1BE3J

Cytochrome bc1 complex from bovine
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
62
structure length
62
Chain Sequence
VAPTLTARLYSLLFRRTSTFALTIVVGALFFERAFDQGADAIYEHINEGKLWKHIKHKYENK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Electron transport
molecule keywords CYTOCHROME BC1 COMPLEX
publication title Complete structure of the 11-subunit bovine mitochondrial cytochrome bc1 complex.
pubmed doi rcsb
total genus 22
structure length 62
sequence length 62
ec nomenclature
pdb deposition date 1998-05-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF05365 UCR_UQCRX_QCR9 Ubiquinol-cytochrome C reductase, UQCRX/QCR9 like
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.260 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 9 1be3J00
3H1IJ 4PD4I 1SQPJ 3L72J 1SQBJ 4U3FJ 1PP9J 1NTMJ 3CWBJ 3H1LJ 1BCCJ 1SQQJ 3H1HJ 3L71J 1KYOI 3CXHI 1NTKJ 1EZVI 1L0LJ 1L0NJ 1BE3J 3H1JJ 3TGUJ 1SQVJ 1SQXJ 3CX5I 3L75J 3BCCJ 3H1KJ 3L70J 1BGYJ 1NU1J 3L73J 2BCCJ 4D6TJ 1P84I 1NTZJ 2FYUJ 3L74J 1KB9I 2IBZI 5KLVJ
chains in the Genus database with same CATH superfamily
3AE8C 1VF5D 1J1EC 2QJPC 1VDFA 1Y8AA 2RN0A 3TF5A 1U57A 3CCUP 1NH4A 1OZHA 3CC7P 1FDMA 3P7KA 3L70E 1YITP 1BCCG 1BE3D 1MFZA 3PH0A 4H0LD 4IOIH 4KJMA 3SWYA 1Q2NA 5KLIC 3H32A 5CHXA 1M1JC 2OTKE 4YTPC 3L71D 2ZYGA 2R3SA 1NTZE 2JWAA 1LT1A 2JDIH 5H2FE 1YTZT 3H32B 1FC2C 3D71A 2O01J 1N73A 1Q81Q 4N78E 2W8ZA 3CCSP 3WUUA 5CBOA 2Q3IA 2V7QJ 3RBXA 2YKPA 2K37A 1NU1J 3FXEA 2O3JA 3D6ZA 1YI2P 1N73B 3EFFK 1Q7YQ 1SQBE 2OQQA 5CCGC 3CWBE 3M06A 1KQGB 3CXHE 3EWKA 4W7ZA 3GMAA 3Q5RA 2R3CA 3N7NA 1RHZB 2RKLA 2N1TC 1N7SA 1GL2A 5APYA 3Q2YA 3SWFA 1M90Q 5AW4B 2FXPA 2CK3H 4U3FE 5APUA 2IFMA 1N7SB 1GL2B 1SQXE 2RMZA 3QH9A 1LTSC 1USEA 3PJSK 1GZLA 1SQQG 1RQUA 2A45G 3KQGA 3H1JD 1AA0A 2V4HA 1E79H 3L71E 1X9VA 1FAVA 1SQVJ 5KLVK 1X22A 5AVVB 1YJ9P 3C8VA 1L0NK 1OFCX 1GTWA 1QVGO 2YMKA 2SPZA 3P32A 1LNQA 3MZWB 1AQTA 1EDLA 3A0HE 1N73C 1JNMA 1JUNA 3H1HD 1EXIA 4DCKA 3FX0A 4UB6H 3AE3C 1GK6A 1M7LA 3SWKA 5AW2B 1VQ4P 3H1ID 2WZ7A 2XNXA 1NTMD 2E5TA 3USSA 3AEFC 1VQ8P 4H44B 1P84I 5AW3B 2KIKA 2WSSH 1N7SC 2CPBA 3HTKA 2QJKB 1GL2C 1BE3G 3VN0A 1QVFO 2WITA 2XU6A 1TU3F 1VPCA 3TGUE 2O1KA 3L73J 3ZDMA 3HTKB 3GHGC 1M1KQ 3T97A 1S5LX 1K04A 3D6YA 1PP9E 2Y0EA 2ZXXA 4RKUJ 3KDPB 3JCUE 1NTKJ 1YJWP 3T97B 5KAIH 1SQPJ 1N2DC 3TK1A 1RQVA 3M9BA 2IDBA 2JKVA 3H1HE 3L72D 1JOCA 1HGVA 5K5GB 2WSCJ 3B71A 3SSUA 3BCCJ 2BEQD 2D2CB 3V4WA 2W27A 4JQ0D 1L0LK 3CCLP 1YIJP 1SQVG 5AVUB 2K9JA 4H44C 1NTZK 1KC8Q 4W80A 1X8YA 2QJKC 2K3RA 2FYUJ 1JCCA 4UB6E 3CI9A 3L72J 1W2BO 1QEXA 3CMEP 2K9JB 3H1JG 3MUDA 3CCMP 4PV1D 2P58A 5E79H 3A0BH 1RE4A 3OA7A 1L4AD 2WSFH 5KLVD 2IPPA 2H88C 3HD7D 3CLQA 1YBKA 1PGPA 2HODA 3MIWA 4JBZA 3AE2C 4K3AA 3KZIH 1L0ND 4QMAA 2E76D 1S9KD 1JY2P 1ZRTE 1SQXK 3PLNA 4M3LA 4EYYQ 2NPSD 2D2CC 1MZ9A 3L73G 2HODB 1LTGC 4WB4A 2HPCA 1NHLA 4Y99C 4EIJA 1NTMG 1AJYA 3AEEC 4DOJA 2BASA 1NTKG 2J59M 3WU2E 1DEBA 4EI2A 3AE7C 4IL6X 5GTHH 1NU1K 2HPCB 1FZFA 1WMKA 3WUVA 2IBZG 5CCHA 4AUWA 1SQPG 3H1KE 2HLOA 2A06G 2YO2A 3HUSC 3RK3D 1ZP0C 1BCCJ 1U7JA 2K88A 3S4RA 2PGDA 1YQ4C 3MGNA 2WMMA 1PFIA 3L75J 1ZOYC 1GD2E 3A3YB 3MUDC 1MFTA 3M9HA 3VMXA 1NGMB 4NPEA 2HFED 1J2JB 5KLVE 1HTLC 4WY4D 1JY2O 2KZIA 1RE4C 3GG2A 2LXCB 2FYUG 3CC4P 1XTGB 1WRGA 4I1LA 3L72G 1S9KE 3A0BE 1VQMP 1J1EB 5AW1B 3CPWO 1LT9A 1EZVG 2WSEJ 1VQPP 3L70D 1PV3A 2QVAA 1M1JA 3PRJA 1Q90D 2I1KA 1YQ3C 2W6JH 3TDKA 2E74B 1LT9B 5KLIB 3KZIE 1FZCA 1L0LD 3ITKA 4EOTA 2LKMA 1M1JB 1FZBA 1SFCA 1NTZD 2Q7CA 1OIPA 1FU1A 5AW5B 1S3JA 3B4SA 4BXLA 3NXSA 1FZCB 3IAOA 4N78D 5CMZA 5AW0B 2R44A 1SFCB 2KZJA 1DH3A 2ZAEB 5GTHE 2H7HA 5TISH 2N1TA 2UWJE 1LJ2A 1VQNP 1NOHA 1OXZA 1T2KD 3N4XA 1OW8A 4AYCA 1BGYE 4D6TE 3CCVP 2IYPA 1N7LA 1DEEG 1URQA 4ZKUA 1L0NG 2N1TB 2ZJSE 3A5TA 3M0DA 1RE3A 1FBMA 4AQRD 4XE5B 2O01H 5CCGD 1BDDA 1ZR2A 4U3FD 2GA1A 1IC2A 1URQB 2N1TD 1GK4A 1AVOA 2V7QH 5APSA 5KAFH 2QA4P 5DJUB 2M3BA 1PGQA 1SQXD 1SQBJ 4WBAA 2E74C 2PP6A 3CWBJ 3L75G 1LT9C 1R5LA 1AVYA 1KN7A 4BRYA 4Z1MH 3MTUE 1L0LE 4HH2A 1PPJG 1OW7A 1N8RQ 1JEKA 3U1CA 3V2PA 4OGQB 1QL2A 1AV1A 4U3FJ 4JF7A 3HE5A 1FZCC 4BRYB 1JY2N 2GM4A 3IR9A 3L74D 1IFNA 3P8MC 1SFCC 1LTBC 1BE3J 4DZOA 1NAYA 3F5HA 3CX5H 2M0BA 1L2PA 1SP4A 1W2EA 2MKVA 1ZW0A 3AE1C 3HE5B 3U59A 1KB9H 1S72P 2AXCA 2OYOA 2YIUC 3L71J 1KD1Q 4OWFA 1KQFB 1VQ5P 3TSIA 1S1CX 1BSNA 4TT3H 2OYHC 3CC2P 3BASA 4N6JA 2W90A 2AXTH 1P84E 3A2AA 1GW4A 1USDA 3MD0A 3L70G 1URQC 5BU8B 4IFMA 1UIIA 3GHGA 1OW6A 3M0DC 5KKZC 1DX7A 1RE3C 1PIXA 4OVNF 2ZYDA 1FOSF 3I56P 3BRVB 3TGUD 1N7SD 3VYIA 2QG4A 1GL2D 4XA4A 3GHGB 1EXJA 1S2EA 2JO1A 3EFGA 4OGQC 1PP9D 1SS1A 1NKZB 5L8RJ 2C0WA 2ZT9B 3L4FA 1NU1E 1IK9A 2OARA 3SFEC 3L74E 3OW2O 1T8ZA 1CI6A 2K1AA 1ZV8A 1ZLLA 2YXRB 4CPGA 3VMAA 3H1JJ 3SFDC 1Q86Q 2WPQA 1HVVA 1SQBG 3CWBG 1CI6B 1GU4A 2H43A 3G71P 1H88A 3GF3A 2LR2A 2YKOA 2BCCD 2POHA 2E42A 5AVXB 2B87A 4YXDC 2CPSA 2R32A 2HYNA 3VOPA 2AEMA 4U3FG 1KB9E 5EFWB 1NVOA 1VL2A 4IFDK 4PD4H 1SQXG 1PGOA 3A7OA 3KPEA 2N9YB 3H1HJ 2B87B 3E7KA 4EDFA 4WWIA 3S1KA 4H44D 1KTMA 3AEAC 1QL1A 2WSCH 2KS1A 1MUUA 3WMM0 3GLMA 3H1IJ 3L71G 3RL0g 4PJ0H 2XZRA 1X79B 1NTMJ 4XFJA 2PFXA 4BWNA 2FXMA 1ZMEC 2ZT9C 4NPFX 3H25A 1ZR4A 3CMAP 3AE5C 1KORA 1KYOH 5CBNA 2KS1B 2GUSA 3H1LD 1FDIA 3NFQA 5M1BA 2O1JA 1RF0C 3BVHA 2E43A 1U7MA 3B8EB 2WTYA 1OVRA 1M56D 2GUVA 3V2RA 4L76A 2J5UA 4NPDA 2ZYAA 2E5YA 1ZRTD 1LGHB 3LW5J 1YJNP 1DD3A 3I55P 4L73A 2BCCE 1IFIA 2Y0DA 3IN6A 3P8CE 4IL6H 4JYCA 4Y99B 3F89A 5AW9B 5KJ7A 5BVZA 3EQ2A 5GTIH 1NAFA 3CX5I 2D2CD 3HUSA 3FWNA 3ABVC 1KB9I 1SQQK 2KXPB 3H1KD 1OVUA 3TGUG 2ZXEB 1K9MQ 3HUSB 1LTIC 2H8PD 2KNCA 2KSJA 2R5DA 1H0TA 1JMBA 2FXOA 2KYVA 4H13B 2BEZF 3BRTB 2DW3A 4PD4E 4L75A 1KZUB 3H1LE 2KNCB 2QM7A 3Q3DA 4W7YA 2XKMA 1H0TB 1JMMA 2M3EA 1VQ7P 2P1JA 3BCCE 3AE4C 2G8YA 4PJ0E 1HUCA 3H1HG 3MP7B 3PTZA 3B5NA 1HWTC 1OMIA 3FWLA 1KILC 2FBWC 2J58A 3AE9C 1FZAA 2FYNB 1N86A 2PAJA 5C39A 3TYYA 4ZKPA 3H1IG 3V6IA 2M8RA 5KAIE 4GOEA 3B5NB 2FYUE 5KLVJ 2Z5IA 1AQ5A 2L91A 5AVTB 4LGDE 5B66H 1BDCA 1T6AA 2H89C 2I8DA 1L0NJ 1PZQA 1GU5A 1FE6A 5KJ7C 1G2CA 3K5BA 3JSVC 3TNUA 3RL0B 2WSEH 4H13C 3RK2C 2IZ1A 5APVA 3PHLA 1G2CB 3TNUB 3V4QA 1DD4A 1SVFA 3VTPC 2IBZI 5CJ4A 1DIPA 3Q5SA 4PD4I 1JM0A 2YKQA 3NMDA 5CCHD 1BGYD 4C7NA 4D6TD 1EDKA 3NTNA 1LWUC 4ZMDA 1HJ0A 1VQ6P 3IF4A 2W83C 3KHUA 5DJTB 5APTA 2JP3A 1IK7A 2E75B 1HGZA 5E79E 2P7JA 4HYTB 4L74A 2E76C 4C7NB 2AEFA 2FYNC 5BU5A 1T3UA 4ASWA 1SQVK 1QGKB 5AW6B 1KYOI 1EDIA 3FXDA 3B5NC 1IJDB 2A45H 3OJAB 4ASVA 2P67A 2XNDH 1FZGA 1K8AQ 3V2QA 1XTCC 1FZEA 5CJ0A 2WPVB 1OVVA 5APXA 2IX7C 2YO3A 2QM8A 3H1KG 3LIDA 1BCCE 2E74D 1EZVI 1EQ7A 4C7RA 4I7ZC 5AW8B 3CCQP 1Q82Q 3L75E 2KK7A 3L70J 3RL0C 1SQQD 2IZ0A 2XDJA 4DJGA 1JTHA 3V5BA 1IFDA 2B88A 2C0XA 4GODA 1VQLP 5B66E 1R5SA 3V2NA 3OAKA 3RGUA 2I1JA 3M9QA 1QX8A 2OYHA 3CL3D 1L0LJ 3CCRP 1H8AA 3CXHH 1VQOP 1RH5B 5KLVG 1SFCD 2YIUB 1JTHB 3UIAA 1NTZJ 2NZ2A 3D70A 2OTJP 2Z4EA 1BSHA 2OYHB 3QWOC 1P84D 2E75C 3L35A 1LP1A 1VF5B 1WT6A 4LLHA 1K05A 4RESB 2OGUA 2P10A 1Y47A 3PP5A 5AW7B 1NTKK 1LP1B 4KT0J 5KKZB 5AVSB 4R4LA 4H0LB 3AE6C 5APWA 2W6BA 1URQD 4UB8H 4YPCA 1LTJA 1SQPK 1IO4A 1IZNB 1YYCA 5TJHA 2WWWA 1KMIZ 4C46A 4I2LC 2KSEA 2KB7P 1NU1D 2JJLA 2NRGA 1LTJB 1SQQE 2OYIA 2L5GB 5AVWB 1SQXJ 3A0HH 1YHQP 2AEJA 4OGQD 3KXDA 1KFNA 1OX3A 2QE7H 2OYIB 1PL5A 2Q6QA 1BGYG 4D6TG 2WVRA 1KQSO 2FYUK 1T2KC 1AFOA 4JYBA 1JB0J 3L36A 3AEBC 3I5CA 3S9OA 3L74J 2HG5D 3CX5D 1VF5C 2ZFCA 1PGJA 4RO0A 3R2PA 4IFFA 1ZXGA 5TISE 1IFMA 3Q1MA 1MKMA 1KB9D 1T3JA 2IYOA 3G4SP 3VP8A 5AVYB 3Q5PA 4ZNCA 4H0LC 1SQVD 5B5EH 1S5LH 1L0LG 1FDOA 3CCJP 2ZVOB 4GT1A 3JCUH 1JY3N 1NTZG 3AEGC 2Y0CA 1BE3E 4O9BA 5KTBA 1RF0A 5KAFE 3AECC 1LTJC 2JWDA 2IFNA 1S4XA 4JPZB 4YXWH 1HF9A 2Q3EA 2A45I 4UB8E 2ZT9D 2ZVNB 3TGUJ 1Y9BA 2WT7A 2OYIC 1J1DB 2K9YA 1NKNA 2R5BA 1FJKA 3O8ZA 1PP9J 2WT7B 3P8CD 2C9NY 3CX5E 4TLFA 3VP9A 3G3ZA 2G3AA 3R4YA 3W67A 3L73D 1K73Q 3CXHI 2QIWA 2Q5UA 4HKZH 2OTLP 2WQYC 1UIXA 1FOSE 1SQVE 2BCCJ 3LW5H 2AXTE 1D7MA 1M8OB 1NTKD 1Z56A 2FYZA 2HR3A 1CZQA 1M57D 1NU1G 2IBZD 1HBWA 4PD4D 1EC5A 2QRXA 1SQPD 3L74G 2Z5HA 2A06D 3H1JE 2N9BA 1IFJA 1HJBA 3HE4A 1OWAA 2XV5A 1GW3A 4KHXA 5B5EE 1KILA 1S5LE 3VMYA 2FFDA 3BCCD 3H6PA 2FY8A 2YXQB 1VQ9P 1J1DC 2M5AA 3HE4B 1KILB 2KP8A 1KYOD 3W68A 2FFDB 3FGAD 1GMJA 3WU2H 2Q1KA 3H1LJ 2FYUD 4GKGA 1NO4A 2M5AB 1KILD 1ZN5A 1RF1A 1A02F 2WPSA 3WUTA 1YTZI 3E1IA 1EZVD 1FS0E 3L73E 1MV8A 1H89A 2PRRA 3H1IE 4GOFA 1LTTC 1NTME 1RF1B 1A02J 4K35A 4MN4C 1NTKE 3U1AA 2FKWB 1SLQA 4PV1B 2B9BA 1L4AA 1PP9G 3M0AA 3RK2B 1G1JA 5KJ7D 2VRSA 3HD7A 2IBZE 1LWUA 3M91A 1SQPE 2KUBA 2A06E 1CW5A 4H13D 2JEEA 1L4AB 3RK2D 5AVRB 1JCDA 3H1KJ 1W5CE 2KOGA 1SQBK 3HD7B 1LWUB 2NPSA 2P2UA 4U7JA 2E76B 1KYOE 2BCCG 2FFDC 2NPSB 1KV4A 5AVZB 3HRNA 3G6EP 2ITAA 3CCEP 1LTAC 1KILE 2RH0A 3L72E 4A7PA 2LXBA 3VMZA 4OH8B 1EZVE 3B5ND 4B86A 1BCCD 1NJIQ 4RJTA 1RF1C 4I6MC 3GW6A 4WVZA 4I7ZB 3L75D 4GDOA 3E1RA 4IL6E 2WSFJ 4PV1C 2Y9ZA 3RK3B 4Y28J 1PPJD 4HJGH 5GTIE 1NYHA 5AVQB 3LIEA 1CSBA 5APQA 4WY4A 4LC1A 3RL0D 3JC22 3H1LG 2JR8A 2QSIA 3IFMA 1X0TA 1L4AC 2YNYA 3BCCG 2KLUA 3HD7C 1JY3P 1G1IA 4WY4B 1QLED 4R4MA 1NWQA 1R8EA 4N3YB 1JO5A 2NPSC 2QJYB 2E75D 4GIFA 2YMYA 3C1LA 1L0NE 4DT0A 1BGYJ 1IFPA 4D6TJ 1KQLA 1FJPA 2QJPB 3C9IA 3RBZA 5H2FH 2W6AA 1KFMA 1HH0A 2QEXP 3O6QA 1RY3A 1E5WA 1EDJA 3RK3C 2KLVA 1PPJE 3GF7A 2WPRA 2B89A 3O6QB 1GDTA 3CD6P 1JY3O 3RK3E 2C9LY 3AEDC 3KYQA 5CCHC 1VQKP 5CCGA 1P84H 2MJZA 2KI7B 3G9RA 4WY4C 1SQQJ 3II6A 2Q9IA 2O01N 4HB1A 1SQBD 3CWBD 3BATA 1NTMK 3CXHD 3L37A 3MHVA 2Y9YA 2QJYC
chains in the Genus database with same CATH topology
3H1IJ 4PD4I 1SQPJ 3L72J 1SQBJ 4U3FJ 1PP9J 1NTMJ 3CWBJ 3H1LJ 1BCCJ 1SQQJ 3H1HJ 3L71J 1KYOI 3CXHI 1NTKJ 1EZVI 1L0LJ 1L0NJ 1BE3J 3H1JJ 3TGUJ 1SQVJ 1SQXJ 3CX5I 3L75J 3BCCJ 3H1KJ 3L70J 1BGYJ 1NU1J 3L73J 2BCCJ 4D6TJ 1P84I 1NTZJ 2FYUJ 3L74J 1KB9I 2IBZI 5KLVJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1I J;  4PD4 I;  1SQP J;  3L72 J;  1SQB J;  4U3F J;  1PP9 J;  1NTM J;  3CWB J;  3H1L J;  1BCC J;  1SQQ J;  3H1H J;  3L71 J;  1KYO I;  3CXH I;  1NTK J;  1EZV I;  1L0L J;  1L0N J;  1BE3 J;  3H1J J;  3TGU J;  1SQV J;  1SQX J;  3CX5 I;  3L75 J;  3BCC J;  3H1K J;  3L70 J;  1BGY J;  1NU1 J;  3L73 J;  2BCC J;  4D6T J;  1P84 I;  1NTZ J;  2FYU J;  3L74 J;  1KB9 I;  2IBZ I;  5KLV J; 
#chains in the Genus database with same CATH topology
 3AE8 C;  1VF5 D;  1J1E C;  2QJP C;  1VDF A;  1Y8A A;  2RN0 A;  3TF5 A;  1U57 A;  3CCU P;  1NH4 A;  1OZH A;  3CC7 P;  1FDM A;  3P7K A;  3L70 E;  1YIT P;  1BCC G;  1BE3 D;  1MFZ A;  3PH0 A;  4H0L D;  4IOI H;  4KJM A;  3SWY A;  1Q2N A;  5KLI C;  3H32 A;  5CHX A;  1M1J C;  2OTK E;  4YTP C;  3L71 D;  2ZYG A;  2R3S A;  1NTZ E;  2JWA A;  1LT1 A;  2JDI H;  5H2F E;  1YTZ T;  3H32 B;  1FC2 C;  3D71 A;  2O01 J;  1N73 A;  1Q81 Q;  4N78 E;  2W8Z A;  3CCS P;  3WUU A;  5CBO A;  2Q3I A;  2V7Q J;  3RBX A;  2YKP A;  2K37 A;  1NU1 J;  3FXE A;  2O3J A;  3D6Z A;  1YI2 P;  1N73 B;  3EFF K;  1Q7Y Q;  1SQB E;  2OQQ A;  5CCG C;  3CWB E;  3M06 A;  1KQG B;  3CXH E;  3EWK A;  4W7Z A;  3GMA A;  3Q5R A;  2R3C A;  3N7N A;  1RHZ B;  2RKL A;  2N1T C;  1N7S A;  1GL2 A;  5APY A;  3Q2Y A;  3SWF A;  1M90 Q;  5AW4 B;  2FXP A;  2CK3 H;  4U3F E;  5APU A;  2IFM A;  1N7S B;  1GL2 B;  1SQX E;  2RMZ A;  3QH9 A;  1LTS C;  1USE A;  3PJS K;  1GZL A;  1SQQ G;  1RQU A;  2A45 G;  3KQG A;  3H1J D;  1AA0 A;  2V4H A;  1E79 H;  3L71 E;  1X9V A;  1FAV A;  1SQV J;  5KLV K;  1X22 A;  5AVV B;  1YJ9 P;  3C8V A;  1L0N K;  1OFC X;  1GTW A;  1QVG O;  2YMK A;  2SPZ A;  3P32 A;  1LNQ A;  3MZW B;  1AQT A;  1EDL A;  3A0H E;  1N73 C;  1JNM A;  1JUN A;  3H1H D;  1EXI A;  4DCK A;  3FX0 A;  4UB6 H;  3AE3 C;  1GK6 A;  1M7L A;  3SWK A;  5AW2 B;  1VQ4 P;  3H1I D;  2WZ7 A;  2XNX A;  1NTM D;  2E5T A;  3USS A;  3AEF C;  1VQ8 P;  4H44 B;  1P84 I;  5AW3 B;  2KIK A;  2WSS H;  1N7S C;  2CPB A;  3HTK A;  2QJK B;  1GL2 C;  1BE3 G;  3VN0 A;  1QVF O;  2WIT A;  2XU6 A;  1TU3 F;  1VPC A;  3TGU E;  2O1K A;  3L73 J;  3ZDM A;  3HTK B;  3GHG C;  1M1K Q;  3T97 A;  1S5L X;  1K04 A;  3D6Y A;  1PP9 E;  2Y0E A;  2ZXX A;  4RKU J;  3KDP B;  3JCU E;  1NTK J;  1YJW P;  3T97 B;  5KAI H;  1SQP J;  1N2D C;  3TK1 A;  1RQV A;  3M9B A;  2IDB A;  2JKV A;  3H1H E;  3L72 D;  1JOC A;  1HGV A;  5K5G B;  2WSC J;  3B71 A;  3SSU A;  3BCC J;  2BEQ D;  2D2C B;  3V4W A;  2W27 A;  4JQ0 D;  1L0L K;  3CCL P;  1YIJ P;  1SQV G;  5AVU B;  2K9J A;  4H44 C;  1NTZ K;  1KC8 Q;  4W80 A;  1X8Y A;  2QJK C;  2K3R A;  2FYU J;  1JCC A;  4UB6 E;  3CI9 A;  3L72 J;  1W2B O;  1QEX A;  3CME P;  2K9J B;  3H1J G;  3MUD A;  3CCM P;  4PV1 D;  2P58 A;  5E79 H;  3A0B H;  1RE4 A;  3OA7 A;  1L4A D;  2WSF H;  5KLV D;  2IPP A;  2H88 C;  3HD7 D;  3CLQ A;  1YBK A;  1PGP A;  2HOD A;  3MIW A;  4JBZ A;  3AE2 C;  4K3A A;  3KZI H;  1L0N D;  4QMA A;  2E76 D;  1S9K D;  1JY2 P;  1ZRT E;  1SQX K;  3PLN A;  4M3L A;  4EYY Q;  2NPS D;  2D2C C;  1MZ9 A;  3L73 G;  2HOD B;  1LTG C;  4WB4 A;  2HPC A;  1NHL A;  4Y99 C;  4EIJ A;  1NTM G;  1AJY A;  3AEE C;  4DOJ A;  2BAS A;  1NTK G;  2J59 M;  3WU2 E;  1DEB A;  4EI2 A;  3AE7 C;  4IL6 X;  5GTH H;  1NU1 K;  2HPC B;  1FZF A;  1WMK A;  3WUV A;  2IBZ G;  5CCH A;  4AUW A;  1SQP G;  3H1K E;  2HLO A;  2A06 G;  2YO2 A;  3HUS C;  3RK3 D;  1ZP0 C;  1BCC J;  1U7J A;  2K88 A;  3S4R A;  2PGD A;  1YQ4 C;  3MGN A;  2WMM A;  1PFI A;  3L75 J;  1ZOY C;  1GD2 E;  3A3Y B;  3MUD C;  1MFT A;  3M9H A;  3VMX A;  1NGM B;  4NPE A;  2HFE D;  1J2J B;  5KLV E;  1HTL C;  4WY4 D;  1JY2 O;  2KZI A;  1RE4 C;  3GG2 A;  2LXC B;  2FYU G;  3CC4 P;  1XTG B;  1WRG A;  4I1L A;  3L72 G;  1S9K E;  3A0B E;  1VQM P;  1J1E B;  5AW1 B;  3CPW O;  1LT9 A;  1EZV G;  2WSE J;  1VQP P;  3L70 D;  1PV3 A;  2QVA A;  1M1J A;  3PRJ A;  1Q90 D;  2I1K A;  1YQ3 C;  2W6J H;  3TDK A;  2E74 B;  1LT9 B;  5KLI B;  3KZI E;  1FZC A;  1L0L D;  3ITK A;  4EOT A;  2LKM A;  1M1J B;  1FZB A;  1SFC A;  1NTZ D;  2Q7C A;  1OIP A;  1FU1 A;  5AW5 B;  1S3J A;  3B4S A;  4BXL A;  3NXS A;  1FZC B;  3IAO A;  4N78 D;  5CMZ A;  5AW0 B;  2R44 A;  1SFC B;  2KZJ A;  1DH3 A;  2ZAE B;  5GTH E;  2H7H A;  5TIS H;  2N1T A;  2UWJ E;  1LJ2 A;  1VQN P;  1NOH A;  1OXZ A;  1T2K D;  3N4X A;  1OW8 A;  4AYC A;  1BGY E;  4D6T E;  3CCV P;  2IYP A;  1N7L A;  1DEE G;  1URQ A;  4ZKU A;  1L0N G;  2N1T B;  2ZJS E;  3A5T A;  3M0D A;  1RE3 A;  1FBM A;  4AQR D;  4XE5 B;  2O01 H;  5CCG D;  1BDD A;  1ZR2 A;  4U3F D;  2GA1 A;  1IC2 A;  1URQ B;  2N1T D;  1GK4 A;  1AVO A;  2V7Q H;  5APS A;  5KAF H;  2QA4 P;  5DJU B;  2M3B A;  1PGQ A;  1SQX D;  1SQB J;  4WBA A;  2E74 C;  2PP6 A;  3CWB J;  3L75 G;  1LT9 C;  1R5L A;  1AVY A;  1KN7 A;  4BRY A;  4Z1M H;  3MTU E;  1L0L E;  4HH2 A;  1PPJ G;  1OW7 A;  1N8R Q;  1JEK A;  3U1C A;  3V2P A;  4OGQ B;  1QL2 A;  1AV1 A;  4U3F J;  4JF7 A;  3HE5 A;  1FZC C;  4BRY B;  1JY2 N;  2GM4 A;  3IR9 A;  3L74 D;  1IFN A;  3P8M C;  1SFC C;  1LTB C;  1BE3 J;  4DZO A;  1NAY A;  3F5H A;  3CX5 H;  2M0B A;  1L2P A;  1SP4 A;  1W2E A;  2MKV A;  1ZW0 A;  3AE1 C;  3HE5 B;  3U59 A;  1KB9 H;  1S72 P;  2AXC A;  2OYO A;  2YIU C;  3L71 J;  1KD1 Q;  4OWF A;  1KQF B;  1VQ5 P;  3TSI A;  1S1C X;  1BSN A;  4TT3 H;  2OYH C;  3CC2 P;  3BAS A;  4N6J A;  2W90 A;  2AXT H;  1P84 E;  3A2A A;  1GW4 A;  1USD A;  3MD0 A;  3L70 G;  1URQ C;  5BU8 B;  4IFM A;  1UII A;  3GHG A;  1OW6 A;  3M0D C;  5KKZ C;  1DX7 A;  1RE3 C;  1PIX A;  4OVN F;  2ZYD A;  1FOS F;  3I56 P;  3BRV B;  3TGU D;  1N7S D;  3VYI A;  2QG4 A;  1GL2 D;  4XA4 A;  3GHG B;  1EXJ A;  1S2E A;  2JO1 A;  3EFG A;  4OGQ C;  1PP9 D;  1SS1 A;  1NKZ B;  5L8R J;  2C0W A;  2ZT9 B;  3L4F A;  1NU1 E;  1IK9 A;  2OAR A;  3SFE C;  3L74 E;  3OW2 O;  1T8Z A;  1CI6 A;  2K1A A;  1ZV8 A;  1ZLL A;  2YXR B;  4CPG A;  3VMA A;  3H1J J;  3SFD C;  1Q86 Q;  2WPQ A;  1HVV A;  1SQB G;  3CWB G;  1CI6 B;  1GU4 A;  2H43 A;  3G71 P;  1H88 A;  3GF3 A;  2LR2 A;  2YKO A;  2BCC D;  2POH A;  2E42 A;  5AVX B;  2B87 A;  4YXD C;  2CPS A;  2R32 A;  2HYN A;  3VOP A;  2AEM A;  4U3F G;  1KB9 E;  5EFW B;  1NVO A;  1VL2 A;  4IFD K;  4PD4 H;  1SQX G;  1PGO A;  3A7O A;  3KPE A;  2N9Y B;  3H1H J;  2B87 B;  3E7K A;  4EDF A;  4WWI A;  3S1K A;  4H44 D;  1KTM A;  3AEA C;  1QL1 A;  2WSC H;  2KS1 A;  1MUU A;  3WMM 0;  3GLM A;  3H1I J;  3L71 G;  3RL0 g;  4PJ0 H;  2XZR A;  1X79 B;  1NTM J;  4XFJ A;  2PFX A;  4BWN A;  2FXM A;  1ZME C;  2ZT9 C;  4NPF X;  3H25 A;  1ZR4 A;  3CMA P;  3AE5 C;  1KOR A;  1KYO H;  5CBN A;  2KS1 B;  2GUS A;  3H1L D;  1FDI A;  3NFQ A;  5M1B A;  2O1J A;  1RF0 C;  3BVH A;  2E43 A;  1U7M A;  3B8E B;  2WTY A;  1OVR A;  1M56 D;  2GUV A;  3V2R A;  4L76 A;  2J5U A;  4NPD A;  2ZYA A;  2E5Y A;  1ZRT D;  1LGH B;  3LW5 J;  1YJN P;  1DD3 A;  3I55 P;  4L73 A;  2BCC E;  1IFI A;  2Y0D A;  3IN6 A;  3P8C E;  4IL6 H;  4JYC A;  4Y99 B;  3F89 A;  5AW9 B;  5KJ7 A;  5BVZ A;  3EQ2 A;  5GTI H;  1NAF A;  3CX5 I;  2D2C D;  3HUS A;  3FWN A;  3ABV C;  1KB9 I;  1SQQ K;  2KXP B;  3H1K D;  1OVU A;  3TGU G;  2ZXE B;  1K9M Q;  3HUS B;  1LTI C;  2H8P D;  2KNC A;  2KSJ A;  2R5D A;  1H0T A;  1JMB A;  2FXO A;  2KYV A;  4H13 B;  2BEZ F;  3BRT B;  2DW3 A;  4PD4 E;  4L75 A;  1KZU B;  3H1L E;  2KNC B;  2QM7 A;  3Q3D A;  4W7Y A;  2XKM A;  1H0T B;  1JMM A;  2M3E A;  1VQ7 P;  2P1J A;  3BCC E;  3AE4 C;  2G8Y A;  4PJ0 E;  1HUC A;  3H1H G;  3MP7 B;  3PTZ A;  3B5N A;  1HWT C;  1OMI A;  3FWL A;  1KIL C;  2FBW C;  2J58 A;  3AE9 C;  1FZA A;  2FYN B;  1N86 A;  2PAJ A;  5C39 A;  3TYY A;  4ZKP A;  3H1I G;  3V6I A;  2M8R A;  5KAI E;  4GOE A;  3B5N B;  2FYU E;  5KLV J;  2Z5I A;  1AQ5 A;  2L91 A;  5AVT B;  4LGD E;  5B66 H;  1BDC A;  1T6A A;  2H89 C;  2I8D A;  1L0N J;  1PZQ A;  1GU5 A;  1FE6 A;  5KJ7 C;  1G2C A;  3K5B A;  3JSV C;  3TNU A;  3RL0 B;  2WSE H;  4H13 C;  3RK2 C;  2IZ1 A;  5APV A;  3PHL A;  1G2C B;  3TNU B;  3V4Q A;  1DD4 A;  1SVF A;  3VTP C;  2IBZ I;  5CJ4 A;  1DIP A;  3Q5S A;  4PD4 I;  1JM0 A;  2YKQ A;  3NMD A;  5CCH D;  1BGY D;  4C7N A;  4D6T D;  1EDK A;  3NTN A;  1LWU C;  4ZMD A;  1HJ0 A;  1VQ6 P;  3IF4 A;  2W83 C;  3KHU A;  5DJT B;  5APT A;  2JP3 A;  1IK7 A;  2E75 B;  1HGZ A;  5E79 E;  2P7J A;  4HYT B;  4L74 A;  2E76 C;  4C7N B;  2AEF A;  2FYN C;  5BU5 A;  1T3U A;  4ASW A;  1SQV K;  1QGK B;  5AW6 B;  1KYO I;  1EDI A;  3FXD A;  3B5N C;  1IJD B;  2A45 H;  3OJA B;  4ASV A;  2P67 A;  2XND H;  1FZG A;  1K8A Q;  3V2Q A;  1XTC C;  1FZE A;  5CJ0 A;  2WPV B;  1OVV A;  5APX A;  2IX7 C;  2YO3 A;  2QM8 A;  3H1K G;  3LID A;  1BCC E;  2E74 D;  1EZV I;  1EQ7 A;  4C7R A;  4I7Z C;  5AW8 B;  3CCQ P;  1Q82 Q;  3L75 E;  2KK7 A;  3L70 J;  3RL0 C;  1SQQ D;  2IZ0 A;  2XDJ A;  4DJG A;  1JTH A;  3V5B A;  1IFD A;  2B88 A;  2C0X A;  4GOD A;  1VQL P;  5B66 E;  1R5S A;  3V2N A;  3OAK A;  3RGU A;  2I1J A;  3M9Q A;  1QX8 A;  2OYH A;  3CL3 D;  1L0L J;  3CCR P;  1H8A A;  3CXH H;  1VQO P;  1RH5 B;  5KLV G;  1SFC D;  2YIU B;  1JTH B;  3UIA A;  1NTZ J;  2NZ2 A;  3D70 A;  2OTJ P;  2Z4E A;  1BSH A;  2OYH B;  3QWO C;  1P84 D;  2E75 C;  3L35 A;  1LP1 A;  1VF5 B;  1WT6 A;  4LLH A;  1K05 A;  4RES B;  2OGU A;  2P10 A;  1Y47 A;  3PP5 A;  5AW7 B;  1NTK K;  1LP1 B;  4KT0 J;  5KKZ B;  5AVS B;  4R4L A;  4H0L B;  3AE6 C;  5APW A;  2W6B A;  1URQ D;  4UB8 H;  4YPC A;  1LTJ A;  1SQP K;  1IO4 A;  1IZN B;  1YYC A;  5TJH A;  2WWW A;  1KMI Z;  4C46 A;  4I2L C;  2KSE A;  2KB7 P;  1NU1 D;  2JJL A;  2NRG A;  1LTJ B;  1SQQ E;  2OYI A;  2L5G B;  5AVW B;  1SQX J;  3A0H H;  1YHQ P;  2AEJ A;  4OGQ D;  3KXD A;  1KFN A;  1OX3 A;  2QE7 H;  2OYI B;  1PL5 A;  2Q6Q A;  1BGY G;  4D6T G;  2WVR A;  1KQS O;  2FYU K;  1T2K C;  1AFO A;  4JYB A;  1JB0 J;  3L36 A;  3AEB C;  3I5C A;  3S9O A;  3L74 J;  2HG5 D;  3CX5 D;  1VF5 C;  2ZFC A;  1PGJ A;  4RO0 A;  3R2P A;  4IFF A;  1ZXG A;  5TIS E;  1IFM A;  3Q1M A;  1MKM A;  1KB9 D;  1T3J A;  2IYO A;  3G4S P;  3VP8 A;  5AVY B;  3Q5P A;  4ZNC A;  4H0L C;  1SQV D;  5B5E H;  1S5L H;  1L0L G;  1FDO A;  3CCJ P;  2ZVO B;  4GT1 A;  3JCU H;  1JY3 N;  1NTZ G;  3AEG C;  2Y0C A;  1BE3 E;  4O9B A;  5KTB A;  1RF0 A;  5KAF E;  3AEC C;  1LTJ C;  2JWD A;  2IFN A;  1S4X A;  4JPZ B;  4YXW H;  1HF9 A;  2Q3E A;  2A45 I;  4UB8 E;  2ZT9 D;  2ZVN B;  3TGU J;  1Y9B A;  2WT7 A;  2OYI C;  1J1D B;  2K9Y A;  1NKN A;  2R5B A;  1FJK A;  3O8Z A;  1PP9 J;  2WT7 B;  3P8C D;  2C9N Y;  3CX5 E;  4TLF A;  3VP9 A;  3G3Z A;  2G3A A;  3R4Y A;  3W67 A;  3L73 D;  1K73 Q;  3CXH I;  2QIW A;  2Q5U A;  4HKZ H;  2OTL P;  2WQY C;  1UIX A;  1FOS E;  1SQV E;  2BCC J;  3LW5 H;  2AXT E;  1D7M A;  1M8O B;  1NTK D;  1Z56 A;  2FYZ A;  2HR3 A;  1CZQ A;  1M57 D;  1NU1 G;  2IBZ D;  1HBW A;  4PD4 D;  1EC5 A;  2QRX A;  1SQP D;  3L74 G;  2Z5H A;  2A06 D;  3H1J E;  2N9B A;  1IFJ A;  1HJB A;  3HE4 A;  1OWA A;  2XV5 A;  1GW3 A;  4KHX A;  5B5E E;  1KIL A;  1S5L E;  3VMY A;  2FFD A;  3BCC D;  3H6P A;  2FY8 A;  2YXQ B;  1VQ9 P;  1J1D C;  2M5A A;  3HE4 B;  1KIL B;  2KP8 A;  1KYO D;  3W68 A;  2FFD B;  3FGA D;  1GMJ A;  3WU2 H;  2Q1K A;  3H1L J;  2FYU D;  4GKG A;  1NO4 A;  2M5A B;  1KIL D;  1ZN5 A;  1RF1 A;  1A02 F;  2WPS A;  3WUT A;  1YTZ I;  3E1I A;  1EZV D;  1FS0 E;  3L73 E;  1MV8 A;  1H89 A;  2PRR A;  3H1I E;  4GOF A;  1LTT C;  1NTM E;  1RF1 B;  1A02 J;  4K35 A;  4MN4 C;  1NTK E;  3U1A A;  2FKW B;  1SLQ A;  4PV1 B;  2B9B A;  1L4A A;  1PP9 G;  3M0A A;  3RK2 B;  1G1J A;  5KJ7 D;  2VRS A;  3HD7 A;  2IBZ E;  1LWU A;  3M91 A;  1SQP E;  2KUB A;  2A06 E;  1CW5 A;  4H13 D;  2JEE A;  1L4A B;  3RK2 D;  5AVR B;  1JCD A;  3H1K J;  1W5C E;  2KOG A;  1SQB K;  3HD7 B;  1LWU B;  2NPS A;  2P2U A;  4U7J A;  2E76 B;  1KYO E;  2BCC G;  2FFD C;  2NPS B;  1KV4 A;  5AVZ B;  3HRN A;  3G6E P;  2ITA A;  3CCE P;  1LTA C;  1KIL E;  2RH0 A;  3L72 E;  4A7P A;  2LXB A;  3VMZ A;  4OH8 B;  1EZV E;  3B5N D;  4B86 A;  1BCC D;  1NJI Q;  4RJT A;  1RF1 C;  4I6M C;  3GW6 A;  4WVZ A;  4I7Z B;  3L75 D;  4GDO A;  3E1R A;  4IL6 E;  2WSF J;  4PV1 C;  2Y9Z A;  3RK3 B;  4Y28 J;  1PPJ D;  4HJG H;  5GTI E;  1NYH A;  5AVQ B;  3LIE A;  1CSB A;  5APQ A;  4WY4 A;  4LC1 A;  3RL0 D;  3JC2 2;  3H1L G;  2JR8 A;  2QSI A;  3IFM A;  1X0T A;  1L4A C;  2YNY A;  3BCC G;  2KLU A;  3HD7 C;  1JY3 P;  1G1I A;  4WY4 B;  1QLE D;  4R4M A;  1NWQ A;  1R8E A;  4N3Y B;  1JO5 A;  2NPS C;  2QJY B;  2E75 D;  4GIF A;  2YMY A;  3C1L A;  1L0N E;  4DT0 A;  1BGY J;  1IFP A;  4D6T J;  1KQL A;  1FJP A;  2QJP B;  3C9I A;  3RBZ A;  5H2F H;  2W6A A;  1KFM A;  1HH0 A;  2QEX P;  3O6Q A;  1RY3 A;  1E5W A;  1EDJ A;  3RK3 C;  2KLV A;  1PPJ E;  3GF7 A;  2WPR A;  2B89 A;  3O6Q B;  1GDT A;  3CD6 P;  1JY3 O;  3RK3 E;  2C9L Y;  3AED C;  3KYQ A;  5CCH C;  1VQK P;  5CCG A;  1P84 H;  2MJZ A;  2KI7 B;  3G9R A;  4WY4 C;  1SQQ J;  3II6 A;  2Q9I A;  2O01 N;  4HB1 A;  1SQB D;  3CWB D;  3BAT A;  1NTM K;  3CXH D;  3L37 A;  3MHV A;  2Y9Y A;  2QJY C; 
#chains in the Genus database with same CATH homology
 3H1I J;  4PD4 I;  1SQP J;  3L72 J;  1SQB J;  4U3F J;  1PP9 J;  1NTM J;  3CWB J;  3H1L J;  1BCC J;  1SQQ J;  3H1H J;  3L71 J;  1KYO I;  3CXH I;  1NTK J;  1EZV I;  1L0L J;  1L0N J;  1BE3 J;  3H1J J;  3TGU J;  1SQV J;  1SQX J;  3CX5 I;  3L75 J;  3BCC J;  3H1K J;  3L70 J;  1BGY J;  1NU1 J;  3L73 J;  2BCC J;  4D6T J;  1P84 I;  1NTZ J;  2FYU J;  3L74 J;  1KB9 I;  2IBZ I;  5KLV J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...