2IFNA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ifnA00
1PFIA 2KLVA 1IFNA 2IFMA 3IFMA 1IFMA 2XKMA 1ZN5A 1QL2A 4IFMA 1QL1A 2KSJA 2IFNA
chains in the Genus database with same CATH superfamily
3Q2YA 2FXOA 3TDKA 2QM7A 1R5LA 1LT9C 1P84D 1M1JB 2OYIA 1FZBA 1FZEA 1W5CE 2BCCD 1BE3G 3RBZA 3Q1MA 2JJLA 1BCCD 2AEJA 4LGDE 5KKZB 1OIPA 5GTHH 1SQBE 1VQKP 1SQVE 2CPBA 1OW7A 2ZAEB 4AQRD 1KILD 3L71G 1BE3D 1BE3E 3AE6C 4BRYA 1J1DC 1EDKA 2A06G 1OW6A 1AQ5A 2XKMA 1GMJA 2QJPB 3TYYA 2GA1A 5TISE 1RQUA 5TJHA 1CI6A 2Y9YA 3MZWB 3VOPA 3AE3C 4ASVA 3H1HG 5CCGA 2ITAA 5BU8B 3L71D 2B87A 1RE3C 2W90A 3M91A 1PV3A 4PV1B 5KJ7C 1KB9I 2RH0A 1ZP0C 2A06E 3WMM0 4ZKPA 1Q81Q 1FS0E 1M8OB 1JY3O 3ABVC 1SQXD 1S72P 1AVYA 1QLED 3H1HD 1LP1B 2OTJP 3H1HE 1X8YA 4WBAA 1DD4A 2KZJA 4JBZA 1KQGB 1LWUA 1YBKA 2E76B 2MKVA 2M3EA 2K88A 3CCUP 3M9QA 4JQ0D 1OWAA 2FFDB 3GF3A 3U1CA 1KV4A 1JO5A 1FU1A 4C46A 1PPJG 2HR3A 2IPPA 4XE5B 3L72J 1UIXA 4WY4C 4K35A 1L0LJ 4PD4D 3H1IG 4PD4E 3SFDC 3K5BA 1N7SD 3MGNA 1H89A 4RKUJ 1GD2E 1RE4C 2BEQD 4GIFA 1Z56A 2D2CB 1YQ3C 1ZV8A 5AVSB 4L74A 1GL2A 1PPJD 5APQA 1OXZA 4MN4C 2IYPA 3CXHH 2JDIH 4JYBA 1X79B 1AVOA 1SQQK 3H1IE 1EQ7A 2PGDA 4JYCA 1VQ7P 1GDTA 4GDOA 2E74C 3H1LD 2K3RA 1URQA 3PP5A 4BRYB 5AVUB 1Y8AA 4HKZH 3KZIH 4RESB 3KHUA 5AVQB 1FZCC 2E43A 1IFMA 2YIUC 4NPFX 3HD7C 1CI6B 1N73A 1JNMA 2NPSA 1USEA 4LC1A 2H7HA 2P58A 3EFGA 2CPSA 2ZXEB 3RBXA 2R32A 2Y0CA 2W8ZA 2FYNC 3GW6A 3OJAB 1IFDA 1IFJA 1J1EC 3A0HE 1HUCA 5CCHC 5CBNA 1M1KQ 3QH9A 1EDIA 2HLOA 1SQQE 1FJPA 5H2FH 5KLVJ 1YIJP 2N1TB 5APTA 4N6JA 2E5TA 2A45H 2BEZF 3M9HA 1LJ2A 2Q6QA 5BU5A 2RN0A 2V4HA 1CSBA 1ZMEC 3CMAP 3CXHD 2QIWA 3CXHE 3BCCJ 1RF1B 1LTJB 2QE7H 1Q2NA 3BASA 1NU1K 1VQ5P 3BRTB 2OYHA 1X22A 3L75J 5B5EH 1S5LE 3M06A 2Q3IA 4U3FE 4L75A 1SFCA 4UB6H 1RF0C 3Q5SA 3KZIE 3VMAA 1SQPK 3V5BA 3Q3DA 3MIWA 1DEBA 3L74G 4WB4A 3WU2H 1GL2B 4OH8B 2E75C 4ZMDA 3GMAA 3CWBJ 3CMEP 1HBWA 2H43A 4H13C 3A5TA 1EC5A 1YJ9P 5CHXA 1KB9D 2KLVA 3W68A 3RL0B 1L4AB 3TSIA 2UWJE 5KJ7D 1PL5A 2OARA 3LW5J 3L74D 1YJWP 1KYOI 1URQB 3L74E 3OAKA 1KQFB 1U7MA 3FX0A 3HTKA 1QL2A 1NH4A 5C39A 3S9OA 2Y0DA 1OMIA 3CCEP 3CPWO 1HVVA 3V2PA 5AW3B 1S4XA 2WITA 3Q5PA 1PGOA 2B9BA 1GU4A 5APVA 5AW1B 1N73B 2NPSB 1DD3A 1NU1E 4GOEA 1QVGO 3CWBD 4I7ZB 2KK7A 2ZFCA 1L0NK 1A02J 2KNCA 1SQPE 2WSFH 1YQ4C 2QEXP 4H0LB 2K9JA 2K37A 3IF4A 3N4XA 3I56P 2PFXA 2O1KA 4WY4D 5L8RJ 3V6IA 4I1LA 4H44C 5AW6B 4RJTA 1HH0A 1H0TA 3FXEA 2FYUG 1N2DC 2P1JA 1FDOA 1P84H 1PGPA 4Y99B 5DJUB 3B5NC 3L73G 2R5BA 3AEEC 3WU2E 2QJKC 2YNYA 5GTIH 2XDJA 1L0NG 1EZVI 1NTKJ 1M1JC 3CC2P 1BSNA 1YI2P 1JY3P 3EFFK 5KAIH 2LR2A 1QL1A 3CX5D 2KLUA 1G2CA 2E74D 2FYUD 2ZYGA 3M0DC 2OYHB 3E7KA 1Q7YQ 4IFDK 1NYHA 1W2EA 2W6BA 5KKZC 1M90Q 3CCQP 3H1KJ 3L73D 1SFCB 1H88A 2C0WA 1L0ND 1S5LX 3F89A 1L0NE 4IFMA 1NTMJ 1FDIA 1JM0A 3HD7D 2WT7A 3H6PA 3SSUA 1N86A 4L76A 3LIDA 3V2RA 3ZDMA 1SVFA 1NTKD 1PP9J 3TGUG 2JWAA 2IZ0A 5AVRB 2QJPC 1SLQA 2ZT9B 4N78E 3SWYA 1QGKB 1Q82Q 2MJZA 2BCCG 1OZHA 4RO0A 3HRNA 3IN6A 5CCHD 1BCCG 4JPZB 1EDJA 1OW8A 1K05A 2WWWA 2YKOA 2GM4A 4PV1C 3RK3E 3ITKA 1NTMD 3TGUD 3TGUE 4OGQB 1SQBJ 1SQVJ 1P84E 3HE5A 2JEEA 1L2PA 5AVZB 2LKMA 3T97A 2ZXXA 1FZFA 3HUSA 5K5GB 2WTYA 2BCCE 2QVAA 5KLIC 3P8CD 2E42A 3P8CE 2SPZA 3P32A 1BCCE 2B88A 2KNCB 5GTIE 1SQXK 1FZAA 1EDLA 3MHVA 2K9JB 2HG5D 3L70J 5KAIE 3OA7A 2E76C 2KUBA 1KORA 1FOSE 4HB1A 1FZGA 4HJGH 1FAVA 2ZYDA 2O01H 2H88C 2ZJSE 2FFDC 4PD4H 1H0TB 1KILE 4PJ0H 2WSCH 3BVHA 1E5WA 3PH0A 2KSJA 2NZ2A 2E75D 5APUA 2AXCA 4H13D 2WSEJ 3B71A 2OYIC 1IO4A 2K9YA 1SQXG 3G6EP 2HODA 3NFQA 5APYA 4XA4A 1JY2N 1G2CB 1KYOD 2OYOA 3L71E 3C1LA 3L70D 3LIEA 1JOCA 2LXCB 2M0BA 2R3SA 3F5HA 3CD6P 1GTWA 1SQXE 2WT7B 2RKLA 4ASWA 4EI2A 1LT1A 1DH3A 2G3AA 2KB7P 4R4LA 2N1TA 2I1KA 1FBMA 3W67A 2BASA 5APSA 3I55P 3D6YA 1JCDA 1EXIA 2WPSA 1N8RQ 1L0LK 3BRVB 1IZNB 5CCGC 1RF1A 1LTJA 3A0HH 3EWKA 2WSSH 3AE1C 4H44D 1LTAC 1YHQP 1HF9A 1NKNA 1BGYJ 4PJ0E 3P7KA 4DOJA 1MUUA 3HE5B 3T97B 2I8DA 3HUSB 3B5ND 4I6MC 3H1LG 4BWNA 2IYOA 1L0LG 3GHGA 1LGHB 3B4SA 2RMZA 1PPJE 3PJSK 1LWUC 1USDA 1K8AQ 2XU6A 3VP9A 2WVRA 2Y0EA 5AVYB 1A02F 1L4AA 3CC7P 1JEKA 1S5LH 4NPEA 3L72D 3H1LE 3CCSP 3RK2B 1L0LD 4DT0A 5AW2B 1L0LE 1YJNP 2QSIA 2LXBA 3O6QA 4W80A 1MKMA 2KP8A 1VQLP 2XNXA 3HE4A 2HODB 2P67A 3CCJP 2PP6A 2IBZI 1KB9H 1VDFA 1D7MA 1SQQJ 1YYCA 1X9VA 1GL2C 2FXPA 4W7YA 1Q90D 3CCRP 2Y9ZA 3GF7A 4U7JA 4AUWA 3SWFA 3USSA 3RL0C 2FKWB 4PV1D 2AEMA 3AE2C 1U7JA 1GU5A 1URQC 2WMMA 3MTUE 1QX8A 2JWDA 3II6A 2YKQA 4Z1MH 1KILA 4DZOA 2ZYAA 1IFIA 4U3FJ 3OW2O 1N73C 2NPSC 5KLVG 2L91A 2J58A 1JMMA 1IK9A 2E76D 4I7ZC 3LW5H 3S4RA 2WPQA 2OQQA 3O8ZA 4ZKUA 1S1CX 1P84I 2P7JA 1YTZT 3V4WA 1K9MQ 1FE6A 2XZRA 4H0LC 3GLMA 1N7LA 4KJMA 1NKZB 3TK1A 2W6AA 3M0AA 5KLVD 2N9BA 1PIXA 1G1IA 3TF5A 3L75G 3GHGB 5AW8B 2OGUA 1AV1A 1PGJA 1S9KD 1DX7A 1S9KE 2Q5UA 4AYCA 2O1JA 2D2CD 4Y99C 1JY2O 1IK7A 3E1RA 1KB9E 3CX5H 1ZOYC 3BCCD 1NU1J 1LNQA 3CWBG 3IFMA 5B66H 1UIIA 3L75D 3L75E 3KQGA 3NTNA 4M3LA 2WPVB 1R5SA 2OYHC 1AJYA 3KDPB 3JCUE 1SQPJ 3A7OA 3E1IA 4NPDA 3O6QB 1U57A 1S2EA 1R8EA 1NWQA 4IOIH 3RK3B 1SFCC 5KTBA 3HE4B 2FYUK 1VF5B 2C0XA 1X0TA 2V7QJ 2FBWC 1E79H 3RL0g 2M8RA 3CWBE 1N7SA 1HGZA 3MP7B 5AVVB 3RGUA 1BSHA 1ZRTD 1ZRTE 4GOFA 4C7NA 3FXDA 5CCGD 4KT0J 1NVOA 4HH2A 2Q9IA 1Y9BA 3VMZA 3S1KA 1TU3F 2I1JA 2L5GB 3IAOA 3D70A 2ZT9C 1IC2A 1EXJA 1NTKK 2ZVOB 1NTZJ 2E5YA 3KXDA 1PZQA 1KILB 3VTPC 1T6AA 1NGMB 2PRRA 4TT3H 1CZQA 4YXWH 3TNUB 3AE8C 1KFMA 2KXPB 2IFNA 2N1TD 1GW3A 1GK6A 1KQLA 1T2KC 3L36A 1NTMK 4PD4I 1KZUB 3CX5E 1ZR4A 2YO2A 2FYUE 4BXLA 2QG4A 4Y28J 3WUUA 2QM8A 1NTKG 4EOTA 1Q86Q 5B66E 3CL3D 1MFTA 3L73E 2R3CA 3A2AA 2KZIA 1JB0J 2WSFJ 1QEXA 1FDMA 3MUDA 2IBZD 3H1KG 5E79H 1VPCA 1KC8Q 1NO4A 4D6TJ 3H1JJ 1LT9A 1GL2D 1NTMG 1RQVA 1NTKE 2R44A 1KYOH 2H89C 1NAFA 1M7LA 2P10A 3SFEC 3RL0D 1L4AD 3H1KD 3H1KE 2GUSA 2YO3A 1BCCJ 4I2LC 2QJYB 5CJ4A 3CCLP 1URQD 1YTZI 1SP4A 1NTME 2Z5HA 2NRGA 1HJ0A 5EFWB 1N7SB 4D6TD 2NPSD 1BE3J 3G71P 1PP9D 4C7NB 2QJKB 2P2UA 3FGAD 3FWLA 1SS1A 1SQVG 3AE7C 1T8ZA 3KYQA 4JF7A 3D6ZA 1WRGA 2GUVA 2POHA 1RE3A 4H0LD 3UIAA 4WVZA 2C9NY 5KJ7A 3L71J 3L70G 1ZXGA 2J59M 1HGVA 2M5AB 1SQBD 4UB8H 4XFJA 3CXHI 1SQVD 1GW4A 1PFIA 1AA0A 3U1AA 4C7RA 3G4SP 3JSVC 5E79E 3P8MC 1SQXJ 3HUSC 3H1HJ 2D2CC 1M56D 3AECC 1LTGC 1ZR2A 3MD0A 1KYOE 1WMKA 3L70E 2Z5IA 3CC4P 2WPRA 4EIJA 1T3JA 5KAFH 3AE5C 1FC2C 2HFED 3PLNA 1VQ8P 4GT1A 5AW7B 1SFCD 4WY4A 4IL6H 3PHLA 1IFPA 2A06D 3L37A 3RK2C 1W2BO 2YMKA 2YXRB 1LT9B 2XV5A 1RE4A 2O01J 1M57D 5AW0B 3AE4C 2G8YA 2B89A 5KLIB 2WSCJ 2FYZA 1NHLA 3U59A 1S3JA 1EZVG 3AEGC 5AVTB 4TLFA 5AW4B 2ZT9D 1LTTC 2VRSA 1MFZA 3FWNA 3V2QA 5CMZA 2A45I 5AW5B 1JY2P 3H1IJ 2IFMA 1BDDA 1NJIQ 5GTHE 4UB8E 1EZVD 1J1DB 3L72G 4K3AA 1EZVE 2Z4EA 3H1LJ 3V2NA 3D71A 1FJKA 4OGQD 5AW9B 4O9BA 1FZCA 2IX7C 1BGYG 3HD7A 1T2KD 2N1TC 1LTIC 1G1JA 1KD1Q 2OYIB 1OFCX 3A0BH 3H25A 3VYIA 2AEFA 1WT6A 3L72E 1RF1C 1LTJC 3WUVA 5KAFE 3I5CA 1AFOA 3H1ID 1BGYD 2M3BA 1BGYE 3G3ZA 1KQSO 1HJBA 1VQ4P 3AEBC 3H32A 5CCHA 2QA4P 1YITP 2O3JA 4IL6E 3CX5I 3CCVP 1IFNA 2YKPA 4IFFA 5APXA 3GHGC 2J5UA 5AVWB 5KLVK 5CBOA 2W6JH 1BDCA 5M1BA 2KI7B 2DW3A 1AQTA 1RY3A 1SQQG 2B87B 1L4AC 3JCUH 2C9LY 1OX3A 4WY4B 3N7NA 2JR8A 3WUTA 4WWIA 2KYVA 3VN0A 1RF0A 3L4FA 3M9BA 1ZW0A 2KS1A 2WZ7A 3TNUA 1OVUA 3RK3C 1SQQD 2IZ1A 5APWA 1LTSC 1VF5C 2O01N 4R4MA 1H8AA 4L73A 1LWUB 2FXMA 2FY8A 4U3FG 4QMAA 3A0BE 2JKVA 2XNDH 2IDBA 3AE9C 1K73Q 2E74B 2H8PD 1HTLC 3BCCG 5BVZA 4YXDC 1T3UA 5KLVE 2N9YB 2Q1KA 2V7QH 3L74J 1FZCB 2WQYC 1JCCA 2YIUB 1FOSF 3HD7B 4U3FD 1GZLA 1KILC 2YMYA 3SWKA 1JMBA 4ZNCA 3BCCE 1DIPA 4GODA 1MZ9A 1JTHA 3R4YA 1PGQA 2FYNB 2JO1A 1KN7A 1OVRA 1J1EB 1JUNA 1NU1G 4LLHA 2OTKE 2HPCA 2YXQB 3H32B 2OTLP 4OWFA 2Q3EA 3RK2D 2A45G 3PRJA 3EQ2A 3VMXA 3CI9A 2W83C 1SQPG 4IL6X 3KPEA 2KIKA 4EYYQ 1JY3N 4KHXA 3VMYA 1QVFO 1RHZB 2AXTH 1GK4A 5CJ0A 1DEEG 1LTBC 1NOHA 1NTZK 3B5NA 2KOGA 1NU1D 5H2FE 1KFNA 4W7ZA 4DJGA 2CK3H 3BATA 1M1JA 3QWOC 3AEAC 3B8EB 4A7PA 1KMIZ 2HYNA 1VQNP 3M0DA 4N3YB 1MV8A 1SQPD 2KSEA 2ZVNB 1XTCC 1ZN5A 1VQ6P 2R5DA 3NXSA 2FYUJ 4GKGA 2M5AA 2QJYC 2KS1B 3PTZA 4OVNF 3L73J 5B5EE 1NTZG 4OGQC 2E75B 1J2JB 2QRXA 1L0NJ 1VQOP 3IR9A 4UB6E 1N7SC 4H13B 4EDFA 3L35A 2IBZG 3CLQA 2K1AA 2W27A 1ZLLA 3CCMP 3NMDA 1XTGB 1NTZD 1VQ9P 1NTZE 4CPGA 2Q7CA 1VL2A 4DCKA 3AEDC 2IBZE 3JC22 1NAYA 3AEFC 3C8VA 3TGUJ 2AXTE 3Q5RA 1LP1A 1SQBK 5TISH 1JTHB 1SQVK 4D6TG 1CW5A 2BCCJ 3H1JG 1PP9G 1K04A 4YTPC 4B86A 1VQMP 3V4QA 1OVVA 4YPCA 5DJTB 2HPCB 1IJDB 1Y47A 4N78D 4H44B 1KTMA 1HWTC 3GG2A 3C9IA 2FFDA 3G9RA 3A3YB 3HTKB 1VQPP 1RH5B 2WSEH 3VP8A 3R2PA 3H1JD 4D6TE 3RK3D 3H1JE 3MUDC 3B5NB 2JP3A 1PP9E 1VF5D 4HYTB 2PAJA 5AVXB 1SQBG
chains in the Genus database with same CATH topology
3V2QA 5CMZA 1IFIA 2A45I 2QM7A 3N4XA 5AW5B 1LT9C 2O1KA 1M1JB 2OYIA 1FZBA 1JY2P 4WY4D 1N73C 1FZEA 2IFMA 2NPSC 4I1LA 2J58A 5AW6B 1JMMA 1IK9A 2JJLA 1J1DB 1HH0A 3LW5H 2Z4EA 3V2NA 1N2DC 1FJKA 2P1JA 5AW9B 2WPQA 4LGDE 4O9BA 4ZKUA 3O8ZA 1FZCA 4Y99B 2IX7C 3HD7A 1T2KD 2P7JA 1YTZT 3V4WA 2N1TC 1LTIC 3B5NC 1G1JA 2R5BA 2XZRA 2OYIB 2YNYA 1N7LA 2CPBA 2XDJA 1NKZB 3TK1A 2W6AA 1M1JC 3M0AA 1JY3P 2N9BA 4AQRD 1KILD 1G1IA 3VYIA 1QL1A 1WT6A 3GHGB 5AW8B 1G2CA 3M0DC 1LTJC 1RF1C 2OYHB 4IFDK 1J1DC 1S9KD 1DX7A 1S9KE 2Q5UA 3I5CA 4AYCA 1W2EA 1AFOA 2W6BA 1AQ5A 2M3BA 2O1JA 3G3ZA 2XKMA 4Y99C 3TYYA 1JY2O 1HJBA 1SFCB 1H88A 3H32A 1CI6A 5CCHA 3VOPA 2C0WA 4IFMA 3HD7D 5CCGA 2WT7A 5BU8B 1IFNA 3IFMA 3H6PA 2YKPA 4IFFA 1RE3C 1N86A 3KQGA 3M91A 5APXA 3NTNA 3LIDA 3GHGC 4M3LA 3V2RA 5KJ7C 2OYHC 1SVFA 3KDPB 5AVWB 5KLVK 3WMM0 3A7OA 3E1IA 4ZKPA 5AVRB 1NWQA 1JY3O 3RK3B 1SFCC 5KTBA 3HE4B 1SLQA 2FYUK 4N78E 3SWYA 1RY3A 2C0XA 1X8YA 2MJZA 4WBAA 1L4AC 2C9LY 2M8RA 1N7SA 1HGZA 4WY4B 3HRNA 5CCHD 5AVVB 3N7NA 2WWWA 2YKOA 1LWUA 2GM4A 4C7NA 2KYVA 5CCGD 4HH2A 3VN0A 1RF0A 2Q9IA 3L4FA 3M9BA 3VMZA 3M9QA 1OWAA 2I1JA 2WZ7A 2L5GB 3TNUA 2FFDB 3HE5A 2JEEA 3RK3C 5AVZB 2LKMA 3U1CA 3T97A 1FZFA 3HUSA 1IC2A 1JO5A 5APWA 1LTSC 1FU1A 1NTKK 4C46A 2WTYA 3P8CD 2E42A 1H8AA 3P8CE 2IPPA 1LWUB 3P32A 4XE5B 4WY4C 2FXMA 1KILB 1SQXK 1FZAA 3VTPC 2HG5D 1N7SD 1CZQA 3OA7A 3MGNA 3TNUB 1H89A 2H8PD 1HTLC 1KFMA 1GD2E 1RE4C 2IFNA 2N1TD 1FOSE 4GIFA 1GW3A 1Z56A 5BVZA 1FZGA 1FAVA 1GK6A 2O01H 1KQLA 2FFDC 1T2KC 1T3UA 1ZV8A 5AVSB 3L36A 1GL2A 1NTMK 2WSCH 1KZUB 3BVHA 1ZR4A 1E5WA 5APQA 1JCCA 1FZCB 1OXZA 2YO2A 1FOSF 2KSJA 3HD7B 4JYBA 1X79B 1GZLA 1SQQK 2QM8A 1KILC 4EOTA 2YMYA 1EQ7A 5APUA 3CL3D 4JYCA 2R3CA 3A2AA 1GDTA 2OYIC 1IO4A 2HODA 3NFQA 5APYA 4XA4A 1URQA 1JY2N 1MZ9A 3PP5A 1JTHA 5AVUB 1G2CB 4RESB 1FDMA 3MUDA 5AVQB 3LIEA 1JOCA 1J1EB 1FZCC 1JUNA 2E43A 1VPCA 1IFMA 1NO4A 4LLHA 3HD7C 1LT9A 2HPCA 1GL2D 3H32B 1CI6B 1N73A 1JNMA 2NPSA 3RK2D 4LC1A 2A45G 3EQ2A 2H7HA 1GTWA 3VMXA 1NAFA 3EFGA 2WT7B 2CPSA 2ZXEB 1DH3A 1M7LA 3CI9A 2R32A 3RL0D 2KB7P 3KPEA 1JY3N 4KHXA 1L4AD 3VMYA 1GK4A 5CJ0A 2GUSA 1LTBC 2N1TA 2YO3A 1NOHA 1NTZK 2I1KA 3B5NA 1IFDA 3OJAB 4I2LC 2KOGA 1FBMA 5CJ4A 2BASA 5APSA 1IFJA 1JCDA 1J1EC 1URQD 1YTZI 1KFNA 1HUCA 1SP4A 2WPSA 4W7ZA 1L0LK 3BATA 1M1JA 5CCHC 3B8EB 3BRVB 2Z5HA 2HYNA 1N7SB 2HLOA 5CCGC 1FJPA 3M0DA 1LTJA 1RF1A 4N3YB 1MV8A 2N1TB 1XTCC 2NPSD 1LTAC 5APTA 4N6JA 1ZN5A 2A45H 3M9HA 4C7NB 2R5DA 3NXSA 2P2UA 4GKGA 1T8ZA 3KYQA 5BU5A 1NKNA 3P7KA 4DOJA 1MUUA 1CSBA 4JF7A 3HE5B 1WRGA 3B5ND 2GUVA 3HUSB 2POHA 1J2JB 1RF1B 1LTJB 4I6MC 1RE3A 3BASA 3UIAA 1NU1K 3IR9A 2C9NY 3GHGA 1N7SC 3BRTB 5KJ7A 1LGHB 2OYHA 3L35A 3CLQA 2J59M 1HGVA 2W27A 3M06A 1LWUC 2Q3IA 1GW4A 1ZLLA 1PFIA 1SFCA 1RF0C 2XU6A 3VP9A 5AVYB 3NMDA 3U1AA 1SQPK 3V5BA 4C7RA 1A02F 1L4AA 1XTGB 1DEBA 3MIWA 4WB4A 1GL2B 3P8MC 4OH8B 2Q7CA 3HUSC 3RK2B 5AW2B 1LTGC 1ZR2A 3MD0A 1HBWA 2H43A 2Z5IA 3A5TA 5CHXA 2KLVA 2WPRA 4W80A 3RL0B 2KP8A 4EIJA 1L4AB 3TSIA 5KJ7D 1T3JA 2XNXA 3HE4A 2OARA 2HODB 2P67A 2HFED 1URQB 1SQBK 3OAKA 2PP6A 1JTHB 1VDFA 4GT1A 1SQVK 1YYCA 1X9VA 1GL2C 3HTKA 1SFCD 4WY4A 1QL2A 5AW7B 1NH4A 4W7YA 1CW5A 3L37A 3RK2C 1HVVA 3V2PA 5AW3B 4B86A 2WITA 3V4QA 1GU4A 1LT9B 5APVA 5AW1B 2HPCB 1N73B 1IJDB 2XV5A 1RE4A 2NPSB 5AW0B 3SWFA 4AUWA 4N78D 3RL0C 1HWTC 2FKWB 3C9IA 2FYZA 2FFDA 1NHLA 3U59A 3A3YB 3HTKB 1GU5A 5AVTB 2WSEH 1URQC 3MTUE 3VP8A 3R2PA 2ZFCA 5AW4B 1L0NK 3II6A 1A02J 3RK3D 2YKQA 3B5NB 2WSFH 1LTTC 1KILA 4DZOA 2VRSA 1MFZA 4HYTB 2PAJA 5AVXB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PFI A;  2KLV A;  1IFN A;  2IFM A;  3IFM A;  1IFM A;  2XKM A;  1ZN5 A;  1QL2 A;  4IFM A;  1QL1 A;  2KSJ A;  2IFN A; 
#chains in the Genus database with same CATH topology
 3Q2Y A;  2FXO A;  3TDK A;  2QM7 A;  1R5L A;  1LT9 C;  1P84 D;  1M1J B;  2OYI A;  1FZB A;  1FZE A;  1W5C E;  2BCC D;  1BE3 G;  3RBZ A;  3Q1M A;  2JJL A;  1BCC D;  2AEJ A;  4LGD E;  5KKZ B;  1OIP A;  5GTH H;  1SQB E;  1VQK P;  1SQV E;  2CPB A;  1OW7 A;  2ZAE B;  4AQR D;  1KIL D;  3L71 G;  1BE3 D;  1BE3 E;  3AE6 C;  4BRY A;  1J1D C;  1EDK A;  2A06 G;  1OW6 A;  1AQ5 A;  2XKM A;  1GMJ A;  2QJP B;  3TYY A;  2GA1 A;  5TIS E;  1RQU A;  5TJH A;  1CI6 A;  2Y9Y A;  3MZW B;  3VOP A;  3AE3 C;  4ASV A;  3H1H G;  5CCG A;  2ITA A;  5BU8 B;  3L71 D;  2B87 A;  1RE3 C;  2W90 A;  3M91 A;  1PV3 A;  4PV1 B;  5KJ7 C;  1KB9 I;  2RH0 A;  1ZP0 C;  2A06 E;  3WMM 0;  4ZKP A;  1Q81 Q;  1FS0 E;  1M8O B;  1JY3 O;  3ABV C;  1SQX D;  1S72 P;  1AVY A;  1QLE D;  3H1H D;  1LP1 B;  2OTJ P;  3H1H E;  1X8Y A;  4WBA A;  1DD4 A;  2KZJ A;  4JBZ A;  1KQG B;  1LWU A;  1YBK A;  2E76 B;  2MKV A;  2M3E A;  2K88 A;  3CCU P;  3M9Q A;  4JQ0 D;  1OWA A;  2FFD B;  3GF3 A;  3U1C A;  1KV4 A;  1JO5 A;  1FU1 A;  4C46 A;  1PPJ G;  2HR3 A;  2IPP A;  4XE5 B;  3L72 J;  1UIX A;  4WY4 C;  4K35 A;  1L0L J;  4PD4 D;  3H1I G;  4PD4 E;  3SFD C;  3K5B A;  1N7S D;  3MGN A;  1H89 A;  4RKU J;  1GD2 E;  1RE4 C;  2BEQ D;  4GIF A;  1Z56 A;  2D2C B;  1YQ3 C;  1ZV8 A;  5AVS B;  4L74 A;  1GL2 A;  1PPJ D;  5APQ A;  1OXZ A;  4MN4 C;  2IYP A;  3CXH H;  2JDI H;  4JYB A;  1X79 B;  1AVO A;  1SQQ K;  3H1I E;  1EQ7 A;  2PGD A;  4JYC A;  1VQ7 P;  1GDT A;  4GDO A;  2E74 C;  3H1L D;  2K3R A;  1URQ A;  3PP5 A;  4BRY B;  5AVU B;  1Y8A A;  4HKZ H;  3KZI H;  4RES B;  3KHU A;  5AVQ B;  1FZC C;  2E43 A;  1IFM A;  2YIU C;  4NPF X;  3HD7 C;  1CI6 B;  1N73 A;  1JNM A;  2NPS A;  1USE A;  4LC1 A;  2H7H A;  2P58 A;  3EFG A;  2CPS A;  2ZXE B;  3RBX A;  2R32 A;  2Y0C A;  2W8Z A;  2FYN C;  3GW6 A;  3OJA B;  1IFD A;  1IFJ A;  1J1E C;  3A0H E;  1HUC A;  5CCH C;  5CBN A;  1M1K Q;  3QH9 A;  1EDI A;  2HLO A;  1SQQ E;  1FJP A;  5H2F H;  5KLV J;  1YIJ P;  2N1T B;  5APT A;  4N6J A;  2E5T A;  2A45 H;  2BEZ F;  3M9H A;  1LJ2 A;  2Q6Q A;  5BU5 A;  2RN0 A;  2V4H A;  1CSB A;  1ZME C;  3CMA P;  3CXH D;  2QIW A;  3CXH E;  3BCC J;  1RF1 B;  1LTJ B;  2QE7 H;  1Q2N A;  3BAS A;  1NU1 K;  1VQ5 P;  3BRT B;  2OYH A;  1X22 A;  3L75 J;  5B5E H;  1S5L E;  3M06 A;  2Q3I A;  4U3F E;  4L75 A;  1SFC A;  4UB6 H;  1RF0 C;  3Q5S A;  3KZI E;  3VMA A;  1SQP K;  3V5B A;  3Q3D A;  3MIW A;  1DEB A;  3L74 G;  4WB4 A;  3WU2 H;  1GL2 B;  4OH8 B;  2E75 C;  4ZMD A;  3GMA A;  3CWB J;  3CME P;  1HBW A;  2H43 A;  4H13 C;  3A5T A;  1EC5 A;  1YJ9 P;  5CHX A;  1KB9 D;  2KLV A;  3W68 A;  3RL0 B;  1L4A B;  3TSI A;  2UWJ E;  5KJ7 D;  1PL5 A;  2OAR A;  3LW5 J;  3L74 D;  1YJW P;  1KYO I;  1URQ B;  3L74 E;  3OAK A;  1KQF B;  1U7M A;  3FX0 A;  3HTK A;  1QL2 A;  1NH4 A;  5C39 A;  3S9O A;  2Y0D A;  1OMI A;  3CCE P;  3CPW O;  1HVV A;  3V2P A;  5AW3 B;  1S4X A;  2WIT A;  3Q5P A;  1PGO A;  2B9B A;  1GU4 A;  5APV A;  5AW1 B;  1N73 B;  2NPS B;  1DD3 A;  1NU1 E;  4GOE A;  1QVG O;  3CWB D;  4I7Z B;  2KK7 A;  2ZFC A;  1L0N K;  1A02 J;  2KNC A;  1SQP E;  2WSF H;  1YQ4 C;  2QEX P;  4H0L B;  2K9J A;  2K37 A;  3IF4 A;  3N4X A;  3I56 P;  2PFX A;  2O1K A;  4WY4 D;  5L8R J;  3V6I A;  4I1L A;  4H44 C;  5AW6 B;  4RJT A;  1HH0 A;  1H0T A;  3FXE A;  2FYU G;  1N2D C;  2P1J A;  1FDO A;  1P84 H;  1PGP A;  4Y99 B;  5DJU B;  3B5N C;  3L73 G;  2R5B A;  3AEE C;  3WU2 E;  2QJK C;  2YNY A;  5GTI H;  2XDJ A;  1L0N G;  1EZV I;  1NTK J;  1M1J C;  3CC2 P;  1BSN A;  1YI2 P;  1JY3 P;  3EFF K;  5KAI H;  2LR2 A;  1QL1 A;  3CX5 D;  2KLU A;  1G2C A;  2E74 D;  2FYU D;  2ZYG A;  3M0D C;  2OYH B;  3E7K A;  1Q7Y Q;  4IFD K;  1NYH A;  1W2E A;  2W6B A;  5KKZ C;  1M90 Q;  3CCQ P;  3H1K J;  3L73 D;  1SFC B;  1H88 A;  2C0W A;  1L0N D;  1S5L X;  3F89 A;  1L0N E;  4IFM A;  1NTM J;  1FDI A;  1JM0 A;  3HD7 D;  2WT7 A;  3H6P A;  3SSU A;  1N86 A;  4L76 A;  3LID A;  3V2R A;  3ZDM A;  1SVF A;  1NTK D;  1PP9 J;  3TGU G;  2JWA A;  2IZ0 A;  5AVR B;  2QJP C;  1SLQ A;  2ZT9 B;  4N78 E;  3SWY A;  1QGK B;  1Q82 Q;  2MJZ A;  2BCC G;  1OZH A;  4RO0 A;  3HRN A;  3IN6 A;  5CCH D;  1BCC G;  4JPZ B;  1EDJ A;  1OW8 A;  1K05 A;  2WWW A;  2YKO A;  2GM4 A;  4PV1 C;  3RK3 E;  3ITK A;  1NTM D;  3TGU D;  3TGU E;  4OGQ B;  1SQB J;  1SQV J;  1P84 E;  3HE5 A;  2JEE A;  1L2P A;  5AVZ B;  2LKM A;  3T97 A;  2ZXX A;  1FZF A;  3HUS A;  5K5G B;  2WTY A;  2BCC E;  2QVA A;  5KLI C;  3P8C D;  2E42 A;  3P8C E;  2SPZ A;  3P32 A;  1BCC E;  2B88 A;  2KNC B;  5GTI E;  1SQX K;  1FZA A;  1EDL A;  3MHV A;  2K9J B;  2HG5 D;  3L70 J;  5KAI E;  3OA7 A;  2E76 C;  2KUB A;  1KOR A;  1FOS E;  4HB1 A;  1FZG A;  4HJG H;  1FAV A;  2ZYD A;  2O01 H;  2H88 C;  2ZJS E;  2FFD C;  4PD4 H;  1H0T B;  1KIL E;  4PJ0 H;  2WSC H;  3BVH A;  1E5W A;  3PH0 A;  2KSJ A;  2NZ2 A;  2E75 D;  5APU A;  2AXC A;  4H13 D;  2WSE J;  3B71 A;  2OYI C;  1IO4 A;  2K9Y A;  1SQX G;  3G6E P;  2HOD A;  3NFQ A;  5APY A;  4XA4 A;  1JY2 N;  1G2C B;  1KYO D;  2OYO A;  3L71 E;  3C1L A;  3L70 D;  3LIE A;  1JOC A;  2LXC B;  2M0B A;  2R3S A;  3F5H A;  3CD6 P;  1GTW A;  1SQX E;  2WT7 B;  2RKL A;  4ASW A;  4EI2 A;  1LT1 A;  1DH3 A;  2G3A A;  2KB7 P;  4R4L A;  2N1T A;  2I1K A;  1FBM A;  3W67 A;  2BAS A;  5APS A;  3I55 P;  3D6Y A;  1JCD A;  1EXI A;  2WPS A;  1N8R Q;  1L0L K;  3BRV B;  1IZN B;  5CCG C;  1RF1 A;  1LTJ A;  3A0H H;  3EWK A;  2WSS H;  3AE1 C;  4H44 D;  1LTA C;  1YHQ P;  1HF9 A;  1NKN A;  1BGY J;  4PJ0 E;  3P7K A;  4DOJ A;  1MUU A;  3HE5 B;  3T97 B;  2I8D A;  3HUS B;  3B5N D;  4I6M C;  3H1L G;  4BWN A;  2IYO A;  1L0L G;  3GHG A;  1LGH B;  3B4S A;  2RMZ A;  1PPJ E;  3PJS K;  1LWU C;  1USD A;  1K8A Q;  2XU6 A;  3VP9 A;  2WVR A;  2Y0E A;  5AVY B;  1A02 F;  1L4A A;  3CC7 P;  1JEK A;  1S5L H;  4NPE A;  3L72 D;  3H1L E;  3CCS P;  3RK2 B;  1L0L D;  4DT0 A;  5AW2 B;  1L0L E;  1YJN P;  2QSI A;  2LXB A;  3O6Q A;  4W80 A;  1MKM A;  2KP8 A;  1VQL P;  2XNX A;  3HE4 A;  2HOD B;  2P67 A;  3CCJ P;  2PP6 A;  2IBZ I;  1KB9 H;  1VDF A;  1D7M A;  1SQQ J;  1YYC A;  1X9V A;  1GL2 C;  2FXP A;  4W7Y A;  1Q90 D;  3CCR P;  2Y9Z A;  3GF7 A;  4U7J A;  4AUW A;  3SWF A;  3USS A;  3RL0 C;  2FKW B;  4PV1 D;  2AEM A;  3AE2 C;  1U7J A;  1GU5 A;  1URQ C;  2WMM A;  3MTU E;  1QX8 A;  2JWD A;  3II6 A;  2YKQ A;  4Z1M H;  1KIL A;  4DZO A;  2ZYA A;  1IFI A;  4U3F J;  3OW2 O;  1N73 C;  2NPS C;  5KLV G;  2L91 A;  2J58 A;  1JMM A;  1IK9 A;  2E76 D;  4I7Z C;  3LW5 H;  3S4R A;  2WPQ A;  2OQQ A;  3O8Z A;  4ZKU A;  1S1C X;  1P84 I;  2P7J A;  1YTZ T;  3V4W A;  1K9M Q;  1FE6 A;  2XZR A;  4H0L C;  3GLM A;  1N7L A;  4KJM A;  1NKZ B;  3TK1 A;  2W6A A;  3M0A A;  5KLV D;  2N9B A;  1PIX A;  1G1I A;  3TF5 A;  3L75 G;  3GHG B;  5AW8 B;  2OGU A;  1AV1 A;  1PGJ A;  1S9K D;  1DX7 A;  1S9K E;  2Q5U A;  4AYC A;  2O1J A;  2D2C D;  4Y99 C;  1JY2 O;  1IK7 A;  3E1R A;  1KB9 E;  3CX5 H;  1ZOY C;  3BCC D;  1NU1 J;  1LNQ A;  3CWB G;  3IFM A;  5B66 H;  1UII A;  3L75 D;  3L75 E;  3KQG A;  3NTN A;  4M3L A;  2WPV B;  1R5S A;  2OYH C;  1AJY A;  3KDP B;  3JCU E;  1SQP J;  3A7O A;  3E1I A;  4NPD A;  3O6Q B;  1U57 A;  1S2E A;  1R8E A;  1NWQ A;  4IOI H;  3RK3 B;  1SFC C;  5KTB A;  3HE4 B;  2FYU K;  1VF5 B;  2C0X A;  1X0T A;  2V7Q J;  2FBW C;  1E79 H;  3RL0 g;  2M8R A;  3CWB E;  1N7S A;  1HGZ A;  3MP7 B;  5AVV B;  3RGU A;  1BSH A;  1ZRT D;  1ZRT E;  4GOF A;  4C7N A;  3FXD A;  5CCG D;  4KT0 J;  1NVO A;  4HH2 A;  2Q9I A;  1Y9B A;  3VMZ A;  3S1K A;  1TU3 F;  2I1J A;  2L5G B;  3IAO A;  3D70 A;  2ZT9 C;  1IC2 A;  1EXJ A;  1NTK K;  2ZVO B;  1NTZ J;  2E5Y A;  3KXD A;  1PZQ A;  1KIL B;  3VTP C;  1T6A A;  1NGM B;  2PRR A;  4TT3 H;  1CZQ A;  4YXW H;  3TNU B;  3AE8 C;  1KFM A;  2KXP B;  2IFN A;  2N1T D;  1GW3 A;  1GK6 A;  1KQL A;  1T2K C;  3L36 A;  1NTM K;  4PD4 I;  1KZU B;  3CX5 E;  1ZR4 A;  2YO2 A;  2FYU E;  4BXL A;  2QG4 A;  4Y28 J;  3WUU A;  2QM8 A;  1NTK G;  4EOT A;  1Q86 Q;  5B66 E;  3CL3 D;  1MFT A;  3L73 E;  2R3C A;  3A2A A;  2KZI A;  1JB0 J;  2WSF J;  1QEX A;  1FDM A;  3MUD A;  2IBZ D;  3H1K G;  5E79 H;  1VPC A;  1KC8 Q;  1NO4 A;  4D6T J;  3H1J J;  1LT9 A;  1GL2 D;  1NTM G;  1RQV A;  1NTK E;  2R44 A;  1KYO H;  2H89 C;  1NAF A;  1M7L A;  2P10 A;  3SFE C;  3RL0 D;  1L4A D;  3H1K D;  3H1K E;  2GUS A;  2YO3 A;  1BCC J;  4I2L C;  2QJY B;  5CJ4 A;  3CCL P;  1URQ D;  1YTZ I;  1SP4 A;  1NTM E;  2Z5H A;  2NRG A;  1HJ0 A;  5EFW B;  1N7S B;  4D6T D;  2NPS D;  1BE3 J;  3G71 P;  1PP9 D;  4C7N B;  2QJK B;  2P2U A;  3FGA D;  3FWL A;  1SS1 A;  1SQV G;  3AE7 C;  1T8Z A;  3KYQ A;  4JF7 A;  3D6Z A;  1WRG A;  2GUV A;  2POH A;  1RE3 A;  4H0L D;  3UIA A;  4WVZ A;  2C9N Y;  5KJ7 A;  3L71 J;  3L70 G;  1ZXG A;  2J59 M;  1HGV A;  2M5A B;  1SQB D;  4UB8 H;  4XFJ A;  3CXH I;  1SQV D;  1GW4 A;  1PFI A;  1AA0 A;  3U1A A;  4C7R A;  3G4S P;  3JSV C;  5E79 E;  3P8M C;  1SQX J;  3HUS C;  3H1H J;  2D2C C;  1M56 D;  3AEC C;  1LTG C;  1ZR2 A;  3MD0 A;  1KYO E;  1WMK A;  3L70 E;  2Z5I A;  3CC4 P;  2WPR A;  4EIJ A;  1T3J A;  5KAF H;  3AE5 C;  1FC2 C;  2HFE D;  3PLN A;  1VQ8 P;  4GT1 A;  5AW7 B;  1SFC D;  4WY4 A;  4IL6 H;  3PHL A;  1IFP A;  2A06 D;  3L37 A;  3RK2 C;  1W2B O;  2YMK A;  2YXR B;  1LT9 B;  2XV5 A;  1RE4 A;  2O01 J;  1M57 D;  5AW0 B;  3AE4 C;  2G8Y A;  2B89 A;  5KLI B;  2WSC J;  2FYZ A;  1NHL A;  3U59 A;  1S3J A;  1EZV G;  3AEG C;  5AVT B;  4TLF A;  5AW4 B;  2ZT9 D;  1LTT C;  2VRS A;  1MFZ A;  3FWN A;  3V2Q A;  5CMZ A;  2A45 I;  5AW5 B;  1JY2 P;  3H1I J;  2IFM A;  1BDD A;  1NJI Q;  5GTH E;  4UB8 E;  1EZV D;  1J1D B;  3L72 G;  4K3A A;  1EZV E;  2Z4E A;  3H1L J;  3V2N A;  3D71 A;  1FJK A;  4OGQ D;  5AW9 B;  4O9B A;  1FZC A;  2IX7 C;  1BGY G;  3HD7 A;  1T2K D;  2N1T C;  1LTI C;  1G1J A;  1KD1 Q;  2OYI B;  1OFC X;  3A0B H;  3H25 A;  3VYI A;  2AEF A;  1WT6 A;  3L72 E;  1RF1 C;  1LTJ C;  3WUV A;  5KAF E;  3I5C A;  1AFO A;  3H1I D;  1BGY D;  2M3B A;  1BGY E;  3G3Z A;  1KQS O;  1HJB A;  1VQ4 P;  3AEB C;  3H32 A;  5CCH A;  2QA4 P;  1YIT P;  2O3J A;  4IL6 E;  3CX5 I;  3CCV P;  1IFN A;  2YKP A;  4IFF A;  5APX A;  3GHG C;  2J5U A;  5AVW B;  5KLV K;  5CBO A;  2W6J H;  1BDC A;  5M1B A;  2KI7 B;  2DW3 A;  1AQT A;  1RY3 A;  1SQQ G;  2B87 B;  1L4A C;  3JCU H;  2C9L Y;  1OX3 A;  4WY4 B;  3N7N A;  2JR8 A;  3WUT A;  4WWI A;  2KYV A;  3VN0 A;  1RF0 A;  3L4F A;  3M9B A;  1ZW0 A;  2KS1 A;  2WZ7 A;  3TNU A;  1OVU A;  3RK3 C;  1SQQ D;  2IZ1 A;  5APW A;  1LTS C;  1VF5 C;  2O01 N;  4R4M A;  1H8A A;  4L73 A;  1LWU B;  2FXM A;  2FY8 A;  4U3F G;  4QMA A;  3A0B E;  2JKV A;  2XND H;  2IDB A;  3AE9 C;  1K73 Q;  2E74 B;  2H8P D;  1HTL C;  3BCC G;  5BVZ A;  4YXD C;  1T3U A;  5KLV E;  2N9Y B;  2Q1K A;  2V7Q H;  3L74 J;  1FZC B;  2WQY C;  1JCC A;  2YIU B;  1FOS F;  3HD7 B;  4U3F D;  1GZL A;  1KIL C;  2YMY A;  3SWK A;  1JMB A;  4ZNC A;  3BCC E;  1DIP A;  4GOD A;  1MZ9 A;  1JTH A;  3R4Y A;  1PGQ A;  2FYN B;  2JO1 A;  1KN7 A;  1OVR A;  1J1E B;  1JUN A;  1NU1 G;  4LLH A;  2OTK E;  2HPC A;  2YXQ B;  3H32 B;  2OTL P;  4OWF A;  2Q3E A;  3RK2 D;  2A45 G;  3PRJ A;  3EQ2 A;  3VMX A;  3CI9 A;  2W83 C;  1SQP G;  4IL6 X;  3KPE A;  2KIK A;  4EYY Q;  1JY3 N;  4KHX A;  3VMY A;  1QVF O;  1RHZ B;  2AXT H;  1GK4 A;  5CJ0 A;  1DEE G;  1LTB C;  1NOH A;  1NTZ K;  3B5N A;  2KOG A;  1NU1 D;  5H2F E;  1KFN A;  4W7Z A;  4DJG A;  2CK3 H;  3BAT A;  1M1J A;  3QWO C;  3AEA C;  3B8E B;  4A7P A;  1KMI Z;  2HYN A;  1VQN P;  3M0D A;  4N3Y B;  1MV8 A;  1SQP D;  2KSE A;  2ZVN B;  1XTC C;  1ZN5 A;  1VQ6 P;  2R5D A;  3NXS A;  2FYU J;  4GKG A;  2M5A A;  2QJY C;  2KS1 B;  3PTZ A;  4OVN F;  3L73 J;  5B5E E;  1NTZ G;  4OGQ C;  2E75 B;  1J2J B;  2QRX A;  1L0N J;  1VQO P;  3IR9 A;  4UB6 E;  1N7S C;  4H13 B;  4EDF A;  3L35 A;  2IBZ G;  3CLQ A;  2K1A A;  2W27 A;  1ZLL A;  3CCM P;  3NMD A;  1XTG B;  1NTZ D;  1VQ9 P;  1NTZ E;  4CPG A;  2Q7C A;  1VL2 A;  4DCK A;  3AED C;  2IBZ E;  3JC2 2;  1NAY A;  3AEF C;  3C8V A;  3TGU J;  2AXT E;  3Q5R A;  1LP1 A;  1SQB K;  5TIS H;  1JTH B;  1SQV K;  4D6T G;  1CW5 A;  2BCC J;  3H1J G;  1PP9 G;  1K04 A;  4YTP C;  4B86 A;  1VQM P;  3V4Q A;  1OVV A;  4YPC A;  5DJT B;  2HPC B;  1IJD B;  1Y47 A;  4N78 D;  4H44 B;  1KTM A;  1HWT C;  3GG2 A;  3C9I A;  2FFD A;  3G9R A;  3A3Y B;  3HTK B;  1VQP P;  1RH5 B;  2WSE H;  3VP8 A;  3R2P A;  3H1J D;  4D6T E;  3RK3 D;  3H1J E;  3MUD C;  3B5N B;  2JP3 A;  1PP9 E;  1VF5 D;  4HYT B;  2PAJ A;  5AVX B;  1SQB G; 
#chains in the Genus database with same CATH homology
 3V2Q A;  5CMZ A;  1IFI A;  2A45 I;  2QM7 A;  3N4X A;  5AW5 B;  1LT9 C;  2O1K A;  1M1J B;  2OYI A;  1FZB A;  1JY2 P;  4WY4 D;  1N73 C;  1FZE A;  2IFM A;  2NPS C;  4I1L A;  2J58 A;  5AW6 B;  1JMM A;  1IK9 A;  2JJL A;  1J1D B;  1HH0 A;  3LW5 H;  2Z4E A;  3V2N A;  1N2D C;  1FJK A;  2P1J A;  5AW9 B;  2WPQ A;  4LGD E;  4O9B A;  4ZKU A;  3O8Z A;  1FZC A;  4Y99 B;  2IX7 C;  3HD7 A;  1T2K D;  2P7J A;  1YTZ T;  3V4W A;  2N1T C;  1LTI C;  3B5N C;  1G1J A;  2R5B A;  2XZR A;  2OYI B;  2YNY A;  1N7L A;  2CPB A;  2XDJ A;  1NKZ B;  3TK1 A;  2W6A A;  1M1J C;  3M0A A;  1JY3 P;  2N9B A;  4AQR D;  1KIL D;  1G1I A;  3VYI A;  1QL1 A;  1WT6 A;  3GHG B;  5AW8 B;  1G2C A;  3M0D C;  1LTJ C;  1RF1 C;  2OYH B;  4IFD K;  1J1D C;  1S9K D;  1DX7 A;  1S9K E;  2Q5U A;  3I5C A;  4AYC A;  1W2E A;  1AFO A;  2W6B A;  1AQ5 A;  2M3B A;  2O1J A;  3G3Z A;  2XKM A;  4Y99 C;  3TYY A;  1JY2 O;  1HJB A;  1SFC B;  1H88 A;  3H32 A;  1CI6 A;  5CCH A;  3VOP A;  2C0W A;  4IFM A;  3HD7 D;  5CCG A;  2WT7 A;  5BU8 B;  1IFN A;  3IFM A;  3H6P A;  2YKP A;  4IFF A;  1RE3 C;  1N86 A;  3KQG A;  3M91 A;  5APX A;  3NTN A;  3LID A;  3GHG C;  4M3L A;  3V2R A;  5KJ7 C;  2OYH C;  1SVF A;  3KDP B;  5AVW B;  5KLV K;  3WMM 0;  3A7O A;  3E1I A;  4ZKP A;  5AVR B;  1NWQ A;  1JY3 O;  3RK3 B;  1SFC C;  5KTB A;  3HE4 B;  1SLQ A;  2FYU K;  4N78 E;  3SWY A;  1RY3 A;  2C0X A;  1X8Y A;  2MJZ A;  4WBA A;  1L4A C;  2C9L Y;  2M8R A;  1N7S A;  1HGZ A;  4WY4 B;  3HRN A;  5CCH D;  5AVV B;  3N7N A;  2WWW A;  2YKO A;  1LWU A;  2GM4 A;  4C7N A;  2KYV A;  5CCG D;  4HH2 A;  3VN0 A;  1RF0 A;  2Q9I A;  3L4F A;  3M9B A;  3VMZ A;  3M9Q A;  1OWA A;  2I1J A;  2WZ7 A;  2L5G B;  3TNU A;  2FFD B;  3HE5 A;  2JEE A;  3RK3 C;  5AVZ B;  2LKM A;  3U1C A;  3T97 A;  1FZF A;  3HUS A;  1IC2 A;  1JO5 A;  5APW A;  1LTS C;  1FU1 A;  1NTK K;  4C46 A;  2WTY A;  3P8C D;  2E42 A;  1H8A A;  3P8C E;  2IPP A;  1LWU B;  3P32 A;  4XE5 B;  4WY4 C;  2FXM A;  1KIL B;  1SQX K;  1FZA A;  3VTP C;  2HG5 D;  1N7S D;  1CZQ A;  3OA7 A;  3MGN A;  3TNU B;  1H89 A;  2H8P D;  1HTL C;  1KFM A;  1GD2 E;  1RE4 C;  2IFN A;  2N1T D;  1FOS E;  4GIF A;  1GW3 A;  1Z56 A;  5BVZ A;  1FZG A;  1FAV A;  1GK6 A;  2O01 H;  1KQL A;  2FFD C;  1T2K C;  1T3U A;  1ZV8 A;  5AVS B;  3L36 A;  1GL2 A;  1NTM K;  2WSC H;  1KZU B;  3BVH A;  1ZR4 A;  1E5W A;  5APQ A;  1JCC A;  1FZC B;  1OXZ A;  2YO2 A;  1FOS F;  2KSJ A;  3HD7 B;  4JYB A;  1X79 B;  1GZL A;  1SQQ K;  2QM8 A;  1KIL C;  4EOT A;  2YMY A;  1EQ7 A;  5APU A;  3CL3 D;  4JYC A;  2R3C A;  3A2A A;  1GDT A;  2OYI C;  1IO4 A;  2HOD A;  3NFQ A;  5APY A;  4XA4 A;  1URQ A;  1JY2 N;  1MZ9 A;  3PP5 A;  1JTH A;  5AVU B;  1G2C B;  4RES B;  1FDM A;  3MUD A;  5AVQ B;  3LIE A;  1JOC A;  1J1E B;  1FZC C;  1JUN A;  2E43 A;  1VPC A;  1IFM A;  1NO4 A;  4LLH A;  3HD7 C;  1LT9 A;  2HPC A;  1GL2 D;  3H32 B;  1CI6 B;  1N73 A;  1JNM A;  2NPS A;  3RK2 D;  4LC1 A;  2A45 G;  3EQ2 A;  2H7H A;  1GTW A;  3VMX A;  1NAF A;  3EFG A;  2WT7 B;  2CPS A;  2ZXE B;  1DH3 A;  1M7L A;  3CI9 A;  2R32 A;  3RL0 D;  2KB7 P;  3KPE A;  1JY3 N;  4KHX A;  1L4A D;  3VMY A;  1GK4 A;  5CJ0 A;  2GUS A;  1LTB C;  2N1T A;  2YO3 A;  1NOH A;  1NTZ K;  2I1K A;  3B5N A;  1IFD A;  3OJA B;  4I2L C;  2KOG A;  1FBM A;  5CJ4 A;  2BAS A;  5APS A;  1IFJ A;  1JCD A;  1J1E C;  1URQ D;  1YTZ I;  1KFN A;  1HUC A;  1SP4 A;  2WPS A;  4W7Z A;  1L0L K;  3BAT A;  1M1J A;  5CCH C;  3B8E B;  3BRV B;  2Z5H A;  2HYN A;  1N7S B;  2HLO A;  5CCG C;  1FJP A;  3M0D A;  1LTJ A;  1RF1 A;  4N3Y B;  1MV8 A;  2N1T B;  1XTC C;  2NPS D;  1LTA C;  5APT A;  4N6J A;  1ZN5 A;  2A45 H;  3M9H A;  4C7N B;  2R5D A;  3NXS A;  2P2U A;  4GKG A;  1T8Z A;  3KYQ A;  5BU5 A;  1NKN A;  3P7K A;  4DOJ A;  1MUU A;  1CSB A;  4JF7 A;  3HE5 B;  1WRG A;  3B5N D;  2GUV A;  3HUS B;  2POH A;  1J2J B;  1RF1 B;  1LTJ B;  4I6M C;  1RE3 A;  3BAS A;  3UIA A;  1NU1 K;  3IR9 A;  2C9N Y;  3GHG A;  1N7S C;  3BRT B;  5KJ7 A;  1LGH B;  2OYH A;  3L35 A;  3CLQ A;  2J59 M;  1HGV A;  2W27 A;  3M06 A;  1LWU C;  2Q3I A;  1GW4 A;  1ZLL A;  1PFI A;  1SFC A;  1RF0 C;  2XU6 A;  3VP9 A;  5AVY B;  3NMD A;  3U1A A;  1SQP K;  3V5B A;  4C7R A;  1A02 F;  1L4A A;  1XTG B;  1DEB A;  3MIW A;  4WB4 A;  1GL2 B;  3P8M C;  4OH8 B;  2Q7C A;  3HUS C;  3RK2 B;  5AW2 B;  1LTG C;  1ZR2 A;  3MD0 A;  1HBW A;  2H43 A;  2Z5I A;  3A5T A;  5CHX A;  2KLV A;  2WPR A;  4W80 A;  3RL0 B;  2KP8 A;  4EIJ A;  1L4A B;  3TSI A;  5KJ7 D;  1T3J A;  2XNX A;  3HE4 A;  2OAR A;  2HOD B;  2P67 A;  2HFE D;  1URQ B;  1SQB K;  3OAK A;  2PP6 A;  1JTH B;  1VDF A;  4GT1 A;  1SQV K;  1YYC A;  1X9V A;  1GL2 C;  3HTK A;  1SFC D;  4WY4 A;  1QL2 A;  5AW7 B;  1NH4 A;  4W7Y A;  1CW5 A;  3L37 A;  3RK2 C;  1HVV A;  3V2P A;  5AW3 B;  4B86 A;  2WIT A;  3V4Q A;  1GU4 A;  1LT9 B;  5APV A;  5AW1 B;  2HPC B;  1N73 B;  1IJD B;  2XV5 A;  1RE4 A;  2NPS B;  5AW0 B;  3SWF A;  4AUW A;  4N78 D;  3RL0 C;  1HWT C;  2FKW B;  3C9I A;  2FYZ A;  2FFD A;  1NHL A;  3U59 A;  3A3Y B;  3HTK B;  1GU5 A;  5AVT B;  2WSE H;  1URQ C;  3MTU E;  3VP8 A;  3R2P A;  2ZFC A;  5AW4 B;  1L0N K;  3II6 A;  1A02 J;  3RK3 D;  2YKQ A;  3B5N B;  2WSF H;  1LTT C;  1KIL A;  4DZO A;  2VRS A;  1MFZ A;  4HYT B;  2PAJ A;  5AVX B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...