2IFNA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Virus
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ifnA00
2XKMA 4IFMA 3IFMA 1ZN5A 1IFNA 1QL2A 1IFMA 2KSJA 2KLVA 1PFIA 2IFNA 1QL1A 2IFMA
chains in the Genus database with same CATH superfamily
4B86A 5CJ0A 2WSSH 5GTIH 5AW9B 5CCHD 3H1IG 3VYIA 2OYOA 3BCCG 5AW1B 5APXA 2B89A 2JEEA 1JUNA 3RK3D 1D7MA 2HFED 3G71P 3BASA 4ASWA 1YJ9P 2ZJSE 1RHZB 1SFCB 1KILA 1NWQA 1FZFA 2HR3A 1LWUB 2YO3A 3A3YB 3OW2O 3Q5SA 1RF1C 4XA4A 3JCUH 4PV1B 3UIAA 1YIJP 2K37A 3KDPB 3VMYA 3NFQA 1PP9D 3CC2P 5BVZA 1SQBJ 4RJTA 3P8CD 1SQVG 1LTTC 4C7NA 2Q3IA 1EDKA 3IAOA 1WT6A 3A7OA 2RMZA 1YQ3C 1T8ZA 1J1EC 2O01H 2YMKA 2Q7CA 5CHXA 1L2PA 3EFGA 1VQ8P 1GL2A 1R5LA 3KQGA 3TGUG 3H25A 1N73A 1QL1A 3H1KG 1QVFO 1BE3E 1QEXA 3BCCD 3Q5PA 1RF0C 2IZ0A 5KLVE 1WRGA 5KKZB 2ZAEB 1N86A 2W27A 1VF5C 2H8PD 1U7JA 1YITP 2D2CD 1JCCA 1DD4A 1L0NK 2FXPA 3H1JG 5AW3B 2E76B 3CCJP 3O8ZA 4LLHA 2WVRA 4U3FG 1OW8A 3B5NB 1L0LE 1NTKK 2I8DA 2CK3H 3TK1A 3OA7A 1S1CX 4BWNA 1FDMA 3R4YA 1LP1B 5AVWB 1AJYA 1NTKG 1DX7A 5KJ7C 2LR2A 1ZRTD 3H6PA 3TNUB 1CW5A 5KAFH 3H32A 1YBKA 4Y99C 1BGYJ 3CMEP 2Q9IA 2DW3A 1GW3A 2OYIB 2FYUE 4OVNF 1N7SB 1GMJA 1YTZT 3TGUD 2QJYB 3H1KD 1AVOA 3H1LG 1EQ7A 1VQLP 1VQKP 2C9NY 1IO4A 3MP7B 1BCCG 3CXHD 3V6IA 5KAIE 2Z5HA 1JTHB 2C9LY 5AVTB 3HUSA 1N8RQ 5GTHE 1FZBA 2IBZE 2WT7B 3H1JD 2JWAA 3E1RA 4JYBA 4U7JA 2GA1A 2PP6A 1UIIA 2M3EA 2QRXA 1VQNP 4GOFA 2SPZA 5CCHA 1FZCB 4U3FD 1MV8A 4JQ0D 1U7MA 2BASA 2HODB 1JB0J 2OYHA 3CC7P 3A0BE 2O01N 4IL6H 3AEDC 1AQTA 1USDA 2QIWA 4DOJA 3CCMP 1NTKD 1Q82Q 1YYCA 4O9BA 3K5BA 4I7ZB 1M56D 2A06E 1X0TA 2M8RA 2IBZI 2E75B 4TT3H 4D6TG 3MIWA 2P67A 4L75A 3GHGC 1KC8Q 2Q3EA 1SQBE 2I1KA 5AVZB 4N6JA 4JYCA 3USSA 1OWAA 3HE4B 3H1LD 2J58A 3G3ZA 1BCCD 4WWIA 4W7YA 2WSEH 1NTMJ 3L70G 1P84E 3VN0A 4CPGA 3JSVC 3L36A 2WQYC 3LW5J 2P58A 3TYYA 2J5UA 4PD4E 1NYHA 3CWBG 3RL0D 3Q1MA 2PRRA 1OIPA 2P2UA 5CCGC 1NJIQ 1MUUA 3M9HA 1K05A 1HWTC 3E1IA 3CLQA 2KOGA 5TISH 4OGQB 2R3CA 2H43A 1EDLA 4GODA 1GU4A 2WTYA 5AW0B 1P84I 2BCCG 2JDIH 1LTAC 1SQQG 4IL6X 2A45G 3NTNA 4PD4I 4D6TD 3SFEC 2FFDA 2N1TD 4ZKPA 3BVHA 1PZQA 1SQPJ 1LTSC 3VMZA 3CI9A 1KYOE 2K9JA 1HVVA 1OVRA 2IX7C 3CCLP 1DIPA 3IFMA 3WUTA 1BGYE 1VF5D 2NPSB 1L4AB 1EZVE 3L70D 3AE3C 4L74A 3O6QA 2W83C 1JOCA 2O1JA 3HE5B 3CWBD 1SVFA 1FC2C 1SQXJ 3AEAC 2QJKB 1CZQA 1AFOA 1KQLA 1SFCC 1NO4A 3BRVB 3F5HA 2O01J 5AVXB 1FOSF 1KYOI 1LWUC 1PP9J 5KJ7D 3PJSK 4PV1C 5APSA 1EZVI 2BCCD 1VQOP 1SQQD 4ASVA 1URQB 4H44B 5B66H 3C8VA 2UWJE 1PIXA 1VDFA 1NU1K 4WB4A 1VPCA 2AEFA 3AE6C 2QSIA 1W2BO 2KSJA 1DEBA 2WPVB 1R8EA 2FYNB 2A45H 5BU8B 2ITAA 3L4FA 3BCCJ 2N9YB 1OMIA 1H89A 1JO5A 1KB9E 1LNQA 5KKZC 4IFMA 1HGZA 3M0AA 1IFDA 4N78D 3A0HH 1NTME 2P7JA 3I5CA 1FAVA 2E76C 4WY4B 4LGDE 2GUVA 2ZVNB 1BE3G 3M06A 1ZR2A 4OWFA 3Q2YA 1GK6A 3V2RA 1IFPA 3B5NC 5KLVG 2P1JA 2OGUA 1RF1A 3M0DC 1KB9I 5AVQB 1ZV8A 2KSEA 5TJHA 3GMAA 3T97A 3CX5D 5H2FH 3SWYA 2FY8A 1NTZJ 2YKOA 4IFFA 1ZMEC 3VMAA 1S2EA 4YXWH 2O3JA 5GTIE 4KJMA 1NU1D 2OYIC 5AVSB 1N7SC 3PH0A 3CX5H 3HRNA 2QJYC 1KZUB 3CCVP 4TLFA 1SQPE 2N1TA 1LT1A 2KXPB 2XU6A 4GKGA 2W6JH 3HD7B 5CCGD 1GW4A 2N9BA 1SQVK 2AXTH 1SS1A 4R4LA 1OVUA 1RF0A 3JCUE 4EOTA 2FYUG 2KI7B 2WMMA 2KS1B 1G1JA 1NAYA 4U3FJ 2NZ2A 1GDTA 1L0NJ 2JWDA 3C1LA 1SQXE 1FZCC 2FXOA 1R5SA 2QM7A 3L72G 3IR9A 1NTKJ 1JY2P 1NAFA 2J59M 1Q7YQ 1M8OB 2K88A 5AVRB 3WMM0 2WSEJ 4GIFA 1YTZI 2IBZG 3H1ID 1PP9E 3E7KA 2KNCB 4I7ZC 3ABVC 3TDKA 3MZWB 2E75C 5KJ7A 1KFNA 4DJGA 2B87A 3H1LJ 4C7RA 1VQ7P 1G2CB 3D70A 4IOIH 1GK4A 1CI6B 3N4XA 3RL0g 4AQRD 2ZT9C 3AE4C 4EIJA 1BDCA 1IJDB 1X79B 2WITA 1FE6A 4L76A 1PPJG 5KTBA 2K1AA 2M5AA 3BCCE 2FYUD 1LTJB 1SQVD 1SQBG 2ZYDA 3H1HJ 4PV1D 2O1KA 3KZIE 1Z56A 3P8MC 2YKQA 2Y9ZA 2H88C 3RBXA 2KLVA 3A5TA 2BEZF 1EXJA 4UB6H 1LT9B 3L72D 2QE7H 3VP9A 1ZLLA 3B71A 4W80A 4RO0A 5APYA 4YXDC 2WSFJ 3U1AA 3TF5A 5KAFE 4OGQC 1OZHA 1IC2A 3C9IA 3EWKA 3AE2C 4HYTB 1NVOA 1M1JA 2E43A 3L73J 3MGNA 3HTKB 1JEKA 2POHA 3EFFK 3B8EB 2Z5IA 1PGQA 3NMDA 3S4RA 3GF3A 5AVUB 1QVGO 2IPPA 2KP8A 2WSCH 2M0BA 4EDFA 1XTCC 1GTWA 3GHGA 4BRYA 3U59A 1NTZE 1RQUA 3ITKA 1A02F 2OTJP 3CXHH 2RN0A 3L75J 2NPSC 1L4AC 3CWBJ 3GLMA 1Y9BA 1PPJD 3IN6A 5APTA 2HPCA 1K04A 3AE9C 2E76D 3A0BH 2ZYGA 2QJKC 4I6MC 4H13B 1OXZA 1T6AA 4L73A 1KILB 2IFMA 3B5ND 1K73Q 1AV1A 2AEMA 2W6AA 4H0LB 3RK2B 4IL6E 4BXLA 3GG2A 5AW4B 1BGYG 4LC1A 3VP8A 5CCGA 1EZVG 1P84D 3II6A 1FDIA 4U3FE 1L0NE 4PD4D 1GD2E 1K8AQ 1Q86Q 2XV5A 3FGAD 1EDIA 2ZT9B 2R3SA 3QH9A 3L37A 4C7NB 1URQC 3PRJA 1FZGA 4H44C 1DEEG 1NTKE 1N7SD 3WU2H 4EYYQ 2Q5UA 2V7QH 1S5LH 1P84H 1H88A 1OW7A 4PD4H 2E74B 1GL2B 3AEGC 2FYNC 1H0TA 2E5YA 1N73B 2Y9YA 2Y0DA 3H1LE 1RE4C 3CCRP 1LTBC 5AVVB 2RKLA 1SQQK 2JKVA 4UB8H 1YI2P 2QVAA 5CJ4A 3D6ZA 5DJTB 3SSUA 4JBZA 3L74J 4Y28J 1IFIA 2XZRA 2KIKA 2C0WA 1BGYD 3CPWO 4I2LC 1J2JB 1RQVA 5L8RJ 4WY4C 1KQGB 5AW7B 3LIDA 1JY2O 1VQ5P 5B5EH 2KK7A 1IFNA 1AA0A 1SFCA 4WVZA 1OX3A 3CCUP 3H1HE 1X22A 1LWUA 2QJPB 1YJWP 1S9KE 1Y47A 1KFMA 2E75D 5APWA 1FZEA 3G6EP 5BU5A 2KZIA 1IK9A 5E79H 3OAKA 1VL2A 3FWNA 4WBAA 2H7HA 3H32B 1Q2NA 1NTMG 1NU1J 1KILE 1FOSE 1NHLA 1M90Q 4GDOA 2YIUC 2K3RA 2BEQD 5AW8B 1S5LX 3L73E 1LJ2A 3L71G 5KLIB 1PGPA 1RE3C 2HLOA 3CCSP 2ZXEB 2XNXA 2NRGA 3HD7C 3HUSB 2OTLP 1FU1A 1YJNP 1E5WA 3L75E 3CWBE 1USEA 1S72P 1IFMA 3MUDC 1SQPK 2YXRB 1VQMP 3FX0A 4OGQD 4ZNCA 2PGDA 2QA4P 2KLUA 1PL5A 1SQPG 1KB9D 2OYHB 1JY3P 4ZMDA 3RK3B 4KHXA 3M9QA 5M1BA 3H1IJ 2JR8A 4C46A 2ZVOB 3KYQA 1J1DB 1JNMA 1HJBA 4YPCA 1NH4A 3B5NA 1SQXK 4IFDK 1LTGC 3M0DA 3WUVA 2ZYAA 1LP1A 2WPRA 1T2KC 1SQXG 2LKMA 2H89C 2NPSD 1L4AD 3TNUA 1JY3N 3L71D 1HUCA 1QX8A 1NKZB 2ZFCA 3BATA 3D6YA 5AVYB 2IFNA 2OYIA 5KLVK 1JM0A 4MN4C 1N7SA 3A0HE 5AW6B 3CL3D 2HG5D 1SQVJ 1W5CE 4PJ0H 1N2DC 1BDDA 2JO1A 1G1IA 4HKZH 2A45I 2XKMA 1LTJC 3G9RA 3MTUE 1JTHA 1EXIA 3L72J 4I1LA 3GF7A 1HTLC 5APQA 2WPSA 2E5TA 1L0LK 4N78E 2WT7A 1SQPD 2XDJA 3SFDC 3RGUA 2YIUB 1LT9C 5AW2B 1URQD 3TGUJ 2WSCJ 3L74E 3H1KJ 4H44D 3W67A 1L0LG 1FZCA 2W6BA 2CPBA 1EDJA 2D2CB 2YXQB 1ZW0A 2HODA 2IYPA 3AEFC 2YNYA 2FFDB 2Z4EA 2KUBA 2FYUK 3CX5E 1IK7A 2R5DA 1SQXD 2KB7P 1NOHA 1ZP0C 4GT1A 1RH5B 3H1JJ 3L35A 2KZJA 3AEBC 2Y0EA 3P32A 2K9JB 4NPFX 1KTMA 3RL0C 5DJUB 3RK3E 2AXTE 1NU1E 3PP5A 1BE3D 1JMBA 3OJAB 2RH0A 3O6QB 2ZXXA 1GZLA 4ZKUA 3HE4A 1Q90D 3EQ2A 1M57D 3BRTB 1DD3A 5KLVD 3V4QA 3V2NA 2Q1KA 4DZOA 3MD0A 4WY4D 2MJZA 1NTZK 4HJGH 3CX5I 5APUA 2AEJA 1KD1Q 4H13C 3VOPA 1KILC 2V7QJ 1T3JA 4H0LC 3RK2C 1NTZG 3V2PA 2XNDH 2N1TC 3P8CE 4YTPC 2JP3A 3QWOC 5CBNA 3CMAP 4K3AA 1L0LD 1BCCJ 1WMKA 1JY2N 1OFCX 1SP4A 1HGVA 1M7LA 2R44A 4N3YB 1LGHB 1MKMA 1VQPP 3FXEA 2QM8A 4JF7A 1SQBK 2A06G 3H1IE 1SFCD 3V4WA 3NXSA 1FDOA 4QMAA 3HD7D 2E74C 1GL2C 1L0NG 2WPQA 1ZOYC 1N73C 1KORA 3KZIH 4JPZB 3S9OA 3R2PA 2L5GB 4A7PA 2FKWB 1FJPA 2YMYA 3VMXA 4W7ZA 1NGMB 2NPSA 1L4AA 4EI2A 3CCQP 4K35A 4UB6E 1IFJA 2YKPA 1OVVA 2IBZD 4D6TJ 1K9MQ 2OQQA 3HE5A 1PFIA 2K9YA 1NTZD 3N7NA 2Q6QA 1SQVE 1JY3O 1MFTA 1ZR4A 5APVA 1ZRTE 3SWFA 1XTGB 5KAIH 3RL0B 3VTPC 3D71A 5GTHH 1RF1B 3L72E 2B88A 2QJPC 1VQ9P 2OARA 3L70J 3AEEC 3JC22 4XFJA 3T97B 1T2KD 2L91A 5CBOA 2G8YA 1FJKA 3TGUE 2E42A 2A06D 3H1KE 3PLNA 3P7KA 2JJLA 3SWKA 2LXCB 2M3BA 3AECC 1URQA 2HYNA 3CXHE 5EFWB 1Y8AA 1QGKB 3AE5C 1SQBD 1HF9A 2W8ZA 3LIEA 3H1HG 1L0ND 1J1EB 3CD6P 5KLIC 2MKVA 1M1JC 4Z1MH 2N1TB 2IDBA 3H1JE 1Q81Q 1HBWA 2BCCJ 1BSHA 1JMMA 2G3AA 1SQQJ 1EC5A 1BSNA 2IZ1A 3HUSC 1RE4A 1PPJE 2KYVA 1VF5B 4HH2A 3L73G 3CXHI 5CCHC 2PFXA 4DT0A 1KQFB 2B9BA 1KMIZ 1M1KQ 2P10A 3V5BA 2YO2A 2FYZA 3G4SP 2OYHC 1QL2A 3RK3C 3IF4A 3WU2E 3KPEA 4WY4A 1ZN5A 1HH0A 1S5LE 1RY3A 3I56P 1S4XA 1J1DC 3L75G 4R4MA 1BCCE 3L71J 1ZXGA 2B87B 3B4SA 2GM4A 4Y99B 3AE7C 3H1HD 2GUSA 1KYOD 2FBWC 1CSBA 5TISE 1S9KD 1AQ5A 4UB8E 3PTZA 2WWWA 2AXCA 1EZVD 3A2AA 3W68A 2VRSA 4RESB 1RE3A 2FXMA 4H13D 2M5AB 3S1KA 3M9BA 1KILD 1NKNA 3RK2D 4H0LD 3Q3DA 1GU5A 4AYCA 1NTMK 1KYOH 1T3UA 4HB1A 5B5EE 3HD7A 2WZ7A 3L73D 1AVYA 4OH8B 1H8AA 2WSFH 2KS1A 3MUDA 2ZT9D 4D6TE 5E79E 2QEXP 3FXDA 1S3JA 1KQSO 1JCDA 1MZ9A 1W2EA 3I55P 3CC4P 2D2CC 2I1JA 1X8YA 1DH3A 1M1JB 3L75D 1SLQA 2FFDC 2LXBA 1U57A 2E74D 1GL2D 1X9VA 1FS0E 2PAJA 4GOEA 2V4HA 3L70E 1PGJA 2QG4A 2KNCA 1KV4A 3TSIA 3KHUA 3L74G 1MFZA 3KXDA 3GHGB 2R32A 4BRYB 4RKUJ 1BE3J 3AE8C 3RBZA 5C39A 1PV3A 5KLVJ 2C0XA 3U1CA 1VQ4P 1G2CA 1UIXA 4M3LA 1FZAA 5B66E 1CI6A 2HPCB 3ZDMA 1KN7A 1N7LA 3V2QA 4DCKA 1FBMA 3FWLA 1NTMD 2BCCE 2Y0CA 4XE5B 1SQQE 4NPEA 1NU1G 1L0LJ 1LTJA 1PGOA 2IYOA 1KB9H 5AW5B 2OTKE 1YQ4C 1VQ6P 5K5GB 3PHLA 1E79H 1HJ0A 4AUWA 1LT9A 4NPDA 2W90A 3GW6A 3LW5H 1TU3F 3MHVA 1QLED 4KT0J 1PP9G 1IZNB 5CMZA 2FYUJ 1YHQP 1A02J 1OW6A 3Q5RA 3L74D 2R5BA 3HTKA 1H0TB 4PJ0E 3AE1C 3F89A 1LTIC 3L71E 3CCEP 2CPSA 3M91A 5H2FE 3WUUA
chains in the Genus database with same CATH topology
4B86A 5CJ0A 1GD2E 1CZQA 2XV5A 1AFOA 1KQLA 5AW9B 5CCHD 1SFCC 3VYIA 3HD7D 3L37A 1NO4A 3BRVB 4C7NB 1URQC 5AVXB 1GL2C 1FOSF 5AW1B 1LWUC 2WPQA 5APXA 1FZGA 1N73C 2JEEA 1N7SD 3R2PA 5KJ7D 1JUNA 2L5GB 3RK3D 2Q5UA 2HFED 2FKWB 5APSA 1FJPA 3BASA 2YMYA 3VMXA 4W7ZA 1H88A 2NPSA 1SFCB 1L4AA 1KILA 1NWQA 1URQB 1FZFA 1GL2B 1IFJA 1LWUB 2YKPA 2YO3A 3A3YB 1N73B 3HE5A 1RF1C 4XA4A 1VDFA 1NU1K 3UIAA 4WB4A 1PFIA 1VPCA 1RE4C 3N7NA 3KDPB 1LTBC 3VMYA 5AVVB 3NFQA 1JY3O 1ZR4A 1SQQK 5APVA 2KSJA 5BVZA 3SWFA 1XTGB 1DEBA 5CJ4A 3RL0B 3VTPC 3P8CD 2A45H 5BU8B 1LTTC 3L4FA 4C7NA 1RF1B 2Q3IA 2OARA 1IFIA 1WT6A 3A7OA 2XZRA 1T2KD 1H89A 2C0WA 1JO5A 4I2LC 1T8ZA 1FJKA 1J1EC 1J2JB 2O01H 4WY4C 5AW7B 3LIDA 2E42A 1JY2O 2Q7CA 5CHXA 4IFMA 1IFNA 3P7KA 2JJLA 1SFCA 1HGZA 3M0AA 2M3BA 3EFGA 1URQA 1GL2A 1IFDA 2HYNA 1LWUA 3KQGA 4N78D 1S9KE 1N73A 1KFMA 1QL1A 5APWA 1FZEA 5BU5A 3LIEA 2P7JA 1IK9A 3I5CA 1J1EB 1RF0C 1FAVA 4WY4B 1WRGA 3OAKA 4WBAA 2H7HA 3H32B 4LGDE 2GUVA 1N86A 3M06A 1M1JC 1ZR2A 2N1TB 2W27A 1GK6A 3V2RA 1FOSE 1NHLA 3B5NC 1HBWA 2H8PD 2P1JA 1JMMA 1RF1A 1JCCA 3M0DC 1L0NK 5AVQB 1ZV8A 5AW8B 3HUSC 3T97A 5AW3B 1RE4A 3O8ZA 1RE3C 2KYVA 3SWYA 4LLHA 2HLOA 2YKOA 4HH2A 4IFFA 3B5NB 1NTKK 2ZXEB 2XNXA 3TK1A 5CCHC 3HD7C 3OA7A 1FDMA 2OYIC 5AVSB 3HUSB 3V5BA 2YO2A 5AVWB 2FYZA 1DX7A 2OYHC 1QL2A 1N7SC 1FU1A 5KJ7C 3RK3C 3HRNA 3KPEA 4WY4A 1E5WA 1ZN5A 3H6PA 3TNUB 1KZUB 1CW5A 1HH0A 1IFMA 3H32A 1RY3A 1SQPK 4Y99C 2N1TA 2Q9IA 1GW3A 2XU6A 4GKGA 1J1DC 3HD7B 5CCGD 1GW4A 2OYIB 2N9BA 1SQVK 2OYHB 1JY3P 1N7SB 3RK3B 1RF0A 1YTZT 4KHXA 3M9QA 4EOTA 1EQ7A 1G1JA 2GM4A 4Y99B 2C9NY 1IO4A 1GDTA 4C46A 3KYQA 1J1DB 2GUSA 1JNMA 1HJBA 1CSBA 1NH4A 3B5NA 1S9KD 1AQ5A 1SQXK 1FZCC 4IFDK 1LTGC 2WWWA 2Z5HA 1JTHB 3M0DA 2C9LY 5AVTB 2QM7A 3HUSA 3IR9A 1FZBA 1JY2P 3A2AA 2WPRA 1NAFA 2VRSA 2J59M 4RESB 1T2KC 1RE3A 2FXMA 2WT7B 2LKMA 2NPSD 1L4AD 3M9BA 1KILD 3TNUA 5AVRB 1NKNA 4JYBA 1JY3N 3WMM0 3RK2D 2PP6A 1GU5A 4AYCA 4GIFA 1YTZI 1HUCA 1NTMK 1NKZB 2ZFCA 3BATA 5AVYB 5CCHA 1FZCB 1T3UA 3HD7A 2IFNA 1MV8A 2WZ7A 2OYIA 5KLVK 2BASA 2HODB 2OYHA 5KJ7A 1N7SA 4OH8B 1KFNA 5AW6B 3CL3D 2HG5D 1H8AA 2WSFH 4C7RA 3MUDA 1G2CB 4DOJA 1N2DC 1YYCA 4O9BA 1JCDA 1GK4A 1MZ9A 1CI6B 1G1IA 3N4XA 2A45I 4AQRD 1W2EA 1LTJC 2XKMA 4EIJA 2M8RA 3MTUE 1JTHA 1IJDB 2I1JA 4I1LA 1X8YA 1DH3A 1HTLC 1M1JB 1X79B 2WITA 3MIWA 5APQA 2WPSA 2P67A 1L0LK 3GHGC 4N78E 1SLQA 2WT7A 5KTBA 2XDJA 2FFDC 2I1KA 1LT9C 5AVZB 5AW2B 1URQD 4N6JA 4JYCA 1OWAA 1GL2D 1X9VA 3HE4B 2PAJA 2J58A 3G3ZA 1LTJB 1FZCA 2W6BA 2CPBA 2O1KA 1Z56A 4W7YA 3TSIA 2WSEH 3P8MC 2YKQA 2HODA 1MFZA 3GHGB 2R32A 2KLVA 3A5TA 2YNYA 3VN0A 3L36A 2FFDB 2Z4EA 1LT9B 3TYYA 3VP9A 2C0XA 1ZLLA 3U1CA 2FYUK 1G2CA 4W80A 5APYA 2R5DA 3RL0D 3U1AA 2KB7P 1NOHA 4GT1A 4M3LA 1FZAA 3L35A 1CI6A 2P2UA 2HPCB 1IC2A 3C9IA 5CCGC 3P32A 1N7LA 4HYTB 3RL0C 3V2QA 1M1JA 2E43A 1MUUA 1FBMA 3M9HA 1HWTC 3E1IA 3PP5A 3MGNA 3CLQA 2KOGA 2POHA 3HTKB 3OJAB 3B8EB 2Z5IA 1GZLA 4ZKUA 4XE5B 3NMDA 3HE4A 2R3CA 2H43A 3EQ2A 1LTJA 3BRTB 3V4QA 5AVUB 1GU4A 2WTYA 3V2NA 5AW5B 2IPPA 5AW0B 4DZOA 2KP8A 3MD0A 2WSCH 4WY4D 2MJZA 1LTAC 1XTCC 1NTZK 1GTWA 3GHGA 2A45G 3U59A 3NTNA 5APUA 2FFDA 4AUWA 1A02F 2N1TD 1LT9A 2NPSC 1L4AC 3VOPA 1KILC 4ZKPA 3BVHA 1T3JA 3RK2C 3V2PA 1LTSC 3VMZA 3LW5H 2N1TC 3P8CE 5APTA 2HPCA 5CMZA 3CI9A 1HVVA 2IX7C 1A02J 3IFMA 1JY2N 1SP4A 4I6MC 1OXZA 1HGVA 1M7LA 1L4AB 2NPSB 1KILB 4N3YB 1LGHB 2IFMA 3B5ND 2W6AA 3RK2B 2R5BA 3HTKA 5AW4B 1JOCA 2O1JA 3HE5B 4LC1A 2QM8A 3VP8A 5CCGA 1LTIC 1SVFA 4JF7A 1SQBK 3II6A 2CPSA 3M91A 1SFCD 3V4WA 3NXSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XKM A;  4IFM A;  3IFM A;  1ZN5 A;  1IFN A;  1QL2 A;  1IFM A;  2KSJ A;  2KLV A;  1PFI A;  2IFN A;  1QL1 A;  2IFM A; 
#chains in the Genus database with same CATH topology
 4B86 A;  5CJ0 A;  2WSS H;  5GTI H;  5AW9 B;  5CCH D;  3H1I G;  3VYI A;  2OYO A;  3BCC G;  5AW1 B;  5APX A;  2B89 A;  2JEE A;  1JUN A;  3RK3 D;  1D7M A;  2HFE D;  3G71 P;  3BAS A;  4ASW A;  1YJ9 P;  2ZJS E;  1RHZ B;  1SFC B;  1KIL A;  1NWQ A;  1FZF A;  2HR3 A;  1LWU B;  2YO3 A;  3A3Y B;  3OW2 O;  3Q5S A;  1RF1 C;  4XA4 A;  3JCU H;  4PV1 B;  3UIA A;  1YIJ P;  2K37 A;  3KDP B;  3VMY A;  3NFQ A;  1PP9 D;  3CC2 P;  5BVZ A;  1SQB J;  4RJT A;  3P8C D;  1SQV G;  1LTT C;  4C7N A;  2Q3I A;  1EDK A;  3IAO A;  1WT6 A;  3A7O A;  2RMZ A;  1YQ3 C;  1T8Z A;  1J1E C;  2O01 H;  2YMK A;  2Q7C A;  5CHX A;  1L2P A;  3EFG A;  1VQ8 P;  1GL2 A;  1R5L A;  3KQG A;  3TGU G;  3H25 A;  1N73 A;  1QL1 A;  3H1K G;  1QVF O;  1BE3 E;  1QEX A;  3BCC D;  3Q5P A;  1RF0 C;  2IZ0 A;  5KLV E;  1WRG A;  5KKZ B;  2ZAE B;  1N86 A;  2W27 A;  1VF5 C;  2H8P D;  1U7J A;  1YIT P;  2D2C D;  1JCC A;  1DD4 A;  1L0N K;  2FXP A;  3H1J G;  5AW3 B;  2E76 B;  3CCJ P;  3O8Z A;  4LLH A;  2WVR A;  4U3F G;  1OW8 A;  3B5N B;  1L0L E;  1NTK K;  2I8D A;  2CK3 H;  3TK1 A;  3OA7 A;  1S1C X;  4BWN A;  1FDM A;  3R4Y A;  1LP1 B;  5AVW B;  1AJY A;  1NTK G;  1DX7 A;  5KJ7 C;  2LR2 A;  1ZRT D;  3H6P A;  3TNU B;  1CW5 A;  5KAF H;  3H32 A;  1YBK A;  4Y99 C;  1BGY J;  3CME P;  2Q9I A;  2DW3 A;  1GW3 A;  2OYI B;  2FYU E;  4OVN F;  1N7S B;  1GMJ A;  1YTZ T;  3TGU D;  2QJY B;  3H1K D;  1AVO A;  3H1L G;  1EQ7 A;  1VQL P;  1VQK P;  2C9N Y;  1IO4 A;  3MP7 B;  1BCC G;  3CXH D;  3V6I A;  5KAI E;  2Z5H A;  1JTH B;  2C9L Y;  5AVT B;  3HUS A;  1N8R Q;  5GTH E;  1FZB A;  2IBZ E;  2WT7 B;  3H1J D;  2JWA A;  3E1R A;  4JYB A;  4U7J A;  2GA1 A;  2PP6 A;  1UII A;  2M3E A;  2QRX A;  1VQN P;  4GOF A;  2SPZ A;  5CCH A;  1FZC B;  4U3F D;  1MV8 A;  4JQ0 D;  1U7M A;  2BAS A;  2HOD B;  1JB0 J;  2OYH A;  3CC7 P;  3A0B E;  2O01 N;  4IL6 H;  3AED C;  1AQT A;  1USD A;  2QIW A;  4DOJ A;  3CCM P;  1NTK D;  1Q82 Q;  1YYC A;  4O9B A;  3K5B A;  4I7Z B;  1M56 D;  2A06 E;  1X0T A;  2M8R A;  2IBZ I;  2E75 B;  4TT3 H;  4D6T G;  3MIW A;  2P67 A;  4L75 A;  3GHG C;  1KC8 Q;  2Q3E A;  1SQB E;  2I1K A;  5AVZ B;  4N6J A;  4JYC A;  3USS A;  1OWA A;  3HE4 B;  3H1L D;  2J58 A;  3G3Z A;  1BCC D;  4WWI A;  4W7Y A;  2WSE H;  1NTM J;  3L70 G;  1P84 E;  3VN0 A;  4CPG A;  3JSV C;  3L36 A;  2WQY C;  3LW5 J;  2P58 A;  3TYY A;  2J5U A;  4PD4 E;  1NYH A;  3CWB G;  3RL0 D;  3Q1M A;  2PRR A;  1OIP A;  2P2U A;  5CCG C;  1NJI Q;  1MUU A;  3M9H A;  1K05 A;  1HWT C;  3E1I A;  3CLQ A;  2KOG A;  5TIS H;  4OGQ B;  2R3C A;  2H43 A;  1EDL A;  4GOD A;  1GU4 A;  2WTY A;  5AW0 B;  1P84 I;  2BCC G;  2JDI H;  1LTA C;  1SQQ G;  4IL6 X;  2A45 G;  3NTN A;  4PD4 I;  4D6T D;  3SFE C;  2FFD A;  2N1T D;  4ZKP A;  3BVH A;  1PZQ A;  1SQP J;  1LTS C;  3VMZ A;  3CI9 A;  1KYO E;  2K9J A;  1HVV A;  1OVR A;  2IX7 C;  3CCL P;  1DIP A;  3IFM A;  3WUT A;  1BGY E;  1VF5 D;  2NPS B;  1L4A B;  1EZV E;  3L70 D;  3AE3 C;  4L74 A;  3O6Q A;  2W83 C;  1JOC A;  2O1J A;  3HE5 B;  3CWB D;  1SVF A;  1FC2 C;  1SQX J;  3AEA C;  2QJK B;  1CZQ A;  1AFO A;  1KQL A;  1SFC C;  1NO4 A;  3BRV B;  3F5H A;  2O01 J;  5AVX B;  1FOS F;  1KYO I;  1LWU C;  1PP9 J;  5KJ7 D;  3PJS K;  4PV1 C;  5APS A;  1EZV I;  2BCC D;  1VQO P;  1SQQ D;  4ASV A;  1URQ B;  4H44 B;  5B66 H;  3C8V A;  2UWJ E;  1PIX A;  1VDF A;  1NU1 K;  4WB4 A;  1VPC A;  2AEF A;  3AE6 C;  2QSI A;  1W2B O;  2KSJ A;  1DEB A;  2WPV B;  1R8E A;  2FYN B;  2A45 H;  5BU8 B;  2ITA A;  3L4F A;  3BCC J;  2N9Y B;  1OMI A;  1H89 A;  1JO5 A;  1KB9 E;  1LNQ A;  5KKZ C;  4IFM A;  1HGZ A;  3M0A A;  1IFD A;  4N78 D;  3A0H H;  1NTM E;  2P7J A;  3I5C A;  1FAV A;  2E76 C;  4WY4 B;  4LGD E;  2GUV A;  2ZVN B;  1BE3 G;  3M06 A;  1ZR2 A;  4OWF A;  3Q2Y A;  1GK6 A;  3V2R A;  1IFP A;  3B5N C;  5KLV G;  2P1J A;  2OGU A;  1RF1 A;  3M0D C;  1KB9 I;  5AVQ B;  1ZV8 A;  2KSE A;  5TJH A;  3GMA A;  3T97 A;  3CX5 D;  5H2F H;  3SWY A;  2FY8 A;  1NTZ J;  2YKO A;  4IFF A;  1ZME C;  3VMA A;  1S2E A;  4YXW H;  2O3J A;  5GTI E;  4KJM A;  1NU1 D;  2OYI C;  5AVS B;  1N7S C;  3PH0 A;  3CX5 H;  3HRN A;  2QJY C;  1KZU B;  3CCV P;  4TLF A;  1SQP E;  2N1T A;  1LT1 A;  2KXP B;  2XU6 A;  4GKG A;  2W6J H;  3HD7 B;  5CCG D;  1GW4 A;  2N9B A;  1SQV K;  2AXT H;  1SS1 A;  4R4L A;  1OVU A;  1RF0 A;  3JCU E;  4EOT A;  2FYU G;  2KI7 B;  2WMM A;  2KS1 B;  1G1J A;  1NAY A;  4U3F J;  2NZ2 A;  1GDT A;  1L0N J;  2JWD A;  3C1L A;  1SQX E;  1FZC C;  2FXO A;  1R5S A;  2QM7 A;  3L72 G;  3IR9 A;  1NTK J;  1JY2 P;  1NAF A;  2J59 M;  1Q7Y Q;  1M8O B;  2K88 A;  5AVR B;  3WMM 0;  2WSE J;  4GIF A;  1YTZ I;  2IBZ G;  3H1I D;  1PP9 E;  3E7K A;  2KNC B;  4I7Z C;  3ABV C;  3TDK A;  3MZW B;  2E75 C;  5KJ7 A;  1KFN A;  4DJG A;  2B87 A;  3H1L J;  4C7R A;  1VQ7 P;  1G2C B;  3D70 A;  4IOI H;  1GK4 A;  1CI6 B;  3N4X A;  3RL0 g;  4AQR D;  2ZT9 C;  3AE4 C;  4EIJ A;  1BDC A;  1IJD B;  1X79 B;  2WIT A;  1FE6 A;  4L76 A;  1PPJ G;  5KTB A;  2K1A A;  2M5A A;  3BCC E;  2FYU D;  1LTJ B;  1SQV D;  1SQB G;  2ZYD A;  3H1H J;  4PV1 D;  2O1K A;  3KZI E;  1Z56 A;  3P8M C;  2YKQ A;  2Y9Z A;  2H88 C;  3RBX A;  2KLV A;  3A5T A;  2BEZ F;  1EXJ A;  4UB6 H;  1LT9 B;  3L72 D;  2QE7 H;  3VP9 A;  1ZLL A;  3B71 A;  4W80 A;  4RO0 A;  5APY A;  4YXD C;  2WSF J;  3U1A A;  3TF5 A;  5KAF E;  4OGQ C;  1OZH A;  1IC2 A;  3C9I A;  3EWK A;  3AE2 C;  4HYT B;  1NVO A;  1M1J A;  2E43 A;  3L73 J;  3MGN A;  3HTK B;  1JEK A;  2POH A;  3EFF K;  3B8E B;  2Z5I A;  1PGQ A;  3NMD A;  3S4R A;  3GF3 A;  5AVU B;  1QVG O;  2IPP A;  2KP8 A;  2WSC H;  2M0B A;  4EDF A;  1XTC C;  1GTW A;  3GHG A;  4BRY A;  3U59 A;  1NTZ E;  1RQU A;  3ITK A;  1A02 F;  2OTJ P;  3CXH H;  2RN0 A;  3L75 J;  2NPS C;  1L4A C;  3CWB J;  3GLM A;  1Y9B A;  1PPJ D;  3IN6 A;  5APT A;  2HPC A;  1K04 A;  3AE9 C;  2E76 D;  3A0B H;  2ZYG A;  2QJK C;  4I6M C;  4H13 B;  1OXZ A;  1T6A A;  4L73 A;  1KIL B;  2IFM A;  3B5N D;  1K73 Q;  1AV1 A;  2AEM A;  2W6A A;  4H0L B;  3RK2 B;  4IL6 E;  4BXL A;  3GG2 A;  5AW4 B;  1BGY G;  4LC1 A;  3VP8 A;  5CCG A;  1EZV G;  1P84 D;  3II6 A;  1FDI A;  4U3F E;  1L0N E;  4PD4 D;  1GD2 E;  1K8A Q;  1Q86 Q;  2XV5 A;  3FGA D;  1EDI A;  2ZT9 B;  2R3S A;  3QH9 A;  3L37 A;  4C7N B;  1URQ C;  3PRJ A;  1FZG A;  4H44 C;  1DEE G;  1NTK E;  1N7S D;  3WU2 H;  4EYY Q;  2Q5U A;  2V7Q H;  1S5L H;  1P84 H;  1H88 A;  1OW7 A;  4PD4 H;  2E74 B;  1GL2 B;  3AEG C;  2FYN C;  1H0T A;  2E5Y A;  1N73 B;  2Y9Y A;  2Y0D A;  3H1L E;  1RE4 C;  3CCR P;  1LTB C;  5AVV B;  2RKL A;  1SQQ K;  2JKV A;  4UB8 H;  1YI2 P;  2QVA A;  5CJ4 A;  3D6Z A;  5DJT B;  3SSU A;  4JBZ A;  3L74 J;  4Y28 J;  1IFI A;  2XZR A;  2KIK A;  2C0W A;  1BGY D;  3CPW O;  4I2L C;  1J2J B;  1RQV A;  5L8R J;  4WY4 C;  1KQG B;  5AW7 B;  3LID A;  1JY2 O;  1VQ5 P;  5B5E H;  2KK7 A;  1IFN A;  1AA0 A;  1SFC A;  4WVZ A;  1OX3 A;  3CCU P;  3H1H E;  1X22 A;  1LWU A;  2QJP B;  1YJW P;  1S9K E;  1Y47 A;  1KFM A;  2E75 D;  5APW A;  1FZE A;  3G6E P;  5BU5 A;  2KZI A;  1IK9 A;  5E79 H;  3OAK A;  1VL2 A;  3FWN A;  4WBA A;  2H7H A;  3H32 B;  1Q2N A;  1NTM G;  1NU1 J;  1KIL E;  1FOS E;  1NHL A;  1M90 Q;  4GDO A;  2YIU C;  2K3R A;  2BEQ D;  5AW8 B;  1S5L X;  3L73 E;  1LJ2 A;  3L71 G;  5KLI B;  1PGP A;  1RE3 C;  2HLO A;  3CCS P;  2ZXE B;  2XNX A;  2NRG A;  3HD7 C;  3HUS B;  2OTL P;  1FU1 A;  1YJN P;  1E5W A;  3L75 E;  3CWB E;  1USE A;  1S72 P;  1IFM A;  3MUD C;  1SQP K;  2YXR B;  1VQM P;  3FX0 A;  4OGQ D;  4ZNC A;  2PGD A;  2QA4 P;  2KLU A;  1PL5 A;  1SQP G;  1KB9 D;  2OYH B;  1JY3 P;  4ZMD A;  3RK3 B;  4KHX A;  3M9Q A;  5M1B A;  3H1I J;  2JR8 A;  4C46 A;  2ZVO B;  3KYQ A;  1J1D B;  1JNM A;  1HJB A;  4YPC A;  1NH4 A;  3B5N A;  1SQX K;  4IFD K;  1LTG C;  3M0D A;  3WUV A;  2ZYA A;  1LP1 A;  2WPR A;  1T2K C;  1SQX G;  2LKM A;  2H89 C;  2NPS D;  1L4A D;  3TNU A;  1JY3 N;  3L71 D;  1HUC A;  1QX8 A;  1NKZ B;  2ZFC A;  3BAT A;  3D6Y A;  5AVY B;  2IFN A;  2OYI A;  5KLV K;  1JM0 A;  4MN4 C;  1N7S A;  3A0H E;  5AW6 B;  3CL3 D;  2HG5 D;  1SQV J;  1W5C E;  4PJ0 H;  1N2D C;  1BDD A;  2JO1 A;  1G1I A;  4HKZ H;  2A45 I;  2XKM A;  1LTJ C;  3G9R A;  3MTU E;  1JTH A;  1EXI A;  3L72 J;  4I1L A;  3GF7 A;  1HTL C;  5APQ A;  2WPS A;  2E5T A;  1L0L K;  4N78 E;  2WT7 A;  1SQP D;  2XDJ A;  3SFD C;  3RGU A;  2YIU B;  1LT9 C;  5AW2 B;  1URQ D;  3TGU J;  2WSC J;  3L74 E;  3H1K J;  4H44 D;  3W67 A;  1L0L G;  1FZC A;  2W6B A;  2CPB A;  1EDJ A;  2D2C B;  2YXQ B;  1ZW0 A;  2HOD A;  2IYP A;  3AEF C;  2YNY A;  2FFD B;  2Z4E A;  2KUB A;  2FYU K;  3CX5 E;  1IK7 A;  2R5D A;  1SQX D;  2KB7 P;  1NOH A;  1ZP0 C;  4GT1 A;  1RH5 B;  3H1J J;  3L35 A;  2KZJ A;  3AEB C;  2Y0E A;  3P32 A;  2K9J B;  4NPF X;  1KTM A;  3RL0 C;  5DJU B;  3RK3 E;  2AXT E;  1NU1 E;  3PP5 A;  1BE3 D;  1JMB A;  3OJA B;  2RH0 A;  3O6Q B;  2ZXX A;  1GZL A;  4ZKU A;  3HE4 A;  1Q90 D;  3EQ2 A;  1M57 D;  3BRT B;  1DD3 A;  5KLV D;  3V4Q A;  3V2N A;  2Q1K A;  4DZO A;  3MD0 A;  4WY4 D;  2MJZ A;  1NTZ K;  4HJG H;  3CX5 I;  5APU A;  2AEJ A;  1KD1 Q;  4H13 C;  3VOP A;  1KIL C;  2V7Q J;  1T3J A;  4H0L C;  3RK2 C;  1NTZ G;  3V2P A;  2XND H;  2N1T C;  3P8C E;  4YTP C;  2JP3 A;  3QWO C;  5CBN A;  3CMA P;  4K3A A;  1L0L D;  1BCC J;  1WMK A;  1JY2 N;  1OFC X;  1SP4 A;  1HGV A;  1M7L A;  2R44 A;  4N3Y B;  1LGH B;  1MKM A;  1VQP P;  3FXE A;  2QM8 A;  4JF7 A;  1SQB K;  2A06 G;  3H1I E;  1SFC D;  3V4W A;  3NXS A;  1FDO A;  4QMA A;  3HD7 D;  2E74 C;  1GL2 C;  1L0N G;  2WPQ A;  1ZOY C;  1N73 C;  1KOR A;  3KZI H;  4JPZ B;  3S9O A;  3R2P A;  2L5G B;  4A7P A;  2FKW B;  1FJP A;  2YMY A;  3VMX A;  4W7Z A;  1NGM B;  2NPS A;  1L4A A;  4EI2 A;  3CCQ P;  4K35 A;  4UB6 E;  1IFJ A;  2YKP A;  1OVV A;  2IBZ D;  4D6T J;  1K9M Q;  2OQQ A;  3HE5 A;  1PFI A;  2K9Y A;  1NTZ D;  3N7N A;  2Q6Q A;  1SQV E;  1JY3 O;  1MFT A;  1ZR4 A;  5APV A;  1ZRT E;  3SWF A;  1XTG B;  5KAI H;  3RL0 B;  3VTP C;  3D71 A;  5GTH H;  1RF1 B;  3L72 E;  2B88 A;  2QJP C;  1VQ9 P;  2OAR A;  3L70 J;  3AEE C;  3JC2 2;  4XFJ A;  3T97 B;  1T2K D;  2L91 A;  5CBO A;  2G8Y A;  1FJK A;  3TGU E;  2E42 A;  2A06 D;  3H1K E;  3PLN A;  3P7K A;  2JJL A;  3SWK A;  2LXC B;  2M3B A;  3AEC C;  1URQ A;  2HYN A;  3CXH E;  5EFW B;  1Y8A A;  1QGK B;  3AE5 C;  1SQB D;  1HF9 A;  2W8Z A;  3LIE A;  3H1H G;  1L0N D;  1J1E B;  3CD6 P;  5KLI C;  2MKV A;  1M1J C;  4Z1M H;  2N1T B;  2IDB A;  3H1J E;  1Q81 Q;  1HBW A;  2BCC J;  1BSH A;  1JMM A;  2G3A A;  1SQQ J;  1EC5 A;  1BSN A;  2IZ1 A;  3HUS C;  1RE4 A;  1PPJ E;  2KYV A;  1VF5 B;  4HH2 A;  3L73 G;  3CXH I;  5CCH C;  2PFX A;  4DT0 A;  1KQF B;  2B9B A;  1KMI Z;  1M1K Q;  2P10 A;  3V5B A;  2YO2 A;  2FYZ A;  3G4S P;  2OYH C;  1QL2 A;  3RK3 C;  3IF4 A;  3WU2 E;  3KPE A;  4WY4 A;  1ZN5 A;  1HH0 A;  1S5L E;  1RY3 A;  3I56 P;  1S4X A;  1J1D C;  3L75 G;  4R4M A;  1BCC E;  3L71 J;  1ZXG A;  2B87 B;  3B4S A;  2GM4 A;  4Y99 B;  3AE7 C;  3H1H D;  2GUS A;  1KYO D;  2FBW C;  1CSB A;  5TIS E;  1S9K D;  1AQ5 A;  4UB8 E;  3PTZ A;  2WWW A;  2AXC A;  1EZV D;  3A2A A;  3W68 A;  2VRS A;  4RES B;  1RE3 A;  2FXM A;  4H13 D;  2M5A B;  3S1K A;  3M9B A;  1KIL D;  1NKN A;  3RK2 D;  4H0L D;  3Q3D A;  1GU5 A;  4AYC A;  1NTM K;  1KYO H;  1T3U A;  4HB1 A;  5B5E E;  3HD7 A;  2WZ7 A;  3L73 D;  1AVY A;  4OH8 B;  1H8A A;  2WSF H;  2KS1 A;  3MUD A;  2ZT9 D;  4D6T E;  5E79 E;  2QEX P;  3FXD A;  1S3J A;  1KQS O;  1JCD A;  1MZ9 A;  1W2E A;  3I55 P;  3CC4 P;  2D2C C;  2I1J A;  1X8Y A;  1DH3 A;  1M1J B;  3L75 D;  1SLQ A;  2FFD C;  2LXB A;  1U57 A;  2E74 D;  1GL2 D;  1X9V A;  1FS0 E;  2PAJ A;  4GOE A;  2V4H A;  3L70 E;  1PGJ A;  2QG4 A;  2KNC A;  1KV4 A;  3TSI A;  3KHU A;  3L74 G;  1MFZ A;  3KXD A;  3GHG B;  2R32 A;  4BRY B;  4RKU J;  1BE3 J;  3AE8 C;  3RBZ A;  5C39 A;  1PV3 A;  5KLV J;  2C0X A;  3U1C A;  1VQ4 P;  1G2C A;  1UIX A;  4M3L A;  1FZA A;  5B66 E;  1CI6 A;  2HPC B;  3ZDM A;  1KN7 A;  1N7L A;  3V2Q A;  4DCK A;  1FBM A;  3FWL A;  1NTM D;  2BCC E;  2Y0C A;  4XE5 B;  1SQQ E;  4NPE A;  1NU1 G;  1L0L J;  1LTJ A;  1PGO A;  2IYO A;  1KB9 H;  5AW5 B;  2OTK E;  1YQ4 C;  1VQ6 P;  5K5G B;  3PHL A;  1E79 H;  1HJ0 A;  4AUW A;  1LT9 A;  4NPD A;  2W90 A;  3GW6 A;  3LW5 H;  1TU3 F;  3MHV A;  1QLE D;  4KT0 J;  1PP9 G;  1IZN B;  5CMZ A;  2FYU J;  1YHQ P;  1A02 J;  1OW6 A;  3Q5R A;  3L74 D;  2R5B A;  3HTK A;  1H0T B;  4PJ0 E;  3AE1 C;  3F89 A;  1LTI C;  3L71 E;  3CCE P;  2CPS A;  3M91 A;  5H2F E;  3WUU A; 
#chains in the Genus database with same CATH homology
 4B86 A;  5CJ0 A;  1GD2 E;  1CZQ A;  2XV5 A;  1AFO A;  1KQL A;  5AW9 B;  5CCH D;  1SFC C;  3VYI A;  3HD7 D;  3L37 A;  1NO4 A;  3BRV B;  4C7N B;  1URQ C;  5AVX B;  1GL2 C;  1FOS F;  5AW1 B;  1LWU C;  2WPQ A;  5APX A;  1FZG A;  1N73 C;  2JEE A;  1N7S D;  3R2P A;  5KJ7 D;  1JUN A;  2L5G B;  3RK3 D;  2Q5U A;  2HFE D;  2FKW B;  5APS A;  1FJP A;  3BAS A;  2YMY A;  3VMX A;  4W7Z A;  1H88 A;  2NPS A;  1SFC B;  1L4A A;  1KIL A;  1NWQ A;  1URQ B;  1FZF A;  1GL2 B;  1IFJ A;  1LWU B;  2YKP A;  2YO3 A;  3A3Y B;  1N73 B;  3HE5 A;  1RF1 C;  4XA4 A;  1VDF A;  1NU1 K;  3UIA A;  4WB4 A;  1PFI A;  1VPC A;  1RE4 C;  3N7N A;  3KDP B;  1LTB C;  3VMY A;  5AVV B;  3NFQ A;  1JY3 O;  1ZR4 A;  1SQQ K;  5APV A;  2KSJ A;  5BVZ A;  3SWF A;  1XTG B;  1DEB A;  5CJ4 A;  3RL0 B;  3VTP C;  3P8C D;  2A45 H;  5BU8 B;  1LTT C;  3L4F A;  4C7N A;  1RF1 B;  2Q3I A;  2OAR A;  1IFI A;  1WT6 A;  3A7O A;  2XZR A;  1T2K D;  1H89 A;  2C0W A;  1JO5 A;  4I2L C;  1T8Z A;  1FJK A;  1J1E C;  1J2J B;  2O01 H;  4WY4 C;  5AW7 B;  3LID A;  2E42 A;  1JY2 O;  2Q7C A;  5CHX A;  4IFM A;  1IFN A;  3P7K A;  2JJL A;  1SFC A;  1HGZ A;  3M0A A;  2M3B A;  3EFG A;  1URQ A;  1GL2 A;  1IFD A;  2HYN A;  1LWU A;  3KQG A;  4N78 D;  1S9K E;  1N73 A;  1KFM A;  1QL1 A;  5APW A;  1FZE A;  5BU5 A;  3LIE A;  2P7J A;  1IK9 A;  3I5C A;  1J1E B;  1RF0 C;  1FAV A;  4WY4 B;  1WRG A;  3OAK A;  4WBA A;  2H7H A;  3H32 B;  4LGD E;  2GUV A;  1N86 A;  3M06 A;  1M1J C;  1ZR2 A;  2N1T B;  2W27 A;  1GK6 A;  3V2R A;  1FOS E;  1NHL A;  3B5N C;  1HBW A;  2H8P D;  2P1J A;  1JMM A;  1RF1 A;  1JCC A;  3M0D C;  1L0N K;  5AVQ B;  1ZV8 A;  5AW8 B;  3HUS C;  3T97 A;  5AW3 B;  1RE4 A;  3O8Z A;  1RE3 C;  2KYV A;  3SWY A;  4LLH A;  2HLO A;  2YKO A;  4HH2 A;  4IFF A;  3B5N B;  1NTK K;  2ZXE B;  2XNX A;  3TK1 A;  5CCH C;  3HD7 C;  3OA7 A;  1FDM A;  2OYI C;  5AVS B;  3HUS B;  3V5B A;  2YO2 A;  5AVW B;  2FYZ A;  1DX7 A;  2OYH C;  1QL2 A;  1N7S C;  1FU1 A;  5KJ7 C;  3RK3 C;  3HRN A;  3KPE A;  4WY4 A;  1E5W A;  1ZN5 A;  3H6P A;  3TNU B;  1KZU B;  1CW5 A;  1HH0 A;  1IFM A;  3H32 A;  1RY3 A;  1SQP K;  4Y99 C;  2N1T A;  2Q9I A;  1GW3 A;  2XU6 A;  4GKG A;  1J1D C;  3HD7 B;  5CCG D;  1GW4 A;  2OYI B;  2N9B A;  1SQV K;  2OYH B;  1JY3 P;  1N7S B;  3RK3 B;  1RF0 A;  1YTZ T;  4KHX A;  3M9Q A;  4EOT A;  1EQ7 A;  1G1J A;  2GM4 A;  4Y99 B;  2C9N Y;  1IO4 A;  1GDT A;  4C46 A;  3KYQ A;  1J1D B;  2GUS A;  1JNM A;  1HJB A;  1CSB A;  1NH4 A;  3B5N A;  1S9K D;  1AQ5 A;  1SQX K;  1FZC C;  4IFD K;  1LTG C;  2WWW A;  2Z5H A;  1JTH B;  3M0D A;  2C9L Y;  5AVT B;  2QM7 A;  3HUS A;  3IR9 A;  1FZB A;  1JY2 P;  3A2A A;  2WPR A;  1NAF A;  2VRS A;  2J59 M;  4RES B;  1T2K C;  1RE3 A;  2FXM A;  2WT7 B;  2LKM A;  2NPS D;  1L4A D;  3M9B A;  1KIL D;  3TNU A;  5AVR B;  1NKN A;  4JYB A;  1JY3 N;  3WMM 0;  3RK2 D;  2PP6 A;  1GU5 A;  4AYC A;  4GIF A;  1YTZ I;  1HUC A;  1NTM K;  1NKZ B;  2ZFC A;  3BAT A;  5AVY B;  5CCH A;  1FZC B;  1T3U A;  3HD7 A;  2IFN A;  1MV8 A;  2WZ7 A;  2OYI A;  5KLV K;  2BAS A;  2HOD B;  2OYH A;  5KJ7 A;  1N7S A;  4OH8 B;  1KFN A;  5AW6 B;  3CL3 D;  2HG5 D;  1H8A A;  2WSF H;  4C7R A;  3MUD A;  1G2C B;  4DOJ A;  1N2D C;  1YYC A;  4O9B A;  1JCD A;  1GK4 A;  1MZ9 A;  1CI6 B;  1G1I A;  3N4X A;  2A45 I;  4AQR D;  1W2E A;  1LTJ C;  2XKM A;  4EIJ A;  2M8R A;  3MTU E;  1JTH A;  1IJD B;  2I1J A;  4I1L A;  1X8Y A;  1DH3 A;  1HTL C;  1M1J B;  1X79 B;  2WIT A;  3MIW A;  5APQ A;  2WPS A;  2P67 A;  1L0L K;  3GHG C;  4N78 E;  1SLQ A;  2WT7 A;  5KTB A;  2XDJ A;  2FFD C;  2I1K A;  1LT9 C;  5AVZ B;  5AW2 B;  1URQ D;  4N6J A;  4JYC A;  1OWA A;  1GL2 D;  1X9V A;  3HE4 B;  2PAJ A;  2J58 A;  3G3Z A;  1LTJ B;  1FZC A;  2W6B A;  2CPB A;  2O1K A;  1Z56 A;  4W7Y A;  3TSI A;  2WSE H;  3P8M C;  2YKQ A;  2HOD A;  1MFZ A;  3GHG B;  2R32 A;  2KLV A;  3A5T A;  2YNY A;  3VN0 A;  3L36 A;  2FFD B;  2Z4E A;  1LT9 B;  3TYY A;  3VP9 A;  2C0X A;  1ZLL A;  3U1C A;  2FYU K;  1G2C A;  4W80 A;  5APY A;  2R5D A;  3RL0 D;  3U1A A;  2KB7 P;  1NOH A;  4GT1 A;  4M3L A;  1FZA A;  3L35 A;  1CI6 A;  2P2U A;  2HPC B;  1IC2 A;  3C9I A;  5CCG C;  3P32 A;  1N7L A;  4HYT B;  3RL0 C;  3V2Q A;  1M1J A;  2E43 A;  1MUU A;  1FBM A;  3M9H A;  1HWT C;  3E1I A;  3PP5 A;  3MGN A;  3CLQ A;  2KOG A;  2POH A;  3HTK B;  3OJA B;  3B8E B;  2Z5I A;  1GZL A;  4ZKU A;  4XE5 B;  3NMD A;  3HE4 A;  2R3C A;  2H43 A;  3EQ2 A;  1LTJ A;  3BRT B;  3V4Q A;  5AVU B;  1GU4 A;  2WTY A;  3V2N A;  5AW5 B;  2IPP A;  5AW0 B;  4DZO A;  2KP8 A;  3MD0 A;  2WSC H;  4WY4 D;  2MJZ A;  1LTA C;  1XTC C;  1NTZ K;  1GTW A;  3GHG A;  2A45 G;  3U59 A;  3NTN A;  5APU A;  2FFD A;  4AUW A;  1A02 F;  2N1T D;  1LT9 A;  2NPS C;  1L4A C;  3VOP A;  1KIL C;  4ZKP A;  3BVH A;  1T3J A;  3RK2 C;  3V2P A;  1LTS C;  3VMZ A;  3LW5 H;  2N1T C;  3P8C E;  5APT A;  2HPC A;  5CMZ A;  3CI9 A;  1HVV A;  2IX7 C;  1A02 J;  3IFM A;  1JY2 N;  1SP4 A;  4I6M C;  1OXZ A;  1HGV A;  1M7L A;  1L4A B;  2NPS B;  1KIL B;  4N3Y B;  1LGH B;  2IFM A;  3B5N D;  2W6A A;  3RK2 B;  2R5B A;  3HTK A;  5AW4 B;  1JOC A;  2O1J A;  3HE5 B;  4LC1 A;  2QM8 A;  3VP8 A;  5CCG A;  1LTI C;  1SVF A;  4JF7 A;  1SQB K;  3II6 A;  2CPS A;  3M91 A;  1SFC D;  3V4W A;  3NXS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...