4CPGA

Solution structure of the sgta n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PRO
publication title Solution Structure of the Sgta Dimerisation Domain and Investigation of its Interactions with the Ubiquitin-Like Domains of Bag6 and Ubl4A.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Chaperone
total genus 24
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16546 SGTA_dimer Homodimerisation domain of SGTA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4cpgA00
4NPDA 4WWIA 4HJGH 3FXEA 1BDCA 2JWDA 5CBOA 1H0TB 2KZJA 2LXCB 2I8DA 1FC2C 2OTKE 2B88A 3MZWB 1LP1A 1Y47A 2Q1KA 2QVAA 2SPZA 2LXBA 2HR3A 3ZDMA 1NVOA 2ZAEB 3S1KA 2WMMA 1BDDA 4BXLA 1EDJA 2KI7B 4CPGA 2B89A 1OVVA 4NPEA 1U7MA 4MN4C 1X0TA 4GODA 4KJMA 2KUBA 1OVUA 1JMBA 1S3JA 1DEEG 5DJUB 2KZIA 2UWJE 4HB1A 2QRXA 2RKLA 1EC5A 1LP1B 2KS1B 2M5AB 1U7JA 2B87A 4GOFA 5EFWB 1Q2NA 4K35A 4K3AA 5C39A 3RGUA 4HKZH 4JBZA 3MHVA 1H0TA 1ZXGA 5K5GB 2R44A 2KIKA 1SS1A 5CBNA 1JM0A 2K3RA 4NPFX 4ZNCA 4ASVA 2LR2A 1EDIA 1LT1A 1OVRA 4ASWA 4ZMDA 2M5AA 5DJTB 2B87B 2P58A 1EDLA 3QWOC 4GOEA 4IOIH 1MFTA 3FXDA 2M0BA 3PH0A 1EDKA 1ZW0A 4EYYQ
chains in the Genus database with same CATH superfamily
3BCCE 1A02J 3RL0C 4C46A 3LW5H 1LP1A 2Q1KA 1N7SD 1OIPA 3CWBG 1YITP 1VF5C 1LWUC 3A3YB 2Q3IA 4NPEA 1SQPK 5APWA 1KILE 3H1IE 4EI2A 1PP9D 2BCCE 1FDIA 2RKLA 1LP1B 5TJHA 3CI9A 4D6TE 3BRTB 1JEKA 4RJTA 2C9NY 3WUUA 1VL2A 4UB6E 1QL2A 1VQPP 2GA1A 5B5EE 3RK2C 1XTCC 5CCGD 4Y99B 3CCEP 4PV1B 5GTIH 3CC4P 1ZXGA 3JC22 2YO3A 1JCDA 1GD2E 1K04A 4ZKPA 3CX5I 1HJBA 4IL6H 1NWQA 5AVWB 3Q2YA 1LTBC 1FZCC 1GMJA 3NXSA 3RBZA 1L0LJ 1L0ND 1IFMA 1P84E 1PGPA 3M91A 2W27A 5KLVK 4WY4A 1PP9J 5KKZC 3GW6A 1LTTC 1HVVA 2LXCB 2I8DA 2XKMA 3CWBE 2SPZA 1NKZB 3N7NA 2E5TA 1L2PA 2B9BA 3E7KA 4H44C 2FYUG 4CPGA 1OVVA 1NHLA 1G1JA 3BCCD 3U59A 2IFNA 1JB0J 2N1TC 5APSA 2K88A 1GDTA 3AEFC 1PGOA 2QA4P 1IFPA 1LTAC 3L72D 3S9OA 1JY2N 3G71P 4GOFA 5EFWB 1NTMG 4N3YB 1SQVK 2G8YA 1L0NJ 3G6EP 3OW2O 3RL0B 3IF4A 1KILD 3H1HD 3L73G 3PP5A 5BU8B 3AE9C 3TNUB 3L70D 1VF5B 4OVNF 3TDKA 1NOHA 2K3RA 4D6TD 1SFCC 3CX5D 1FU1A 1Q82Q 1FBMA 3Q5PA 1WMKA 1IFNA 1KQFB 3H25A 3BCCJ 4H13C 2YKPA 2AXCA 2WVRA 4W80A 1T8ZA 1EDKA 1BE3G 5KAFE 4HJGH 2JR8A 5AVQB 2L5GB 2NRGA 3L75G 3IAOA 4KT0J 1KYOH 3L72J 2W6JH 2GUVA 1NO4A 4L73A 2KS1A 2E76B 2YNYA 1KQLA 4AYCA 3RK2B 1KB9E 2FYUE 4RKUJ 3S1KA 1HJ0A 1H88A 1GK4A 3A0HE 4L75A 2JWAA 1GL2D 3OA7A 3L4FA 2KYVA 1ZP0C 2FYNC 1SLQA 4H0LC 3ABVC 3O8ZA 4L76A 4BWNA 4UB8E 3L70J 3CWBD 3HRNA 1PV3A 4D6TJ 1M8OB 1NTME 2W83C 1G2CB 5KAIH 4BRYA 2KS1B 2I1JA 1L4AD 1OZHA 1K9MQ 2V4HA 5AVTB 4I2LC 3EWKA 5KKZB 2I1KA 3L73E 1NU1G 1JUNA 3L74D 2P2UA 1E5WA 1CZQA 3MGNA 1RY3A 1MKMA 4GIFA 4Y28J 1Z56A 3H1JE 4H44B 4NPFX 3RK3E 4BRYB 2AEJA 4O9BA 1BE3E 2N1TB 5BVZA 1KFMA 1OW8A 1OFCX 4EYYQ 2QJKC 3L75E 2D2CB 2WQYC 2E74D 4U3FG 3FXEA 5AW2B 3CWBJ 1PFIA 3A0BH 4IFFA 1NAYA 5GTIE 3I5CA 3O6QA 4WVZA 3NMDA 1SQQK 3FX0A 1X22A 1S9KE 1VQ8P 3R4YA 4N78D 3D71A 4GODA 1U57A 2K1AA 3A2AA 4OGQB 3B5ND 3LIDA 1SFCB 4UB6H 3II6A 5B5EH 2E75B 3AE4C 1KMIZ 2FYUD 3K5BA 4H13B 1VPCA 2J5UA 3O6QB 1T2KC 3N4XA 1NU1E 1J1EC 3MTUE 4PD4E 2MKVA 1K73Q 3HTKA 1OXZA 5AW4B 3HUSA 5CCHD 1P84H 4Z1MH 1URQA 1KORA 2BEZF 3AE7C 3BATA 4ASWA 3KXDA 1S2EA 2RH0A 4ZMDA 2P58A 3L73D 2FYNB 2G3AA 4H0LB 4U3FE 5AVYB 5KLVG 2LKMA 2CPBA 2M0BA 2BEQD 2ITAA 1BGYD 2AXTH 3HTKB 2IBZI 2ZT9D 1E79H 1MUUA 3G9RA 2FYUJ 5BU5A 1SQXK 2K9YA 3AE2C 4U7JA 1W2BO 5AW1B 2YO2A 1VQ9P 1Q7YQ 1URQB 1AA0A 1T3JA 2OYHA 1ZR2A 2Y9YA 4B86A 1S5LX 3H1LG 1N2DC 1BCCD 5TISE 4PV1C 3AE6C 3M9QA 2KLUA 3H32A 3B8EB 2M3EA 1EC5A 2Y9ZA 2WPRA 3B4SA 2OYIA 2XDJA 2Z4EA 1SQVG 3LW5J 1S9KD 1K05A 3L73J 3VP8A 3OAKA 2QJKB 3V2NA 2A06D 4K35A 1WT6A 2Z5HA 2XU6A 3PTZA 1H8AA 1QLED 3H1IG 3WUTA 1K8AQ 2C9LY 3H32B 5AVZB 5KAFH 1LTGC 1DX7A 2OYIB 2LR2A 2Q6QA 1SQBD 5APYA 3SFEC 5KLVE 3H1KG 3V2QA 4JF7A 2NPSD 2K37A 2AEMA 4IOIH 5KAIE 5AW5B 2FFDC 1N7SA 3A0HH 3HE4A 1D7MA 3C9IA 4WY4C 2YXQB 2OTKE 2HR3A 3HE5A 2H7HA 1J1EB 3T97A 3V2PA 1JCCA 1PPJG 3AEGC 4UB8H 4I7ZC 2WSEH 3H1LE 1EZVD 3GLMA 2QG4A 3CXHH 2CPSA 3AE8C 1YYCA 2KSEA 2Y0CA 3SWFA 1R5SA 3CCMP 1AJYA 3HE4B 3Q1MA 3GF3A 1SQVE 2OTJP 2PP6A 3AEDC 3HE5B 5CCGA 1SQBJ 3T97B 3A0BE 1LTJA 1NTKK 2PGDA 3AE3C 1ZV8A 1L0LD 1BSNA 2ZYGA 2O01H 4IL6X 2OARA 2YKQA 1Q81Q 2L91A 3MHVA 2R44A 2PAJA 3B71A 5AW7B 3TYYA 4M3LA 3KPEA 2GM4A 3H1KE 2W90A 2E76C 1KYOD 1OVRA 2HG5D 2M5AA 5DJTB 2JP3A 2DW3A 1GL2C 1GW3A 2A45I 3C1LA 1ZW0A 5AW8B 1YJ9P 2QE7H 1J2JB 1PPJE 1OX3A 3ITKA 1L4AC 5KLVD 3TK1A 2FFDA 4TT3H 1KFNA 1H89A 3Q5RA 1VQ7P 1IJDB 1XTGB 4XE5B 2W6AA 2VRSA 1QVGO 2P10A 2YMKA 2IFMA 3AEAC 1JMBA 3VOPA 3FWNA 1PGQA 4PD4H 2QRXA 3TSIA 1S4XA 3V6IA 2OYOA 4JYBA 4WBAA 3NFQA 3M06A 2AXTE 1AFOA 3CMEP 1L0NK 2FFDB 3U1CA 5AVRB 4JYCA 4XFJA 4WY4B 2KLVA 5KJ7D 3VMZA 3R2PA 2WTYA 2WSFJ 2HODA 2D2CC 1VQNP 2C0XA 2FY8A 4I7ZB 1USEA 5KLVJ 2IX7C 2GUSA 2PRRA 4OWFA 3I56P 4N6JA 1NTZG 3H1ID 4R4LA 3A7OA 1AQ5A 2BCCD 4RO0A 4WWIA 3EQ2A 2JJLA 1QX8A 2C0WA 2HODB 3CL3D 3L35A 4OGQC 1SQXG 4AQRD 3H1KD 2E75C 3RL0D 1GL2A 3H1LJ 3ZDMA 5TISH 3H1JG 1IC2A 2J59M 2ZAEB 1KTMA 3CCSP 1QVFO 2OTLP 3V4QA 3FWLA 2FXPA 4C7RA 4BXLA 1VF5D 1UIIA 2YXRB 4DJGA 1YIJP 3VTPC 1L4AA 1KQSO 5KLIB 1KQGB 1S5LE 1GL2B 1FZGA 1U7JA 3H1IJ 1P84D 2WSFH 2OQQA 1EQ7A 2BCCJ 5B66H 2W6BA 2WITA 5C39A 1HTLC 3SFDC 3IR9A 1YTZI 3RK2D 5K5GB 1KB9I 3CXHE 1L4AB 2ZT9C 3HD7D 3H1KJ 1VQMP 1JM0A 1DH3A 3HUSC 3P7KA 1NTZE 1URQC 1M7LA 1QGKB 2Y0DA 3SWKA 1KZUB 1JY3O 1AQTA 1MFTA 5GTHH 2KB7P 4GDOA 3PH0A 2HPCA 1SQXE 4NPDA 2WZ7A 1BDCA 2KZJA 1GU5A 1CSBA 2HYNA 1OW7A 1M57D 1NVOA 2V7QH 3WUVA 2RN0A 1JTHA 2WPQA 2FBWC 3W68A 5CHXA 2E74B 2WMMA 3B5NA 3FGAD 2ZVNB 4I6MC 2OYHC 1RF0C 3TF5A 2B89A 1RE4A 3KHUA 2M8RA 1WRGA 4H44D 3BVHA 4OH8B 3TGUG 5CJ4A 2IBZG 1W2EA 2IYPA 2H43A 2N1TD 4XA4A 2BASA 1ZRTE 1AVOA 1NTKG 1LJ2A 1SQPG 2FXMA 2OYIC 3AECC 1YI2P 1RF1C 1Q2NA 3JCUH 5CCHA 3RGUA 2R5BA 1IZNB 3UIAA 3WU2E 1JNMA 5APTA 4EIJA 1JO5A 1RE3A 1KB9D 1JOCA 1ZR4A 1JY3P 2E43A 1PL5A 5M1BA 4ASVA 1N73C 2Y0EA 1EDIA 1VQLP 4DT0A 1SFCD 3VMAA 2QSIA 5AVSB 3MP7B 3MD0A 2H88C 2O1KA 1LTIC 4H13D 2JDIH 3CXHD 1NTMD 1IFDA 1N7SC 2XNDH 1IFIA 1NTZD 1Y47A 3G4SP 2AEFA 3JSVC 3I55P 3GF7A 1AV1A 2XV5A 1FDOA 3TGUE 2IBZE 2ZYDA 2ZT9B 3W67A 4MN4C 1X8YA 2KXPB 1R8EA 2IZ0A 3HUSB 2CK3H 3H1JD 3RK3D 1RH5B 4W7YA 1FE6A 1NTKE 3M0DC 1SQPE 4H0LD 3WMM0 1SVFA 1RF0A 1EZVI 1BE3D 3A5TA 1IK7A 3L75D 5CCGC 2N9YB 3M9HA 1LTJC 2WSEJ 1M1JA 3L36A 1HF9A 1NTMJ 1DD3A 1NTZJ 1RF1A 1IO4A 2NPSA 1ZRTD 2R3CA 2OYHB 1PIXA 1LT1A 3P8CE 1SP4A 1FOSF 1SQXJ 3FXDA 1YQ4C 1GU4A 1M1JB 3L72G 2O01J 3VMYA 1T6AA 3H1JJ 1GW4A 5AW3B 4TLFA 2JKVA 3M0AA 4LGDE 1N73A 1RQVA 3D6ZA 1KYOI 5B66E 1NU1D 2B88A 1BE3J 1RF1B 2NPSB 2R32A 3H1HG 4PD4D 3L75J 1S5LH 3V5BA 3RBXA 2A45G 2H89C 3CCUP 4KJMA 5H2FH 2KOGA 1N73B 5GTHE 4HB1A 1SQBK 1YQ3C 4U3FD 4YXWH 4R4MA 3TGUD 3P8MC 1KILC 3F5HA 1NYHA 4EDFA 1T2KD 3V4WA 1JMMA 1N7SB 3M0DA 2IZ1A 2ZVOB 1YBKA 1N8RQ 1KC8Q 1H0TA 1SQPD 1NU1J 3CCQP 2KP8A 2FXOA 1GTWA 2O01N 1M56D 4IFDK 2Z5IA 1S72P 3L72E 1A02F 5APXA 3QWOC 2RMZA 1YHQP 1JY2O 1FJKA 1W5CE 2JWDA 4JPZB 2WT7A 1H0TB 3JCUE 5KLIC 1FZFA 3V2RA 3H1HE 4U3FJ 2WSSH 1L0LK 3AEBC 2YMYA 3P8CD 1VQ6P 1LTJB 3L74G 3TGUJ 3CD6P 3BRVB 2KNCA 1HGZA 3L70E 1VQ5P 4QMAA 3VMXA 1NJIQ 1BDDA 4LLHA 1OWAA 2JO1A 1U7MA 3CX5E 3PHLA 2J58A 4I1LA 1NAFA 1NTKJ 1SQPJ 1S3JA 3AE5C 3HD7C 2WT7B 1SQQG 4WB4A 4PV1D 1ZOYC 1QL1A 3WU2H 3L71G 2M5AB 2R5DA 3H6PA 2QJYC 2O3JA 2B87A 5KJ7A 2KNCB 5L8RJ 4YTPC 2P67A 1ZN5A 5APQA 1GZLA 4JBZA 5CMZA 2WPSA 3OJAB 1VQKP 1N86A 1P84I 1KILA 3H1LD 1HUCA 5E79E 2WWWA 3KZIH 1N7LA 2W8ZA 2B87B 1JY2P 2E74C 3C8VA 3CCRP 1SQVD 1S1CX 1VDFA 1M1KQ 3L74E 2HLOA 1KILB 3TNUA 2QJPC 4WY4D 3MUDC 4DCKA 4EOTA 1LWUA 2WSCJ 3B5NC 1Q90D 1SQQE 2PFXA 3KQGA 1RE4C 3M9BA 1DEEG 3L71E 4ZKUA 1FZAA 3CLQA 3QH9A 1AVYA 3E1IA 3KYQA 1BGYG 2FKWB 3BASA 2V7QJ 1OMIA 1LWUB 2Q3EA 3USSA 3HD7A 3VP9A 1DD4A 1SQVJ 4K3AA 1PPJD 3E1RA 1IK9A 5CCHC 1QEXA 1DIPA 2YIUC 1EXIA 3U1AA 4N78E 1X9VA 5H2FE 1RE3C 2ZJSE 4ZNCA 1BCCG 1FZCA 1G2CA 2YKOA 1NH4A 1OW6A 2QM8A 2E76D 1FZBA 3HD7B 4HH2A 1M90Q 5KTBA 3H1HJ 2R3SA 2K9JA 3RK3C 5CBOA 1CW5A 2ZXEB 3SSUA 2QJYB 4GT1A 1FAVA 1LT9C 1FOSE 3MZWB 2WSCH 2QVAA 5CJ0A 2A06G 1YJNP 5APUA 2M3BA 1UIXA 1FZCB 1GK6A 3CXHI 4PJ0H 4C7NA 3PRJA 2N1TA 3EFGA 1R5LA 1Y8AA 2N9BA 1OVUA 3Q3DA 3MUDA 2K9JB 5DJUB 1SQBG 2IDBA 1KN7A 4KHXA 4LC1A 3GHGC 1BGYE 1KV4A 3GG2A 2HPCB 4C7NB 3CPWO 1SQQD 4HKZH 1YTZT 1M1JC 2WPVB 5AW9B 3CCJP 4YXDC 2QJPB 2KIKA 3L71D 4GKGA 2XZRA 2Q7CA 4YPCA 5CBNA 1EZVG 1BCCE 1MZ9A 1SFCA 2E42A 2D2CD 1JTHB 2NPSC 3EFFK 2KK7A 1TU3F 3B5NB 2OGUA 5AVUB 2ZFCA 1ZMEC 1FS0E 1NGMB 1LNQA 2A45H 4AUWA 4DOJA 1J1DC 3L74J 4IL6E 2A06E 5AVXB 3KDPB 1L0LG 3CX5H 2HFED 2LXBA 2NZ2A 4OGQD 2QEXP 1PP9G 1DEBA 1MV8A 2E75D 3SWYA 2H8PD 3KZIE 2KI7B 2KSJA 1SQQJ 2YIUB 1HBWA 2Q5UA 1LT9A 1SQBE 2FYUK 2P7JA 1FZEA 3L71J 1HWTC 1ZLLA 2QM7A 2FYZA 1JY3N 2KZIA 4PD4I 4DZOA 5AVVB 3P32A 1CI6A 1HGVA 2Q9IA 3Q5SA 1SQXD 5E79H 1NTMK 3RK3B 3GHGA 1PGJA 2E5YA 1LT9B 4HYTB 4JQ0D 1NTZK 1EZVE 1SS1A 3AE1C 1L0NG 3D70A 1T3UA 5APVA 4RESB 2POHA 2ZXXA 1CI6B 3VN0A 5AW6B 3MIWA 2QIWA 1YJWP 4GOEA 1URQD 3AEEC 1X79B 3GHGB 2IPPA 1L0LE 3D6YA 2MJZA 1Y9BA 4Y99C 3BCCG 1PP9E 1FC2C 1FDMA 1G1IA 3GMAA 1VQ4P 1BSHA 4W7ZA 3RL0g 3CCVP 1RQUA 1LGHB 2O1JA 1USDA 2IYOA 1EDJA 1RHZB 1KYOE 1EXJA 2XNXA 3VYIA 1X0TA 2KUBA 1BGYJ 4L74A 1MFZA 2UWJE 1PZQA 1HH0A 1IFJA 2BCCG 3CC7P 3LIEA 4A7PA 2JEEA 4IFMA 3F89A 1Q86Q 3S4RA 3L70G 1FJPA 1J1DB 1LTSC 5KJ7C 3L37A 4D6TG 1VQOP 3CCLP 3IFMA 1L0NE 3CC2P 1NU1K 1NKNA 1BCCJ 3PJSK 4PJ0E 1KB9H 3PLNA 2IBZD 3NTNA 5AW0B 3IN6A 3G3ZA 1EDLA 1KD1Q 2ZYAA 3CMAP 1NTKD 2P1JA
chains in the Genus database with same CATH topology
4NPDA 4WWIA 4HJGH 3FXEA 1BDCA 2JWDA 5CBOA 1H0TB 2KZJA 2LXCB 2I8DA 1FC2C 2OTKE 2B88A 3MZWB 1LP1A 1Y47A 2Q1KA 2QVAA 2SPZA 2LXBA 2HR3A 3ZDMA 1NVOA 2ZAEB 3S1KA 2WMMA 1BDDA 4BXLA 1EDJA 2KI7B 4CPGA 2B89A 1OVVA 4NPEA 1U7MA 4MN4C 1X0TA 4GODA 4KJMA 2KUBA 1OVUA 1JMBA 1S3JA 1DEEG 5DJUB 2KZIA 2UWJE 4HB1A 2QRXA 2RKLA 1EC5A 1LP1B 2KS1B 2M5AB 1U7JA 2B87A 4GOFA 5EFWB 1Q2NA 4K35A 4K3AA 5C39A 3RGUA 4HKZH 4JBZA 3MHVA 1H0TA 1ZXGA 5K5GB 2R44A 2KIKA 1SS1A 5CBNA 1JM0A 2K3RA 4NPFX 4ZNCA 4ASVA 2LR2A 1EDIA 1LT1A 1OVRA 4ASWA 4ZMDA 2M5AA 5DJTB 2B87B 2P58A 1EDLA 3QWOC 4GOEA 4IOIH 1MFTA 3FXDA 2M0BA 3PH0A 1EDKA 1ZW0A 4EYYQ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NPD A;  4WWI A;  4HJG H;  3FXE A;  1BDC A;  2JWD A;  5CBO A;  1H0T B;  2KZJ A;  2LXC B;  2I8D A;  1FC2 C;  2OTK E;  2B88 A;  3MZW B;  1LP1 A;  1Y47 A;  2Q1K A;  2QVA A;  2SPZ A;  2LXB A;  2HR3 A;  3ZDM A;  1NVO A;  2ZAE B;  3S1K A;  2WMM A;  1BDD A;  4BXL A;  1EDJ A;  2KI7 B;  4CPG A;  2B89 A;  1OVV A;  4NPE A;  1U7M A;  4MN4 C;  1X0T A;  4GOD A;  4KJM A;  2KUB A;  1OVU A;  1JMB A;  1S3J A;  1DEE G;  5DJU B;  2KZI A;  2UWJ E;  4HB1 A;  2QRX A;  2RKL A;  1EC5 A;  1LP1 B;  2KS1 B;  2M5A B;  1U7J A;  2B87 A;  4GOF A;  5EFW B;  1Q2N A;  4K35 A;  4K3A A;  5C39 A;  3RGU A;  4HKZ H;  4JBZ A;  3MHV A;  1H0T A;  1ZXG A;  5K5G B;  2R44 A;  2KIK A;  1SS1 A;  5CBN A;  1JM0 A;  2K3R A;  4NPF X;  4ZNC A;  4ASV A;  2LR2 A;  1EDI A;  1LT1 A;  1OVR A;  4ASW A;  4ZMD A;  2M5A A;  5DJT B;  2B87 B;  2P58 A;  1EDL A;  3QWO C;  4GOE A;  4IOI H;  1MFT A;  3FXD A;  2M0B A;  3PH0 A;  1EDK A;  1ZW0 A;  4EYY Q; 
#chains in the Genus database with same CATH topology
 3BCC E;  1A02 J;  3RL0 C;  4C46 A;  3LW5 H;  1LP1 A;  2Q1K A;  1N7S D;  1OIP A;  3CWB G;  1YIT P;  1VF5 C;  1LWU C;  3A3Y B;  2Q3I A;  4NPE A;  1SQP K;  5APW A;  1KIL E;  3H1I E;  4EI2 A;  1PP9 D;  2BCC E;  1FDI A;  2RKL A;  1LP1 B;  5TJH A;  3CI9 A;  4D6T E;  3BRT B;  1JEK A;  4RJT A;  2C9N Y;  3WUU A;  1VL2 A;  4UB6 E;  1QL2 A;  1VQP P;  2GA1 A;  5B5E E;  3RK2 C;  1XTC C;  5CCG D;  4Y99 B;  3CCE P;  4PV1 B;  5GTI H;  3CC4 P;  1ZXG A;  3JC2 2;  2YO3 A;  1JCD A;  1GD2 E;  1K04 A;  4ZKP A;  3CX5 I;  1HJB A;  4IL6 H;  1NWQ A;  5AVW B;  3Q2Y A;  1LTB C;  1FZC C;  1GMJ A;  3NXS A;  3RBZ A;  1L0L J;  1L0N D;  1IFM A;  1P84 E;  1PGP A;  3M91 A;  2W27 A;  5KLV K;  4WY4 A;  1PP9 J;  5KKZ C;  3GW6 A;  1LTT C;  1HVV A;  2LXC B;  2I8D A;  2XKM A;  3CWB E;  2SPZ A;  1NKZ B;  3N7N A;  2E5T A;  1L2P A;  2B9B A;  3E7K A;  4H44 C;  2FYU G;  4CPG A;  1OVV A;  1NHL A;  1G1J A;  3BCC D;  3U59 A;  2IFN A;  1JB0 J;  2N1T C;  5APS A;  2K88 A;  1GDT A;  3AEF C;  1PGO A;  2QA4 P;  1IFP A;  1LTA C;  3L72 D;  3S9O A;  1JY2 N;  3G71 P;  4GOF A;  5EFW B;  1NTM G;  4N3Y B;  1SQV K;  2G8Y A;  1L0N J;  3G6E P;  3OW2 O;  3RL0 B;  3IF4 A;  1KIL D;  3H1H D;  3L73 G;  3PP5 A;  5BU8 B;  3AE9 C;  3TNU B;  3L70 D;  1VF5 B;  4OVN F;  3TDK A;  1NOH A;  2K3R A;  4D6T D;  1SFC C;  3CX5 D;  1FU1 A;  1Q82 Q;  1FBM A;  3Q5P A;  1WMK A;  1IFN A;  1KQF B;  3H25 A;  3BCC J;  4H13 C;  2YKP A;  2AXC A;  2WVR A;  4W80 A;  1T8Z A;  1EDK A;  1BE3 G;  5KAF E;  4HJG H;  2JR8 A;  5AVQ B;  2L5G B;  2NRG A;  3L75 G;  3IAO A;  4KT0 J;  1KYO H;  3L72 J;  2W6J H;  2GUV A;  1NO4 A;  4L73 A;  2KS1 A;  2E76 B;  2YNY A;  1KQL A;  4AYC A;  3RK2 B;  1KB9 E;  2FYU E;  4RKU J;  3S1K A;  1HJ0 A;  1H88 A;  1GK4 A;  3A0H E;  4L75 A;  2JWA A;  1GL2 D;  3OA7 A;  3L4F A;  2KYV A;  1ZP0 C;  2FYN C;  1SLQ A;  4H0L C;  3ABV C;  3O8Z A;  4L76 A;  4BWN A;  4UB8 E;  3L70 J;  3CWB D;  3HRN A;  1PV3 A;  4D6T J;  1M8O B;  1NTM E;  2W83 C;  1G2C B;  5KAI H;  4BRY A;  2KS1 B;  2I1J A;  1L4A D;  1OZH A;  1K9M Q;  2V4H A;  5AVT B;  4I2L C;  3EWK A;  5KKZ B;  2I1K A;  3L73 E;  1NU1 G;  1JUN A;  3L74 D;  2P2U A;  1E5W A;  1CZQ A;  3MGN A;  1RY3 A;  1MKM A;  4GIF A;  4Y28 J;  1Z56 A;  3H1J E;  4H44 B;  4NPF X;  3RK3 E;  4BRY B;  2AEJ A;  4O9B A;  1BE3 E;  2N1T B;  5BVZ A;  1KFM A;  1OW8 A;  1OFC X;  4EYY Q;  2QJK C;  3L75 E;  2D2C B;  2WQY C;  2E74 D;  4U3F G;  3FXE A;  5AW2 B;  3CWB J;  1PFI A;  3A0B H;  4IFF A;  1NAY A;  5GTI E;  3I5C A;  3O6Q A;  4WVZ A;  3NMD A;  1SQQ K;  3FX0 A;  1X22 A;  1S9K E;  1VQ8 P;  3R4Y A;  4N78 D;  3D71 A;  4GOD A;  1U57 A;  2K1A A;  3A2A A;  4OGQ B;  3B5N D;  3LID A;  1SFC B;  4UB6 H;  3II6 A;  5B5E H;  2E75 B;  3AE4 C;  1KMI Z;  2FYU D;  3K5B A;  4H13 B;  1VPC A;  2J5U A;  3O6Q B;  1T2K C;  3N4X A;  1NU1 E;  1J1E C;  3MTU E;  4PD4 E;  2MKV A;  1K73 Q;  3HTK A;  1OXZ A;  5AW4 B;  3HUS A;  5CCH D;  1P84 H;  4Z1M H;  1URQ A;  1KOR A;  2BEZ F;  3AE7 C;  3BAT A;  4ASW A;  3KXD A;  1S2E A;  2RH0 A;  4ZMD A;  2P58 A;  3L73 D;  2FYN B;  2G3A A;  4H0L B;  4U3F E;  5AVY B;  5KLV G;  2LKM A;  2CPB A;  2M0B A;  2BEQ D;  2ITA A;  1BGY D;  2AXT H;  3HTK B;  2IBZ I;  2ZT9 D;  1E79 H;  1MUU A;  3G9R A;  2FYU J;  5BU5 A;  1SQX K;  2K9Y A;  3AE2 C;  4U7J A;  1W2B O;  5AW1 B;  2YO2 A;  1VQ9 P;  1Q7Y Q;  1URQ B;  1AA0 A;  1T3J A;  2OYH A;  1ZR2 A;  2Y9Y A;  4B86 A;  1S5L X;  3H1L G;  1N2D C;  1BCC D;  5TIS E;  4PV1 C;  3AE6 C;  3M9Q A;  2KLU A;  3H32 A;  3B8E B;  2M3E A;  1EC5 A;  2Y9Z A;  2WPR A;  3B4S A;  2OYI A;  2XDJ A;  2Z4E A;  1SQV G;  3LW5 J;  1S9K D;  1K05 A;  3L73 J;  3VP8 A;  3OAK A;  2QJK B;  3V2N A;  2A06 D;  4K35 A;  1WT6 A;  2Z5H A;  2XU6 A;  3PTZ A;  1H8A A;  1QLE D;  3H1I G;  3WUT A;  1K8A Q;  2C9L Y;  3H32 B;  5AVZ B;  5KAF H;  1LTG C;  1DX7 A;  2OYI B;  2LR2 A;  2Q6Q A;  1SQB D;  5APY A;  3SFE C;  5KLV E;  3H1K G;  3V2Q A;  4JF7 A;  2NPS D;  2K37 A;  2AEM A;  4IOI H;  5KAI E;  5AW5 B;  2FFD C;  1N7S A;  3A0H H;  3HE4 A;  1D7M A;  3C9I A;  4WY4 C;  2YXQ B;  2OTK E;  2HR3 A;  3HE5 A;  2H7H A;  1J1E B;  3T97 A;  3V2P A;  1JCC A;  1PPJ G;  3AEG C;  4UB8 H;  4I7Z C;  2WSE H;  3H1L E;  1EZV D;  3GLM A;  2QG4 A;  3CXH H;  2CPS A;  3AE8 C;  1YYC A;  2KSE A;  2Y0C A;  3SWF A;  1R5S A;  3CCM P;  1AJY A;  3HE4 B;  3Q1M A;  3GF3 A;  1SQV E;  2OTJ P;  2PP6 A;  3AED C;  3HE5 B;  5CCG A;  1SQB J;  3T97 B;  3A0B E;  1LTJ A;  1NTK K;  2PGD A;  3AE3 C;  1ZV8 A;  1L0L D;  1BSN A;  2ZYG A;  2O01 H;  4IL6 X;  2OAR A;  2YKQ A;  1Q81 Q;  2L91 A;  3MHV A;  2R44 A;  2PAJ A;  3B71 A;  5AW7 B;  3TYY A;  4M3L A;  3KPE A;  2GM4 A;  3H1K E;  2W90 A;  2E76 C;  1KYO D;  1OVR A;  2HG5 D;  2M5A A;  5DJT B;  2JP3 A;  2DW3 A;  1GL2 C;  1GW3 A;  2A45 I;  3C1L A;  1ZW0 A;  5AW8 B;  1YJ9 P;  2QE7 H;  1J2J B;  1PPJ E;  1OX3 A;  3ITK A;  1L4A C;  5KLV D;  3TK1 A;  2FFD A;  4TT3 H;  1KFN A;  1H89 A;  3Q5R A;  1VQ7 P;  1IJD B;  1XTG B;  4XE5 B;  2W6A A;  2VRS A;  1QVG O;  2P10 A;  2YMK A;  2IFM A;  3AEA C;  1JMB A;  3VOP A;  3FWN A;  1PGQ A;  4PD4 H;  2QRX A;  3TSI A;  1S4X A;  3V6I A;  2OYO A;  4JYB A;  4WBA A;  3NFQ A;  3M06 A;  2AXT E;  1AFO A;  3CME P;  1L0N K;  2FFD B;  3U1C A;  5AVR B;  4JYC A;  4XFJ A;  4WY4 B;  2KLV A;  5KJ7 D;  3VMZ A;  3R2P A;  2WTY A;  2WSF J;  2HOD A;  2D2C C;  1VQN P;  2C0X A;  2FY8 A;  4I7Z B;  1USE A;  5KLV J;  2IX7 C;  2GUS A;  2PRR A;  4OWF A;  3I56 P;  4N6J A;  1NTZ G;  3H1I D;  4R4L A;  3A7O A;  1AQ5 A;  2BCC D;  4RO0 A;  4WWI A;  3EQ2 A;  2JJL A;  1QX8 A;  2C0W A;  2HOD B;  3CL3 D;  3L35 A;  4OGQ C;  1SQX G;  4AQR D;  3H1K D;  2E75 C;  3RL0 D;  1GL2 A;  3H1L J;  3ZDM A;  5TIS H;  3H1J G;  1IC2 A;  2J59 M;  2ZAE B;  1KTM A;  3CCS P;  1QVF O;  2OTL P;  3V4Q A;  3FWL A;  2FXP A;  4C7R A;  4BXL A;  1VF5 D;  1UII A;  2YXR B;  4DJG A;  1YIJ P;  3VTP C;  1L4A A;  1KQS O;  5KLI B;  1KQG B;  1S5L E;  1GL2 B;  1FZG A;  1U7J A;  3H1I J;  1P84 D;  2WSF H;  2OQQ A;  1EQ7 A;  2BCC J;  5B66 H;  2W6B A;  2WIT A;  5C39 A;  1HTL C;  3SFD C;  3IR9 A;  1YTZ I;  3RK2 D;  5K5G B;  1KB9 I;  3CXH E;  1L4A B;  2ZT9 C;  3HD7 D;  3H1K J;  1VQM P;  1JM0 A;  1DH3 A;  3HUS C;  3P7K A;  1NTZ E;  1URQ C;  1M7L A;  1QGK B;  2Y0D A;  3SWK A;  1KZU B;  1JY3 O;  1AQT A;  1MFT A;  5GTH H;  2KB7 P;  4GDO A;  3PH0 A;  2HPC A;  1SQX E;  4NPD A;  2WZ7 A;  1BDC A;  2KZJ A;  1GU5 A;  1CSB A;  2HYN A;  1OW7 A;  1M57 D;  1NVO A;  2V7Q H;  3WUV A;  2RN0 A;  1JTH A;  2WPQ A;  2FBW C;  3W68 A;  5CHX A;  2E74 B;  2WMM A;  3B5N A;  3FGA D;  2ZVN B;  4I6M C;  2OYH C;  1RF0 C;  3TF5 A;  2B89 A;  1RE4 A;  3KHU A;  2M8R A;  1WRG A;  4H44 D;  3BVH A;  4OH8 B;  3TGU G;  5CJ4 A;  2IBZ G;  1W2E A;  2IYP A;  2H43 A;  2N1T D;  4XA4 A;  2BAS A;  1ZRT E;  1AVO A;  1NTK G;  1LJ2 A;  1SQP G;  2FXM A;  2OYI C;  3AEC C;  1YI2 P;  1RF1 C;  1Q2N A;  3JCU H;  5CCH A;  3RGU A;  2R5B A;  1IZN B;  3UIA A;  3WU2 E;  1JNM A;  5APT A;  4EIJ A;  1JO5 A;  1RE3 A;  1KB9 D;  1JOC A;  1ZR4 A;  1JY3 P;  2E43 A;  1PL5 A;  5M1B A;  4ASV A;  1N73 C;  2Y0E A;  1EDI A;  1VQL P;  4DT0 A;  1SFC D;  3VMA A;  2QSI A;  5AVS B;  3MP7 B;  3MD0 A;  2H88 C;  2O1K A;  1LTI C;  4H13 D;  2JDI H;  3CXH D;  1NTM D;  1IFD A;  1N7S C;  2XND H;  1IFI A;  1NTZ D;  1Y47 A;  3G4S P;  2AEF A;  3JSV C;  3I55 P;  3GF7 A;  1AV1 A;  2XV5 A;  1FDO A;  3TGU E;  2IBZ E;  2ZYD A;  2ZT9 B;  3W67 A;  4MN4 C;  1X8Y A;  2KXP B;  1R8E A;  2IZ0 A;  3HUS B;  2CK3 H;  3H1J D;  3RK3 D;  1RH5 B;  4W7Y A;  1FE6 A;  1NTK E;  3M0D C;  1SQP E;  4H0L D;  3WMM 0;  1SVF A;  1RF0 A;  1EZV I;  1BE3 D;  3A5T A;  1IK7 A;  3L75 D;  5CCG C;  2N9Y B;  3M9H A;  1LTJ C;  2WSE J;  1M1J A;  3L36 A;  1HF9 A;  1NTM J;  1DD3 A;  1NTZ J;  1RF1 A;  1IO4 A;  2NPS A;  1ZRT D;  2R3C A;  2OYH B;  1PIX A;  1LT1 A;  3P8C E;  1SP4 A;  1FOS F;  1SQX J;  3FXD A;  1YQ4 C;  1GU4 A;  1M1J B;  3L72 G;  2O01 J;  3VMY A;  1T6A A;  3H1J J;  1GW4 A;  5AW3 B;  4TLF A;  2JKV A;  3M0A A;  4LGD E;  1N73 A;  1RQV A;  3D6Z A;  1KYO I;  5B66 E;  1NU1 D;  2B88 A;  1BE3 J;  1RF1 B;  2NPS B;  2R32 A;  3H1H G;  4PD4 D;  3L75 J;  1S5L H;  3V5B A;  3RBX A;  2A45 G;  2H89 C;  3CCU P;  4KJM A;  5H2F H;  2KOG A;  1N73 B;  5GTH E;  4HB1 A;  1SQB K;  1YQ3 C;  4U3F D;  4YXW H;  4R4M A;  3TGU D;  3P8M C;  1KIL C;  3F5H A;  1NYH A;  4EDF A;  1T2K D;  3V4W A;  1JMM A;  1N7S B;  3M0D A;  2IZ1 A;  2ZVO B;  1YBK A;  1N8R Q;  1KC8 Q;  1H0T A;  1SQP D;  1NU1 J;  3CCQ P;  2KP8 A;  2FXO A;  1GTW A;  2O01 N;  1M56 D;  4IFD K;  2Z5I A;  1S72 P;  3L72 E;  1A02 F;  5APX A;  3QWO C;  2RMZ A;  1YHQ P;  1JY2 O;  1FJK A;  1W5C E;  2JWD A;  4JPZ B;  2WT7 A;  1H0T B;  3JCU E;  5KLI C;  1FZF A;  3V2R A;  3H1H E;  4U3F J;  2WSS H;  1L0L K;  3AEB C;  2YMY A;  3P8C D;  1VQ6 P;  1LTJ B;  3L74 G;  3TGU J;  3CD6 P;  3BRV B;  2KNC A;  1HGZ A;  3L70 E;  1VQ5 P;  4QMA A;  3VMX A;  1NJI Q;  1BDD A;  4LLH A;  1OWA A;  2JO1 A;  1U7M A;  3CX5 E;  3PHL A;  2J58 A;  4I1L A;  1NAF A;  1NTK J;  1SQP J;  1S3J A;  3AE5 C;  3HD7 C;  2WT7 B;  1SQQ G;  4WB4 A;  4PV1 D;  1ZOY C;  1QL1 A;  3WU2 H;  3L71 G;  2M5A B;  2R5D A;  3H6P A;  2QJY C;  2O3J A;  2B87 A;  5KJ7 A;  2KNC B;  5L8R J;  4YTP C;  2P67 A;  1ZN5 A;  5APQ A;  1GZL A;  4JBZ A;  5CMZ A;  2WPS A;  3OJA B;  1VQK P;  1N86 A;  1P84 I;  1KIL A;  3H1L D;  1HUC A;  5E79 E;  2WWW A;  3KZI H;  1N7L A;  2W8Z A;  2B87 B;  1JY2 P;  2E74 C;  3C8V A;  3CCR P;  1SQV D;  1S1C X;  1VDF A;  1M1K Q;  3L74 E;  2HLO A;  1KIL B;  3TNU A;  2QJP C;  4WY4 D;  3MUD C;  4DCK A;  4EOT A;  1LWU A;  2WSC J;  3B5N C;  1Q90 D;  1SQQ E;  2PFX A;  3KQG A;  1RE4 C;  3M9B A;  1DEE G;  3L71 E;  4ZKU A;  1FZA A;  3CLQ A;  3QH9 A;  1AVY A;  3E1I A;  3KYQ A;  1BGY G;  2FKW B;  3BAS A;  2V7Q J;  1OMI A;  1LWU B;  2Q3E A;  3USS A;  3HD7 A;  3VP9 A;  1DD4 A;  1SQV J;  4K3A A;  1PPJ D;  3E1R A;  1IK9 A;  5CCH C;  1QEX A;  1DIP A;  2YIU C;  1EXI A;  3U1A A;  4N78 E;  1X9V A;  5H2F E;  1RE3 C;  2ZJS E;  4ZNC A;  1BCC G;  1FZC A;  1G2C A;  2YKO A;  1NH4 A;  1OW6 A;  2QM8 A;  2E76 D;  1FZB A;  3HD7 B;  4HH2 A;  1M90 Q;  5KTB A;  3H1H J;  2R3S A;  2K9J A;  3RK3 C;  5CBO A;  1CW5 A;  2ZXE B;  3SSU A;  2QJY B;  4GT1 A;  1FAV A;  1LT9 C;  1FOS E;  3MZW B;  2WSC H;  2QVA A;  5CJ0 A;  2A06 G;  1YJN P;  5APU A;  2M3B A;  1UIX A;  1FZC B;  1GK6 A;  3CXH I;  4PJ0 H;  4C7N A;  3PRJ A;  2N1T A;  3EFG A;  1R5L A;  1Y8A A;  2N9B A;  1OVU A;  3Q3D A;  3MUD A;  2K9J B;  5DJU B;  1SQB G;  2IDB A;  1KN7 A;  4KHX A;  4LC1 A;  3GHG C;  1BGY E;  1KV4 A;  3GG2 A;  2HPC B;  4C7N B;  3CPW O;  1SQQ D;  4HKZ H;  1YTZ T;  1M1J C;  2WPV B;  5AW9 B;  3CCJ P;  4YXD C;  2QJP B;  2KIK A;  3L71 D;  4GKG A;  2XZR A;  2Q7C A;  4YPC A;  5CBN A;  1EZV G;  1BCC E;  1MZ9 A;  1SFC A;  2E42 A;  2D2C D;  1JTH B;  2NPS C;  3EFF K;  2KK7 A;  1TU3 F;  3B5N B;  2OGU A;  5AVU B;  2ZFC A;  1ZME C;  1FS0 E;  1NGM B;  1LNQ A;  2A45 H;  4AUW A;  4DOJ A;  1J1D C;  3L74 J;  4IL6 E;  2A06 E;  5AVX B;  3KDP B;  1L0L G;  3CX5 H;  2HFE D;  2LXB A;  2NZ2 A;  4OGQ D;  2QEX P;  1PP9 G;  1DEB A;  1MV8 A;  2E75 D;  3SWY A;  2H8P D;  3KZI E;  2KI7 B;  2KSJ A;  1SQQ J;  2YIU B;  1HBW A;  2Q5U A;  1LT9 A;  1SQB E;  2FYU K;  2P7J A;  1FZE A;  3L71 J;  1HWT C;  1ZLL A;  2QM7 A;  2FYZ A;  1JY3 N;  2KZI A;  4PD4 I;  4DZO A;  5AVV B;  3P32 A;  1CI6 A;  1HGV A;  2Q9I A;  3Q5S A;  1SQX D;  5E79 H;  1NTM K;  3RK3 B;  3GHG A;  1PGJ A;  2E5Y A;  1LT9 B;  4HYT B;  4JQ0 D;  1NTZ K;  1EZV E;  1SS1 A;  3AE1 C;  1L0N G;  3D70 A;  1T3U A;  5APV A;  4RES B;  2POH A;  2ZXX A;  1CI6 B;  3VN0 A;  5AW6 B;  3MIW A;  2QIW A;  1YJW P;  4GOE A;  1URQ D;  3AEE C;  1X79 B;  3GHG B;  2IPP A;  1L0L E;  3D6Y A;  2MJZ A;  1Y9B A;  4Y99 C;  3BCC G;  1PP9 E;  1FC2 C;  1FDM A;  1G1I A;  3GMA A;  1VQ4 P;  1BSH A;  4W7Z A;  3RL0 g;  3CCV P;  1RQU A;  1LGH B;  2O1J A;  1USD A;  2IYO A;  1EDJ A;  1RHZ B;  1KYO E;  1EXJ A;  2XNX A;  3VYI A;  1X0T A;  2KUB A;  1BGY J;  4L74 A;  1MFZ A;  2UWJ E;  1PZQ A;  1HH0 A;  1IFJ A;  2BCC G;  3CC7 P;  3LIE A;  4A7P A;  2JEE A;  4IFM A;  3F89 A;  1Q86 Q;  3S4R A;  3L70 G;  1FJP A;  1J1D B;  1LTS C;  5KJ7 C;  3L37 A;  4D6T G;  1VQO P;  3CCL P;  3IFM A;  1L0N E;  3CC2 P;  1NU1 K;  1NKN A;  1BCC J;  3PJS K;  4PJ0 E;  1KB9 H;  3PLN A;  2IBZ D;  3NTN A;  5AW0 B;  3IN6 A;  3G3Z A;  1EDL A;  1KD1 Q;  2ZYA A;  3CMA P;  1NTK D;  2P1J A; 
#chains in the Genus database with same CATH homology
 4NPD A;  4WWI A;  4HJG H;  3FXE A;  1BDC A;  2JWD A;  5CBO A;  1H0T B;  2KZJ A;  2LXC B;  2I8D A;  1FC2 C;  2OTK E;  2B88 A;  3MZW B;  1LP1 A;  1Y47 A;  2Q1K A;  2QVA A;  2SPZ A;  2LXB A;  2HR3 A;  3ZDM A;  1NVO A;  2ZAE B;  3S1K A;  2WMM A;  1BDD A;  4BXL A;  1EDJ A;  2KI7 B;  4CPG A;  2B89 A;  1OVV A;  4NPE A;  1U7M A;  4MN4 C;  1X0T A;  4GOD A;  4KJM A;  2KUB A;  1OVU A;  1JMB A;  1S3J A;  1DEE G;  5DJU B;  2KZI A;  2UWJ E;  4HB1 A;  2QRX A;  2RKL A;  1EC5 A;  1LP1 B;  2KS1 B;  2M5A B;  1U7J A;  2B87 A;  4GOF A;  5EFW B;  1Q2N A;  4K35 A;  4K3A A;  5C39 A;  3RGU A;  4HKZ H;  4JBZ A;  3MHV A;  1H0T A;  1ZXG A;  5K5G B;  2R44 A;  2KIK A;  1SS1 A;  5CBN A;  1JM0 A;  2K3R A;  4NPF X;  4ZNC A;  4ASV A;  2LR2 A;  1EDI A;  1LT1 A;  1OVR A;  4ASW A;  4ZMD A;  2M5A A;  5DJT B;  2B87 B;  2P58 A;  1EDL A;  3QWO C;  4GOE A;  4IOI H;  1MFT A;  3FXD A;  2M0B A;  3PH0 A;  1EDK A;  1ZW0 A;  4EYY Q; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...