX7A 1G1IA 2ZFCA 3M0AA 1RF1C 1FZEA 3TNUA 1GTWA 2C9LY 4IFDK 3GHGB 3T97A 1URQC 2WSCH 4N78D 1FZCC 1L4AD 1SQQK 1N7SD 3BRTB 4AQRD 2Q7CA 3RK2D 2WPQA 1H89A 2A45G 5AW0B 1YTZI 2XZRA 1RE4C 3KPEA 1ZR4A 1NHLA 4AUWA 1LT9A 3VP9A 1KFNA 3M0DC 4N78E 1NH4A 1JUNA 1URQA 3B5ND 3II6A 5AW4B 1AQ5A 1FOSF 1LTJB 1GW4A 1GK6A 3N7NA 1NAFA 2R32A 2Z5HA 4N6JA 3BRVB 3V2RA 3HE5A 1HH0A 3RK3C 2HODB 1URQD 2E42A 4JYCA 3C9IA 2WPSA 1FBMA 1GW3A 2YKQA 2OYIC 1IFMA 5AVXB 1A02F 1GK4A 1CW5A 5AVWB 1NKZB 1ZN5A 2POHA 1G1JA 2CPSA 4I6MC 4C7NB 3A5TA 2WZ7A 4JYBA 1KILD 1HUCA 2GUVA 2P7JA 3V5BA 3HE4B 1IJDB 2C0WA 2NPSD 2I1KA 2IPPA 1T3JA 1H88A 3HD7A 1G2CB 5AVTB 3HTKB 2KYVA 3LW5H 1JNMA 2H8PD 4GIFA 4Y99C 5KLVK 5CMZA 1J1DB 1JY3O 1QL2A 2YKOA 3L4FA 3HUSB 1JY2P 5CCHC 2FKWB 2O01H 3GHGC 1N73B 2OYHC 1Z56A 3M9BA 3SWYA 3UIAA 1URQB 1VDFA 2QM8A 1FJPA 3OA7A 1IO4A 1SQXK 1RE3A 2N1TA 1NWQA 4Y99B 3RL0C 1HBWA 1T2KC 1FZFA 2WT7A 3OAKA 4W7YA 4O9BA 3G3ZA 4ZKUA 3A2AA 1L4AA 5CCGA 1NTZK 1T8ZA 4LC1A 1NTMK 2JJLA 1GZLA 5AVVB 2N1TD 1SQPK 2KP8A 2R3CA 2WSFH 4WY4B 3B5NB 3MD0A 4M3LA 1XTGB 3I5CA 2IFMA 3HD7D 2P1JA 2P2UA 4I2LC 1WT6A 2WWWA 5BVZA 3TNUB 2N9BA 3GHGA 1SFCA 2C0XA 1GU5A 2YKPA 1EQ7A 1RE3C 3WMM0 2N1TC 3RK3D 2JEEA 5KTBA 2H43A 1SVFA 1L0LK 2L5GB 3L36A 1ZV8A 1ZLLA 2NPSB 3SWFA 3VMXA 3TYYA 3VYIA 1IK9A 2CPBA 5AVZB 3NFQA 3HTKA 1IFDA 3MGNA 4WY4D 2OYHA 1SFCC 1GD2E 1HGVA 4EOTA 5KJ7D 5AVSB 3N4XA 4HH2A 1KILA 3HRNA 3BVHA 1FU1A 4N3YB 1FZCB 1J1EB 2A45I 2PAJA 1LWUA 2J59M 4C7RA 1LTTC 2YO3A 2FFDC 3LIEA 1NU1K 5CCHD 1RF1B 4IFMA 2Q3IA 2Z5IA 3M91A 2LKMA 3OJAB 5AW9B 4IFFA 3HE5B 2XDJA 1N73A 1SLQA 1N2DC 3TSIA 2FFDB 4OH8B 2GM4A 1GDTA 1IFNA 1JCCA 2W6AA 1KILC 1J1EC 2J58A 1WRGA 1LWUC 4WBAA 2HPCB 4W7ZA 2IX7C 5CCGD 3IR9A 3U1AA 2YO2A 1GL2C 1AFOA 1SP4A 1HGZA 1L4AB 1DH3A 3V2QA 1SFCB 1KZUB 3H32B 2OYIB 1HVVA 1M1JC 3IFMA 1FAVA 1JTHA 3HD7C 1NO4A 4XA4A 2HFED 3KQGA 3VTPC 5KJ7C 2NPSC 3RK3B 5APSA 1MZ9A 2I1JA 1X9VA 5CCHA 1FZGA 1JMMA 1LTJC 2W6BA 3P8CE 2YNYA 3HUSA 4C7NA 1N86A 3B5NC 3EQ2A 3B8EB 3E1IA 4XE5B 1RY3A 3VMZA 1GL2A 1MUUA 1PFIA 1IC2A 5APTA 3HD7B 4ZKPA 1XTCC 2YMYA 2KB7P 1M1JA 3NMDA 3CL3D 1GL2D 4KHXA 5CCGC 4DZOA 2NPSA 2FFDA 1HTLC 1JTHB 1LWUB 1FDMA 1JY2O
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FZG A;  2H43 A;  1LTJ C;  1FZC B;  2HLO A;  2HOD A;  3GHG C;  1RF0 A;  3GHG B;  1N73 B;  2A45 I;  2OYH C;  1RF0 C;  1LWU A;  2XNX A;  3HUS A;  2A45 H;  2HPC B;  1LWU C;  3HUS C;  1N86 A;  1FZC A;  1N73 C;  2OYH B;  1FZC C;  1LTJ B;  3E1I A;  2FFD C;  1LT9 C;  1JY2 O;  1RE3 A;  3H32 A;  1JY3 N;  1RF1 B;  2Z4E A;  2HOD B;  1FZB A;  1W2E A;  3GHG A;  3H32 B;  1JY3 P;  1JY2 N;  1M1J B;  1JY2 P;  2A45 G;  3HUS B;  2OYI B;  1M1J C;  1FZF A;  1LTJ A;  1M1J A;  1N73 A;  2OYH A;  1RE4 A;  2OYI A;  2HPC A;  2Q9I A;  1RE4 C;  2OYI C;  1RE3 C;  1FZA A;  2FFD B;  1RF1 A;  1JY3 O;  1RF1 C;  2FFD A;  1LT9 A;  1T3U A;  1LWU B;  1FZE A;  3BVH A;  1LT9 B; 
#chains in the Genus database with same CATH topology
 3L37 A;  5DJU B;  1VPC A;  2FXP A;  2JDI H;  3D6Z A;  3V4W A;  2B87 B;  2YXR B;  4W80 A;  3NTN A;  1K05 A;  3VOP A;  2KIK A;  4H13 D;  5B5E H;  5KJ7 A;  3WUV A;  1KB9 H;  1LTI C;  1N73 C;  5APY A;  2O01 N;  2WVR A;  3L71 J;  1LNQ A;  2WPR A;  1NTM E;  1DEE G;  1L0N J;  4YXD C;  2P67 A;  1J1D C;  3AE5 C;  3EFF K;  4XFJ A;  1JOC A;  5AW1 B;  1M90 Q;  3TGU G;  2FBW C;  1MV8 A;  5AVR B;  1SQP G;  2G8Y A;  3VMY A;  2FXO A;  1YTZ T;  4H0L C;  1D7M A;  2KXP B;  3RGU A;  2FYZ A;  3L73 J;  1BDC A;  2FYU K;  2IFN A;  3KXD A;  1DIP A;  3L73 G;  1VF5 C;  1KFM A;  1P84 I;  1IFI A;  1KB9 D;  2WIT A;  2ZYG A;  3H1J J;  5CJ0 A;  1S5L H;  4C46 A;  3Q2Y A;  2G3A A;  1HJB A;  1BDD A;  3LID A;  1T2K D;  1ZME C;  5CBO A;  3MIW A;  5AW3 B;  4WB4 A;  5AW2 B;  1S9K D;  2ZT9 D;  4U3F J;  5TIS E;  2Q1K A;  1SQV K;  2K88 A;  1J2J B;  4L74 A;  2KS1 B;  2Y0C A;  4GT1 A;  3KDP B;  4BRY A;  5KAI E;  4D6T G;  2M8R A;  3F5H A;  4PD4 I;  1ZR2 A;  3JC2 2;  4MN4 C;  2KI7 B;  2MKV A;  2Z4E A;  1OW6 A;  5KAI H;  4D6T J;  1NGM B;  4R4L A;  5AVQ B;  1LTJ A;  1KOR A;  2P10 A;  1FS0 E;  1LGH B;  3AEB C;  1FDI A;  3NXS A;  5CHX A;  3PJS K;  1CSB A;  4IL6 H;  1NTZ G;  3V4Q A;  2H7H A;  2KK7 A;  2M3B A;  2HPC A;  2YIU C;  3B5N A;  1SQB K;  3CWB J;  3PP5 A;  1FZA A;  4IL6 E;  3JCU H;  3ZDM A;  1RF1 A;  3TGU J;  2BEZ F;  3KYQ A;  2FY8 A;  1E79 H;  5AW5 B;  5CJ4 A;  4Z1M H;  1KQL A;  1IFP A;  1LT9 B;  3HE5 A;  4RO0 A;  3BCC E;  4JF7 A;  5H2F E;  1YHQ P;  4GOE A;  2ZAE B;  1AFO A;  1KTM A;  1M57 D;  4JQ0 D;  1YJ9 P;  4H0L D;  2VRS A;  3P8M C;  2FXM A;  1FZC A;  3MUD C;  1HWT C;  1SQV J;  2O3J A;  4ASV A;  3AEE C;  2QM7 A;  4PV1 D;  2E43 A;  1SQV D;  3M9Q A;  3EFG A;  1JY3 N;  2Q5U A;  3TK1 A;  2BCC D;  1H0T B;  2KOG A;  1LTA C;  1YQ4 C;  4GKG A;  2K9Y A;  1K04 A;  1JY2 N;  1YYC A;  3TDK A;  1S9K E;  1PV3 A;  4UB6 H;  5BU8 B;  2A06 D;  2KUB A;  1QX8 A;  3P8C D;  3C8V A;  3FWL A;  5APV A;  2ZJS E;  3T97 B;  4UB6 E;  4B86 A;  2FYU J;  2RN0 A;  3Q5R A;  1ZXG A;  4LGD E;  3O6Q A;  1MFZ A;  4RES B;  2R44 A;  2M3E A;  1PGP A;  4HB1 A;  1EDJ A;  2WTY A;  1ZRT D;  1NTK J;  1OFC X;  1NU1 G;  1L0N D;  3M0D A;  5KKZ B;  1GL2 B;  1NKN A;  5CCH A;  5KLV G;  1VQ8 P;  2A06 G;  2J5U A;  4ZNC A;  2NZ2 A;  1JO5 A;  5APX A;  3H1L J;  2A45 H;  1CI6 A;  1LTB C;  1NVO A;  1OXZ A;  2O1K A;  3JCU E;  3GG2 A;  3RK2 B;  3O8Z A;  2LXC B;  2QVA A;  3CLQ A;  1OX3 A;  1BGY J;  1OVR A;  1ZRT E;  3GF3 A;  3AE7 C;  5AVU B;  4D6T D;  5CBN A;  2HG5 D;  2KLV A;  1AJY A;  2KS1 A;  2AXT E;  3CXH H;  1VF5 B;  3L71 E;  3U1C A;  1W2E A;  1LTS C;  3L70 J;  1PPJ G;  1SQX G;  2IZ0 A;  1X79 B;  1PGJ A;  3V2N A;  3VN0 A;  3Q5P A;  2XU6 A;  3RL0 B;  1VQ4 P;  3D6Y A;  3IAO A;  1EZV D;  3R2P A;  2E74 C;  4DOJ A;  5AW6 B;  1SS1 A;  3P7K A;  1H8A A;  2Y9Z A;  2OYI A;  2MJZ A;  3S9O A;  1FJK A;  3R4Y A;  4YPC A;  2DW3 A;  1M8O B;  1OVU A;  2JO1 A;  2WSE H;  2BAS A;  4UB8 H;  5APQ A;  4AYC A;  1N7S C;  4LLH A;  1QVF O;  3AED C;  2HOD A;  3RL0 D;  3RK2 C;  2Q6Q A;  1BGY E;  1YBK A;  3BCC D;  3HUS C;  1FDO A;  1U7M A;  3P32 A;  5BU5 A;  1X8Y A;  1M56 D;  2O1J A;  1OW7 A;  1S2E A;  2K9J B;  3M06 A;  3U59 A;  1IFJ A;  3VP8 A;  3G6E P;  3GW6 A;  4D6T E;  2WSF J;  1SQB D;  2B9B A;  3H32 A;  2RH0 A;  3IF4 A;  1CZQ A;  3RBZ A;  5AW7 B;  2XV5 A;  4I1L A;  1KV4 A;  1NU1 J;  3E1R A;  4BXL A;  3CI9 A;  4H44 C;  1VQ9 P;  1GU4 A;  2XKM A;  2E74 D;  2Q9I A;  2PFX A;  5KLV D;  2PP6 A;  3F89 A;  2HYN A;  2JP3 A;  3H6P A;  2ZVN B;  4WY4 B;  3MUD A;  5E79 E;  5APW A;  4DJG A;  4TT3 H;  1VQM P;  1KD1 Q;  1P84 E;  4U3F D;  5AW8 B;  1OWA A;  1T3U A;  3A7O A;  4BRY B;  1YIJ P;  5KLI C;  1N7S A;  1RH5 B;  1M7L A;  1P84 H;  1R5L A;  4PV1 C;  2OAR A;  3HE4 A;  4DT0 A;  1RF0 A;  2M5A A;  2XNX A;  1VQ6 P;  1A02 J;  3TGU D;  3A3Y B;  1SQX J;  4WY4 A;  3Q1M A;  1Q7Y Q;  3L71 D;  2H89 C;  1PPJ D;  1SQX D;  2N1T B;  2R5D A;  2W27 A;  3A0B H;  4PV1 B;  3W68 A;  1VQP P;  1LT9 C;  3BCC J;  3L74 D;  4QMA A;  1NTM G;  3V2P A;  2JWA A;  1K9M Q;  1QLE D;  1S72 P;  2V4H A;  2ZYA A;  1W5C E;  1E5W A;  1N8R Q;  3WU2 E;  1BE3 G;  2WT7 B;  1N7L A;  1W2B O;  1FZB A;  1NTK K;  2E76 C;  2YIU B;  1M1J B;  1L0N K;  3MTU E;  4U7J A;  1LTG C;  2FYU E;  3MP7 B;  3BAT A;  1SQQ J;  1PP9 D;  3CD6 P;  1KQG B;  1Q90 D;  1L4A C;  5AVY B;  4HYT B;  3OW2 O;  1QL1 A;  1GMJ A;  3L75 E;  1S4X A;  4KJM A;  1OVV A;  3MZW B;  3V6I A;  1AVY A;  1CI6 B;  4OGQ C;  3W67 A;  2D2C C;  3L70 D;  1PPJ E;  1MFT A;  1SQX E;  2B87 A;  1G2C A;  2HLO A;  2HR3 A;  2W90 A;  4RKU J;  5B5E E;  1FOS E;  1RF0 C;  2IBZ E;  3QWO C;  1JMB A;  1SFC D;  3L35 A;  1VQ7 P;  1YI2 P;  2C9N Y;  4WY4 C;  2R5B A;  1SQQ D;  3M9H A;  1DEB A;  4EIJ A;  1KIL B;  2ZXE B;  4BWN A;  3L72 E;  1N7S B;  3BAS A;  3WUT A;  5GTI E;  2KSJ A;  4ZMD A;  1JCD A;  1BE3 E;  3H1L E;  1L2P A;  2K1A A;  1JY3 P;  5KLV E;  4L76 A;  5APU A;  1NTK D;  1KC8 Q;  1NOH A;  4H13 C;  1IK7 A;  4H44 D;  1VL2 A;  1RE4 A;  2FYN C;  2GUS A;  3AE3 C;  1S5L X;  1G1I A;  2ZFC A;  3L75 J;  2B88 A;  1DX7 A;  3M0A A;  1MKM A;  1H0T A;  1RF1 C;  3D70 A;  2BEQ D;  1FZE A;  2IZ1 A;  3TNU A;  1GTW A;  1NTM J;  2C9L Y;  4IFD K;  3GHG B;  3T97 A;  2D2C D;  1URQ C;  2WSC H;  1BGY D;  2ZT9 C;  1Y9B A;  3SFE C;  3H1K G;  4N78 D;  2I8D A;  3AE1 C;  1FZC C;  5K5G B;  2AEM A;  1L4A D;  1SQQ K;  1SQB G;  1N7S D;  3BRT B;  4AQR D;  2FYN B;  3L73 E;  2Q3E A;  1L0L J;  3L74 G;  4PD4 D;  2Q7C A;  3CPW O;  3RK2 D;  2WPQ A;  2QJK C;  1H89 A;  1JEK A;  2A45 G;  2E76 D;  2FYU G;  1Q86 Q;  2ZXX A;  1R8E A;  3JSV C;  1EZV E;  5AW0 B;  1YTZ I;  3FXE A;  2XZR A;  3QH9 A;  4L73 A;  1RE4 C;  1VQL P;  2LR2 A;  3KPE A;  4YTP C;  1ZR4 A;  2JR8 A;  1NHL A;  1DD3 A;  3KHU A;  1P84 D;  3AE8 C;  4U3F E;  1NU1 E;  1LT9 A;  4U3F G;  1DD4 A;  1K8A Q;  3VP9 A;  4AUW A;  1UII A;  1KFN A;  2RMZ A;  2BCC J;  3H1L G;  3M0D C;  4DCK A;  4N78 E;  1EDL A;  2OYI C;  3K5B A;  1K73 Q;  1NH4 A;  1VQK P;  1JUN A;  1YJW P;  1URQ A;  3B5N D;  3CWB G;  3II6 A;  3PH0 A;  4PJ0 H;  5AW4 B;  2E5Y A;  5KKZ C;  3TF5 A;  3GF7 A;  1AQ5 A;  1FOS F;  4PJ0 E;  3RK3 E;  1LTJ B;  1GW4 A;  1GK6 A;  1NTM D;  2ZYD A;  3E7K A;  1NAF A;  3N7N A;  5TJH A;  2IYP A;  2R32 A;  1SQB E;  2Z5H A;  4N6J A;  3BRV B;  1RHZ B;  1SQP J;  1HH0 A;  2Y0E A;  2HOD B;  3CXH I;  1URQ D;  1L0L D;  1PIX A;  3H1I J;  1LP1 A;  3L71 G;  3RK3 C;  4NPE A;  3ITK A;  4JYC A;  2E42 A;  1Y47 A;  3C9I A;  3CWB D;  3CWB E;  2KNC B;  2WPS A;  1FBM A;  1GW3 A;  2LXB A;  2N9Y B;  1IFM A;  2YKQ A;  3L73 D;  4IOI H;  1GK4 A;  3G9R A;  4PD4 E;  5AVX B;  5C39 A;  4K3A A;  5AVW B;  1CW5 A;  1BSN A;  2K3R A;  1NKZ B;  1TU3 F;  1SQV E;  1ZN5 A;  3CXH D;  5DJT B;  3CCQ P;  2POH A;  4WWI A;  3CX5 I;  2UWJ E;  1EZV G;  1EZV I;  1G1J A;  2AEJ A;  2P58 A;  4GOD A;  1BSH A;  2CPS A;  3H1I E;  4I6M C;  4C7N B;  3A5T A;  2W83 C;  2WZ7 A;  1KB9 I;  4JYB A;  1X0T A;  1KIL D;  3CME P;  3SSU A;  3WUU A;  1HUC A;  2GUV A;  2P7J A;  3AEG C;  3V5B A;  4GOF A;  3O6Q B;  1IJD B;  3HE4 B;  1FZG A;  2C0W A;  2NPS D;  2I1K A;  2IPP A;  2PGD A;  1T3J A;  3Q5S A;  1H88 A;  2L91 A;  1NTK E;  3HD7 A;  3H1I D;  2IBZ G;  2QEX P;  2E5T A;  1G2C B;  3CC2 P;  5KLV J;  3CC4 P;  5AVT B;  3HTK B;  2KYV A;  3FX0 A;  3LW5 H;  1JNM A;  2H8P D;  4GIF A;  3I56 P;  4Y99 C;  5KLV K;  5CMZ A;  1J1D B;  1JY3 O;  2W6J H;  1KMI Z;  1QL2 A;  2YKO A;  3L4F A;  3MHV A;  1JY2 P;  2QJP C;  3HUS B;  2FKW B;  2RKL A;  2AXC A;  2E75 B;  1S3J A;  2KNC A;  2O01 H;  3RBX A;  5CCH C;  3H1J E;  3GHG C;  5L8R J;  1N73 B;  3H1J D;  2OYH C;  1Z56 A;  3M9B A;  3D71 A;  2E75 C;  1A02 F;  2ZT9 B;  3H1I G;  3SWY A;  1NTZ E;  4NPF X;  3UIA A;  1URQ B;  1VDF A;  2K9J A;  3H1H J;  2OTJ P;  2QM8 A;  1KN7 A;  2PRR A;  1L0L E;  1FJP A;  3OA7 A;  1IO4 A;  1SQX K;  1EXJ A;  3SWK A;  1RE3 A;  3CCS P;  1SQV G;  3GLM A;  1AV1 A;  2N1T A;  4PD4 H;  3A0H E;  2JKV A;  4H0L B;  4OVN F;  4Y99 B;  4H13 B;  1NWQ A;  1SQQ G;  2AXT H;  3RL0 C;  1HJ0 A;  1HBW A;  3A0H H;  3H1J G;  3KZI H;  5KAF H;  1T2K C;  1FZF A;  2SPZ A;  2WT7 A;  3OAK A;  5H2F H;  4W7Y A;  4O9B A;  3KZI E;  3G3Z A;  5KAF E;  2QRX A;  1NU1 D;  3IN6 A;  4ZKU A;  1EC5 A;  3A2A A;  1L4A A;  3CXH E;  5CCG A;  2H88 C;  1ZW0 A;  2KLU A;  1ZP0 C;  1NTZ K;  1T8Z A;  3H1H E;  4LC1 A;  1NTM K;  5M1B A;  1LJ2 A;  5B66 E;  3CX5 D;  2JJL A;  1GZL A;  5AVV B;  2N1T D;  2V7Q H;  3G71 P;  1Q81 Q;  1YQ3 C;  1QEX A;  1NTZ J;  1NTK G;  1PP9 G;  1SQP K;  2KP8 A;  2M5A B;  2R3C A;  2WSF H;  3AEA C;  3B5N B;  3PHL A;  3A0B E;  3MD0 A;  4M3L A;  2IBZ D;  1XTG B;  3I5C A;  4I7Z B;  2ZVO B;  3S1K A;  1N73 A;  2IFM A;  3HD7 D;  1R5S A;  2P1J A;  4K35 A;  2P2U A;  3H1H D;  2QJY B;  4I2L C;  2WSS H;  1WT6 A;  3WU2 H;  3CCE P;  2WWW A;  3L72 D;  5BVZ A;  3CCR P;  3TNU B;  2N9B A;  4OWF A;  1USE A;  2KZI A;  3VMA A;  2M0B A;  3GHG A;  2KZJ A;  3CCU P;  3CCV P;  1VQ5 P;  1EXI A;  1OZH A;  1SFC A;  3L70 G;  3EWK A;  2E75 D;  4HKZ H;  2C0X A;  2K37 A;  2QE7 H;  1GU5 A;  1KYO D;  1U57 A;  2YKP A;  3Q3D A;  1EQ7 A;  1RE3 C;  3WMM 0;  3C1L A;  3PLN A;  2N1T C;  3RK3 D;  1KB9 E;  1OMI A;  1PZQ A;  1PL5 A;  2JEE A;  3L74 E;  5KTB A;  1BCC D;  4NPD A;  2AEF A;  1SVF A;  2H43 A;  4L75 A;  1L0L K;  1QVG O;  2WSE J;  4I7Z C;  1SQP D;  2L5G B;  3L36 A;  3I55 P;  1VF5 D;  1BE3 D;  1ZV8 A;  5GTI H;  1ZLL A;  3CCM P;  1YIT P;  3H25 A;  3V2R A;  2NPS B;  3RL0 g;  3FGA D;  1U7J A;  4JPZ B;  3VMX A;  3SWF A;  3TYY A;  1PP9 J;  1ZOY C;  3VYI A;  1IK9 A;  4EI2 A;  2CPB A;  5AVZ B;  3NFQ A;  3HTK A;  1IFD A;  1FC2 C;  3H1K D;  4OGQ D;  3MGN A;  3L70 E;  4WY4 D;  1BGY G;  3CC7 P;  2IDB A;  1SFC C;  2OYH A;  1HGV A;  4Y28 J;  4EOT A;  1GD2 E;  3CX5 E;  1KYO H;  5KJ7 D;  2QJK B;  4ASW A;  1IZN B;  4UB8 E;  5AVS B;  3ABV C;  1KYO I;  3N4X A;  4HH2 A;  1AVO A;  1QGK B;  1KIL A;  3HRN A;  3BVH A;  2QG4 A;  2V7Q J;  1FU1 A;  4EDF A;  4N3Y B;  4GDO A;  1FZC B;  1J1E B;  2A45 I;  1OW8 A;  2PAJ A;  1LWU A;  2Y9Y A;  1T6A A;  2J59 M;  2WQY C;  3CCL P;  4C7R A;  2FYU D;  1RQU A;  3B4S A;  4JBZ A;  1LTT C;  2YMK A;  2YO3 A;  1BE3 J;  2FFD C;  4RJT A;  1AQT A;  1Y8A A;  2CK3 H;  2QJP B;  1NU1 K;  1S1C X;  3H1H G;  3LIE A;  5CCH D;  1KQS O;  1FDM A;  5E79 H;  1RF1 B;  3L75 G;  2O01 J;  4IFM A;  2E74 B;  3CCJ P;  3BCC G;  2Q3I A;  2Z5I A;  3AE6 C;  3M91 A;  1Q2N A;  1PGO A;  1USD A;  2ITA A;  2LKM A;  2QIW A;  3HE5 B;  2XDJ A;  2IYO A;  3OJA B;  1SLQ A;  4IFF A;  5AW9 B;  3H1L D;  5GTH H;  1SQB J;  1BCC G;  1N2D C;  4A7P A;  2QA4 P;  3TSI A;  5GTH E;  2FFD B;  1WMK A;  3AE4 C;  3H1K J;  1UIX A;  3FWN A;  4OH8 B;  4TLF A;  1HF9 A;  2GM4 A;  3SFD C;  1M1K Q;  1GDT A;  3AEF C;  1IFN A;  1JCC A;  2W6A A;  1KIL C;  1FE6 A;  4HJG H;  2NRG A;  1VQO P;  1J1E C;  1RQV A;  2KSE A;  2J58 A;  1Q82 Q;  2D2C B;  3CX5 H;  4OGQ B;  1WRG A;  1LWU C;  4WBA A;  1BCC E;  2HPC B;  4W7Z A;  1PGQ A;  2IX7 C;  3LW5 J;  5CCG D;  1NJI Q;  3IR9 A;  3L72 G;  1X22 A;  2BCC G;  3U1A A;  2YO2 A;  1GL2 C;  4CPG A;  1KIL E;  1HGZ A;  1KYO E;  1L4A B;  1LT1 A;  1SP4 A;  3B71 A;  1JM0 A;  1DH3 A;  3V2Q A;  1SFC B;  1KZU B;  3FXD A;  3H32 B;  2WMM A;  3PTZ A;  2OYI B;  1HVV A;  3PRJ A;  1M1J C;  3IFM A;  3AEC C;  1FAV A;  1JTH A;  1NAY A;  2Y0D A;  3HD7 C;  1KQF B;  1NO4 A;  3H1K E;  1L0N G;  4XA4 A;  2HFE D;  1OIP A;  3KQG A;  3VTP C;  2E76 B;  3CMA P;  1EDI A;  2R3S A;  4WVZ A;  5KJ7 C;  2NPS C;  3RK3 B;  2BCC E;  2WSC J;  5APS A;  1MZ9 A;  2I1J A;  2OGU A;  1X9V A;  3TGU E;  1SQQ E;  1EDK A;  1JMM A;  1LTJ C;  2W6B A;  1BCC J;  2A06 E;  2IBZ I;  2YNY A;  3P8C E;  3G4S P;  1SQP E;  3HUS A;  4C7N A;  5KLI B;  2GA1 A;  1LP1 B;  1N86 A;  3B5N C;  3EQ2 A;  3B8E B;  1L0L G;  3L74 J;  4KT0 J;  3E1I A;  3AE2 C;  4XE5 B;  5EFW B;  2YXQ B;  3L75 D;  2W8Z A;  5B66 H;  1RY3 A;  1VQN P;  3VMZ A;  1GL2 A;  1MUU A;  2WPV B;  2OTL P;  1PFI A;  1IC2 A;  5APT A;  3AE9 C;  3GMA A;  1S5L E;  3HD7 B;  1PP9 E;  4ZKP A;  1XTC C;  1JB0 J;  2YMY A;  2KB7 P;  1M1J A;  3NMD A;  3CL3 D;  1NYH A;  1AA0 A;  3L72 J;  4H44 B;  2OYH B;  2B89 A;  1L0N E;  2OQQ A;  4EYY Q;  1GL2 D;  4R4M A;  3S4R A;  2JWD A;  4IL6 X;  2OYO A;  4KHX A;  2QJY C;  2QSI A;  3USS A;  5CCG C;  4DZO A;  5TIS H;  1YJN P;  2NPS A;  2FFD A;  1HTL C;  1JTH B;  1LWU B;  1NTZ D;  2XND H;  4YXW H;  1JY2 O;  2OTK E; 
#chains in the Genus database with same CATH homology
 3L37 A;  1VPC A;  3V4W A;  4W80 A;  3NTN A;  3VOP A;  5KJ7 A;  1N73 C;  2OYH B;  1LTI C;  5APY A;  2WPR A;  2P67 A;  1J1D C;  5AW1 B;  1JOC A;  1MV8 A;  5AVR B;  3VMY A;  1YTZ T;  2FYZ A;  2FYU K;  2IFN A;  1KFM A;  2WIT A;  1IFI A;  4C46 A;  5CJ0 A;  1HJB A;  3LID A;  1T2K D;  3MIW A;  5AW3 B;  4WB4 A;  5AW2 B;  1S9K D;  1SQV K;  1J2J B;  4GT1 A;  3KDP B;  1ZR2 A;  2M8R A;  2Z4E A;  5AVQ B;  1LTJ A;  1LGH B;  3NXS A;  5CHX A;  3V4Q A;  4B86 A;  2H7H A;  1CSB A;  2M3B A;  2HPC A;  3B5N A;  1SQB K;  3PP5 A;  1FZA A;  1RF1 A;  3KYQ A;  5AW5 B;  5CJ4 A;  1KQL A;  1LT9 B;  4JF7 A;  2VRS A;  3P8M C;  2FXM A;  1FZC A;  1HWT C;  2E43 A;  2QM7 A;  3M9Q A;  3EFG A;  1JY3 N;  2Q5U A;  3TK1 A;  2KOG A;  1LTA C;  4GKG A;  1JY2 N;  1YYC A;  1S9K E;  5BU8 B;  3P8C D;  5APV A;  4LGD E;  4RES B;  1MFZ A;  2WTY A;  3M0D A;  1GL2 B;  1NKN A;  1JO5 A;  5APX A;  2A45 H;  1CI6 A;  1LTB C;  1OXZ A;  2O1K A;  3RK2 B;  3O8Z A;  3CLQ A;  5AVU B;  2HG5 D;  2KLV A;  3U1C A;  1W2E A;  1LTS C;  3V2N A;  3VN0 A;  1X79 B;  2XU6 A;  3RL0 B;  3R2P A;  4DOJ A;  5AW6 B;  3P7K A;  1H8A A;  2OYI A;  2MJZ A;  1FJK A;  2WSE H;  2BAS A;  5APQ A;  4AYC A;  1N7S C;  4LLH A;  3RL0 D;  2HOD A;  3RK2 C;  3HUS C;  3P32 A;  5BU5 A;  1X8Y A;  2O1J A;  3M06 A;  3U59 A;  1IFJ A;  3VP8 A;  3H32 A;  1CZQ A;  5AW7 B;  2XV5 A;  4I1L A;  3CI9 A;  1GU4 A;  2XKM A;  2Q9I A;  2PP6 A;  2HYN A;  3H6P A;  3MUD A;  5APW A;  5AW8 B;  1OWA A;  1T3U A;  3A7O A;  1N7S A;  1M7L A;  2OAR A;  3HE4 A;  1RF0 A;  2XNX A;  1A02 J;  3A3Y B;  4WY4 A;  2W27 A;  2N1T B;  2R5D A;  1LT9 C;  3V2P A;  1E5W A;  2WT7 B;  1N7L A;  1FZB A;  1NTK K;  3MTU E;  1M1J B;  1L0N K;  1LTG C;  3BAT A;  1L4A C;  5AVY B;  4HYT B;  1QL1 A;  1CI6 B;  1FOS E;  2HLO A;  1G2C A;  1RF0 C;  3L35 A;  1SFC D;  2C9N Y;  4WY4 C;  2R5B A;  3M9H A;  1DEB A;  4EIJ A;  1KIL B;  2ZXE B;  1N7S B;  3BAS A;  2KSJ A;  1JCD A;  1JY3 P;  5APU A;  1NOH A;  1RE4 A;  2GUS A;  1DX7 A;  1G1I A;  2ZFC A;  3M0A A;  1RF1 C;  1FZE A;  3TNU A;  1GTW A;  2C9L Y;  4IFD K;  3GHG B;  3T97 A;  1URQ C;  2WSC H;  4N78 D;  1FZC C;  1L4A D;  1SQQ K;  1N7S D;  3BRT B;  4AQR D;  2Q7C A;  3RK2 D;  2WPQ A;  1H89 A;  2A45 G;  5AW0 B;  1YTZ I;  2XZR A;  1RE4 C;  3KPE A;  1ZR4 A;  1NHL A;  4AUW A;  1LT9 A;  3VP9 A;  1KFN A;  3M0D C;  4N78 E;  1NH4 A;  1JUN A;  1URQ A;  3B5N D;  3II6 A;  5AW4 B;  1AQ5 A;  1FOS F;  1LTJ B;  1GW4 A;  1GK6 A;  3N7N A;  1NAF A;  2R32 A;  2Z5H A;  4N6J A;  3BRV B;  3V2R A;  3HE5 A;  1HH0 A;  3RK3 C;  2HOD B;  1URQ D;  2E42 A;  4JYC A;  3C9I A;  2WPS A;  1FBM A;  1GW3 A;  2YKQ A;  2OYI C;  1IFM A;  5AVX B;  1A02 F;  1GK4 A;  1CW5 A;  5AVW B;  1NKZ B;  1ZN5 A;  2POH A;  1G1J A;  2CPS A;  4I6M C;  4C7N B;  3A5T A;  2WZ7 A;  4JYB A;  1KIL D;  1HUC A;  2GUV A;  2P7J A;  3V5B A;  3HE4 B;  1IJD B;  2C0W A;  2NPS D;  2I1K A;  2IPP A;  1T3J A;  1H88 A;  3HD7 A;  1G2C B;  5AVT B;  3HTK B;  2KYV A;  3LW5 H;  1JNM A;  2H8P D;  4GIF A;  4Y99 C;  5KLV K;  5CMZ A;  1J1D B;  1JY3 O;  1QL2 A;  2YKO A;  3L4F A;  3HUS B;  1JY2 P;  5CCH C;  2FKW B;  2O01 H;  3GHG C;  1N73 B;  2OYH C;  1Z56 A;  3M9B A;  3SWY A;  3UIA A;  1URQ B;  1VDF A;  2QM8 A;  1FJP A;  3OA7 A;  1IO4 A;  1SQX K;  1RE3 A;  2N1T A;  1NWQ A;  4Y99 B;  3RL0 C;  1HBW A;  1T2K C;  1FZF A;  2WT7 A;  3OAK A;  4W7Y A;  4O9B A;  3G3Z A;  4ZKU A;  3A2A A;  1L4A A;  5CCG A;  1NTZ K;  1T8Z A;  4LC1 A;  1NTM K;  2JJL A;  1GZL A;  5AVV B;  2N1T D;  1SQP K;  2KP8 A;  2R3C A;  2WSF H;  4WY4 B;  3B5N B;  3MD0 A;  4M3L A;  1XTG B;  3I5C A;  2IFM A;  3HD7 D;  2P1J A;  2P2U A;  4I2L C;  1WT6 A;  2WWW A;  5BVZ A;  3TNU B;  2N9B A;  3GHG A;  1SFC A;  2C0X A;  1GU5 A;  2YKP A;  1EQ7 A;  1RE3 C;  3WMM 0;  2N1T C;  3RK3 D;  2JEE A;  5KTB A;  2H43 A;  1SVF A;  1L0L K;  2L5G B;  3L36 A;  1ZV8 A;  1ZLL A;  2NPS B;  3SWF A;  3VMX A;  3TYY A;  3VYI A;  1IK9 A;  2CPB A;  5AVZ B;  3NFQ A;  3HTK A;  1IFD A;  3MGN A;  4WY4 D;  2OYH A;  1SFC C;  1GD2 E;  1HGV A;  4EOT A;  5KJ7 D;  5AVS B;  3N4X A;  4HH2 A;  1KIL A;  3HRN A;  3BVH A;  1FU1 A;  4N3Y B;  1FZC B;  1J1E B;  2A45 I;  2PAJ A;  1LWU A;  2J59 M;  4C7R A;  1LTT C;  2YO3 A;  2FFD C;  3LIE A;  1NU1 K;  5CCH D;  1RF1 B;  4IFM A;  2Q3I A;  2Z5I A;  3M91 A;  2LKM A;  3OJA B;  5AW9 B;  4IFF A;  3HE5 B;  2XDJ A;  1N73 A;  1SLQ A;  1N2D C;  3TSI A;  2FFD B;  4OH8 B;  2GM4 A;  1GDT A;  1IFN A;  1JCC A;  2W6A A;  1KIL C;  1J1E C;  2J58 A;  1WRG A;  1LWU C;  4WBA A;  2HPC B;  4W7Z A;  2IX7 C;  5CCG D;  3IR9 A;  3U1A A;  2YO2 A;  1GL2 C;  1AFO A;  1SP4 A;  1HGZ A;  1L4A B;  1DH3 A;  3V2Q A;  1SFC B;  1KZU B;  3H32 B;  2OYI B;  1HVV A;  1M1J C;  3IFM A;  1FAV A;  1JTH A;  3HD7 C;  1NO4 A;  4XA4 A;  2HFE D;  3KQG A;  3VTP C;  5KJ7 C;  2NPS C;  3RK3 B;  5APS A;  1MZ9 A;  2I1J A;  1X9V A;  5CCH A;  1FZG A;  1JMM A;  1LTJ C;  2W6B A;  3P8C E;  2YNY A;  3HUS A;  4C7N A;  1N86 A;  3B5N C;  3EQ2 A;  3B8E B;  3E1I A;  4XE5 B;  1RY3 A;  3VMZ A;  1GL2 A;  1MUU A;  1PFI A;  1IC2 A;  5APT A;  3HD7 B;  4ZKP A;  1XTC C;  2YMY A;  2KB7 P;  1M1J A;  3NMD A;  3CL3 D;  1GL2 D;  4KHX A;  5CCG C;  4DZO A;  2NPS A;  2FFD A;  1HTL C;  1JTH B;  1LWU B;  1FDM A;  1JY2 O; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...