4CPGA

Solution structure of the sgta n-terminal domain
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
69
structure length
69
Chain Sequence
MDNKKRLAYAIIQFLHDQLRHGGLSSDAQESLEVAIQCLETAFGVTVEDSDLALPQTLPEIFEAAATGK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Chaperone
molecule keywords SMALL GLUTAMINE-RICH TETRATRICOPEPTIDE REPEAT-CONTAINING PRO
publication title Solution Structure of the Sgta Dimerisation Domain and Investigation of its Interactions with the Ubiquitin-Like Domains of Bag6 and Ubl4A.
pubmed doi rcsb
source organism Homo sapiens
total genus 24
structure length 69
sequence length 69
chains with identical sequence B
ec nomenclature
pdb deposition date 2014-02-06

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF16546 SGTA_dimer Homodimerisation domain of SGTA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4cpgA00
1OVVA 1X0TA 4NPEA 5CBOA 4ZNCA 1EDKA 1OVUA 2KUBA 4BXLA 2QVAA 3S1KA 2LR2A 1JMBA 2Q1KA 1LP1A 1LT1A 3QWOC 2LXBA 4ZMDA 1NVOA 2RKLA 3FXDA 1EDIA 4CPGA 3MHVA 1DEEG 2K3RA 1Q2NA 1LP1B 2JWDA 1EDLA 2I8DA 4GOEA 4KJMA 4ASVA 1Y47A 2SPZA 5CBNA 1SS1A 2M5AA 2B87A 4K3AA 4HB1A 4ASWA 2KI7B 1H0TA 2QRXA 4GODA 1BDDA 5K5GB 2ZAEB 3PH0A 3FXEA 1JM0A 4HJGH 1OVRA 4IOIH 5DJTB 2M0BA 5EFWB 1ZXGA 2KIKA 1BDCA 2KZIA 1FC2C 2LXCB 2P58A 2B87B 2M5AB 5DJUB 1ZW0A 2B88A 4K35A 2WMMA 1MFTA 1H0TB 1EDJA 2R44A 1U7MA 1S3JA 4HKZH 4NPFX 2UWJE 5C39A 2KS1B 3MZWB 4GOFA 4MN4C 2OTKE 2HR3A 3RGUA 4WWIA 2B89A 1U7JA 4JBZA 4EYYQ 1EC5A 2KZJA 3ZDMA 4NPDA
chains in the Genus database with same CATH superfamily
3H6PA 1YJNP 5TISE 2YIUC 5KAFH 1AJYA 3L75E 3A5TA 3VMZA 3P32A 1PP9J 2AXTE 2PP6A 1JO5A 1L0LD 3M9QA 3CCUP 2QEXP 4OH8B 4CPGA 2BCCD 1SQXJ 3SFEC 2V4HA 3RBXA 1DEEG 3AE5C 1QX8A 3V4WA 2WSEJ 1ZV8A 5AVZB 1QEXA 1KORA 3F5HA 4PD4E 3AE3C 1RQVA 1IC2A 2WITA 1BDDA 5K5GB 3L70J 3PH0A 4W7YA 1IFNA 2KZIA 3M0AA 1P84H 1AFOA 3FWNA 3PP5A 3CXHD 4PV1D 3VTPC 1LTGC 1X8YA 1RE4A 3GHGA 5BVZA 3Q3DA 1FDIA 2UWJE 1DD3A 4IFMA 2E76B 1TU3F 2N1TB 4PD4I 1N7LA 3AE4C 3M0DC 1NGMB 3NXSA 2WPQA 3AECC 5APWA 3P8CE 5AW9B 3ZDMA 1RY3A 5KAFE 1PPJG 1WT6A 3TGUJ 4H13B 5AVRB 3B5NA 1HWTC 1EDKA 3MUDC 3HTKB 2Q1KA 1N8RQ 2KLUA 4RO0A 1YI2P 3MD0A 5AW5B 1IK7A 1YBKA 2Y0CA 5KLIC 3OJAB 3A0BE 1FBMA 3RK3E 3L73D 4U3FG 2R3SA 2Q3EA 1HJBA 2QJPB 2WSCJ 1EDLA 5APQA 5CJ4A 2A45H 2H43A 2B87A 3CX5I 1AQ5A 1PGPA 3EWKA 4WB4A 3H1ID 4ASWA 1H0TA 1DX7A 4IOIH 4YXWH 1OVRA 1KFNA 3CWBE 5GTHH 1P84E 1NU1J 2H7HA 2IBZD 1BE3G 3L72J 3HE5B 2E75B 5DJUB 2W83C 2B88A 2WPVB 3L71G 2JDIH 2BEZF 1Q82Q 2FFDA 2R44A 3AE6C 4NPFX 1ZOYC 1NHLA 3JCUH 4I2LC 1PP9D 3AE1C 3NMDA 2PAJA 5AVSB 3MTUE 5B66E 1IJDB 3LIDA 4GT1A 1P84I 1SQXD 2WPRA 1L0ND 1BGYD 3H1HG 5APVA 2HODB 2QSIA 3CMAP 1UIXA 5AVWB 2WVRA 1LT9C 2WZ7A 5CCGC 3II6A 3TNUB 2AEFA 3EFGA 1GL2C 2C9NY 2IYOA 2WWWA 3PRJA 1JY2O 4WBAA 5AVUB 3V2QA 1EXIA 4N78E 3CCMP 1H8AA 3D70A 1VDFA 1X9VA 1KILC 1HGVA 1IFJA 4R4MA 1ZR4A 2HLOA 1KFMA 3O6QB 1SQQE 1T3UA 1FDOA 3H32A 2GUSA 5GTHE 3AEGC 5AW8B 1KILD 5APSA 3GF3A 1SQVG 1BDCA 3CC4P 1L0LE 3VN0A 3P7KA 4W80A 1HBWA 2XNDH 1OIPA 3TGUD 2WSFJ 1U7MA 2Q6QA 2A45I 2FYUG 2OGUA 3GMAA 3MZWB 1KYOD 1SQQK 2RN0A 1NTKD 3HUSA 4GKGA 3M9HA 1EC5A 1L0LK 2OYOA 2P67A 2FBWC 3AEAC 4B86A 5AW2B 4H0LB 1J1DC 1J1EB 1NTZG 1RHZB 3V2NA 1LTTC 1M56D 2C0WA 5KLVE 1E5WA 3G6EP 2E42A 1BCCG 2FYZA 1Y8AA 3IFMA 3A3YB 3L72D 3TK1A 3OW2O 3F89A 4BWNA 3RK2B 4D6TJ 2NZ2A 3HRNA 3L74G 3N4XA 2OYIB 2I1KA 1SQBJ 3CXHI 2QRXA 2WSEH 1A02F 3GW6A 2RH0A 1VQNP 3SWYA 2WSSH 5KLVK 1VQ5P 1QL1A 4YTPC 3RK3B 5AW0B 4WY4C 3SWFA 2YXRB 3K5BA 2FFDB 5AVXB 1SQPG 1NTMJ 1VF5B 3Q2YA 2A06E 3E1RA 1FZAA 1VQPP 2BCCJ 1T3JA 1SFCC 2E74B 3M0DA 1KQLA 2QJKB 4WY4D 3ITKA 2OYHC 3H1KG 1DIPA 1S9KE 2WPSA 1OVVA 2QE7H 3KPEA 3H1JG 1NTZE 2FY8A 3MUDA 1SFCD 1JEKA 3AEDC 2HPCA 2BASA 4BXLA 4I1LA 4ZMDA 2K9JB 2N9BA 2HFED 3G9RA 3SWKA 1YQ4C 1EDIA 1KYOH 2ZT9C 3BRTB 1NO4A 1N73C 4H44C 3L75G 1NTZK 1SQXE 5M1BA 1USDA 2RMZA 2OTJP 1LTBC 2KSEA 2M5AA 2FYNC 4K3AA 1CSBA 2R5DA 1RH5B 4H44D 2WSCH 1GZLA 3H1LD 4HJGH 1QVFO 1AA0A 3A0HH 3HE4A 2P1JA 1FC2C 3G71P 2P10A 3L70E 1ZMEC 1W5CE 1SLQA 2XZRA 3SSUA 1SQXK 1LTSC 1GK6A 1YITP 3ABVC 2KB7P 4N6JA 2W6JH 3RL0D 5GTIH 2HR3A 4U7JA 3L73J 1GK4A 4JBZA 2NPSC 2YIUB 5CHXA 3NFQA 4EIJA 1KILE 1VQLP 1WMKA 1M1JB 1X0TA 1L4AC 1PPJD 2Q5UA 1R8EA 2M8RA 3H1IJ 1EZVD 2NPSD 3TGUE 1URQD 1RF0C 3GF7A 1LT1A 3HUSC 1GL2A 1OFCX 1DD4A 4AYCA 1LGHB 1L4AD 1KYOE 3LIEA 1NKNA 3WUVA 1H88A 1S2EA 2IYPA 2QJYB 5AW6B 1GD2E 1KILA 3CX5H 1N7SC 1LP1B 3E7KA 1Q86Q 3AE9C 1YQ3C 1IFMA 2KP8A 1NTMD 3CCJP 1M8OB 3D6ZA 3OAKA 2KSJA 1L0NJ 1BGYJ 1PGOA 3A0HE 1N7SD 3FXEA 3A7OA 1G1IA 5EFWB 1NTKK 1KYOI 1JNMA 4Y99C 1BE3D 2P2UA 1G1JA 1K04A 1JY2P 3E1IA 5CMZA 1NU1E 3L71D 1LTJB 3L72E 4PV1C 4HKZH 2E43A 2JWAA 1CI6B 2O3JA 2HYNA 1FAVA 3TDKA 2B89A 2JR8A 3CWBG 2WSFH 1K9MQ 3BVHA 4EYYQ 1W2EA 3WU2H 2LXCB 2FXOA 1NAYA 1NWQA 1VPCA 1KN7A 1GDTA 1NU1K 1HGZA 1KTMA 4C7NB 4A7PA 2CPBA 3V4QA 5KLIB 2G3AA 1BSNA 3CC7P 3KYQA 2VRSA 3MHVA 3CX5E 1AVYA 2L91A 4HH2A 2O01J 1NTKJ 4DJGA 3HD7B 2FKWB 2IFMA 3Q5RA 2DW3A 2Y0DA 4I7ZC 3WUTA 2QA4P 2O1JA 3T97B 2WQYC 2LKMA 2KS1A 1ZRTD 3D71A 4BRYB 4WY4A 2N1TC 2A45G 2KOGA 2AEMA 3L36A 1SQQG 4GOFA 1SFCA 3Q5SA 2GM4A 1PGJA 2E76D 2N1TD 3WU2E 2OYHA 1VQ7P 2CPSA 1YJWP 1VL2A 4RJTA 1L0LG 3R4YA 1YIJP 2QM7A 4WVZA 3CLQA 4I6MC 1LT9B 4RKUJ 4H13D 3USSA 4ZNCA 1IO4A 1GL2B 1OW7A 4O9BA 3G3ZA 1G2CA 2LXBA 2E5TA 1HUCA 4DT0A 2M3BA 4L74A 3BCCJ 2GUVA 1N73A 2YNYA 1BCCD 1JTHA 3LW5J 3CXHH 5KKZB 3UIAA 1EZVE 2D2CB 3MGNA 2ZVOB 2KI7B 5KLVG 4XFJA 3D6YA 2ZAEB 1SVFA 4D6TE 1JM0A 5DJTB 2M0BA 3PJSK 3VP8A 1SQBE 2KXPB 3AE8C 3CCEP 2E75D 1KQGB 4K35A 4JF7A 4W7ZA 4HYTB 2XU6A 1OMIA 1OX3A 3Q1MA 1JY3O 1NTME 1Z56A 2G8YA 1EZVI 3WMM0 1JUNA 2NPSA 5B5EH 4OGQB 2BCCE 2KZJA 4NPDA 2IDBA 3GHGB 3H1KD 1SQBK 1L4AA 1J1DB 5AVQB 1OW8A 4JQ0D 5APUA 3FWLA 3JCUE 3L73G 3GLMA 1H89A 1QLED 2A06G 1RF0A 3H1LJ 5E79H 1JMBA 3C9IA 1FZGA 2Z4EA 2Z5IA 1T2KD 1NTMK 1GU5A 1JB0J 2R5BA 2KLVA 3B5NB 5APTA 1M7LA 2JEEA 1N7SA 2JKVA 1XTCC 3CL3D 3CXHE 2K1AA 2K37A 4ASVA 3H25A 3CMEP 3SFDC 2KNCA 3IF4A 1FJPA 3VOPA 1R5SA 5AW1B 1YTZI 1PP9G 3JC22 1OW6A 3N7NA 1LTIC 3S9OA 2B87B 3A2AA 4IL6X 1SQXG 1IFDA 4EOTA 1N2DC 1H0TB 1JY2N 2YKPA 1AQTA 3I56P 1LTAC 1GW4A 2B9BA 2OYHB 3RBZA 2J58A 4WWIA 5AW4B 2C9LY 3MP7B 2PGDA 1GU4A 4U3FJ 1K05A 3U59A 1K73Q 2R32A 3BCCD 3L70G 3L73E 2J59M 2N9YB 2E5YA 1PFIA 2W8ZA 4H0LD 5E79E 2YMYA 5BU8B 1PV3A 3S1KA 1E79H 1X79B 1AV1A 3H1IE 1T6AA 2Q7CA 3AE2C 1BE3J 2ZT9B 2RKLA 2OTLP 3P8CD 3L71J 2IBZE 2OYIC 1S5LX 4DOJA 2FYNB 4KJMA 3TGUG 2XNXA 3RK2D 4PJ0H 1PP9E 3BASA 4GODA 2O01H 5CJ0A 1FDMA 1KMIZ 1NTKG 2BEQD 3H1HJ 5BU5A 1LWUC 2IFNA 3PTZA 1VF5C 2KIKA 2H89C 1USEA 2OARA 1HH0A 2N1TA 3RK3D 2Q9IA 1L0NE 1BGYE 2W6BA 2IBZI 4OWFA 3BATA 4L75A 3H32B 3L37A 1FZCC 1S3JA 1VF5D 3RL0g 2O01N 4QMAA 3RGUA 2E74D 3O8ZA 1FJKA 3RL0C 1KZUB 1P84D 1L4AB 1RF1C 1YYCA 1FZFA 1DEBA 3JSVC 4IFFA 1L0NK 1NU1G 4YXDC 5H2FH 1Q7YQ 2IZ1A 3HUSB 3L72G 5CCHD 2WT7A 1FOSE 1SQVJ 3I5CA 1URQC 4AUWA 1MFZA 2YKQA 1Q90D 1KB9D 1MV8A 1M90Q 3VP9A 1YJ9P 1WRGA 2FYUJ 1J2JB 1YTZT 3HE5A 3CCSP 3AEEC 2XDJA 3CCQP 2YKOA 1NTKE 3LW5H 3W68A 4DCKA 4Y99B 3QH9A 2Z5HA 3M9BA 3B71A 4U3FD 4M3LA 1RE3C 1AVOA 3AE7C 3CCLP 4PV1B 2W6AA 2QIWA 1SQQD 2HODA 1M1JC 1BCCJ 5AVYB 1U7JA 3AEBC 3TNUA 1NJIQ 3V2RA 5L8RJ 5KAIH 2QM8A 3V5BA 3KQGA 5APXA 3FGAD 4ZKUA 5H2FE 5APYA 3L74J 4UB8H 5CBOA 5GTIE 1HVVA 3A0BH 5KTBA 2QJYC 5KJ7C 1ZN5A 2XV5A 3KZIH 1GW3A 2Q3IA 3O6QA 1OZHA 3H1LG 1JY3P 3H1HD 1SQPJ 2ITAA 2POHA 2NRGA 1NOHA 3VMXA 2HPCB 5KJ7D 1IK9A 3BCCE 2H88C 1Y47A 4I7ZB 1OWAA 2Y9YA 1Y9BA 3H1KJ 3AEFC 1LTJC 5KLVD 1KV4A 1HTLC 3H1JJ 1ZXGA 3C8VA 2M5AB 1CZQA 2J5UA 1ZW0A 3P8MC 3VYIA 3VMAA 2AEJA 3B8EB 5B66H 5AW7B 1PGQA 1KB9H 1GMJA 1EZVG 4JPZB 3HE4B 2Y9ZA 1QGKB 4D6TG 5KAIE 1NYHA 1SQVD 3L75J 1SQBG 2E76C 4UB8E 1FS0E 5TJHA 4LGDE 2V7QJ 1OVUA 2FYUD 2WT7B 2ZYDA 4H13C 1U57A 2LR2A 2A06D 3FX0A 1S1CX 1NTMG 4LLHA 2ZFCA 3KZIE 2YMKA 1ZLLA 2M3EA 3H1LE 2BCCG 3HD7C 2H8PD 1IZNB 1RQUA 2OYIA 2YO3A 4C7RA 3TSIA 2JJLA 4AQRD 1S9KD 2K3RA 3U1CA 1Q2NA 1VQ9P 2ZJSE 3IR9A 1NTZD 3PLNA 4TT3H 1FU1A 3L35A 1VQ6P 2SPZA 1HJ0A 3HD7D 1EXJA 2QJPC 2ZVNB 4C46A 4DZOA 3V6IA 1LWUA 1KILB 1UIIA 1Q81Q 3CI9A 4N3YB 4R4LA 1S72P 1PPJE 1FZCA 1KB9E 1HF9A 1MKMA 1NH4A 2E75C 3L74D 1QL2A 1K8AQ 1R5LA 2MJZA 5C39A 4MN4C 2K88A 2KK7A 2FXMA 5CCHA 4KHXA 1RF1A 4XA4A 2ZYAA 3WUUA 2K9JA 1OXZA 3L70D 1SQPD 4U3FE 5CCGD 3B4SA 1BSHA 1IFPA 4JYBA 1KB9I 2KUBA 1DH3A 2QVAA 1GL2D 1S4XA 2I1JA 1FZEA 1URQA 3M06A 4Y28J 1NVOA 3KDPB 5KKZC 1ZP0C 3CCRP 1T2KC 5AW3B 2D2CC 2JP3A 3H1JD 3G4SP 1W2BO 1BE3E 4XE5B 1PZQA 2IZ0A 2ZXXA 2YO2A 3L71E 2R3CA 1PIXA 4KT0J 3CWBJ 3H1IG 2D2CD 4GDOA 2L5GB 4IFDK 2C0XA 4Z1MH 2IBZG 1RE3A 1QVGO 1KC8Q 3L75D 2XKMA 4EI2A 2HG5D 3H1HE 1X22A 3IN6A 4OGQC 1MFTA 4L73A 1RE4C 3GHGC 1M1JA 2KS1B 2W27A 4ZKPA 2OTKE 1SP4A 5AVTB 4IL6H 4WY4B 1M57D 2W90A 2FXPA 4OGQD 1VQ4P 4YPCA 1NAFA 1L0NG 1BGYG 1VQMP 1CW5A 2IPPA 3CCVP 1SFCB 1NU1D 4PD4D 3B5NC 2WTYA 5KJ7A 4JYCA 5B5EE 4H0LC 1J1EC 1LP1A 1FE6A 4TLFA 1MZ9A 4UB6H 1KQSO 1EQ7A 3M91A 1ZRTE 3B5ND 2PFXA 5AVVB 1JCCA 1SQVE 3PHLA 1JY3N 1SQQJ 2JWDA 1KD1Q 1G2CB 2GA1A 4GOEA 1VQOP 3TF5A 1IFIA 1SS1A 1JMMA 4L76A 3MIWA 4HB1A 2P7JA 2YXQB 2FYUE 1LWUB 1S5LH 1L0LJ 3RK2C 1N73B 4H44B 1LTJA 2MKVA 1MUUA 1JTHB 2CK3H 1CI6A 4RESB 2AXCA 3CX5D 1FZCB 2P58A 1JCDA 1SQVK 2IX7C 3EQ2A 1LJ2A 1VQ8P 2WMMA 1T8ZA 3RK3C 3KXDA 3R2PA 4LC1A 2FFDC 4IL6E 3RL0B 2PRRA 3V2PA 2FYUK 1RF1B 4OVNF 3GG2A 3S4RA 4C7NA 3Q5PA 2ZXEB 2E74C 3C1LA 3KHUA 2QJKC 1JOCA 1LNQA 1XTGB 1BCCE 4NPEA 1PL5A 5TISH 3U1AA 3TYYA 2NPSB 5KLVJ 1URQB 1N86A 3L74E 1A02J 4UB6E 3QWOC 3CWBD 3CC2P 3HTKA 5CCHC 2KYVA 2AXTH 1M1KQ 3HD7A 2V7QH 2ZT9D 3NTNA 1ZR2A 3FXDA 2OQQA 3BRVB 1L2PA 3T97A 2I8DA 3I55P 1SQPE 3W67A 4BRYA 2ZYGA 5CBNA 3L4FA 1GTWA 1S5LE 1FZBA 4PD4H 1D7MA 1N7SB 1YHQP 3OA7A 3H1KE 1NKZB 3CPWO 2KNCB 4PJ0E 3BCCG 1FOSF 2K9YA 3IAOA 3H1JE 2Y0EA 1EDJA 1SQPK 3CD6P 1LT9A 1VQKP 4EDFA 2QG4A 3VMYA 5CCGA 3EFFK 4GIFA 4N78D 2O1KA 1KQFB 4D6TD 1NTZJ 2JO1A 1SQBD
chains in the Genus database with same CATH topology
1OVVA 1X0TA 4NPEA 5CBOA 4ZNCA 1EDKA 1OVUA 2KUBA 4BXLA 2QVAA 3S1KA 2LR2A 1JMBA 2Q1KA 1LP1A 1LT1A 3QWOC 2LXBA 4ZMDA 1NVOA 2RKLA 3FXDA 1EDIA 4CPGA 3MHVA 1DEEG 2K3RA 1Q2NA 1LP1B 2JWDA 1EDLA 2I8DA 4GOEA 4KJMA 4ASVA 1Y47A 2SPZA 5CBNA 1SS1A 2M5AA 2B87A 4K3AA 4HB1A 4ASWA 2KI7B 1H0TA 2QRXA 4GODA 1BDDA 5K5GB 2ZAEB 3PH0A 3FXEA 1JM0A 4HJGH 1OVRA 4IOIH 5DJTB 2M0BA 5EFWB 1ZXGA 2KIKA 1BDCA 2KZIA 1FC2C 2LXCB 2P58A 2B87B 2M5AB 5DJUB 1ZW0A 2B88A 4K35A 2WMMA 1MFTA 1H0TB 1EDJA 2R44A 1U7MA 1S3JA 4HKZH 4NPFX 2UWJE 5C39A 2KS1B 3MZWB 4GOFA 4MN4C 2OTKE 2HR3A 3RGUA 4WWIA 2B89A 1U7JA 4JBZA 4EYYQ 1EC5A 2KZJA 3ZDMA 4NPDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1OVV A;  1X0T A;  4NPE A;  5CBO A;  4ZNC A;  1EDK A;  1OVU A;  2KUB A;  4BXL A;  2QVA A;  3S1K A;  2LR2 A;  1JMB A;  2Q1K A;  1LP1 A;  1LT1 A;  3QWO C;  2LXB A;  4ZMD A;  1NVO A;  2RKL A;  3FXD A;  1EDI A;  4CPG A;  3MHV A;  1DEE G;  2K3R A;  1Q2N A;  1LP1 B;  2JWD A;  1EDL A;  2I8D A;  4GOE A;  4KJM A;  4ASV A;  1Y47 A;  2SPZ A;  5CBN A;  1SS1 A;  2M5A A;  2B87 A;  4K3A A;  4HB1 A;  4ASW A;  2KI7 B;  1H0T A;  2QRX A;  4GOD A;  1BDD A;  5K5G B;  2ZAE B;  3PH0 A;  3FXE A;  1JM0 A;  4HJG H;  1OVR A;  4IOI H;  5DJT B;  2M0B A;  5EFW B;  1ZXG A;  2KIK A;  1BDC A;  2KZI A;  1FC2 C;  2LXC B;  2P58 A;  2B87 B;  2M5A B;  5DJU B;  1ZW0 A;  2B88 A;  4K35 A;  2WMM A;  1MFT A;  1H0T B;  1EDJ A;  2R44 A;  1U7M A;  1S3J A;  4HKZ H;  4NPF X;  2UWJ E;  5C39 A;  2KS1 B;  3MZW B;  4GOF A;  4MN4 C;  2OTK E;  2HR3 A;  3RGU A;  4WWI A;  2B89 A;  1U7J A;  4JBZ A;  4EYY Q;  1EC5 A;  2KZJ A;  3ZDM A;  4NPD A; 
#chains in the Genus database with same CATH topology
 3H6P A;  1YJN P;  5TIS E;  2YIU C;  5KAF H;  1AJY A;  3L75 E;  3A5T A;  3VMZ A;  3P32 A;  1PP9 J;  2AXT E;  2PP6 A;  1JO5 A;  1L0L D;  3M9Q A;  3CCU P;  2QEX P;  4OH8 B;  4CPG A;  2BCC D;  1SQX J;  3SFE C;  2V4H A;  3RBX A;  1DEE G;  3AE5 C;  1QX8 A;  3V4W A;  2WSE J;  1ZV8 A;  5AVZ B;  1QEX A;  1KOR A;  3F5H A;  4PD4 E;  3AE3 C;  1RQV A;  1IC2 A;  2WIT A;  1BDD A;  5K5G B;  3L70 J;  3PH0 A;  4W7Y A;  1IFN A;  2KZI A;  3M0A A;  1P84 H;  1AFO A;  3FWN A;  3PP5 A;  3CXH D;  4PV1 D;  3VTP C;  1LTG C;  1X8Y A;  1RE4 A;  3GHG A;  5BVZ A;  3Q3D A;  1FDI A;  2UWJ E;  1DD3 A;  4IFM A;  2E76 B;  1TU3 F;  2N1T B;  4PD4 I;  1N7L A;  3AE4 C;  3M0D C;  1NGM B;  3NXS A;  2WPQ A;  3AEC C;  5APW A;  3P8C E;  5AW9 B;  3ZDM A;  1RY3 A;  5KAF E;  1PPJ G;  1WT6 A;  3TGU J;  4H13 B;  5AVR B;  3B5N A;  1HWT C;  1EDK A;  3MUD C;  3HTK B;  2Q1K A;  1N8R Q;  2KLU A;  4RO0 A;  1YI2 P;  3MD0 A;  5AW5 B;  1IK7 A;  1YBK A;  2Y0C A;  5KLI C;  3OJA B;  3A0B E;  1FBM A;  3RK3 E;  3L73 D;  4U3F G;  2R3S A;  2Q3E A;  1HJB A;  2QJP B;  2WSC J;  1EDL A;  5APQ A;  5CJ4 A;  2A45 H;  2H43 A;  2B87 A;  3CX5 I;  1AQ5 A;  1PGP A;  3EWK A;  4WB4 A;  3H1I D;  4ASW A;  1H0T A;  1DX7 A;  4IOI H;  4YXW H;  1OVR A;  1KFN A;  3CWB E;  5GTH H;  1P84 E;  1NU1 J;  2H7H A;  2IBZ D;  1BE3 G;  3L72 J;  3HE5 B;  2E75 B;  5DJU B;  2W83 C;  2B88 A;  2WPV B;  3L71 G;  2JDI H;  2BEZ F;  1Q82 Q;  2FFD A;  2R44 A;  3AE6 C;  4NPF X;  1ZOY C;  1NHL A;  3JCU H;  4I2L C;  1PP9 D;  3AE1 C;  3NMD A;  2PAJ A;  5AVS B;  3MTU E;  5B66 E;  1IJD B;  3LID A;  4GT1 A;  1P84 I;  1SQX D;  2WPR A;  1L0N D;  1BGY D;  3H1H G;  5APV A;  2HOD B;  2QSI A;  3CMA P;  1UIX A;  5AVW B;  2WVR A;  1LT9 C;  2WZ7 A;  5CCG C;  3II6 A;  3TNU B;  2AEF A;  3EFG A;  1GL2 C;  2C9N Y;  2IYO A;  2WWW A;  3PRJ A;  1JY2 O;  4WBA A;  5AVU B;  3V2Q A;  1EXI A;  4N78 E;  3CCM P;  1H8A A;  3D70 A;  1VDF A;  1X9V A;  1KIL C;  1HGV A;  1IFJ A;  4R4M A;  1ZR4 A;  2HLO A;  1KFM A;  3O6Q B;  1SQQ E;  1T3U A;  1FDO A;  3H32 A;  2GUS A;  5GTH E;  3AEG C;  5AW8 B;  1KIL D;  5APS A;  3GF3 A;  1SQV G;  1BDC A;  3CC4 P;  1L0L E;  3VN0 A;  3P7K A;  4W80 A;  1HBW A;  2XND H;  1OIP A;  3TGU D;  2WSF J;  1U7M A;  2Q6Q A;  2A45 I;  2FYU G;  2OGU A;  3GMA A;  3MZW B;  1KYO D;  1SQQ K;  2RN0 A;  1NTK D;  3HUS A;  4GKG A;  3M9H A;  1EC5 A;  1L0L K;  2OYO A;  2P67 A;  2FBW C;  3AEA C;  4B86 A;  5AW2 B;  4H0L B;  1J1D C;  1J1E B;  1NTZ G;  1RHZ B;  3V2N A;  1LTT C;  1M56 D;  2C0W A;  5KLV E;  1E5W A;  3G6E P;  2E42 A;  1BCC G;  2FYZ A;  1Y8A A;  3IFM A;  3A3Y B;  3L72 D;  3TK1 A;  3OW2 O;  3F89 A;  4BWN A;  3RK2 B;  4D6T J;  2NZ2 A;  3HRN A;  3L74 G;  3N4X A;  2OYI B;  2I1K A;  1SQB J;  3CXH I;  2QRX A;  2WSE H;  1A02 F;  3GW6 A;  2RH0 A;  1VQN P;  3SWY A;  2WSS H;  5KLV K;  1VQ5 P;  1QL1 A;  4YTP C;  3RK3 B;  5AW0 B;  4WY4 C;  3SWF A;  2YXR B;  3K5B A;  2FFD B;  5AVX B;  1SQP G;  1NTM J;  1VF5 B;  3Q2Y A;  2A06 E;  3E1R A;  1FZA A;  1VQP P;  2BCC J;  1T3J A;  1SFC C;  2E74 B;  3M0D A;  1KQL A;  2QJK B;  4WY4 D;  3ITK A;  2OYH C;  3H1K G;  1DIP A;  1S9K E;  2WPS A;  1OVV A;  2QE7 H;  3KPE A;  3H1J G;  1NTZ E;  2FY8 A;  3MUD A;  1SFC D;  1JEK A;  3AED C;  2HPC A;  2BAS A;  4BXL A;  4I1L A;  4ZMD A;  2K9J B;  2N9B A;  2HFE D;  3G9R A;  3SWK A;  1YQ4 C;  1EDI A;  1KYO H;  2ZT9 C;  3BRT B;  1NO4 A;  1N73 C;  4H44 C;  3L75 G;  1NTZ K;  1SQX E;  5M1B A;  1USD A;  2RMZ A;  2OTJ P;  1LTB C;  2KSE A;  2M5A A;  2FYN C;  4K3A A;  1CSB A;  2R5D A;  1RH5 B;  4H44 D;  2WSC H;  1GZL A;  3H1L D;  4HJG H;  1QVF O;  1AA0 A;  3A0H H;  3HE4 A;  2P1J A;  1FC2 C;  3G71 P;  2P10 A;  3L70 E;  1ZME C;  1W5C E;  1SLQ A;  2XZR A;  3SSU A;  1SQX K;  1LTS C;  1GK6 A;  1YIT P;  3ABV C;  2KB7 P;  4N6J A;  2W6J H;  3RL0 D;  5GTI H;  2HR3 A;  4U7J A;  3L73 J;  1GK4 A;  4JBZ A;  2NPS C;  2YIU B;  5CHX A;  3NFQ A;  4EIJ A;  1KIL E;  1VQL P;  1WMK A;  1M1J B;  1X0T A;  1L4A C;  1PPJ D;  2Q5U A;  1R8E A;  2M8R A;  3H1I J;  1EZV D;  2NPS D;  3TGU E;  1URQ D;  1RF0 C;  3GF7 A;  1LT1 A;  3HUS C;  1GL2 A;  1OFC X;  1DD4 A;  4AYC A;  1LGH B;  1L4A D;  1KYO E;  3LIE A;  1NKN A;  3WUV A;  1H88 A;  1S2E A;  2IYP A;  2QJY B;  5AW6 B;  1GD2 E;  1KIL A;  3CX5 H;  1N7S C;  1LP1 B;  3E7K A;  1Q86 Q;  3AE9 C;  1YQ3 C;  1IFM A;  2KP8 A;  1NTM D;  3CCJ P;  1M8O B;  3D6Z A;  3OAK A;  2KSJ A;  1L0N J;  1BGY J;  1PGO A;  3A0H E;  1N7S D;  3FXE A;  3A7O A;  1G1I A;  5EFW B;  1NTK K;  1KYO I;  1JNM A;  4Y99 C;  1BE3 D;  2P2U A;  1G1J A;  1K04 A;  1JY2 P;  3E1I A;  5CMZ A;  1NU1 E;  3L71 D;  1LTJ B;  3L72 E;  4PV1 C;  4HKZ H;  2E43 A;  2JWA A;  1CI6 B;  2O3J A;  2HYN A;  1FAV A;  3TDK A;  2B89 A;  2JR8 A;  3CWB G;  2WSF H;  1K9M Q;  3BVH A;  4EYY Q;  1W2E A;  3WU2 H;  2LXC B;  2FXO A;  1NAY A;  1NWQ A;  1VPC A;  1KN7 A;  1GDT A;  1NU1 K;  1HGZ A;  1KTM A;  4C7N B;  4A7P A;  2CPB A;  3V4Q A;  5KLI B;  2G3A A;  1BSN A;  3CC7 P;  3KYQ A;  2VRS A;  3MHV A;  3CX5 E;  1AVY A;  2L91 A;  4HH2 A;  2O01 J;  1NTK J;  4DJG A;  3HD7 B;  2FKW B;  2IFM A;  3Q5R A;  2DW3 A;  2Y0D A;  4I7Z C;  3WUT A;  2QA4 P;  2O1J A;  3T97 B;  2WQY C;  2LKM A;  2KS1 A;  1ZRT D;  3D71 A;  4BRY B;  4WY4 A;  2N1T C;  2A45 G;  2KOG A;  2AEM A;  3L36 A;  1SQQ G;  4GOF A;  1SFC A;  3Q5S A;  2GM4 A;  1PGJ A;  2E76 D;  2N1T D;  3WU2 E;  2OYH A;  1VQ7 P;  2CPS A;  1YJW P;  1VL2 A;  4RJT A;  1L0L G;  3R4Y A;  1YIJ P;  2QM7 A;  4WVZ A;  3CLQ A;  4I6M C;  1LT9 B;  4RKU J;  4H13 D;  3USS A;  4ZNC A;  1IO4 A;  1GL2 B;  1OW7 A;  4O9B A;  3G3Z A;  1G2C A;  2LXB A;  2E5T A;  1HUC A;  4DT0 A;  2M3B A;  4L74 A;  3BCC J;  2GUV A;  1N73 A;  2YNY A;  1BCC D;  1JTH A;  3LW5 J;  3CXH H;  5KKZ B;  3UIA A;  1EZV E;  2D2C B;  3MGN A;  2ZVO B;  2KI7 B;  5KLV G;  4XFJ A;  3D6Y A;  2ZAE B;  1SVF A;  4D6T E;  1JM0 A;  5DJT B;  2M0B A;  3PJS K;  3VP8 A;  1SQB E;  2KXP B;  3AE8 C;  3CCE P;  2E75 D;  1KQG B;  4K35 A;  4JF7 A;  4W7Z A;  4HYT B;  2XU6 A;  1OMI A;  1OX3 A;  3Q1M A;  1JY3 O;  1NTM E;  1Z56 A;  2G8Y A;  1EZV I;  3WMM 0;  1JUN A;  2NPS A;  5B5E H;  4OGQ B;  2BCC E;  2KZJ A;  4NPD A;  2IDB A;  3GHG B;  3H1K D;  1SQB K;  1L4A A;  1J1D B;  5AVQ B;  1OW8 A;  4JQ0 D;  5APU A;  3FWL A;  3JCU E;  3L73 G;  3GLM A;  1H89 A;  1QLE D;  2A06 G;  1RF0 A;  3H1L J;  5E79 H;  1JMB A;  3C9I A;  1FZG A;  2Z4E A;  2Z5I A;  1T2K D;  1NTM K;  1GU5 A;  1JB0 J;  2R5B A;  2KLV A;  3B5N B;  5APT A;  1M7L A;  2JEE A;  1N7S A;  2JKV A;  1XTC C;  3CL3 D;  3CXH E;  2K1A A;  2K37 A;  4ASV A;  3H25 A;  3CME P;  3SFD C;  2KNC A;  3IF4 A;  1FJP A;  3VOP A;  1R5S A;  5AW1 B;  1YTZ I;  1PP9 G;  3JC2 2;  1OW6 A;  3N7N A;  1LTI C;  3S9O A;  2B87 B;  3A2A A;  4IL6 X;  1SQX G;  1IFD A;  4EOT A;  1N2D C;  1H0T B;  1JY2 N;  2YKP A;  1AQT A;  3I56 P;  1LTA C;  1GW4 A;  2B9B A;  2OYH B;  3RBZ A;  2J58 A;  4WWI A;  5AW4 B;  2C9L Y;  3MP7 B;  2PGD A;  1GU4 A;  4U3F J;  1K05 A;  3U59 A;  1K73 Q;  2R32 A;  3BCC D;  3L70 G;  3L73 E;  2J59 M;  2N9Y B;  2E5Y A;  1PFI A;  2W8Z A;  4H0L D;  5E79 E;  2YMY A;  5BU8 B;  1PV3 A;  3S1K A;  1E79 H;  1X79 B;  1AV1 A;  3H1I E;  1T6A A;  2Q7C A;  3AE2 C;  1BE3 J;  2ZT9 B;  2RKL A;  2OTL P;  3P8C D;  3L71 J;  2IBZ E;  2OYI C;  1S5L X;  4DOJ A;  2FYN B;  4KJM A;  3TGU G;  2XNX A;  3RK2 D;  4PJ0 H;  1PP9 E;  3BAS A;  4GOD A;  2O01 H;  5CJ0 A;  1FDM A;  1KMI Z;  1NTK G;  2BEQ D;  3H1H J;  5BU5 A;  1LWU C;  2IFN A;  3PTZ A;  1VF5 C;  2KIK A;  2H89 C;  1USE A;  2OAR A;  1HH0 A;  2N1T A;  3RK3 D;  2Q9I A;  1L0N E;  1BGY E;  2W6B A;  2IBZ I;  4OWF A;  3BAT A;  4L75 A;  3H32 B;  3L37 A;  1FZC C;  1S3J A;  1VF5 D;  3RL0 g;  2O01 N;  4QMA A;  3RGU A;  2E74 D;  3O8Z A;  1FJK A;  3RL0 C;  1KZU B;  1P84 D;  1L4A B;  1RF1 C;  1YYC A;  1FZF A;  1DEB A;  3JSV C;  4IFF A;  1L0N K;  1NU1 G;  4YXD C;  5H2F H;  1Q7Y Q;  2IZ1 A;  3HUS B;  3L72 G;  5CCH D;  2WT7 A;  1FOS E;  1SQV J;  3I5C A;  1URQ C;  4AUW A;  1MFZ A;  2YKQ A;  1Q90 D;  1KB9 D;  1MV8 A;  1M90 Q;  3VP9 A;  1YJ9 P;  1WRG A;  2FYU J;  1J2J B;  1YTZ T;  3HE5 A;  3CCS P;  3AEE C;  2XDJ A;  3CCQ P;  2YKO A;  1NTK E;  3LW5 H;  3W68 A;  4DCK A;  4Y99 B;  3QH9 A;  2Z5H A;  3M9B A;  3B71 A;  4U3F D;  4M3L A;  1RE3 C;  1AVO A;  3AE7 C;  3CCL P;  4PV1 B;  2W6A A;  2QIW A;  1SQQ D;  2HOD A;  1M1J C;  1BCC J;  5AVY B;  1U7J A;  3AEB C;  3TNU A;  1NJI Q;  3V2R A;  5L8R J;  5KAI H;  2QM8 A;  3V5B A;  3KQG A;  5APX A;  3FGA D;  4ZKU A;  5H2F E;  5APY A;  3L74 J;  4UB8 H;  5CBO A;  5GTI E;  1HVV A;  3A0B H;  5KTB A;  2QJY C;  5KJ7 C;  1ZN5 A;  2XV5 A;  3KZI H;  1GW3 A;  2Q3I A;  3O6Q A;  1OZH A;  3H1L G;  1JY3 P;  3H1H D;  1SQP J;  2ITA A;  2POH A;  2NRG A;  1NOH A;  3VMX A;  2HPC B;  5KJ7 D;  1IK9 A;  3BCC E;  2H88 C;  1Y47 A;  4I7Z B;  1OWA A;  2Y9Y A;  1Y9B A;  3H1K J;  3AEF C;  1LTJ C;  5KLV D;  1KV4 A;  1HTL C;  3H1J J;  1ZXG A;  3C8V A;  2M5A B;  1CZQ A;  2J5U A;  1ZW0 A;  3P8M C;  3VYI A;  3VMA A;  2AEJ A;  3B8E B;  5B66 H;  5AW7 B;  1PGQ A;  1KB9 H;  1GMJ A;  1EZV G;  4JPZ B;  3HE4 B;  2Y9Z A;  1QGK B;  4D6T G;  5KAI E;  1NYH A;  1SQV D;  3L75 J;  1SQB G;  2E76 C;  4UB8 E;  1FS0 E;  5TJH A;  4LGD E;  2V7Q J;  1OVU A;  2FYU D;  2WT7 B;  2ZYD A;  4H13 C;  1U57 A;  2LR2 A;  2A06 D;  3FX0 A;  1S1C X;  1NTM G;  4LLH A;  2ZFC A;  3KZI E;  2YMK A;  1ZLL A;  2M3E A;  3H1L E;  2BCC G;  3HD7 C;  2H8P D;  1IZN B;  1RQU A;  2OYI A;  2YO3 A;  4C7R A;  3TSI A;  2JJL A;  4AQR D;  1S9K D;  2K3R A;  3U1C A;  1Q2N A;  1VQ9 P;  2ZJS E;  3IR9 A;  1NTZ D;  3PLN A;  4TT3 H;  1FU1 A;  3L35 A;  1VQ6 P;  2SPZ A;  1HJ0 A;  3HD7 D;  1EXJ A;  2QJP C;  2ZVN B;  4C46 A;  4DZO A;  3V6I A;  1LWU A;  1KIL B;  1UII A;  1Q81 Q;  3CI9 A;  4N3Y B;  4R4L A;  1S72 P;  1PPJ E;  1FZC A;  1KB9 E;  1HF9 A;  1MKM A;  1NH4 A;  2E75 C;  3L74 D;  1QL2 A;  1K8A Q;  1R5L A;  2MJZ A;  5C39 A;  4MN4 C;  2K88 A;  2KK7 A;  2FXM A;  5CCH A;  4KHX A;  1RF1 A;  4XA4 A;  2ZYA A;  3WUU A;  2K9J A;  1OXZ A;  3L70 D;  1SQP D;  4U3F E;  5CCG D;  3B4S A;  1BSH A;  1IFP A;  4JYB A;  1KB9 I;  2KUB A;  1DH3 A;  2QVA A;  1GL2 D;  1S4X A;  2I1J A;  1FZE A;  1URQ A;  3M06 A;  4Y28 J;  1NVO A;  3KDP B;  5KKZ C;  1ZP0 C;  3CCR P;  1T2K C;  5AW3 B;  2D2C C;  2JP3 A;  3H1J D;  3G4S P;  1W2B O;  1BE3 E;  4XE5 B;  1PZQ A;  2IZ0 A;  2ZXX A;  2YO2 A;  3L71 E;  2R3C A;  1PIX A;  4KT0 J;  3CWB J;  3H1I G;  2D2C D;  4GDO A;  2L5G B;  4IFD K;  2C0X A;  4Z1M H;  2IBZ G;  1RE3 A;  1QVG O;  1KC8 Q;  3L75 D;  2XKM A;  4EI2 A;  2HG5 D;  3H1H E;  1X22 A;  3IN6 A;  4OGQ C;  1MFT A;  4L73 A;  1RE4 C;  3GHG C;  1M1J A;  2KS1 B;  2W27 A;  4ZKP A;  2OTK E;  1SP4 A;  5AVT B;  4IL6 H;  4WY4 B;  1M57 D;  2W90 A;  2FXP A;  4OGQ D;  1VQ4 P;  4YPC A;  1NAF A;  1L0N G;  1BGY G;  1VQM P;  1CW5 A;  2IPP A;  3CCV P;  1SFC B;  1NU1 D;  4PD4 D;  3B5N C;  2WTY A;  5KJ7 A;  4JYC A;  5B5E E;  4H0L C;  1J1E C;  1LP1 A;  1FE6 A;  4TLF A;  1MZ9 A;  4UB6 H;  1KQS O;  1EQ7 A;  3M91 A;  1ZRT E;  3B5N D;  2PFX A;  5AVV B;  1JCC A;  1SQV E;  3PHL A;  1JY3 N;  1SQQ J;  2JWD A;  1KD1 Q;  1G2C B;  2GA1 A;  4GOE A;  1VQO P;  3TF5 A;  1IFI A;  1SS1 A;  1JMM A;  4L76 A;  3MIW A;  4HB1 A;  2P7J A;  2YXQ B;  2FYU E;  1LWU B;  1S5L H;  1L0L J;  3RK2 C;  1N73 B;  4H44 B;  1LTJ A;  2MKV A;  1MUU A;  1JTH B;  2CK3 H;  1CI6 A;  4RES B;  2AXC A;  3CX5 D;  1FZC B;  2P58 A;  1JCD A;  1SQV K;  2IX7 C;  3EQ2 A;  1LJ2 A;  1VQ8 P;  2WMM A;  1T8Z A;  3RK3 C;  3KXD A;  3R2P A;  4LC1 A;  2FFD C;  4IL6 E;  3RL0 B;  2PRR A;  3V2P A;  2FYU K;  1RF1 B;  4OVN F;  3GG2 A;  3S4R A;  4C7N A;  3Q5P A;  2ZXE B;  2E74 C;  3C1L A;  3KHU A;  2QJK C;  1JOC A;  1LNQ A;  1XTG B;  1BCC E;  4NPE A;  1PL5 A;  5TIS H;  3U1A A;  3TYY A;  2NPS B;  5KLV J;  1URQ B;  1N86 A;  3L74 E;  1A02 J;  4UB6 E;  3QWO C;  3CWB D;  3CC2 P;  3HTK A;  5CCH C;  2KYV A;  2AXT H;  1M1K Q;  3HD7 A;  2V7Q H;  2ZT9 D;  3NTN A;  1ZR2 A;  3FXD A;  2OQQ A;  3BRV B;  1L2P A;  3T97 A;  2I8D A;  3I55 P;  1SQP E;  3W67 A;  4BRY A;  2ZYG A;  5CBN A;  3L4F A;  1GTW A;  1S5L E;  1FZB A;  4PD4 H;  1D7M A;  1N7S B;  1YHQ P;  3OA7 A;  3H1K E;  1NKZ B;  3CPW O;  2KNC B;  4PJ0 E;  3BCC G;  1FOS F;  2K9Y A;  3IAO A;  3H1J E;  2Y0E A;  1EDJ A;  1SQP K;  3CD6 P;  1LT9 A;  1VQK P;  4EDF A;  2QG4 A;  3VMY A;  5CCG A;  3EFF K;  4GIF A;  4N78 D;  2O1K A;  1KQF B;  4D6T D;  1NTZ J;  2JO1 A;  1SQB D; 
#chains in the Genus database with same CATH homology
 1OVV A;  1X0T A;  4NPE A;  5CBO A;  4ZNC A;  1EDK A;  1OVU A;  2KUB A;  4BXL A;  2QVA A;  3S1K A;  2LR2 A;  1JMB A;  2Q1K A;  1LP1 A;  1LT1 A;  3QWO C;  2LXB A;  4ZMD A;  1NVO A;  2RKL A;  3FXD A;  1EDI A;  4CPG A;  3MHV A;  1DEE G;  2K3R A;  1Q2N A;  1LP1 B;  2JWD A;  1EDL A;  2I8D A;  4GOE A;  4KJM A;  4ASV A;  1Y47 A;  2SPZ A;  5CBN A;  1SS1 A;  2M5A A;  2B87 A;  4K3A A;  4HB1 A;  4ASW A;  2KI7 B;  1H0T A;  2QRX A;  4GOD A;  1BDD A;  5K5G B;  2ZAE B;  3PH0 A;  3FXE A;  1JM0 A;  4HJG H;  1OVR A;  4IOI H;  5DJT B;  2M0B A;  5EFW B;  1ZXG A;  2KIK A;  1BDC A;  2KZI A;  1FC2 C;  2LXC B;  2P58 A;  2B87 B;  2M5A B;  5DJU B;  1ZW0 A;  2B88 A;  4K35 A;  2WMM A;  1MFT A;  1H0T B;  1EDJ A;  2R44 A;  1U7M A;  1S3J A;  4HKZ H;  4NPF X;  2UWJ E;  5C39 A;  2KS1 B;  3MZW B;  4GOF A;  4MN4 C;  2OTK E;  2HR3 A;  3RGU A;  4WWI A;  2B89 A;  1U7J A;  4JBZ A;  4EYY Q;  1EC5 A;  2KZJ A;  3ZDM A;  4NPD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...