2Y9YA

Chromatin remodeling factor isw1a(del_atpase)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
STPSHPRMPKPHVFHSHQLQPPQLQVLYEKERMWTAKKTGYVPTMDDVKAAYGKISDQEEQKEKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
total genus 63
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9yA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9yA03
3D1NI 3IH3A 1DU0A 3C2BA 3HGYA 1ZGWA 1T56A 2MG4A 1BW6A 2YU9J 2MGQA 1IGNA 1D5YA 3JRGA 4M3BA 1FTZA 1H89C 2NVYJ 2IBDA 4QTRA 2JA7J 5GPAA 3PO3J 5FKNA 1MBFA 2LP0A 2LY9A 4UUSA 4W97A 3S2HJ 2DA5A 4Y7NJ 2XSDC 1P7JA 2DA1A 2FQ4A 4FE4A 2R93J 2Y31A 1MBKA 1ORKA 2DJNA 1JT6A 1X2MA 2CJJA 4OVNF 1U8BA 1JKRC 4D7MA 1BW5A 2ID6A 1WH5A 4AC0A 4C3IJ 2QCOA 2R5YB 2FD5A 2NOGA 2HDDA 3QPLA 2GM4A 3FK7A 5C4JJ 3G1LA 4V2GA 1HOMA 2K40A 4DZJA 5EZGA 2GLOA 2G0EA 5EGOA 3HOZJ 3F0CA 4A3EJ 1AKHA 3MVPA 5IP9J 4XK4A 2HQ5A 3TW7A 1ZR4A 4IHYA 1QPIA 1Z0XA 1XC5A 3E7LA 2Y9ZA 1ETVA 2XGCA 3HOVJ 2L7ZA 1FIAA 4W1UA 1BJZA 2XPVA 4C3JJ 3BR5A 3S1MJ 4QSHA 2OPTA 3ZOBA 1UHSA 3BT9A 2OF7A 1G2HA 3FIWA 2R92J 4XRSG 3ZQCA 2M0CA 1HDDC 1A6IA 4D5FA 2LD5A 3Q0UA 4MIMA 2Y0SN 4AUXA 5GP9A 1LFUP 3JRAA 4JQ0D 1GV5A 4S0HB 4DW6A 2CUFA 3MN2A 3HM5A 1IDZA 4DCKA 1PUFA 1OCPA 2JWTA 2VI6A 1U9NA 3JRBA 1WCMJ 2LR8A 1I50J 1T33A 1ZK8A 4UUTA 3PO2J 4EEFG 1MH3A 2EBIA 3BR2A 1P7IA 2ELKA 5F27A 2WAQN 5IOYA 3S1QJ 2DMNA 4L5EA 5J1YA 1Y1VJ 4M6VA 1JUPA 1OJLA 4CYCB 3S1RJ 1S7EA 1Y1WJ 2K9QA 3TP0A 1GDTA 4XRSA 1JTXA 4M3EA 1JTYA 5C4XJ 3TP3A 5M3FJ 2LLKA 5IPAA 2YUSA 4NDLA 1JKQC 1FTTA 1VFCA 1B8IB 1F36A 2MSYA 5E3LA 2HXIA 3M4OJ 5EEAA 2L0KA 3LOCA 3GTKJ 2DMPA 2ME6A 1NK3P 2DTZA 4X1EA 1OFCX 2E19A 2W48A 2DMUA 3MKLA 2M2EA 1I3QJ 1IV6A 4CYCA 4A69C 4C2MJ 3RZDJ 1K83J 5F0CA 2JMWA 5E3OA 1RR7A 1BA5A 4JYKA 1UG2A 4XIDA 2B63J 5M3MJ 4HNVA 5J1RA 2E1OA 2L9RA 1H88C 2NVQJ 3O8GA 5IYDJ 2XGDA 1W0TA 1W0UA 1MBJA 1LE8A 4BBRJ 3OSFA 2XB0X 1NTCA 1POGA 3TW6A 4BY1J 2ECBA 3A01B 5FLVA 2EZKA 1MBGA 3S16J 5M5XJ 2CQXA 2NVXJ 2HXOA 1IUFA 1VNDA 4I76A 2N8GA 3B6AA 1ETWA 2H8RA 3FISA 1LFBA 3GBGA 1E3OC 2CQQA 5JLWA 1QVTA 2CU7A 3QPSA 2R5YA 5J1UA 1H8AC 5M5YJ 3BR1A 3HGGA 5FLMJ 2WV1A 2JN6A 3FKIJ 5FKLA 3VPRA 4A3IJ 3HBLA 4BXXJ 4MFDA 2AHQA 2ME0A 1JGGA 1RESA 2LK2A 3BG9A 4A93J 3S1NJ 3I4NJ 1IRZA 3Q3SA 2XGEA 4IHXA 2E2JJ 4M3GA 2EZIA 3QQAA 1FIPA 4BY7J 3GTPJ 4A3MJ 3NARA 3BR6A 3BR0A 1JUSA 4FISA 4A3FJ 3OSGA 1SFOJ 1UMQA 5IP7J 1Z77A 4IEJA 3LSJA 2NS7A 2RAEA 4DYRA 2LTPA 1TWGJ 5K7FA 3JRIA 2HOSA 3CQZJ 3B6CA 3K2AA 4JX6A 3TEDA 1B72B 5F08A 3S14J 3NAUA 3GTGJ 4XRMA 2WB1N 5FKKA 2X48A 2EH3A 3JRHA 5E3MA 1WPKA 2EZHA 4V2FA 3OOUA 2TRTA 3Q0VA 4AYBN 4I6ZA 3S17J 2M8GX 1YRNA 4A3JJ 2K9NA 2DA3A 1ZQ3P 3BR3A 4GFBA 9ANTA 5F04A 1TWHJ 3BQZA 3G1OA 1JKOC 5FJ8J 1ITYA 3JRCA 3WHCA 3BTJA 2Y9YA 5EF6A 2E2HJ 2DN0A 1A5JA 4Y52J 1WH7A 1ZKGA 3JRFA 3LSPA 3CDLA 3HDDA 3DCFA 1ENHA 3SFIA 4JP0A 3HOUJ 1ETQA 2DA2A 4RBOA 1AKHB 1XS9A 1AU7A 4M3DA 5EZHA 3BG3A 3BTCA 2MW8A 1WGXA 1ETKA 1XG1A 3CMYA 1BL0A 3RZOJ 2O8KA 4FE7A 3HOWJ 3HB9A 2YS9A 3BTLA 4JX5A 1JKPC 1RPWA 1ETOA 1IJWC 1HDPA 3JR9A 2E2IJ 1MBEA 3BTIA 2IAIA 2DA4A 2NS8A 4MO7A 3HOXJ 5IOZA 1IC8A 1TWCJ 5E3NA 1GV2A 4LOCA 5EDNA 2HI3A 1OCTC 4M3FA 3G1MA 1MNMC 2X9DA 1GVDA 2R7ZJ 2LVSA 5FKOA 3BG5A 5IYBJ 2DMTA 2L7FP 3A02A 2JA6J 2JK3A 4A3BJ 2QF7A 1SANA 2H1KA 1MSEC 1VI0A 1RKWA 1RETA 2M34A 1ZTRA 2XRLA 3K7AJ 5HODA 5IYCJ 2KDZA 1QRYA 2EQRA 3S15J 4XICA 1JJ6C 1LE8B 3SDGA 3HKZN 1HCRA 3HOYJ 3ZQGA 1TWAJ 2Y30A 5M5WJ 2VUMJ 3GTQJ 4ABZA 2VKVA 5J3LA 2CRGA 4FTHA 4JX4A 1AHDP 1APLC 1GUUA 1FEXA 3LSGA 5BNGA 2HOAA 2Y2ZA 2D5VA 3H3VK 1B72A 4IHWA 1Q1VA 4A3DJ 4A3KJ 5K7ZA 5JLXA 5EG0A 3RKQA 4MLOA 3W6VA 3JREA 1F43A 3L1PA 4B1RA 1QVUA 1YRNB 2PMZN 2R5ZA 2JA5J 3DEWA 1HF0A 1DU6A 5F1JA 4QIWN 3GTOJ 3SJMA 3ZQLA 4DZPA 3A01A 3LNQA 2R0QC 1GT0C 3O8HA 2LFBA 4J19A 4A3CJ 1PUFB 1IDYA 1VF9A 4JPZB 3OIOA 4A3GJ 2M9HA 2DA7A 2L7MP 2DA6A 3UKGA 1K61A 2EZLA 1I6HJ 1X58A 1RKTA 1MBHA 1ETYA 3CCYA 4IHVA 1U78A 2ZB9A 2O7OA 2I10A 2O9LA 3GTJJ 2R5ZB 4DYQA 1R9TJ 5EG0B 5FKMA 3IV5A 3LSRA 4MFEA 3S2DJ 4DYCA 2ID3A 3A03A 4A3LJ 2ECCA 3PM1A 1CQTA 2FJ1A 4FCYA 2FX0A 1O4XA 2KT0A 3GTLJ 5DTDA 4B3AA 3Q0WA 1HLVA 5F0FA 5GPCA 2LKXA 2JA8J 1NK2P 1TWFJ 4C3HJ 1MSFC 3I4MJ 4BKXA 2HYJA 5K7HA 2XB5A 5C44J 5F0HA 2DMQA 1TC3C 1ETXA 1U9OA 3ZQIA 5EGOB 2AO9A 1JUMA 2IEKA 1ZR2A 1EF4A 2HOTA 1JT0A 1X2NA 2P81A 2JJ7A 2X6OA 3GTMJ 3H0GJ 5EYRA 3ZQHA 4D5CA 3RQIA 3BQYA 2XPWA 5DS9A 3IH4A 1MH4A 4B4CA 4RDUA 3HEFA 2TCTA 3M3YJ 2CUEA 1WI3A 3WHBA 4X6AJ 4G12A 4BBSJ 3JRDA 5C3EJ 2VPRA 4D7NA 2NVTJ 3FK6A 2GBYA 3ZQFA 5IP6A 1JJ8C 4UUSB 1IG7A 2COBA 2K9SA 3IH2A 2XPUA 1B8IA 2VKEA 1FJLA
chains in the Genus database with same CATH superfamily
1LTSC 5KLIC 3G71I 2FMLA 1OCRH 3JCUH 2XRNA 1MJBA 2ZXXA 2ZCWA 4WBAA 3I9V2 2HDCA 1MNEA 2HYNA 3N4XA 3HUSA 4ZNCA 2HQAA 3OIPA 3RPUD 3FZVA 3IWFA 3V4QA 1OLTA 1VQ4I 1ZGWA 1PP8F 1J1EC 1KQLA 1BI1A 3M07A 3PUFA 2MG4A 1EC5A 1X19A 2XKMA 4H44B 1GTWA 1KFMA 3K10A 1IGNA 3ZMUA 1D5YA 5CBOA 4RB2C 1BDDA 5ILUA 2L5QA 1NTZD 1S2EA 2JZYA 1VQNP 1SQXG 3HRNA 1KS9A 1NYHA 1DEBA 4WXHA 2A5YB 5GPAA 4OIOF 3TBIA 3PNYA 5FKNA 1IRGA 1NVOA 2F4MB 1W7PD 1IL0A 1NTZE 1L0NG 2LY9A 1SFUA 2UZKA 1X22A 1KTMA 3S2HJ 3NWSA 3L75D 3C7JA 3LA7A 3FR7A 4YIIA 2FQ4A 2QQAA 3BC8A 3J81Z 2KIMA 1ORKA 2QQ8A 1HF9A 1JT6A 3WFIA 3L70E 1BGYJ 1IFDA 4O9BA 1ZAOA 3RK3D 1R1VA 2L4AA 4D7MA 3VFZA 1YFHA 2NOJB 1DUXC 1G4DA 2ID6A 1WH5A 4JF7A 1N73C 4E4HA 2ZYAA 4YXDC 3F21A 1T0FA 2A69F 4U7BA 1JTHB 1VL2A 1K8AQ 3GFLA 3V6IA 1H8AA 3G1LA 3QHAA 1K7AA 2VRSA 2DYSH 2PBIA 3M9QA 1IV8A 2K40A 1YE9A 3QRFF 2G7HA 1SQVJ 2HTJA 3QPTA 3MMYB 4JBAA 3O6QB 3BVHA 1BN5A 2FYUJ 3A0BH 3MZ8A 3PNTA 5B1AH 2QUFA 2ICWG 1AKHA 3HOZJ 1M66A 1IFPA 3HRTA 1FOKA 1SFCB 3L72E 4XK4A 1WZ2A 3A5TA 3BCCE 3F8NA 2YKOA 2HQ5A 3CP2A 5JVTA 2M5AB 2RH0A 3BP8A 5D4SA 1ZR4A 2PLYA 2QM8A 3HTKA 4N6JA 3P8CE 1DH3A 1XC5A 2P1JA 2RKLA 2MBFA 1ETVA 2O3FA 3M9AA 1IJDB 4V19K 2DDAA 4H13C 3HOVJ 2Q9IA 2V6EA 3AG2H 1KA8A 1LT1A 4OMYA 4W1UA 1BJZA 5KLVE 5KJ7C 2GIZA 3S1MJ 3H1LD 5KK1A 3PP5A 1FBQA 3G6EP 2W6JH 4F55A 4YELA 1VQMI 4U7DA 1ON2A 3HL2A 1OXZA 3J80Z 1N7LA 3RPUA 2OF7A 5APYA 1G2HA 1Z3XA 1G8XA 2ELHA 2V1XA 4L74A 1DGWY 4J01A 3ZQCA 2YKPA 3SWYA 3W67A 2LD5A 4MIMA 4XQFA 1ZELA 5APVA 4PJ0H 2OYIA 1YG2A 2FBKA 2OZ6A 4NBQA 2Q2EB 3GVAA 2ZO4A 3HWRA 1J9IA 4EJUA 3L2VA 5FFXA 2L02A 2K86A 3BWGA 4S0HB 3MKZA 2CUFA 3FXJA 3MN2A 1X8YA 2O1JA 3TNUB 1YJWP 1G2CB 1OCPA 4CCOA 3CUOA 1XSDA 1X3UA 3AEDC 3GLXA 2KIKA 1DX7A 2QGUA 4DNCA 3IP4B 4BQNA 1S5LE 1AV1A 1T33A 4UUTA 1K6OA 3PO2J 1E3HA 1R71A 4EEFG 3VTPC 1VQ7P 2EBIA 1FYLA 2H94A 3PSFA 1X0TA 1P7IA 3O6BB 2ELKA 3PIPF 2A06E 2IX7C 3VEPA 1YTZI 4WY4D 2IGNA 5CCGA 2WY7Q 1LT9C 3JAMZ 1J59A 1SS1A 3H3UA 1OJLA 5AIPA 1W36D 3S1RJ 1S7EA 1Y1WJ 1TNSA 1IN8A 2O03A 3CCRI 5DUKA 3GZ6A 1M1JB 3SEQA 2UXXA 4IQJA 1S3JA 4I6MC 2FEZA 2A6HF 3PNVA 2R5DA 1I1SA 3H1JD 1JTYA 3S93A 5KCMA 1LPQA 3TP3A 1FMWA 2WTBA 3V2PA 5KAIE 5IPAA 4NDLA 5LLQA 1NTMJ 1T2KA 1FTTA 2ZT9B 3L70J 3T8RA 2CPSA 2BY0A 4QWQA 2BXZA 3CJRB 4IL6X 2FNPA 1ODDA 1SQPD 3WTYC 2AXTC 3M4OJ 5EEAA 2OGUA 3SEZA 4FHTA 4ZZDA 3Q3CA 2L0KA 3HKZA 1RUOA 1LNWA 1SFEA 2DMPA 2Z1DA 2ME6A 2DTZA 1HVVA 1OFCX 4UV8A 3L73E 2M45A 4XMYA 5APWA 3CX5E 3MKLA 1YOVB 4NC6A 3KYCB 3CF5F 2HPMA 3ABMH 1BDCA 1IC2A 3KP6A 1IV6A 1OW7A 3WUVA 1Q81Q 2BOLA 4LB5A 4B44A 3L36A 1O7FA 1ZN5A 1NTKD 1Q86Q 3LAPA 3BRVB 1LT9A 3ZMTA 1RR7A 1BA5A 1SFCC 2VB6A 2ZBKA 2Z2SB 3DKWA 3MWMA 3MKWB 3REOA 1VTNC 3T5XA 4XLFA 5J1RA 3CTVA 1L0LJ 4CSWA 1Y8AA 2OBPA 3DLAA 3DWLE 1T8IA 2NVQJ 2CV1A 4H44C 1GLNA 1WSUA 4CCNA 1W0UA 4PGHA 4J0EA 3CMMA 4U88A 2LKPA 5E18F 3W6JB 3DQVC 1RIOH 2HYFA 5HWSA 4EJOA 2NRAC 1HGVA 3CCSI 4Y17A 1KB9I 1WJFA 2L91A 2EZKA 3TKYA 1EVYA 5B5EE 2LREA 2GXBA 2VOOA 1H0TA 1O57A 3EUHC 2V1NA 2A06G 2Q1KA 4ENMA 2I76A 2CQXA 2NVXJ 4B48A 1U5TA 5DV5A 3U1DA 1OVRA 3D70A 4UUVA 1IUFA 3NQOA 4ZYAA 3B6AA 2KZIA 1O3SA 3CX5H 4HJGH 3FISA 1RHZB 1AJYA 1QVTA 3QPSA 5EEHA 1BE3G 4EM1A 3IHUA 5J1UA 1H8AC 3L2QA 1N1EA 1U7JA 3WU0A 2IW5A 2F2EA 2ZMEA 1QHGA 4O5VA 4C2UA 3AEFC 3BOQA 2JN6A 1X1DA 3FKIJ 1EKEA 3ABTA 3HZJA 3HBLA 4GYIA 4JK1X 4L9VA 4MFDA 1UB9A 2P4WA 3KZIC 1VQPI 5KJ7D 4NC7A 1DLJA 2K02A 3DLLF 2Q2EA 2STTA 1EA3A 4G7OF 4EIJA 3IAOA 2GWRA 3Q3SA 4B8XA 1EDIA 2SPZA 2XGEA 4PJJA 4IHXA 2IVMA 4IHTA 1BC7C 1KYOE 3FXRA 2JO1A 3CXHD 4PZDA 5AW1B 3L71D 3L73G 2M30A 4BE0A 2LKMA 4C7NB 3QOPA 5D5XB 1O7LA 1N86A 3CKYA 4LMYA 3CMAP 1EDJA 1WPQA 2BEZF 2XDJA 3GTPJ 1CSBA 2R5BA 4IHSA 4AIHA 4A0YA 2HVRA 4RJTA 2LRDA 3K4JA 2O3JA 5IP7J 1LTJA 3HSFA 2EINH 1KZUB 2JRMA 4C7RA 3HSRA 4UV9A 3KYDB 5CKTA 2QJKB 4PV1C 2ZNZA 3KYLA 1WP4A 1BSNA 3RSNA 3GLMA 4HX7A 4A5MA 4F7ZA 5K7FA 4WWIA 3FX0A 3B6CA 1B72B 3S14J 1I1GA 4U87A 3D1LA 2FYUK 2HTSA 2W8ZA 2FYUE 2YXRB 1LJ9A 3H6PA 3QODA 4JOMA 3CCQP 1KU9A 1RE3A 3DFUA 1JI8A 3R0JA 1W1WE 4U0WA 3S3OA 3OL4A 3E6BA 3KP7A 1WPKA 4BJ6C 2DAOA 3AG3H 3OOUA 4HV5A 1OW8A 2FYUD 3VMZA 2TRTA 4MEXF 1T98A 3Q0VA 1YJNI 1YQAA 1SQXD 3CXHI 3F8BA 4A3JJ 2DA3A 2R7DA 3FF5A 4HX4A 2EIJH 2K9YA 3BR3A 3CWBD 5F6FA 1YBKA 1Z05A 3SSUA 1LWUA 4MN4C 3H92A 5DD8A 4GCVA 1SQXE 1IF1A 4G6TB 3T1BA 2Z99A 1IN7A 1JKOC 2GXAA 3JSPA 2B87A 2YMKA 1NHLA 4Y15A 4KUGA 1ZLJA 1KB9H 4I7ZC 1LWUC 3H1LJ 1SD7A 2PQ8A 2N1TA 3HUSB 4XM3A 1FYMA 3H1HJ 2DLLA 2DN0A 4RB0A 3M0DC 3U59A 4DYDA 1EZVG 2XNDH 1ZKGA 3JRFA 2O8XA 2PMZA 3LSPA 3FWNA 1ZH5A 2D2CB 3C2HA 4UB8C 3DBRB 4JP0A 5DDGA 5FRMA 2FOKA 3HOUJ 4EM0B 1SQBJ 3R2PA 5AVQB 1ETQA 1LEAA 5B5EC 4HSTA 1QLED 2KRCA 3VOEA 2B0LA 3S3NA 3V7RA 3M7GA 2W27A 3E97A 3BG3A 1KC8Q 3ITKA 2OYHA 1ETKA 1WFXA 2WT7B 1VDFA 2YO3A 3S32A 1E3PA 1I3AA 4HG2A 3HN2A 2EIMH 3IAM2 3DOJA 3HOWJ 4IL6E 3BTLA 2NS0A 2E7XA 3GLLA 1A02J 3LA2A 3P8CD 1IJWC 1KQGB 4L75A 2Y0MA 1OX3A 1SVFA 1R00A 1S5LH 3ZW9A 2E75B 2E2IJ 3K69A 4IJAA 2A05A 5H6QA 1SQPE 2YIUB 2FFDC 2DA4A 2ZT9D 4H0LB 2FYUG 3WU1B 1IC8A 1LT9B 4L0ZB 5B66E 2OC6A 3RK3B 2HI3A 1JY3O 4ITVA 3V8LA 1RF0A 1HKSA 2OQRA 2XF5A 1GVDA 1ZARA 4PZJA 2R7ZJ 1MGTA 2HYGD 2AEFA 1YQ4C 1SQVK 2DYRH 2L3DA 1YYVA 1HWTC 3CC4P 3E3VA 2XAJA 2HNHA 4D9JA 3OYKA 1KD1Q 4L5IA 2MD5A 2XRLA 2KDZA 1BIBA 3DU5A 3L00A 2IBZG 5DJTB 3LW5J 1PP9J 4A12A 1FOYA 3SDGA 3ZQ7A 1KYOH 2IZ1A 4IFMA 3WU2H 2E1NA 2O6GE 3OL3A 4A7PA 4E7HA 3QSGA 1N73A 5HNHA 2MLKA 2Y30A 4YFNF 5M5WJ 3GTQJ 1Z56A 2DT5A 3EYYA 5D5VB 1J2XA 2L2OA 2OAZA 3BZCA 4JX4A 1APLC 2BCCJ 1N73B 1OZHA 1KQ9A 3NRVA 4TV7A 3ZR8X 1VQNI 2HOAA 2D5VA 5KAFE 4IHWA 2CMPA 1HW1A 2M0MA 2V6CA 2HPCA 3G73A 4LLHA 2RGVA 3W6KB 5JLXA 5K7ZA 2VBWA 1JHFA 2FFDA 1IN4A 2JA2A 2WV0A 3MP7B 1HQCA 3LSHA 2RVCA 2I1JA 2NPSC 2ZJSE 3F6OA 4Y28J 1DQUA 1K78B 2PMZN 4AVZA 1XD7A 5E8IA 2R5ZA 1T39A 3IAS2 2W6BA 3C18A 3H1JE 2WADA 1DU6A 1HUCA 3VN0A 2KNCB 4HDVA 1H88A 3HOSA 1WRJA 2M87A 1GT0C 3LNQA 4E7KA 3O8HA 1SD5A 2ESHA 3I83A 4EJVA 1JCDA 1KYWA 1B9MA 1VF9A 2DDBA 4XN0A 4A2UA 4Z6YA 2J5UA 3H1HE 1V5FA 4F92B 3AE4C 4A3GJ 1K61A 2RNGA 2VIXA 3MD2A 2DJIA 1X58A 3SXYA 1SP4A 4DBQA 5EFWB 1DGRM 4XSXF 1EV7A 2BEOA 3CCYA 1GL2D 3H1HD 5AW3B 1NTME 1PPJG 4HEA2 3B5ND 1PV3A 2O7OA 2FNAA 4XRFA 4GT1A 3CCMP 3EETA 2O9LA 2M8EA 4HKZH 5CJ9A 2K37A 5H2FH 1QQIA 3L09A 2F5FA 4DYQA 3J7AY 4GO1A 1R9TJ 2O01J 2MA3A 1HGZA 3BLYA 4QPOA 4LLLA 5ERIA 1TT5B 4XLPF 3LSRA 3IV5A 3FMRA 1ZRDA 1CI6A 1VPCA 3QP6A 2RMZA 4DYCA 5CCGD 1M1KQ 2QJYC 4FCYA 5L3BA 2ZAEB 4LG3A 2OYOA 2ZJQF 3JCUE 2X85A 5DTDA 4B3AA 1REPC 3CTAA 2EW2A 2ZYDA 1T6AA 4RAGA 4XL9A 2OA4A 4M71A 1NK2P 3HXLA 4WXDA 1XTAA 2HYJA 1PGQA 3L9FA 2P6TA 2EV5A 2E75D 1OR7C 5C44J 4NUBA 2DMQA 1KU2A 1TC3C 4IRIA 1CF7A 3K6GA 3H1JJ 2ISZA 4OWFA 4XKCA 3MKYB 3TYYA 1ZLLA 5KVRA 1XGOA 1W2BO 1LDKB 2P0WA 2DXIA 3ZW8A 1U57A 3B73A 5JHFA 1HJ0A 1EF4A 4M72A 2HOTA 3ZWBA 3L74J 5J8FA 3V4WA 3O3KA 1JT0A 5J4YA 1P9QC 2X6OA 4LK1F 3GTMJ 2FBHA 2LMDA 1MMAA 3ZP5A 4AQRD 1RNLA 1R58A 4HNUA 1YRLA 5AW6B 1LTTC 3BQYA 3C9IA 1AVYA 2N9BA 5DS9A 1E5WA 1S8NA 4HV6A 1A31A 2DOFA 3H3ZA 3TOAA 5H20A 4RDUA 1LTAC 4IF4A 3L74E 4EI2A 3I56P 2JPBA 2CUEA 2DOAA 2N9YB 1WI3A 3WHBA 5DJUB 3CXHH 4XORA 5FO5A 1RI7A 1MUUA 1X79B 4RO0A 4WXCA 2GOMA 1O3RA 2A5WA 1XX5A 3AAFA 2XASA 3E5QA 3HC7A 4UUSB 2R7XA 3H1HG 4W80A 2HQRA 3Q9SA 2COBA 2K9SA 1MW7A 2XPUA 1L4AC 2R32A 1N7SD 3LWFA 3LAJA 4Z2YA 4ZTFA 1MDMB 2QBYA 2EIKH 1E2XA 3HE5A 1DPRA 3IH3A 1AQTA 4MQ9F 4BUPA 5L3GA 3VOPA 4IFDK 2EWNA 2N1TC 3ULKA 2IGOA 1T56A 3VYRB 3MAJA 5JE8A 5D5UB 5CVRA 2KKOA 1BW6A 2FBIA 2YU9J 1NKZB 2XKOA 2YO2A 3PH0A 5F64A 3SZTA 4BHCA 2E60A 5KLIB 3Q5RA 2PAJA 5JR3A 5L3CA 3AE6C 5CJ0A 3JRGA 1IXCA 2V9VA 3ELKA 4BNCA 3A7OA 4QLCU 2VE9A 1H89C 4PK4A 5AVVB 3SFZA 1KILB 3PL8A 4W7YA 3E0JB 1XCVA 1A6QA 3PO3J 2V7QH 1BIAA 2LP0A 3NWTA 1FP2A 2F6CA 3O2PE 4ZYHA 4HF2A 3LSMA 5CCHA 4W97A 3X2QH 1SFXA 4UHTA 4E70A 1W36C 3MOGA 1P7JA 1FC3A 2CWEA 3SZGA 2OCCH 2DA1A 5B66C 1SAXA 1F12A 5A9SA 3QH9A 4FE4A 2GA1A 2R93J 1VQ5I 2AXTE 2Y31A 1MBKA 2WSCJ 3MD0A 1IRFA 1OQYA 2X1EA 1U8BA 4ENNA 3ABUA 4X0GA 3V2QA 3I59A 3JTHA 4C3IJ 3ONQA 2MD0A 1RQVA 2Q3EA 5FFZA 2YMYA 3HD7B 5FKLA 2NOGA 2EFOA 3KLNA 3BPVA 3FX3A 4MNUA 2HDDA 2GM4A 5C4JJ 3H1KD 4UB6C 2WPVB 1FC2C 4M9SA 4WVZA 4UB8H 1S9HA 1HOMA 4RGSA 3CJTB 4JQFA 2X1CA 2BBYA 5TJHA 4ZC3A 3P9IA 2G0EA 3OOPA 3PRJA 5C39A 4A3EJ 5DD4A 4XA4A 4PSWA 3F89A 2Q5UA 3TW7A 2GXGA 2VL8A 1KU7A 5GAHJ 3E7LA 2YKQA 1P92A 2Y0SA 1S5LC 2F5DA 4XOPA 1F4KA 1LTJC 3MIWA 3LFUA 2BCCE 2KSEA 3V42A 1XMAA 1QZZA 1GU4A 1FIAA 2QRXA 5J47A 2K9JB 1QBJA 3G9RA 5AW5B 2AQFA 4HF0A 4BHBA 3PIDA 1F5TA 1NJIQ 4ZDPA 1QGPA 4HB1A 3ZOBA 2GOXB 1NO4A 1T8ZA 1I39A 1M75A 4R1HA 1TQPA 2BXYA 3FIWA 2KFDA 1CF7B 2R92J 1OYIA 3WTXC 2KSJA 2DPUA 1MMSA 3IF4A 4IM7A 1HXDA 2CFOA 4II2A 5GP9A 2JUGA 3ZWCA 1OYWA 3AEEC 3S1KA 3CCUP 2IBZD 1P84H 1SQPG 2G7UA 1UHWA 2BYVE 1JHHA 4Y13A 4JQ0D 4GDOA 1GV5A 4YIRX 2VONA 1GW4A 2GQQA 3BZ6A 4Y33A 4DW6A 3HM5A 1XGNA 1KMIZ 1MD0A 1YI2I 1STZA 5GAGJ 4KN4X 1PUFA 2ZFCA 1U3EM 2VI6A 3JRBA 3C2GA 5LHIA 5AVTB 1WCMJ 2LR8A 4NPFX 5JFRA 2R7SA 3V2RA 4QPQA 3VMAA 1OCZH 5TISH 5KHDA 4P5OA 3BR2A 3GYHX 1DPUA 3F6VA 1DD4A 5FD5A 1WHUA 1YIOA 5LRSA 3VODA 2ZJPF 2NPSB 1ZCJA 2K85A 3KFWX 1S6LA 2DMNA 3WE2A 3LSKA 3FXDA 1P4WA 1Y1VJ 1SQXK 3RQ4A 4LLNA 5AIQA 4CYCB 1NH4A 4IOCF 2DTRA 1FDIA 4PV1D 4DT0A 3HE5B 2YNYA 2K1AA 4OQYA 1VQ5P 3AFHA 1EH8A 1JTXA 2KXPB 3VSKA 5APQA 2DFEA 1M56D 2BGCA 1D0XA 3EQLF 1ZOYC 4BDZA 3BCCJ 2P67A 3AE5C 2R3SA 3JSVC 1KU3A 2Q8KA 3J7ZI 3AECC 1VFCA 2GZWA 2KMUA 1B8IB 4MEYF 3B5NC 5APXA 4R1NA 2QZ8A 4N3YB 2MSYA 3KQGA 4ZH4F 3AE1C 1RZ4A 1YS6A 2I9PA 4KITB 1NU1K 2WZ7A 3O8ZA 1BOBA 3Q9VA 3LOCA 5AONA 1YIJI 2HVSA 1BG6A 1CGPA 1K4TA 2D1VA 2QE7H 3RK2D 3ABLH 3OIQA 3K1MA 3TGUE 5E20A 4B3IA 4ESFA 4CICA 3GF3A 1G3SA 2M2EA 1I3QJ 1WWXA 4LJZF 3AE9C 2BHYA 2W84A 4UB6E 2E71A 5D8KB 3OYJA 1E17A 3K0LA 3AL0B 2JMWA 3AEAC 1IXRC 3SQNA 1SQXJ 3FBNB 5TISE 2A6EF 2M3AA 2QVOA 5E3OA 3C1LA 2JQ7A 1FBSA 1LP1A 1JY2O 4Y99C 3MUDC 5GTIE 2L9RA 3TO9A 3O8GA 2I8DA 1GXPA 3KLOA 5IYDJ 3H1CA 4BACA 2XGXA 1MKMA 2EA2A 4G9YA 2OCEA 2CG4A 2XUBA 4F91B 2YU3A 3V7CA 5KAFC 4D1QA 4MHGA 4BBRJ 3A0BC 2R7RA 1KILA 2IPPA 1XDUA 3AKZA 4ZTJA 1NTCA 3CESA 3H1IJ 2D1HA 3T0YA 4PD4E 2X6XA 1KV4A 1QZEA 1T0FC 5M5XJ 4CH7A 5B1BH 2MJZA 1IFMA 1RH5B 2WB1A 2HXOA 2OFPA 4KMFA 1VNDA 4PD4D 4BJTA 3U1CA 3F8FA 4AWXB 3CWBJ 4RAYA 2A6TA 3B02A 1HSTA 1LFBA 4LK0F 3SHFA 1W5CC 2L9SA 2CQQA 1MNDA 5JLWA 2WWYA 2IFMA 5K5GB 4H13B 1S4XA 2LY1A 1JCCA 4A3IJ 4D6TJ 1KGSA 3ZDMA 5FLXZ 2VN2A 1T95A 2AXCA 2HODA 5ED4A 3M91A 3CF2A 4ASWA 4UVCA 1EH6A 1T38A 1PGJA 2WTYA 2DW4A 4A93J 1HKQA 1J1EB 3I4NJ 1V54H 3R60A 2Y69H 1OW6A 2M7AA 3OR2C 4AD9A 3CC7P 1JO5A 4M74A 2KRFA 3P7NA 5FGMA 4KISA 4C46A 4M3GA 3M06A 1R6RA 1FIPA 2H6CA 3FXOA 1NTKE 3RK2C 3EFFK 4Y99B 2WSCH 4XSZF 4RA2A 2OU2A 2DW3A 4FETA 1JM0A 3HD7D 3L71J 3NARA 3BR6A 1JUSA 4FISA 4A3FJ 1SFOJ 1UMQA 3CPWO 1M2WA 4WY4C 2XVCA 3M9BA 4DYRA 3ZRGA 2LTPA 3VYTB 1B9NA 1G3TA 5AW2B 2HOSA 1S29A 4P9FA 3TEDA 1X1BA 3OAKA 2ZFWA 2H6BA 4EGYA 3AEGC 2EFNA 3VMYA 4RB3C 4CDGA 2X48A 2PG4A 3BG6A 1KYOI 1L0LD 3CWBE 3VB2A 5E3MA 4XKVA 1J2JB 1RE4A 4V2FA 1FS0E 3WUTA 1HW5A 2IYOA 1FPQA 4OMZA 4BU2A 3CO7C 3W2WA 5B66H 1KN7A 2E5NA 3II6A 1U0JA 2K9NA 3RGUA 4IZZA 4BXFA 2F5VA 4M6XA 1RE4C 2VXZA 2JVHA 1SQQG 1ZG3A 4CYDA 4DJAA 3CUQB 4BL0B 4HQMA 3TF5A 4AIKA 4WF2A 3BQZA 3L2WA 3AEBC 1G3YA 5FRNA 3G0OA 1B1BA 2OZUA 4KUEA 1FOXA 5LHHA 5EF6A 2E2HJ 2V9KA 3L75E 1YW7A 1MDMA 2CFXA 2ZSIB 1Y8RB 1WH7A 2OTKE 2PFXA 3AL0C 3MGNA 2VT2A 2H8WA 3CDLA 3ADPA 3CCLI 3DCFA 1ENHA 1FAVA 1IUYA 3L71E 1D1CA 1V4RA 1W5TA 1AKHB 1XS9A 4PD4I 1AU7A 3ROUA 1RUNA 5DCMA 2O01N 1PDNC 5EZHA 1R22A 1P84I 1YYCA 1Y0UA 3F23A 2R3CA 2MW8A 5CCGC 1JNMA 2HDWA 3QU6A 1BM9A 1B59A 5E1XA 1JOCA 5MGBA 3MUDA 1NTKG 4B86A 3FWEA 3RZOJ 1SD4A 2NAZA 2NXNB 3SWFA 4ZDOA 4FE7A 4XLNF 1JY2N 2CK3H 1OYYA 4OAYA 3HD7C 5HS9A 3H1ID 2QBYB 2IDBA 4ENJA 4LB6B 2M3EA 2Q6QA 1RPWA 3W3CA 3QYBA 3IQDB 3HHGA 2V1UA 4KJMA 3KDPB 4IL6H 2OQQA 4BGDA 4FX0A 2BY2A 1GXQA 3ML6A 3CLQA 3JR9A 1ZN2A 3E6CC 2AEMA 2IAIA 4I2LC 2E35A 2HZTA 3FKJA 3HOXJ 1HJBA 4GRIA 2P7VB 3ECOA 2P58A 1F9NA 3OYIA 2CO5A 5E3NA 3HPHA 4PZCA 1NU1E 1K04A 1GV2A 5CJ4A 1TT0A 4M3FA 3K1NA 1N1GA 2BW3A 4PFOA 1YITP 5E79H 4E7SA 4FASD 3BG5A 3TO6A 2G8YA 3A0HE 2MLGA 4DZOA 2L7FP 3A02A 3BDDA 1RRJA 3KZIH 2QF7A 4H0LC 2K4BA 5AW4B 3ZCOA 1SANA 5TRDA 5HODA 1RETA 1MIJA 1P6RA 1ZTRA 2RKHA 5IYCJ 1YJ9I 2FA5A 3AE8C 4WB4A 3TK1A 1QRYA 2EQRA 3U2RA 4PUSA 1JJ6C 4E7JA 1LE8B 2KLUA 3GXOA 2M1BA 2OQGA 4GYGA 1LTGC 1HCRA 3SWKA 3ZQGA 3DTEA 3L70G 3H1KE 2PMUA 4RLQA 3V7SA 4F93B 4ESBA 2CGPA 4RKUJ 4ABZA 1IFJA 4LIVA 1YJ8A 3KCCA 1LUJB 4FQGA 2CRGA 4FTHA 4PDKA 1A04A 1GUUA 3I56I 1EXJA 1N78A 1Z7LA 4HQEA 5BNGA 3H3VK 1L4AB 2VQLA 2FUG2 4OU0A 3L2UA 4IX7A 1B72A 5KLVJ 2GIVA 1Q1VA 2KL4A 2IT0A 3CZ6A 4A3DJ 3VP8A 2EILH 2LXCB 3K1PA 4CCMA 2H09A 3LIDA 2UV1A 4MLOA 1FZAA 1CI6B 3L72J 4J00A 4BRYA 4PV1B 4XLAA 4CCLA 1F43A 4BXUA 5AYVA 2IGMA 2OARA 4N0BA 1M67A 1XB4A 1YW9A 4IL6C 5FD6A 1OMIA 1ZHFA 2K9MA 4Q48A 3CD6P 1LSJA 3MQ0A 1HF0A 1YLFA 1UG0A 5HLGA 2JP3A 3CCMI 2K9JA 3KXDA 2CYYA 1F17A 2KJBA 3SJMA 5E79E 1FY7A 3BY6A 2LY2A 1ONVA 3EDPA 3ZQLA 2C0WA 3FXUA 3RTRA 4DZPA 3OR1C 3A01A 3UR3C 5KLVG 3LA3A 5JHUA 2LFBA 3BPXA 3TNUA 1VQ9P 4J19A 3TGUJ 2N1TB 4A3CJ 2F5EA 2EFQA 3EUKL 2B89A 1IDYA 2DBBA 4GDFA 1BE3J 4KICA 3DP7A 3L75J 2ZC2A 2VJ4A 5KJ7A 2HKXA 1NTMD 3CCQI 3CX5D 2OTLI 3I5UA 4RGUA 3B71A 3OYBA 1Y47A 1LNQA 4OIQF 1KQ0A 1MBHA 1KFNA 3U1KA 1UAAA 1ULYA 3FWLA 4R8HA 3I64A 3KPHA 2UWJE 3GCMA 3K9TA 2LBFB 4G7HF 2E76B 2ZB9A 1UIIA 5JVGF 1X1CA 2X0LA 1RF1A 4KT5C 3GHGC 4LFUA 4L73A 2RNJA 2E76D 1X9VA 2D2CC 5FKMA 1VQKI 2E74B 4ZYGA 4OAZA 4MFEA 4I09A 4L9TA 1P84E 2ID3A 3A03A 1TNTA 4GOFA 2ECCA 3PM1A 1DLIA 2FJ1A 4B3JA 3ERED 2Z5IA 2FX0A 3H5RA 1VQLI 4LD5A 4D3FA 1QL1A 1W2EA 2H89C 4UB8E 5B3SH 1HBXG 3TL4X 1DP7P 1WT6A 5APUA 1TWFJ 4C3HJ 2VOPA 2Y75A 1EXIA 3CC2P 1SMYF 4PFPA 3J80K 3ASOH 1RR8C 1SQBG 3LQRA 3IR9A 1U9OA 2DT7B 5F1RA 1FT9A 3ZQIA 2Y0CA 2AO9A 3C3WA 1GHCA 3EYIA 1LP1B 3OWTA 4M73A 1ZR2A 1VQLP 4IQ4A 4KFCA 1OVUA 3DBHB 3EWKA 2FXAA 1GD2E 2FMYA 1TXGA 1X2NA 2JJ7A 3H5NA 2ESNA 3CMEI 1QX8A 1QO0D 5KAIH 1SEUA 1ACIA 2KOGA 3ZQHA 5BQTA 3RQIA 3OYEA 2XAUA 2XPWA 3RYRA 2GF2A 2QKMB 3IH4A 3W2VA 3K4KA 4I2OA 3SDBA 1SVLA 5A9SB 4WWCA 1EDLA 2QSGX 2ZVNB 3ZMZA 4X6AJ 4G12A 2M5WA 3T97A 2VPRA 1UCRA 5CVUA 4K3AA 3F8CA 4D7NA 3FK6A 1BOAA 4DBRA 1A35A 2RDPA 2ZXHA 2NVTJ 2WQYC 3ZQFA 5IP6A 1WMKA 4XBFA 2V4JC 3FBIB 1IG7A 3C7DB 4F52A 3GG2A 3FM5A 3WG9A 1B8IA 3KZIE 1FJLA 2M4GA 3ABKH 3BCAA 3FXLA 4E6KG 3D1NI 4GODA 4D6TG 1KONA 2L54A 2VC0A 3E5UA 2HKOA 1VQ8I 1MMDA 3A2KA 1USTA 2WITA 2NVUB 2QEXI 1T6SA 1Y6IA 1DU0A 1Y9BA 2O01H 3C2BA 1NTKK 3H1IE 2LF7A 4PGGA 4MTEA 5BU5A 4HLYA 3OYAA 4FX4A 1MFTA 2NPSD 3WFJA 3WTZA 2EFPA 2FBWC 1LVAA 3OBBA 4BAYA 1LFPA 1J1DB 2IYPA 5LHGA 3H32A 2KRHA 3E6MA 1FTZA 4EJWA 3EQ2A 1VZ0A 4WX9A 4CCKA 4PCQA 4HDUA 2JTVA 2V4HA 2XAHA 3OYDA 4G8XA 1BI2A 1YX3A 4OINF 2HEOA 4HF1A 3K5BA 4LG0B 2XZRA 2H7HA 2K27A 1UJ8A 2XSDC 4ZKUA 2KP6A 5H6RA 2QA4I 2E5TA 3CWBG 3CJQB 1RE3C 3CCEP 5LGTA 3VYUB 4IVNA 3FGAD 4XKWA 1RY3A 2PP6A 5A9RA 2CJJA 2LYCA 1JKRC 4W7ZA 1USSA 2W85A 1WJ5A 2HPIA 1BW5A 1NTZG 1Q1HA 4AC0A 1LDDA 1DDNA 1SQQK 5DEQA 1SQQE 3S4RA 2XF6A 3H9JA 2R5YB 1USDA 2FD5A 2V9PA 2WY8Q 1HH0A 2BY3A 3QPLA 3FK7A 3RDIA 3OJAB 1K9MQ 3CCEI 1GL2C 1FDMA 3TDKA 1JB0J 1SQBK 1X3WB 4DZJA 1U2WA 1D8KA 5EZGA 2UWMA 1LVKA 3RPQA 1T3UA 3JC22 4N78D 3M0AA 2H43A 5LBQA 1FE6A 2COMA 2WAQA 5EGOA 4E7LA 1I36A 2WSEJ 4QMAA 2MC4A 2LG4A 4P55A 1OIPA 1MMGA 2KDOA 4IO9F 3MHVA 2O61A 4N78E 1QPIA 1Z0XA 3A1YA 3H25A 2QG4A 1AA7A 2HODB 1G59A 1WKMA 1Y8QB 2K88A 1FOSE 3TSIA 1Y0NA 2A07F 3GZ5A 1Q2NA 2XPVA 4C3JJ 2IJLA 2W1OA 2KIUA 2P6SA 3BR5A 4QSHA 3WU2E 2HWVA 2Y48A 5ICGA 5BPIA 1LEBA 2NPSA 4WCGA 3E1IA 5HS7A 1LB2A 2F5CA 1UHSA 3P9KA 1TZLA 5BS6A 3H1IG 4L9NA 1BCCG 1QVFO 4HLXA 4XRSG 1HA8A 2CPBA 1A6IA 2MKVA 1N7SC 3Q0UA 4HH2A 2X51A 5D8LB 2Y0SN 3E6DA 2HLOA 1H0TB 4II3A 2XAGA 2XV5A 1LFUP 2A45G 2J59M 2LXBA 3WTUC 5GTIC 3K70D 1NU1D 4B3XA 1OKRA 5BPDA 3OYFA 1E0EA 3L70D 1FZBA 5KAIC 2KUBA 1PFIA 2ETHA 4AVPA 4HRIA 3VYSB 2JWTA 2MC3A 2HR3A 2K9LA 3IKVA 1RF1C 4PJ0E 2P5KA 3RQSA 2W24A 1NAYA 3A0HC 3GEZA 2L01A 4G6QA 3WGHA 1FOWA 4NPEA 1QPMA 5IOYA 1FZCC 1VQ7I 2IBZI 3HRSA 1UFMA 5GADJ 2G9WA 3H5AA 5J1YA 3GW2A 2OUMA 2VJJA 3D71A 1Z9CA 2YIUC 3L72D 2FFDB 2PX9A 3V8KA 2K9QA 5CVIA 1YHQI 2QSFX 3TP0A 4I98B 1MFZA 2P4QA 2OTJP 4XRSA 2BHZA 1FJKA 4M3EA 1SC7A 1S5LX 1VQ4P 3LSIA 3FR8A 2LLKA 2JSPA 1MZ9A 2XNXA 5A9TA 2YUSA 1PP7U 4ASVA 1VQ8P 3M8EA 3LSTA 5K5QA 2KNCA 1MV8A 5EEGA 2Q0OA 1HSJA 4N4NB 3VYIA 1YI2P 2UYYA 2O1KA 2KB7P 3OYLA 2E1MB 2QM7A 3EFGA 4R4MA 3T97B 1ZREA 3GTKJ 4TT3H 1NK3P 2D45A 1IN6A 3DEEA 5HS8A 2GUVA 4RM2A 5LEKA 2W48A 2DMUA 1PYVA 1CZQA 2V7FA 2ZVOB 2VLAA 3C8VA 4BDYA 3KPEA 3I59B 1BCCE 1U5TB 1LTIC 5CQGA 4A69C 2CSOA 1UZCA 2B9SA 4WY4B 4UY8I 5F0CA 2BW3B 2Y0EA 2NRGA 1PGOA 3FHNA 1L0NJ 3PJRA 2YSRA 3GHGA 1R8EA 4OOIA 4JYKA 4XIDA 4CA0A 2A3SA 1BR1A 2B63J 1YB4A 5M3MJ 2K7LA 1URQB 4HNVA 4YCAA 1K6YA 2KI7B 3OY9A 2ZMEB 2XC7A 2JR8A 2PMHA 1H88C 5GTHH 1PPJD 2QLZA 5LEJA 1W0TA 3SZPA 3KEYA 2DFHA 2VC1A 4EZBA 1LE8A 3SYTA 1PGPA 1M7LA 3GUDA 2B87B 4NPDA 2B9BA 2L5GB 1EZVI 3OSFA 5KKZC 1S72P 4YPCA 1POGA 3HHHA 3G4SP 4BY1J 2VQGA 1YS7A 2ECBA 3A01B 3RL0g 3KZZA 1L0ND 3H2ZA 3CCJP 1BE3E 3S16J 2G3AA 3RI4A 5L8RJ 4M6YA 3F22A 1QA6A 5HDGA 4C30A 3NMDA 4RLFA 1RF0C 2F4IA 4I76A 5K1YA 1B6AA 3CO6C 3PFYA 2YX4A 2H8RA 3G71P 1NG6A 5AW7B 1JMMA 3WGGA 4YFKF 2QJKC 2CU7A 2VE8A 3IFMA 2R5YA 1M90Q 1XPXA 3BR1A 2EA4A 1R1TA 1YJWI 1X0XA 2BV6A 3S2WA 2WV1A 4HAMA 3VPRA 3QOEA 4ZYDA 1DD3A 4IPAA 4RMNA 3Q5FA 3L6DA 2ME0A 2QYOA 4UVAA 3RK2B 2IXSA 1TTYA 2LK2A 3RBZA 2QKLB 2EJRA 3P9CA 2FXOA 3TDZC 4PJ0C 2IS2A 1IRZA 4D3SA 1NKNA 4LITA 4E12A 2W6AA 1YX5A 1D1BA 1X1AA 2TDXA 2C6YA 4P96A 1VQOP 4BH9A 1O3TA 4IOAF 3BCCG 2E74D 1V3FA 1BBYA 1QEXA 1Z91A 1URQC 5E1ZB 4HYEA 3H0DA 3L74D 1IW7F 1VPDA 1M76A 2X1DA 4KT0J 3CMAI 5GTHC 2Z5HA 3HYIA 3WE3A 3OS1A 4OGQB 1GZLA 1Z77A 4LGDE 1VQMP 1NWQA 2VBXA 2LBFA 5HDKA 2E74C 3F72A 1M8OB 4XONA 1TWGJ 3MEXA 1F14A 3JRIA 3CQZJ 1ERDA 4JX6A 1TQIA 1PGNA 1LQ1A 1J7KA 4I0AA 3GTGJ 1L4AD 4XRMA 1SFCA 5CBNA 2OD5A 1XN7A 2WB1N 3BCBA 2M5AA 4BQAA 2DCEA 3R0AA 4Y3OA 5LGNA 5FKKA 2FE3A 2EH3A 1K73Q 3JRHA 2CQKA 2VJ5A 3HPGA 5D4RA 1D8JA 1FJPA 2WBMA 5KNLA 3RBXA 3A2AA 3I58A 3OYNA 5E17F 3WTVC 1JDJA 3S17J 4PZEA 1EDKA 2QJPB 3QWLA 3KP4A 3NXSA 2HFHA 3IUOA 1YRNA 3VDXA 1PL5A 1OCOH 1ZQ3P 3LFKA 2HFED 4KUHA 1RQUA 3PDUA 5F04A 4ZYEA 3H36A 3V5BA 3LMMA 2JWAA 3KP5A 1S72I 5FJ8J 2J5PA 4HSRA 3WHCA 3JRCA 3CC2I 2EV6A 3BTJA 1ITYA 4NC8A 3P8MC 2BE5F 1IXSB 3I55P 1ZMEC 1OISA 3CCJI 1QGKB 2EPFA 3HG9A 1FP1D 1A5JA 4Y52J 3EUAA 3PTZA 3ZQQA 1SVOA 1B4AA 2CH0A 4BJ5C 4ESJA 3GX4X 3HSEA 2Q7CA 3N4MA 4N9IA 2ZKZA 3EPZA 3GHGB 2DA2A 2XV4S 1G2CA 3BCCD 3IC7A 3H32B 5CHXA 1YQ3C 1URQA 3FHZA 2Q1ZB 2JDIH 2VASA 2R7TA 3PSIA 1EZVE 2WPSA 3UIAA 1L0OC 3V2NA 2JT1A 1X1PA 3QYFA 1XG1A 4XLCA 1T08B 1BL0A 2IS4A 1NHAA 2EV0A 3ZGYA 2FY8A 2P5LC 1L3LA 2F48A 1Z7UA 3HB9A 3BASA 3MZWB 2Z5UA 3D5LA 3EGOA 3SFDC 1WDLA 1TW2A 1I5ZA 1HDPA 2D2CD 1MBEA 1PZQA 4KIGA 1G1IA 4JYBA 3BTIA 3HUGB 2P8TA 2YPRA 2BCCD 1P2FA 3D6YA 2CW7A 3GW6A 3KETA 4TLFA 3ESWB 2E5ZA 2QENA 5IOZA 2D3TA 1R7JA 1TWCJ 3L2CA 2JKVA 3D0SA 4LOCA 5EDNA 1NTMK 4HBLA 1DP3A 3GO5A 3G1MA 1U5TC 3I3LA 5DM7F 1MNMC 4KYWA 3B8EB 2LVSA 2A68F 3HE4B 3KP2A 1R36A 3WTWC 2DMTA 4H4KC 4G6DA 5K5OA 2JK3A 5J6XA 1FSHA 3OYHA 2OYIB 2PLAA 3W6UA 2LKSA 1LWUB 2H88C 1LDJA 3HUSC 2H1KA 1YJNP 4JBZA 2M34A 1S7OA 1RKWA 2W7NA 2WC2A 2KISA 3I53A 2IS6A 1J09A 3A0HH 1ZYRF 2E1MC 5AVUB 1GU5A 1GK6A 3LL7A 3G3ZA 5AVXB 1ZRTD 2WSFH 2FQ3A 2WAFA 3HKZN 1SMTA 2DT6A 1TWAJ 4U3FJ 2V26A 1N7SB 1FOSF 4D3DA 5J3LA 4GWGA 3A4CA 1FEXA 3ISPA 2CQNA 1V5GA 3OYCA 3FMSA 1QHHD 4KIBA 1R5ID 3MCZA 1C0WA 3PJGA 2KLVA 3AG4H 4XR6A 3RKYA 3ZMDA 3BRTB 4OL9A 2KPMA 4KA4A 3GWZA 3M1CA 5CVJA 5CCHC 3H1JG 4BEHB 3RKQA 2K4JA 2Y0DA 1KQ8A 4E7IA 1N25A 2DFIA 3TGNA 2WT7A 2FOWA 1JY3N 3W6VA 1R1UA 4RAZA 2PI0A 2H8PD 1ZG5A 3L73J 3JREA 3R61A 2VQHA 4IKFA 1BSHA 4I01A 1AVOA 3L1PA 4B1RA 1QVUA 1ZLKA 3KHUA 1LKXA 1HBWA 2UXNA 2Z9OA 1QZYA 2JA5J 1KILC 2WPQA 4RS8A 3MZHA 5APTA 2HZDA 3JSOA 1FZPB 5IT9Z 1HKTA 1KZHA 2C0XA 3F5HA 3AE7C 5F1JA 1XDSA 3C7AA 1IK7A 1WRGA 4QIWN 2BCCG 2M4KA 3I5CA 1KYZA 2I5UA 5GAEJ 1KILD 5D5WB 3COAC 3FM3A 3J7YJ 1NAFA 3F3XA 1V55H 3FXEA 3TDUC 3PUBA 1MJ9A 5L3FA 3G4SI 1PUFB 3DPUA 1HC8A 5H2FE 1NG7A 4U0YA 3L37A 2WA0A 3OIOA 3V8JA 1ZV8A 4GOEA 3JAMK 2DA7A 3BG7A 1SD6A 2DA6A 1IFIA 2P7JA 3TGUD 3WU2C 3GFJA 3UKGA 2LOOA 1YVEI 2EZLA 4NQWA 1U7MA 3Q5SA 2KZVA 4CO8A 4S04A 1BCCD 4KMUX 3SFEC 4IHVA 2B7EA 2ZYGA 4OGQD 1FU1A 1U78A 3VMXA 3LQQA 1P84D 2I10A 5M1BA 5DUIA 5HOOA 2R5ZB 3I55I 2FSWA 4Y4RA 4DGWB 2XIGA 3D5SC 2XAFA 3GFIA 3H9GA 1WVRA 2RN0A 2LC2A 2E34A 5EG0B 3WTTC 1W5SA 5LD2C 3S2DJ 1J0RA 2M7BA 3OS0A 1CW5A 1NTMG 1PPJE 4CCJA 4OGQC 1CQTA 4EVIA 1O4XA 2PJRA 2XHKA 3GTLJ 4Q47A 2M0BA 2KK7A 4I7ZB 1T2KD 1HLVA 1QVGO 5F0FA 5FROA 2JA8J 2EFWA 1MSFC 3M0DA 5AVYB 5K7HA 2XSJC 2IRFG 5ICFA 1AQ5A 2AXLA 1GL2B 3BJAA 5F0HA 1ETXA 1J5YA 3I54A 4AIJA 4DLLA 3JTGA 3A3YB 1XSXA 4ZJZA 3L35A 4LC1A 1JUMA 1KB9E 4U0VA 4UVBA 3DV8A 2MYSA 1ZG1A 2VKDA 2HU9A 4IFFA 1LSOA 4XE5B 1KQFB 2XDVA 2JEEA 3WS7A 2P81A 4BRYB 5GTIH 3USSA 3H0GJ 4XLHA 4HPQA 3HD7A 4D5CA 1H89A 4F3QA 3F8MA 2DI3A 4B4CA 4BYYA 3M8FA 4B43A 4CGZA 2A45H 1S1CX 2TCTA 4BQQA 5TISC 4E7ZA 3JW4A 3TOBA 1R4MB 4PJLA 4KUMA 3PIOF 2MFZA 2QQ9A 2P7CB 3JRDA 4BBSJ 3TGUG 2VQCA 2LH9A 3FXKA 1XMKA 1W7PA 1EQ7A 3LIEA 4U3FE 1AOYA 1L0LK 2FYNC 1W7PB 3L74G 3CX5I 5AVWB 3B5NB 4GBJA 3D6ZA 1OPCA 1FZFA 1QU3A 3L4FA 4U3FD 1X4OA 2AEJA 3CUQC 1XGSA 4KNYA 1LTBC 5APSA 3DPLC 2IS1A 1BJAA 1MJAA 2JRTA 3HGYA 3CDIA 2BASA 2OYHB 1Z21A 1EH7A 1TBXA 3K4MA 2MGQA 1UHMA 1WQ2A 1VQOI 3MTUE 5TJJA 3CMEP 4XN3A 4BE2A 1D3YA 1PP9G 4PD4H 4M3BA 3DBLB 5AW0B 2VJIA 3GFMA 1TLHB 2NVYJ 2IBDA 1IZ1A 2R7QA 3DKYA 4NB5A 4QTRA 1FYKA 2JA7J 1SFKA 3E1RA 3RCOA 1L0LE 1MBFA 1V5EA 1JE8A 4AU7A 2MH9A 4BQOA 4UUSA 2HG5D 1KORA 1EVZA 2DA5A 1IRXA 4Y7NJ 2QSHX 2CV2A 2DQLA 4OIPF 2IBZE 3IL2A 4H0EA 3ZWAA 3Q3DA 4CPGA 2E76C 3R4YA 5HLIA 2MABA 2DJNA 3IRQA 2V1DA 1X2MA 1USEA 2E75C 3RYPA 4OVNF 5CMZA 1QNTA 1VQ9I 4OH8B 3Q2YA 3OYGA 1PIXA 1M1JC 2QCOA 2KYVA 1K4SA 3BATA 5ILSA 5KKZB 4OWRB 3RK3E 1I27A 2R7UA 4V2GA 2JSCA 2HS5A 3BJOA 1P4XA 1JY3P 5B5EH 2GLOA 1BCCJ 3CCVP 2DODA 1YONA 3E7KA 1Q7YQ 2C9NY 3F0CA 4MTDA 3B4SA 1H9TA 2IA0A 3MVPA 5IP9J 3QP5A 4HYTB 2KZJA 3U1AA 4DOJA 1BR2A 1FMVA 4IHYA 1OWAA 1D0YA 4U3FG 3DTKA 3CCUI 3RKXA 1R49A 2Y9ZA 4E13A 4L5JA 2XGCA 4E21A 4L0YB 1R23A 2PN6A 5ICEA 2L7ZA 1Q90D 3OV8A 2E43A 2GA2A 4UXNA 3J81K 2DO7A 2ADUA 3F3SA 2OPTA 2PEXA 2FF4A 2IFNA 1Z1DA 3BT9A 2NZ2A 1JTHA 2W00A 2X4HA 3GMAA 2M0CA 1HDDC 3WODF 2POHA 2L4MA 4D5FA 3WMM0 5E8GA 2R7VA 1PP9E 1WJCA 4K2EA 1VQPP 5TGTA 4RM3A 2ZFUA 4AUXA 2PGDA 4S3MA 3CCLP 1VQ6P 4LIUA 2QQBA 4HOBA 4L9JA 4YIFA 2ZNYA 3JRAA 3CC7I 4G94A 2CQ7A 1L0LG 1S9KD 4JYCA 2KJCA 3HJEA 4O6JA 1IDZA 2L7KA 4DCKA 3HTKB 1N2DC 4K35A 1U9NA 3WTSC 3DPTA 4YEJA 4LG0A 2JWDA 4M9XA 3VSLA 1VF5C 3CCRP 1S9KE 3L7WA 1I50J 1ZK8A 4BE1A 1Y39A 5DCFA 2KP8A 1MH3A 1AWCA 1JXSA 3GHYA 1IZNB 3CJNA 3CL3D 5F27A 3L2RA 2V79A 2WAQN 3K4LA 5CYVA 5ICCA 2GAUA 3S1QJ 4L5EA 3K96A 4DJGA 1YHQP 3NEUA 4M6VA 4H44D 1JUPA 3F9KA 1I6XA 3OMYA 2W25A 4MQVA 4EQQA 1EZVD 1LJ8A 5AVSB 4BXLA 5GTHE 2XU6A 3ULQB 2FU4A 1FSEA 2WSEH 5CPRB 5DYMA 4D0PA 1NGMB 1GDTA 1R5LA 1W5CE 3W6ZA 3IRRA 3U21A 5LRRA 1WJAA 5J4VA 3RKWA 5HLTA 1XSVA 1VQ6I 5C4XJ 5M3FJ 5IT9K 4YRVA 3ABVC 2ZT9C 4KJZA 1NH3A 4XFJA 1JKQC 2Z16A 3HRMA 4RGRA 5BVZA 1ZRCA 3FMQA 2VBYA 1KB9D 2RV8A 2BEQD 1F36A 5E3LA 4LGWA 2HXIA 3PEFA 1YJ9P 1T3JA 1F0YA 4HNTA 5D6EA 3GMEA 4X1EA 2KS1A 2QEXP 2E19A 3QPHA 5FB2A 1QL2A 2ZJRF 4CZZA 1SQVG 4N4OB 1JUNA 3G6EI 1LTJB 4CYCA 1KILE 3D5RC 3RZDJ 4C2MJ 1SAUA 2RN7A 3I0TA 1K83J 5JI6A 2KLOA 5FLXK 1BGYE 3HE4A 3KYQA 4L76A 3RK3C 4BEHA 4Z1MH 2NYXA 1WJBA 2QVAA 3U9GA 1UG2A 4FT8A 4B09A 1ZGJA 2WPRA 3JCUC 3ERMA 1BC8C 4I99C 2E1OA 2W83C 4S05A 1Y56A 2OYHC 2XGDA 2CUZA 3V4GA 1NOHA 5AW8B 3HUGA 1MBJA 1BE3D 1SVMA 2R4GA 3IN6A 2IP2A 3PJSK 2XB0X 4M3LA 1PVEA 2QM3A 5CCHD 3TW6A 1PJRA 3GF2A 4N9HA 5HDNA 5FLVA 4I02A 1XTGB 2PRRA 3N7NA 4EM2A 1NTZJ 1MBGA 1Z6TA 3DEUA 3HTUA 2FXMA 3GF7A 4DOZA 3CC4I 2JJLA 3ZMVA 3K4BA 3K70C 2IA2A 1N75A 3ZGKA 1R5HA 3C1DA 2WSFJ 2CW8A 4HW0A 2CV0A 2GUSA 1M1EB 2N8GA 4P9UA 4BWNA 2R44A 1Q82Q 1FZGA 2W82A 1ETWA 3HADA 1G1JA 5DCMB 1D5VA 1URQD 4AUWA 3R4KA 3GBGA 3WGIA 1E3OC 1X0VA 3E5XA 1ZXGA 2OTLP 2KQRA 1FZCA 3H9QA 4NQWB 3ZMSA 2KIQA 5ILVA 1TP4A 3HGGA 2DU9A 2ZXWH 3K4NA 5M5YJ 5FLMJ 2M3BA 4ETSA 5BU8B 3I71A 4GWKA 2BVLA 1WDMA 1FDOA 5CVVA 4R79A 4BXXJ 2AHQA 3K4CA 1JGGA 1FZEA 5L3EA 4YTPC 1RESA 4NHJA 2Z3YA 3BG9A 2E5YA 3S1NJ 4B47A 1EJ9A 2JPCA 6PAXA 1OCCH 3HIFA 2QSIA 4GGGA 2IPQX 2E2JJ 2EZIA 3OS2A 3QQAA 4OQZA 1WJEA 3QU3A 2QJPC 5HLHA 4GIFA 5KLVK 2H27A 1H0MA 2DOEA 1SQVE 1JMBA 1GMJA 3H1LG 2JVGA 3MFKA 1S7AA 5CLSA 4BY7J 4OM8A 5KAFH 1KYOD 2RREA 1AFOA 2LSOA 1GL2A 4A3MJ 1ZW0A 4BS9A 2WVRA 4YXWH 3BR0A 3OSGA 4I0BA 4XLEA 4AYBA 4EV0A 4RESB 4IEJA 3LSJA 4ZDLA 5L3DA 3TQNA 1SQQJ 2NS7A 2RAEA 4KN7X 1SQPJ 3DF8A 5DM6F 5EJCA 2AQEA 5LFAA 2WTEA 3K2AA 2ACJA 1VF5B 5F08A 3NAUA 4XKBA 4YG2F 3WG7H 3P7KA 2ZJ2A 2IGKA 3BZKA 1L0NE 1D7MA 3KIOA 5KLVD 3VP9A 4AYCA 1G3WA 3AG1H 1IN5A 2UUZA 2W90A 3QWOC 2OTJI 1VF5D 3CD6I 1J75A 5CQEA 4ANJA 1X4PA 2X58A 2FYZA 2M8RA 2EZHA 1GVJA 4IRGA 4EMSA 2DPDA 3IKTA 3K2ZA 4RGXA 3O6QA 1U8RA 4AYBN 4I6ZA 3R6SA 2W4SA 2M8GX 3HTSB 5AVZB 1GK4A 3DU6A 1PP9D 4A6EA 2C9LY 2R7FA 5HNFA 4GFBA 2FKWB 9ANTA 1YW8A 2KIFA 2ZXJA 5E79C 1TU3F 1SQBE 2CW0F 3G1OA 1TWHJ 2IA1A 2P2UA 2YX7A 1TQMA 2P5VA 5IY5H 1FNNA 4HA8A 5A2QZ 3B5NA 1NTZK 1DIPA 1WJDA 3BJ6A 2Y9YA 1E79H 2FXPA 2F4OB 1N8RQ 2LF8A 1SQBD 1MMNA 2HPCB 3EUHA 4C9YA 4EGZA 2PJRB 1TL8A 3HDDA 2E36A 2Z4EA 3KEQA 4XOTA 3CCSP 3SFIA 4CHUA 1KQSO 1L4AA 4KDPA 1SFCD 3QAHA 4RBOA 4FGWA 2FRHA 4RB1A 1SQQD 2E7WA 4RAFA 5AVRB 1VQKP 4M3DA 3HDHA 1K78A 2B88A 2HOEA 3BTCA 4HX8A 2JUCA 3S3MA 1WGXA 4ZZLA 2VT3A 3PQKA 2XKPA 1FWZA 4PSXA 3RL0C 3IWZA 2X6WA 3CMYA 1DEEG 1LJ2A 1YITI 3UNGC 4BHPA 1GW3A 3CUQA 3H1LE 1D0ZA 2EB7A 2O8KA 2OJED 4Q5SF 4EOTA 1YIJP 3NFQA 4YFXF 2RC4A 1W4MA 4R4LA 3MZYA 2YS9A 1BI3A 2WWWA 4JX5A 4EDFA 3G2BA 1JKPC 5A2QK 4D6TE 3Q1MA 1T2KC 3KP3A 4EYYQ 1ETOA 2AXTH 2DK8A 2ZMEC 3N05A 2P10A 2RQPA 1G6NA 4GKGA 1O3QA 4IOIH 2NS8A 4MO7A 4D6TD 2DQRA 4H0LD 1FX7A 1OVVA 2VXDA 3Q5PA 2OYIC 3TO7A 2IZ0A 1FZCB 1OCTC 3A0BE 3C7CB 1R4NB 2K3FA 2D2WA 2KHMA 3CP8A 4OIRF 2WAEA 2ZXEB 3CI9A 2X9DA 2HDHA 2L9NA 4IRHA 2LNBA 5FKOA 4M9ZA 5IYBJ 2RQQA 3OYMA 1IAWA 1ZGAA 2O5RA 2JA6J 3LW5H 4A3BJ 3ZN0A 5J40A 1AA0A 4I7HA 2ELJA 2O0YA 3PFIA 4CZCA 1J1DC 4ON0A 1XTCC 3H1KJ 1MSEC 1N77A 1VI0A 1NU1G 3ZPLA 2QWWA 3H35A 3K7AJ 3J7AO 3DFGA 1UELB 5E1WA 3S15J 2HQNA 4XICA 3N97A 4KIFA 3AE3C 2BY1A 2A61A 3P5JA 5D6FA 3S8PA 3HOTA 3HOYJ 2E1CA 1FLIA 1M1JA 2VUMJ 4MGRA 3FDYA 2VKVA 3CDHA 1YO5C 5J8CA 4UB6H 1R5SA 4PJMA 2J5OA 1Z6RA 1AHDP 1BR4A 2CS3A 3LSGA 4XNFA 4IXAA 5BMZA 2Y2ZA 1YTYA 2J58A 2QA4P 2N1TD 4GXOA 4CUGA 4U7JA 1M57D 3KZYA 3M8JA 4LLGF 1TW3A 4A3KJ 3H1KG 2A45I 5EG0A 1MZBA 4CXFA 3I4PA 4DIQA 2Z33A 4ZKPA 2VKHA 3CLOA 3RIRA 1JY2P 2NNNA 2ISYA 3CCVI 2VPLA 3KX2A 4ENKA 3GZNB 1BI0A 1YRNB 3G17A 3PLRA 1JEKA 1YTZT 3RL0D 4J0FA 2ZSHB 2CUJA 1X3ZB 3ASNH 3DEWA 3KEOA 5K5RA 1RF1B 2I1KA 2XAQA 4KT6A 3PLNA 2YXQB 3PHLA 3S9OA 3GTOJ 2HVQA 4H13D 1H9GA 4L18B 1L2PA 2R0QC 2WSSH 2W57A 1WI9A 2K3PA 3P32A 3ZHBA 1SQPK 1A36A 4JPZB 2H1LA 3M9HA 2M9HA 2L7MP 3FXMA 3PQJA 1PUEE 3ADOA 3W68A 2K5CA 3FXQA 1I6HJ 4AM3A 1RKTA 4ASNA 1SQVD 4AIDA 5KTBA 3BROA 1P4AA 2Q3IA 1ETYA 1UIXA 3NTNA 2QJYB 2E42A 1QMGA 4A0XA 1ZRTE 4KHXA 3GTJJ 1BGYG 3ECHA 2QIWA 3HRUA 3TMOA 1K79A 3W2AA 2OV7A 1XMXA 2VBZA 2NNYA 2A06D 2DK5A 3OA7A 2R7OA 2R7WA 5AW9B 2AS5F 3ZXSA 3DKXA 4I1LA 2MH2A 2VODA 2CVZA 4A3LJ 1XGMA 5LGUA 4C2TA 4C7NA 2XROA 4B3HA 2BVMA 2KT0A 1IO4A 2BZTA 2XF7A 4EATA 1YJQA 3Q0WA 1FBMA 2KS1B 1R5GA 4DQ2A 5GPCA 4PJNA 2LKXA 3I4MJ 2WMMA 3ZN1A 1OR7A 1NU1J 1RC9A 3T8TA 4BKXA 2V7QJ 2KZGA 4G7ZF 4O3MA 3E1SA 1IO2A 2XB5A 3WUUA 3KE2A 2X6YA 4EJTA 5EGOB 5BOXA 2QYTA 1NTKJ 3QYEA 4A6DA 1Z67A 4A0ZA 2PJPA 2IEKA 1IFNA 3L75G 3M1EA 1F1ZA 1D1AA 2LDUA 1Z82A 1JGSA 2EK5A 1Z3YA 5HVQC 1ZRFA 2FYNB 4WY4A 2YR2A 3RL0B 1A02F 4A5NA 4WK8F 5EYRA 3L73D 3L71G 3CXHE 1XCBA 2L9VA 2ZXIA 3DXJF 2DFFA 1ZP0C 2LR2A 1MH4A 4ZMDA 3HEFA 1ON1A 4UNOA 2ITAA 3OW2O 3M3YJ 1K05A 1WDKA 1HW2A 5FWNA 3VWBA 1BGYD 1L0NK 3L72G 2STWA 3DTIA 5C3EJ 5IT3A 2K3RA 1U6GA 2PFBA 4P1WA 2HGCA 3RJPA 1LGHB 4NNJA 2GBYA 4Q4ZF 3K6JA 1N7SA 1JJ8C 1SLQA 5H2FC 3AE2C 1FBUA 4HZFA 3IH2A 1HTLC 2VKEA 1IK9A
chains in the Genus database with same CATH topology
3D1NI 4GBJA 3IH3A 1DU0A 3C2BA 3HGYA 1ZGWA 3ULKA 1T56A 5JE8A 2MG4A 1BW6A 2YU9J 2MGQA 3WFJA 3OBBA 1IGNA 1D5YA 2IYPA 3JRGA 4M3BA 1FTZA 1H89C 1KS9A 2NVYJ 2IBDA 4QTRA 2JA7J 5GPAA 3PO3J 5FKNA 1IL0A 1MBFA 2LP0A 2LY9A 4UUSA 4W97A 1EVZA 3S2HJ 2DA5A 4Y7NJ 2XSDC 3MOGA 3FR7A 1P7JA 1F12A 3ZWAA 2DA1A 5A9SA 2FQ4A 4FE4A 2R93J 2Y31A 1MBKA 1ORKA 2DJNA 1JT6A 1X2MA 2CJJA 3WFIA 5A9RA 1U8BA 1JKRC 4OVNF 4D7MA 1BW5A 2ID6A 1WH5A 4AC0A 4C3IJ 2ZYAA 2QCOA 2R5YB 2FD5A 2NOGA 2HDDA 3QPLA 2GM4A 3FK7A 5C4JJ 3G1LA 3QHAA 4V2GA 1HOMA 2K40A 4DZJA 5EZGA 2GLOA 1YONA 2G0EA 5EGOA 3HOZJ 3F0CA 1I36A 1M66A 4A3EJ 1AKHA 3MVPA 5IP9J 4XK4A 2HQ5A 3TW7A 1ZR4A 4IHYA 1QPIA 1Z0XA 1XC5A 3E7LA 2Y9ZA 1ETVA 4E13A 2XGCA 3HOVJ 4E21A 2L7ZA 1FIAA 4W1UA 1BJZA 2XPVA 4C3JJ 3BR5A 3S1MJ 4QSHA 3PIDA 3F3SA 2OPTA 3ZOBA 1UHSA 3BT9A 2OF7A 1M75A 1G2HA 3FIWA 2R92J 4XRSG 3ZQCA 2M0CA 1HDDC 1A6IA 4D5FA 2LD5A 3Q0UA 4MIMA 4IM7A 2Y0SN 4AUXA 5GP9A 2PGDA 4S3MA 3ZWCA 3HWRA 1LFUP 3JRAA 4JQ0D 1GV5A 4S0HB 4DW6A 2CUFA 3MN2A 3HM5A 1IDZA 4DCKA 1PUFA 1OCPA 2JWTA 2VI6A 1U9NA 3JRBA 1WCMJ 2LR8A 1I50J 1T33A 1ZK8A 4UUTA 3PO2J 3RQSA 4EEFG 1MH3A 2EBIA 3BR2A 1P7IA 3GHYA 2ELKA 5F27A 2WAQN 5IOYA 1ZCJA 3S1QJ 2DMNA 4L5EA 5J1YA 3K96A 1Y1VJ 4M6VA 1JUPA 1OJLA 4CYCB 1LJ8A 3S1RJ 1S7EA 1Y1WJ 2K9QA 3TP0A 1GDTA 4OQYA 2P4QA 4XRSA 3W6ZA 1JTXA 4M3EA 3FR8A 1JTYA 2WTBA 5C4XJ 3TP3A 5M3FJ 2LLKA 5IPAA 2YUSA 4NDLA 5A9TA 1JKQC 1FTTA 1VFCA 1B8IB 4R1NA 1F36A 2MSYA 2UYYA 5E3LA 2HXIA 3PEFA 3M4OJ 5EEAA 1F0YA 2I9PA 3Q3CA 2L0KA 3LOCA 3GTKJ 2DMPA 2ME6A 1NK3P 1BG6A 2DTZA 4X1EA 1OFCX 2E19A 2W48A 4B3IA 2DMUA 3MKLA 2M2EA 1I3QJ 1IV6A 4CYCA 4A69C 4C2MJ 3RZDJ 1K83J 5F0CA 2JMWA 1PGOA 5E3OA 1RR7A 1BA5A 4JYKA 1UG2A 4XIDA 2B63J 1YB4A 5M3MJ 4HNVA 4YCAA 3CTVA 5J1RA 2E1OA 2L9RA 1H88C 2NVQJ 3O8GA 5IYDJ 2XGDA 1W0TA 1W0UA 4EZBA 4J0EA 1MBJA 1LE8A 1PGPA 4BBRJ 3OSFA 2XB0X 5HWSA 1NTCA 1POGA 3TW6A 4BY1J 2ECBA 3A01B 5FLVA 2EZKA 1EVYA 3H2ZA 1MBGA 3S16J 5M5XJ 2CQXA 2NVXJ 2HXOA 2OFPA 1IUFA 1VNDA 4I76A 2N8GA 3B6AA 1ETWA 3HADA 2H8RA 3FISA 1LFBA 3GBGA 1E3OC 1X0VA 2CQQA 5JLWA 1QVTA 2CU7A 3QPSA 2R5YA 5J1UA 1H8AC 5M5YJ 3BR1A 1N1EA 3HGGA 5FLMJ 1X0XA 2WV1A 2JN6A 3FKIJ 5FKLA 3VPRA 4A3IJ 4GWKA 3HBLA 1WDMA 3L6DA 4BXXJ 4MFDA 2AHQA 2ME0A 1JGGA 1DLJA 1PGJA 1RESA 2LK2A 3BG9A 4A93J 4D3SA 3S1NJ 3I4NJ 1IRZA 3Q3SA 4E12A 2XGEA 4IHXA 2E2JJ 4M3GA 4PZDA 2EZIA 3QQAA 1FIPA 4OQZA 3CKYA 1WPQA 4OM8A 4BY7J 1VPDA 1M76A 3GTPJ 4A3MJ 3NARA 3BR6A 3BR0A 1JUSA 4FISA 4A3FJ 3OSGA 1SFOJ 1UMQA 5IP7J 1Z77A 1M2WA 4IEJA 3LSJA 2NS7A 2RAEA 4DYRA 2LTPA 1WP4A 1TWGJ 1F14A 5K7FA 3JRIA 2HOSA 3CQZJ 3B6CA 3K2AA 4JX6A 3TEDA 1B72B 5F08A 3S14J 3NAUA 3GTGJ 1PGNA 2W8ZA 4XRMA 2WB1N 2W90A 5FKKA 2X48A 3DFUA 2EH3A 3JRHA 5E3MA 2X58A 1WPKA 2EZHA 4V2FA 3OOUA 2IYOA 2TRTA 1JDJA 3Q0VA 4AYBN 4I6ZA 3S17J 4PZEA 2M8GX 1YRNA 4A3JJ 2K9NA 2DA3A 1ZQ3P 3BR3A 4GFBA 4KUHA 9ANTA 3PDUA 5F04A 1TWHJ 3BQZA 3G1OA 1JKOC 5FJ8J 1ITYA 3JRCA 3WHCA 3BTJA 3G0OA 4KUGA 4KUEA 2Y9YA 5EF6A 2E2HJ 2DN0A 1A5JA 4Y52J 1WH7A 4DYDA 1ZKGA 3JRFA 3LSPA 3CDLA 3HDDA 3ADPA 3DCFA 1ENHA 3FWNA 3SFIA 4JP0A 3HOUJ 1ETQA 2DA2A 4RBOA 1AKHB 1XS9A 4FGWA 1AU7A 4M3DA 3HDHA 5EZHA 3BG3A 3BTCA 2MW8A 1WGXA 1ETKA 5MGBA 1XG1A 3CMYA 1BL0A 3RZOJ 2O8KA 4FE7A 3ZGYA 3HN2A 3DOJA 3HOWJ 3HB9A 2YS9A 3BTLA 4JX5A 1JKPC 3EGOA 1RPWA 3IQDB 1WDLA 1ETOA 1IJWC 1HDPA 3JR9A 3ZW9A 2E2IJ 1MBEA 3BTIA 2IAIA 2DA4A 2NS8A 4MO7A 3HOXJ 5IOZA 1IC8A 2D3TA 1TWCJ 2JKVA 5E3NA 2IZ0A 4PZCA 1GV2A 4LOCA 5EDNA 2HI3A 1OCTC 3C7CB 4M3FA 3G1MA 1MNMC 1N1GA 2X9DA 2HDHA 1GVDA 2R7ZJ 2LVSA 5FKOA 3BG5A 5IYBJ 2DMTA 2L7FP 3A02A 2JA6J 2JK3A 4A3BJ 2QF7A 2PLAA 3W6UA 1SANA 2H1KA 1MSEC 1VI0A 1RKWA 1RETA 2M34A 1ZTRA 2XRLA 3K7AJ 5HODA 5IYCJ 2KDZA 1QRYA 2EQRA 3S15J 4XICA 1JJ6C 1LE8B 3SDGA 2IZ1A 3HKZN 1HCRA 3HOYJ 3ZQGA 3QSGA 1TWAJ 2Y30A 5M5WJ 2VUMJ 3GTQJ 4ABZA 2VKVA 1YJ8A 5J3LA 4D3DA 4GWGA 2CRGA 4FTHA 4JX4A 1AHDP 1APLC 1GUUA 1FEXA 3LSGA 5BNGA 2HOAA 2Y2ZA 2D5VA 3H3VK 1B72A 4IHWA 3PJGA 1Q1VA 4A3DJ 4OL9A 4A3KJ 5K7ZA 5JLXA 5EG0A 3RKQA 4MLOA 3W6VA 3JREA 1F43A 5AYVA 3L1PA 4B1RA 1QVUA 1M67A 1YRNB 3G17A 2PMZN 3PLRA 2R5ZA 2JA5J 4J0FA 1LSJA 3DEWA 1HF0A 1DU6A 5F1JA 3C7AA 1F17A 4QIWN 3GTOJ 3SJMA 3ZQLA 4DZPA 3A01A 3LNQA 2R0QC 1GT0C 3O8HA 2LFBA 3I83A 4J19A 4A3CJ 1PUFB 3ZHBA 1IDYA 1VF9A 4JPZB 3OIOA 4A3GJ 2M9HA 2DA7A 2L7MP 2DA6A 3UKGA 1K61A 3ADOA 1YVEI 2EZLA 1I6HJ 1X58A 1RKTA 1MBHA 1ETYA 3CCYA 4IHVA 2ZYGA 1QMGA 1U78A 2ZB9A 2O7OA 2I10A 2O9LA 3GTJJ 2R5ZB 4DYQA 1R9TJ 5EG0B 5FKMA 3IV5A 3LSRA 4MFEA 3S2DJ 4DYCA 2ID3A 3A03A 2CVZA 4A3LJ 2ECCA 3PM1A 1CQTA 2FJ1A 4FCYA 1DLIA 4B3JA 4B3HA 2FX0A 1O4XA 4D3FA 2KT0A 3GTLJ 5DTDA 4B3AA 1YJQA 3Q0WA 2EW2A 1HLVA 2ZYDA 5F0FA 5GPCA 2LKXA 2JA8J 1NK2P 1TWFJ 4C3HJ 1MSFC 3I4MJ 4BKXA 2HYJA 5K7HA 1PGQA 2XB5A 5C44J 5F0HA 2DMQA 1TC3C 1ETXA 1U9OA 4DLLA 3ZQIA 5EGOB 2AO9A 2QYTA 1JUMA 2IEKA 1ZR2A 3ZW8A 1EF4A 1Z82A 2HOTA 1LSOA 3ZWBA 1JT0A 1TXGA 3WS7A 1X2NA 2P81A 2JJ7A 2X6OA 3GTMJ 3H0GJ 5EYRA 3ZQHA 4D5CA 1YRLA 3RQIA 3BQYA 2XPWA 2GF2A 5DS9A 3IH4A 1MH4A 4B4CA 4RDUA 3HEFA 5A9SB 2TCTA 3M3YJ 2CUEA 1WDKA 1WI3A 3WHBA 5FWNA 4X6AJ 4G12A 4BBSJ 3JRDA 5C3EJ 2VPRA 4D7NA 2NVTJ 3FK6A 2GBYA 3ZQFA 5IP6A 1JJ8C 3K6JA 4UUSB 3C7DB 1IG7A 2COBA 2K9SA 3IH2A 2XPUA 1B8IA 2VKEA 1FJLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3D1N I;  3IH3 A;  1DU0 A;  3C2B A;  3HGY A;  1ZGW A;  1T56 A;  2MG4 A;  1BW6 A;  2YU9 J;  2MGQ A;  1IGN A;  1D5Y A;  3JRG A;  4M3B A;  1FTZ A;  1H89 C;  2NVY J;  2IBD A;  4QTR A;  2JA7 J;  5GPA A;  3PO3 J;  5FKN A;  1MBF A;  2LP0 A;  2LY9 A;  4UUS A;  4W97 A;  3S2H J;  2DA5 A;  4Y7N J;  2XSD C;  1P7J A;  2DA1 A;  2FQ4 A;  4FE4 A;  2R93 J;  2Y31 A;  1MBK A;  1ORK A;  2DJN A;  1JT6 A;  1X2M A;  2CJJ A;  4OVN F;  1U8B A;  1JKR C;  4D7M A;  1BW5 A;  2ID6 A;  1WH5 A;  4AC0 A;  4C3I J;  2QCO A;  2R5Y B;  2FD5 A;  2NOG A;  2HDD A;  3QPL A;  2GM4 A;  3FK7 A;  5C4J J;  3G1L A;  4V2G A;  1HOM A;  2K40 A;  4DZJ A;  5EZG A;  2GLO A;  2G0E A;  5EGO A;  3HOZ J;  3F0C A;  4A3E J;  1AKH A;  3MVP A;  5IP9 J;  4XK4 A;  2HQ5 A;  3TW7 A;  1ZR4 A;  4IHY A;  1QPI A;  1Z0X A;  1XC5 A;  3E7L A;  2Y9Z A;  1ETV A;  2XGC A;  3HOV J;  2L7Z A;  1FIA A;  4W1U A;  1BJZ A;  2XPV A;  4C3J J;  3BR5 A;  3S1M J;  4QSH A;  2OPT A;  3ZOB A;  1UHS A;  3BT9 A;  2OF7 A;  1G2H A;  3FIW A;  2R92 J;  4XRS G;  3ZQC A;  2M0C A;  1HDD C;  1A6I A;  4D5F A;  2LD5 A;  3Q0U A;  4MIM A;  2Y0S N;  4AUX A;  5GP9 A;  1LFU P;  3JRA A;  4JQ0 D;  1GV5 A;  4S0H B;  4DW6 A;  2CUF A;  3MN2 A;  3HM5 A;  1IDZ A;  4DCK A;  1PUF A;  1OCP A;  2JWT A;  2VI6 A;  1U9N A;  3JRB A;  1WCM J;  2LR8 A;  1I50 J;  1T33 A;  1ZK8 A;  4UUT A;  3PO2 J;  4EEF G;  1MH3 A;  2EBI A;  3BR2 A;  1P7I A;  2ELK A;  5F27 A;  2WAQ N;  5IOY A;  3S1Q J;  2DMN A;  4L5E A;  5J1Y A;  1Y1V J;  4M6V A;  1JUP A;  1OJL A;  4CYC B;  3S1R J;  1S7E A;  1Y1W J;  2K9Q A;  3TP0 A;  1GDT A;  4XRS A;  1JTX A;  4M3E A;  1JTY A;  5C4X J;  3TP3 A;  5M3F J;  2LLK A;  5IPA A;  2YUS A;  4NDL A;  1JKQ C;  1FTT A;  1VFC A;  1B8I B;  1F36 A;  2MSY A;  5E3L A;  2HXI A;  3M4O J;  5EEA A;  2L0K A;  3LOC A;  3GTK J;  2DMP A;  2ME6 A;  1NK3 P;  2DTZ A;  4X1E A;  1OFC X;  2E19 A;  2W48 A;  2DMU A;  3MKL A;  2M2E A;  1I3Q J;  1IV6 A;  4CYC A;  4A69 C;  4C2M J;  3RZD J;  1K83 J;  5F0C A;  2JMW A;  5E3O A;  1RR7 A;  1BA5 A;  4JYK A;  1UG2 A;  4XID A;  2B63 J;  5M3M J;  4HNV A;  5J1R A;  2E1O A;  2L9R A;  1H88 C;  2NVQ J;  3O8G A;  5IYD J;  2XGD A;  1W0T A;  1W0U A;  1MBJ A;  1LE8 A;  4BBR J;  3OSF A;  2XB0 X;  1NTC A;  1POG A;  3TW6 A;  4BY1 J;  2ECB A;  3A01 B;  5FLV A;  2EZK A;  1MBG A;  3S16 J;  5M5X J;  2CQX A;  2NVX J;  2HXO A;  1IUF A;  1VND A;  4I76 A;  2N8G A;  3B6A A;  1ETW A;  2H8R A;  3FIS A;  1LFB A;  3GBG A;  1E3O C;  2CQQ A;  5JLW A;  1QVT A;  2CU7 A;  3QPS A;  2R5Y A;  5J1U A;  1H8A C;  5M5Y J;  3BR1 A;  3HGG A;  5FLM J;  2WV1 A;  2JN6 A;  3FKI J;  5FKL A;  3VPR A;  4A3I J;  3HBL A;  4BXX J;  4MFD A;  2AHQ A;  2ME0 A;  1JGG A;  1RES A;  2LK2 A;  3BG9 A;  4A93 J;  3S1N J;  3I4N J;  1IRZ A;  3Q3S A;  2XGE A;  4IHX A;  2E2J J;  4M3G A;  2EZI A;  3QQA A;  1FIP A;  4BY7 J;  3GTP J;  4A3M J;  3NAR A;  3BR6 A;  3BR0 A;  1JUS A;  4FIS A;  4A3F J;  3OSG A;  1SFO J;  1UMQ A;  5IP7 J;  1Z77 A;  4IEJ A;  3LSJ A;  2NS7 A;  2RAE A;  4DYR A;  2LTP A;  1TWG J;  5K7F A;  3JRI A;  2HOS A;  3CQZ J;  3B6C A;  3K2A A;  4JX6 A;  3TED A;  1B72 B;  5F08 A;  3S14 J;  3NAU A;  3GTG J;  4XRM A;  2WB1 N;  5FKK A;  2X48 A;  2EH3 A;  3JRH A;  5E3M A;  1WPK A;  2EZH A;  4V2F A;  3OOU A;  2TRT A;  3Q0V A;  4AYB N;  4I6Z A;  3S17 J;  2M8G X;  1YRN A;  4A3J J;  2K9N A;  2DA3 A;  1ZQ3 P;  3BR3 A;  4GFB A;  9ANT A;  5F04 A;  1TWH J;  3BQZ A;  3G1O A;  1JKO C;  5FJ8 J;  1ITY A;  3JRC A;  3WHC A;  3BTJ A;  2Y9Y A;  5EF6 A;  2E2H J;  2DN0 A;  1A5J A;  4Y52 J;  1WH7 A;  1ZKG A;  3JRF A;  3LSP A;  3CDL A;  3HDD A;  3DCF A;  1ENH A;  3SFI A;  4JP0 A;  3HOU J;  1ETQ A;  2DA2 A;  4RBO A;  1AKH B;  1XS9 A;  1AU7 A;  4M3D A;  5EZH A;  3BG3 A;  3BTC A;  2MW8 A;  1WGX A;  1ETK A;  1XG1 A;  3CMY A;  1BL0 A;  3RZO J;  2O8K A;  4FE7 A;  3HOW J;  3HB9 A;  2YS9 A;  3BTL A;  4JX5 A;  1JKP C;  1RPW A;  1ETO A;  1IJW C;  1HDP A;  3JR9 A;  2E2I J;  1MBE A;  3BTI A;  2IAI A;  2DA4 A;  2NS8 A;  4MO7 A;  3HOX J;  5IOZ A;  1IC8 A;  1TWC J;  5E3N A;  1GV2 A;  4LOC A;  5EDN A;  2HI3 A;  1OCT C;  4M3F A;  3G1M A;  1MNM C;  2X9D A;  1GVD A;  2R7Z J;  2LVS A;  5FKO A;  3BG5 A;  5IYB J;  2DMT A;  2L7F P;  3A02 A;  2JA6 J;  2JK3 A;  4A3B J;  2QF7 A;  1SAN A;  2H1K A;  1MSE C;  1VI0 A;  1RKW A;  1RET A;  2M34 A;  1ZTR A;  2XRL A;  3K7A J;  5HOD A;  5IYC J;  2KDZ A;  1QRY A;  2EQR A;  3S15 J;  4XIC A;  1JJ6 C;  1LE8 B;  3SDG A;  3HKZ N;  1HCR A;  3HOY J;  3ZQG A;  1TWA J;  2Y30 A;  5M5W J;  2VUM J;  3GTQ J;  4ABZ A;  2VKV A;  5J3L A;  2CRG A;  4FTH A;  4JX4 A;  1AHD P;  1APL C;  1GUU A;  1FEX A;  3LSG A;  5BNG A;  2HOA A;  2Y2Z A;  2D5V A;  3H3V K;  1B72 A;  4IHW A;  1Q1V A;  4A3D J;  4A3K J;  5K7Z A;  5JLX A;  5EG0 A;  3RKQ A;  4MLO A;  3W6V A;  3JRE A;  1F43 A;  3L1P A;  4B1R A;  1QVU A;  1YRN B;  2PMZ N;  2R5Z A;  2JA5 J;  3DEW A;  1HF0 A;  1DU6 A;  5F1J A;  4QIW N;  3GTO J;  3SJM A;  3ZQL A;  4DZP A;  3A01 A;  3LNQ A;  2R0Q C;  1GT0 C;  3O8H A;  2LFB A;  4J19 A;  4A3C J;  1PUF B;  1IDY A;  1VF9 A;  4JPZ B;  3OIO A;  4A3G J;  2M9H A;  2DA7 A;  2L7M P;  2DA6 A;  3UKG A;  1K61 A;  2EZL A;  1I6H J;  1X58 A;  1RKT A;  1MBH A;  1ETY A;  3CCY A;  4IHV A;  1U78 A;  2ZB9 A;  2O7O A;  2I10 A;  2O9L A;  3GTJ J;  2R5Z B;  4DYQ A;  1R9T J;  5EG0 B;  5FKM A;  3IV5 A;  3LSR A;  4MFE A;  3S2D J;  4DYC A;  2ID3 A;  3A03 A;  4A3L J;  2ECC A;  3PM1 A;  1CQT A;  2FJ1 A;  4FCY A;  2FX0 A;  1O4X A;  2KT0 A;  3GTL J;  5DTD A;  4B3A A;  3Q0W A;  1HLV A;  5F0F A;  5GPC A;  2LKX A;  2JA8 J;  1NK2 P;  1TWF J;  4C3H J;  1MSF C;  3I4M J;  4BKX A;  2HYJ A;  5K7H A;  2XB5 A;  5C44 J;  5F0H A;  2DMQ A;  1TC3 C;  1ETX A;  1U9O A;  3ZQI A;  5EGO B;  2AO9 A;  1JUM A;  2IEK A;  1ZR2 A;  1EF4 A;  2HOT A;  1JT0 A;  1X2N A;  2P81 A;  2JJ7 A;  2X6O A;  3GTM J;  3H0G J;  5EYR A;  3ZQH A;  4D5C A;  3RQI A;  3BQY A;  2XPW A;  5DS9 A;  3IH4 A;  1MH4 A;  4B4C A;  4RDU A;  3HEF A;  2TCT A;  3M3Y J;  2CUE A;  1WI3 A;  3WHB A;  4X6A J;  4G12 A;  4BBS J;  3JRD A;  5C3E J;  2VPR A;  4D7N A;  2NVT J;  3FK6 A;  2GBY A;  3ZQF A;  5IP6 A;  1JJ8 C;  4UUS B;  1IG7 A;  2COB A;  2K9S A;  3IH2 A;  2XPU A;  1B8I A;  2VKE A;  1FJL A; 
#chains in the Genus database with same CATH topology
 1LTS C;  5KLI C;  3G71 I;  2FML A;  1OCR H;  3JCU H;  2XRN A;  1MJB A;  2ZXX A;  2ZCW A;  4WBA A;  3I9V 2;  2HDC A;  1MNE A;  2HYN A;  3N4X A;  3HUS A;  4ZNC A;  2HQA A;  3OIP A;  3RPU D;  3FZV A;  3IWF A;  3V4Q A;  1OLT A;  1VQ4 I;  1ZGW A;  1PP8 F;  1J1E C;  1KQL A;  1BI1 A;  3M07 A;  3PUF A;  2MG4 A;  1EC5 A;  1X19 A;  2XKM A;  4H44 B;  1GTW A;  1KFM A;  3K10 A;  1IGN A;  3ZMU A;  1D5Y A;  5CBO A;  4RB2 C;  1BDD A;  5ILU A;  2L5Q A;  1NTZ D;  1S2E A;  2JZY A;  1VQN P;  1SQX G;  3HRN A;  1KS9 A;  1NYH A;  1DEB A;  4WXH A;  2A5Y B;  5GPA A;  4OIO F;  3TBI A;  3PNY A;  5FKN A;  1IRG A;  1NVO A;  2F4M B;  1W7P D;  1IL0 A;  1NTZ E;  1L0N G;  2LY9 A;  1SFU A;  2UZK A;  1X22 A;  1KTM A;  3S2H J;  3NWS A;  3L75 D;  3C7J A;  3LA7 A;  3FR7 A;  4YII A;  2FQ4 A;  2QQA A;  3BC8 A;  3J81 Z;  2KIM A;  1ORK A;  2QQ8 A;  1HF9 A;  1JT6 A;  3WFI A;  3L70 E;  1BGY J;  1IFD A;  4O9B A;  1ZAO A;  3RK3 D;  1R1V A;  2L4A A;  4D7M A;  3VFZ A;  1YFH A;  2NOJ B;  1DUX C;  1G4D A;  2ID6 A;  1WH5 A;  4JF7 A;  1N73 C;  4E4H A;  2ZYA A;  4YXD C;  3F21 A;  1T0F A;  2A69 F;  4U7B A;  1JTH B;  1VL2 A;  1K8A Q;  3GFL A;  3V6I A;  1H8A A;  3G1L A;  3QHA A;  1K7A A;  2VRS A;  2DYS H;  2PBI A;  3M9Q A;  1IV8 A;  2K40 A;  1YE9 A;  3QRF F;  2G7H A;  1SQV J;  2HTJ A;  3QPT A;  3MMY B;  4JBA A;  3O6Q B;  3BVH A;  1BN5 A;  2FYU J;  3A0B H;  3MZ8 A;  3PNT A;  5B1A H;  2QUF A;  2ICW G;  1AKH A;  3HOZ J;  1M66 A;  1IFP A;  3HRT A;  1FOK A;  1SFC B;  3L72 E;  4XK4 A;  1WZ2 A;  3A5T A;  3BCC E;  3F8N A;  2YKO A;  2HQ5 A;  3CP2 A;  5JVT A;  2M5A B;  2RH0 A;  3BP8 A;  5D4S A;  1ZR4 A;  2PLY A;  2QM8 A;  3HTK A;  4N6J A;  3P8C E;  1DH3 A;  1XC5 A;  2P1J A;  2RKL A;  2MBF A;  1ETV A;  2O3F A;  3M9A A;  1IJD B;  4V19 K;  2DDA A;  4H13 C;  3HOV J;  2Q9I A;  2V6E A;  3AG2 H;  1KA8 A;  1LT1 A;  4OMY A;  4W1U A;  1BJZ A;  5KLV E;  5KJ7 C;  2GIZ A;  3S1M J;  3H1L D;  5KK1 A;  3PP5 A;  1FBQ A;  3G6E P;  2W6J H;  4F55 A;  4YEL A;  1VQM I;  4U7D A;  1ON2 A;  3HL2 A;  1OXZ A;  3J80 Z;  1N7L A;  3RPU A;  2OF7 A;  5APY A;  1G2H A;  1Z3X A;  1G8X A;  2ELH A;  2V1X A;  4L74 A;  1DGW Y;  4J01 A;  3ZQC A;  2YKP A;  3SWY A;  3W67 A;  2LD5 A;  4MIM A;  4XQF A;  1ZEL A;  5APV A;  4PJ0 H;  2OYI A;  1YG2 A;  2FBK A;  2OZ6 A;  4NBQ A;  2Q2E B;  3GVA A;  2ZO4 A;  3HWR A;  1J9I A;  4EJU A;  3L2V A;  5FFX A;  2L02 A;  2K86 A;  3BWG A;  4S0H B;  3MKZ A;  2CUF A;  3FXJ A;  3MN2 A;  1X8Y A;  2O1J A;  3TNU B;  1YJW P;  1G2C B;  1OCP A;  4CCO A;  3CUO A;  1XSD A;  1X3U A;  3AED C;  3GLX A;  2KIK A;  1DX7 A;  2QGU A;  4DNC A;  3IP4 B;  4BQN A;  1S5L E;  1AV1 A;  1T33 A;  4UUT A;  1K6O A;  3PO2 J;  1E3H A;  1R71 A;  4EEF G;  3VTP C;  1VQ7 P;  2EBI A;  1FYL A;  2H94 A;  3PSF A;  1X0T A;  1P7I A;  3O6B B;  2ELK A;  3PIP F;  2A06 E;  2IX7 C;  3VEP A;  1YTZ I;  4WY4 D;  2IGN A;  5CCG A;  2WY7 Q;  1LT9 C;  3JAM Z;  1J59 A;  1SS1 A;  3H3U A;  1OJL A;  5AIP A;  1W36 D;  3S1R J;  1S7E A;  1Y1W J;  1TNS A;  1IN8 A;  2O03 A;  3CCR I;  5DUK A;  3GZ6 A;  1M1J B;  3SEQ A;  2UXX A;  4IQJ A;  1S3J A;  4I6M C;  2FEZ A;  2A6H F;  3PNV A;  2R5D A;  1I1S A;  3H1J D;  1JTY A;  3S93 A;  5KCM A;  1LPQ A;  3TP3 A;  1FMW A;  2WTB A;  3V2P A;  5KAI E;  5IPA A;  4NDL A;  5LLQ A;  1NTM J;  1T2K A;  1FTT A;  2ZT9 B;  3L70 J;  3T8R A;  2CPS A;  2BY0 A;  4QWQ A;  2BXZ A;  3CJR B;  4IL6 X;  2FNP A;  1ODD A;  1SQP D;  3WTY C;  2AXT C;  3M4O J;  5EEA A;  2OGU A;  3SEZ A;  4FHT A;  4ZZD A;  3Q3C A;  2L0K A;  3HKZ A;  1RUO A;  1LNW A;  1SFE A;  2DMP A;  2Z1D A;  2ME6 A;  2DTZ A;  1HVV A;  1OFC X;  4UV8 A;  3L73 E;  2M45 A;  4XMY A;  5APW A;  3CX5 E;  3MKL A;  1YOV B;  4NC6 A;  3KYC B;  3CF5 F;  2HPM A;  3ABM H;  1BDC A;  1IC2 A;  3KP6 A;  1IV6 A;  1OW7 A;  3WUV A;  1Q81 Q;  2BOL A;  4LB5 A;  4B44 A;  3L36 A;  1O7F A;  1ZN5 A;  1NTK D;  1Q86 Q;  3LAP A;  3BRV B;  1LT9 A;  3ZMT A;  1RR7 A;  1BA5 A;  1SFC C;  2VB6 A;  2ZBK A;  2Z2S B;  3DKW A;  3MWM A;  3MKW B;  3REO A;  1VTN C;  3T5X A;  4XLF A;  5J1R A;  3CTV A;  1L0L J;  4CSW A;  1Y8A A;  2OBP A;  3DLA A;  3DWL E;  1T8I A;  2NVQ J;  2CV1 A;  4H44 C;  1GLN A;  1WSU A;  4CCN A;  1W0U A;  4PGH A;  4J0E A;  3CMM A;  4U88 A;  2LKP A;  5E18 F;  3W6J B;  3DQV C;  1RIO H;  2HYF A;  5HWS A;  4EJO A;  2NRA C;  1HGV A;  3CCS I;  4Y17 A;  1KB9 I;  1WJF A;  2L91 A;  2EZK A;  3TKY A;  1EVY A;  5B5E E;  2LRE A;  2GXB A;  2VOO A;  1H0T A;  1O57 A;  3EUH C;  2V1N A;  2A06 G;  2Q1K A;  4ENM A;  2I76 A;  2CQX A;  2NVX J;  4B48 A;  1U5T A;  5DV5 A;  3U1D A;  1OVR A;  3D70 A;  4UUV A;  1IUF A;  3NQO A;  4ZYA A;  3B6A A;  2KZI A;  1O3S A;  3CX5 H;  4HJG H;  3FIS A;  1RHZ B;  1AJY A;  1QVT A;  3QPS A;  5EEH A;  1BE3 G;  4EM1 A;  3IHU A;  5J1U A;  1H8A C;  3L2Q A;  1N1E A;  1U7J A;  3WU0 A;  2IW5 A;  2F2E A;  2ZME A;  1QHG A;  4O5V A;  4C2U A;  3AEF C;  3BOQ A;  2JN6 A;  1X1D A;  3FKI J;  1EKE A;  3ABT A;  3HZJ A;  3HBL A;  4GYI A;  4JK1 X;  4L9V A;  4MFD A;  1UB9 A;  2P4W A;  3KZI C;  1VQP I;  5KJ7 D;  4NC7 A;  1DLJ A;  2K02 A;  3DLL F;  2Q2E A;  2STT A;  1EA3 A;  4G7O F;  4EIJ A;  3IAO A;  2GWR A;  3Q3S A;  4B8X A;  1EDI A;  2SPZ A;  2XGE A;  4PJJ A;  4IHX A;  2IVM A;  4IHT A;  1BC7 C;  1KYO E;  3FXR A;  2JO1 A;  3CXH D;  4PZD A;  5AW1 B;  3L71 D;  3L73 G;  2M30 A;  4BE0 A;  2LKM A;  4C7N B;  3QOP A;  5D5X B;  1O7L A;  1N86 A;  3CKY A;  4LMY A;  3CMA P;  1EDJ A;  1WPQ A;  2BEZ F;  2XDJ A;  3GTP J;  1CSB A;  2R5B A;  4IHS A;  4AIH A;  4A0Y A;  2HVR A;  4RJT A;  2LRD A;  3K4J A;  2O3J A;  5IP7 J;  1LTJ A;  3HSF A;  2EIN H;  1KZU B;  2JRM A;  4C7R A;  3HSR A;  4UV9 A;  3KYD B;  5CKT A;  2QJK B;  4PV1 C;  2ZNZ A;  3KYL A;  1WP4 A;  1BSN A;  3RSN A;  3GLM A;  4HX7 A;  4A5M A;  4F7Z A;  5K7F A;  4WWI A;  3FX0 A;  3B6C A;  1B72 B;  3S14 J;  1I1G A;  4U87 A;  3D1L A;  2FYU K;  2HTS A;  2W8Z A;  2FYU E;  2YXR B;  1LJ9 A;  3H6P A;  3QOD A;  4JOM A;  3CCQ P;  1KU9 A;  1RE3 A;  3DFU A;  1JI8 A;  3R0J A;  1W1W E;  4U0W A;  3S3O A;  3OL4 A;  3E6B A;  3KP7 A;  1WPK A;  4BJ6 C;  2DAO A;  3AG3 H;  3OOU A;  4HV5 A;  1OW8 A;  2FYU D;  3VMZ A;  2TRT A;  4MEX F;  1T98 A;  3Q0V A;  1YJN I;  1YQA A;  1SQX D;  3CXH I;  3F8B A;  4A3J J;  2DA3 A;  2R7D A;  3FF5 A;  4HX4 A;  2EIJ H;  2K9Y A;  3BR3 A;  3CWB D;  5F6F A;  1YBK A;  1Z05 A;  3SSU A;  1LWU A;  4MN4 C;  3H92 A;  5DD8 A;  4GCV A;  1SQX E;  1IF1 A;  4G6T B;  3T1B A;  2Z99 A;  1IN7 A;  1JKO C;  2GXA A;  3JSP A;  2B87 A;  2YMK A;  1NHL A;  4Y15 A;  4KUG A;  1ZLJ A;  1KB9 H;  4I7Z C;  1LWU C;  3H1L J;  1SD7 A;  2PQ8 A;  2N1T A;  3HUS B;  4XM3 A;  1FYM A;  3H1H J;  2DLL A;  2DN0 A;  4RB0 A;  3M0D C;  3U59 A;  4DYD A;  1EZV G;  2XND H;  1ZKG A;  3JRF A;  2O8X A;  2PMZ A;  3LSP A;  3FWN A;  1ZH5 A;  2D2C B;  3C2H A;  4UB8 C;  3DBR B;  4JP0 A;  5DDG A;  5FRM A;  2FOK A;  3HOU J;  4EM0 B;  1SQB J;  3R2P A;  5AVQ B;  1ETQ A;  1LEA A;  5B5E C;  4HST A;  1QLE D;  2KRC A;  3VOE A;  2B0L A;  3S3N A;  3V7R A;  3M7G A;  2W27 A;  3E97 A;  3BG3 A;  1KC8 Q;  3ITK A;  2OYH A;  1ETK A;  1WFX A;  2WT7 B;  1VDF A;  2YO3 A;  3S32 A;  1E3P A;  1I3A A;  4HG2 A;  3HN2 A;  2EIM H;  3IAM 2;  3DOJ A;  3HOW J;  4IL6 E;  3BTL A;  2NS0 A;  2E7X A;  3GLL A;  1A02 J;  3LA2 A;  3P8C D;  1IJW C;  1KQG B;  4L75 A;  2Y0M A;  1OX3 A;  1SVF A;  1R00 A;  1S5L H;  3ZW9 A;  2E75 B;  2E2I J;  3K69 A;  4IJA A;  2A05 A;  5H6Q A;  1SQP E;  2YIU B;  2FFD C;  2DA4 A;  2ZT9 D;  4H0L B;  2FYU G;  3WU1 B;  1IC8 A;  1LT9 B;  4L0Z B;  5B66 E;  2OC6 A;  3RK3 B;  2HI3 A;  1JY3 O;  4ITV A;  3V8L A;  1RF0 A;  1HKS A;  2OQR A;  2XF5 A;  1GVD A;  1ZAR A;  4PZJ A;  2R7Z J;  1MGT A;  2HYG D;  2AEF A;  1YQ4 C;  1SQV K;  2DYR H;  2L3D A;  1YYV A;  1HWT C;  3CC4 P;  3E3V A;  2XAJ A;  2HNH A;  4D9J A;  3OYK A;  1KD1 Q;  4L5I A;  2MD5 A;  2XRL A;  2KDZ A;  1BIB A;  3DU5 A;  3L00 A;  2IBZ G;  5DJT B;  3LW5 J;  1PP9 J;  4A12 A;  1FOY A;  3SDG A;  3ZQ7 A;  1KYO H;  2IZ1 A;  4IFM A;  3WU2 H;  2E1N A;  2O6G E;  3OL3 A;  4A7P A;  4E7H A;  3QSG A;  1N73 A;  5HNH A;  2MLK A;  2Y30 A;  4YFN F;  5M5W J;  3GTQ J;  1Z56 A;  2DT5 A;  3EYY A;  5D5V B;  1J2X A;  2L2O A;  2OAZ A;  3BZC A;  4JX4 A;  1APL C;  2BCC J;  1N73 B;  1OZH A;  1KQ9 A;  3NRV A;  4TV7 A;  3ZR8 X;  1VQN I;  2HOA A;  2D5V A;  5KAF E;  4IHW A;  2CMP A;  1HW1 A;  2M0M A;  2V6C A;  2HPC A;  3G73 A;  4LLH A;  2RGV A;  3W6K B;  5JLX A;  5K7Z A;  2VBW A;  1JHF A;  2FFD A;  1IN4 A;  2JA2 A;  2WV0 A;  3MP7 B;  1HQC A;  3LSH A;  2RVC A;  2I1J A;  2NPS C;  2ZJS E;  3F6O A;  4Y28 J;  1DQU A;  1K78 B;  2PMZ N;  4AVZ A;  1XD7 A;  5E8I A;  2R5Z A;  1T39 A;  3IAS 2;  2W6B A;  3C18 A;  3H1J E;  2WAD A;  1DU6 A;  1HUC A;  3VN0 A;  2KNC B;  4HDV A;  1H88 A;  3HOS A;  1WRJ A;  2M87 A;  1GT0 C;  3LNQ A;  4E7K A;  3O8H A;  1SD5 A;  2ESH A;  3I83 A;  4EJV A;  1JCD A;  1KYW A;  1B9M A;  1VF9 A;  2DDB A;  4XN0 A;  4A2U A;  4Z6Y A;  2J5U A;  3H1H E;  1V5F A;  4F92 B;  3AE4 C;  4A3G J;  1K61 A;  2RNG A;  2VIX A;  3MD2 A;  2DJI A;  1X58 A;  3SXY A;  1SP4 A;  4DBQ A;  5EFW B;  1DGR M;  4XSX F;  1EV7 A;  2BEO A;  3CCY A;  1GL2 D;  3H1H D;  5AW3 B;  1NTM E;  1PPJ G;  4HEA 2;  3B5N D;  1PV3 A;  2O7O A;  2FNA A;  4XRF A;  4GT1 A;  3CCM P;  3EET A;  2O9L A;  2M8E A;  4HKZ H;  5CJ9 A;  2K37 A;  5H2F H;  1QQI A;  3L09 A;  2F5F A;  4DYQ A;  3J7A Y;  4GO1 A;  1R9T J;  2O01 J;  2MA3 A;  1HGZ A;  3BLY A;  4QPO A;  4LLL A;  5ERI A;  1TT5 B;  4XLP F;  3LSR A;  3IV5 A;  3FMR A;  1ZRD A;  1CI6 A;  1VPC A;  3QP6 A;  2RMZ A;  4DYC A;  5CCG D;  1M1K Q;  2QJY C;  4FCY A;  5L3B A;  2ZAE B;  4LG3 A;  2OYO A;  2ZJQ F;  3JCU E;  2X85 A;  5DTD A;  4B3A A;  1REP C;  3CTA A;  2EW2 A;  2ZYD A;  1T6A A;  4RAG A;  4XL9 A;  2OA4 A;  4M71 A;  1NK2 P;  3HXL A;  4WXD A;  1XTA A;  2HYJ A;  1PGQ A;  3L9F A;  2P6T A;  2EV5 A;  2E75 D;  1OR7 C;  5C44 J;  4NUB A;  2DMQ A;  1KU2 A;  1TC3 C;  4IRI A;  1CF7 A;  3K6G A;  3H1J J;  2ISZ A;  4OWF A;  4XKC A;  3MKY B;  3TYY A;  1ZLL A;  5KVR A;  1XGO A;  1W2B O;  1LDK B;  2P0W A;  2DXI A;  3ZW8 A;  1U57 A;  3B73 A;  5JHF A;  1HJ0 A;  1EF4 A;  4M72 A;  2HOT A;  3ZWB A;  3L74 J;  5J8F A;  3V4W A;  3O3K A;  1JT0 A;  5J4Y A;  1P9Q C;  2X6O A;  4LK1 F;  3GTM J;  2FBH A;  2LMD A;  1MMA A;  3ZP5 A;  4AQR D;  1RNL A;  1R58 A;  4HNU A;  1YRL A;  5AW6 B;  1LTT C;  3BQY A;  3C9I A;  1AVY A;  2N9B A;  5DS9 A;  1E5W A;  1S8N A;  4HV6 A;  1A31 A;  2DOF A;  3H3Z A;  3TOA A;  5H20 A;  4RDU A;  1LTA C;  4IF4 A;  3L74 E;  4EI2 A;  3I56 P;  2JPB A;  2CUE A;  2DOA A;  2N9Y B;  1WI3 A;  3WHB A;  5DJU B;  3CXH H;  4XOR A;  5FO5 A;  1RI7 A;  1MUU A;  1X79 B;  4RO0 A;  4WXC A;  2GOM A;  1O3R A;  2A5W A;  1XX5 A;  3AAF A;  2XAS A;  3E5Q A;  3HC7 A;  4UUS B;  2R7X A;  3H1H G;  4W80 A;  2HQR A;  3Q9S A;  2COB A;  2K9S A;  1MW7 A;  2XPU A;  1L4A C;  2R32 A;  1N7S D;  3LWF A;  3LAJ A;  4Z2Y A;  4ZTF A;  1MDM B;  2QBY A;  2EIK H;  1E2X A;  3HE5 A;  1DPR A;  3IH3 A;  1AQT A;  4MQ9 F;  4BUP A;  5L3G A;  3VOP A;  4IFD K;  2EWN A;  2N1T C;  3ULK A;  2IGO A;  1T56 A;  3VYR B;  3MAJ A;  5JE8 A;  5D5U B;  5CVR A;  2KKO A;  1BW6 A;  2FBI A;  2YU9 J;  1NKZ B;  2XKO A;  2YO2 A;  3PH0 A;  5F64 A;  3SZT A;  4BHC A;  2E60 A;  5KLI B;  3Q5R A;  2PAJ A;  5JR3 A;  5L3C A;  3AE6 C;  5CJ0 A;  3JRG A;  1IXC A;  2V9V A;  3ELK A;  4BNC A;  3A7O A;  4QLC U;  2VE9 A;  1H89 C;  4PK4 A;  5AVV B;  3SFZ A;  1KIL B;  3PL8 A;  4W7Y A;  3E0J B;  1XCV A;  1A6Q A;  3PO3 J;  2V7Q H;  1BIA A;  2LP0 A;  3NWT A;  1FP2 A;  2F6C A;  3O2P E;  4ZYH A;  4HF2 A;  3LSM A;  5CCH A;  4W97 A;  3X2Q H;  1SFX A;  4UHT A;  4E70 A;  1W36 C;  3MOG A;  1P7J A;  1FC3 A;  2CWE A;  3SZG A;  2OCC H;  2DA1 A;  5B66 C;  1SAX A;  1F12 A;  5A9S A;  3QH9 A;  4FE4 A;  2GA1 A;  2R93 J;  1VQ5 I;  2AXT E;  2Y31 A;  1MBK A;  2WSC J;  3MD0 A;  1IRF A;  1OQY A;  2X1E A;  1U8B A;  4ENN A;  3ABU A;  4X0G A;  3V2Q A;  3I59 A;  3JTH A;  4C3I J;  3ONQ A;  2MD0 A;  1RQV A;  2Q3E A;  5FFZ A;  2YMY A;  3HD7 B;  5FKL A;  2NOG A;  2EFO A;  3KLN A;  3BPV A;  3FX3 A;  4MNU A;  2HDD A;  2GM4 A;  5C4J J;  3H1K D;  4UB6 C;  2WPV B;  1FC2 C;  4M9S A;  4WVZ A;  4UB8 H;  1S9H A;  1HOM A;  4RGS A;  3CJT B;  4JQF A;  2X1C A;  2BBY A;  5TJH A;  4ZC3 A;  3P9I A;  2G0E A;  3OOP A;  3PRJ A;  5C39 A;  4A3E J;  5DD4 A;  4XA4 A;  4PSW A;  3F89 A;  2Q5U A;  3TW7 A;  2GXG A;  2VL8 A;  1KU7 A;  5GAH J;  3E7L A;  2YKQ A;  1P92 A;  2Y0S A;  1S5L C;  2F5D A;  4XOP A;  1F4K A;  1LTJ C;  3MIW A;  3LFU A;  2BCC E;  2KSE A;  3V42 A;  1XMA A;  1QZZ A;  1GU4 A;  1FIA A;  2QRX A;  5J47 A;  2K9J B;  1QBJ A;  3G9R A;  5AW5 B;  2AQF A;  4HF0 A;  4BHB A;  3PID A;  1F5T A;  1NJI Q;  4ZDP A;  1QGP A;  4HB1 A;  3ZOB A;  2GOX B;  1NO4 A;  1T8Z A;  1I39 A;  1M75 A;  4R1H A;  1TQP A;  2BXY A;  3FIW A;  2KFD A;  1CF7 B;  2R92 J;  1OYI A;  3WTX C;  2KSJ A;  2DPU A;  1MMS A;  3IF4 A;  4IM7 A;  1HXD A;  2CFO A;  4II2 A;  5GP9 A;  2JUG A;  3ZWC A;  1OYW A;  3AEE C;  3S1K A;  3CCU P;  2IBZ D;  1P84 H;  1SQP G;  2G7U A;  1UHW A;  2BYV E;  1JHH A;  4Y13 A;  4JQ0 D;  4GDO A;  1GV5 A;  4YIR X;  2VON A;  1GW4 A;  2GQQ A;  3BZ6 A;  4Y33 A;  4DW6 A;  3HM5 A;  1XGN A;  1KMI Z;  1MD0 A;  1YI2 I;  1STZ A;  5GAG J;  4KN4 X;  1PUF A;  2ZFC A;  1U3E M;  2VI6 A;  3JRB A;  3C2G A;  5LHI A;  5AVT B;  1WCM J;  2LR8 A;  4NPF X;  5JFR A;  2R7S A;  3V2R A;  4QPQ A;  3VMA A;  1OCZ H;  5TIS H;  5KHD A;  4P5O A;  3BR2 A;  3GYH X;  1DPU A;  3F6V A;  1DD4 A;  5FD5 A;  1WHU A;  1YIO A;  5LRS A;  3VOD A;  2ZJP F;  2NPS B;  1ZCJ A;  2K85 A;  3KFW X;  1S6L A;  2DMN A;  3WE2 A;  3LSK A;  3FXD A;  1P4W A;  1Y1V J;  1SQX K;  3RQ4 A;  4LLN A;  5AIQ A;  4CYC B;  1NH4 A;  4IOC F;  2DTR A;  1FDI A;  4PV1 D;  4DT0 A;  3HE5 B;  2YNY A;  2K1A A;  4OQY A;  1VQ5 P;  3AFH A;  1EH8 A;  1JTX A;  2KXP B;  3VSK A;  5APQ A;  2DFE A;  1M56 D;  2BGC A;  1D0X A;  3EQL F;  1ZOY C;  4BDZ A;  3BCC J;  2P67 A;  3AE5 C;  2R3S A;  3JSV C;  1KU3 A;  2Q8K A;  3J7Z I;  3AEC C;  1VFC A;  2GZW A;  2KMU A;  1B8I B;  4MEY F;  3B5N C;  5APX A;  4R1N A;  2QZ8 A;  4N3Y B;  2MSY A;  3KQG A;  4ZH4 F;  3AE1 C;  1RZ4 A;  1YS6 A;  2I9P A;  4KIT B;  1NU1 K;  2WZ7 A;  3O8Z A;  1BOB A;  3Q9V A;  3LOC A;  5AON A;  1YIJ I;  2HVS A;  1BG6 A;  1CGP A;  1K4T A;  2D1V A;  2QE7 H;  3RK2 D;  3ABL H;  3OIQ A;  3K1M A;  3TGU E;  5E20 A;  4B3I A;  4ESF A;  4CIC A;  3GF3 A;  1G3S A;  2M2E A;  1I3Q J;  1WWX A;  4LJZ F;  3AE9 C;  2BHY A;  2W84 A;  4UB6 E;  2E71 A;  5D8K B;  3OYJ A;  1E17 A;  3K0L A;  3AL0 B;  2JMW A;  3AEA C;  1IXR C;  3SQN A;  1SQX J;  3FBN B;  5TIS E;  2A6E F;  2M3A A;  2QVO A;  5E3O A;  3C1L A;  2JQ7 A;  1FBS A;  1LP1 A;  1JY2 O;  4Y99 C;  3MUD C;  5GTI E;  2L9R A;  3TO9 A;  3O8G A;  2I8D A;  1GXP A;  3KLO A;  5IYD J;  3H1C A;  4BAC A;  2XGX A;  1MKM A;  2EA2 A;  4G9Y A;  2OCE A;  2CG4 A;  2XUB A;  4F91 B;  2YU3 A;  3V7C A;  5KAF C;  4D1Q A;  4MHG A;  4BBR J;  3A0B C;  2R7R A;  1KIL A;  2IPP A;  1XDU A;  3AKZ A;  4ZTJ A;  1NTC A;  3CES A;  3H1I J;  2D1H A;  3T0Y A;  4PD4 E;  2X6X A;  1KV4 A;  1QZE A;  1T0F C;  5M5X J;  4CH7 A;  5B1B H;  2MJZ A;  1IFM A;  1RH5 B;  2WB1 A;  2HXO A;  2OFP A;  4KMF A;  1VND A;  4PD4 D;  4BJT A;  3U1C A;  3F8F A;  4AWX B;  3CWB J;  4RAY A;  2A6T A;  3B02 A;  1HST A;  1LFB A;  4LK0 F;  3SHF A;  1W5C C;  2L9S A;  2CQQ A;  1MND A;  5JLW A;  2WWY A;  2IFM A;  5K5G B;  4H13 B;  1S4X A;  2LY1 A;  1JCC A;  4A3I J;  4D6T J;  1KGS A;  3ZDM A;  5FLX Z;  2VN2 A;  1T95 A;  2AXC A;  2HOD A;  5ED4 A;  3M91 A;  3CF2 A;  4ASW A;  4UVC A;  1EH6 A;  1T38 A;  1PGJ A;  2WTY A;  2DW4 A;  4A93 J;  1HKQ A;  1J1E B;  3I4N J;  1V54 H;  3R60 A;  2Y69 H;  1OW6 A;  2M7A A;  3OR2 C;  4AD9 A;  3CC7 P;  1JO5 A;  4M74 A;  2KRF A;  3P7N A;  5FGM A;  4KIS A;  4C46 A;  4M3G A;  3M06 A;  1R6R A;  1FIP A;  2H6C A;  3FXO A;  1NTK E;  3RK2 C;  3EFF K;  4Y99 B;  2WSC H;  4XSZ F;  4RA2 A;  2OU2 A;  2DW3 A;  4FET A;  1JM0 A;  3HD7 D;  3L71 J;  3NAR A;  3BR6 A;  1JUS A;  4FIS A;  4A3F J;  1SFO J;  1UMQ A;  3CPW O;  1M2W A;  4WY4 C;  2XVC A;  3M9B A;  4DYR A;  3ZRG A;  2LTP A;  3VYT B;  1B9N A;  1G3T A;  5AW2 B;  2HOS A;  1S29 A;  4P9F A;  3TED A;  1X1B A;  3OAK A;  2ZFW A;  2H6B A;  4EGY A;  3AEG C;  2EFN A;  3VMY A;  4RB3 C;  4CDG A;  2X48 A;  2PG4 A;  3BG6 A;  1KYO I;  1L0L D;  3CWB E;  3VB2 A;  5E3M A;  4XKV A;  1J2J B;  1RE4 A;  4V2F A;  1FS0 E;  3WUT A;  1HW5 A;  2IYO A;  1FPQ A;  4OMZ A;  4BU2 A;  3CO7 C;  3W2W A;  5B66 H;  1KN7 A;  2E5N A;  3II6 A;  1U0J A;  2K9N A;  3RGU A;  4IZZ A;  4BXF A;  2F5V A;  4M6X A;  1RE4 C;  2VXZ A;  2JVH A;  1SQQ G;  1ZG3 A;  4CYD A;  4DJA A;  3CUQ B;  4BL0 B;  4HQM A;  3TF5 A;  4AIK A;  4WF2 A;  3BQZ A;  3L2W A;  3AEB C;  1G3Y A;  5FRN A;  3G0O A;  1B1B A;  2OZU A;  4KUE A;  1FOX A;  5LHH A;  5EF6 A;  2E2H J;  2V9K A;  3L75 E;  1YW7 A;  1MDM A;  2CFX A;  2ZSI B;  1Y8R B;  1WH7 A;  2OTK E;  2PFX A;  3AL0 C;  3MGN A;  2VT2 A;  2H8W A;  3CDL A;  3ADP A;  3CCL I;  3DCF A;  1ENH A;  1FAV A;  1IUY A;  3L71 E;  1D1C A;  1V4R A;  1W5T A;  1AKH B;  1XS9 A;  4PD4 I;  1AU7 A;  3ROU A;  1RUN A;  5DCM A;  2O01 N;  1PDN C;  5EZH A;  1R22 A;  1P84 I;  1YYC A;  1Y0U A;  3F23 A;  2R3C A;  2MW8 A;  5CCG C;  1JNM A;  2HDW A;  3QU6 A;  1BM9 A;  1B59 A;  5E1X A;  1JOC A;  5MGB A;  3MUD A;  1NTK G;  4B86 A;  3FWE A;  3RZO J;  1SD4 A;  2NAZ A;  2NXN B;  3SWF A;  4ZDO A;  4FE7 A;  4XLN F;  1JY2 N;  2CK3 H;  1OYY A;  4OAY A;  3HD7 C;  5HS9 A;  3H1I D;  2QBY B;  2IDB A;  4ENJ A;  4LB6 B;  2M3E A;  2Q6Q A;  1RPW A;  3W3C A;  3QYB A;  3IQD B;  3HHG A;  2V1U A;  4KJM A;  3KDP B;  4IL6 H;  2OQQ A;  4BGD A;  4FX0 A;  2BY2 A;  1GXQ A;  3ML6 A;  3CLQ A;  3JR9 A;  1ZN2 A;  3E6C C;  2AEM A;  2IAI A;  4I2L C;  2E35 A;  2HZT A;  3FKJ A;  3HOX J;  1HJB A;  4GRI A;  2P7V B;  3ECO A;  2P58 A;  1F9N A;  3OYI A;  2CO5 A;  5E3N A;  3HPH A;  4PZC A;  1NU1 E;  1K04 A;  1GV2 A;  5CJ4 A;  1TT0 A;  4M3F A;  3K1N A;  1N1G A;  2BW3 A;  4PFO A;  1YIT P;  5E79 H;  4E7S A;  4FAS D;  3BG5 A;  3TO6 A;  2G8Y A;  3A0H E;  2MLG A;  4DZO A;  2L7F P;  3A02 A;  3BDD A;  1RRJ A;  3KZI H;  2QF7 A;  4H0L C;  2K4B A;  5AW4 B;  3ZCO A;  1SAN A;  5TRD A;  5HOD A;  1RET A;  1MIJ A;  1P6R A;  1ZTR A;  2RKH A;  5IYC J;  1YJ9 I;  2FA5 A;  3AE8 C;  4WB4 A;  3TK1 A;  1QRY A;  2EQR A;  3U2R A;  4PUS A;  1JJ6 C;  4E7J A;  1LE8 B;  2KLU A;  3GXO A;  2M1B A;  2OQG A;  4GYG A;  1LTG C;  1HCR A;  3SWK A;  3ZQG A;  3DTE A;  3L70 G;  3H1K E;  2PMU A;  4RLQ A;  3V7S A;  4F93 B;  4ESB A;  2CGP A;  4RKU J;  4ABZ A;  1IFJ A;  4LIV A;  1YJ8 A;  3KCC A;  1LUJ B;  4FQG A;  2CRG A;  4FTH A;  4PDK A;  1A04 A;  1GUU A;  3I56 I;  1EXJ A;  1N78 A;  1Z7L A;  4HQE A;  5BNG A;  3H3V K;  1L4A B;  2VQL A;  2FUG 2;  4OU0 A;  3L2U A;  4IX7 A;  1B72 A;  5KLV J;  2GIV A;  1Q1V A;  2KL4 A;  2IT0 A;  3CZ6 A;  4A3D J;  3VP8 A;  2EIL H;  2LXC B;  3K1P A;  4CCM A;  2H09 A;  3LID A;  2UV1 A;  4MLO A;  1FZA A;  1CI6 B;  3L72 J;  4J00 A;  4BRY A;  4PV1 B;  4XLA A;  4CCL A;  1F43 A;  4BXU A;  5AYV A;  2IGM A;  2OAR A;  4N0B A;  1M67 A;  1XB4 A;  1YW9 A;  4IL6 C;  5FD6 A;  1OMI A;  1ZHF A;  2K9M A;  4Q48 A;  3CD6 P;  1LSJ A;  3MQ0 A;  1HF0 A;  1YLF A;  1UG0 A;  5HLG A;  2JP3 A;  3CCM I;  2K9J A;  3KXD A;  2CYY A;  1F17 A;  2KJB A;  3SJM A;  5E79 E;  1FY7 A;  3BY6 A;  2LY2 A;  1ONV A;  3EDP A;  3ZQL A;  2C0W A;  3FXU A;  3RTR A;  4DZP A;  3OR1 C;  3A01 A;  3UR3 C;  5KLV G;  3LA3 A;  5JHU A;  2LFB A;  3BPX A;  3TNU A;  1VQ9 P;  4J19 A;  3TGU J;  2N1T B;  4A3C J;  2F5E A;  2EFQ A;  3EUK L;  2B89 A;  1IDY A;  2DBB A;  4GDF A;  1BE3 J;  4KIC A;  3DP7 A;  3L75 J;  2ZC2 A;  2VJ4 A;  5KJ7 A;  2HKX A;  1NTM D;  3CCQ I;  3CX5 D;  2OTL I;  3I5U A;  4RGU A;  3B71 A;  3OYB A;  1Y47 A;  1LNQ A;  4OIQ F;  1KQ0 A;  1MBH A;  1KFN A;  3U1K A;  1UAA A;  1ULY A;  3FWL A;  4R8H A;  3I64 A;  3KPH A;  2UWJ E;  3GCM A;  3K9T A;  2LBF B;  4G7H F;  2E76 B;  2ZB9 A;  1UII A;  5JVG F;  1X1C A;  2X0L A;  1RF1 A;  4KT5 C;  3GHG C;  4LFU A;  4L73 A;  2RNJ A;  2E76 D;  1X9V A;  2D2C C;  5FKM A;  1VQK I;  2E74 B;  4ZYG A;  4OAZ A;  4MFE A;  4I09 A;  4L9T A;  1P84 E;  2ID3 A;  3A03 A;  1TNT A;  4GOF A;  2ECC A;  3PM1 A;  1DLI A;  2FJ1 A;  4B3J A;  3ERE D;  2Z5I A;  2FX0 A;  3H5R A;  1VQL I;  4LD5 A;  4D3F A;  1QL1 A;  1W2E A;  2H89 C;  4UB8 E;  5B3S H;  1HBX G;  3TL4 X;  1DP7 P;  1WT6 A;  5APU A;  1TWF J;  4C3H J;  2VOP A;  2Y75 A;  1EXI A;  3CC2 P;  1SMY F;  4PFP A;  3J80 K;  3ASO H;  1RR8 C;  1SQB G;  3LQR A;  3IR9 A;  1U9O A;  2DT7 B;  5F1R A;  1FT9 A;  3ZQI A;  2Y0C A;  2AO9 A;  3C3W A;  1GHC A;  3EYI A;  1LP1 B;  3OWT A;  4M73 A;  1ZR2 A;  1VQL P;  4IQ4 A;  4KFC A;  1OVU A;  3DBH B;  3EWK A;  2FXA A;  1GD2 E;  2FMY A;  1TXG A;  1X2N A;  2JJ7 A;  3H5N A;  2ESN A;  3CME I;  1QX8 A;  1QO0 D;  5KAI H;  1SEU A;  1ACI A;  2KOG A;  3ZQH A;  5BQT A;  3RQI A;  3OYE A;  2XAU A;  2XPW A;  3RYR A;  2GF2 A;  2QKM B;  3IH4 A;  3W2V A;  3K4K A;  4I2O A;  3SDB A;  1SVL A;  5A9S B;  4WWC A;  1EDL A;  2QSG X;  2ZVN B;  3ZMZ A;  4X6A J;  4G12 A;  2M5W A;  3T97 A;  2VPR A;  1UCR A;  5CVU A;  4K3A A;  3F8C A;  4D7N A;  3FK6 A;  1BOA A;  4DBR A;  1A35 A;  2RDP A;  2ZXH A;  2NVT J;  2WQY C;  3ZQF A;  5IP6 A;  1WMK A;  4XBF A;  2V4J C;  3FBI B;  1IG7 A;  3C7D B;  4F52 A;  3GG2 A;  3FM5 A;  3WG9 A;  1B8I A;  3KZI E;  1FJL A;  2M4G A;  3ABK H;  3BCA A;  3FXL A;  4E6K G;  3D1N I;  4GOD A;  4D6T G;  1KON A;  2L54 A;  2VC0 A;  3E5U A;  2HKO A;  1VQ8 I;  1MMD A;  3A2K A;  1UST A;  2WIT A;  2NVU B;  2QEX I;  1T6S A;  1Y6I A;  1DU0 A;  1Y9B A;  2O01 H;  3C2B A;  1NTK K;  3H1I E;  2LF7 A;  4PGG A;  4MTE A;  5BU5 A;  4HLY A;  3OYA A;  4FX4 A;  1MFT A;  2NPS D;  3WFJ A;  3WTZ A;  2EFP A;  2FBW C;  1LVA A;  3OBB A;  4BAY A;  1LFP A;  1J1D B;  2IYP A;  5LHG A;  3H32 A;  2KRH A;  3E6M A;  1FTZ A;  4EJW A;  3EQ2 A;  1VZ0 A;  4WX9 A;  4CCK A;  4PCQ A;  4HDU A;  2JTV A;  2V4H A;  2XAH A;  3OYD A;  4G8X A;  1BI2 A;  1YX3 A;  4OIN F;  2HEO A;  4HF1 A;  3K5B A;  4LG0 B;  2XZR A;  2H7H A;  2K27 A;  1UJ8 A;  2XSD C;  4ZKU A;  2KP6 A;  5H6R A;  2QA4 I;  2E5T A;  3CWB G;  3CJQ B;  1RE3 C;  3CCE P;  5LGT A;  3VYU B;  4IVN A;  3FGA D;  4XKW A;  1RY3 A;  2PP6 A;  5A9R A;  2CJJ A;  2LYC A;  1JKR C;  4W7Z A;  1USS A;  2W85 A;  1WJ5 A;  2HPI A;  1BW5 A;  1NTZ G;  1Q1H A;  4AC0 A;  1LDD A;  1DDN A;  1SQQ K;  5DEQ A;  1SQQ E;  3S4R A;  2XF6 A;  3H9J A;  2R5Y B;  1USD A;  2FD5 A;  2V9P A;  2WY8 Q;  1HH0 A;  2BY3 A;  3QPL A;  3FK7 A;  3RDI A;  3OJA B;  1K9M Q;  3CCE I;  1GL2 C;  1FDM A;  3TDK A;  1JB0 J;  1SQB K;  1X3W B;  4DZJ A;  1U2W A;  1D8K A;  5EZG A;  2UWM A;  1LVK A;  3RPQ A;  1T3U A;  3JC2 2;  4N78 D;  3M0A A;  2H43 A;  5LBQ A;  1FE6 A;  2COM A;  2WAQ A;  5EGO A;  4E7L A;  1I36 A;  2WSE J;  4QMA A;  2MC4 A;  2LG4 A;  4P55 A;  1OIP A;  1MMG A;  2KDO A;  4IO9 F;  3MHV A;  2O61 A;  4N78 E;  1QPI A;  1Z0X A;  3A1Y A;  3H25 A;  2QG4 A;  1AA7 A;  2HOD B;  1G59 A;  1WKM A;  1Y8Q B;  2K88 A;  1FOS E;  3TSI A;  1Y0N A;  2A07 F;  3GZ5 A;  1Q2N A;  2XPV A;  4C3J J;  2IJL A;  2W1O A;  2KIU A;  2P6S A;  3BR5 A;  4QSH A;  3WU2 E;  2HWV A;  2Y48 A;  5ICG A;  5BPI A;  1LEB A;  2NPS A;  4WCG A;  3E1I A;  5HS7 A;  1LB2 A;  2F5C A;  1UHS A;  3P9K A;  1TZL A;  5BS6 A;  3H1I G;  4L9N A;  1BCC G;  1QVF O;  4HLX A;  4XRS G;  1HA8 A;  2CPB A;  1A6I A;  2MKV A;  1N7S C;  3Q0U A;  4HH2 A;  2X51 A;  5D8L B;  2Y0S N;  3E6D A;  2HLO A;  1H0T B;  4II3 A;  2XAG A;  2XV5 A;  1LFU P;  2A45 G;  2J59 M;  2LXB A;  3WTU C;  5GTI C;  3K70 D;  1NU1 D;  4B3X A;  1OKR A;  5BPD A;  3OYF A;  1E0E A;  3L70 D;  1FZB A;  5KAI C;  2KUB A;  1PFI A;  2ETH A;  4AVP A;  4HRI A;  3VYS B;  2JWT A;  2MC3 A;  2HR3 A;  2K9L A;  3IKV A;  1RF1 C;  4PJ0 E;  2P5K A;  3RQS A;  2W24 A;  1NAY A;  3A0H C;  3GEZ A;  2L01 A;  4G6Q A;  3WGH A;  1FOW A;  4NPE A;  1QPM A;  5IOY A;  1FZC C;  1VQ7 I;  2IBZ I;  3HRS A;  1UFM A;  5GAD J;  2G9W A;  3H5A A;  5J1Y A;  3GW2 A;  2OUM A;  2VJJ A;  3D71 A;  1Z9C A;  2YIU C;  3L72 D;  2FFD B;  2PX9 A;  3V8K A;  2K9Q A;  5CVI A;  1YHQ I;  2QSF X;  3TP0 A;  4I98 B;  1MFZ A;  2P4Q A;  2OTJ P;  4XRS A;  2BHZ A;  1FJK A;  4M3E A;  1SC7 A;  1S5L X;  1VQ4 P;  3LSI A;  3FR8 A;  2LLK A;  2JSP A;  1MZ9 A;  2XNX A;  5A9T A;  2YUS A;  1PP7 U;  4ASV A;  1VQ8 P;  3M8E A;  3LST A;  5K5Q A;  2KNC A;  1MV8 A;  5EEG A;  2Q0O A;  1HSJ A;  4N4N B;  3VYI A;  1YI2 P;  2UYY A;  2O1K A;  2KB7 P;  3OYL A;  2E1M B;  2QM7 A;  3EFG A;  4R4M A;  3T97 B;  1ZRE A;  3GTK J;  4TT3 H;  1NK3 P;  2D45 A;  1IN6 A;  3DEE A;  5HS8 A;  2GUV A;  4RM2 A;  5LEK A;  2W48 A;  2DMU A;  1PYV A;  1CZQ A;  2V7F A;  2ZVO B;  2VLA A;  3C8V A;  4BDY A;  3KPE A;  3I59 B;  1BCC E;  1U5T B;  1LTI C;  5CQG A;  4A69 C;  2CSO A;  1UZC A;  2B9S A;  4WY4 B;  4UY8 I;  5F0C A;  2BW3 B;  2Y0E A;  2NRG A;  1PGO A;  3FHN A;  1L0N J;  3PJR A;  2YSR A;  3GHG A;  1R8E A;  4OOI A;  4JYK A;  4XID A;  4CA0 A;  2A3S A;  1BR1 A;  2B63 J;  1YB4 A;  5M3M J;  2K7L A;  1URQ B;  4HNV A;  4YCA A;  1K6Y A;  2KI7 B;  3OY9 A;  2ZME B;  2XC7 A;  2JR8 A;  2PMH A;  1H88 C;  5GTH H;  1PPJ D;  2QLZ A;  5LEJ A;  1W0T A;  3SZP A;  3KEY A;  2DFH A;  2VC1 A;  4EZB A;  1LE8 A;  3SYT A;  1PGP A;  1M7L A;  3GUD A;  2B87 B;  4NPD A;  2B9B A;  2L5G B;  1EZV I;  3OSF A;  5KKZ C;  1S72 P;  4YPC A;  1POG A;  3HHH A;  3G4S P;  4BY1 J;  2VQG A;  1YS7 A;  2ECB A;  3A01 B;  3RL0 g;  3KZZ A;  1L0N D;  3H2Z A;  3CCJ P;  1BE3 E;  3S16 J;  2G3A A;  3RI4 A;  5L8R J;  4M6Y A;  3F22 A;  1QA6 A;  5HDG A;  4C30 A;  3NMD A;  4RLF A;  1RF0 C;  2F4I A;  4I76 A;  5K1Y A;  1B6A A;  3CO6 C;  3PFY A;  2YX4 A;  2H8R A;  3G71 P;  1NG6 A;  5AW7 B;  1JMM A;  3WGG A;  4YFK F;  2QJK C;  2CU7 A;  2VE8 A;  3IFM A;  2R5Y A;  1M90 Q;  1XPX A;  3BR1 A;  2EA4 A;  1R1T A;  1YJW I;  1X0X A;  2BV6 A;  3S2W A;  2WV1 A;  4HAM A;  3VPR A;  3QOE A;  4ZYD A;  1DD3 A;  4IPA A;  4RMN A;  3Q5F A;  3L6D A;  2ME0 A;  2QYO A;  4UVA A;  3RK2 B;  2IXS A;  1TTY A;  2LK2 A;  3RBZ A;  2QKL B;  2EJR A;  3P9C A;  2FXO A;  3TDZ C;  4PJ0 C;  2IS2 A;  1IRZ A;  4D3S A;  1NKN A;  4LIT A;  4E12 A;  2W6A A;  1YX5 A;  1D1B A;  1X1A A;  2TDX A;  2C6Y A;  4P96 A;  1VQO P;  4BH9 A;  1O3T A;  4IOA F;  3BCC G;  2E74 D;  1V3F A;  1BBY A;  1QEX A;  1Z91 A;  1URQ C;  5E1Z B;  4HYE A;  3H0D A;  3L74 D;  1IW7 F;  1VPD A;  1M76 A;  2X1D A;  4KT0 J;  3CMA I;  5GTH C;  2Z5H A;  3HYI A;  3WE3 A;  3OS1 A;  4OGQ B;  1GZL A;  1Z77 A;  4LGD E;  1VQM P;  1NWQ A;  2VBX A;  2LBF A;  5HDK A;  2E74 C;  3F72 A;  1M8O B;  4XON A;  1TWG J;  3MEX A;  1F14 A;  3JRI A;  3CQZ J;  1ERD A;  4JX6 A;  1TQI A;  1PGN A;  1LQ1 A;  1J7K A;  4I0A A;  3GTG J;  1L4A D;  4XRM A;  1SFC A;  5CBN A;  2OD5 A;  1XN7 A;  2WB1 N;  3BCB A;  2M5A A;  4BQA A;  2DCE A;  3R0A A;  4Y3O A;  5LGN A;  5FKK A;  2FE3 A;  2EH3 A;  1K73 Q;  3JRH A;  2CQK A;  2VJ5 A;  3HPG A;  5D4R A;  1D8J A;  1FJP A;  2WBM A;  5KNL A;  3RBX A;  3A2A A;  3I58 A;  3OYN A;  5E17 F;  3WTV C;  1JDJ A;  3S17 J;  4PZE A;  1EDK A;  2QJP B;  3QWL A;  3KP4 A;  3NXS A;  2HFH A;  3IUO A;  1YRN A;  3VDX A;  1PL5 A;  1OCO H;  1ZQ3 P;  3LFK A;  2HFE D;  4KUH A;  1RQU A;  3PDU A;  5F04 A;  4ZYE A;  3H36 A;  3V5B A;  3LMM A;  2JWA A;  3KP5 A;  1S72 I;  5FJ8 J;  2J5P A;  4HSR A;  3WHC A;  3JRC A;  3CC2 I;  2EV6 A;  3BTJ A;  1ITY A;  4NC8 A;  3P8M C;  2BE5 F;  1IXS B;  3I55 P;  1ZME C;  1OIS A;  3CCJ I;  1QGK B;  2EPF A;  3HG9 A;  1FP1 D;  1A5J A;  4Y52 J;  3EUA A;  3PTZ A;  3ZQQ A;  1SVO A;  1B4A A;  2CH0 A;  4BJ5 C;  4ESJ A;  3GX4 X;  3HSE A;  2Q7C A;  3N4M A;  4N9I A;  2ZKZ A;  3EPZ A;  3GHG B;  2DA2 A;  2XV4 S;  1G2C A;  3BCC D;  3IC7 A;  3H32 B;  5CHX A;  1YQ3 C;  1URQ A;  3FHZ A;  2Q1Z B;  2JDI H;  2VAS A;  2R7T A;  3PSI A;  1EZV E;  2WPS A;  3UIA A;  1L0O C;  3V2N A;  2JT1 A;  1X1P A;  3QYF A;  1XG1 A;  4XLC A;  1T08 B;  1BL0 A;  2IS4 A;  1NHA A;  2EV0 A;  3ZGY A;  2FY8 A;  2P5L C;  1L3L A;  2F48 A;  1Z7U A;  3HB9 A;  3BAS A;  3MZW B;  2Z5U A;  3D5L A;  3EGO A;  3SFD C;  1WDL A;  1TW2 A;  1I5Z A;  1HDP A;  2D2C D;  1MBE A;  1PZQ A;  4KIG A;  1G1I A;  4JYB A;  3BTI A;  3HUG B;  2P8T A;  2YPR A;  2BCC D;  1P2F A;  3D6Y A;  2CW7 A;  3GW6 A;  3KET A;  4TLF A;  3ESW B;  2E5Z A;  2QEN A;  5IOZ A;  2D3T A;  1R7J A;  1TWC J;  3L2C A;  2JKV A;  3D0S A;  4LOC A;  5EDN A;  1NTM K;  4HBL A;  1DP3 A;  3GO5 A;  3G1M A;  1U5T C;  3I3L A;  5DM7 F;  1MNM C;  4KYW A;  3B8E B;  2LVS A;  2A68 F;  3HE4 B;  3KP2 A;  1R36 A;  3WTW C;  2DMT A;  4H4K C;  4G6D A;  5K5O A;  2JK3 A;  5J6X A;  1FSH A;  3OYH A;  2OYI B;  2PLA A;  3W6U A;  2LKS A;  1LWU B;  2H88 C;  1LDJ A;  3HUS C;  2H1K A;  1YJN P;  4JBZ A;  2M34 A;  1S7O A;  1RKW A;  2W7N A;  2WC2 A;  2KIS A;  3I53 A;  2IS6 A;  1J09 A;  3A0H H;  1ZYR F;  2E1M C;  5AVU B;  1GU5 A;  1GK6 A;  3LL7 A;  3G3Z A;  5AVX B;  1ZRT D;  2WSF H;  2FQ3 A;  2WAF A;  3HKZ N;  1SMT A;  2DT6 A;  1TWA J;  4U3F J;  2V26 A;  1N7S B;  1FOS F;  4D3D A;  5J3L A;  4GWG A;  3A4C A;  1FEX A;  3ISP A;  2CQN A;  1V5G A;  3OYC A;  3FMS A;  1QHH D;  4KIB A;  1R5I D;  3MCZ A;  1C0W A;  3PJG A;  2KLV A;  3AG4 H;  4XR6 A;  3RKY A;  3ZMD A;  3BRT B;  4OL9 A;  2KPM A;  4KA4 A;  3GWZ A;  3M1C A;  5CVJ A;  5CCH C;  3H1J G;  4BEH B;  3RKQ A;  2K4J A;  2Y0D A;  1KQ8 A;  4E7I A;  1N25 A;  2DFI A;  3TGN A;  2WT7 A;  2FOW A;  1JY3 N;  3W6V A;  1R1U A;  4RAZ A;  2PI0 A;  2H8P D;  1ZG5 A;  3L73 J;  3JRE A;  3R61 A;  2VQH A;  4IKF A;  1BSH A;  4I01 A;  1AVO A;  3L1P A;  4B1R A;  1QVU A;  1ZLK A;  3KHU A;  1LKX A;  1HBW A;  2UXN A;  2Z9O A;  1QZY A;  2JA5 J;  1KIL C;  2WPQ A;  4RS8 A;  3MZH A;  5APT A;  2HZD A;  3JSO A;  1FZP B;  5IT9 Z;  1HKT A;  1KZH A;  2C0X A;  3F5H A;  3AE7 C;  5F1J A;  1XDS A;  3C7A A;  1IK7 A;  1WRG A;  4QIW N;  2BCC G;  2M4K A;  3I5C A;  1KYZ A;  2I5U A;  5GAE J;  1KIL D;  5D5W B;  3COA C;  3FM3 A;  3J7Y J;  1NAF A;  3F3X A;  1V55 H;  3FXE A;  3TDU C;  3PUB A;  1MJ9 A;  5L3F A;  3G4S I;  1PUF B;  3DPU A;  1HC8 A;  5H2F E;  1NG7 A;  4U0Y A;  3L37 A;  2WA0 A;  3OIO A;  3V8J A;  1ZV8 A;  4GOE A;  3JAM K;  2DA7 A;  3BG7 A;  1SD6 A;  2DA6 A;  1IFI A;  2P7J A;  3TGU D;  3WU2 C;  3GFJ A;  3UKG A;  2LOO A;  1YVE I;  2EZL A;  4NQW A;  1U7M A;  3Q5S A;  2KZV A;  4CO8 A;  4S04 A;  1BCC D;  4KMU X;  3SFE C;  4IHV A;  2B7E A;  2ZYG A;  4OGQ D;  1FU1 A;  1U78 A;  3VMX A;  3LQQ A;  1P84 D;  2I10 A;  5M1B A;  5DUI A;  5HOO A;  2R5Z B;  3I55 I;  2FSW A;  4Y4R A;  4DGW B;  2XIG A;  3D5S C;  2XAF A;  3GFI A;  3H9G A;  1WVR A;  2RN0 A;  2LC2 A;  2E34 A;  5EG0 B;  3WTT C;  1W5S A;  5LD2 C;  3S2D J;  1J0R A;  2M7B A;  3OS0 A;  1CW5 A;  1NTM G;  1PPJ E;  4CCJ A;  4OGQ C;  1CQT A;  4EVI A;  1O4X A;  2PJR A;  2XHK A;  3GTL J;  4Q47 A;  2M0B A;  2KK7 A;  4I7Z B;  1T2K D;  1HLV A;  1QVG O;  5F0F A;  5FRO A;  2JA8 J;  2EFW A;  1MSF C;  3M0D A;  5AVY B;  5K7H A;  2XSJ C;  2IRF G;  5ICF A;  1AQ5 A;  2AXL A;  1GL2 B;  3BJA A;  5F0H A;  1ETX A;  1J5Y A;  3I54 A;  4AIJ A;  4DLL A;  3JTG A;  3A3Y B;  1XSX A;  4ZJZ A;  3L35 A;  4LC1 A;  1JUM A;  1KB9 E;  4U0V A;  4UVB A;  3DV8 A;  2MYS A;  1ZG1 A;  2VKD A;  2HU9 A;  4IFF A;  1LSO A;  4XE5 B;  1KQF B;  2XDV A;  2JEE A;  3WS7 A;  2P81 A;  4BRY B;  5GTI H;  3USS A;  3H0G J;  4XLH A;  4HPQ A;  3HD7 A;  4D5C A;  1H89 A;  4F3Q A;  3F8M A;  2DI3 A;  4B4C A;  4BYY A;  3M8F A;  4B43 A;  4CGZ A;  2A45 H;  1S1C X;  2TCT A;  4BQQ A;  5TIS C;  4E7Z A;  3JW4 A;  3TOB A;  1R4M B;  4PJL A;  4KUM A;  3PIO F;  2MFZ A;  2QQ9 A;  2P7C B;  3JRD A;  4BBS J;  3TGU G;  2VQC A;  2LH9 A;  3FXK A;  1XMK A;  1W7P A;  1EQ7 A;  3LIE A;  4U3F E;  1AOY A;  1L0L K;  2FYN C;  1W7P B;  3L74 G;  3CX5 I;  5AVW B;  3B5N B;  4GBJ A;  3D6Z A;  1OPC A;  1FZF A;  1QU3 A;  3L4F A;  4U3F D;  1X4O A;  2AEJ A;  3CUQ C;  1XGS A;  4KNY A;  1LTB C;  5APS A;  3DPL C;  2IS1 A;  1BJA A;  1MJA A;  2JRT A;  3HGY A;  3CDI A;  2BAS A;  2OYH B;  1Z21 A;  1EH7 A;  1TBX A;  3K4M A;  2MGQ A;  1UHM A;  1WQ2 A;  1VQO I;  3MTU E;  5TJJ A;  3CME P;  4XN3 A;  4BE2 A;  1D3Y A;  1PP9 G;  4PD4 H;  4M3B A;  3DBL B;  5AW0 B;  2VJI A;  3GFM A;  1TLH B;  2NVY J;  2IBD A;  1IZ1 A;  2R7Q A;  3DKY A;  4NB5 A;  4QTR A;  1FYK A;  2JA7 J;  1SFK A;  3E1R A;  3RCO A;  1L0L E;  1MBF A;  1V5E A;  1JE8 A;  4AU7 A;  2MH9 A;  4BQO A;  4UUS A;  2HG5 D;  1KOR A;  1EVZ A;  2DA5 A;  1IRX A;  4Y7N J;  2QSH X;  2CV2 A;  2DQL A;  4OIP F;  2IBZ E;  3IL2 A;  4H0E A;  3ZWA A;  3Q3D A;  4CPG A;  2E76 C;  3R4Y A;  5HLI A;  2MAB A;  2DJN A;  3IRQ A;  2V1D A;  1X2M A;  1USE A;  2E75 C;  3RYP A;  4OVN F;  5CMZ A;  1QNT A;  1VQ9 I;  4OH8 B;  3Q2Y A;  3OYG A;  1PIX A;  1M1J C;  2QCO A;  2KYV A;  1K4S A;  3BAT A;  5ILS A;  5KKZ B;  4OWR B;  3RK3 E;  1I27 A;  2R7U A;  4V2G A;  2JSC A;  2HS5 A;  3BJO A;  1P4X A;  1JY3 P;  5B5E H;  2GLO A;  1BCC J;  3CCV P;  2DOD A;  1YON A;  3E7K A;  1Q7Y Q;  2C9N Y;  3F0C A;  4MTD A;  3B4S A;  1H9T A;  2IA0 A;  3MVP A;  5IP9 J;  3QP5 A;  4HYT B;  2KZJ A;  3U1A A;  4DOJ A;  1BR2 A;  1FMV A;  4IHY A;  1OWA A;  1D0Y A;  4U3F G;  3DTK A;  3CCU I;  3RKX A;  1R49 A;  2Y9Z A;  4E13 A;  4L5J A;  2XGC A;  4E21 A;  4L0Y B;  1R23 A;  2PN6 A;  5ICE A;  2L7Z A;  1Q90 D;  3OV8 A;  2E43 A;  2GA2 A;  4UXN A;  3J81 K;  2DO7 A;  2ADU A;  3F3S A;  2OPT A;  2PEX A;  2FF4 A;  2IFN A;  1Z1D A;  3BT9 A;  2NZ2 A;  1JTH A;  2W00 A;  2X4H A;  3GMA A;  2M0C A;  1HDD C;  3WOD F;  2POH A;  2L4M A;  4D5F A;  3WMM 0;  5E8G A;  2R7V A;  1PP9 E;  1WJC A;  4K2E A;  1VQP P;  5TGT A;  4RM3 A;  2ZFU A;  4AUX A;  2PGD A;  4S3M A;  3CCL P;  1VQ6 P;  4LIU A;  2QQB A;  4HOB A;  4L9J A;  4YIF A;  2ZNY A;  3JRA A;  3CC7 I;  4G94 A;  2CQ7 A;  1L0L G;  1S9K D;  4JYC A;  2KJC A;  3HJE A;  4O6J A;  1IDZ A;  2L7K A;  4DCK A;  3HTK B;  1N2D C;  4K35 A;  1U9N A;  3WTS C;  3DPT A;  4YEJ A;  4LG0 A;  2JWD A;  4M9X A;  3VSL A;  1VF5 C;  3CCR P;  1S9K E;  3L7W A;  1I50 J;  1ZK8 A;  4BE1 A;  1Y39 A;  5DCF A;  2KP8 A;  1MH3 A;  1AWC A;  1JXS A;  3GHY A;  1IZN B;  3CJN A;  3CL3 D;  5F27 A;  3L2R A;  2V79 A;  2WAQ N;  3K4L A;  5CYV A;  5ICC A;  2GAU A;  3S1Q J;  4L5E A;  3K96 A;  4DJG A;  1YHQ P;  3NEU A;  4M6V A;  4H44 D;  1JUP A;  3F9K A;  1I6X A;  3OMY A;  2W25 A;  4MQV A;  4EQQ A;  1EZV D;  1LJ8 A;  5AVS B;  4BXL A;  5GTH E;  2XU6 A;  3ULQ B;  2FU4 A;  1FSE A;  2WSE H;  5CPR B;  5DYM A;  4D0P A;  1NGM B;  1GDT A;  1R5L A;  1W5C E;  3W6Z A;  3IRR A;  3U21 A;  5LRR A;  1WJA A;  5J4V A;  3RKW A;  5HLT A;  1XSV A;  1VQ6 I;  5C4X J;  5M3F J;  5IT9 K;  4YRV A;  3ABV C;  2ZT9 C;  4KJZ A;  1NH3 A;  4XFJ A;  1JKQ C;  2Z16 A;  3HRM A;  4RGR A;  5BVZ A;  1ZRC A;  3FMQ A;  2VBY A;  1KB9 D;  2RV8 A;  2BEQ D;  1F36 A;  5E3L A;  4LGW A;  2HXI A;  3PEF A;  1YJ9 P;  1T3J A;  1F0Y A;  4HNT A;  5D6E A;  3GME A;  4X1E A;  2KS1 A;  2QEX P;  2E19 A;  3QPH A;  5FB2 A;  1QL2 A;  2ZJR F;  4CZZ A;  1SQV G;  4N4O B;  1JUN A;  3G6E I;  1LTJ B;  4CYC A;  1KIL E;  3D5R C;  3RZD J;  4C2M J;  1SAU A;  2RN7 A;  3I0T A;  1K83 J;  5JI6 A;  2KLO A;  5FLX K;  1BGY E;  3HE4 A;  3KYQ A;  4L76 A;  3RK3 C;  4BEH A;  4Z1M H;  2NYX A;  1WJB A;  2QVA A;  3U9G A;  1UG2 A;  4FT8 A;  4B09 A;  1ZGJ A;  2WPR A;  3JCU C;  3ERM A;  1BC8 C;  4I99 C;  2E1O A;  2W83 C;  4S05 A;  1Y56 A;  2OYH C;  2XGD A;  2CUZ A;  3V4G A;  1NOH A;  5AW8 B;  3HUG A;  1MBJ A;  1BE3 D;  1SVM A;  2R4G A;  3IN6 A;  2IP2 A;  3PJS K;  2XB0 X;  4M3L A;  1PVE A;  2QM3 A;  5CCH D;  3TW6 A;  1PJR A;  3GF2 A;  4N9H A;  5HDN A;  5FLV A;  4I02 A;  1XTG B;  2PRR A;  3N7N A;  4EM2 A;  1NTZ J;  1MBG A;  1Z6T A;  3DEU A;  3HTU A;  2FXM A;  3GF7 A;  4DOZ A;  3CC4 I;  2JJL A;  3ZMV A;  3K4B A;  3K70 C;  2IA2 A;  1N75 A;  3ZGK A;  1R5H A;  3C1D A;  2WSF J;  2CW8 A;  4HW0 A;  2CV0 A;  2GUS A;  1M1E B;  2N8G A;  4P9U A;  4BWN A;  2R44 A;  1Q82 Q;  1FZG A;  2W82 A;  1ETW A;  3HAD A;  1G1J A;  5DCM B;  1D5V A;  1URQ D;  4AUW A;  3R4K A;  3GBG A;  3WGI A;  1E3O C;  1X0V A;  3E5X A;  1ZXG A;  2OTL P;  2KQR A;  1FZC A;  3H9Q A;  4NQW B;  3ZMS A;  2KIQ A;  5ILV A;  1TP4 A;  3HGG A;  2DU9 A;  2ZXW H;  3K4N A;  5M5Y J;  5FLM J;  2M3B A;  4ETS A;  5BU8 B;  3I71 A;  4GWK A;  2BVL A;  1WDM A;  1FDO A;  5CVV A;  4R79 A;  4BXX J;  2AHQ A;  3K4C A;  1JGG A;  1FZE A;  5L3E A;  4YTP C;  1RES A;  4NHJ A;  2Z3Y A;  3BG9 A;  2E5Y A;  3S1N J;  4B47 A;  1EJ9 A;  2JPC A;  6PAX A;  1OCC H;  3HIF A;  2QSI A;  4GGG A;  2IPQ X;  2E2J J;  2EZI A;  3OS2 A;  3QQA A;  4OQZ A;  1WJE A;  3QU3 A;  2QJP C;  5HLH A;  4GIF A;  5KLV K;  2H27 A;  1H0M A;  2DOE A;  1SQV E;  1JMB A;  1GMJ A;  3H1L G;  2JVG A;  3MFK A;  1S7A A;  5CLS A;  4BY7 J;  4OM8 A;  5KAF H;  1KYO D;  2RRE A;  1AFO A;  2LSO A;  1GL2 A;  4A3M J;  1ZW0 A;  4BS9 A;  2WVR A;  4YXW H;  3BR0 A;  3OSG A;  4I0B A;  4XLE A;  4AYB A;  4EV0 A;  4RES B;  4IEJ A;  3LSJ A;  4ZDL A;  5L3D A;  3TQN A;  1SQQ J;  2NS7 A;  2RAE A;  4KN7 X;  1SQP J;  3DF8 A;  5DM6 F;  5EJC A;  2AQE A;  5LFA A;  2WTE A;  3K2A A;  2ACJ A;  1VF5 B;  5F08 A;  3NAU A;  4XKB A;  4YG2 F;  3WG7 H;  3P7K A;  2ZJ2 A;  2IGK A;  3BZK A;  1L0N E;  1D7M A;  3KIO A;  5KLV D;  3VP9 A;  4AYC A;  1G3W A;  3AG1 H;  1IN5 A;  2UUZ A;  2W90 A;  3QWO C;  2OTJ I;  1VF5 D;  3CD6 I;  1J75 A;  5CQE A;  4ANJ A;  1X4P A;  2X58 A;  2FYZ A;  2M8R A;  2EZH A;  1GVJ A;  4IRG A;  4EMS A;  2DPD A;  3IKT A;  3K2Z A;  4RGX A;  3O6Q A;  1U8R A;  4AYB N;  4I6Z A;  3R6S A;  2W4S A;  2M8G X;  3HTS B;  5AVZ B;  1GK4 A;  3DU6 A;  1PP9 D;  4A6E A;  2C9L Y;  2R7F A;  5HNF A;  4GFB A;  2FKW B;  9ANT A;  1YW8 A;  2KIF A;  2ZXJ A;  5E79 C;  1TU3 F;  1SQB E;  2CW0 F;  3G1O A;  1TWH J;  2IA1 A;  2P2U A;  2YX7 A;  1TQM A;  2P5V A;  5IY5 H;  1FNN A;  4HA8 A;  5A2Q Z;  3B5N A;  1NTZ K;  1DIP A;  1WJD A;  3BJ6 A;  2Y9Y A;  1E79 H;  2FXP A;  2F4O B;  1N8R Q;  2LF8 A;  1SQB D;  1MMN A;  2HPC B;  3EUH A;  4C9Y A;  4EGZ A;  2PJR B;  1TL8 A;  3HDD A;  2E36 A;  2Z4E A;  3KEQ A;  4XOT A;  3CCS P;  3SFI A;  4CHU A;  1KQS O;  1L4A A;  4KDP A;  1SFC D;  3QAH A;  4RBO A;  4FGW A;  2FRH A;  4RB1 A;  1SQQ D;  2E7W A;  4RAF A;  5AVR B;  1VQK P;  4M3D A;  3HDH A;  1K78 A;  2B88 A;  2HOE A;  3BTC A;  4HX8 A;  2JUC A;  3S3M A;  1WGX A;  4ZZL A;  2VT3 A;  3PQK A;  2XKP A;  1FWZ A;  4PSX A;  3RL0 C;  3IWZ A;  2X6W A;  3CMY A;  1DEE G;  1LJ2 A;  1YIT I;  3UNG C;  4BHP A;  1GW3 A;  3CUQ A;  3H1L E;  1D0Z A;  2EB7 A;  2O8K A;  2OJE D;  4Q5S F;  4EOT A;  1YIJ P;  3NFQ A;  4YFX F;  2RC4 A;  1W4M A;  4R4L A;  3MZY A;  2YS9 A;  1BI3 A;  2WWW A;  4JX5 A;  4EDF A;  3G2B A;  1JKP C;  5A2Q K;  4D6T E;  3Q1M A;  1T2K C;  3KP3 A;  4EYY Q;  1ETO A;  2AXT H;  2DK8 A;  2ZME C;  3N05 A;  2P10 A;  2RQP A;  1G6N A;  4GKG A;  1O3Q A;  4IOI H;  2NS8 A;  4MO7 A;  4D6T D;  2DQR A;  4H0L D;  1FX7 A;  1OVV A;  2VXD A;  3Q5P A;  2OYI C;  3TO7 A;  2IZ0 A;  1FZC B;  1OCT C;  3A0B E;  3C7C B;  1R4N B;  2K3F A;  2D2W A;  2KHM A;  3CP8 A;  4OIR F;  2WAE A;  2ZXE B;  3CI9 A;  2X9D A;  2HDH A;  2L9N A;  4IRH A;  2LNB A;  5FKO A;  4M9Z A;  5IYB J;  2RQQ A;  3OYM A;  1IAW A;  1ZGA A;  2O5R A;  2JA6 J;  3LW5 H;  4A3B J;  3ZN0 A;  5J40 A;  1AA0 A;  4I7H A;  2ELJ A;  2O0Y A;  3PFI A;  4CZC A;  1J1D C;  4ON0 A;  1XTC C;  3H1K J;  1MSE C;  1N77 A;  1VI0 A;  1NU1 G;  3ZPL A;  2QWW A;  3H35 A;  3K7A J;  3J7A O;  3DFG A;  1UEL B;  5E1W A;  3S15 J;  2HQN A;  4XIC A;  3N97 A;  4KIF A;  3AE3 C;  2BY1 A;  2A61 A;  3P5J A;  5D6F A;  3S8P A;  3HOT A;  3HOY J;  2E1C A;  1FLI A;  1M1J A;  2VUM J;  4MGR A;  3FDY A;  2VKV A;  3CDH A;  1YO5 C;  5J8C A;  4UB6 H;  1R5S A;  4PJM A;  2J5O A;  1Z6R A;  1AHD P;  1BR4 A;  2CS3 A;  3LSG A;  4XNF A;  4IXA A;  5BMZ A;  2Y2Z A;  1YTY A;  2J58 A;  2QA4 P;  2N1T D;  4GXO A;  4CUG A;  4U7J A;  1M57 D;  3KZY A;  3M8J A;  4LLG F;  1TW3 A;  4A3K J;  3H1K G;  2A45 I;  5EG0 A;  1MZB A;  4CXF A;  3I4P A;  4DIQ A;  2Z33 A;  4ZKP A;  2VKH A;  3CLO A;  3RIR A;  1JY2 P;  2NNN A;  2ISY A;  3CCV I;  2VPL A;  3KX2 A;  4ENK A;  3GZN B;  1BI0 A;  1YRN B;  3G17 A;  3PLR A;  1JEK A;  1YTZ T;  3RL0 D;  4J0F A;  2ZSH B;  2CUJ A;  1X3Z B;  3ASN H;  3DEW A;  3KEO A;  5K5R A;  1RF1 B;  2I1K A;  2XAQ A;  4KT6 A;  3PLN A;  2YXQ B;  3PHL A;  3S9O A;  3GTO J;  2HVQ A;  4H13 D;  1H9G A;  4L18 B;  1L2P A;  2R0Q C;  2WSS H;  2W57 A;  1WI9 A;  2K3P A;  3P32 A;  3ZHB A;  1SQP K;  1A36 A;  4JPZ B;  2H1L A;  3M9H A;  2M9H A;  2L7M P;  3FXM A;  3PQJ A;  1PUE E;  3ADO A;  3W68 A;  2K5C A;  3FXQ A;  1I6H J;  4AM3 A;  1RKT A;  4ASN A;  1SQV D;  4AID A;  5KTB A;  3BRO A;  1P4A A;  2Q3I A;  1ETY A;  1UIX A;  3NTN A;  2QJY B;  2E42 A;  1QMG A;  4A0X A;  1ZRT E;  4KHX A;  3GTJ J;  1BGY G;  3ECH A;  2QIW A;  3HRU A;  3TMO A;  1K79 A;  3W2A A;  2OV7 A;  1XMX A;  2VBZ A;  2NNY A;  2A06 D;  2DK5 A;  3OA7 A;  2R7O A;  2R7W A;  5AW9 B;  2AS5 F;  3ZXS A;  3DKX A;  4I1L A;  2MH2 A;  2VOD A;  2CVZ A;  4A3L J;  1XGM A;  5LGU A;  4C2T A;  4C7N A;  2XRO A;  4B3H A;  2BVM A;  2KT0 A;  1IO4 A;  2BZT A;  2XF7 A;  4EAT A;  1YJQ A;  3Q0W A;  1FBM A;  2KS1 B;  1R5G A;  4DQ2 A;  5GPC A;  4PJN A;  2LKX A;  3I4M J;  2WMM A;  3ZN1 A;  1OR7 A;  1NU1 J;  1RC9 A;  3T8T A;  4BKX A;  2V7Q J;  2KZG A;  4G7Z F;  4O3M A;  3E1S A;  1IO2 A;  2XB5 A;  3WUU A;  3KE2 A;  2X6Y A;  4EJT A;  5EGO B;  5BOX A;  2QYT A;  1NTK J;  3QYE A;  4A6D A;  1Z67 A;  4A0Z A;  2PJP A;  2IEK A;  1IFN A;  3L75 G;  3M1E A;  1F1Z A;  1D1A A;  2LDU A;  1Z82 A;  1JGS A;  2EK5 A;  1Z3Y A;  5HVQ C;  1ZRF A;  2FYN B;  4WY4 A;  2YR2 A;  3RL0 B;  1A02 F;  4A5N A;  4WK8 F;  5EYR A;  3L73 D;  3L71 G;  3CXH E;  1XCB A;  2L9V A;  2ZXI A;  3DXJ F;  2DFF A;  1ZP0 C;  2LR2 A;  1MH4 A;  4ZMD A;  3HEF A;  1ON1 A;  4UNO A;  2ITA A;  3OW2 O;  3M3Y J;  1K05 A;  1WDK A;  1HW2 A;  5FWN A;  3VWB A;  1BGY D;  1L0N K;  3L72 G;  2STW A;  3DTI A;  5C3E J;  5IT3 A;  2K3R A;  1U6G A;  2PFB A;  4P1W A;  2HGC A;  3RJP A;  1LGH B;  4NNJ A;  2GBY A;  4Q4Z F;  3K6J A;  1N7S A;  1JJ8 C;  1SLQ A;  5H2F C;  3AE2 C;  1FBU A;  4HZF A;  3IH2 A;  1HTL C;  2VKE A;  1IK9 A; 
#chains in the Genus database with same CATH homology
 3D1N I;  4GBJ A;  3IH3 A;  1DU0 A;  3C2B A;  3HGY A;  1ZGW A;  3ULK A;  1T56 A;  5JE8 A;  2MG4 A;  1BW6 A;  2YU9 J;  2MGQ A;  3WFJ A;  3OBB A;  1IGN A;  1D5Y A;  2IYP A;  3JRG A;  4M3B A;  1FTZ A;  1H89 C;  1KS9 A;  2NVY J;  2IBD A;  4QTR A;  2JA7 J;  5GPA A;  3PO3 J;  5FKN A;  1IL0 A;  1MBF A;  2LP0 A;  2LY9 A;  4UUS A;  4W97 A;  1EVZ A;  3S2H J;  2DA5 A;  4Y7N J;  2XSD C;  3MOG A;  3FR7 A;  1P7J A;  1F12 A;  3ZWA A;  2DA1 A;  5A9S A;  2FQ4 A;  4FE4 A;  2R93 J;  2Y31 A;  1MBK A;  1ORK A;  2DJN A;  1JT6 A;  1X2M A;  2CJJ A;  3WFI A;  5A9R A;  1U8B A;  1JKR C;  4OVN F;  4D7M A;  1BW5 A;  2ID6 A;  1WH5 A;  4AC0 A;  4C3I J;  2ZYA A;  2QCO A;  2R5Y B;  2FD5 A;  2NOG A;  2HDD A;  3QPL A;  2GM4 A;  3FK7 A;  5C4J J;  3G1L A;  3QHA A;  4V2G A;  1HOM A;  2K40 A;  4DZJ A;  5EZG A;  2GLO A;  1YON A;  2G0E A;  5EGO A;  3HOZ J;  3F0C A;  1I36 A;  1M66 A;  4A3E J;  1AKH A;  3MVP A;  5IP9 J;  4XK4 A;  2HQ5 A;  3TW7 A;  1ZR4 A;  4IHY A;  1QPI A;  1Z0X A;  1XC5 A;  3E7L A;  2Y9Z A;  1ETV A;  4E13 A;  2XGC A;  3HOV J;  4E21 A;  2L7Z A;  1FIA A;  4W1U A;  1BJZ A;  2XPV A;  4C3J J;  3BR5 A;  3S1M J;  4QSH A;  3PID A;  3F3S A;  2OPT A;  3ZOB A;  1UHS A;  3BT9 A;  2OF7 A;  1M75 A;  1G2H A;  3FIW A;  2R92 J;  4XRS G;  3ZQC A;  2M0C A;  1HDD C;  1A6I A;  4D5F A;  2LD5 A;  3Q0U A;  4MIM A;  4IM7 A;  2Y0S N;  4AUX A;  5GP9 A;  2PGD A;  4S3M A;  3ZWC A;  3HWR A;  1LFU P;  3JRA A;  4JQ0 D;  1GV5 A;  4S0H B;  4DW6 A;  2CUF A;  3MN2 A;  3HM5 A;  1IDZ A;  4DCK A;  1PUF A;  1OCP A;  2JWT A;  2VI6 A;  1U9N A;  3JRB A;  1WCM J;  2LR8 A;  1I50 J;  1T33 A;  1ZK8 A;  4UUT A;  3PO2 J;  3RQS A;  4EEF G;  1MH3 A;  2EBI A;  3BR2 A;  1P7I A;  3GHY A;  2ELK A;  5F27 A;  2WAQ N;  5IOY A;  1ZCJ A;  3S1Q J;  2DMN A;  4L5E A;  5J1Y A;  3K96 A;  1Y1V J;  4M6V A;  1JUP A;  1OJL A;  4CYC B;  1LJ8 A;  3S1R J;  1S7E A;  1Y1W J;  2K9Q A;  3TP0 A;  1GDT A;  4OQY A;  2P4Q A;  4XRS A;  3W6Z A;  1JTX A;  4M3E A;  3FR8 A;  1JTY A;  2WTB A;  5C4X J;  3TP3 A;  5M3F J;  2LLK A;  5IPA A;  2YUS A;  4NDL A;  5A9T A;  1JKQ C;  1FTT A;  1VFC A;  1B8I B;  4R1N A;  1F36 A;  2MSY A;  2UYY A;  5E3L A;  2HXI A;  3PEF A;  3M4O J;  5EEA A;  1F0Y A;  2I9P A;  3Q3C A;  2L0K A;  3LOC A;  3GTK J;  2DMP A;  2ME6 A;  1NK3 P;  1BG6 A;  2DTZ A;  4X1E A;  1OFC X;  2E19 A;  2W48 A;  4B3I A;  2DMU A;  3MKL A;  2M2E A;  1I3Q J;  1IV6 A;  4CYC A;  4A69 C;  4C2M J;  3RZD J;  1K83 J;  5F0C A;  2JMW A;  1PGO A;  5E3O A;  1RR7 A;  1BA5 A;  4JYK A;  1UG2 A;  4XID A;  2B63 J;  1YB4 A;  5M3M J;  4HNV A;  4YCA A;  3CTV A;  5J1R A;  2E1O A;  2L9R A;  1H88 C;  2NVQ J;  3O8G A;  5IYD J;  2XGD A;  1W0T A;  1W0U A;  4EZB A;  4J0E A;  1MBJ A;  1LE8 A;  1PGP A;  4BBR J;  3OSF A;  2XB0 X;  5HWS A;  1NTC A;  1POG A;  3TW6 A;  4BY1 J;  2ECB A;  3A01 B;  5FLV A;  2EZK A;  1EVY A;  3H2Z A;  1MBG A;  3S16 J;  5M5X J;  2CQX A;  2NVX J;  2HXO A;  2OFP A;  1IUF A;  1VND A;  4I76 A;  2N8G A;  3B6A A;  1ETW A;  3HAD A;  2H8R A;  3FIS A;  1LFB A;  3GBG A;  1E3O C;  1X0V A;  2CQQ A;  5JLW A;  1QVT A;  2CU7 A;  3QPS A;  2R5Y A;  5J1U A;  1H8A C;  5M5Y J;  3BR1 A;  1N1E A;  3HGG A;  5FLM J;  1X0X A;  2WV1 A;  2JN6 A;  3FKI J;  5FKL A;  3VPR A;  4A3I J;  4GWK A;  3HBL A;  1WDM A;  3L6D A;  4BXX J;  4MFD A;  2AHQ A;  2ME0 A;  1JGG A;  1DLJ A;  1PGJ A;  1RES A;  2LK2 A;  3BG9 A;  4A93 J;  4D3S A;  3S1N J;  3I4N J;  1IRZ A;  3Q3S A;  4E12 A;  2XGE A;  4IHX A;  2E2J J;  4M3G A;  4PZD A;  2EZI A;  3QQA A;  1FIP A;  4OQZ A;  3CKY A;  1WPQ A;  4OM8 A;  4BY7 J;  1VPD A;  1M76 A;  3GTP J;  4A3M J;  3NAR A;  3BR6 A;  3BR0 A;  1JUS A;  4FIS A;  4A3F J;  3OSG A;  1SFO J;  1UMQ A;  5IP7 J;  1Z77 A;  1M2W A;  4IEJ A;  3LSJ A;  2NS7 A;  2RAE A;  4DYR A;  2LTP A;  1WP4 A;  1TWG J;  1F14 A;  5K7F A;  3JRI A;  2HOS A;  3CQZ J;  3B6C A;  3K2A A;  4JX6 A;  3TED A;  1B72 B;  5F08 A;  3S14 J;  3NAU A;  3GTG J;  1PGN A;  2W8Z A;  4XRM A;  2WB1 N;  2W90 A;  5FKK A;  2X48 A;  3DFU A;  2EH3 A;  3JRH A;  5E3M A;  2X58 A;  1WPK A;  2EZH A;  4V2F A;  3OOU A;  2IYO A;  2TRT A;  1JDJ A;  3Q0V A;  4AYB N;  4I6Z A;  3S17 J;  4PZE A;  2M8G X;  1YRN A;  4A3J J;  2K9N A;  2DA3 A;  1ZQ3 P;  3BR3 A;  4GFB A;  4KUH A;  9ANT A;  3PDU A;  5F04 A;  1TWH J;  3BQZ A;  3G1O A;  1JKO C;  5FJ8 J;  1ITY A;  3JRC A;  3WHC A;  3BTJ A;  3G0O A;  4KUG A;  4KUE A;  2Y9Y A;  5EF6 A;  2E2H J;  2DN0 A;  1A5J A;  4Y52 J;  1WH7 A;  4DYD A;  1ZKG A;  3JRF A;  3LSP A;  3CDL A;  3HDD A;  3ADP A;  3DCF A;  1ENH A;  3FWN A;  3SFI A;  4JP0 A;  3HOU J;  1ETQ A;  2DA2 A;  4RBO A;  1AKH B;  1XS9 A;  4FGW A;  1AU7 A;  4M3D A;  3HDH A;  5EZH A;  3BG3 A;  3BTC A;  2MW8 A;  1WGX A;  1ETK A;  5MGB A;  1XG1 A;  3CMY A;  1BL0 A;  3RZO J;  2O8K A;  4FE7 A;  3ZGY A;  3HN2 A;  3DOJ A;  3HOW J;  3HB9 A;  2YS9 A;  3BTL A;  4JX5 A;  1JKP C;  3EGO A;  1RPW A;  3IQD B;  1WDL A;  1ETO A;  1IJW C;  1HDP A;  3JR9 A;  3ZW9 A;  2E2I J;  1MBE A;  3BTI A;  2IAI A;  2DA4 A;  2NS8 A;  4MO7 A;  3HOX J;  5IOZ A;  1IC8 A;  2D3T A;  1TWC J;  2JKV A;  5E3N A;  2IZ0 A;  4PZC A;  1GV2 A;  4LOC A;  5EDN A;  2HI3 A;  1OCT C;  3C7C B;  4M3F A;  3G1M A;  1MNM C;  1N1G A;  2X9D A;  2HDH A;  1GVD A;  2R7Z J;  2LVS A;  5FKO A;  3BG5 A;  5IYB J;  2DMT A;  2L7F P;  3A02 A;  2JA6 J;  2JK3 A;  4A3B J;  2QF7 A;  2PLA A;  3W6U A;  1SAN A;  2H1K A;  1MSE C;  1VI0 A;  1RKW A;  1RET A;  2M34 A;  1ZTR A;  2XRL A;  3K7A J;  5HOD A;  5IYC J;  2KDZ A;  1QRY A;  2EQR A;  3S15 J;  4XIC A;  1JJ6 C;  1LE8 B;  3SDG A;  2IZ1 A;  3HKZ N;  1HCR A;  3HOY J;  3ZQG A;  3QSG A;  1TWA J;  2Y30 A;  5M5W J;  2VUM J;  3GTQ J;  4ABZ A;  2VKV A;  1YJ8 A;  5J3L A;  4D3D A;  4GWG A;  2CRG A;  4FTH A;  4JX4 A;  1AHD P;  1APL C;  1GUU A;  1FEX A;  3LSG A;  5BNG A;  2HOA A;  2Y2Z A;  2D5V A;  3H3V K;  1B72 A;  4IHW A;  3PJG A;  1Q1V A;  4A3D J;  4OL9 A;  4A3K J;  5K7Z A;  5JLX A;  5EG0 A;  3RKQ A;  4MLO A;  3W6V A;  3JRE A;  1F43 A;  5AYV A;  3L1P A;  4B1R A;  1QVU A;  1M67 A;  1YRN B;  3G17 A;  2PMZ N;  3PLR A;  2R5Z A;  2JA5 J;  4J0F A;  1LSJ A;  3DEW A;  1HF0 A;  1DU6 A;  5F1J A;  3C7A A;  1F17 A;  4QIW N;  3GTO J;  3SJM A;  3ZQL A;  4DZP A;  3A01 A;  3LNQ A;  2R0Q C;  1GT0 C;  3O8H A;  2LFB A;  3I83 A;  4J19 A;  4A3C J;  1PUF B;  3ZHB A;  1IDY A;  1VF9 A;  4JPZ B;  3OIO A;  4A3G J;  2M9H A;  2DA7 A;  2L7M P;  2DA6 A;  3UKG A;  1K61 A;  3ADO A;  1YVE I;  2EZL A;  1I6H J;  1X58 A;  1RKT A;  1MBH A;  1ETY A;  3CCY A;  4IHV A;  2ZYG A;  1QMG A;  1U78 A;  2ZB9 A;  2O7O A;  2I10 A;  2O9L A;  3GTJ J;  2R5Z B;  4DYQ A;  1R9T J;  5EG0 B;  5FKM A;  3IV5 A;  3LSR A;  4MFE A;  3S2D J;  4DYC A;  2ID3 A;  3A03 A;  2CVZ A;  4A3L J;  2ECC A;  3PM1 A;  1CQT A;  2FJ1 A;  4FCY A;  1DLI A;  4B3J A;  4B3H A;  2FX0 A;  1O4X A;  4D3F A;  2KT0 A;  3GTL J;  5DTD A;  4B3A A;  1YJQ A;  3Q0W A;  2EW2 A;  1HLV A;  2ZYD A;  5F0F A;  5GPC A;  2LKX A;  2JA8 J;  1NK2 P;  1TWF J;  4C3H J;  1MSF C;  3I4M J;  4BKX A;  2HYJ A;  5K7H A;  1PGQ A;  2XB5 A;  5C44 J;  5F0H A;  2DMQ A;  1TC3 C;  1ETX A;  1U9O A;  4DLL A;  3ZQI A;  5EGO B;  2AO9 A;  2QYT A;  1JUM A;  2IEK A;  1ZR2 A;  3ZW8 A;  1EF4 A;  1Z82 A;  2HOT A;  1LSO A;  3ZWB A;  1JT0 A;  1TXG A;  3WS7 A;  1X2N A;  2P81 A;  2JJ7 A;  2X6O A;  3GTM J;  3H0G J;  5EYR A;  3ZQH A;  4D5C A;  1YRL A;  3RQI A;  3BQY A;  2XPW A;  2GF2 A;  5DS9 A;  3IH4 A;  1MH4 A;  4B4C A;  4RDU A;  3HEF A;  5A9S B;  2TCT A;  3M3Y J;  2CUE A;  1WDK A;  1WI3 A;  3WHB A;  5FWN A;  4X6A J;  4G12 A;  4BBS J;  3JRD A;  5C3E J;  2VPR A;  4D7N A;  2NVT J;  3FK6 A;  2GBY A;  3ZQF A;  5IP6 A;  1JJ8 C;  3K6J A;  4UUS B;  3C7D B;  1IG7 A;  2COB A;  2K9S A;  3IH2 A;  2XPU A;  1B8I A;  2VKE A;  1FJL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...