1N86A

Crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Fibrin alpha/alpha-E chain
publication title The crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface.
pubmed doi rcsb
molecule tags Blood clotting
total genus 21
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n86A00
1RF1B 2OYIC 1LT9C 1JY3O 1N73A 2FFDA 1JY3N 1M1JA 3HUSB 1LTJB 2A45G 3HUSA 1LWUC 1RF1A 3GHGB 2Q9IA 1LTJA 1FZCC 1FZGA 1RF0A 1JY2P 1N86A 2XNXA 1RE3C 3GHGA 3BVHA 2HPCA 2OYHC 2Z4EA 2FFDC 3H32B 1JY2O 1FZFA 1M1JC 1JY2N 1FZAA 1RE4A 3H32A 1N73C 1RF1C 1FZBA 2OYIB 2H43A 1LT9B 1FZEA 1W2EA 2HODB 3HUSC 1LTJC 2HODA 2HLOA 1RF0C 2OYIA 1LT9A 1LWUB 3GHGC 2A45H 1FZCB 1LWUA 3E1IA 2OYHB 1RE3A 1FZCA 1JY3P 2OYHA 1RE4C 2A45I 2HPCB 1T3UA 2FFDB 1N73B 1M1JB
chains in the Genus database with same CATH superfamily
4OGQC 4DOJA 1N7LA 1NU1G 1EZVI 2QJYB 1EDLA 1AJYA 5AVYB 4R4MA 3RBXA 3VP8A 4K3AA 1NAFA 1BGYD 4QMAA 2ZXEB 2B89A 4DJGA 3H6PA 1VQ6P 1K8AQ 4MN4C 3PRJA 3FGAD 1K9MQ 1EZVG 1NAYA 2Q6QA 4HKZH 2RKLA 2KIKA 2QM8A 3L70E 4D6TE 3AE6C 1DIPA 2XU6A 3WU2H 1PV3A 3RL0C 2WT7B 1YYCA 1GL2C 5APWA 5AVRB 1U57A 2O1JA 5KLIB 3H1JD 5KJ7C 1YIJP 1OX3A 3AEEC 3AE1C 4IFMA 2P10A 3EWKA 3TGUJ 2K1AA 2YNYA 1RE4A 1DH3A 1GW4A 2OTKE 2E75C 2FY8A 1MFZA 5AVUB 5CJ0A 2OTJP 1DX7A 2OYHA 2ZYGA 1SQPK 1HWTC 1YTZT 1N86A 3TNUB 5APTA 2PGDA 4PV1B 1L4AA 3QWOC 2WPSA 1KB9D 1X0TA 4UB8H 5DJUB 1E79H 4AQRD 3BRVB 2B88A 3AE8C 1QVFO 2BCCE 1FZGA 1S9KD 2AEJA 4GOEA 1RY3A 2P2UA 2A06G 3L73G 1KC8Q 1N2DC 1GK4A 3H1KG 1VQKP 1SQQK 5KAFH 1IFIA 1QLED 3CC2P 2JR8A 1N73B 2D2CD 1BCCG 3RGUA 2JO1A 2QJPC 3L74E 2B87A 1RF1C 1EC5A 1NTKE 5CCHD 3L70D 4D6TD 1Y8AA 2C0WA 3HRNA 4R4LA 2J58A 4UB8E 1BGYJ 1NTZE 5AVTB 1SQPG 4I6MC 1R5SA 2JEEA 1KTMA 2B87B 1T2KC 3IR9A 3N4XA 3C8VA 4NPEA 1P84I 2E5TA 5AVXB 2IFNA 1Y47A 3WUUA 1K73Q 3V2QA 5KAFE 4IL6H 3JSVC 4H44B 5H2FH 2OYIC 1J1EB 3L72D 1OVUA 2OQQA 2YKOA 4TLFA 2E42A 1PZQA 5CCGA 1LTSC 1KILA 2L91A 1L0LK 1W2EA 1OZHA 5AVVB 3RL0g 3BCCE 3MP7B 3GW6A 3AEBC 1URQD 2QJKB 3CX5D 1CSBA 3H1JJ 4WB4A 1AVYA 2QE7H 2SPZA 1NWQA 3NTNA 3KYQA 4H0LC 3D70A 3CWBD 2ZYDA 1VDFA 3AE7C 2NZ2A 1HF9A 2AXTH 3CCVP 4IL6E 3L73E 2AXCA 5H2FE 2O01N 1VL2A 2KSEA 4UB6H 3M91A 1IFMA 4ZKUA 3HTKA 2BEQD 2RMZA 4GT1A 3B71A 1TU3F 2LXBA 2HR3A 3GHGC 4IFDK 1BDCA 3M9HA 3Q3DA 3L36A 3WUVA 1Q82Q 1ZV8A 1SS1A 1GL2A 1ZN5A 2K9JA 2FXPA 1NH4A 1PPJG 2M5AA 1VF5B 1VQMP 3L74D 2QEXP 2QJYC 1L0LG 5KKZB 4BRYA 1OW7A 4NPDA 1PGQA 2AXTE 3AE4C 2XNXA 4YPCA 1BDDA 3A0HH 4L73A 3GMAA 2Y0CA 3HE5B 4UB6E 2R3CA 5L8RJ 3II6A 1PGPA 3CXHD 4XA4A 1RH5B 3LW5J 2A45I 2IBZE 1UIIA 3K5BA 1NKZB 2CPBA 3FXDA 4YTPC 3L70J 4D6TJ 1SQXK 2G3AA 1SQVJ 1Q81Q 3SSUA 3MHVA 3OW2O 5AW9B 5KLVG 4LGDE 1S72P 3PH0A 3BCCD 1BSNA 4PJ0H 3H1HG 2BASA 2QM7A 1IFNA 3G3ZA 4H13D 4I7ZC 2MKVA 3E1RA 4I1LA 1CZQA 2KZIA 3OA7A 2ZVOB 3L72J 2P7JA 3G4SP 2FYUE 5BU8B 5KJ7D 4YXWH 2R32A 1N7SD 1VQ8P 1RF1A 3L73D 4M3LA 3PP5A 2FYNB 3PLNA 2OARA 1NTMG 1H88A 3VTPC 2E75D 3CWBJ 1BCCD 4PV1C 4RO0A 3I55P 1ZOYC 3M9BA 3BRTB 2E76D 5KTBA 2OYHC 1XTCC 1MV8A 3V2NA 3VMZA 1IFJA 2K9YA 2WSSH 1SQXG 1G2CA 1YHQP 2IFMA 1BGYE 5CHXA 1J2JB 4GIFA 1EDJA 1J1DB 1QEXA 5BU5A 2KYVA 3AE9C 3V5BA 1D7MA 1FDMA 1U7MA 4W7ZA 2R5DA 3L71G 3SWYA 4Z1MH 1M56D 1SFCD 4HYTB 2M3EA 2WSFJ 1SLQA 1JTHA 2E74B 3MUDA 2ZT9D 2JWAA 4B86A 2XKMA 2QG4A 4KJMA 2Q1KA 1HVVA 3HD7B 3MD0A 3RK2D 5K5GB 1U7JA 1ZRTD 1FZAA 1KB9H 3B5NB 3SWFA 3AEAC 1JTHB 2H8PD 1FJPA 1M1JB 1OW6A 2Y0EA 1USEA 1Y9BA 3FWNA 4WY4A 3P32A 3VYIA 1FZBA 1LT9B 1M90Q 2W83C 1T2KD 5AVSB 1JB0J 2FYUD 2OTLP 1KV4A 1IFPA 3BCCJ 1NHLA 4JQ0D 2Y9ZA 3LW5H 4WY4B 2QJKC 1NTKK 1Q90D 1NOHA 1LWUB 1KB9E 3CCEP 1YITP 2YIUB 2W6BA 5APUA 2KOGA 2XV5A 3SWKA 1L0NG 1HTLC 1WT6A 1NTZK 1LTJB 1SQBG 1S9KE 2OYOA 1M1KQ 3A3YB 2YO3A 1ZXGA 1OFCX 1VQOP 1S4XA 2FXMA 4H0LD 4LC1A 3L73J 1NJIQ 5AW7B 1EXJA 1AQTA 3PHLA 2VRSA 2Q9IA 1BCCJ 2WT7A 1FDIA 1RQVA 2W27A 1SQVE 1VF5C 1NKNA 5APXA 3CX5H 2YKQA 2POHA 1KQSO 1Q86Q 2KNCA 3CL3D 1ZP0C 3T97B 5KLVD 2QVAA 3CCMP 3USSA 1PP9G 5KKZC 4JBZA 4RKUJ 3A7OA 2Y0DA 5B5EH 1Q2NA 1GU5A 2IX7C 2IPPA 2IZ1A 3H1HD 2XNDH 3D71A 5AVZB 2ZXXA 4EI2A 1LP1B 1A02F 4JYBA 2KNCB 3L72E 4O9BA 1YQ4C 4ZMDA 1HUCA 3CCQP 3TNUA 1KN7A 1JM0A 1H0TB 2FYZA 3G71P 1SVFA 3CLQA 1OVVA 3Q5PA 3CX5E 5CCHA 1BE3G 2YXRB 3LIDA 2WQYC 3BVHA 2D2CB 2WSFH 3HE4B 1NTMD 4IOIH 1EXIA 1JY2N 3CWBE 1PFIA 5B5EE 3AE5C 1IC2A 1L0NE 1LTTC 1NU1E 1SQBE 3TF5A 4C7NB 2RH0A 1N73A 4C7RA 3Q1MA 1LGHB 3Q2YA 2J59M 1IO4A 1JY2P 2FYUJ 1QVGO 5AW6B 3H1LG 3H32B 4GKGA 3P8MC 3I5CA 3BASA 3TSIA 3CXHH 2N1TA 1JO5A 3MIWA 3U1CA 2HPCB 4OH8B 1HBWA 1EZVE 2KSJA 3L71D 2WPVB 3VP9A 3V4QA 1G1JA 1GMJA 3FX0A 5APSA 4BWNA 3RK3E 3A0BH 5GTHH 2N1TB 3L75G 2WZ7A 1SQVD 1DEEG 1KILE 4JPZB 1HH0A 2WWWA 2PAJA 3KZIE 1URQB 2KS1B 2O3JA 2MJZA 4XE5B 2W6AA 3CXHE 1K05A 2WPRA 2IBZI 1G1IA 2NPSD 1L4AD 2ZAEB 3C1LA 1S3JA 1RQUA 4N6JA 1GU4A 2E74C 5AW2B 3A0BE 1JCCA 5AW5B 4L76A 5KLVJ 3EQ2A 3FXEA 5GTHE 4EOTA 3HD7C 2RN0A 3TGUG 2O1KA 3B5NC 3H1HJ 1SQQG 3CMAP 1IZNB 3MUDC 1KYOD 3O8ZA 1PGJA 1M1JC 5CBOA 2Q3IA 2AEMA 1L0ND 3V6IA 2QSIA 4LLHA 1NU1D 4W7YA 1SQBD 4PD4D 3SFDC 5APYA 1LT9C 1K04A 1LT1A 1Q7YQ 2A06E 2JP3A 4OVNF 1XTGB 2Z4EA 3OJAB 3VMAA 3H1KE 1FS0E 2YMYA 1NYHA 3KPEA 1FZCB 2LKMA 1NTMJ 2WSEJ 4WY4C 2KZJA 1BCCE 1YI2P 1EZVD 2XDJA 1LWUC 4Y28J 2GM4A 2YIUC 2Z5IA 3O6QB 4Y99B 4GDOA 2Z5HA 4L75A 3RK3D 3HE5A 1LTJC 1H8AA 4A7PA 5CCGD 1KILD 1SQPE 4OGQD 3V2RA 1FE6A 3IF4A 3L71J 4HB1A 4H13B 1HGVA 1YBKA 5KAIH 3EFGA 4EYYQ 5E79H 2IDBA 2GUSA 3MTUE 5M1BA 3UIAA 1W5CE 1KFMA 1N7SB 1S5LE 1VQPP 1ZRTE 1A02J 3JCUH 1EDIA 1YJWP 1SQQE 1RE3A 2FFDB 4U7JA 2A45G 5KLIC 1L2PA 3RL0D 2P1JA 1LNQA 1N8RQ 1GL2D 2E76B 5KAIE 3TK1A 2H88C 1ZMEC 1SFCA 5E79E 5CJ4A 3TDKA 3A5TA 3H1LD 2A06D 3B8EB 3H1IG 3H1KD 3JCUE 1VQ5P 1SQVK 1KB9I 1X9VA 1KMIZ 1SFCB 4W80A 4U3FG 5AW3B 4CPGA 2KI7B 1PPJE 3P7KA 3PJSK 3SFEC 1KORA 1L0NJ 3D6YA 4HH2A 3VOPA 2W6JH 2ZT9B 1NU1J 1SQBJ 5AW0B 3CMEP 1DEBA 3L75D 5CCHC 2UWJE 4RJTA 1JCDA 1LTAC 1R5LA 1L0LE 2M3BA 3RK2B 5TISH 1ZW0A 2V4HA 2P67A 4I2LC 2QJPB 2XZRA 2HG5D 2GUVA 2W90A 1SQPD 2KLVA 4DT0A 1SP4A 3HD7A 3IAOA 1N73C 1KQLA 4DCKA 5GTIH 4EIJA 3W68A 3B5NA 4KT0J 3H25A 1M1JA 1YTZI 2N1TC 5KLVE 2WITA 2WSEH 1KZUB 4AYCA 4HJGH 2B9BA 3VMYA 1P84D 1LT9A 3H1HE 3ITKA 1URQC 5TISE 3KHUA 1SQQD 4D6TG 1CI6B 1JMMA 2YMKA 4TT3H 1CW5A 1GZLA 1AVOA 1QX8A 2JWDA 1PGOA 4H44C 3FWLA 1J1EC 1S5LX 5GTIE 1LWUA 3P8CD 3CX5I 2K37A 2FBWC 1LTJA 3CPWO 2HYNA 1PL5A 1NTME 1JY2O 5C39A 1HGZA 2H89C 4ZKPA 3CCUP 2DW3A 2ZJSE 3N7NA 1PPJD 1SQXE 3GHGB 1NO4A 3AEFC 3W67A 3PTZA 1T3JA 3H1LJ 5BVZA 2KLUA 2H43A 4JF7A 2CK3H 1L0LD 2E43A 3KDPB 2KXPB 3F89A 3H1KJ 3KQGA 3L71E 2M8RA 1FZCC 2R3SA 1FAVA 1OWAA 3T97A 2BCCG 1FBMA 2PP6A 3S1KA 3ABVC 1S1CX 3L75J 4Y99C 4WY4D 2C9LY 1ZLLA 3GG2A 1LP1A 3NXSA 3HUSA 1KYOH 3CCRP 5B66H 1VQ7P 3S9OA 2YXQB 1DD3A 1SQPJ 3CI9A 1H0TA 3L74G 3AE3C 3CXHI 4PD4H 1EQ7A 1NTKG 1X79B 4H13C 2R44A 2ZYAA 3HUSB 2Y9YA 1GDTA 1IK7A 4ASVA 1NTZG 3HE4A 2YKPA 4I7ZB 2HODA 1FJKA 2IYOA 1N7SC 1VQNP 2QA4P 1E5WA 4C7NA 3H1ID 3CD6P 2K88A 1SQQJ 2FFDC 1KYOE 5B66E 3H32A 1GK6A 2HODB 1FZEA 4U3FD 3QH9A 4PD4E 1MZ9A 2HPCA 3F5HA 3BCCG 2E76C 1JY3N 3KZIH 3WU2E 1SQXD 1RE3C 3S4RA 2NPSA 1DD4A 3ZDMA 4IFFA 2OYHB 1JY3P 2I1KA 4N78E 2ZVNB 3L35A 2H7HA 3G9RA 3EFFK 2FYNC 1GTWA 1RHZB 2P58A 1SFCC 1VQ9P 2NPSB 1URQA 1L4AB 2KS1A 3CCJP 2KK7A 2ZT9C 3L37A 1JMBA 2WMMA 1PP9E 1L0LJ 2LR2A 3GF3A 3JC22 4PV1D 3RK2C 4ZNCA 1J1DC 1QL2A 5AVQB 1JOCA 4N3YB 3CCLP 3OAKA 1ZR2A 3L4FA 3IFMA 3LIEA 1EDKA 2FYUK 3MZWB 5DJTB 3NMDA 2W8ZA 1KQGB 1Z56A 2WSCJ 4ASWA 3V2PA 2IZ0A 1IK9A 1BE3E 3I56P 2CPSA 1YQ3C 1M7LA 2IBZG 2LXCB 2N1TD 1R8EA 1ZR4A 1IJDB 3RK3B 1IFDA 1FZCA 3MGNA 3H1LE 2I1JA 2WVRA 1KILB 5AW8B 3O6QA 2ITAA 2FXOA 1FZFA 3H1IJ 4OGQB 5AW1B 4H44D 1KQFB 1LTGC 3E1IA 5AVWB 3CCSP 1T8ZA 4U3FJ 4N78D 2O01J 2FYUG 5KLVK 2BCCD 1VPCA 2JJLA 1S5LH 4EDFA 3L75E 2PFXA 1P84H 1SQXJ 1RF0C 1MKMA 1AA0A 3VN0A 3CC7P 1LJ2A 2C9NY 1PP9D 2QRXA 2L5GB 3M0DC 4OWFA 5KJ7A 3HTKB 1VQ4P 1N7SA 3GF7A 3A2AA 2HFED 1NTKD 1LTBC 2YO2A 1M8OB 4WVZA 3RL0B 1NGMB 1BGYG 2IYPA 2V7QJ 2OGUA 1GL2B 2WPQA 2FFDA 2K9JB 4K35A 4BXLA 1NTZD 1OIPA 2M5AB 1WMKA 1NTMK 3D6ZA 3U59A 1P84E 3TGUE 2JKVA 1AFOA 1FDOA 1BE3D 4BRYB 1MUUA 1VF5D 1OW8A 3V4WA 3M0AA 2E75B 1M57D 2Q3EA 4NPFX 2QIWA 2NRGA 4L74A 3HUSC 1YJ9P 3AEGC 3B4SA 2R5BA 1KFNA 3P8CE 4GOFA 1FC2C 2KP8A 1H89A 3VMXA 2ZFCA 3H1JG 3KXDA 1JNMA 2G8YA 1LTIC 4AUWA 1W2BO 3C9IA 3A0HE 3TYYA 4DZOA 1KD1Q 3Q5SA 4XFJA 1QL1A 2D2CC 1T3UA 2WSCH 2K3RA 5APVA 2C0XA 1NVOA 2AEFA 2Q7CA 1GD2E 1JUNA 4YXDC 3NFQA 2A45H 3RBZA 4GODA 3M06A 1RE4C 4PJ0E 1RF1B 2BEZF 3WMM0 1X8YA 4IL6X 5TJHA 1T6AA 2JDIH 1X22A 2BCCJ 2OYIA 1QGKB 3WUTA 2KUBA 5APQA 2NPSC 1L4AC 3M9QA 1FU1A 4WWIA 1CI6A 3AEDC 1MFTA 4C46A 3R4YA 1G2CB 5CMZA 5AW4B 1VQLP 1FOSE 1PP9J 2OYIB 2O01H 1L0NK 1OVRA 1NU1K 3R2PA 3TGUD 1SQBK 3AE2C 1PIXA 3L74J 1BSHA 2IBZD 3L70G 1NTKJ 3IN6A 1SQVG 1USDA 1FOSF 1YJNP 1NTZJ 3E7KA 3H1JE 1WRGA 2J5UA 1OMIA 1AQ5A 2PRRA 4H0LB 2N9YB 2WTYA 5EFWB 1HJBA 3AECC 3H1IE 4JYCA 4WBAA 4RESB 1RF0A 3GHGA 1BE3J 2V7QH 3L72G 3GLMA 1KYOI 2KB7P 2E5YA 2E74D 4U3FE 3Q5RA 1UIXA 2N9BA 3M0DA 3HD7D 4PD4I 1JY3O 2FKWB 3B5ND 3RK3C 1HJ0A 3BATA 4KHXA 3G6EP 2GA1A 1JEKA 3CC4P 2HLOA 2Q5UA 2M0BA 1AV1A 5CCGC 3CWBG 1S2EA 3U1AA 1KILC 1OXZA 1GW3A 5CBNA 2I8DA
chains in the Genus database with same CATH topology
3L35A 2H7HA 3M9BA 4DOJA 1N7LA 2XDJA 3BRTB 1LWUC 1GTWA 2GM4A 5KTBA 2Z5IA 1SFCC 1XTCC 2OYHC 1MV8A 3V2NA 3VMZA 4Y99B 1IFJA 2NPSB 1URQA 2Z5HA 1L4AB 5AVYB 3RK3D 1G2CA 3VP8A 2IFMA 1NAFA 5CHXA 3HE5A 2ZXEB 1LTJC 1J2JB 3H6PA 4GIFA 1J1DB 5BU5A 1H8AA 2KYVA 3L37A 5CCGD 3V5BA 1KILD 1FDMA 4W7ZA 3RK2C 3V2RA 2R5DA 1J1DC 1QL2A 5AVQB 3SWYA 1JOCA 4N3YB 1SFCD 4HYTB 3OAKA 1HGVA 1ZR2A 2QM8A 3L4FA 3IFMA 3EFGA 3LIEA 2FYUK 2GUSA 1SLQA 1JTHA 3MUDA 3MTUE 3NMDA 4B86A 2XU6A 2XKMA 3UIAA 3RL0C 2WT7B 1YYCA 1HVVA 3HD7B 1Z56A 3MD0A 3RK2D 1KFMA 1N7SB 1GL2C 5APWA 1FZAA 3V2PA 1A02J 5AVRB 2O1JA 3B5NB 3SWFA 1IK9A 5KJ7C 1JTHB 1RE3A 2FFDB 2H8PD 4IFMA 1FJPA 2CPSA 1M1JB 1M7LA 2A45G 2N1TD 3RL0D 2P1JA 2YNYA 4WY4A 1ZR4A 3P32A 1RE4A 3VYIA 1FZBA 1LT9B 1GL2D 1DH3A 1T2KD 1GW4A 1IJDB 5AVSB 5AVUB 1MFZA 3TK1A 5CJ0A 3RK3B 1IFDA 1FZCA 3MGNA 1SFCA 2OYHA 1DX7A 5CJ4A 1SQPK 3A5TA 1HWTC 2I1JA 3B8EB 1YTZT 1N86A 1NHLA 3TNUB 1KILB 3LW5H 4WY4B 5AW8B 5APTA 1FZFA 1NTKK 1L4AA 5AW1B 1NOHA 1LWUB 1SQVK 2WPSA 1X9VA 1LTGC 3E1IA 2W6BA 1SFCB 4W80A 5APUA 5AVWB 2KOGA 5AW3B 2XV5A 4AQRD 1T8ZA 3BRVB 3P7KA 1HTLC 1WT6A 4N78D 1NTZK 5KLVK 1LTJB 4HH2A 3VOPA 1FZGA 1S9KE 1VPCA 1S9KD 3A3YB 5AW0B 2JJLA 1RY3A 2P2UA 2YO3A 1DEBA 5CCHC 2FXMA 4LC1A 1JCDA 1LTAC 1N2DC 1RF0C 2M3BA 1GK4A 3RK2B 5AW7B 1SQQK 2P67A 4I2LC 3VN0A 1IFIA 2XZRA 2HG5D 2VRSA 2GUVA 1N73B 2C9NY 2Q9IA 2KLVA 2L5GB 3M0DC 1SP4A 2WT7A 5KJ7A 3HTKB 3HD7A 1N7SA 1N73C 1RF1C 2W27A 3A2AA 2HFED 1KQLA 1LTBC 5CCHD 2YO2A 4EIJA 3RL0B 2C0WA 3HRNA 3B5NA 2J58A 1NKNA 5APXA 2YKQA 1GL2B 2POHA 2WPQA 2FFDA 1M1JA 3CL3D 1YTZI 2N1TC 5AVTB 1NTMK 2WITA 4I6MC 2WSEH 1KZUB 2JEEA 4AYCA 3A7OA 1T2KC 3IR9A 3N4XA 3U59A 3VMYA 1GU5A 1LT9A 2IX7C 5AVXB 2IFNA 2IPPA 1URQC 5AVZB 1AFOA 3V2QA 1CI6B 1MUUA 1A02F 1JMMA 4JYBA 2OYIC 1J1EB 3V4WA 3M0AA 4O9BA 1CW5A 1GZLA 2YKOA 2E42A 1HUCA 5CCGA 1LTSC 3TNUA 1KILA 2FYZA 1L0LK 1W2EA 3HUSC 1J1EC 5AVVB 1SVFA 1LWUA 2R5BA 3CLQA 1KFNA 3P8CE 3P8CD 2KP8A 1H89A 1URQD 3VMXA 2ZFCA 1JNMA 5CCHA 1CSBA 4WB4A 1LTIC 3LIDA 4AUWA 1LTJA 1NWQA 3NTNA 3BVHA 3C9IA 2HYNA 2WSFH 3KYQA 3HE4B 3TYYA 1JY2O 1JY2N 4DZOA 1HGZA 1PFIA 4ZKPA 1VDFA 1IC2A 1LTTC 1QL1A 1T3UA 2WSCH 4C7NB 1N73A 3N7NA 4C7RA 5APVA 1LGHB 3GHGB 2C0XA 1NO4A 2J59M 1IO4A 1JY2P 1T3JA 5AW6B 3H32B 4GKGA 3M91A 1IFMA 3P8MC 2Q7CA 4ZKUA 5BVZA 1GD2E 1JUNA 3HTKA 3I5CA 3BASA 3NFQA 3TSIA 2H43A 4GT1A 4JF7A 2E43A 3GHGC 3KDPB 4IFDK 2A45H 2N1TA 3M9HA 1JO5A 3MIWA 3L36A 3M06A 3U1CA 1RE4C 2HPCB 4OH8B 1ZV8A 3KQGA 1HBWA 1ZN5A 1GL2A 2KSJA 1RF1B 3VP9A 3V4QA 2M8RA 1G1JA 1FZCC 3WMM0 1X8YA 1NH4A 1FAVA 1OWAA 5APSA 3T97A 1FBMA 2PP6A 2OYIA 2N1TB 2WZ7A 5APQA 4Y99C 2NPSC 1L4AC 3M9QA 4WY4D 1FU1A 2C9LY 1HH0A 1ZLLA 1CI6A 2WWWA 3NXSA 2PAJA 3HUSA 2XNXA 1URQB 4C46A 1G2CB 5CMZA 5AW4B 3HE5B 1FOSE 2R3CA 2OYIB 2O01H 2MJZA 3CI9A 1L0NK 3II6A 4XE5B 2W6AA 1NU1K 3R2PA 4XA4A 1SQBK 1EQ7A 2WPRA 2A45I 1X79B 1G1IA 1NKZB 2CPBA 2NPSD 1L4AD 3HUSB 1SQXK 4N6JA 1GU4A 1GDTA 5AW9B 5AW2B 1FOSF 3HE4A 1JCCA 2YKPA 5AW5B 2HODA 3EQ2A 1WRGA 4LGDE 1FJKA 4EOTA 3HD7C 1N7SC 1AQ5A 1E5WA 2BASA 2QM7A 4C7NA 1IFNA 3G3ZA 2WTYA 2O1KA 3B5NC 4JYCA 1HJBA 4WBAA 4RESB 4I1LA 1RF0A 3GHGA 1CZQA 2FFDC 3OA7A 3O8ZA 2KB7P 1M1JC 3H32A 1GK6A 2Q3IA 2HODB 1FZEA 2P7JA 2N9BA 4LLHA 5BU8B 3M0DA 5KJ7D 4W7YA 3HD7D 1MZ9A 2R32A 1N7SD 2HPCA 5APYA 1LT9C 1JY3O 1JY3N 1RF1A 2FKWB 1RE3C 3B5ND 3BATA 4KHXA 1XTGB 3RK3C 4M3LA 2Z4EA 3OJAB 2NPSA 2YMYA 3PP5A 2HLOA 2Q5UA 2OARA 4IFFA 1H88A 3KPEA 5CCGC 1FZCB 2OYHB 3VTPC 2LKMA 3U1AA 1KILC 1JY3P 4WY4C 2I1KA 1OXZA 1GW3A 4N78E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1RF1 B;  2OYI C;  1LT9 C;  1JY3 O;  1N73 A;  2FFD A;  1JY3 N;  1M1J A;  3HUS B;  1LTJ B;  2A45 G;  3HUS A;  1LWU C;  1RF1 A;  3GHG B;  2Q9I A;  1LTJ A;  1FZC C;  1FZG A;  1RF0 A;  1JY2 P;  1N86 A;  2XNX A;  1RE3 C;  3GHG A;  3BVH A;  2HPC A;  2OYH C;  2Z4E A;  2FFD C;  3H32 B;  1JY2 O;  1FZF A;  1M1J C;  1JY2 N;  1FZA A;  1RE4 A;  3H32 A;  1N73 C;  1RF1 C;  1FZB A;  2OYI B;  2H43 A;  1LT9 B;  1FZE A;  1W2E A;  2HOD B;  3HUS C;  1LTJ C;  2HOD A;  2HLO A;  1RF0 C;  2OYI A;  1LT9 A;  1LWU B;  3GHG C;  2A45 H;  1FZC B;  1LWU A;  3E1I A;  2OYH B;  1RE3 A;  1FZC A;  1JY3 P;  2OYH A;  1RE4 C;  2A45 I;  2HPC B;  1T3U A;  2FFD B;  1N73 B;  1M1J B; 
#chains in the Genus database with same CATH topology
 4OGQ C;  4DOJ A;  1N7L A;  1NU1 G;  1EZV I;  2QJY B;  1EDL A;  1AJY A;  5AVY B;  4R4M A;  3RBX A;  3VP8 A;  4K3A A;  1NAF A;  1BGY D;  4QMA A;  2ZXE B;  2B89 A;  4DJG A;  3H6P A;  1VQ6 P;  1K8A Q;  4MN4 C;  3PRJ A;  3FGA D;  1K9M Q;  1EZV G;  1NAY A;  2Q6Q A;  4HKZ H;  2RKL A;  2KIK A;  2QM8 A;  3L70 E;  4D6T E;  3AE6 C;  1DIP A;  2XU6 A;  3WU2 H;  1PV3 A;  3RL0 C;  2WT7 B;  1YYC A;  1GL2 C;  5APW A;  5AVR B;  1U57 A;  2O1J A;  5KLI B;  3H1J D;  5KJ7 C;  1YIJ P;  1OX3 A;  3AEE C;  3AE1 C;  4IFM A;  2P10 A;  3EWK A;  3TGU J;  2K1A A;  2YNY A;  1RE4 A;  1DH3 A;  1GW4 A;  2OTK E;  2E75 C;  2FY8 A;  1MFZ A;  5AVU B;  5CJ0 A;  2OTJ P;  1DX7 A;  2OYH A;  2ZYG A;  1SQP K;  1HWT C;  1YTZ T;  1N86 A;  3TNU B;  5APT A;  2PGD A;  4PV1 B;  1L4A A;  3QWO C;  2WPS A;  1KB9 D;  1X0T A;  4UB8 H;  5DJU B;  1E79 H;  4AQR D;  3BRV B;  2B88 A;  3AE8 C;  1QVF O;  2BCC E;  1FZG A;  1S9K D;  2AEJ A;  4GOE A;  1RY3 A;  2P2U A;  2A06 G;  3L73 G;  1KC8 Q;  1N2D C;  1GK4 A;  3H1K G;  1VQK P;  1SQQ K;  5KAF H;  1IFI A;  1QLE D;  3CC2 P;  2JR8 A;  1N73 B;  2D2C D;  1BCC G;  3RGU A;  2JO1 A;  2QJP C;  3L74 E;  2B87 A;  1RF1 C;  1EC5 A;  1NTK E;  5CCH D;  3L70 D;  4D6T D;  1Y8A A;  2C0W A;  3HRN A;  4R4L A;  2J58 A;  4UB8 E;  1BGY J;  1NTZ E;  5AVT B;  1SQP G;  4I6M C;  1R5S A;  2JEE A;  1KTM A;  2B87 B;  1T2K C;  3IR9 A;  3N4X A;  3C8V A;  4NPE A;  1P84 I;  2E5T A;  5AVX B;  2IFN A;  1Y47 A;  3WUU A;  1K73 Q;  3V2Q A;  5KAF E;  4IL6 H;  3JSV C;  4H44 B;  5H2F H;  2OYI C;  1J1E B;  3L72 D;  1OVU A;  2OQQ A;  2YKO A;  4TLF A;  2E42 A;  1PZQ A;  5CCG A;  1LTS C;  1KIL A;  2L91 A;  1L0L K;  1W2E A;  1OZH A;  5AVV B;  3RL0 g;  3BCC E;  3MP7 B;  3GW6 A;  3AEB C;  1URQ D;  2QJK B;  3CX5 D;  1CSB A;  3H1J J;  4WB4 A;  1AVY A;  2QE7 H;  2SPZ A;  1NWQ A;  3NTN A;  3KYQ A;  4H0L C;  3D70 A;  3CWB D;  2ZYD A;  1VDF A;  3AE7 C;  2NZ2 A;  1HF9 A;  2AXT H;  3CCV P;  4IL6 E;  3L73 E;  2AXC A;  5H2F E;  2O01 N;  1VL2 A;  2KSE A;  4UB6 H;  3M91 A;  1IFM A;  4ZKU A;  3HTK A;  2BEQ D;  2RMZ A;  4GT1 A;  3B71 A;  1TU3 F;  2LXB A;  2HR3 A;  3GHG C;  4IFD K;  1BDC A;  3M9H A;  3Q3D A;  3L36 A;  3WUV A;  1Q82 Q;  1ZV8 A;  1SS1 A;  1GL2 A;  1ZN5 A;  2K9J A;  2FXP A;  1NH4 A;  1PPJ G;  2M5A A;  1VF5 B;  1VQM P;  3L74 D;  2QEX P;  2QJY C;  1L0L G;  5KKZ B;  4BRY A;  1OW7 A;  4NPD A;  1PGQ A;  2AXT E;  3AE4 C;  2XNX A;  4YPC A;  1BDD A;  3A0H H;  4L73 A;  3GMA A;  2Y0C A;  3HE5 B;  4UB6 E;  2R3C A;  5L8R J;  3II6 A;  1PGP A;  3CXH D;  4XA4 A;  1RH5 B;  3LW5 J;  2A45 I;  2IBZ E;  1UII A;  3K5B A;  1NKZ B;  2CPB A;  3FXD A;  4YTP C;  3L70 J;  4D6T J;  1SQX K;  2G3A A;  1SQV J;  1Q81 Q;  3SSU A;  3MHV A;  3OW2 O;  5AW9 B;  5KLV G;  4LGD E;  1S72 P;  3PH0 A;  3BCC D;  1BSN A;  4PJ0 H;  3H1H G;  2BAS A;  2QM7 A;  1IFN A;  3G3Z A;  4H13 D;  4I7Z C;  2MKV A;  3E1R A;  4I1L A;  1CZQ A;  2KZI A;  3OA7 A;  2ZVO B;  3L72 J;  2P7J A;  3G4S P;  2FYU E;  5BU8 B;  5KJ7 D;  4YXW H;  2R32 A;  1N7S D;  1VQ8 P;  1RF1 A;  3L73 D;  4M3L A;  3PP5 A;  2FYN B;  3PLN A;  2OAR A;  1NTM G;  1H88 A;  3VTP C;  2E75 D;  3CWB J;  1BCC D;  4PV1 C;  4RO0 A;  3I55 P;  1ZOY C;  3M9B A;  3BRT B;  2E76 D;  5KTB A;  2OYH C;  1XTC C;  1MV8 A;  3V2N A;  3VMZ A;  1IFJ A;  2K9Y A;  2WSS H;  1SQX G;  1G2C A;  1YHQ P;  2IFM A;  1BGY E;  5CHX A;  1J2J B;  4GIF A;  1EDJ A;  1J1D B;  1QEX A;  5BU5 A;  2KYV A;  3AE9 C;  3V5B A;  1D7M A;  1FDM A;  1U7M A;  4W7Z A;  2R5D A;  3L71 G;  3SWY A;  4Z1M H;  1M56 D;  1SFC D;  4HYT B;  2M3E A;  2WSF J;  1SLQ A;  1JTH A;  2E74 B;  3MUD A;  2ZT9 D;  2JWA A;  4B86 A;  2XKM A;  2QG4 A;  4KJM A;  2Q1K A;  1HVV A;  3HD7 B;  3MD0 A;  3RK2 D;  5K5G B;  1U7J A;  1ZRT D;  1FZA A;  1KB9 H;  3B5N B;  3SWF A;  3AEA C;  1JTH B;  2H8P D;  1FJP A;  1M1J B;  1OW6 A;  2Y0E A;  1USE A;  1Y9B A;  3FWN A;  4WY4 A;  3P32 A;  3VYI A;  1FZB A;  1LT9 B;  1M90 Q;  2W83 C;  1T2K D;  5AVS B;  1JB0 J;  2FYU D;  2OTL P;  1KV4 A;  1IFP A;  3BCC J;  1NHL A;  4JQ0 D;  2Y9Z A;  3LW5 H;  4WY4 B;  2QJK C;  1NTK K;  1Q90 D;  1NOH A;  1LWU B;  1KB9 E;  3CCE P;  1YIT P;  2YIU B;  2W6B A;  5APU A;  2KOG A;  2XV5 A;  3SWK A;  1L0N G;  1HTL C;  1WT6 A;  1NTZ K;  1LTJ B;  1SQB G;  1S9K E;  2OYO A;  1M1K Q;  3A3Y B;  2YO3 A;  1ZXG A;  1OFC X;  1VQO P;  1S4X A;  2FXM A;  4H0L D;  4LC1 A;  3L73 J;  1NJI Q;  5AW7 B;  1EXJ A;  1AQT A;  3PHL A;  2VRS A;  2Q9I A;  1BCC J;  2WT7 A;  1FDI A;  1RQV A;  2W27 A;  1SQV E;  1VF5 C;  1NKN A;  5APX A;  3CX5 H;  2YKQ A;  2POH A;  1KQS O;  1Q86 Q;  2KNC A;  3CL3 D;  1ZP0 C;  3T97 B;  5KLV D;  2QVA A;  3CCM P;  3USS A;  1PP9 G;  5KKZ C;  4JBZ A;  4RKU J;  3A7O A;  2Y0D A;  5B5E H;  1Q2N A;  1GU5 A;  2IX7 C;  2IPP A;  2IZ1 A;  3H1H D;  2XND H;  3D71 A;  5AVZ B;  2ZXX A;  4EI2 A;  1LP1 B;  1A02 F;  4JYB A;  2KNC B;  3L72 E;  4O9B A;  1YQ4 C;  4ZMD A;  1HUC A;  3CCQ P;  3TNU A;  1KN7 A;  1JM0 A;  1H0T B;  2FYZ A;  3G71 P;  1SVF A;  3CLQ A;  1OVV A;  3Q5P A;  3CX5 E;  5CCH A;  1BE3 G;  2YXR B;  3LID A;  2WQY C;  3BVH A;  2D2C B;  2WSF H;  3HE4 B;  1NTM D;  4IOI H;  1EXI A;  1JY2 N;  3CWB E;  1PFI A;  5B5E E;  3AE5 C;  1IC2 A;  1L0N E;  1LTT C;  1NU1 E;  1SQB E;  3TF5 A;  4C7N B;  2RH0 A;  1N73 A;  4C7R A;  3Q1M A;  1LGH B;  3Q2Y A;  2J59 M;  1IO4 A;  1JY2 P;  2FYU J;  1QVG O;  5AW6 B;  3H1L G;  3H32 B;  4GKG A;  3P8M C;  3I5C A;  3BAS A;  3TSI A;  3CXH H;  2N1T A;  1JO5 A;  3MIW A;  3U1C A;  2HPC B;  4OH8 B;  1HBW A;  1EZV E;  2KSJ A;  3L71 D;  2WPV B;  3VP9 A;  3V4Q A;  1G1J A;  1GMJ A;  3FX0 A;  5APS A;  4BWN A;  3RK3 E;  3A0B H;  5GTH H;  2N1T B;  3L75 G;  2WZ7 A;  1SQV D;  1DEE G;  1KIL E;  4JPZ B;  1HH0 A;  2WWW A;  2PAJ A;  3KZI E;  1URQ B;  2KS1 B;  2O3J A;  2MJZ A;  4XE5 B;  2W6A A;  3CXH E;  1K05 A;  2WPR A;  2IBZ I;  1G1I A;  2NPS D;  1L4A D;  2ZAE B;  3C1L A;  1S3J A;  1RQU A;  4N6J A;  1GU4 A;  2E74 C;  5AW2 B;  3A0B E;  1JCC A;  5AW5 B;  4L76 A;  5KLV J;  3EQ2 A;  3FXE A;  5GTH E;  4EOT A;  3HD7 C;  2RN0 A;  3TGU G;  2O1K A;  3B5N C;  3H1H J;  1SQQ G;  3CMA P;  1IZN B;  3MUD C;  1KYO D;  3O8Z A;  1PGJ A;  1M1J C;  5CBO A;  2Q3I A;  2AEM A;  1L0N D;  3V6I A;  2QSI A;  4LLH A;  1NU1 D;  4W7Y A;  1SQB D;  4PD4 D;  3SFD C;  5APY A;  1LT9 C;  1K04 A;  1LT1 A;  1Q7Y Q;  2A06 E;  2JP3 A;  4OVN F;  1XTG B;  2Z4E A;  3OJA B;  3VMA A;  3H1K E;  1FS0 E;  2YMY A;  1NYH A;  3KPE A;  1FZC B;  2LKM A;  1NTM J;  2WSE J;  4WY4 C;  2KZJ A;  1BCC E;  1YI2 P;  1EZV D;  2XDJ A;  1LWU C;  4Y28 J;  2GM4 A;  2YIU C;  2Z5I A;  3O6Q B;  4Y99 B;  4GDO A;  2Z5H A;  4L75 A;  3RK3 D;  3HE5 A;  1LTJ C;  1H8A A;  4A7P A;  5CCG D;  1KIL D;  1SQP E;  4OGQ D;  3V2R A;  1FE6 A;  3IF4 A;  3L71 J;  4HB1 A;  4H13 B;  1HGV A;  1YBK A;  5KAI H;  3EFG A;  4EYY Q;  5E79 H;  2IDB A;  2GUS A;  3MTU E;  5M1B A;  3UIA A;  1W5C E;  1KFM A;  1N7S B;  1S5L E;  1VQP P;  1ZRT E;  1A02 J;  3JCU H;  1EDI A;  1YJW P;  1SQQ E;  1RE3 A;  2FFD B;  4U7J A;  2A45 G;  5KLI C;  1L2P A;  3RL0 D;  2P1J A;  1LNQ A;  1N8R Q;  1GL2 D;  2E76 B;  5KAI E;  3TK1 A;  2H88 C;  1ZME C;  1SFC A;  5E79 E;  5CJ4 A;  3TDK A;  3A5T A;  3H1L D;  2A06 D;  3B8E B;  3H1I G;  3H1K D;  3JCU E;  1VQ5 P;  1SQV K;  1KB9 I;  1X9V A;  1KMI Z;  1SFC B;  4W80 A;  4U3F G;  5AW3 B;  4CPG A;  2KI7 B;  1PPJ E;  3P7K A;  3PJS K;  3SFE C;  1KOR A;  1L0N J;  3D6Y A;  4HH2 A;  3VOP A;  2W6J H;  2ZT9 B;  1NU1 J;  1SQB J;  5AW0 B;  3CME P;  1DEB A;  3L75 D;  5CCH C;  2UWJ E;  4RJT A;  1JCD A;  1LTA C;  1R5L A;  1L0L E;  2M3B A;  3RK2 B;  5TIS H;  1ZW0 A;  2V4H A;  2P67 A;  4I2L C;  2QJP B;  2XZR A;  2HG5 D;  2GUV A;  2W90 A;  1SQP D;  2KLV A;  4DT0 A;  1SP4 A;  3HD7 A;  3IAO A;  1N73 C;  1KQL A;  4DCK A;  5GTI H;  4EIJ A;  3W68 A;  3B5N A;  4KT0 J;  3H25 A;  1M1J A;  1YTZ I;  2N1T C;  5KLV E;  2WIT A;  2WSE H;  1KZU B;  4AYC A;  4HJG H;  2B9B A;  3VMY A;  1P84 D;  1LT9 A;  3H1H E;  3ITK A;  1URQ C;  5TIS E;  3KHU A;  1SQQ D;  4D6T G;  1CI6 B;  1JMM A;  2YMK A;  4TT3 H;  1CW5 A;  1GZL A;  1AVO A;  1QX8 A;  2JWD A;  1PGO A;  4H44 C;  3FWL A;  1J1E C;  1S5L X;  5GTI E;  1LWU A;  3P8C D;  3CX5 I;  2K37 A;  2FBW C;  1LTJ A;  3CPW O;  2HYN A;  1PL5 A;  1NTM E;  1JY2 O;  5C39 A;  1HGZ A;  2H89 C;  4ZKP A;  3CCU P;  2DW3 A;  2ZJS E;  3N7N A;  1PPJ D;  1SQX E;  3GHG B;  1NO4 A;  3AEF C;  3W67 A;  3PTZ A;  1T3J A;  3H1L J;  5BVZ A;  2KLU A;  2H43 A;  4JF7 A;  2CK3 H;  1L0L D;  2E43 A;  3KDP B;  2KXP B;  3F89 A;  3H1K J;  3KQG A;  3L71 E;  2M8R A;  1FZC C;  2R3S A;  1FAV A;  1OWA A;  3T97 A;  2BCC G;  1FBM A;  2PP6 A;  3S1K A;  3ABV C;  1S1C X;  3L75 J;  4Y99 C;  4WY4 D;  2C9L Y;  1ZLL A;  3GG2 A;  1LP1 A;  3NXS A;  3HUS A;  1KYO H;  3CCR P;  5B66 H;  1VQ7 P;  3S9O A;  2YXQ B;  1DD3 A;  1SQP J;  3CI9 A;  1H0T A;  3L74 G;  3AE3 C;  3CXH I;  4PD4 H;  1EQ7 A;  1NTK G;  1X79 B;  4H13 C;  2R44 A;  2ZYA A;  3HUS B;  2Y9Y A;  1GDT A;  1IK7 A;  4ASV A;  1NTZ G;  3HE4 A;  2YKP A;  4I7Z B;  2HOD A;  1FJK A;  2IYO A;  1N7S C;  1VQN P;  2QA4 P;  1E5W A;  4C7N A;  3H1I D;  3CD6 P;  2K88 A;  1SQQ J;  2FFD C;  1KYO E;  5B66 E;  3H32 A;  1GK6 A;  2HOD B;  1FZE A;  4U3F D;  3QH9 A;  4PD4 E;  1MZ9 A;  2HPC A;  3F5H A;  3BCC G;  2E76 C;  1JY3 N;  3KZI H;  3WU2 E;  1SQX D;  1RE3 C;  3S4R A;  2NPS A;  1DD4 A;  3ZDM A;  4IFF A;  2OYH B;  1JY3 P;  2I1K A;  4N78 E;  2ZVN B;  3L35 A;  2H7H A;  3G9R A;  3EFF K;  2FYN C;  1GTW A;  1RHZ B;  2P58 A;  1SFC C;  1VQ9 P;  2NPS B;  1URQ A;  1L4A B;  2KS1 A;  3CCJ P;  2KK7 A;  2ZT9 C;  3L37 A;  1JMB A;  2WMM A;  1PP9 E;  1L0L J;  2LR2 A;  3GF3 A;  3JC2 2;  4PV1 D;  3RK2 C;  4ZNC A;  1J1D C;  1QL2 A;  5AVQ B;  1JOC A;  4N3Y B;  3CCL P;  3OAK A;  1ZR2 A;  3L4F A;  3IFM A;  3LIE A;  1EDK A;  2FYU K;  3MZW B;  5DJT B;  3NMD A;  2W8Z A;  1KQG B;  1Z56 A;  2WSC J;  4ASW A;  3V2P A;  2IZ0 A;  1IK9 A;  1BE3 E;  3I56 P;  2CPS A;  1YQ3 C;  1M7L A;  2IBZ G;  2LXC B;  2N1T D;  1R8E A;  1ZR4 A;  1IJD B;  3RK3 B;  1IFD A;  1FZC A;  3MGN A;  3H1L E;  2I1J A;  2WVR A;  1KIL B;  5AW8 B;  3O6Q A;  2ITA A;  2FXO A;  1FZF A;  3H1I J;  4OGQ B;  5AW1 B;  4H44 D;  1KQF B;  1LTG C;  3E1I A;  5AVW B;  3CCS P;  1T8Z A;  4U3F J;  4N78 D;  2O01 J;  2FYU G;  5KLV K;  2BCC D;  1VPC A;  2JJL A;  1S5L H;  4EDF A;  3L75 E;  2PFX A;  1P84 H;  1SQX J;  1RF0 C;  1MKM A;  1AA0 A;  3VN0 A;  3CC7 P;  1LJ2 A;  2C9N Y;  1PP9 D;  2QRX A;  2L5G B;  3M0D C;  4OWF A;  5KJ7 A;  3HTK B;  1VQ4 P;  1N7S A;  3GF7 A;  3A2A A;  2HFE D;  1NTK D;  1LTB C;  2YO2 A;  1M8O B;  4WVZ A;  3RL0 B;  1NGM B;  1BGY G;  2IYP A;  2V7Q J;  2OGU A;  1GL2 B;  2WPQ A;  2FFD A;  2K9J B;  4K35 A;  4BXL A;  1NTZ D;  1OIP A;  2M5A B;  1WMK A;  1NTM K;  3D6Z A;  3U59 A;  1P84 E;  3TGU E;  2JKV A;  1AFO A;  1FDO A;  1BE3 D;  4BRY B;  1MUU A;  1VF5 D;  1OW8 A;  3V4W A;  3M0A A;  2E75 B;  1M57 D;  2Q3E A;  4NPF X;  2QIW A;  2NRG A;  4L74 A;  3HUS C;  1YJ9 P;  3AEG C;  3B4S A;  2R5B A;  1KFN A;  3P8C E;  4GOF A;  1FC2 C;  2KP8 A;  1H89 A;  3VMX A;  2ZFC A;  3H1J G;  3KXD A;  1JNM A;  2G8Y A;  1LTI C;  4AUW A;  1W2B O;  3C9I A;  3A0H E;  3TYY A;  4DZO A;  1KD1 Q;  3Q5S A;  4XFJ A;  1QL1 A;  2D2C C;  1T3U A;  2WSC H;  2K3R A;  5APV A;  2C0X A;  1NVO A;  2AEF A;  2Q7C A;  1GD2 E;  1JUN A;  4YXD C;  3NFQ A;  2A45 H;  3RBZ A;  4GOD A;  3M06 A;  1RE4 C;  4PJ0 E;  1RF1 B;  2BEZ F;  3WMM 0;  1X8Y A;  4IL6 X;  5TJH A;  1T6A A;  2JDI H;  1X22 A;  2BCC J;  2OYI A;  1QGK B;  3WUT A;  2KUB A;  5APQ A;  2NPS C;  1L4A C;  3M9Q A;  1FU1 A;  4WWI A;  1CI6 A;  3AED C;  1MFT A;  4C46 A;  3R4Y A;  1G2C B;  5CMZ A;  5AW4 B;  1VQL P;  1FOS E;  1PP9 J;  2OYI B;  2O01 H;  1L0N K;  1OVR A;  1NU1 K;  3R2P A;  3TGU D;  1SQB K;  3AE2 C;  1PIX A;  3L74 J;  1BSH A;  2IBZ D;  3L70 G;  1NTK J;  3IN6 A;  1SQV G;  1USD A;  1FOS F;  1YJN P;  1NTZ J;  3E7K A;  3H1J E;  1WRG A;  2J5U A;  1OMI A;  1AQ5 A;  2PRR A;  4H0L B;  2N9Y B;  2WTY A;  5EFW B;  1HJB A;  3AEC C;  3H1I E;  4JYC A;  4WBA A;  4RES B;  1RF0 A;  3GHG A;  1BE3 J;  2V7Q H;  3L72 G;  3GLM A;  1KYO I;  2KB7 P;  2E5Y A;  2E74 D;  4U3F E;  3Q5R A;  1UIX A;  2N9B A;  3M0D A;  3HD7 D;  4PD4 I;  1JY3 O;  2FKW B;  3B5N D;  3RK3 C;  1HJ0 A;  3BAT A;  4KHX A;  3G6E P;  2GA1 A;  1JEK A;  3CC4 P;  2HLO A;  2Q5U A;  2M0B A;  1AV1 A;  5CCG C;  3CWB G;  1S2E A;  3U1A A;  1KIL C;  1OXZ A;  1GW3 A;  5CBN A;  2I8D A; 
#chains in the Genus database with same CATH homology
 3L35 A;  2H7H A;  3M9B A;  4DOJ A;  1N7L A;  2XDJ A;  3BRT B;  1LWU C;  1GTW A;  2GM4 A;  5KTB A;  2Z5I A;  1SFC C;  1XTC C;  2OYH C;  1MV8 A;  3V2N A;  3VMZ A;  4Y99 B;  1IFJ A;  2NPS B;  1URQ A;  2Z5H A;  1L4A B;  5AVY B;  3RK3 D;  1G2C A;  3VP8 A;  2IFM A;  1NAF A;  5CHX A;  3HE5 A;  2ZXE B;  1LTJ C;  1J2J B;  3H6P A;  4GIF A;  1J1D B;  5BU5 A;  1H8A A;  2KYV A;  3L37 A;  5CCG D;  3V5B A;  1KIL D;  1FDM A;  4W7Z A;  3RK2 C;  3V2R A;  2R5D A;  1J1D C;  1QL2 A;  5AVQ B;  3SWY A;  1JOC A;  4N3Y B;  1SFC D;  4HYT B;  3OAK A;  1HGV A;  1ZR2 A;  2QM8 A;  3L4F A;  3IFM A;  3EFG A;  3LIE A;  2FYU K;  2GUS A;  1SLQ A;  1JTH A;  3MUD A;  3MTU E;  3NMD A;  4B86 A;  2XU6 A;  2XKM A;  3UIA A;  3RL0 C;  2WT7 B;  1YYC A;  1HVV A;  3HD7 B;  1Z56 A;  3MD0 A;  3RK2 D;  1KFM A;  1N7S B;  1GL2 C;  5APW A;  1FZA A;  3V2P A;  1A02 J;  5AVR B;  2O1J A;  3B5N B;  3SWF A;  1IK9 A;  5KJ7 C;  1JTH B;  1RE3 A;  2FFD B;  2H8P D;  4IFM A;  1FJP A;  2CPS A;  1M1J B;  1M7L A;  2A45 G;  2N1T D;  3RL0 D;  2P1J A;  2YNY A;  4WY4 A;  1ZR4 A;  3P32 A;  1RE4 A;  3VYI A;  1FZB A;  1LT9 B;  1GL2 D;  1DH3 A;  1T2K D;  1GW4 A;  1IJD B;  5AVS B;  5AVU B;  1MFZ A;  3TK1 A;  5CJ0 A;  3RK3 B;  1IFD A;  1FZC A;  3MGN A;  1SFC A;  2OYH A;  1DX7 A;  5CJ4 A;  1SQP K;  3A5T A;  1HWT C;  2I1J A;  3B8E B;  1YTZ T;  1N86 A;  1NHL A;  3TNU B;  1KIL B;  3LW5 H;  4WY4 B;  5AW8 B;  5APT A;  1FZF A;  1NTK K;  1L4A A;  5AW1 B;  1NOH A;  1LWU B;  1SQV K;  2WPS A;  1X9V A;  1LTG C;  3E1I A;  2W6B A;  1SFC B;  4W80 A;  5APU A;  5AVW B;  2KOG A;  5AW3 B;  2XV5 A;  4AQR D;  1T8Z A;  3BRV B;  3P7K A;  1HTL C;  1WT6 A;  4N78 D;  1NTZ K;  5KLV K;  1LTJ B;  4HH2 A;  3VOP A;  1FZG A;  1S9K E;  1VPC A;  1S9K D;  3A3Y B;  5AW0 B;  2JJL A;  1RY3 A;  2P2U A;  2YO3 A;  1DEB A;  5CCH C;  2FXM A;  4LC1 A;  1JCD A;  1LTA C;  1N2D C;  1RF0 C;  2M3B A;  1GK4 A;  3RK2 B;  5AW7 B;  1SQQ K;  2P67 A;  4I2L C;  3VN0 A;  1IFI A;  2XZR A;  2HG5 D;  2VRS A;  2GUV A;  1N73 B;  2C9N Y;  2Q9I A;  2KLV A;  2L5G B;  3M0D C;  1SP4 A;  2WT7 A;  5KJ7 A;  3HTK B;  3HD7 A;  1N7S A;  1N73 C;  1RF1 C;  2W27 A;  3A2A A;  2HFE D;  1KQL A;  1LTB C;  5CCH D;  2YO2 A;  4EIJ A;  3RL0 B;  2C0W A;  3HRN A;  3B5N A;  2J58 A;  1NKN A;  5APX A;  2YKQ A;  1GL2 B;  2POH A;  2WPQ A;  2FFD A;  1M1J A;  3CL3 D;  1YTZ I;  2N1T C;  5AVT B;  1NTM K;  2WIT A;  4I6M C;  2WSE H;  1KZU B;  2JEE A;  4AYC A;  3A7O A;  1T2K C;  3IR9 A;  3N4X A;  3U59 A;  3VMY A;  1GU5 A;  1LT9 A;  2IX7 C;  5AVX B;  2IFN A;  2IPP A;  1URQ C;  5AVZ B;  1AFO A;  3V2Q A;  1CI6 B;  1MUU A;  1A02 F;  1JMM A;  4JYB A;  2OYI C;  1J1E B;  3V4W A;  3M0A A;  4O9B A;  1CW5 A;  1GZL A;  2YKO A;  2E42 A;  1HUC A;  5CCG A;  1LTS C;  3TNU A;  1KIL A;  2FYZ A;  1L0L K;  1W2E A;  3HUS C;  1J1E C;  5AVV B;  1SVF A;  1LWU A;  2R5B A;  3CLQ A;  1KFN A;  3P8C E;  3P8C D;  2KP8 A;  1H89 A;  1URQ D;  3VMX A;  2ZFC A;  1JNM A;  5CCH A;  1CSB A;  4WB4 A;  1LTI C;  3LID A;  4AUW A;  1LTJ A;  1NWQ A;  3NTN A;  3BVH A;  3C9I A;  2HYN A;  2WSF H;  3KYQ A;  3HE4 B;  3TYY A;  1JY2 O;  1JY2 N;  4DZO A;  1HGZ A;  1PFI A;  4ZKP A;  1VDF A;  1IC2 A;  1LTT C;  1QL1 A;  1T3U A;  2WSC H;  4C7N B;  1N73 A;  3N7N A;  4C7R A;  5APV A;  1LGH B;  3GHG B;  2C0X A;  1NO4 A;  2J59 M;  1IO4 A;  1JY2 P;  1T3J A;  5AW6 B;  3H32 B;  4GKG A;  3M91 A;  1IFM A;  3P8M C;  2Q7C A;  4ZKU A;  5BVZ A;  1GD2 E;  1JUN A;  3HTK A;  3I5C A;  3BAS A;  3NFQ A;  3TSI A;  2H43 A;  4GT1 A;  4JF7 A;  2E43 A;  3GHG C;  3KDP B;  4IFD K;  2A45 H;  2N1T A;  3M9H A;  1JO5 A;  3MIW A;  3L36 A;  3M06 A;  3U1C A;  1RE4 C;  2HPC B;  4OH8 B;  1ZV8 A;  3KQG A;  1HBW A;  1ZN5 A;  1GL2 A;  2KSJ A;  1RF1 B;  3VP9 A;  3V4Q A;  2M8R A;  1G1J A;  1FZC C;  3WMM 0;  1X8Y A;  1NH4 A;  1FAV A;  1OWA A;  5APS A;  3T97 A;  1FBM A;  2PP6 A;  2OYI A;  2N1T B;  2WZ7 A;  5APQ A;  4Y99 C;  2NPS C;  1L4A C;  3M9Q A;  4WY4 D;  1FU1 A;  2C9L Y;  1HH0 A;  1ZLL A;  1CI6 A;  2WWW A;  3NXS A;  2PAJ A;  3HUS A;  2XNX A;  1URQ B;  4C46 A;  1G2C B;  5CMZ A;  5AW4 B;  3HE5 B;  1FOS E;  2R3C A;  2OYI B;  2O01 H;  2MJZ A;  3CI9 A;  1L0N K;  3II6 A;  4XE5 B;  2W6A A;  1NU1 K;  3R2P A;  4XA4 A;  1SQB K;  1EQ7 A;  2WPR A;  2A45 I;  1X79 B;  1G1I A;  1NKZ B;  2CPB A;  2NPS D;  1L4A D;  3HUS B;  1SQX K;  4N6J A;  1GU4 A;  1GDT A;  5AW9 B;  5AW2 B;  1FOS F;  3HE4 A;  1JCC A;  2YKP A;  5AW5 B;  2HOD A;  3EQ2 A;  1WRG A;  4LGD E;  1FJK A;  4EOT A;  3HD7 C;  1N7S C;  1AQ5 A;  1E5W A;  2BAS A;  2QM7 A;  4C7N A;  1IFN A;  3G3Z A;  2WTY A;  2O1K A;  3B5N C;  4JYC A;  1HJB A;  4WBA A;  4RES B;  4I1L A;  1RF0 A;  3GHG A;  1CZQ A;  2FFD C;  3OA7 A;  3O8Z A;  2KB7 P;  1M1J C;  3H32 A;  1GK6 A;  2Q3I A;  2HOD B;  1FZE A;  2P7J A;  2N9B A;  4LLH A;  5BU8 B;  3M0D A;  5KJ7 D;  4W7Y A;  3HD7 D;  1MZ9 A;  2R32 A;  1N7S D;  2HPC A;  5APY A;  1LT9 C;  1JY3 O;  1JY3 N;  1RF1 A;  2FKW B;  1RE3 C;  3B5N D;  3BAT A;  4KHX A;  1XTG B;  3RK3 C;  4M3L A;  2Z4E A;  3OJA B;  2NPS A;  2YMY A;  3PP5 A;  2HLO A;  2Q5U A;  2OAR A;  4IFF A;  1H88 A;  3KPE A;  5CCG C;  1FZC B;  2OYH B;  3VTP C;  2LKM A;  3U1A A;  1KIL C;  1JY3 P;  4WY4 C;  2I1K A;  1OXZ A;  1GW3 A;  4N78 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...