2IFNA

Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 angstroms resolution x-ray fibre diffraction data
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
46
structure length
46
Chain Sequence
GVIDTSAVESAITDGQGDMKAIGGYIVGALVILAVAGLIYSMLRKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Pf1 filamentous bacteriophage: refinement of a molecular model by simulated annealing using 3.3 A resolution X-ray fibre diffraction data.
pubmed doi rcsb
molecule tags Virus
molecule keywords PF1 FILAMENTOUS BACTERIOPHAGE
total genus 16
structure length 46
sequence length 46
ec nomenclature
pdb deposition date 1994-01-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.230 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2ifnA00
1IFMA 1PFIA 1QL2A 3IFMA 2IFNA 2KSJA 2XKMA 1ZN5A 2IFMA 2KLVA 4IFMA 1IFNA 1QL1A
chains in the Genus database with same CATH superfamily
3JC22 4K35A 3TDKA 2FYNC 4JF7A 1Y8AA 1M1JA 3L70D 2G3AA 3WUUA 2YKPA 5CBOA 1FJKA 1OW6A 1L4AB 2RMZA 5KLVD 4A7PA 1H0TB 4JYCA 1Q86Q 3E1RA 3VN0A 3RBXA 3A0HH 4PJ0E 2E74C 3N7NA 3AE3C 3KZIH 1M1JB 1URQC 4RESB 2W83C 1JB0J 5B5EE 4IOIH 2M8RA 1KQGB 2KS1A 1QLED 1AQTA 1NTZG 4JYBA 1SVFA 2KUBA 5AVYB 1U57A 3UIAA 4H13C 2QG4A 1JTHB 5AW1B 3USSA 1IK9A 4U3FE 1S5LX 3L75E 1SQXE 3CXHH 5AW0B 1IJDB 5APVA 1FE6A 1P84I 1FJPA 2NZ2A 3FWLA 5APUA 1VF5C 2PRRA 3H1KE 3PTZA 3CMEP 4JPZB 1GK4A 1YHQP 5CCGA 1KTMA 5B5EH 1OW7A 4GKGA 3KZIE 2ZAEB 3L72J 2AEMA 2KB7P 2GUVA 3P8CD 1KILE 1L4AD 2O01N 2W6JH 3H1JE 2HR3A 3HE5B 1LTJA 4L74A 3IF4A 4Y28J 5DJTB 1KQLA 4NPFX 3L70J 4AQRD 1GZLA 1IFDA 2J5UA 3VP8A 1KB9D 2OQQA 5AVTB 3SSUA 3G4SP 1H8AA 2Q3EA 1Y47A 2V7QJ 1H0TA 3TF5A 4NPDA 1JM0A 1SQPD 1OZHA 2I8DA 1NTKE 5AVQB 1NTKK 1QX8A 5H2FE 4WB4A 3SFDC 4DOJA 2WT7A 1G2CA 1BE3G 1LJ2A 1NOHA 2AXCA 2E76D 3GMAA 2KZIA 2XKMA 3CCQP 3CI9A 4M3LA 2XDJA 1FOSE 1SLQA 2V4HA 1Q81Q 1DEBA 1SQVK 1L0NK 2O01J 3L74D 1L0LE 1G1JA 1SP4A 4I6MC 3SWKA 3P7KA 3H1IE 2J58A 1JTHA 1KYOE 2M3EA 2Q5UA 3AE1C 3M91A 1Q82Q 2ZT9B 1SQQK 2HFED 5KKZB 2OARA 1HF9A 2XZRA 3CX5H 1OVUA 3CX5E 3M0AA 3CLQA 4HKZH 4R4MA 1YJNP 3S4RA 5APYA 3TYYA 2KOGA 3L70G 3MUDA 1OXZA 4DCKA 2FY8A 2LXCB 5KLVG 1ZMEC 2KYVA 1JY2O 1A02J 1NTKJ 5KJ7C 3RK3E 1RF1B 1WRGA 1BGYJ 1NTMK 1JCCA 2OYHC 1QEXA 2B88A 3OW2O 3KPEA 3RL0g 1DIPA 4XA4A 2WMMA 1KB9I 1GL2B 1YTZI 2MKVA 3A7OA 1NTZD 4Y99B 2N9BA 3VMXA 3Q5PA 3H25A 1SQPJ 4D6TJ 1RY3A 3TNUA 2P2UA 3CCSP 1EZVE 3VMYA 1GL2A 1JNMA 1H89A 2CPSA 3BRVB 1EZVI 4Z1MH 4N6JA 2JWDA 2KIKA 2CK3H 2W90A 3NXSA 3H1KJ 1RE3A 2QSIA 2QEXP 1MFZA 2HLOA 4OWFA 1SQQE 1N7LA 2KNCA 3B5ND 3H1HJ 3CWBJ 3MP7B 2B87A 2OYIC 2FKWB 4U3FJ 2G8YA 1RH5B 4PD4D 1NU1J 1JMBA 1AVOA 1OW8A 1HJ0A 2JEEA 2MJZA 1SQBJ 1A02F 1HGVA 1MZ9A 1NTKG 1T2KC 1T3JA 5CMZA 3CWBD 1LNQA 1SQBE 1SQPG 2YXRB 4D6TG 3F5HA 2I1JA 1USDA 4O9BA 5KTBA 1R5SA 2KXPB 4GODA 1YJWP 2FYUD 1BE3D 4XE5B 1S72P 1N7SA 2A45H 4GOEA 4N3YB 1W2EA 2JP3A 3TK1A 1U7MA 3IN6A 3H1LJ 1DEEG 2BCCE 2ZFCA 2XV5A 4BRYB 3H1HE 1LTIC 2Z5HA 2AXTE 5CHXA 2C0XA 1GTWA 2D2CD 1N7SB 5KLIB 3Q5RA 2WVRA 3G71P 1SS1A 3L73E 1NU1K 1LTAC 1PGPA 1IFJA 3B71A 4BRYA 3L70E 1N7SC 1QL2A 4C7NA 2P1JA 2K1AA 3AE8C 2Q3IA 3CC4P 4OGQB 2O01H 4N78E 1QVFO 1ZR4A 1KMIZ 3VMAA 5AVRB 1LT9B 2Q7CA 3V2NA 2E43A 1IZNB 3HD7B 1TU3F 2GA1A 3BVHA 4IL6E 4EYYQ 1VQ4P 3P8MC 1N2DC 4IL6X 3S1KA 3S9OA 1RF1C 1LT9A 4DZOA 3AEFC 5AW8B 1EDLA 3L71G 1EZVG 3L75D 1BSNA 2WSEJ 1WMKA 3LW5H 2BCCD 4WBAA 2E76B 5C39A 3CC2P 1Q2NA 2IPPA 1LWUB 3R4YA 2H7HA 1G1IA 2WPSA 3WUVA 1PGJA 1N7SD 2E76C 1FZGA 4KHXA 3PJSK 1N73A 3CXHE 1Q90D 4UB8H 1J1EB 2E5TA 3KHUA 3SWFA 1EXJA 2YIUB 1NGMB 1VQ8P 2FFDA 2QJPB 2C9LY 4N78D 1ZV8A 2C0WA 2OTLP 1AA0A 3U1CA 2Q6QA 4YPCA 1KC8Q 4ZKPA 2FXPA 2IBZI 2YMKA 1S9KE 3L37A 1L4AC 2KSEA 1FU1A 4AYCA 2JKVA 1NTKD 1GMJA 2OTKE 3CWBG 1URQB 1M1JC 2FXOA 4Y99C 2QM7A 3AECC 1GL2D 1MFTA 1FZCA 4ASVA 1RF1A 2FYUG 2GUSA 3CCMP 1HBWA 3H1LG 5APXA 3RK2C 1L0LK 2P58A 1NWQA 5AW7B 1LGHB 2POHA 3GG2A 1QL1A 2ZXXA 1HWTC 4I7ZC 4H44B 4I2LC 1VQLP 1S3JA 1ZLLA 2FBWC 2IFNA 2VRSA 3AEBC 2WSFJ 5AW9B 1S2EA 2IYOA 1IFNA 5B66E 3T97B 4IFDK 2WTYA 5DJUB 3OAKA 4C46A 1AQ5A 1R5LA 1URQD 2WSEH 5KAIE 3WU2H 1UIIA 1R8EA 1CZQA 3KQGA 2A45G 3HTKA 3R2PA 3KDPB 1T3UA 3I55P 3PHLA 1JMMA 3RBZA 5E79H 1EDKA 2I1KA 5CCGC 2JO1A 4PV1D 1BDDA 1J2JB 4PV1C 5KLVJ 2K9YA 4OGQC 1PIXA 2JR8A 2L91A 5AVSB 4YXWH 3GF7A 1VL2A 1LWUA 5CCHA 3MD0A 3A0BE 2RH0A 1SQVJ 2NPSC 2Q9IA 3L71D 1EZVD 3L75G 3FWNA 1K04A 3AE2C 3M0DC 1ZN5A 2BCCG 3GW6A 3PLNA 3QH9A 4W7ZA 1SQXK 5AW3B 3H1ID 1LT1A 2PAJA 1OVVA 5GTIH 1VQ5P 1EC5A 1K9MQ 4ZNCA 3JCUH 2Z4EA 1X22A 1RF0A 4IFFA 2JWAA 1NU1D 2LR2A 2E75B 3O6QB 1USEA 1KD1Q 3RK2D 1CI6A 1DH3A 1AJYA 1KN7A 1N8RQ 4ZMDA 4YTPC 3L36A 5KLVK 1PP9E 3H1HD 2H89C 1YIJP 5BU5A 4HH2A 2FYNB 3L71J 3D70A 1URQA 1JEKA 3A3YB 3G3ZA 4PV1B 3V2QA 2BASA 1FZCB 4UB6E 4DT0A 1JY3P 3M9BA 4PD4H 2A06D 1SQQG 2R3CA 2ZYGA 2E42A 2PGDA 2BEZF 3BCCD 3TNUB 1SFCA 3GHGC 3RK3C 3MUDC 4I1LA 2J59M 1OVRA 4EOTA 3PP5A 2QA4P 2AEJA 2AXTH 2H43A 1AFOA 3H1LD 3Q2YA 1VQ7P 1NTZJ 2Y9YA 3ITKA 5E79E 5CCHD 4RKUJ 1NJIQ 1KZUB 2QIWA 1VDFA 1HVVA 1L0NE 2O1JA 2Y0DA 3MZWB 3AEEC 2IZ0A 2PFXA 3HE5A 4GOFA 1AV1A 1DX7A 1KYOI 2H8PD 2QJPC 1RHZB 2HODA 1S1CX 1KV4A 3SFEC 1JCDA 3AE7C 4PD4E 2O1KA 5AW6B 4C7RA 1ZOYC 2R5DA 3IAOA 3O6QA 2KS1B 3CXHD 2WPVB 1JO5A 2QJKC 1FAVA 1KFMA 4JBZA 1RE3C 2YKQA 3NTNA 4EDFA 2IBZG 1IC2A 3L72G 3E7KA 1FZBA 4LC1A 5KLVE 2WT7B 3L74J 5AVVB 1BDCA 3D71A 1SQVD 2FYUE 2AEFA 2Y0EA 2Z5IA 2NPSD 1M1KQ 3RK2B 4KJMA 1T6AA 1YI2P 2LKMA 1DD4A 3HUSB 1M90Q 3W67A 3V4WA 5BVZA 2ZYDA 1VF5B 3H1IG 4WWIA 1IFPA 2D2CC 3LIDA 4OGQD 4HB1A 3Q5SA 1W5CE 2W8ZA 1LTJC 1VPCA 5GTHE 2N1TD 3FX0A 4JQ0D 1NU1G 1PV3A 3H6PA 1Z56A 5KAFE 1U7JA 2QJYC 1BE3E 4OVNF 3CPWO 1MV8A 2E75D 2OGUA 2ZT9C 1BSHA 3HRNA 1PFIA 4W80A 2K88A 3B5NB 3H1HG 2IFMA 2KP8A 2QJYB 4BWNA 5GTIE 2A45I 3T97A 3P8CE 2KNCB 3FGAD 2O3JA 1N86A 2A06G 1SQQD 1S5LH 3V6IA 1VQ9P 3BCCG 1NHLA 3LW5J 3PRJA 5EFWB 3HE4B 1BGYG 4YXDC 1X79B 2NPSB 1L2PA 2RKLA 5L8RJ 3L4FA 3V4QA 2JJLA 3C9IA 4H0LC 1GL2C 3W68A 1GDTA 1NTMJ 3B4SA 3A0BH 1NTME 2K37A 1JOCA 3MGNA 1L0LD 4QMAA 2P10A 1T8ZA 3VP9A 5M1BA 2WPQA 1UIXA 1IK7A 3RL0D 5K5GB 1HUCA 3CCJP 3EFGA 2FFDB 1G2CB 2GM4A 1SQXG 4D6TD 3OA7A 4WY4C 4ASWA 2P7JA 3EWKA 3II6A 1PP9G 4AUWA 1YITP 3WUTA 3BCCJ 1K8AQ 1FOSF 3H1KG 1FZEA 2YIUC 5H2FH 1LTSC 4WY4B 2N1TA 3H32A 5KKZC 1EDJA 4U7JA 2WZ7A 5APWA 2YNYA 1BE3J 3F89A 1NH4A 2R3SA 3GF3A 3KYQA 3RGUA 1QGKB 1HH0A 1X9VA 2ITAA 4UB6H 2IBZD 3L72D 1PL5A 1RF0C 5KJ7D 3U1AA 3HUSA 1X0TA 1KB9H 3HD7D 3CXHI 1RQUA 1GK6A 1SQVG 2QJKB 2WWWA 1PZQA 3EQ2A 4H0LB 2E5YA 2R44A 3WMM0 2M0BA 1OX3A 3VYIA 1QVGO 2M5AB 1L0NJ 2B89A 4K3AA 4KT0J 3AE5C 1BCCG 1SFCD 3JCUE 3VOPA 5CBNA 1E5WA 2H88C 1XTGB 1JY3N 3TGUJ 2XNDH 1S5LE 1LP1A 3AE4C 2M5AA 2W27A 1KQFB 4I7ZB 1P84E 2B87B 3CCEP 3QWOC 2NRGA 3CD6P 3H1LE 1KQSO 2ZJSE 5AW4B 1KB9E 2WSSH 3V5BA 1ZW0A 1L0NG 1EDIA 2W6AA 4UB8E 1E79H 1VQMP 4DJGA 2WSFH 1JUNA 2K9JB 2W6BA 3C8VA 2N1TB 1LT9C 1ZXGA 2FYZA 2CPBA 2FYUJ 4TT3H 2KLVA 3VTPC 1EXIA 3CCRP 1BGYD 3AEDC 1JY3O 5B66H 3AEGC 5KJ7A 1PGQA 1ZRTD 5APTA 1GW3A 5TISH 1JY2P 1SQBD 1KILC 1WT6A 4OH8B 1T2KD 1L0LG 1CW5A 2HPCA 5KLIC 1VF5D 3AEAC 1SQVE 2FXMA 2PP6A 4MN4C 2ZVOB 4EI2A 4ZKUA 1H88A 1SQXD 1Y9BA 2HPCB 1YQ3C 2WITA 3N4XA 1PP9D 3L71E 4H13D 3CCUP 3B5NC 3H1KD 1KILA 2YO2A 1M57D 1K73Q 1FDIA 1M56D 3TGUE 1W2BO 1FZAA 2LXBA 2YXQB 1NYHA 1KFNA 1YQ4C 4NPEA 1HTLC 1RE4C 1XTCC 4RO0A 2HYNA 4U3FG 4C7NB 2KK7A 3I56P 1NKZB 2WPRA 3H1JD 4HJGH 2IYPA 4WVZA 2OYIA 3L35A 4W7YA 3HTKB 1FZCC 1NTZK 5GTHH 4WY4D 3GHGB 1PPJD 3P32A 3RK3B 4LGDE 2K9JA 2R32A 1S4XA 1X8YA 1BCCD 3PH0A 1GD2E 2V7QH 2SPZA 1OMIA 3RL0C 5KAFH 2L5GB 1KORA 2FFDC 4EIJA 1LTGC 1VQPP 3GLMA 1MUUA 3BCCE 2ZXEB 4XFJA 3RL0B 1LTTC 2N9YB 1L0LJ 2B9BA 3CL3D 4H0LD 4H44C 3G6EP 3CC7P 2XU6A 1NTMD 1OIPA 2DW3A 2KZJA 3TGUD 1KYOD 3IR9A 2OYHA 3E1IA 3TSIA 3CWBE 3CCVP 3L73G 3V2RA 1L0ND 1SQQJ 4IL6H 1N73C 1VQ6P 1KILD 3JSVC 3FXEA 4TLFA 2OYHB 1NKNA 4WY4A 5AVZB 1ZR2A 4HYTB 1D7MA 2QE7H 3M0DA 2R5BA 1JY2N 1KYOH 2N1TC 2HG5D 5CJ0A 3A5TA 1J1DC 2JDIH 3FXDA 1FC2C 3C1LA 1SQBG 2YMYA 5AVWB 1IO4A 1NTZE 2OYOA 3B8EB 2Y9ZA 1OWAA 3V2PA 1VQKP 2IZ1A 5CJ4A 3I5CA 4L73A 4GT1A 4R4LA 1KILB 1CSBA 1SQPK 2D2CB 3AE9C 1BGYE 3M9HA 5BU8B 1J1EC 3M9QA 5AVUB 1YBKA 1K05A 3A2AA 4LLHA 1LTJB 2QRXA 3CX5I 3SWYA 3ZDMA 3BASA 2UWJE 1LTBC 2WSCH 3WU2E 5KAIH 2OYIB 1FS0E 5CCGD 1N73B 3OJAB 4PD4I 3CX5D 1FZFA 2E74B 4IFMA 1PP9J 3HE4A 5APQA 1SFCC 1ZP0C 4U3FD 2ZVNB 3H1JG 3VMZA 1NVOA 3LIEA 3L74E 1NAFA 3NFQA 1GW4A 1NO4A 4H13B 1J1DB 2WQYC 3HD7C 4RJTA 1Q7YQ 1IFMA 1PPJG 1SQBK 2C9NY 2YO3A 2FYUK 3K5BA 2IDBA 2RN0A 3D6ZA 3Q3DA 2YKOA 1BCCJ 2E74D 2HODB 3NMDA 3O8ZA 1GU5A 1HJBA 5CCHC 3KXDA 5AW2B 3H32B 4B86A 1ZRTE 2KSJA 5TJHA 1YYCA 2QVAA 2OTJP 1PPJE 1YTZT 1NTMG 3RK3D 4L75A 2KI7B 2XNXA 3H1JJ 3TGUG 1M8OB 1RQVA 3ABVC 3EFFK 1NU1E 1SQPE 2BEQD 4CPGA 4D6TE 3L73D 1YJ9P 2P67A 1DD3A 2IBZE 3BATA 1SFCB 2KLUA 2Y0CA 3L72E 2A06E 1IFIA 1P84H 1CI6B 3M06A 2WSCJ 1HGZA 4GIFA 1VQOP 1FBMA 3CCLP 2BCCJ 3AE6C 3MHVA 1SQXJ 2QM8A 3L75J 1LP1B 1MKMA 2K3RA 1OFCX 1NAYA 4L76A 5AVXB 4BXLA 1M7LA 2ZYAA 3HD7A 3A0HE 1FDOA 4PJ0H 1PGOA 3G9RA 1LWUC 1VQNP 1GU4A 1FDMA 1RE4A 2IX7C 3HUSC 5AW5B 1P84D 2NPSA 3CMAP 4H44D 4GDOA 3BRTB 3GHGA 3L74G 3MIWA 5APSA 3H1IJ 3IFMA 3L73J 3U59A 3B5NA 3Q1MA 2E75C 2ZT9D 3MTUE 1S9KD 1EQ7A 3D6YA 2M3BA 1L4AA 1BCCE 5TISE 1AVYA 2Q1KA
chains in the Genus database with same CATH topology
4JF7A 1M1JA 5CCGD 2YKPA 1FJKA 1L4AB 4JYCA 3VN0A 3N7NA 4RESB 1M1JB 1URQC 2M8RA 4JYBA 1SVFA 3UIAA 5AVYB 5AW1B 1JTHB 1IK9A 5AW0B 1IJDB 5APVA 1FJPA 5APUA 1GK4A 5CCGA 4GKGA 2KB7P 2GUVA 3P8CD 1L4AD 3HE5B 1LTJA 1KQLA 4AQRD 1GZLA 1IFDA 3VP8A 1H8AA 5AVTB 5AVQB 4DOJA 1NTKK 4WB4A 2WT7A 1G2CA 1NOHA 2XKMA 3CI9A 4M3LA 2XDJA 1FOSE 1SLQA 1DEBA 1SQVK 1L0NK 1SP4A 1G1JA 4I6MC 3P7KA 3M91A 2J58A 1JTHA 2Q5UA 1SQQK 2HFED 2OARA 2XZRA 3M0AA 3CLQA 5APYA 3TYYA 2KOGA 3MUDA 1OXZA 2KYVA 1JY2O 1A02J 5KJ7C 1RF1B 1WRGA 1NTMK 1JCCA 2OYHC 3KPEA 4XA4A 1GL2B 1YTZI 3A7OA 3VMXA 4Y99B 2N9BA 1RY3A 3TNUA 2P2UA 1JNMA 1H89A 3VMYA 1GL2A 2CPSA 3BRVB 4N6JA 3NXSA 1RE3A 1MFZA 2HLOA 1N7LA 3B5ND 2OYIC 2FKWB 2MJZA 2JEEA 1A02F 1HGVA 1MZ9A 1T2KC 1T3JA 5CMZA 5KTBA 2I1JA 4O9BA 4XE5B 1N7SA 2A45H 4N3YB 1W2EA 3TK1A 2ZFCA 2XV5A 1LTIC 2Z5HA 5CHXA 2C0XA 1GTWA 1N7SB 1NU1K 1LTAC 1IFJA 4C7NA 1N7SC 1QL2A 2P1JA 2Q3IA 2O01H 4N78E 5AVRB 1LT9B 2Q7CA 3V2NA 2E43A 3HD7B 3BVHA 3P8MC 1N2DC 1RF1C 1LT9A 4DZOA 5AW8B 4WBAA 3LW5H 2IPPA 1LWUB 2H7HA 1G1IA 2WPSA 1N7SD 1FZGA 4KHXA 1N73A 1J1EB 3SWFA 2FFDA 2C9LY 4N78D 1ZV8A 2C0WA 3U1CA 4ZKPA 1S9KE 3L37A 1L4AC 1FU1A 4AYCA 4Y99C 1M1JC 1URQB 2QM7A 1GL2D 1FZCA 1HBWA 1RF1A 2GUSA 5APXA 3RK2C 1L0LK 1NWQA 5AW7B 1LGHB 2POHA 1QL1A 1HWTC 4I2LC 1ZLLA 2VRSA 2IFNA 5AW9B 1IFNA 4IFDK 2WTYA 1AQ5A 3OAKA 4C46A 2WSEH 1URQD 1CZQA 3KQGA 2A45G 3HTKA 3R2PA 3KDPB 1T3UA 1JMMA 2I1KA 5CCGC 1J2JB 5AVSB 1LWUA 5CCHA 3MD0A 2NPSC 2Q9IA 3M0DC 1ZN5A 4W7ZA 1SQXK 5AW3B 2PAJA 2Z4EA 1RF0A 4IFFA 3RK2D 1CI6A 1DH3A 3L36A 5KLVK 5BU5A 4HH2A 1URQA 3A3YB 3G3ZA 3V2QA 2BASA 1FZCB 1JY3P 3M9BA 2E42A 2R3CA 3TNUB 1SFCA 3GHGC 3RK3C 4I1LA 2J59M 4EOTA 3PP5A 1AFOA 2H43A 5CCHD 1KZUB 1VDFA 1HVVA 2O1JA 3HE5A 1DX7A 2H8PD 2HODA 1JCDA 2O1KA 5AW6B 4C7RA 2R5DA 1JO5A 1FAVA 1KFMA 1RE3C 2YKQA 3NTNA 2WT7B 4LC1A 1IC2A 1FZBA 5AVVB 2Z5IA 2NPSD 3RK2B 2LKMA 3HUSB 3V4WA 5BVZA 3LIDA 1LTJC 1VPCA 2N1TD 3H6PA 1Z56A 4AUWA 1MV8A 3HRNA 1PFIA 4W80A 3B5NB 2IFMA 2KP8A 2A45I 3T97A 3P8CE 1N86A 1NHLA 3HE4B 1X79B 2NPSB 3V4QA 3L4FA 1GDTA 2JJLA 3C9IA 1GL2C 1JOCA 3MGNA 1T8ZA 3VP9A 2WPQA 2FFDB 3RL0D 1HUCA 3EFGA 1G2CB 2GM4A 3OA7A 4WY4C 2P7JA 3II6A 1FOSF 1FZEA 1LTSC 4WY4B 2N1TA 3H32A 2WZ7A 5APWA 2YNYA 1NH4A 3KYQA 1X9VA 1HH0A 3U1AA 5KJ7D 1RF0C 3HUSA 3HD7D 3EQ2A 2WWWA 1GK6A 3WMM0 3VYIA 1SFCD 3VOPA 1E5WA 1JY3N 1XTGB 2W27A 5AW4B 3V5BA 2W6AA 2WSFH 1JUNA 4W7YA 2W6BA 3VTPC 2N1TB 1LT9C 2FYZA 2CPBA 2KLVA 1JY3O 5KJ7A 5APTA 1GW3A 1JY2P 4OH8B 1KILC 1WT6A 1T2KD 1CW5A 2HPCA 2FXMA 2PP6A 4ZKUA 1H88A 2HPCB 3N4XA 2WITA 3B5NC 1KILA 2YO2A 1FZAA 1KFNA 1HTLC 1RE4C 1XTCC 2HYNA 4C7NB 2OYIA 1NKZB 2WPRA 1FZCC 3L35A 3HTKB 1NTZK 4WY4D 3GHGB 3RK3B 3P32A 4LGDE 2R32A 1X8YA 1GD2E 3RL0C 2L5GB 2FFDC 4EIJA 1LTGC 1MUUA 2ZXEB 3RL0B 1LTTC 3CL3D 2XU6A 3IR9A 2OYHA 3E1IA 3TSIA 3V2RA 1N73C 1KILD 2OYHB 1NKNA 4WY4A 5AVZB 1ZR2A 4HYTB 3M0DA 2R5BA 1JY2N 2N1TC 5CJ0A 2HG5D 3A5TA 1J1DC 2YMYA 5AVWB 1IO4A 3B8EB 1OWAA 3V2PA 5CJ4A 3I5CA 1ZR4A 4GT1A 1KILB 3M9HA 1CSBA 1SQPK 5BU8B 1J1EC 3M9QA 5AVUB 3A2AA 4LLHA 1LTJB 3SWYA 3BASA 1LTBC 2WSCH 2OYIB 1N73B 3OJAB 1FZFA 4IFMA 5APQA 3HE4A 1SFCC 3VMZA 3LIEA 1NAFA 3NFQA 1GW4A 1NO4A 1J1DB 3HD7C 1IFMA 2C9NY 1SQBK 2YO3A 2FYUK 2YKOA 3NMDA 3O8ZA 2HODB 1GU5A 1HJBA 5CCHC 5AW2B 3H32B 4B86A 2KSJA 1YYCA 1YTZT 3RK3D 2XNXA 2P67A 3BATA 1SFCB 3M06A 1IFIA 1CI6B 1HGZA 4GIFA 1FBMA 2QM8A 5AVXB 1M7LA 3HD7A 1FDMA 1LWUC 1GU4A 1RE4A 2IX7C 3HUSC 5AW5B 2NPSA 3BRTB 3GHGA 3MIWA 5APSA 3IFMA 3U59A 3B5NA 1S9KD 3MTUE 1EQ7A 2M3BA 1L4AA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IFM A;  1PFI A;  1QL2 A;  3IFM A;  2IFN A;  2KSJ A;  2XKM A;  1ZN5 A;  2IFM A;  2KLV A;  4IFM A;  1IFN A;  1QL1 A; 
#chains in the Genus database with same CATH topology
 3JC2 2;  4K35 A;  3TDK A;  2FYN C;  4JF7 A;  1Y8A A;  1M1J A;  3L70 D;  2G3A A;  3WUU A;  2YKP A;  5CBO A;  1FJK A;  1OW6 A;  1L4A B;  2RMZ A;  5KLV D;  4A7P A;  1H0T B;  4JYC A;  1Q86 Q;  3E1R A;  3VN0 A;  3RBX A;  3A0H H;  4PJ0 E;  2E74 C;  3N7N A;  3AE3 C;  3KZI H;  1M1J B;  1URQ C;  4RES B;  2W83 C;  1JB0 J;  5B5E E;  4IOI H;  2M8R A;  1KQG B;  2KS1 A;  1QLE D;  1AQT A;  1NTZ G;  4JYB A;  1SVF A;  2KUB A;  5AVY B;  1U57 A;  3UIA A;  4H13 C;  2QG4 A;  1JTH B;  5AW1 B;  3USS A;  1IK9 A;  4U3F E;  1S5L X;  3L75 E;  1SQX E;  3CXH H;  5AW0 B;  1IJD B;  5APV A;  1FE6 A;  1P84 I;  1FJP A;  2NZ2 A;  3FWL A;  5APU A;  1VF5 C;  2PRR A;  3H1K E;  3PTZ A;  3CME P;  4JPZ B;  1GK4 A;  1YHQ P;  5CCG A;  1KTM A;  5B5E H;  1OW7 A;  4GKG A;  3KZI E;  2ZAE B;  3L72 J;  2AEM A;  2KB7 P;  2GUV A;  3P8C D;  1KIL E;  1L4A D;  2O01 N;  2W6J H;  3H1J E;  2HR3 A;  3HE5 B;  1LTJ A;  4L74 A;  3IF4 A;  4Y28 J;  5DJT B;  1KQL A;  4NPF X;  3L70 J;  4AQR D;  1GZL A;  1IFD A;  2J5U A;  3VP8 A;  1KB9 D;  2OQQ A;  5AVT B;  3SSU A;  3G4S P;  1H8A A;  2Q3E A;  1Y47 A;  2V7Q J;  1H0T A;  3TF5 A;  4NPD A;  1JM0 A;  1SQP D;  1OZH A;  2I8D A;  1NTK E;  5AVQ B;  1NTK K;  1QX8 A;  5H2F E;  4WB4 A;  3SFD C;  4DOJ A;  2WT7 A;  1G2C A;  1BE3 G;  1LJ2 A;  1NOH A;  2AXC A;  2E76 D;  3GMA A;  2KZI A;  2XKM A;  3CCQ P;  3CI9 A;  4M3L A;  2XDJ A;  1FOS E;  1SLQ A;  2V4H A;  1Q81 Q;  1DEB A;  1SQV K;  1L0N K;  2O01 J;  3L74 D;  1L0L E;  1G1J A;  1SP4 A;  4I6M C;  3SWK A;  3P7K A;  3H1I E;  2J58 A;  1JTH A;  1KYO E;  2M3E A;  2Q5U A;  3AE1 C;  3M91 A;  1Q82 Q;  2ZT9 B;  1SQQ K;  2HFE D;  5KKZ B;  2OAR A;  1HF9 A;  2XZR A;  3CX5 H;  1OVU A;  3CX5 E;  3M0A A;  3CLQ A;  4HKZ H;  4R4M A;  1YJN P;  3S4R A;  5APY A;  3TYY A;  2KOG A;  3L70 G;  3MUD A;  1OXZ A;  4DCK A;  2FY8 A;  2LXC B;  5KLV G;  1ZME C;  2KYV A;  1JY2 O;  1A02 J;  1NTK J;  5KJ7 C;  3RK3 E;  1RF1 B;  1WRG A;  1BGY J;  1NTM K;  1JCC A;  2OYH C;  1QEX A;  2B88 A;  3OW2 O;  3KPE A;  3RL0 g;  1DIP A;  4XA4 A;  2WMM A;  1KB9 I;  1GL2 B;  1YTZ I;  2MKV A;  3A7O A;  1NTZ D;  4Y99 B;  2N9B A;  3VMX A;  3Q5P A;  3H25 A;  1SQP J;  4D6T J;  1RY3 A;  3TNU A;  2P2U A;  3CCS P;  1EZV E;  3VMY A;  1GL2 A;  1JNM A;  1H89 A;  2CPS A;  3BRV B;  1EZV I;  4Z1M H;  4N6J A;  2JWD A;  2KIK A;  2CK3 H;  2W90 A;  3NXS A;  3H1K J;  1RE3 A;  2QSI A;  2QEX P;  1MFZ A;  2HLO A;  4OWF A;  1SQQ E;  1N7L A;  2KNC A;  3B5N D;  3H1H J;  3CWB J;  3MP7 B;  2B87 A;  2OYI C;  2FKW B;  4U3F J;  2G8Y A;  1RH5 B;  4PD4 D;  1NU1 J;  1JMB A;  1AVO A;  1OW8 A;  1HJ0 A;  2JEE A;  2MJZ A;  1SQB J;  1A02 F;  1HGV A;  1MZ9 A;  1NTK G;  1T2K C;  1T3J A;  5CMZ A;  3CWB D;  1LNQ A;  1SQB E;  1SQP G;  2YXR B;  4D6T G;  3F5H A;  2I1J A;  1USD A;  4O9B A;  5KTB A;  1R5S A;  2KXP B;  4GOD A;  1YJW P;  2FYU D;  1BE3 D;  4XE5 B;  1S72 P;  1N7S A;  2A45 H;  4GOE A;  4N3Y B;  1W2E A;  2JP3 A;  3TK1 A;  1U7M A;  3IN6 A;  3H1L J;  1DEE G;  2BCC E;  2ZFC A;  2XV5 A;  4BRY B;  3H1H E;  1LTI C;  2Z5H A;  2AXT E;  5CHX A;  2C0X A;  1GTW A;  2D2C D;  1N7S B;  5KLI B;  3Q5R A;  2WVR A;  3G71 P;  1SS1 A;  3L73 E;  1NU1 K;  1LTA C;  1PGP A;  1IFJ A;  3B71 A;  4BRY A;  3L70 E;  1N7S C;  1QL2 A;  4C7N A;  2P1J A;  2K1A A;  3AE8 C;  2Q3I A;  3CC4 P;  4OGQ B;  2O01 H;  4N78 E;  1QVF O;  1ZR4 A;  1KMI Z;  3VMA A;  5AVR B;  1LT9 B;  2Q7C A;  3V2N A;  2E43 A;  1IZN B;  3HD7 B;  1TU3 F;  2GA1 A;  3BVH A;  4IL6 E;  4EYY Q;  1VQ4 P;  3P8M C;  1N2D C;  4IL6 X;  3S1K A;  3S9O A;  1RF1 C;  1LT9 A;  4DZO A;  3AEF C;  5AW8 B;  1EDL A;  3L71 G;  1EZV G;  3L75 D;  1BSN A;  2WSE J;  1WMK A;  3LW5 H;  2BCC D;  4WBA A;  2E76 B;  5C39 A;  3CC2 P;  1Q2N A;  2IPP A;  1LWU B;  3R4Y A;  2H7H A;  1G1I A;  2WPS A;  3WUV A;  1PGJ A;  1N7S D;  2E76 C;  1FZG A;  4KHX A;  3PJS K;  1N73 A;  3CXH E;  1Q90 D;  4UB8 H;  1J1E B;  2E5T A;  3KHU A;  3SWF A;  1EXJ A;  2YIU B;  1NGM B;  1VQ8 P;  2FFD A;  2QJP B;  2C9L Y;  4N78 D;  1ZV8 A;  2C0W A;  2OTL P;  1AA0 A;  3U1C A;  2Q6Q A;  4YPC A;  1KC8 Q;  4ZKP A;  2FXP A;  2IBZ I;  2YMK A;  1S9K E;  3L37 A;  1L4A C;  2KSE A;  1FU1 A;  4AYC A;  2JKV A;  1NTK D;  1GMJ A;  2OTK E;  3CWB G;  1URQ B;  1M1J C;  2FXO A;  4Y99 C;  2QM7 A;  3AEC C;  1GL2 D;  1MFT A;  1FZC A;  4ASV A;  1RF1 A;  2FYU G;  2GUS A;  3CCM P;  1HBW A;  3H1L G;  5APX A;  3RK2 C;  1L0L K;  2P58 A;  1NWQ A;  5AW7 B;  1LGH B;  2POH A;  3GG2 A;  1QL1 A;  2ZXX A;  1HWT C;  4I7Z C;  4H44 B;  4I2L C;  1VQL P;  1S3J A;  1ZLL A;  2FBW C;  2IFN A;  2VRS A;  3AEB C;  2WSF J;  5AW9 B;  1S2E A;  2IYO A;  1IFN A;  5B66 E;  3T97 B;  4IFD K;  2WTY A;  5DJU B;  3OAK A;  4C46 A;  1AQ5 A;  1R5L A;  1URQ D;  2WSE H;  5KAI E;  3WU2 H;  1UII A;  1R8E A;  1CZQ A;  3KQG A;  2A45 G;  3HTK A;  3R2P A;  3KDP B;  1T3U A;  3I55 P;  3PHL A;  1JMM A;  3RBZ A;  5E79 H;  1EDK A;  2I1K A;  5CCG C;  2JO1 A;  4PV1 D;  1BDD A;  1J2J B;  4PV1 C;  5KLV J;  2K9Y A;  4OGQ C;  1PIX A;  2JR8 A;  2L91 A;  5AVS B;  4YXW H;  3GF7 A;  1VL2 A;  1LWU A;  5CCH A;  3MD0 A;  3A0B E;  2RH0 A;  1SQV J;  2NPS C;  2Q9I A;  3L71 D;  1EZV D;  3L75 G;  3FWN A;  1K04 A;  3AE2 C;  3M0D C;  1ZN5 A;  2BCC G;  3GW6 A;  3PLN A;  3QH9 A;  4W7Z A;  1SQX K;  5AW3 B;  3H1I D;  1LT1 A;  2PAJ A;  1OVV A;  5GTI H;  1VQ5 P;  1EC5 A;  1K9M Q;  4ZNC A;  3JCU H;  2Z4E A;  1X22 A;  1RF0 A;  4IFF A;  2JWA A;  1NU1 D;  2LR2 A;  2E75 B;  3O6Q B;  1USE A;  1KD1 Q;  3RK2 D;  1CI6 A;  1DH3 A;  1AJY A;  1KN7 A;  1N8R Q;  4ZMD A;  4YTP C;  3L36 A;  5KLV K;  1PP9 E;  3H1H D;  2H89 C;  1YIJ P;  5BU5 A;  4HH2 A;  2FYN B;  3L71 J;  3D70 A;  1URQ A;  1JEK A;  3A3Y B;  3G3Z A;  4PV1 B;  3V2Q A;  2BAS A;  1FZC B;  4UB6 E;  4DT0 A;  1JY3 P;  3M9B A;  4PD4 H;  2A06 D;  1SQQ G;  2R3C A;  2ZYG A;  2E42 A;  2PGD A;  2BEZ F;  3BCC D;  3TNU B;  1SFC A;  3GHG C;  3RK3 C;  3MUD C;  4I1L A;  2J59 M;  1OVR A;  4EOT A;  3PP5 A;  2QA4 P;  2AEJ A;  2AXT H;  2H43 A;  1AFO A;  3H1L D;  3Q2Y A;  1VQ7 P;  1NTZ J;  2Y9Y A;  3ITK A;  5E79 E;  5CCH D;  4RKU J;  1NJI Q;  1KZU B;  2QIW A;  1VDF A;  1HVV A;  1L0N E;  2O1J A;  2Y0D A;  3MZW B;  3AEE C;  2IZ0 A;  2PFX A;  3HE5 A;  4GOF A;  1AV1 A;  1DX7 A;  1KYO I;  2H8P D;  2QJP C;  1RHZ B;  2HOD A;  1S1C X;  1KV4 A;  3SFE C;  1JCD A;  3AE7 C;  4PD4 E;  2O1K A;  5AW6 B;  4C7R A;  1ZOY C;  2R5D A;  3IAO A;  3O6Q A;  2KS1 B;  3CXH D;  2WPV B;  1JO5 A;  2QJK C;  1FAV A;  1KFM A;  4JBZ A;  1RE3 C;  2YKQ A;  3NTN A;  4EDF A;  2IBZ G;  1IC2 A;  3L72 G;  3E7K A;  1FZB A;  4LC1 A;  5KLV E;  2WT7 B;  3L74 J;  5AVV B;  1BDC A;  3D71 A;  1SQV D;  2FYU E;  2AEF A;  2Y0E A;  2Z5I A;  2NPS D;  1M1K Q;  3RK2 B;  4KJM A;  1T6A A;  1YI2 P;  2LKM A;  1DD4 A;  3HUS B;  1M90 Q;  3W67 A;  3V4W A;  5BVZ A;  2ZYD A;  1VF5 B;  3H1I G;  4WWI A;  1IFP A;  2D2C C;  3LID A;  4OGQ D;  4HB1 A;  3Q5S A;  1W5C E;  2W8Z A;  1LTJ C;  1VPC A;  5GTH E;  2N1T D;  3FX0 A;  4JQ0 D;  1NU1 G;  1PV3 A;  3H6P A;  1Z56 A;  5KAF E;  1U7J A;  2QJY C;  1BE3 E;  4OVN F;  3CPW O;  1MV8 A;  2E75 D;  2OGU A;  2ZT9 C;  1BSH A;  3HRN A;  1PFI A;  4W80 A;  2K88 A;  3B5N B;  3H1H G;  2IFM A;  2KP8 A;  2QJY B;  4BWN A;  5GTI E;  2A45 I;  3T97 A;  3P8C E;  2KNC B;  3FGA D;  2O3J A;  1N86 A;  2A06 G;  1SQQ D;  1S5L H;  3V6I A;  1VQ9 P;  3BCC G;  1NHL A;  3LW5 J;  3PRJ A;  5EFW B;  3HE4 B;  1BGY G;  4YXD C;  1X79 B;  2NPS B;  1L2P A;  2RKL A;  5L8R J;  3L4F A;  3V4Q A;  2JJL A;  3C9I A;  4H0L C;  1GL2 C;  3W68 A;  1GDT A;  1NTM J;  3B4S A;  3A0B H;  1NTM E;  2K37 A;  1JOC A;  3MGN A;  1L0L D;  4QMA A;  2P10 A;  1T8Z A;  3VP9 A;  5M1B A;  2WPQ A;  1UIX A;  1IK7 A;  3RL0 D;  5K5G B;  1HUC A;  3CCJ P;  3EFG A;  2FFD B;  1G2C B;  2GM4 A;  1SQX G;  4D6T D;  3OA7 A;  4WY4 C;  4ASW A;  2P7J A;  3EWK A;  3II6 A;  1PP9 G;  4AUW A;  1YIT P;  3WUT A;  3BCC J;  1K8A Q;  1FOS F;  3H1K G;  1FZE A;  2YIU C;  5H2F H;  1LTS C;  4WY4 B;  2N1T A;  3H32 A;  5KKZ C;  1EDJ A;  4U7J A;  2WZ7 A;  5APW A;  2YNY A;  1BE3 J;  3F89 A;  1NH4 A;  2R3S A;  3GF3 A;  3KYQ A;  3RGU A;  1QGK B;  1HH0 A;  1X9V A;  2ITA A;  4UB6 H;  2IBZ D;  3L72 D;  1PL5 A;  1RF0 C;  5KJ7 D;  3U1A A;  3HUS A;  1X0T A;  1KB9 H;  3HD7 D;  3CXH I;  1RQU A;  1GK6 A;  1SQV G;  2QJK B;  2WWW A;  1PZQ A;  3EQ2 A;  4H0L B;  2E5Y A;  2R44 A;  3WMM 0;  2M0B A;  1OX3 A;  3VYI A;  1QVG O;  2M5A B;  1L0N J;  2B89 A;  4K3A A;  4KT0 J;  3AE5 C;  1BCC G;  1SFC D;  3JCU E;  3VOP A;  5CBN A;  1E5W A;  2H88 C;  1XTG B;  1JY3 N;  3TGU J;  2XND H;  1S5L E;  1LP1 A;  3AE4 C;  2M5A A;  2W27 A;  1KQF B;  4I7Z B;  1P84 E;  2B87 B;  3CCE P;  3QWO C;  2NRG A;  3CD6 P;  3H1L E;  1KQS O;  2ZJS E;  5AW4 B;  1KB9 E;  2WSS H;  3V5B A;  1ZW0 A;  1L0N G;  1EDI A;  2W6A A;  4UB8 E;  1E79 H;  1VQM P;  4DJG A;  2WSF H;  1JUN A;  2K9J B;  2W6B A;  3C8V A;  2N1T B;  1LT9 C;  1ZXG A;  2FYZ A;  2CPB A;  2FYU J;  4TT3 H;  2KLV A;  3VTP C;  1EXI A;  3CCR P;  1BGY D;  3AED C;  1JY3 O;  5B66 H;  3AEG C;  5KJ7 A;  1PGQ A;  1ZRT D;  5APT A;  1GW3 A;  5TIS H;  1JY2 P;  1SQB D;  1KIL C;  1WT6 A;  4OH8 B;  1T2K D;  1L0L G;  1CW5 A;  2HPC A;  5KLI C;  1VF5 D;  3AEA C;  1SQV E;  2FXM A;  2PP6 A;  4MN4 C;  2ZVO B;  4EI2 A;  4ZKU A;  1H88 A;  1SQX D;  1Y9B A;  2HPC B;  1YQ3 C;  2WIT A;  3N4X A;  1PP9 D;  3L71 E;  4H13 D;  3CCU P;  3B5N C;  3H1K D;  1KIL A;  2YO2 A;  1M57 D;  1K73 Q;  1FDI A;  1M56 D;  3TGU E;  1W2B O;  1FZA A;  2LXB A;  2YXQ B;  1NYH A;  1KFN A;  1YQ4 C;  4NPE A;  1HTL C;  1RE4 C;  1XTC C;  4RO0 A;  2HYN A;  4U3F G;  4C7N B;  2KK7 A;  3I56 P;  1NKZ B;  2WPR A;  3H1J D;  4HJG H;  2IYP A;  4WVZ A;  2OYI A;  3L35 A;  4W7Y A;  3HTK B;  1FZC C;  1NTZ K;  5GTH H;  4WY4 D;  3GHG B;  1PPJ D;  3P32 A;  3RK3 B;  4LGD E;  2K9J A;  2R32 A;  1S4X A;  1X8Y A;  1BCC D;  3PH0 A;  1GD2 E;  2V7Q H;  2SPZ A;  1OMI A;  3RL0 C;  5KAF H;  2L5G B;  1KOR A;  2FFD C;  4EIJ A;  1LTG C;  1VQP P;  3GLM A;  1MUU A;  3BCC E;  2ZXE B;  4XFJ A;  3RL0 B;  1LTT C;  2N9Y B;  1L0L J;  2B9B A;  3CL3 D;  4H0L D;  4H44 C;  3G6E P;  3CC7 P;  2XU6 A;  1NTM D;  1OIP A;  2DW3 A;  2KZJ A;  3TGU D;  1KYO D;  3IR9 A;  2OYH A;  3E1I A;  3TSI A;  3CWB E;  3CCV P;  3L73 G;  3V2R A;  1L0N D;  1SQQ J;  4IL6 H;  1N73 C;  1VQ6 P;  1KIL D;  3JSV C;  3FXE A;  4TLF A;  2OYH B;  1NKN A;  4WY4 A;  5AVZ B;  1ZR2 A;  4HYT B;  1D7M A;  2QE7 H;  3M0D A;  2R5B A;  1JY2 N;  1KYO H;  2N1T C;  2HG5 D;  5CJ0 A;  3A5T A;  1J1D C;  2JDI H;  3FXD A;  1FC2 C;  3C1L A;  1SQB G;  2YMY A;  5AVW B;  1IO4 A;  1NTZ E;  2OYO A;  3B8E B;  2Y9Z A;  1OWA A;  3V2P A;  1VQK P;  2IZ1 A;  5CJ4 A;  3I5C A;  4L73 A;  4GT1 A;  4R4L A;  1KIL B;  1CSB A;  1SQP K;  2D2C B;  3AE9 C;  1BGY E;  3M9H A;  5BU8 B;  1J1E C;  3M9Q A;  5AVU B;  1YBK A;  1K05 A;  3A2A A;  4LLH A;  1LTJ B;  2QRX A;  3CX5 I;  3SWY A;  3ZDM A;  3BAS A;  2UWJ E;  1LTB C;  2WSC H;  3WU2 E;  5KAI H;  2OYI B;  1FS0 E;  5CCG D;  1N73 B;  3OJA B;  4PD4 I;  3CX5 D;  1FZF A;  2E74 B;  4IFM A;  1PP9 J;  3HE4 A;  5APQ A;  1SFC C;  1ZP0 C;  4U3F D;  2ZVN B;  3H1J G;  3VMZ A;  1NVO A;  3LIE A;  3L74 E;  1NAF A;  3NFQ A;  1GW4 A;  1NO4 A;  4H13 B;  1J1D B;  2WQY C;  3HD7 C;  4RJT A;  1Q7Y Q;  1IFM A;  1PPJ G;  1SQB K;  2C9N Y;  2YO3 A;  2FYU K;  3K5B A;  2IDB A;  2RN0 A;  3D6Z A;  3Q3D A;  2YKO A;  1BCC J;  2E74 D;  2HOD B;  3NMD A;  3O8Z A;  1GU5 A;  1HJB A;  5CCH C;  3KXD A;  5AW2 B;  3H32 B;  4B86 A;  1ZRT E;  2KSJ A;  5TJH A;  1YYC A;  2QVA A;  2OTJ P;  1PPJ E;  1YTZ T;  1NTM G;  3RK3 D;  4L75 A;  2KI7 B;  2XNX A;  3H1J J;  3TGU G;  1M8O B;  1RQV A;  3ABV C;  3EFF K;  1NU1 E;  1SQP E;  2BEQ D;  4CPG A;  4D6T E;  3L73 D;  1YJ9 P;  2P67 A;  1DD3 A;  2IBZ E;  3BAT A;  1SFC B;  2KLU A;  2Y0C A;  3L72 E;  2A06 E;  1IFI A;  1P84 H;  1CI6 B;  3M06 A;  2WSC J;  1HGZ A;  4GIF A;  1VQO P;  1FBM A;  3CCL P;  2BCC J;  3AE6 C;  3MHV A;  1SQX J;  2QM8 A;  3L75 J;  1LP1 B;  1MKM A;  2K3R A;  1OFC X;  1NAY A;  4L76 A;  5AVX B;  4BXL A;  1M7L A;  2ZYA A;  3HD7 A;  3A0H E;  1FDO A;  4PJ0 H;  1PGO A;  3G9R A;  1LWU C;  1VQN P;  1GU4 A;  1FDM A;  1RE4 A;  2IX7 C;  3HUS C;  5AW5 B;  1P84 D;  2NPS A;  3CMA P;  4H44 D;  4GDO A;  3BRT B;  3GHG A;  3L74 G;  3MIW A;  5APS A;  3H1I J;  3IFM A;  3L73 J;  3U59 A;  3B5N A;  3Q1M A;  2E75 C;  2ZT9 D;  3MTU E;  1S9K D;  1EQ7 A;  3D6Y A;  2M3B A;  1L4A A;  1BCC E;  5TIS E;  1AVY A;  2Q1K A; 
#chains in the Genus database with same CATH homology
 4JF7 A;  1M1J A;  5CCG D;  2YKP A;  1FJK A;  1L4A B;  4JYC A;  3VN0 A;  3N7N A;  4RES B;  1M1J B;  1URQ C;  2M8R A;  4JYB A;  1SVF A;  3UIA A;  5AVY B;  5AW1 B;  1JTH B;  1IK9 A;  5AW0 B;  1IJD B;  5APV A;  1FJP A;  5APU A;  1GK4 A;  5CCG A;  4GKG A;  2KB7 P;  2GUV A;  3P8C D;  1L4A D;  3HE5 B;  1LTJ A;  1KQL A;  4AQR D;  1GZL A;  1IFD A;  3VP8 A;  1H8A A;  5AVT B;  5AVQ B;  4DOJ A;  1NTK K;  4WB4 A;  2WT7 A;  1G2C A;  1NOH A;  2XKM A;  3CI9 A;  4M3L A;  2XDJ A;  1FOS E;  1SLQ A;  1DEB A;  1SQV K;  1L0N K;  1SP4 A;  1G1J A;  4I6M C;  3P7K A;  3M91 A;  2J58 A;  1JTH A;  2Q5U A;  1SQQ K;  2HFE D;  2OAR A;  2XZR A;  3M0A A;  3CLQ A;  5APY A;  3TYY A;  2KOG A;  3MUD A;  1OXZ A;  2KYV A;  1JY2 O;  1A02 J;  5KJ7 C;  1RF1 B;  1WRG A;  1NTM K;  1JCC A;  2OYH C;  3KPE A;  4XA4 A;  1GL2 B;  1YTZ I;  3A7O A;  3VMX A;  4Y99 B;  2N9B A;  1RY3 A;  3TNU A;  2P2U A;  1JNM A;  1H89 A;  3VMY A;  1GL2 A;  2CPS A;  3BRV B;  4N6J A;  3NXS A;  1RE3 A;  1MFZ A;  2HLO A;  1N7L A;  3B5N D;  2OYI C;  2FKW B;  2MJZ A;  2JEE A;  1A02 F;  1HGV A;  1MZ9 A;  1T2K C;  1T3J A;  5CMZ A;  5KTB A;  2I1J A;  4O9B A;  4XE5 B;  1N7S A;  2A45 H;  4N3Y B;  1W2E A;  3TK1 A;  2ZFC A;  2XV5 A;  1LTI C;  2Z5H A;  5CHX A;  2C0X A;  1GTW A;  1N7S B;  1NU1 K;  1LTA C;  1IFJ A;  4C7N A;  1N7S C;  1QL2 A;  2P1J A;  2Q3I A;  2O01 H;  4N78 E;  5AVR B;  1LT9 B;  2Q7C A;  3V2N A;  2E43 A;  3HD7 B;  3BVH A;  3P8M C;  1N2D C;  1RF1 C;  1LT9 A;  4DZO A;  5AW8 B;  4WBA A;  3LW5 H;  2IPP A;  1LWU B;  2H7H A;  1G1I A;  2WPS A;  1N7S D;  1FZG A;  4KHX A;  1N73 A;  1J1E B;  3SWF A;  2FFD A;  2C9L Y;  4N78 D;  1ZV8 A;  2C0W A;  3U1C A;  4ZKP A;  1S9K E;  3L37 A;  1L4A C;  1FU1 A;  4AYC A;  4Y99 C;  1M1J C;  1URQ B;  2QM7 A;  1GL2 D;  1FZC A;  1HBW A;  1RF1 A;  2GUS A;  5APX A;  3RK2 C;  1L0L K;  1NWQ A;  5AW7 B;  1LGH B;  2POH A;  1QL1 A;  1HWT C;  4I2L C;  1ZLL A;  2VRS A;  2IFN A;  5AW9 B;  1IFN A;  4IFD K;  2WTY A;  1AQ5 A;  3OAK A;  4C46 A;  2WSE H;  1URQ D;  1CZQ A;  3KQG A;  2A45 G;  3HTK A;  3R2P A;  3KDP B;  1T3U A;  1JMM A;  2I1K A;  5CCG C;  1J2J B;  5AVS B;  1LWU A;  5CCH A;  3MD0 A;  2NPS C;  2Q9I A;  3M0D C;  1ZN5 A;  4W7Z A;  1SQX K;  5AW3 B;  2PAJ A;  2Z4E A;  1RF0 A;  4IFF A;  3RK2 D;  1CI6 A;  1DH3 A;  3L36 A;  5KLV K;  5BU5 A;  4HH2 A;  1URQ A;  3A3Y B;  3G3Z A;  3V2Q A;  2BAS A;  1FZC B;  1JY3 P;  3M9B A;  2E42 A;  2R3C A;  3TNU B;  1SFC A;  3GHG C;  3RK3 C;  4I1L A;  2J59 M;  4EOT A;  3PP5 A;  1AFO A;  2H43 A;  5CCH D;  1KZU B;  1VDF A;  1HVV A;  2O1J A;  3HE5 A;  1DX7 A;  2H8P D;  2HOD A;  1JCD A;  2O1K A;  5AW6 B;  4C7R A;  2R5D A;  1JO5 A;  1FAV A;  1KFM A;  1RE3 C;  2YKQ A;  3NTN A;  2WT7 B;  4LC1 A;  1IC2 A;  1FZB A;  5AVV B;  2Z5I A;  2NPS D;  3RK2 B;  2LKM A;  3HUS B;  3V4W A;  5BVZ A;  3LID A;  1LTJ C;  1VPC A;  2N1T D;  3H6P A;  1Z56 A;  4AUW A;  1MV8 A;  3HRN A;  1PFI A;  4W80 A;  3B5N B;  2IFM A;  2KP8 A;  2A45 I;  3T97 A;  3P8C E;  1N86 A;  1NHL A;  3HE4 B;  1X79 B;  2NPS B;  3V4Q A;  3L4F A;  1GDT A;  2JJL A;  3C9I A;  1GL2 C;  1JOC A;  3MGN A;  1T8Z A;  3VP9 A;  2WPQ A;  2FFD B;  3RL0 D;  1HUC A;  3EFG A;  1G2C B;  2GM4 A;  3OA7 A;  4WY4 C;  2P7J A;  3II6 A;  1FOS F;  1FZE A;  1LTS C;  4WY4 B;  2N1T A;  3H32 A;  2WZ7 A;  5APW A;  2YNY A;  1NH4 A;  3KYQ A;  1X9V A;  1HH0 A;  3U1A A;  5KJ7 D;  1RF0 C;  3HUS A;  3HD7 D;  3EQ2 A;  2WWW A;  1GK6 A;  3WMM 0;  3VYI A;  1SFC D;  3VOP A;  1E5W A;  1JY3 N;  1XTG B;  2W27 A;  5AW4 B;  3V5B A;  2W6A A;  2WSF H;  1JUN A;  4W7Y A;  2W6B A;  3VTP C;  2N1T B;  1LT9 C;  2FYZ A;  2CPB A;  2KLV A;  1JY3 O;  5KJ7 A;  5APT A;  1GW3 A;  1JY2 P;  4OH8 B;  1KIL C;  1WT6 A;  1T2K D;  1CW5 A;  2HPC A;  2FXM A;  2PP6 A;  4ZKU A;  1H88 A;  2HPC B;  3N4X A;  2WIT A;  3B5N C;  1KIL A;  2YO2 A;  1FZA A;  1KFN A;  1HTL C;  1RE4 C;  1XTC C;  2HYN A;  4C7N B;  2OYI A;  1NKZ B;  2WPR A;  1FZC C;  3L35 A;  3HTK B;  1NTZ K;  4WY4 D;  3GHG B;  3RK3 B;  3P32 A;  4LGD E;  2R32 A;  1X8Y A;  1GD2 E;  3RL0 C;  2L5G B;  2FFD C;  4EIJ A;  1LTG C;  1MUU A;  2ZXE B;  3RL0 B;  1LTT C;  3CL3 D;  2XU6 A;  3IR9 A;  2OYH A;  3E1I A;  3TSI A;  3V2R A;  1N73 C;  1KIL D;  2OYH B;  1NKN A;  4WY4 A;  5AVZ B;  1ZR2 A;  4HYT B;  3M0D A;  2R5B A;  1JY2 N;  2N1T C;  5CJ0 A;  2HG5 D;  3A5T A;  1J1D C;  2YMY A;  5AVW B;  1IO4 A;  3B8E B;  1OWA A;  3V2P A;  5CJ4 A;  3I5C A;  1ZR4 A;  4GT1 A;  1KIL B;  3M9H A;  1CSB A;  1SQP K;  5BU8 B;  1J1E C;  3M9Q A;  5AVU B;  3A2A A;  4LLH A;  1LTJ B;  3SWY A;  3BAS A;  1LTB C;  2WSC H;  2OYI B;  1N73 B;  3OJA B;  1FZF A;  4IFM A;  5APQ A;  3HE4 A;  1SFC C;  3VMZ A;  3LIE A;  1NAF A;  3NFQ A;  1GW4 A;  1NO4 A;  1J1D B;  3HD7 C;  1IFM A;  2C9N Y;  1SQB K;  2YO3 A;  2FYU K;  2YKO A;  3NMD A;  3O8Z A;  2HOD B;  1GU5 A;  1HJB A;  5CCH C;  5AW2 B;  3H32 B;  4B86 A;  2KSJ A;  1YYC A;  1YTZ T;  3RK3 D;  2XNX A;  2P67 A;  3BAT A;  1SFC B;  3M06 A;  1IFI A;  1CI6 B;  1HGZ A;  4GIF A;  1FBM A;  2QM8 A;  5AVX B;  1M7L A;  3HD7 A;  1FDM A;  1LWU C;  1GU4 A;  1RE4 A;  2IX7 C;  3HUS C;  5AW5 B;  2NPS A;  3BRT B;  3GHG A;  3MIW A;  5APS A;  3IFM A;  3U59 A;  3B5N A;  1S9K D;  3MTU E;  1EQ7 A;  2M3B A;  1L4A A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...