1N86A

Crystal structure of human d-dimer from cross-linked fibrin complexed with gpr and ghrpldk peptide ligands.
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
74
structure length
74
Chain Sequence
IEVLKRKVIEKVQHIQLLQKNVRAQLVDMKRLEVDIDIKIRSCRGSCSRALAREVDLKDYEDQQKQLEQVIAKD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Blood clotting
molecule keywords Fibrin alpha/alpha-E chain
publication title The crystal structure of fragment double-D from cross-linked lamprey fibrin reveals isopeptide linkages across an unexpected D-D interface.
pubmed doi rcsb
total genus 21
structure length 74
sequence length 74
chains with identical sequence D
ec nomenclature
pdb deposition date 2002-11-19
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.50 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1n86A00
2H43A 1N73B 3H32B 1JY2P 1JY2N 2A45H 2A45I 1FZCA 1JY2O 1FZGA 1JY3N 2Z4EA 1LTJA 1LWUB 1RE3C 3HUSB 1JY3O 1JY3P 1RF0A 1FZFA 1T3UA 1FZEA 1M1JB 1N73A 1LT9C 3GHGC 2FFDB 2OYHC 1RE4C 2OYIC 1FZCC 3BVHA 2HLOA 2HODB 3H32A 1RF1C 3E1IA 1LWUA 3HUSA 2HPCB 2FFDA 1LTJC 1M1JA 1W2EA 1RF0C 2HODA 1LT9B 3GHGB 2OYHB 1N73C 2OYIB 1FZCB 2A45G 1RF1B 1RE3A 2HPCA 2Q9IA 2XNXA 1LWUC 1FZBA 3HUSC 1LTJB 1M1JC 2OYIA 2FFDC 1LT9A 1N86A 3GHGA 2OYHA 1FZAA 1RE4A 1RF1A
chains in the Genus database with same CATH superfamily
2O01N 1SFCB 2YO2A 1JY3O 1VQPP 2BASA 3FXEA 1SQXK 4KJMA 1IFPA 3CWBJ 1NTKK 3M06A 4OGQD 2N1TD 1KFNA 3N4XA 1RE4A 2P67A 1NJIQ 3Q1MA 1JY3P 3M0DA 1YIJP 2FYUK 1VQMP 1JMBA 2JEEA 4GT1A 1X0TA 4W80A 2OYOA 3RGUA 1S3JA 3H1HG 1BE3G 2WSEJ 1Z56A 3H6PA 3D6ZA 3SFDC 3PH0A 4EOTA 1JTHB 3QH9A 1SQBK 1P84E 3MUDA 4PV1D 1S2EA 2FXPA 3L72G 4PJ0H 1RF1B 1EDLA 1Q82Q 2C0XA 2QSIA 2FYZA 3Q3DA 3D6YA 1JUNA 1S9KD 1MKMA 3I56P 2IFMA 3VYIA 1N86A 2G3AA 1JY2P 1HTLC 1YI2P 3L74G 4ASVA 1N7SD 4D6TE 1YTZT 1GL2D 3KZIE 3RBZA 1JCDA 3LW5J 2B87A 3K5BA 3KDPB 2YXRB 1J1DC 2N9YB 3E7KA 2NPSD 1QEXA 1VF5B 2RKLA 1HF9A 1YJNP 1EXJA 1PP9G 2NRGA 4H13B 1KQSO 3G9RA 2AXTH 1VQ5P 3M9HA 3WU2E 1QLED 1FOSE 1N73B 3B5NA 1UIXA 1LTIC 2FY8A 1N7LA 1NTZJ 5AVTB 2E75B 3GF7A 1BCCG 3L71J 2ZVNB 4U3FE 2E43A 4AUWA 2WSFJ 1YITP 1SFCA 3D71A 2IBZD 3MTUE 2AXCA 3L75J 3M0DC 3I5CA 2BCCD 2I1KA 2KS1A 1AVYA 1E5WA 5AW2B 2J58A 4N78D 2O3JA 1IFDA 3UIAA 1K05A 1T2KC 3CCEP 1T8ZA 2C9LY 1GW4A 1VQKP 2JDIH 1FAVA 1M7LA 3H1LD 2XDJA 2YIUB 4WY4B 5AW0B 2CK3H 1NTMD 3A0HH 2HODB 3H1HE 1BE3E 1CI6B 2I8DA 4TT3H 3SWYA 1M8OB 3TSIA 1JO5A 3L72E 3U1AA 1GZLA 1IFNA 3SSUA 1S72P 2BEZF 4JYBA 3RK2C 4WB4A 4L75A 2AEFA 5KJ7C 4IL6E 2ZXXA 2WPQA 1EDIA 2AEMA 3TDKA 3H1KJ 1KILD 5AVQB 3JCUH 3L74E 3AE8C 1L4AC 5CHXA 3P8CD 2W6BA 2E74D 4H44D 2IX7C 1OW8A 2A06E 2PFXA 1L2PA 1FJPA 4D6TJ 3CCUP 1NTZK 1L0NJ 4C7NB 3JSVC 3B5NC 4I2LC 1CSBA 2WSEH 1YHQP 1SLQA 3L73J 2FYNC 4I1LA 4QMAA 1K8AQ 2IYPA 2B89A 1Y47A 1MFTA 1PGPA 3A7OA 3RK3C 5KLIB 4DT0A 1IFIA 1X79B 1JEKA 1KYOI 1NKZB 2GUVA 1N2DC 4ZMDA 3L35A 3BASA 1BCCE 5EFWB 1NU1J 1NKNA 2Z5HA 3AE9C 3GMAA 5DJTB 1RH5B 3WMM0 2QJYC 1ZLLA 4GOFA 4JF7A 3CC7P 1KYOH 3PRJA 5H2FH 2D2CD 1M56D 4JPZB 3R4YA 5B66E 1LTTC 1LTAC 2QM7A 1FZFA 3HE4B 4WY4A 3AE4C 3LW5H 1J1DB 5AW3B 2ZVOB 3H1JD 3CMAP 2HYNA 1CI6A 1YJWP 1GU4A 1NTMG 3LIDA 1NVOA 1M57D 1BE3J 4HB1A 2LXBA 1FDIA 2RH0A 2L5GB 4AQRD 1SQVD 2E5YA 4N3YB 2WSCJ 3L72J 2WSFH 2OGUA 2Q9IA 5AVRB 4PD4H 2R5BA 2H43A 3T97B 1A02F 1GK4A 4Y99B 1USEA 1S9KE 1G2CB 3H1HD 2XZRA 1SFCD 1IK9A 1L0NK 5TISE 1T3JA 3D70A 1LWUC 1FZBA 4C7RA 4RESB 1R5SA 3C8VA 2ZT9C 3RL0C 2M8RA 3H32B 5L8RJ 3CX5I 1OVRA 4BWNA 1JM0A 2Q3IA 1KMIZ 1KB9I 1H0TA 2IFNA 1LT1A 1IK7A 2ZJSE 3G6EP 3VMYA 1YBKA 2L91A 4C7NA 1P84I 2A45G 1YYCA 1EXIA 3VMZA 3L70D 3AE3C 2HLOA 5TJHA 1NU1K 1S5LE 2N1TC 2H89C 3CX5H 1KB9H 5KAIE 1PP9J 2KZIA 1VQ9P 1U7JA 4N6JA 1P84H 1L0LG 3RK2B 1RQVA 1OW6A 1ZR4A 1XTGB 2A06D 1U57A 2FYUD 1LNQA 3TGUD 2ZYAA 3OA7A 2O01J 2QJPC 4ZKPA 1ZMEC 1LTBC 1M1JC 2ZXEB 3NFQA 1L4AB 1A02J 2FXOA 4RJTA 2R32A 4N78E 2O1KA 3TYYA 1OW7A 1XTCC 5CJ4A 1ZN5A 5APTA 1ZRTD 3RBXA 3KZIH 3U59A 3B5NB 1NGMB 2K3RA 3HTKA 1HJBA 2FYNB 1NTME 3H1JG 3RK3B 2FFDA 5AVYB 4JQ0D 3WUTA 3G71P 2KS1B 1BSHA 1URQA 2KYVA 1ZR2A 1VF5D 2OYIA 4H13D 2FKWB 1RQUA 3FWNA 1SQVG 2IDBA 2POHA 3CPWO 3T97A 2Y9YA 2NPSC 3AEDC 2QJYB 2E75D 1G2CA 1LP1B 1ZP0C 1GDTA 1KORA 2WZ7A 2HFED 1RF0A 1FS0E 1KILE 4JYCA 2KXPB 5KAFH 3H32A 4C46A 5APYA 2K9YA 3VMAA 3CI9A 1FJKA 1S1CX 5CCGD 2ZFCA 3HRNA 1VDFA 3P8CE 2WPSA 3BRTB 3L36A 5B5EE 3CCMP 1JY2O 3A0BH 4WWIA 1SQPK 1FZCC 1S5LX 1SQQK 4WY4D 3O6QA 3FXDA 3CC4P 3L70G 1KQFB 1PPJD 1J1EB 2Z5IA 2WSCH 1L0LE 1SQXG 5E79E 1U7MA 1YTZI 5KJ7A 1AQ5A 1BDDA 1AVOA 4OWFA 5KLVK 3AEEC 3S4RA 1H8AA 2A06G 2SPZA 4LGDE 3B4SA 4JBZA 3BCCD 2FXMA 2FYUG 1Q2NA 1LWUB 3TGUG 2FBWC 4I7ZC 2ZT9B 1Q90D 1L4AA 3RL0B 2BCCJ 3AE6C 1NHLA 3PHLA 2G8YA 4U7JA 2V4HA 5AW6B 1X22A 4HYTB 2JWAA 3KHUA 2FFDC 1DH3A 2Y9ZA 1KZUB 3GF3A 3ZDMA 1URQC 4OVNF 1W2BO 2OYIC 3CLQA 3H1LJ 3EQ2A 3H1JE 4GIFA 1GW3A 2YKQA 1NTMJ 2H7HA 3FX0A 1BGYD 3SWFA 4O9BA 3CXHD 2KLVA 2XV5A 1M1KQ 3OJAB 1SQVE 1FDOA 1RF0C 5AW4B 3CC2P 4YTPC 5AVXB 2QE7H 3GLMA 5APXA 1LP1A 2QJPB 2O01H 1M1JB 2OYHC 4DOJA 2P10A 3HD7C 1NTZD 1NOHA 4EIJA 5AW9B 3L71D 1LTJC 3AEFC 4PJ0E 1X8YA 1WMKA 2KNCA 2KSJA 3P8MC 1HWTC 3L75D 5CCHA 1FU1A 5B66H 5KKZC 2KK7A 2OTJP 2K1AA 1OXZA 2YMYA 2D2CC 3L70E 3KYQA 2QRXA 1T3UA 1MZ9A 2LKMA 2VRSA 1PPJG 1BSNA 1SQXE 4NPEA 1NTKE 4ASWA 1K73Q 3CX5D 4XA4A 3GG2A 1KC8Q 3CCQP 1EZVD 4XFJA 1H0TB 1OWAA 1PV3A 3L37A 2FYUE 3QWOC 1LWUA 2CPBA 4EDFA 2ITAA 2N9BA 5DJUB 3TGUE 4UB6E 2AXTE 3BCCG 1N8RQ 2AEJA 5TISH 4H0LC 3HE5B 1S4XA 2E76C 2JP3A 2B9BA 1L0LD 1NTMK 5CJ0A 1T2KD 2K9JA 4IOIH 2JKVA 2PRRA 2HR3A 5M1BA 1ZRTE 2Q6QA 1SQBE 1FZCB 2N1TA 1RE3A 3O8ZA 2P2UA 3L4FA 4U3FJ 2YMKA 2E5TA 1WT6A 1S5LH 5CMZA 1QX8A 3H1JJ 5KAIH 2IBZI 1ZV8A 2M0BA 4UB8E 1KQLA 3H1ID 5C39A 3W68A 1BGYG 3H25A 3PP5A 3IF4A 1GK6A 3LIEA 1VPCA 3RK2D 2IZ0A 3A0HE 1SQVJ 5CCHC 5KJ7D 2ZYGA 3Q5PA 3BRVB 2LR2A 1EQ7A 1M1JA 4I7ZB 3AEBC 2WQYC 1NAFA 1QVGO 3HTKB 3PTZA 2WWWA 4PD4I 5AW8B 3U1CA 1NTZG 3H1HJ 2IZ1A 5GTIE 3L71G 2W90A 2XNDH 2FFDB 1QVFO 3BATA 1URQB 3L75G 3CCLP 1KD1Q 1K04A 2OYIB 2QEXP 2J59M 2LXCB 2Y0DA 2OARA 4IL6X 4L74A 3KPEA 1N7SA 3B5ND 2PP6A 1LT9C 3GHGC 3A2AA 3C9IA 3NXSA 1DD4A 1JOCA 1GL2A 1AFOA 1KFMA 2HPCB 3L70J 3MP7B 5APVA 1IC2A 1E79H 4R4MA 1PPJE 4WBAA 4RO0A 2R5DA 3RK3D 4EI2A 3MIWA 2IYOA 3V6IA 2KUBA 1VQ8P 2NPSA 1FBMA 5GTHE 4K35A 3L74J 3G4SP 2R3CA 3AE5C 2OQQA 2OYHB 2KSEA 3Q5SA 3HD7B 3HUSC 1LTJB 1EZVG 3FGAD 3KQGA 3BCCE 2WITA 4OGQC 1JMMA 1JB0J 5AW7B 3B71A 2A45I 3V2RA 3PLNA 1USDA 3HE5A 1JY3N 4H13C 1RE3C 2M3BA 3O6QB 2BEQD 5KKZB 1SQXD 1OX3A 1NTKD 3P7KA 2WPRA 2W27A 2E75C 3EFFK 3VOPA 1FZCA 3TK1A 3H1KG 2A45H 2D2CB 1KYOE 4WVZA 2GUSA 4YXDC 1BCCJ 5H2FE 1SQVK 3CCSP 3KXDA 1PGQA 3AE2C 2MJZA 5CCGC 4PV1C 1SS1A 4KHXA 2C0WA 1HH0A 3AEGC 3TNUA 2W8ZA 2Z4EA 4A7PA 1BGYE 5E79H 2JJLA 3CXHE 3H1IG 1DD3A 2QIWA 3F5HA 3NMDA 4GOEA 2J5UA 1JNMA 3L73G 1PGJA 1SQBD 1OMIA 2JO1A 1VQNP 4M3LA 1SVFA 2WT7B 4H0LB 2GM4A 2E76B 1SQPD 3M9QA 3E1IA 2IPPA 1SQQD 1NTZE 3V2NA 3L71E 1AV1A 1N7SC 1DX7A 2ZT9D 1NO4A 3RL0D 1G1JA 1GL2C 3L75E 2XKMA 3WU2H 1KILA 2QJKC 1FE6A 4Z1MH 5KLVD 1HUCA 2KOGA 3CD6P 5CBOA 2HPCA 5APWA 5APSA 2RMZA 3SFEC 3V2QA 1M90Q 3WUVA 3GW6A 4XE5B 1ZOYC 5BVZA 1PL5A 2H88C 2KNCB 4YPCA 1RY3A 3CCVP 3AEAC 3CWBD 2OYHA 1IJDB 3CX5E 3HD7A 2K88A 1LTJA 1Q86Q 1EZVE 2UWJE 1KB9E 2V7QH 4IFMA 1OVVA 4MN4C 5APUA 2K37A 3S1KA 4R4LA 1IFMA 1LJ2A 3BCCJ 5KLIC 1EDKA 1DEBA 1OZHA 3EFGA 4W7ZA 5AVVB 1NTKG 2DW3A 3H1KE 3VMXA 1HGZA 1LT9B 3GHGB 1FC2C 1VQ7P 1PZQA 4IL6H 1GMJA 2QM8A 3CL3D 2R44A 1K9MQ 4IFFA 2CPSA 1J2JB 1Q81Q 1QGKB 3MD0A 3IN6A 5AVZB 3II6A 1KTMA 1L0NE 2M5AA 2W83C 2WMMA 3H1IE 1BGYJ 2K9JB 3L73E 3R2PA 3HUSB 5AW1B 1KYOD 2W6AA 4NPDA 3MGNA 4OGQB 1SP4A 1SQBG 2WT7A 1KILC 2N1TB 2JR8A 1MFZA 1QL1A 4UB6H 1Y9BA 4I6MC 1EDJA 1SQPG 1ZXGA 4CPGA 1NU1E 1SQQG 3P32A 2E74C 2YKOA 4H44C 4Y28J 1RE4C 2Q3EA 3IFMA 3Q5RA 2QVAA 4LLHA 1VQ4P 5AVUB 3FWLA 2KZJA 3A3YB 4Y99C 1KQGB 2Q5UA 2I1JA 2ZAEB 4GDOA 5KLVG 1YJ9P 5KAFE 3ABVC 1OIPA 4PV1B 4HJGH 2KLUA 2RN0A 2JWDA 4UB8H 4ZNCA 2PGDA 2KB7P 3RK3E 4PD4D 1FOSF 3MUDC 3C1LA 3A0BE 1MV8A 1MUUA 1QL2A 3CWBG 3V4QA 2GA1A 3V5BA 4EYYQ 2W6JH 1JTHA 1KN7A 1N7SB 4AYCA 1R8EA 1RF1A 3S9OA 3W67A 2Q1KA 1LTSC 2P58A 3M0AA 3SWKA 5GTIH 1GL2B 1IO4A 1OVUA 2QJKB 1L0LJ 1URQD 5BU5A 2NPSB 1LT9A 3GHGA 3CCJP 1KV4A 1FZEA 2YNYA 1KB9D 1NAYA 3V4WA 1GD2E 1HGVA 1Y8AA 2XU6A 2E42A 1R5LA 5CBNA 1P84D 3AE1C 3CCRP 3AECC 3OAKA 4K3AA 4NPFX 4W7YA 3EWKA 2MKVA 5GTHH 1RHZB 3H1KD 3H1IJ 1HBWA 3HUSA 2QA4P 5K5GB 5KTBA 1TU3F 3Q2YA 2P1JA 4KT0J 1SFCC 1PP9E 3IR9A 2H8PD 1CZQA 3VTPC 4IFDK 1G1IA 2YKPA 3G3ZA 3HD7D 1N73A 1GU5A 3BVHA 1SQPE 1SQQE 1YQ4C 4TLFA 4D6TD 2ZYDA 2WTYA 1HJ0A 3N7NA 1L0ND 3TNUB 2WVRA 2XNXA 3MZWB 3VP8A 3L73D 2IBZG 2M3EA 1PFIA 1WRGA 4BRYB 3MHVA 2OTKE 3V2PA 2BCCG 5CCGA 5KLVE 3CXHI 1FDMA 1D7MA 3A5TA 2V7QJ 2P7JA 5AVWB 1VL2A 1VQLP 1NU1D 2YO3A 2HG5D 4U3FD 1NH4A 3USSA 4DCKA 1RF1C 1JCCA 1L4AD 3H1LG 3CXHH 1X9VA 2KIKA 2HODA 2Y0CA 2YXQB 3CWBE 1KILB 3PJSK 2R3SA 2WPVB 5APQA 1L0LK 3M91A 4BXLA 2KI7B 3JCUE 4RKUJ 1J1EC 1PIXA 3WUUA 3VN0A 2NZ2A 1DIPA 4H0LD 2E74B 1DEEG 4H44B 1AJYA 2E76D 2Q7CA 4HH2A 1PGOA 1Q7YQ 4HKZH 3IAOA 1SQXJ 2O1JA 1EC5A 3OW2O 1NTKJ 1T6AA 1H88A 2Y0EA 1BE3D 1AQTA 1NWQA 4LC1A 4GODA 3NTNA 2C9NY 3L72D 1VF5C 4B86A 1GTWA 2FYUJ 3TGUJ 3CMEP 1EZVI 1BDCA 1ZW0A 1W2EA 1N73C 5AW5B 4ZKUA 1VQOP 1LTGC 4GKGA 1FZAA 3F89A 3I55P 1VQ6P 5CCHD 5B5EH 1IFJA 3B8EB 4L73A 1SQBJ 4DZOA 5AVSB 2PAJA 3L74D 1HVVA 1YQ3C 2QG4A 1LGHB 4L76A 1AA0A 3VP9A 2WSSH 3RL0g 4OH8B 4YXWH 1SQPJ 2B88A 4DJGA 1SQQJ 4D6TG 1L0NG 2IBZE 4BRYA 5BU8B 2M5AB 1IZNB 2YIUC 2B87B 4WY4C 2BCCE 2KP8A 1PP9D 1JY2N 3E1RA 1H89A 5KLVJ 1FZGA 3JC22 3TF5A 1W5CE 1OFCX 1UIIA 3M9BA 3HE4A 1BCCD 3ITKA 1NYHA 3H1LE 2OTLP 1NU1G 4PD4E 3AE7C 1CW5A 4U3FG
chains in the Genus database with same CATH topology
2H43A 1SFCB 3R2PA 4XA4A 2YO2A 3HUSB 5AW1B 1JY3O 1A02F 2W6AA 2BASA 1GK4A 1OWAA 4Y99B 3MGNA 1SQXK 3L37A 1S9KE 1SP4A 1G2CB 2WT7A 2XZRA 1KILC 1LWUA 1SFCD 2CPBA 1NTKK 1IK9A 2N1TB 2N9BA 3M06A 1L0NK 1MFZA 1QL1A 1T3JA 4I6MC 1LWUC 1FZBA 4C7RA 2N1TD 3HE5B 4RESB 1KFNA 3N4XA 1RE4A 2P67A 3RL0C 2M8RA 3H32B 1NTMK 3P32A 5CJ0A 1T2KD 1JY3P 3M0DA 2YKOA 1RE4C 2FYUK 2Q3IA 2IFNA 2JEEA 4GT1A 3IFMA 3VMYA 4LLHA 5AVUB 1FZCB 4C7NA 2A45G 2N1TA 4W80A 1YYCA 1RE3A 3VMZA 3A3YB 4Y99C 2Q5UA 3O8ZA 2P2UA 2HLOA 3L4FA 2I1JA 1NU1K 2N1TC 1WT6A 5CMZA 1Z56A 3H6PA 4N6JA 4EOTA 1JTHB 1ZV8A 1SQBK 3MUDA 1KQLA 1RF1B 3RK2B 2KB7P 1FOSF 1ZR4A 2C0XA 3PP5A 2FYZA 1XTGB 1GK6A 1MV8A 3LIEA 1VPCA 3RK2D 1MUUA 5CCHC 5KJ7D 1JUNA 1S9KD 1QL2A 3BRVB 3V4QA 1EQ7A 1M1JA 3V5BA 3OA7A 2IFMA 1NAFA 4ZKPA 1JTHA 3HTKB 1LTBC 1M1JC 3VYIA 1N7SB 2WWWA 1N86A 4AYCA 2ZXEB 1RF1A 3NFQA 1L4AB 5AW8B 1JY2P 1HTLC 3U1CA 1A02J 1LTSC 3M0AA 2R32A 1GL2B 4N78E 1IO4A 2O1KA 3TYYA 2FFDB 1N7SD 1XTCC 5CJ4A 1ZN5A 3BATA 1URQB 5APTA 1YTZT 1GL2D 1JCDA 2OYIB 3U59A 2J59M 3B5NB 2OARA 1URQD 5BU5A 2NPSB 1LT9A 3GHGA 3KDPB 3HTKA 1HJBA 3KPEA 1N7SA 3B5ND 1J1DC 2PP6A 1FZEA 2YNYA 1LT9C 3GHGC 2NPSD 3A2AA 3C9IA 3NXSA 1JOCA 3V4WA 3RK3B 1GD2E 1GL2A 1HGVA 1AFOA 1KFMA 2XU6A 2HPCB 2FFDA 2E42A 5AVYB 5APVA 1IC2A 1URQA 4WBAA 2KYVA 1ZR2A 2R5DA 3RK3D 3M9HA 3MIWA 2OYIA 3OAKA 2FKWB 1FOSE 1N73B 3B5NA 1LTIC 1N7LA 2NPSA 1FBMA 5AVTB 4W7YA 2POHA 2E43A 4AUWA 3T97A 1SFCA 2R3CA 1HBWA 3HUSA 3MTUE 2NPSC 5KTBA 3M0DC 3I5CA 2OYHB 2P1JA 1G2CA 1SFCC 3HD7B 1GDTA 3HUSC 2I1KA 3IR9A 1LTJB 2WZ7A 2H8PD 1CZQA 3KQGA 3VTPC 2WITA 4IFDK 1E5WA 5AW2B 1G1IA 3G3ZA 2YKPA 1JMMA 2J58A 5AW7B 3V2RA 2A45I 3HD7D 1JY3N 2HFED 3HE5A 1RE3C 4N78D 1RF0A 2M3BA 4JYCA 1IFDA 1N73A 3UIAA 1GU5A 3BVHA 3H32A 4C46A 1T2KC 5APYA 3CI9A 1FJKA 3P7KA 5CCGD 2WTYA 2ZFCA 2WPRA 1T8ZA 2C9LY 1GW4A 3N7NA 2W27A 3HRNA 1FAVA 3TNUB 1M7LA 1VDFA 2XNXA 3P8CE 2XDJA 2WPSA 3BRTB 3L36A 3VOPA 1FZCA 4WY4B 3VP8A 5AW0B 3TK1A 2A45H 1PFIA 1WRGA 1JY2O 2GUSA 1SQPK 3V2PA 1FZCC 1SQQK 2HODB 4WY4D 1SQVK 5CCGA 1CI6B 3SWYA 1FDMA 1J1EB 3A5TA 2MJZA 5CCGC 3TSIA 4KHXA 1JO5A 2C0WA 2P7JA 1HH0A 3TNUA 2Z5IA 5AVWB 2WSCH 2YO3A 1YTZI 3U1AA 2Z4EA 1GZLA 5KJ7A 1AQ5A 2HG5D 1IFNA 1NH4A 2JJLA 4JYBA 1RF1C 5KLVK 3RK2C 1JCCA 1L4AD 4WB4A 1X9VA 5KJ7C 2HODA 3NMDA 1JNMA 2WPQA 1KILB 1H8AA 4LGDE 5APQA 1L0LK 4M3LA 1SVFA 2FXMA 3M91A 2WT7B 1LWUB 1KILD 2GM4A 5AVQB 1L4AA 1J1EC 3M9QA 3E1IA 3RL0B 2IPPA 1NHLA 3VN0A 3V2NA 1N7SC 1DX7A 1L4AC 1NO4A 5AW6B 4HYTB 5CHXA 2Q7CA 3RL0D 3P8CD 4HH2A 2W6BA 1G1JA 1GL2C 2FFDC 2XKMA 1DH3A 1KILA 2IX7C 1KZUB 1URQC 2O1JA 1FJPA 2OYIC 1H88A 3CLQA 1NTZK 4C7NB 3B5NC 4I2LC 1HUCA 2KOGA 1NWQA 1CSBA 2WSEH 3EQ2A 1SLQA 4LC1A 4GIFA 1GW3A 2YKQA 2HPCA 4I1LA 5APWA 5APSA 3NTNA 2C9NY 3V2QA 3A7OA 3RK3C 4B86A 1GTWA 2H7HA 3SWFA 1IFIA 1X79B 4XE5B 4O9BA 5BVZA 2KLVA 2XV5A 1NKZB 2GUVA 1N2DC 3L35A 3BASA 3OJAB 1W2EA 1RF0C 5AW4B 1N73C 1RY3A 5AW5B 4ZKUA 1NKNA 5AVXB 1LTGC 2OYHA 2Z5HA 4GKGA 1FZAA 1IJDB 5CCHD 3HD7A 5APXA 2O01H 1LTJA 1IFJA 3WMM0 1ZLLA 4JF7A 1M1JB 4IFMA 2OYHC 4DOJA 3B8EB 5APUA 3HD7C 4DZOA 1NOHA 5AVSB 4EIJA 5AW9B 2PAJA 1LTJC 1HVVA 1IFMA 1X8YA 1LGHB 2KSJA 3VP9A 3P8MC 1HWTC 1DEBA 4OH8B 1FU1A 3EFGA 5CCHA 1LTTC 1LTAC 2QM7A 1FZFA 4W7ZA 5AVVB 3HE4B 4WY4A 3LW5H 1OXZA 3VMXA 5BU8B 1HGZA 1J1DB 2YMYA 1LT9B 3GHGB 5AW3B 4WY4C 2KP8A 2HYNA 1CI6A 1GU4A 2QM8A 3CL3D 3KYQA 3LIDA 1JY2N 4IFFA 1H89A 1FZGA 2CPSA 1T3UA 1MZ9A 1J2JB 2LKMA 2VRSA 2L5GB 3M9BA 4AQRD 3HE4A 3MD0A 5AVZB 4N3YB 3II6A 2WSFH 2Q9IA 5AVRB 1CW5A 2R5BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2H43 A;  1N73 B;  3H32 B;  1JY2 P;  1JY2 N;  2A45 H;  2A45 I;  1FZC A;  1JY2 O;  1FZG A;  1JY3 N;  2Z4E A;  1LTJ A;  1LWU B;  1RE3 C;  3HUS B;  1JY3 O;  1JY3 P;  1RF0 A;  1FZF A;  1T3U A;  1FZE A;  1M1J B;  1N73 A;  1LT9 C;  3GHG C;  2FFD B;  2OYH C;  1RE4 C;  2OYI C;  1FZC C;  3BVH A;  2HLO A;  2HOD B;  3H32 A;  1RF1 C;  3E1I A;  1LWU A;  3HUS A;  2HPC B;  2FFD A;  1LTJ C;  1M1J A;  1W2E A;  1RF0 C;  2HOD A;  1LT9 B;  3GHG B;  2OYH B;  1N73 C;  2OYI B;  1FZC B;  2A45 G;  1RF1 B;  1RE3 A;  2HPC A;  2Q9I A;  2XNX A;  1LWU C;  1FZB A;  3HUS C;  1LTJ B;  1M1J C;  2OYI A;  2FFD C;  1LT9 A;  1N86 A;  3GHG A;  2OYH A;  1FZA A;  1RE4 A;  1RF1 A; 
#chains in the Genus database with same CATH topology
 2O01 N;  1SFC B;  2YO2 A;  1JY3 O;  1VQP P;  2BAS A;  3FXE A;  1SQX K;  4KJM A;  1IFP A;  3CWB J;  1NTK K;  3M06 A;  4OGQ D;  2N1T D;  1KFN A;  3N4X A;  1RE4 A;  2P67 A;  1NJI Q;  3Q1M A;  1JY3 P;  3M0D A;  1YIJ P;  2FYU K;  1VQM P;  1JMB A;  2JEE A;  4GT1 A;  1X0T A;  4W80 A;  2OYO A;  3RGU A;  1S3J A;  3H1H G;  1BE3 G;  2WSE J;  1Z56 A;  3H6P A;  3D6Z A;  3SFD C;  3PH0 A;  4EOT A;  1JTH B;  3QH9 A;  1SQB K;  1P84 E;  3MUD A;  4PV1 D;  1S2E A;  2FXP A;  3L72 G;  4PJ0 H;  1RF1 B;  1EDL A;  1Q82 Q;  2C0X A;  2QSI A;  2FYZ A;  3Q3D A;  3D6Y A;  1JUN A;  1S9K D;  1MKM A;  3I56 P;  2IFM A;  3VYI A;  1N86 A;  2G3A A;  1JY2 P;  1HTL C;  1YI2 P;  3L74 G;  4ASV A;  1N7S D;  4D6T E;  1YTZ T;  1GL2 D;  3KZI E;  3RBZ A;  1JCD A;  3LW5 J;  2B87 A;  3K5B A;  3KDP B;  2YXR B;  1J1D C;  2N9Y B;  3E7K A;  2NPS D;  1QEX A;  1VF5 B;  2RKL A;  1HF9 A;  1YJN P;  1EXJ A;  1PP9 G;  2NRG A;  4H13 B;  1KQS O;  3G9R A;  2AXT H;  1VQ5 P;  3M9H A;  3WU2 E;  1QLE D;  1FOS E;  1N73 B;  3B5N A;  1UIX A;  1LTI C;  2FY8 A;  1N7L A;  1NTZ J;  5AVT B;  2E75 B;  3GF7 A;  1BCC G;  3L71 J;  2ZVN B;  4U3F E;  2E43 A;  4AUW A;  2WSF J;  1YIT P;  1SFC A;  3D71 A;  2IBZ D;  3MTU E;  2AXC A;  3L75 J;  3M0D C;  3I5C A;  2BCC D;  2I1K A;  2KS1 A;  1AVY A;  1E5W A;  5AW2 B;  2J58 A;  4N78 D;  2O3J A;  1IFD A;  3UIA A;  1K05 A;  1T2K C;  3CCE P;  1T8Z A;  2C9L Y;  1GW4 A;  1VQK P;  2JDI H;  1FAV A;  1M7L A;  3H1L D;  2XDJ A;  2YIU B;  4WY4 B;  5AW0 B;  2CK3 H;  1NTM D;  3A0H H;  2HOD B;  3H1H E;  1BE3 E;  1CI6 B;  2I8D A;  4TT3 H;  3SWY A;  1M8O B;  3TSI A;  1JO5 A;  3L72 E;  3U1A A;  1GZL A;  1IFN A;  3SSU A;  1S72 P;  2BEZ F;  4JYB A;  3RK2 C;  4WB4 A;  4L75 A;  2AEF A;  5KJ7 C;  4IL6 E;  2ZXX A;  2WPQ A;  1EDI A;  2AEM A;  3TDK A;  3H1K J;  1KIL D;  5AVQ B;  3JCU H;  3L74 E;  3AE8 C;  1L4A C;  5CHX A;  3P8C D;  2W6B A;  2E74 D;  4H44 D;  2IX7 C;  1OW8 A;  2A06 E;  2PFX A;  1L2P A;  1FJP A;  4D6T J;  3CCU P;  1NTZ K;  1L0N J;  4C7N B;  3JSV C;  3B5N C;  4I2L C;  1CSB A;  2WSE H;  1YHQ P;  1SLQ A;  3L73 J;  2FYN C;  4I1L A;  4QMA A;  1K8A Q;  2IYP A;  2B89 A;  1Y47 A;  1MFT A;  1PGP A;  3A7O A;  3RK3 C;  5KLI B;  4DT0 A;  1IFI A;  1X79 B;  1JEK A;  1KYO I;  1NKZ B;  2GUV A;  1N2D C;  4ZMD A;  3L35 A;  3BAS A;  1BCC E;  5EFW B;  1NU1 J;  1NKN A;  2Z5H A;  3AE9 C;  3GMA A;  5DJT B;  1RH5 B;  3WMM 0;  2QJY C;  1ZLL A;  4GOF A;  4JF7 A;  3CC7 P;  1KYO H;  3PRJ A;  5H2F H;  2D2C D;  1M56 D;  4JPZ B;  3R4Y A;  5B66 E;  1LTT C;  1LTA C;  2QM7 A;  1FZF A;  3HE4 B;  4WY4 A;  3AE4 C;  3LW5 H;  1J1D B;  5AW3 B;  2ZVO B;  3H1J D;  3CMA P;  2HYN A;  1CI6 A;  1YJW P;  1GU4 A;  1NTM G;  3LID A;  1NVO A;  1M57 D;  1BE3 J;  4HB1 A;  2LXB A;  1FDI A;  2RH0 A;  2L5G B;  4AQR D;  1SQV D;  2E5Y A;  4N3Y B;  2WSC J;  3L72 J;  2WSF H;  2OGU A;  2Q9I A;  5AVR B;  4PD4 H;  2R5B A;  2H43 A;  3T97 B;  1A02 F;  1GK4 A;  4Y99 B;  1USE A;  1S9K E;  1G2C B;  3H1H D;  2XZR A;  1SFC D;  1IK9 A;  1L0N K;  5TIS E;  1T3J A;  3D70 A;  1LWU C;  1FZB A;  4C7R A;  4RES B;  1R5S A;  3C8V A;  2ZT9 C;  3RL0 C;  2M8R A;  3H32 B;  5L8R J;  3CX5 I;  1OVR A;  4BWN A;  1JM0 A;  2Q3I A;  1KMI Z;  1KB9 I;  1H0T A;  2IFN A;  1LT1 A;  1IK7 A;  2ZJS E;  3G6E P;  3VMY A;  1YBK A;  2L91 A;  4C7N A;  1P84 I;  2A45 G;  1YYC A;  1EXI A;  3VMZ A;  3L70 D;  3AE3 C;  2HLO A;  5TJH A;  1NU1 K;  1S5L E;  2N1T C;  2H89 C;  3CX5 H;  1KB9 H;  5KAI E;  1PP9 J;  2KZI A;  1VQ9 P;  1U7J A;  4N6J A;  1P84 H;  1L0L G;  3RK2 B;  1RQV A;  1OW6 A;  1ZR4 A;  1XTG B;  2A06 D;  1U57 A;  2FYU D;  1LNQ A;  3TGU D;  2ZYA A;  3OA7 A;  2O01 J;  2QJP C;  4ZKP A;  1ZME C;  1LTB C;  1M1J C;  2ZXE B;  3NFQ A;  1L4A B;  1A02 J;  2FXO A;  4RJT A;  2R32 A;  4N78 E;  2O1K A;  3TYY A;  1OW7 A;  1XTC C;  5CJ4 A;  1ZN5 A;  5APT A;  1ZRT D;  3RBX A;  3KZI H;  3U59 A;  3B5N B;  1NGM B;  2K3R A;  3HTK A;  1HJB A;  2FYN B;  1NTM E;  3H1J G;  3RK3 B;  2FFD A;  5AVY B;  4JQ0 D;  3WUT A;  3G71 P;  2KS1 B;  1BSH A;  1URQ A;  2KYV A;  1ZR2 A;  1VF5 D;  2OYI A;  4H13 D;  2FKW B;  1RQU A;  3FWN A;  1SQV G;  2IDB A;  2POH A;  3CPW O;  3T97 A;  2Y9Y A;  2NPS C;  3AED C;  2QJY B;  2E75 D;  1G2C A;  1LP1 B;  1ZP0 C;  1GDT A;  1KOR A;  2WZ7 A;  2HFE D;  1RF0 A;  1FS0 E;  1KIL E;  4JYC A;  2KXP B;  5KAF H;  3H32 A;  4C46 A;  5APY A;  2K9Y A;  3VMA A;  3CI9 A;  1FJK A;  1S1C X;  5CCG D;  2ZFC A;  3HRN A;  1VDF A;  3P8C E;  2WPS A;  3BRT B;  3L36 A;  5B5E E;  3CCM P;  1JY2 O;  3A0B H;  4WWI A;  1SQP K;  1FZC C;  1S5L X;  1SQQ K;  4WY4 D;  3O6Q A;  3FXD A;  3CC4 P;  3L70 G;  1KQF B;  1PPJ D;  1J1E B;  2Z5I A;  2WSC H;  1L0L E;  1SQX G;  5E79 E;  1U7M A;  1YTZ I;  5KJ7 A;  1AQ5 A;  1BDD A;  1AVO A;  4OWF A;  5KLV K;  3AEE C;  3S4R A;  1H8A A;  2A06 G;  2SPZ A;  4LGD E;  3B4S A;  4JBZ A;  3BCC D;  2FXM A;  2FYU G;  1Q2N A;  1LWU B;  3TGU G;  2FBW C;  4I7Z C;  2ZT9 B;  1Q90 D;  1L4A A;  3RL0 B;  2BCC J;  3AE6 C;  1NHL A;  3PHL A;  2G8Y A;  4U7J A;  2V4H A;  5AW6 B;  1X22 A;  4HYT B;  2JWA A;  3KHU A;  2FFD C;  1DH3 A;  2Y9Z A;  1KZU B;  3GF3 A;  3ZDM A;  1URQ C;  4OVN F;  1W2B O;  2OYI C;  3CLQ A;  3H1L J;  3EQ2 A;  3H1J E;  4GIF A;  1GW3 A;  2YKQ A;  1NTM J;  2H7H A;  3FX0 A;  1BGY D;  3SWF A;  4O9B A;  3CXH D;  2KLV A;  2XV5 A;  1M1K Q;  3OJA B;  1SQV E;  1FDO A;  1RF0 C;  5AW4 B;  3CC2 P;  4YTP C;  5AVX B;  2QE7 H;  3GLM A;  5APX A;  1LP1 A;  2QJP B;  2O01 H;  1M1J B;  2OYH C;  4DOJ A;  2P10 A;  3HD7 C;  1NTZ D;  1NOH A;  4EIJ A;  5AW9 B;  3L71 D;  1LTJ C;  3AEF C;  4PJ0 E;  1X8Y A;  1WMK A;  2KNC A;  2KSJ A;  3P8M C;  1HWT C;  3L75 D;  5CCH A;  1FU1 A;  5B66 H;  5KKZ C;  2KK7 A;  2OTJ P;  2K1A A;  1OXZ A;  2YMY A;  2D2C C;  3L70 E;  3KYQ A;  2QRX A;  1T3U A;  1MZ9 A;  2LKM A;  2VRS A;  1PPJ G;  1BSN A;  1SQX E;  4NPE A;  1NTK E;  4ASW A;  1K73 Q;  3CX5 D;  4XA4 A;  3GG2 A;  1KC8 Q;  3CCQ P;  1EZV D;  4XFJ A;  1H0T B;  1OWA A;  1PV3 A;  3L37 A;  2FYU E;  3QWO C;  1LWU A;  2CPB A;  4EDF A;  2ITA A;  2N9B A;  5DJU B;  3TGU E;  4UB6 E;  2AXT E;  3BCC G;  1N8R Q;  2AEJ A;  5TIS H;  4H0L C;  3HE5 B;  1S4X A;  2E76 C;  2JP3 A;  2B9B A;  1L0L D;  1NTM K;  5CJ0 A;  1T2K D;  2K9J A;  4IOI H;  2JKV A;  2PRR A;  2HR3 A;  5M1B A;  1ZRT E;  2Q6Q A;  1SQB E;  1FZC B;  2N1T A;  1RE3 A;  3O8Z A;  2P2U A;  3L4F A;  4U3F J;  2YMK A;  2E5T A;  1WT6 A;  1S5L H;  5CMZ A;  1QX8 A;  3H1J J;  5KAI H;  2IBZ I;  1ZV8 A;  2M0B A;  4UB8 E;  1KQL A;  3H1I D;  5C39 A;  3W68 A;  1BGY G;  3H25 A;  3PP5 A;  3IF4 A;  1GK6 A;  3LIE A;  1VPC A;  3RK2 D;  2IZ0 A;  3A0H E;  1SQV J;  5CCH C;  5KJ7 D;  2ZYG A;  3Q5P A;  3BRV B;  2LR2 A;  1EQ7 A;  1M1J A;  4I7Z B;  3AEB C;  2WQY C;  1NAF A;  1QVG O;  3HTK B;  3PTZ A;  2WWW A;  4PD4 I;  5AW8 B;  3U1C A;  1NTZ G;  3H1H J;  2IZ1 A;  5GTI E;  3L71 G;  2W90 A;  2XND H;  2FFD B;  1QVF O;  3BAT A;  1URQ B;  3L75 G;  3CCL P;  1KD1 Q;  1K04 A;  2OYI B;  2QEX P;  2J59 M;  2LXC B;  2Y0D A;  2OAR A;  4IL6 X;  4L74 A;  3KPE A;  1N7S A;  3B5N D;  2PP6 A;  1LT9 C;  3GHG C;  3A2A A;  3C9I A;  3NXS A;  1DD4 A;  1JOC A;  1GL2 A;  1AFO A;  1KFM A;  2HPC B;  3L70 J;  3MP7 B;  5APV A;  1IC2 A;  1E79 H;  4R4M A;  1PPJ E;  4WBA A;  4RO0 A;  2R5D A;  3RK3 D;  4EI2 A;  3MIW A;  2IYO A;  3V6I A;  2KUB A;  1VQ8 P;  2NPS A;  1FBM A;  5GTH E;  4K35 A;  3L74 J;  3G4S P;  2R3C A;  3AE5 C;  2OQQ A;  2OYH B;  2KSE A;  3Q5S A;  3HD7 B;  3HUS C;  1LTJ B;  1EZV G;  3FGA D;  3KQG A;  3BCC E;  2WIT A;  4OGQ C;  1JMM A;  1JB0 J;  5AW7 B;  3B71 A;  2A45 I;  3V2R A;  3PLN A;  1USD A;  3HE5 A;  1JY3 N;  4H13 C;  1RE3 C;  2M3B A;  3O6Q B;  2BEQ D;  5KKZ B;  1SQX D;  1OX3 A;  1NTK D;  3P7K A;  2WPR A;  2W27 A;  2E75 C;  3EFF K;  3VOP A;  1FZC A;  3TK1 A;  3H1K G;  2A45 H;  2D2C B;  1KYO E;  4WVZ A;  2GUS A;  4YXD C;  1BCC J;  5H2F E;  1SQV K;  3CCS P;  3KXD A;  1PGQ A;  3AE2 C;  2MJZ A;  5CCG C;  4PV1 C;  1SS1 A;  4KHX A;  2C0W A;  1HH0 A;  3AEG C;  3TNU A;  2W8Z A;  2Z4E A;  4A7P A;  1BGY E;  5E79 H;  2JJL A;  3CXH E;  3H1I G;  1DD3 A;  2QIW A;  3F5H A;  3NMD A;  4GOE A;  2J5U A;  1JNM A;  3L73 G;  1PGJ A;  1SQB D;  1OMI A;  2JO1 A;  1VQN P;  4M3L A;  1SVF A;  2WT7 B;  4H0L B;  2GM4 A;  2E76 B;  1SQP D;  3M9Q A;  3E1I A;  2IPP A;  1SQQ D;  1NTZ E;  3V2N A;  3L71 E;  1AV1 A;  1N7S C;  1DX7 A;  2ZT9 D;  1NO4 A;  3RL0 D;  1G1J A;  1GL2 C;  3L75 E;  2XKM A;  3WU2 H;  1KIL A;  2QJK C;  1FE6 A;  4Z1M H;  5KLV D;  1HUC A;  2KOG A;  3CD6 P;  5CBO A;  2HPC A;  5APW A;  5APS A;  2RMZ A;  3SFE C;  3V2Q A;  1M90 Q;  3WUV A;  3GW6 A;  4XE5 B;  1ZOY C;  5BVZ A;  1PL5 A;  2H88 C;  2KNC B;  4YPC A;  1RY3 A;  3CCV P;  3AEA C;  3CWB D;  2OYH A;  1IJD B;  3CX5 E;  3HD7 A;  2K88 A;  1LTJ A;  1Q86 Q;  1EZV E;  2UWJ E;  1KB9 E;  2V7Q H;  4IFM A;  1OVV A;  4MN4 C;  5APU A;  2K37 A;  3S1K A;  4R4L A;  1IFM A;  1LJ2 A;  3BCC J;  5KLI C;  1EDK A;  1DEB A;  1OZH A;  3EFG A;  4W7Z A;  5AVV B;  1NTK G;  2DW3 A;  3H1K E;  3VMX A;  1HGZ A;  1LT9 B;  3GHG B;  1FC2 C;  1VQ7 P;  1PZQ A;  4IL6 H;  1GMJ A;  2QM8 A;  3CL3 D;  2R44 A;  1K9M Q;  4IFF A;  2CPS A;  1J2J B;  1Q81 Q;  1QGK B;  3MD0 A;  3IN6 A;  5AVZ B;  3II6 A;  1KTM A;  1L0N E;  2M5A A;  2W83 C;  2WMM A;  3H1I E;  1BGY J;  2K9J B;  3L73 E;  3R2P A;  3HUS B;  5AW1 B;  1KYO D;  2W6A A;  4NPD A;  3MGN A;  4OGQ B;  1SP4 A;  1SQB G;  2WT7 A;  1KIL C;  2N1T B;  2JR8 A;  1MFZ A;  1QL1 A;  4UB6 H;  1Y9B A;  4I6M C;  1EDJ A;  1SQP G;  1ZXG A;  4CPG A;  1NU1 E;  1SQQ G;  3P32 A;  2E74 C;  2YKO A;  4H44 C;  4Y28 J;  1RE4 C;  2Q3E A;  3IFM A;  3Q5R A;  2QVA A;  4LLH A;  1VQ4 P;  5AVU B;  3FWL A;  2KZJ A;  3A3Y B;  4Y99 C;  1KQG B;  2Q5U A;  2I1J A;  2ZAE B;  4GDO A;  5KLV G;  1YJ9 P;  5KAF E;  3ABV C;  1OIP A;  4PV1 B;  4HJG H;  2KLU A;  2RN0 A;  2JWD A;  4UB8 H;  4ZNC A;  2PGD A;  2KB7 P;  3RK3 E;  4PD4 D;  1FOS F;  3MUD C;  3C1L A;  3A0B E;  1MV8 A;  1MUU A;  1QL2 A;  3CWB G;  3V4Q A;  2GA1 A;  3V5B A;  4EYY Q;  2W6J H;  1JTH A;  1KN7 A;  1N7S B;  4AYC A;  1R8E A;  1RF1 A;  3S9O A;  3W67 A;  2Q1K A;  1LTS C;  2P58 A;  3M0A A;  3SWK A;  5GTI H;  1GL2 B;  1IO4 A;  1OVU A;  2QJK B;  1L0L J;  1URQ D;  5BU5 A;  2NPS B;  1LT9 A;  3GHG A;  3CCJ P;  1KV4 A;  1FZE A;  2YNY A;  1KB9 D;  1NAY A;  3V4W A;  1GD2 E;  1HGV A;  1Y8A A;  2XU6 A;  2E42 A;  1R5L A;  5CBN A;  1P84 D;  3AE1 C;  3CCR P;  3AEC C;  3OAK A;  4K3A A;  4NPF X;  4W7Y A;  3EWK A;  2MKV A;  5GTH H;  1RHZ B;  3H1K D;  3H1I J;  1HBW A;  3HUS A;  2QA4 P;  5K5G B;  5KTB A;  1TU3 F;  3Q2Y A;  2P1J A;  4KT0 J;  1SFC C;  1PP9 E;  3IR9 A;  2H8P D;  1CZQ A;  3VTP C;  4IFD K;  1G1I A;  2YKP A;  3G3Z A;  3HD7 D;  1N73 A;  1GU5 A;  3BVH A;  1SQP E;  1SQQ E;  1YQ4 C;  4TLF A;  4D6T D;  2ZYD A;  2WTY A;  1HJ0 A;  3N7N A;  1L0N D;  3TNU B;  2WVR A;  2XNX A;  3MZW B;  3VP8 A;  3L73 D;  2IBZ G;  2M3E A;  1PFI A;  1WRG A;  4BRY B;  3MHV A;  2OTK E;  3V2P A;  2BCC G;  5CCG A;  5KLV E;  3CXH I;  1FDM A;  1D7M A;  3A5T A;  2V7Q J;  2P7J A;  5AVW B;  1VL2 A;  1VQL P;  1NU1 D;  2YO3 A;  2HG5 D;  4U3F D;  1NH4 A;  3USS A;  4DCK A;  1RF1 C;  1JCC A;  1L4A D;  3H1L G;  3CXH H;  1X9V A;  2KIK A;  2HOD A;  2Y0C A;  2YXQ B;  3CWB E;  1KIL B;  3PJS K;  2R3S A;  2WPV B;  5APQ A;  1L0L K;  3M91 A;  4BXL A;  2KI7 B;  3JCU E;  4RKU J;  1J1E C;  1PIX A;  3WUU A;  3VN0 A;  2NZ2 A;  1DIP A;  4H0L D;  2E74 B;  1DEE G;  4H44 B;  1AJY A;  2E76 D;  2Q7C A;  4HH2 A;  1PGO A;  1Q7Y Q;  4HKZ H;  3IAO A;  1SQX J;  2O1J A;  1EC5 A;  3OW2 O;  1NTK J;  1T6A A;  1H88 A;  2Y0E A;  1BE3 D;  1AQT A;  1NWQ A;  4LC1 A;  4GOD A;  3NTN A;  2C9N Y;  3L72 D;  1VF5 C;  4B86 A;  1GTW A;  2FYU J;  3TGU J;  3CME P;  1EZV I;  1BDC A;  1ZW0 A;  1W2E A;  1N73 C;  5AW5 B;  4ZKU A;  1VQO P;  1LTG C;  4GKG A;  1FZA A;  3F89 A;  3I55 P;  1VQ6 P;  5CCH D;  5B5E H;  1IFJ A;  3B8E B;  4L73 A;  1SQB J;  4DZO A;  5AVS B;  2PAJ A;  3L74 D;  1HVV A;  1YQ3 C;  2QG4 A;  1LGH B;  4L76 A;  1AA0 A;  3VP9 A;  2WSS H;  3RL0 g;  4OH8 B;  4YXW H;  1SQP J;  2B88 A;  4DJG A;  1SQQ J;  4D6T G;  1L0N G;  2IBZ E;  4BRY A;  5BU8 B;  2M5A B;  1IZN B;  2YIU C;  2B87 B;  4WY4 C;  2BCC E;  2KP8 A;  1PP9 D;  1JY2 N;  3E1R A;  1H89 A;  5KLV J;  1FZG A;  3JC2 2;  3TF5 A;  1W5C E;  1OFC X;  1UII A;  3M9B A;  3HE4 A;  1BCC D;  3ITK A;  1NYH A;  3H1L E;  2OTL P;  1NU1 G;  4PD4 E;  3AE7 C;  1CW5 A;  4U3F G; 
#chains in the Genus database with same CATH homology
 2H43 A;  1SFC B;  3R2P A;  4XA4 A;  2YO2 A;  3HUS B;  5AW1 B;  1JY3 O;  1A02 F;  2W6A A;  2BAS A;  1GK4 A;  1OWA A;  4Y99 B;  3MGN A;  1SQX K;  3L37 A;  1S9K E;  1SP4 A;  1G2C B;  2WT7 A;  2XZR A;  1KIL C;  1LWU A;  1SFC D;  2CPB A;  1NTK K;  1IK9 A;  2N1T B;  2N9B A;  3M06 A;  1L0N K;  1MFZ A;  1QL1 A;  1T3J A;  4I6M C;  1LWU C;  1FZB A;  4C7R A;  2N1T D;  3HE5 B;  4RES B;  1KFN A;  3N4X A;  1RE4 A;  2P67 A;  3RL0 C;  2M8R A;  3H32 B;  1NTM K;  3P32 A;  5CJ0 A;  1T2K D;  1JY3 P;  3M0D A;  2YKO A;  1RE4 C;  2FYU K;  2Q3I A;  2IFN A;  2JEE A;  4GT1 A;  3IFM A;  3VMY A;  4LLH A;  5AVU B;  1FZC B;  4C7N A;  2A45 G;  2N1T A;  4W80 A;  1YYC A;  1RE3 A;  3VMZ A;  3A3Y B;  4Y99 C;  2Q5U A;  3O8Z A;  2P2U A;  2HLO A;  3L4F A;  2I1J A;  1NU1 K;  2N1T C;  1WT6 A;  5CMZ A;  1Z56 A;  3H6P A;  4N6J A;  4EOT A;  1JTH B;  1ZV8 A;  1SQB K;  3MUD A;  1KQL A;  1RF1 B;  3RK2 B;  2KB7 P;  1FOS F;  1ZR4 A;  2C0X A;  3PP5 A;  2FYZ A;  1XTG B;  1GK6 A;  1MV8 A;  3LIE A;  1VPC A;  3RK2 D;  1MUU A;  5CCH C;  5KJ7 D;  1JUN A;  1S9K D;  1QL2 A;  3BRV B;  3V4Q A;  1EQ7 A;  1M1J A;  3V5B A;  3OA7 A;  2IFM A;  1NAF A;  4ZKP A;  1JTH A;  3HTK B;  1LTB C;  1M1J C;  3VYI A;  1N7S B;  2WWW A;  1N86 A;  4AYC A;  2ZXE B;  1RF1 A;  3NFQ A;  1L4A B;  5AW8 B;  1JY2 P;  1HTL C;  3U1C A;  1A02 J;  1LTS C;  3M0A A;  2R32 A;  1GL2 B;  4N78 E;  1IO4 A;  2O1K A;  3TYY A;  2FFD B;  1N7S D;  1XTC C;  5CJ4 A;  1ZN5 A;  3BAT A;  1URQ B;  5APT A;  1YTZ T;  1GL2 D;  1JCD A;  2OYI B;  3U59 A;  2J59 M;  3B5N B;  2OAR A;  1URQ D;  5BU5 A;  2NPS B;  1LT9 A;  3GHG A;  3KDP B;  3HTK A;  1HJB A;  3KPE A;  1N7S A;  3B5N D;  1J1D C;  2PP6 A;  1FZE A;  2YNY A;  1LT9 C;  3GHG C;  2NPS D;  3A2A A;  3C9I A;  3NXS A;  1JOC A;  3V4W A;  3RK3 B;  1GD2 E;  1GL2 A;  1HGV A;  1AFO A;  1KFM A;  2XU6 A;  2HPC B;  2FFD A;  2E42 A;  5AVY B;  5APV A;  1IC2 A;  1URQ A;  4WBA A;  2KYV A;  1ZR2 A;  2R5D A;  3RK3 D;  3M9H A;  3MIW A;  2OYI A;  3OAK A;  2FKW B;  1FOS E;  1N73 B;  3B5N A;  1LTI C;  1N7L A;  2NPS A;  1FBM A;  5AVT B;  4W7Y A;  2POH A;  2E43 A;  4AUW A;  3T97 A;  1SFC A;  2R3C A;  1HBW A;  3HUS A;  3MTU E;  2NPS C;  5KTB A;  3M0D C;  3I5C A;  2OYH B;  2P1J A;  1G2C A;  1SFC C;  3HD7 B;  1GDT A;  3HUS C;  2I1K A;  3IR9 A;  1LTJ B;  2WZ7 A;  2H8P D;  1CZQ A;  3KQG A;  3VTP C;  2WIT A;  4IFD K;  1E5W A;  5AW2 B;  1G1I A;  3G3Z A;  2YKP A;  1JMM A;  2J58 A;  5AW7 B;  3V2R A;  2A45 I;  3HD7 D;  1JY3 N;  2HFE D;  3HE5 A;  1RE3 C;  4N78 D;  1RF0 A;  2M3B A;  4JYC A;  1IFD A;  1N73 A;  3UIA A;  1GU5 A;  3BVH A;  3H32 A;  4C46 A;  1T2K C;  5APY A;  3CI9 A;  1FJK A;  3P7K A;  5CCG D;  2WTY A;  2ZFC A;  2WPR A;  1T8Z A;  2C9L Y;  1GW4 A;  3N7N A;  2W27 A;  3HRN A;  1FAV A;  3TNU B;  1M7L A;  1VDF A;  2XNX A;  3P8C E;  2XDJ A;  2WPS A;  3BRT B;  3L36 A;  3VOP A;  1FZC A;  4WY4 B;  3VP8 A;  5AW0 B;  3TK1 A;  2A45 H;  1PFI A;  1WRG A;  1JY2 O;  2GUS A;  1SQP K;  3V2P A;  1FZC C;  1SQQ K;  2HOD B;  4WY4 D;  1SQV K;  5CCG A;  1CI6 B;  3SWY A;  1FDM A;  1J1E B;  3A5T A;  2MJZ A;  5CCG C;  3TSI A;  4KHX A;  1JO5 A;  2C0W A;  2P7J A;  1HH0 A;  3TNU A;  2Z5I A;  5AVW B;  2WSC H;  2YO3 A;  1YTZ I;  3U1A A;  2Z4E A;  1GZL A;  5KJ7 A;  1AQ5 A;  2HG5 D;  1IFN A;  1NH4 A;  2JJL A;  4JYB A;  1RF1 C;  5KLV K;  3RK2 C;  1JCC A;  1L4A D;  4WB4 A;  1X9V A;  5KJ7 C;  2HOD A;  3NMD A;  1JNM A;  2WPQ A;  1KIL B;  1H8A A;  4LGD E;  5APQ A;  1L0L K;  4M3L A;  1SVF A;  2FXM A;  3M91 A;  2WT7 B;  1LWU B;  1KIL D;  2GM4 A;  5AVQ B;  1L4A A;  1J1E C;  3M9Q A;  3E1I A;  3RL0 B;  2IPP A;  1NHL A;  3VN0 A;  3V2N A;  1N7S C;  1DX7 A;  1L4A C;  1NO4 A;  5AW6 B;  4HYT B;  5CHX A;  2Q7C A;  3RL0 D;  3P8C D;  4HH2 A;  2W6B A;  1G1J A;  1GL2 C;  2FFD C;  2XKM A;  1DH3 A;  1KIL A;  2IX7 C;  1KZU B;  1URQ C;  2O1J A;  1FJP A;  2OYI C;  1H88 A;  3CLQ A;  1NTZ K;  4C7N B;  3B5N C;  4I2L C;  1HUC A;  2KOG A;  1NWQ A;  1CSB A;  2WSE H;  3EQ2 A;  1SLQ A;  4LC1 A;  4GIF A;  1GW3 A;  2YKQ A;  2HPC A;  4I1L A;  5APW A;  5APS A;  3NTN A;  2C9N Y;  3V2Q A;  3A7O A;  3RK3 C;  4B86 A;  1GTW A;  2H7H A;  3SWF A;  1IFI A;  1X79 B;  4XE5 B;  4O9B A;  5BVZ A;  2KLV A;  2XV5 A;  1NKZ B;  2GUV A;  1N2D C;  3L35 A;  3BAS A;  3OJA B;  1W2E A;  1RF0 C;  5AW4 B;  1N73 C;  1RY3 A;  5AW5 B;  4ZKU A;  1NKN A;  5AVX B;  1LTG C;  2OYH A;  2Z5H A;  4GKG A;  1FZA A;  1IJD B;  5CCH D;  3HD7 A;  5APX A;  2O01 H;  1LTJ A;  1IFJ A;  3WMM 0;  1ZLL A;  4JF7 A;  1M1J B;  4IFM A;  2OYH C;  4DOJ A;  3B8E B;  5APU A;  3HD7 C;  4DZO A;  1NOH A;  5AVS B;  4EIJ A;  5AW9 B;  2PAJ A;  1LTJ C;  1HVV A;  1IFM A;  1X8Y A;  1LGH B;  2KSJ A;  3VP9 A;  3P8M C;  1HWT C;  1DEB A;  4OH8 B;  1FU1 A;  3EFG A;  5CCH A;  1LTT C;  1LTA C;  2QM7 A;  1FZF A;  4W7Z A;  5AVV B;  3HE4 B;  4WY4 A;  3LW5 H;  1OXZ A;  3VMX A;  5BU8 B;  1HGZ A;  1J1D B;  2YMY A;  1LT9 B;  3GHG B;  5AW3 B;  4WY4 C;  2KP8 A;  2HYN A;  1CI6 A;  1GU4 A;  2QM8 A;  3CL3 D;  3KYQ A;  3LID A;  1JY2 N;  4IFF A;  1H89 A;  1FZG A;  2CPS A;  1T3U A;  1MZ9 A;  1J2J B;  2LKM A;  2VRS A;  2L5G B;  3M9B A;  4AQR D;  3HE4 A;  3MD0 A;  5AVZ B;  4N3Y B;  3II6 A;  2WSF H;  2Q9I A;  5AVR B;  1CW5 A;  2R5B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...