2Y9YA

Chromatin remodeling factor isw1a(del_atpase)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
STPSHPRMPKPHVFHSHQLQPPQLQVLYEKERMWTAKKTGYVPTMDDVKAAYGKISDQEEQKEKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
total genus 63
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9yA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9yA03
2XRLA 1HLVA 1GUUA 3BR5A 2L7ZA 3JR9A 2O8KA 2CUFA 1ZTRA 2ID6A 3BTCA 1ETVA 5C4JJ 2X48A 5M5XJ 2XB0X 1VNDA 2MG4A 5BNGA 4X1EA 4A93J 2NVYJ 3WHBA 5DTDA 5M5WJ 1OJLA 5F0FA 1IRZA 4UUTA 2RAEA 3Q0UA 3BG3A 1IG7A 4C3IJ 3OSFA 3BG9A 3QPSA 1ORKA 3IH2A 5EZGA 4RDUA 3G1OA 2E2HJ 1GDTA 3S1RJ 1Y1WJ 4B1RA 3CDLA 1XC5A 4M6VA 2NVQJ 3A01A 4DZPA 4A3CJ 3S1QJ 5FJ8J 4OVNF 3TP0A 1QVTA 1HF0A 1X2NA 2XPUA 1MBKA 4FTHA 3HOVJ 4AUXA 1P7JA 1LE8A 4XRSG 2CJJA 2JK3A 1Y1VJ 5FKOA 2MGQA 9ANTA 1MH3A 2XPVA 4FE4A 1JKPC 1AKHA 3GTPJ 2KT0A 1WGXA 4QTRA 4EEFG 2HXIA 3BR2A 1HDPA 1AKHB 1UHSA 1JTYA 4JQ0D 2WB1N 2ELKA 2FD5A 1E3OC 3S2DJ 5K7ZA 1LE8B 1BL0A 1X2MA 5E3MA 3Q0VA 1MH4A 4I6ZA 4W97A 3RZOJ 1NK2P 4MIMA 1RETA 3ZQFA 2D5VA 2M0CA 3LNQA 4A3DJ 3GTQJ 2H1KA 2XPWA 5M3MJ 2HQ5A 3H0GJ 1MNMC 4W1UA 2EZIA 1FIPA 5EZHA 2M2EA 1P7IA 3FK6A 4A3LJ 3G1MA 2NS7A 2LY9A 3JRFA 4XIDA 3CMYA 3DEWA 4JYKA 3HEFA 2NVTJ 1FTZA 1TWAJ 1APLC 4IHXA 1ETKA 1BJZA 4NDLA 1ETXA 1NK3P 5F04A 1W0TA 1ZR2A 3IH4A 1HDDC 2R0QC 1IC8A 4BXXJ 4A3BJ 3TP3A 5JLXA 1I3QJ 1UMQA 1D5YA 1BW5A 1ETOA 1T56A 4B3AA 1YRNA 4XRSA 2IBDA 2VKEA 4XRMA 3A03A 2PMZN 4D7NA 1RPWA 1IDZA 3VPRA 2HYJA 1WH7A 2P81A 2K9NA 1NTCA 1FTTA 1PUFB 5E3NA 3BQZA 2ECBA 5C44J 2G0EA 4FE7A 3B6AA 3S14J 2DMQA 2E2JJ 3K7AJ 2VUMJ 3GTJJ 3NAUA 2CUEA 1FEXA 3BQYA 4D7MA 1A5JA 3Q0WA 4V2FA 2DA7A 1VF9A 3WHCA 1U9OA 3JRAA 4QIWN 1DU0A 4JX5A 3BR6A 1MBEA 2QCOA 4A69C 4DYRA 2CQXA 1ZK8A 1K61A 3BR3A 3LOCA 3OSGA 1RR7A 1WI3A 3NARA 4MLOA 5IP6A 5J1RA 2GM4A 5EYRA 2EZKA 4V2GA 4DW6A 1GV2A 3Q3SA 2R5YB 1ZR4A 3HOUJ 1LFBA 2ID3A 2LR8A 3HGYA 2COBA 2XB5A 3ZQLA 1XS9A 1I50J 4DCKA 2M8GX 5IYDJ 1H88C 2JA5J 4BBSJ 5EEAA 2AHQA 2NS8A 2R92J 1AHDP 3RKQA 3QPLA 3BTLA 1IGNA 2OPTA 4C3JJ 1JT6A 2R93J 2WV1A 5FKLA 2L9RA 2M34A 1H8AC 5K7HA 1ETYA 3S1MJ 2OF7A 4DYCA 4BBRJ 3E7LA 1IJWC 2DMNA 2LKXA 2NVXJ 1U9NA 3LSJA 2FX0A 1EF4A 2E1OA 3FK7A 3I4MJ 5JLWA 2YS9A 5EG0A 5F0HA 1HCRA 5F08A 3W6VA 3S16J 5GP9A 1U8BA 5M3FJ 3L1PA 2CRGA 2HXOA 2LVSA 5M5YJ 3MKLA 2LD5A 1A6IA 4XICA 3BR1A 2HI3A 5IP7J 2L7MP 1U78A 5IPAA 4M3BA 3BG5A 3FIWA 4MO7A 5J1UA 1RESA 5FLMJ 1H89C 1FJLA 2ME0A 1OCTC 2DA3A 3JRHA 1QVUA 2XGEA 3O8HA 1B8IB 3SJMA 3SFIA 3IH3A 1F36A 1GV5A 4M3EA 4BY1J 2HOAA 2XGDA 1ITYA 3A01B 5IYCJ 1WCMJ 1JUMA 1X58A 1G2HA 4A3EJ 1JTXA 1TWHJ 3HGGA 2KDZA 4C3HJ 4RBOA 2O9LA 2E19A 1QPIA 4UUSA 2CQQA 1TWCJ 5J3LA 2B63J 2MW8A 4FCYA 1ETQA 3DCFA 4MFEA 4D5CA 5F1JA 1GT0C 2X6OA 2GBYA 3LSRA 2Y9ZA 5F0CA 5EGOB 1GVDA 2DJNA 3I4NJ 2EBIA 2R5ZA 3HOWJ 4JPZB 2DN0A 1JJ6C 5FKKA 5IOZA 4M3DA 5J1YA 1POGA 1ETWA 2ME6A 2FJ1A 4JX6A 3MN2A 3F0CA 1OCPA 2LLKA 2AO9A 1R9TJ 2ZB9A 5F27A 3K2AA 4AYBN 3O8GA 2I10A 3JRIA 5HODA 5EF6A 3M4OJ 3OOUA 2L0KA 2DA5A 3FISA 1F43A 1MBJA 1JGGA 1B72A 4CYCA 3HBLA 3S15J 4JP0A 1DU6A 3BR0A 2EQRA 2JJ7A 4X6AJ 2Y2ZA 3S1NJ 2NOGA 4A3GJ 4IEJA 3HOYJ 1ZKGA 3ZQHA 3SDGA 5EG0B 3OIOA 3ZQCA 1Z0XA 1RKTA 2FQ4A 3PM1A 2R7ZJ 3IV5A 3H3VK 1JKOC 1WH5A 3TW7A 1ENHA 4I76A 1VI0A 2R5ZB 2JA8J 2LTPA 4GFBA 2JA7J 2Y0SN 4MFDA 3PO2J 5C3EJ 3BTIA 2HOSA 3UKGA 2HOTA 1JKRC 2L7FP 3BTJA 1CQTA 3LSGA 2EZHA 5IP9J 4UUSB 2K9QA 1RKWA 1O4XA 4DZJA 3D1NI 5IYBJ 4B4CA 2E2IJ 2CU7A 2GLOA 3S2HJ 3ZQGA 4IHWA 3HKZN 3FKIJ 4BY7J 2DA6A 3GBGA 2LFBA 2YUSA 2YU9J 2K9SA 2LK2A 3M3YJ 2H8RA 2XSDC 2MSYA 4Y52J 1Q1VA 1OFCX 5FKMA 1HOMA 2TRTA 4FISA 4M3GA 1W0UA 1JUPA 3CQZJ 2Y30A 2K40A 2JN6A 3CCYA 1JKQC 1MBGA 3GTOJ 1LFUP 1FIAA 1SFOJ 1WPKA 1VFCA 2TCTA 3MVPA 2DA4A 2VI6A 3GTGJ 2LP0A 4JX4A 2Y9YA 1MSEC 2JA6J 1ZQ3P 2EH3A 2VKVA 5E3OA 4A3MJ 3LSPA 2JMWA 1ZGWA 1JT0A 2EZLA 1YRNB 3PO3J 5GPAA 3B6CA 4AC0A 3TW6A 2DMPA 2DTZA 3TEDA 4M3FA 5E3LA 1BW6A 3JREA 3JRBA 1IV6A 4C2MJ 4HNVA 4L5EA 2DMTA 4D5FA 2XGCA 2DMUA 3JRCA 2IEKA 2WAQN 5EGOA 3HOXJ 4Y7NJ 3GTMJ 1JUSA 5GPCA 2R5YA 2IAIA 1Z77A 2QF7A 3ZQIA 5IOYA 1QRYA 4A3JJ 3HDDA 1TWFJ 3QQAA 2X9DA 1AU7A 3JRDA 3S17J 3HM5A 1B8IA 3G1LA 3ZOBA 4J19A 2DA2A 1IDYA 4A3IJ 2DA1A 3A02A 1BA5A 2HDDA 4A3FJ 4G12A 5K7FA 1TC3C 5FKNA 3HOZJ 1K83J 1I6HJ 1S7EA 1SANA 2Y31A 3BT9A 4S0HB 4IHVA 3GTKJ 1PUFA 4DYQA 1MBHA 2ECCA 3JRGA 5DS9A 4IHYA 2O7OA 1UG2A 2M9HA 3HB9A 1TWGJ 3RQIA 1MSFC 5FLVA 5EDNA 4CYCB 4A3KJ 3RZDJ 1B72B 2W48A 5C4XJ 1T33A 4QSHA 4LOCA 3GTLJ 3C2BA 4ABZA 1JJ8C 4XK4A 4BKXA 2JWTA 1IUFA 2N8GA 2VPRA 1XG1A 1MBFA
chains in the Genus database with same CATH superfamily
1EH8A 1RNLA 4WK8F 2FXMA 1AQTA 1W2BO 3K70D 2ZXIA 3DP7A 4HX8A 4YIIA 1R7JA 2KIFA 2L7ZA 2ID6A 4EMSA 1LQ1A 3ONQA 4BAYA 1W5TA 2X48A 2G8YA 3Q5RA 4BQAA 2VN2A 5K5GB 5CVIA 3VP8A 5ERIA 1KYZA 2NVYJ 2M5WA 2MKVA 4PJ0C 3FHNA 3HOTA 2GQQA 3KZYA 3WHBA 3RK3B 2QUFA 3EUHC 4DOZA 5A9SB 1OJLA 5F0FA 3W3CA 3L74G 2HZTA 3BRTB 4U3FJ 3DPTA 4PFPA 4P1WA 4BQQA 2N9YB 2X0LA 2OQQA 4EV0A 1PGOA 1ORKA 2QENA 3FDYA 3HUSB 3VODA 1X1DA 1Z56A 2L9NA 3BZ6A 2QSHX 3G9RA 3RTRA 5KVRA 1FP2A 1UHWA 3SZTA 3RBXA 4EJWA 1XC5A 1BIBA 5J47A 1U6GA 2DFFA 1RC9A 3AG3H 1G4DA 4A3CJ 2LDUA 4OVNF 1HF0A 5D4RA 3OS0A 1X2NA 3MUDA 5CVVA 4M6XA 2QBYB 2RMZA 3C2HA 5CCHC 1GTWA 1P7JA 3BCAA 1YIJP 4QWQA 4U0WA 2A3SA 2O3FA 3GCMA 3MQ0A 4M74A 4FE4A 3I55I 1T3UA 1VPDA 4Q5SF 2X1DA 1ZG5A 1MZ9A 1LTJB 1DDNA 1DIPA 2KT0A 3M07A 3V2PA 3ML6A 5ICCA 1SMYF 1PJRA 5KAIC 3V8LA 3N97A 1AKHB 2WT7A 1ULYA 4WXHA 2VJJA 4Y15A 3EQ2A 2RN7A 2ELKA 2FD5A 2WB1N 2R7WA 1E3OC 4BJTA 1VQKI 3S2DJ 1LTSC 3CCQI 1BL0A 2QRXA 3L71D 4HPQA 1NO4A 3KEQA 3A3YB 1IV8A 3KCCA 3Q0VA 5HS9A 2CV2A 1L0NE 5BU5A 3TGUE 2G7UA 3HRTA 1NK2P 3RZOJ 3ZW9A 1XMAA 4MIMA 4A7PA 4R4MA 2K9MA 1FOKA 3OYHA 2M0CA 3LNQA 1IK7A 3GTQJ 4XLEA 2H1KA 1ZRTD 2HDHA 1T0FC 2KK7A 3GW6A 2XPWA 3GHYA 2HQ5A 2WTEA 3H0GJ 3F3SA 3EFFK 2EZIA 3QP5A 5HNFA 1WJDA 3HPHA 3HSRA 3QWLA 2WSCJ 1VQ7P 2QZ8A 2WADA 3ISPA 2V6CA 4OWFA 1FNNA 4OMYA 3O2PE 1MMAA 3LA7A 2B87A 4AIKA 3ZP5A 1S9KD 3K9TA 4CCOA 4KFCA 2VE9A 3HEFA 2NVTJ 3F8NA 2Y0DA 2BVLA 3GZNB 1ETKA 3G3ZA 1TXGA 2DLLA 3DBHB 4NDLA 2FSWA 1ETXA 1NK3P 3W2AA 3CXHH 3HD7B 2A6HF 1W0TA 1BCCE 1ZR2A 1RUNA 2WPSA 3OY9A 1HDDC 2YPRA 4UVCA 1MW7A 4BXXJ 3D5LA 5BQTA 5CCGA 3V8JA 2EFPA 1Z6RA 3NWTA 3JSOA 1I3QJ 2L9VA 1P84E 4CHUA 1WMKA 1VQPP 3H5NA 4RLQA 4LK0F 3FKJA 3H1KG 3TNUB 3ZGKA 4D6TD 4QLCU 2IBDA 4IRHA 1OR7A 2KIMA 5GAGJ 4I01A 3ZHBA 3FWEA 4DLLA 4XRMA 3KDPB 3O8ZA 4XFJA 1M90Q 2PMZN 2W85A 1QGPA 1RPWA 1XDSA 3VPRA 2OZ6A 1D5VA 1IDZA 2JJLA 2KOGA 4XQFA 3H1KJ 2P81A 3K0LA 3T8RA 1QZYA 2Z99A 3OYDA 1NTCA 2ZO4A 1HWTC 3CCJP 1L4AA 2ECBA 2F5FA 1GD2E 2HOEA 2Q2EB 3TL4X 4YFXF 3S2WA 2DDAA 3L37A 3FBIB 1JY2O 3AL0B 4HNUA 5HDKA 2VUMJ 2N1TA 5KJ7D 1BC7C 2CUEA 4IOIH 3BQYA 4D7MA 2JTVA 1IRXA 1NG6A 3WG9A 3WHCA 4OM8A 5KLVG 2IRFG 1QGKB 3V6IA 1MUUA 3LSHA 5D6EA 3H1HG 3CMAP 1OCCH 4LG0B 3GFJA 2ZJRF 1MBEA 2DOEA 4F91B 3WTYC 4EGZA 1EV7A 3S3OA 2P58A 2CQXA 1VQ8I 1ZK8A 3OA7A 1FT9A 2E35A 3LOCA 2OYHC 4I0BA 5J1RA 1IRFA 3R2PA 2QJPC 1DP3A 2XAUA 1L2PA 4RM2A 4V2GA 3CZ6A 4DW6A 3Q3SA 3HOUJ 2CV0A 1SQVD 4G94A 4R1NA 4BHBA 1YI2I 5TISC 1NTKG 1XS9A 1PP8F 3L7WA 3VYUB 3PIOF 4S3MA 5D5UB 2HODA 3DTIA 4OAZA 5A9TA 1WZ2A 4LLGF 2NVUB 1IAWA 4KUGA 4UB6C 3NTNA 1RI7A 3PLNA 5APVA 4ENKA 1U7MA 3Q1MA 2P10A 3H0DA 5KKZB 3N7NA 4XONA 3AE9C 1T0FA 4G8XA 3FWLA 3J7YJ 2MC3A 1UZCA 5FKLA 1OIPA 3CCEP 1FOXA 5J40A 2HYGD 2VBYA 5BU8B 3PNYA 4B3HA 2OA4A 2ZXJA 5ICFA 1M1JA 3CUOA 2BEZF 2Z3YA 1SFKA 2XAGA 2XC7A 4DYCA 5ILSA 1BI2A 2LKXA 2BW3B 1DUXC 1FZAA 3W6JB 1URQC 3TF5A 1YHQP 4XL9A 2GZWA 2FX0A 4DJAA 3N4MA 4HNTA 5BPDA 5AVUB 1CI6B 1FZPB 3S32A 4HH2A 2QQBA 3FK7A 4A5NA 1LP1B 1Q82Q 2FFDB 1ZAOA 4GXOA 3V2NA 5F0HA 3J81K 3S16J 2W82A 1NU1D 2GIVA 1U8BA 4PV1B 4PV1D 2VE8A 4OWRB 5M3FJ 3RK3C 4IX7A 3M06A 1J1EC 1O7FA 2G7HA 4LB5A 1GL2D 4G6TB 5AVXB 4XSXF 1NJIQ 4I7ZC 1OR7C 5M5YJ 2LD5A 1IF1A 1A6IA 1LP1A 2FFDA 1MFTA 2ZT9C 2O03A 2R7QA 2DFIA 1U78A 1VQMP 2D1VA 1FX7A 2VJIA 3K4CA 4M9ZA 4BU2A 1JY2P 2UV1A 1VQNP 1WQ2A 1Y56A 3CCJI 4BDZA 1XTAA 3HPGA 2BYVE 5HOOA 1S4XA 2ME0A 2ZFCA 2DA3A 1W36D 3GG2A 4ANJA 3SWYA 1OPCA 3JAMZ 1Z7LA 3SFIA 1F36A 3KPHA 4M3EA 2YMYA 3IF4A 4ZMDA 3Q5SA 2XZRA 2PJRA 1EH6A 3DPLC 1NG7A 2LMDA 3WG7H 1VL2A 2XGDA 2O3JA 3A01B 2C0XA 2CSOA 1X58A 1P92A 3VWBA 2Y0EA 3FBNB 1JTXA 1C0WA 2YU3A 1RF1C 3RGUA 1AFOA 1EH7A 3GF3A 3MZ8A 2E19A 2PMUA 4ITVA 5F6FA 3G6EI 1QPIA 1PPJE 2M3EA 4J0FA 1I6XA 4GGGA 1SQVK 2WSSH 1S9HA 1KN7A 2EFQA 1IXCA 5GTHC 4CZCA 5KAFC 2LBFA 4MNUA 2O6GE 2UWMA 1BM9A 1SQQG 1NTMG 4CGZA 3V2RA 1DH3A 3C7AA 2RQQA 2KMUA 1L0LK 3VSKA 1OW7A 2VIXA 3OYMA 4XLFA 1YTZI 3F8BA 2LSOA 4CZZA 2I9PA 2K86A 2P2UA 1YI2P 3M0DA 5BMZA 1WDMA 4Q47A 2V9PA 5DD8A 3RDIA 2G9WA 2R5ZA 3AAFA 1ZLKA 2LKMA 1DGWY 2FOKA 4OIRF 4JPZB 3WGIA 2UZKA 3RJPA 3VOPA 4M3DA 4IL6H 1K4TA 3HL2A 1LT1A 2P5KA 4IF4A 2DT6A 3RCOA 1R23A 5F27A 3ULKA 1P4WA 3OL3A 2Y69H 3OR1C 2MD0A 1BJAA 3N05A 1F9NA 1ZG1A 2JSCA 3O8GA 2I10A 3RKYA 3F21A 5APTA 3HC7A 2L54A 5HS7A 4ZYEA 2FU4A 3L36A 4PFOA 4CYDA 4QMAA 4IHSA 3OOUA 3W6ZA 3PLRA 1IFJA 5KJ7C 5K1YA 4PJ0E 2NYXA 3D1LA 1BGYG 2Y0MA 3A0BH 1VDFA 1XSVA 2HKOA 4EM2A 1B72A 4DOJA 2E1MB 1NAFA 4XRFA 4BE0A 3HN2A 3NQOA 4F3QA 3LQRA 3LFKA 5APUA 1GMJA 3S1NJ 1B4AA 3BCBA 1V5EA 2P67A 2LXCB 2DJIA 3D6YA 3FMRA 4ESJA 3A0HC 3BWGA 5BS6A 3E6CC 3QYEA 1DP7P 1LT9C 3JSVC 4PV1C 2D2CC 4W7YA 2FNPA 3VMAA 4FETA 3W6KB 3IWFA 1QL1A 1TNSA 4M71A 2EV6A 4HF2A 2V4HA 1JKOC 1WH5A 1JHHA 1ENHA 3A5TA 2IGKA 3NEUA 1T2KA 1KU9A 2ZXHA 3V8KA 1VQ4P 4AVZA 2VBWA 4XMYA 1XCVA 5TJHA 5D8LB 2W8ZA 2VKDA 3TMOA 2Y0SN 4HDUA 3CCRP 1QVFO 2XAQA 4P9FA 4HSRA 3PUFA 2D3TA 2HOTA 5FWNA 2Z2SB 1SFUA 1JKRC 3E6BA 2V9VA 2KLOA 2LY2A 2ZXWH 2BEQD 3GX4X 1XDUA 2OTJI 3LSGA 3EPZA 2BBYA 1O3SA 1FP1D 1SVLA 3KP2A 1HKSA 4Y13A 3J80Z 4I6MC 4B48A 4A12A 4EOTA 1IFDA 2RN0A 4H4KC 4B4CA 1NTZG 3E1SA 4U0VA 2WSCH 1VQ6P 5APWA 1FOSE 4CXFA 5K5RA 1LVAA 1YJNI 1PP7U 1FOSF 3FXRA 1F1ZA 4IHWA 2QJPB 2XDJA 3LAPA 5KK1A 1L0LJ 1X3WB 2ICWG 4AIHA 4P55A 1NTZJ 3ECHA 2O0YA 4JK1X 1LDDA 4LG3A 1A31A 3ZRGA 3GBGA 2HYNA 2A5WA 1MKMA 3AG2H 3A0BE 3CCSP 3HTUA 1RE4C 1OQYA 3G0OA 2B7EA 3PNVA 1HF9A 2MSYA 1Q1VA 3MWMA 3RK2C 4IHTA 2WT7B 2P6SA 2PN6A 5FKMA 1R8EA 1JEKA 1FMVA 2ITAA 2E42A 2R7FA 1N1EA 3ZMUA 1PGPA 4XLCA 1JUPA 2LC2A 3ADPA 2K40A 4IOCF 3GTOJ 2XIGA 1Q90D 1LFUP 2O1KA 4HSTA 4L5JA 2TCTA 3MVPA 5AVVB 2RQPA 2Y9YA 1ZQ3P 4RKUJ 1LEAA 2EH3A 3U1DA 5JE8A 2YSRA 1XB4A 1LT9B 4A0ZA 4HQEA 2EFNA 2BZTA 4Y3OA 5B1BH 3LSPA 4A3MJ 1YIJI 3AEAC 3PQKA 1QA6A 2ZYDA 2IVMA 3V2QA 1YRNB 2WWYA 3I55P 3HADA 1HUCA 5IT3A 2A68F 2VQCA 4RMNA 3E1RA 4ZDOA 4EJUA 2LREA 2L91A 1R6RA 3B6CA 4RJTA 4PK4A 4RM3A 4L9TA 4AC0A 3CC7I 3IC7A 2KISA 3TGNA 1EZVD 3GF7A 1XMKA 1KYOH 2DPDA 2AXTH 1R36A 1Q7YQ 3DV8A 3L72J 2W84A 1R5SA 1J5YA 1BSHA 4U3FE 3RL0C 2XF5A 4HNVA 5A9SA 2DMTA 2XGCA 1VQ4I 1OLTA 1SFCA 2YXQB 4HJGH 1TNTA 1WJFA 2E75D 2IS1A 1YOVB 1G8XA 4IL6E 4ZZLA 2IA0A 3HYIA 1UAAA 1M7LA 1NHAA 1IN6A 4W80A 5JI6A 2WAQN 2F4IA 4Y7NJ 4L5IA 1JUSA 3F6VA 3OV8A 4RAZA 2VQHA 1FZGA 3F9KA 2H27A 1KQGB 3CLQA 1H9TA 1VF5C 2QEXP 2STWA 4LLLA 2GA1A 4IRGA 1FBQA 4H0EA 4LLHA 3K96A 4EJOA 2XVCA 4BS9A 3I83A 1FC3A 4EQQA 1QVGO 1MGTA 3S8PA 3L2VA 1AU7A 3C7JA 2BY3A 1LTGC 5E79H 3HM5A 3MKZA 1IN7A 3G1LA 4PJJA 2W4SA 3CDHA 3OYJA 1BIAA 4NC7A 3ZOBA 2R7RA 1SEUA 1IDYA 2DW4A 2DA1A 3A02A 1CGPA 3V7CA 1F0YA 1IZNB 1L0OC 2ZAEB 3WU2E 2ZT9B 2ZT9D 4G12A 1FDOA 5K7FA 1SQPD 3H9QA 1SQBE 4U3FG 4DT0A 3LIDA 2QQ8A 1S3JA 4XR6A 3HOZJ 3WGGA 1IRGA 3KETA 4NPFX 3E6MA 1FBSA 4RLFA 4S0HB 4LFUA 2KIQA 1FE6A 1SLQA 1XSDA 5LLQA 1IUYA 3H1JG 1NTKD 4DYQA 1G3SA 1UELB 2M8EA 3I54A 1T8IA 3H2ZA 2IGMA 4IHYA 2O7OA 1UG2A 3HB9A 3L70D 5EDNA 2W48A 1PPJD 2ZVNB 3EFGA 3QPTA 1YG2A 2JWDA 2XAHA 1X0TA 4LOCA 1N77A 2DK8A 3C2BA 4B44A 4CCKA 4GCVA 1IL0A 1Q81Q 1OCRH 2XF7A 3HRUA 1JB0J 2UUZA 4BKXA 5AW1B 1TQPA 1IUFA 1PIXA 1XG1A 4L75A 1BI0A 2XV5A 1ODDA 2YMKA 3DPUA 5JHUA 2Q8KA 1EZVI 2YO2A 1KQSO 2K1AA 3O3KA 3GW2A 3BR5A 2O8KA 3FXLA 3C3WA 2CUFA 2DK5A 4Q48A 3BTCA 4XOTA 1ETVA 1MMNA 5C4JJ 1HKTA 3CO6C 1S5LX 1QLED 5E8GA 2R7VA 2XB0X 4EJVA 3L4FA 2KZGA 2MG4A 3L73E 3LSTA 3BRVB 3OYIA 2E5NA 5BNGA 4A5MA 3CC7P 2VRSA 5CJ4A 3KP7A 1YFHA 1IFMA 1LTTC 2ETHA 1SFCB 1D0XA 3DQVC 1T38A 4XOPA 1I5ZA 2CW7A 5M5WJ 2LKPA 2FOWA 2CUZA 1XPXA 1URQD 2OJED 2BCCJ 3NXSA 3HUGA 3Q0UA 3BG3A 1IG7A 4UB8H 1JCCA 1T2KC 1M2WA 3BG9A 3QPSA 3V42A 3HKZA 3OYNA 3MUDC 1CW5A 4MTEA 5EZGA 4RDUA 3B5NB 2DFEA 3DKWA 3LSKA 2PX9A 3H1IE 2IXSA 2QJYC 4IFMA 1LVKA 2GAUA 1R5GA 2VQLA 4B09A 4CA0A 3MKYB 4B1RA 2HTSA 1G3TA 3R60A 4KIBA 3Q5FA 3K6GA 5K5OA 4PD4D 4D6TE 4ZDLA 5B5EC 5FJ8J 2OTLI 5JVGF 5KLVE 2VB6A 1MBKA 1F4KA 3HOVJ 2BXZA 1KMIZ 4XRSG 5H20A 2PFBA 2JK3A 3EYIA 1MH3A 2XPVA 5GADJ 4PJNA 1Y8RB 1FYMA 1JGSA 3WTZA 3SFEC 3WU1B 4BXLA 1UB9A 2XKPA 1U3EM 1D0YA 2X6WA 4EI2A 2OZUA 3RYPA 2DYRH 2OBPA 2HDWA 4QTRA 5IT9K 2CK3H 3H32B 2BY1A 3CL3D 1AV1A 2QM3A 1SMTA 2V9KA 1NU1K 2OCEA 3WTSC 2P7VB 1NTMJ 1SFCD 3CX5I 2D2CD 3V5BA 5B66H 5TRDA 2DODA 1VQOI 3D70A 2K9JA 2H94A 3TNUA 2HFED 4RGUA 1NTZD 4WB4A 3RL0B 4EJTA 2UYYA 1X2MA 1BG6A 1N73A 2BGCA 2K3FA 3CMEP 3LSIA 2DCEA 3HG9A 4ENMA 2HS5A 4EDFA 2E36A 2Z5HA 1OCOH 1YBKA 1KA8A 1RETA 1U5TA 3ZQFA 5MGBA 4WWCA 3AE7C 1OMIA 2P7JA 1MJ9A 1BBYA 2M8RA 2V7FA 1J2JB 1GLNA 3P9IA 1SQXK 1JE8A 2V1XA 5M3MJ 1MNMC 3B5NA 1IXRC 1FIPA 3GO5A 3B8EB 2VPLA 5DYMA 1VQ5P 2CUJA 5EZHA 2JO1A 1P7IA 2V4JC 5JVTA 2PGDA 2ZJSE 2Z16A 4A3LJ 2DDBA 4WCGA 4E7LA 4NUBA 3FXEA 2LRDA 4XIDA 4L18B 1S9KE 1KILC 2E74D 3CJNA 4OGQD 4YTPC 3FMQA 2LBFB 1WPQA 1MNDA 2X1EA 1D3YA 3CX5D 2B0LA 3J80K 1FTZA 4ESFA 2VOOA 1HKQA 1U7JA 5CQEA 1IK9A 4KT0J 1TWAJ 2Q0OA 3WGHA 3DU5A 2L2OA 1APLC 2FYUE 3K4KA 1FZCC 3CJRB 1Y8QB 5DM7F 2CQNA 4D9JA 2PI0A 1S5LH 3QU3A 2BXYA 4A0YA 1LWUC 5HDGA 1YX3A 2PAJA 5JHFA 1N75A 1KFMA 5AVQB 3KYDB 2RKLA 2EILH 4HZFA 5CPRB 3Q9VA 5JLXA 3TP3A 2P1JA 3G6EP 4I0AA 4JBAA 1YJQA 2AXTE 1EXJA 4NNJA 3IFMA 2OV7A 1GW4A 1T56A 2CO5A 1KB9I 1PPJG 3CCSI 3NWSA 1M1KQ 5BOXA 2VKEA 2CH0A 2FFDC 3QRFF 3R4KA 3E5QA 3WU2H 3CCVP 3E97A 1EA3A 3R0AA 4BJ6C 4D7NA 2A45G 2H8PD 3AE5C 1V4RA 4FX4A 1URQB 3GZ5A 3D71A 3FXJA 1EZVE 5DM6F 2FA5A 3CP8A 4MQVA 4KICA 2IS6A 3L00A 5AVTB 3AEEC 1OXZA 3BQZA 3ZQ7A 3L73G 2G0EA 2DPUA 1N7SD 4L76A 4OGQB 1WDKA 1URQA 1K6OA 2L4AA 4Z1MH 2E2JJ 3F89A 2GXAA 2K9YA 1V55H 2BV6A 3KIOA 3MFKA 4B86A 5FRMA 2PEXA 3H3UA 2AQFA 3GXOA 1A5JA 1DEBA 2ZFUA 3Q0WA 2HLOA 3JRAA 2P8TA 4B8XA 3Q3CA 1DU0A 2IGNA 4GOFA 1D0ZA 3ABMH 3BR6A 1G6NA 2IS2A 4WBAA 2H6BA 4DYRA 4E7HA 1TU3F 5H6RA 3G73A 5FB2A 1K61A 1ZYRF 2EV0A 2L3DA 2A06E 3OSGA 3HSEA 3NARA 4MLOA 2GM4A 5EYRA 2KKOA 2EZKA 1KB9H 5CVRA 1R22A 2KSJA 1SQPJ 3I58A 4C2TA 4M6YA 1MFZA 3VTPC 1AA7A 3RSNA 4H44C 2WY7Q 1LFBA 1HTLC 3P9KA 2LR8A 1K73Q 1K6YA 4XKWA 5FFXA 1VQ5I 1PL5A 3QODA 3FX0A 1BR2A 3CXHE 4DCKA 2NPSD 2M8GX 1H88C 1JI8A 1YTZT 3EQLF 1SC7A 2AHQA 3K70C 2NS8A 1YJWI 2WITA 3MTUE 2BCCD 3USSA 3H5RA 3JTHA 2QA4I 5DJTB 2WAQA 1HQCA 4XKBA 3SZGA 1S1CX 1IZ1A 1JT6A 2WV1A 3KEYA 2J58A 1P4AA 1LJ9A 2M34A 2VBZA 1F17A 2O01H 2KYVA 1ETYA 1KB9E 3L70E 2P4QA 1UIIA 1KONA 3CUQA 3K4BA 1AJYA 2PLYA 4G9YA 2KI7B 5KLIC 4GYGA 2EIMH 1SVFA 2W6BA 3SFZA 2KZIA 4PSWA 1U9NA 1SAXA 3J7ZI 4CDGA 1E0EA 2NZ2A 3CCMP 3LSJA 1PVEA 3PIPF 3QWOC 1OYIA 5AW0B 3WTXC 1KQLA 5JLWA 3W6VA 2CW8A 2V1DA 1ZG3A 4FT8A 4I98B 5F08A 2W27A 1KYOI 2PLAA 3B5ND 4O3MA 1LGHB 3M1CA 2K27A 1T08B 3P7NA 5HDNA 3EETA 4XN3A 1JTHA 2G3AA 3AE3C 1O3TA 4PD4I 2NXNB 2KQRA 3MKLA 1T95A 1TT0A 2ZJQF 1TQIA 3HRSA 2VLAA 3BR1A 3WFJA 3H1CA 4OAYA 1X79B 2HI3A 3CC2P 3KP6A 3L70J 5IPAA 2BW3A 1RIOH 3CTAA 1Z1DA 3FIWA 4OINF 5J1UA 2GXBA 2E71A 1EVZA 1G1JA 4C9YA 1ZLJA 1RESA 5ILUA 2H88C 3U59A 4BDYA 4B47A 3KZIE 2E1CA 3JRHA 3L72E 1RF0A 1KQFB 3SJMA 3TDUC 1JXSA 1T6AA 1BGYJ 1R5LA 3QYBA 1KU3A 3H1LE 2ACJA 4KN4X 5B3SH 4A2UA 1ITYA 1FSHA 5DJUB 5IYCJ 1WCMJ 3NRVA 1SD5A 1G2HA 4A3EJ 4IL6X 3BROA 1YJNP 2L9SA 2P5LC 4E7SA 2KDZA 3ABTA 2Z33A 2K37A 3TGUJ 1N73C 2CQQA 5KLVJ 3K6JA 1USDA 4BHPA 2HWVA 2B63J 2E60A 2MW8A 1YB4A 1KZUB 3VYIA 4R4LA 3V7SA 5GAHJ 3VP9A 4FCYA 1J09A 3DCFA 4MFEA 4D5CA 5F1JA 2X6OA 4PSXA 4U88A 3TO9A 2M4KA 5HWSA 4GOEA 5D5WB 2QJYB 2K4BA 4XLPF 3DFGA 1VQKP 2DJNA 3GUDA 3OS1A 3MP7B 3T0YA 4GKGA 1HC8A 4L9NA 5L3GA 2DN0A 3PUBA 4B3JA 5IOZA 1Z91A 2HQNA 2KDOA 3L73D 4UUVA 2ZSIB 1LEBA 2PJPA 1SD6A 3H36A 4JX6A 3TGUG 1I27A 1AWCA 2C9LY 2LLKA 1Q1HA 2AO9A 3L35A 2OARA 3K2AA 4F55A 1VTNC 3M0AA 2O8XA 4P9UA 2PBIA 1WJAA 2AXLA 3JRIA 5EF6A 3CXHI 5M1BA 4ZJZA 1NWQA 3L9FA 5H2FC 2L0KA 2WQYC 1YQ3C 1VPCA 4K2EA 4AVPA 1MBJA 4CO8A 3M9QA 4IQ4A 4D6TG 3I4PA 2XAFA 2HYFA 3H1KD 3ZWAA 1PUEE 3I56I 1HBXG 4YIFA 1HH0A 3CF5F 1LT9A 1YVEI 3H32A 2HR3A 3S15J 3M9HA 1JNMA 1SQPG 4TLFA 3CPWO 3RL0g 1TBXA 1A04A 1IO2A 4S04A 2JJ7A 2M0MA 1QU3A 3PDUA 5CCGC 5H6QA 5KAIH 2NOGA 2ESHA 3BCCG 4IEJA 2KIKA 4GWKA 2QVAA 1LKXA 3SDGA 1AOYA 4E6KG 3HUSC 3NMDA 3QU6A 3OIOA 1W2EA 3P7KA 3ZQCA 2E43A 3EGOA 2DI3A 3CX5E 4LGWA 3KP4A 4AIJA 1LTAC 3IV5A 3H3VK 1STZA 3WUVA 3CUQB 2C6YA 2V1UA 5LBQA 2M30A 3E5UA 2AQEA 2QSIA 2BHZA 1V3FA 3H1JE 3E3VA 2I76A 5FLXK 3MD2A 4GFBA 4HOBA 2JA7J 4H13D 2OYIC 2E75C 4L0ZB 3FR8A 1GW3A 3CF2A 1D1AA 3HE4A 2J59M 3BG6A 2HOSA 4H0LC 2RNGA 2WY8Q 2KRCA 2L7FP 4AU7A 3AE2C 3HSFA 1BN5A 1XX5A 5FLXZ 1OVRA 2W6AA 2BOLA 1WFXA 1QX8A 1Z9CA 2EZHA 2QJKB 5IP9J 4DZOA 1Y0NA 1MD0A 4N6JA 2I8DA 5LHHA 2K9QA 3BPXA 3CCLP 1EVYA 2ZNYA 2A05A 1M67A 2QQ9A 4DZJA 4EZBA 1MJAA 3U9GA 5E18F 2NRAC 3WU0A 4A6EA 1WKMA 4YCAA 3A0HE 2MBFA 3CMAI 1A02F 3V4GA 1BI1A 3ZQGA 3ABUA 3ZQQA 1EDLA 5GTIC 3JTGA 2OGUA 2VASA 1VQ8P 1X1CA 3PFYA 2KZJA 2K02A 3FR7A 1Y8AA 2LFBA 3I71A 1KU7A 5D6FA 3CX5H 2K9SA 4Y52J 2ZYGA 2IBZD 1OFCX 5DCMA 4HRIA 1DPUA 1LTIC 2IA2A 2K85A 2M5AB 3BASA 3CD6I 2MFZA 1TQMA 5DUKA 1IXSB 5AW4B 3K2ZA 3GLLA 3GFIA 3CCRI 1TTYA 5CYVA 1VQLI 3TBIA 2DOAA 1FIAA 3HRMA 1SFOJ 1ZCJA 3HWRA 4HAMA 4Y99C 1LB2A 1VFCA 2F5VA 2VBXA 3BVHA 1SQXD 2VI6A 2KLUA 3GTGJ 3MZHA 4XLHA 3WTWC 3BJ6A 4NHJA 3B73A 2JA6J 4II2A 2RV8A 5E1ZB 4PJMA 5CCHA 2IPPA 2Y75A 1R5HA 4B3IA 5LHIA 2ZXEB 3C7CB 3CWBJ 3P8MC 4XE5B 2X4HA 2JMWA 2ZCWA 4Y4RA 1JT0A 2Q6QA 2DQLA 1K78B 2DFHA 1YLFA 4PGHA 1BDCA 3C1DA 1CF7B 3EUHA 4HB1A 3TW6A 4U7DA 3MGNA 3IAM2 1MDMB 3BY6A 4M3FA 4RESB 5E79E 1YW8A 1TW2A 2OQGA 3Q3DA 4C2MJ 5DCFA 4L5EA 4D3DA 1AQ5A 4PGGA 3L73J 2XRNA 1O3QA 1J1DC 2GUSA 1NH3A 1L0LE 2HODB 5FGMA 3CJQB 3T1BA 4FASD 3IKVA 2DMUA 2EJRA 3WODF 3BOQA 2HQRA 4AWXB 4E7KA 4GDFA 5TISH 5EGOA 3HOXJ 1P84D 4OL9A 1KQ9A 2QWWA 2M7BA 3ZWCA 1M66A 3WUTA 3WFIA 5DV5A 4OU0A 2YNYA 1H0TA 2IAIA 1JUNA 1TL8A 2IS4A 1N78A 1JOCA 1I1SA 2OU2A 4ENJA 3AEGC 1KYOD 2KNCB 3FXUA 1IN5A 5L3CA 4E12A 2IZ0A 3H1HJ 4F7ZA 1TWFJ 1FZBA 3MIWA 3PH0A 3FXMA 1U57A 2AXCA 2MLGA 3JRDA 2WMMA 3BJOA 2ZC2A 5KLVD 3TKYA 2A6EF 1HJ0A 2ZFWA 2JDIH 4PJ0H 3ZMDA 2DA2A 2GUVA 1NTMD 2E34A 1K79A 2HDDA 4RA2A 3WTTC 4A3FJ 1WP4A 3RYRA 2KS1A 2PP6A 1PZQA 1VQ9I 1TC3C 3RL0D 3L74J 5FKNA 3DBLB 2DT7B 2DBBA 4E21A 2GWRA 5D8KB 1I6HJ 1LNQA 4HV5A 1BOAA 2YKOA 4BRYA 3HIFA 3R61A 1XGSA 1Z6TA 1BGYD 3E5XA 1S7EA 1NTKE 3BT9A 1JY3P 3H1IG 2H43A 4DGWB 2BCCE 4WXDA 4R1HA 1T98A 3GHGC 4DBRA 2KFDA 1PUFA 5CBNA 2IDBA 1MBHA 2ECCA 4I2LC 5LGUA 1DGRM 2V26A 3M9AA 4C30A 1JCDA 3FM5A 1WI9A 1NTZE 2DYSH 2M9HA 1N25A 2VJ5A 4EGYA 2PFXA 1SVOA 4IRIA 4OQZA 4L9JA 5HLIA 3S3NA 5DCMB 4LIVA 1FYLA 5C4XJ 2DTRA 1W5CC 2F48A 2LF8A 4C7NA 1M1EB 2L5QA 2HZDA 2Y0SA 4XK4A 5J6XA 1YITP 4OIPF 2N8GA 2IGOA 1M57D 2F4MB 1MBFA 4BQOA 4HF0A 2EIJH 1EJ9A 2VONA 1HLVA 1RY3A 3HE5A 2JUGA 1KGSA 3JR9A 3AE6C 4UVBA 1ZTRA 2KB7P 1ZRDA 2NPSC 3H9JA 4E13A 2ISZA 4N3YB 1N2DC 1ZMEC 1S2EA 1QQIA 1XMXA 2MLKA 5AVRB 1WJEA 4HEA2 1K8AQ 4OGQC 2YX7A 1K9MQ 2NRGA 4BUPA 1Q2NA 2FBWC 4XM3A 5DTDA 1UFMA 5J8CA 3L72D 4NB5A 1LDJA 1IRZA 3OL4A 4HQMA 1SP4A 2RAEA 1OVUA 1WRGA 2KSEA 2WPQA 3L75E 1USSA 4ZNCA 3HE4B 3BZKA 3KZIC 2P4WA 4C3IJ 3CCVI 3OSFA 2YR2A 4JBZA 2F4OB 3JAMK 2IZ1A 3L72G 2H6CA 3G1OA 1DEEG 2D2CB 3OYFA 2KUBA 5AW6B 2FYNC 2XSJC 3QYFA 4CUGA 1Y1WJ 4KT5C 1SQVJ 4UB6E 1R58A 5KLVK 5APYA 5CCHD 2YKPA 4IL6C 4M6VA 1G3YA 1YRLA 2WTBA 4JQFA 3DKYA 1SAUA 1FMWA 4DZPA 2CPSA 3SSUA 3S1QJ 4BACA 2JSPA 4EIJA 3F6OA 1N7SB 1QVTA 3L71G 1Y47A 2XPUA 1SQVG 2RC4A 2VT2A 3C1LA 2E1MC 1E5WA 1LE8A 2V6EA 2F2EA 2Q9IA 5LRRA 2CJJA 1L4AB 1Y1VJ 5FKOA 2MGQA 5A9RA 4C7NB 3F3XA 3I59A 4D1QA 4BWNA 3H25A 5CJ0A 1YHQI 2XAJA 3GZ6A 2KRFA 4PDKA 2L7KA 3CESA 3A0BC 2RDPA 3I3LA 1J75A 2NNNA 1VF5D 1WGXA 1YW9A 4EEFG 4HYEA 2CFXA 3D0SA 1N8RQ 4YFKF 4IM7A 2AS5F 1DPRA 3L70G 4G7ZF 3L71J 3I59B 1VQ6I 2FRHA 4J00A 3S4RA 3TQNA 2QQAA 2FKWB 3PRJA 5E3MA 4Y17A 1NTMK 2M0BA 3H1LJ 1T6SA 2HVQA 3K1MA 5ED4A 1NKZB 4W97A 1LJ2A 1FJKA 1R71A 2E7XA 1SQQE 2FBIA 3ASOH 1GL2C 1QHHD 2D5VA 1YJ8A 2A06D 2YIUC 1IJDB 3PFIA 2R7DA 1FOWA 1SQQK 4D6TJ 3FZVA 2ZJ2A 4XKVA 1K4SA 2QM8A 2YKQA 4JYBA 4LLNA 1R4MB 1P9QC 2GA2A 3GMEA 2IPQX 3SHFA 1IFPA 2M2EA 1VZ0A 3HRNA 4J01A 4YEJA 3G1MA 5BPIA 2NS7A 2QVOA 3W2WA 3JRFA 5LEKA 3DOJA 3CMYA 4IXAA 2XASA 2XHKA 3DEWA 3IRRA 2FBHA 1NOHA 1O57A 1KD1Q 4JYKA 3II6A 4F93B 1OX3A 5APXA 3MMYB 3PIDA 2RH0A 2IBZI 4UNOA 5CHXA 4IHXA 1UG0A 2AEJA 4CCLA 1BJZA 2ADUA 5KKZC 5AVWB 3I5UA 3LIEA 3VEPA 3CWBD 1YW7A 2ZYAA 3SQNA 4YELA 4XSZF 2GOMA 2FF4A 2IA1A 3LSMA 2R0QC 1IC8A 1BCCD 4H0LB 4A3BJ 2DQRA 2GOXB 3CC2I 1X8YA 4BEHB 1UMQA 3ZMTA 1FAVA 5CMZA 1D5YA 1BW5A 2EB7A 2QGUA 4B3AA 1YRNA 1B6AA 4XRSA 4E7JA 3CP2A 4MEYF 4UB6H 1U5TB 3B5NC 3O6QA 2Y0CA 2N1TB 4PCQA 3S9OA 5KTBA 3KZZA 2EWNA 4R79A 5K5QA 3JCUC 1WJCA 1W36C 2IP2A 1NVOA 1WH7A 3VMYA 1B59A 1U5TC 2K9NA 3R4YA 4II3A 5LFAA 3FXKA 4RS8A 3OWTA 2QSGX 1SQPE 5E3NA 3DFUA 1I39A 5C44J 5AW5B 3DWLE 4FE7A 2OCCH 1QPMA 5F1RA 2FXAA 1SQPK 3K5BA 3HTKA 1XN7A 3NAUA 3KLNA 1FEXA 3L2UA 3MKWB 1OKRA 4A0XA 4V2FA 2DA7A 1VF9A 3GF2A 4E7ZA 1U9OA 3E6DA 6PAXA 4QIWN 1N1GA 1M76A 2M4GA 1NAYA 2Q1KA 4JX5A 1IFIA 1MZBA 4UVAA 1YJ9I 3CCUI 1SQQD 2E76B 3D5RC 2KP6A 1GU5A 3UNGC 3T8TA 2ZXXA 3LW5H 2A07F 4BXFA 3H35A 4YRVA 1W7PA 1BE3G 1SQXE 1E2XA 1UJ8A 2J5UA 2KPMA 5GTIE 2FUG2 2AXTC 3QSGA 2VQGA 1SQVE 2R5YB 3H1HE 1NYHA 2R44A 2E74B 2F5CA 3L6DA 3KXDA 4XLAA 4RB3C 3HDHA 2QYOA 2W57A 2XB5A 3ZQLA 2FYZA 1L4AC 3OYKA 4Y28J 5IYDJ 4M9SA 1DLJA 5LGNA 4ZYDA 5ICEA 4ZH4F 3DEUA 3HUGB 2YIUB 1AHDP 3QPLA 1IGNA 1X9VA 1OYYA 2OPTA 1JO5A 4C3JJ 1KILA 2ELJA 1P84H 2DW3A 1FZCB 4HA8A 4I09A 2PJRB 2L9RA 3OAKA 2KJCA 2PMZA 3ZN0A 1H8AC 3AL0C 3GVAA 5AVZB 2LOOA 3S1MJ 2O01J 5LD2C 2JR8A 2CGPA 2KRHA 4XLNF 1YS7A 1P84I 2BY2A 2XNDH 1IJWC 4HV6A 2NVXJ 4ASWA 3MCZA 1MMDA 1OISA 2RGVA 3B02A 5EEGA 3OYCA 3RK3E 1SS1A 1X22A 3RPUD 2E1OA 3H1KE 5L8RJ 3F72A 4UHTA 2YS9A 4BL0B 3HZJA 5EG0A 5E1WA 2A5YB 3KHUA 2W6JH 1FYKA 1S7OA 3SEZA 4H13B 1ZELA 4I2OA 4IPAA 1ERDA 2C9NY 3OR2C 3ZWBA 2R7OA 3L75G 1H0MA 2KL4A 1VQMI 3SXYA 2L7MP 3MAJA 3KLOA 1T8ZA 3OIPA 1NTME 1E3HA 4MQ9F 2CV1A 1L0NK 3ZMVA 5LHGA 2E1NA 1M75A 1HJBA 2LF7A 3V4WA 5FLMJ 5BVZA 1NTKJ 1FJLA 1OCTC 4G7OF 2XGEA 1Z05A 4EATA 4YG2F 1GK6A 3KYQA 1GV5A 3P8CE 1IN4A 1DX7A 1AVYA 1VQ7I 4M3LA 3RKWA 3ZGYA 2PQ8A 4MN4C 2CVZA 3RBZA 2KS1B 4EVIA 3HD7A 2RKHA 1A02J 4C3HJ 1YJ9P 1FOYA 2O9LA 4BGDA 2D2WA 1WVRA 1MMSA 3TGUD 2EK5A 4UUSA 2ZKZA 1YYVA 4JF7A 4V19K 3MZYA 2O01N 3GHGB 1DQUA 2KNCA 3ZCOA 1HW1A 4OIOF 3ZW8A 1J2XA 1ETQA 1FS0E 2B87B 2WB1A 4GBJA 2A61A 2MA3A 1E79H 1L0NG 1DLIA 2NPSB 5AW3B 4YXWH 1KQ0A 1XGOA 2HU9A 4YFNF 2OYIB 3P5JA 2FXPA 4DIQA 3A2KA 3VDXA 1Z21A 5F0CA 1GVDA 2H8WA 1WJ5A 5EGOB 2A45H 3SDBA 3I4NJ 3IAOA 1X1PA 1TZLA 3IR9A 3CMEI 2SPZA 1EKEA 2Z5UA 4LJZF 4ZYHA 4CCMA 2P5VA 4KJZA 3SYTA 2WSEH 1K78A 4PZEA 1POGA 2ZVOB 1ETWA 3DF8A 2BASA 2ME6A 5AIPA 2QEXI 3HJEA 2Z9OA 1JDJA 5AW7B 3MN2A 1OCPA 4ZKPA 2ZB9A 4IOAF 1KV4A 3ITKA 4X0GA 1Z3YA 4RGSA 3LWFA 1W5CE 4IFDK 4BE2A 3N4XA 3SWKA 3GEZA 3H92A 2CQ7A 3TYYA 2KXPB 1O3RA 4HF1A 2QKMB 4U7BA 3I9V2 1Z7UA 3JSPA 4DYDA 1OW8A 2DA5A 3FISA 3H9GA 1NU1J 1F43A 1JY3O 3IRQA 1FPQA 2BEOA 3M8EA 4CYCA 1SFXA 3W67A 2Z4EA 4XORA 3KE2A 4I7HA 4F92B 2IJLA 2V7QJ 4IQJA 1P6RA 4L9VA 1F12A 3U1CA 4WXCA 2M87A 2Q2EA 3BR0A 1DD3A 2EQRA 1NHLA 3VB2A 4D3FA 1P2FA 1T3JA 2L02A 2WV0A 3HOYJ 4A3GJ 2FXOA 1RQVA 2WWWA 3ZQHA 1HA8A 2NS0A 5EG0B 2M3BA 2HTJA 3J81Z 4O6JA 1ONVA 5GTHH 1QZZA 1W4MA 1Z0XA 1RKTA 3UR3C 4Z2YA 1CSBA 3ABVC 3AE4C 4AQRD 2HG5D 2WBMA 1OVVA 3CJTB 3PM1A 2R7ZJ 2K3RA 2UXXA 2CQKA 2CWEA 1WSUA 1KS9A 5DEQA 2JP3A 4GO1A 4ZDPA 3TW7A 5B1AH 1R1VA 3G4SI 2R5BA 2W83C 4I76A 1TLHB 3GWZA 1KC8Q 2QKLB 1J7KA 3DTKA 5D5XB 1VI0A 4WVZA 3S1KA 3BCCD 1L0LD 2JA8J 2N9BA 4AYBA 1FC2C 1QL2A 3E7KA 3MOGA 2FYUG 1L3LA 1Y0UA 2QSFX 3ZDMA 4AM3A 1H0TB 3BTIA 5FO5A 4FGWA 3BJAA 1RH5B 3BTJA 1CQTA 1O7LA 3ABLH 4WY4C 1ZGAA 1YITI 1EXIA 4P5OA 2R4GA 1USEA 2EIKH 1ZGJA 1EDKA 1WT6A 4HG2A 4H44D 3D1NI 3WMM0 3BC8A 1X4PA 2H1LA 1HSJA 2CU7A 2GLOA 3M1EA 4ZC3A 1DD4A 4LD5A 3CXHD 3T97A 4C46A 3HKZN 3U1AA 5EJCA 4XBFA 1ZARA 4HLYA 5CCGD 2X6YA 1X1BA 2GXGA 3L2RA 2YUSA 2V79A 2EFOA 3ZN1A 3M3YJ 3M8JA 1XGNA 2H8RA 1KFNA 1IN8A 1LSJA 3T5XA 4OQYA 2E7WA 2BY0A 1KB9D 4M3GA 3HD7D 3CQZJ 2Y30A 2FYNB 1JKQC 3RQ4A 1MBGA 3M8FA 4KMUX 3S93A 1FU1A 1L0ND 4FQGA 1OZHA 2WVRA 5E79C 3QH9A 1FJPA 4UY8I 1ON2A 2E75B 1JTHB 4WY4A 5E17F 4K35A 4UXNA 1AA0A 1PYVA 2FE3A 3FXQA 3DTEA 1OW6A 4JX4A 3ZPLA 4RB0A 4IJAA 3WTUC 1EQ7A 1NTKK 2VKVA 3UIAA 1RF1B 2LH9A 3PSIA 5IT9Z 1F5TA 4B43A 2IYOA 5KLIB 3Q9SA 1CZQA 4RGXA 2JRMA 3PO3J 4LITA 4P96A 1G59A 2HGCA 1QZEA 2VXDA 2YX4A 3KPEA 5FD6A 5C39A 1A6QA 1VQPI 4KIFA 1W7PD 3OYLA 2QBYA 2WAEA 4YIRX 3H1JJ 2DMPA 2DTZA 4U3FD 2X1CA 2WTYA 2W25A 5E3LA 1BW6A 1X0XA 4M9XA 3W6UA 3JRBA 3K4NA 3TDKA 4ZKUA 3HHGA 3PSFA 4KA4A 2NOJB 3BCCE 2J5OA 4U7JA 1MV8A 2RREA 4PZDA 2AEFA 2IEKA 3FMSA 4RGRA 3PHLA 4I7ZB 3RK3D 3JC22 5CLSA 1V54H 4EM1A 5KAFE 1KILD 3GTMJ 2DT5A 2X51A 1FSEA 1A35A 3LW5J 2OYIA 4Q4ZF 1V5GA 2XUBA 1QRYA 4A3JJ 2F5DA 2X9DA 4ZYGA 5L3BA 3S17J 1B8IA 2X6XA 5A2QZ 1UHMA 1USTA 4WX9A 2HDCA 4HKZH 4AUWA 1HBWA 2Q5UA 3MD0A 3W68A 2JZYA 4K3AA 2EFWA 1PP9J 1GVJA 3BP8A 1FZFA 5DDGA 1RR8C 1BGYE 1GL2B 2BCCG 1RF1A 3P32A 4GODA 1S72I 1R00A 4O9BA 1LSOA 4MHGA 1SQBK 2I1JA 4IHVA 1G1IA 3H5AA 2EW2A 1XTGB 1HVVA 3CC4P 3JRGA 3MZWB 5GAEJ 5DS9A 4CSWA 5B5EH 2HPCA 1GL2A 5LGTA 3RQIA 5FLVA 1H88A 4A3KJ 3L74E 1PP9D 1BE3D 4LC1A 2Q1ZB 4QSHA 3GTLJ 1QHGA 1NTZK 3FF5A 3E0JB 4ABZA 3QPHA 2XROA 4ON0A 1JJ8C 3FGAD 1OCZH 3ROUA 3HHHA 4OIQF 3VN0A 2R7UA 4BRYB 2LY1A 1IFNA 1CI6A 5HLGA 2XRLA 5GTHE 5TJJA 2BVMA 4KN7X 5CKTA 1GUUA 3WTVC 2HQAA 5B66C 4KUHA 2A69F 1JY3N 2LYCA 5M5XJ 4D0PA 2B88A 4N9IA 2EA2A 5B5EE 1KTMA 1VNDA 2JPBA 4ENNA 4AYCA 1XCBA 4X1EA 3F22A 1RRJA 4A93J 2IFMA 5KAFH 3HTSB 1ZH5A 4KT6A 3IAS2 2H09A 3CO7C 2FYUJ 1PDNC 1B9MA 3COAC 2L5GB 3AEDC 5H2FE 1MIJA 5CBOA 1BCCJ 4YXDC 4UUTA 1Z3XA 3LMMA 4EYYQ 3U1KA 3DLAA 1MDMA 1VF5B 5AYVA 2E76C 3H1JD 4GRIA 1YIOA 3SEQA 3ADOA 3IH2A 4ZYAA 1PGJA 2PG4A 3LFUA 1WDLA 3H1ID 3CCUP 2K88A 1A36A 3PJRA 2COMA 3K69A 2E2HJ 4LIUA 1RE4A 2QJKC 1GDTA 3S1RJ 3FHZA 3O6BB 3CDLA 2NVQJ 3GFLA 4E4HA 2Z5IA 1W7PB 3WS7A 1FDIA 3A01A 2WC2A 1HGVA 1ZXGA 4HX7A 1LUJB 1ZOYC 3TP0A 4PD4E 2MJZA 2OTLP 5FROA 3CLOA 3TOBA 4FTHA 3CWBG 2KJBA 4N0BA 4AUXA 3GLXA 2W00A 3RK2B 1H9GA 4WF2A 9ANTA 3RKXA 1HSTA 2KIUA 4NQWA 4UV8A 4ZTFA 1REPC 1JKPC 1AKHA 1ZREA 1LWUA 3J7AY 3MHVA 3GTPJ 4C7RA 2N1TC 2I1KA 1I3AA 1J0RA 3EWKA 1EC5A 2HXIA 3H1LD 3BR2A 1ZRCA 1HDPA 1UHSA 3CCLI 1J9IA 3FXOA 3G71P 3F8FA 1JTYA 3A0HH 4JQ0D 4NQWB 2I5UA 1HXDA 4L74A 3IKTA 1GXQA 2B9SA 3NFQA 1FWZA 4AIDA 5E8IA 2LNBA 5K7ZA 1LE8B 3J7AO 1PV3A 2HPIA 2M3AA 2K3PA 3KP5A 3LA2A 2KZVA 1MH4A 3T97B 4C2UA 4NC8A 4I6ZA 2XDVA 2A06G 2OC6A 4RO0A 3AKZA 5L3DA 1EZVG 4M73A 1G2CB 4A3DJ 2Q3EA 1TP4A 4PJLA 3TDZC 3RPUA 1J1EB 1LFPA 3ZR8X 1Y9BA 2R32A 1H89A 3G4SP 1SVMA 2C0WA 3SZPA 4BJ5C 4UV9A 2JKVA 4W1UA 2LG4A 1ZLLA 4OH8B 2FY8A 1T2KD 4N78E 2EINH 2EA4A 3FK6A 1LPQA 2ZMEC 4H44B 2IYPA 3PTZA 2LY9A 4E70A 3L2WA 2CPBA 2RNJA 3ECOA 2R3CA 3BCCJ 2DXIA 4JOMA 3IUOA 2IT0A 3C8VA 5HLTA 3H1IJ 3CWBE 2KHMA 1NH4A 5F04A 2WSFJ 2XNXA 2O61A 4PZJA 4XKCA 3IH4A 3C7DB 1S29A 4H0LD 2FYUK 5JFRA 2JQ7A 2WAFA 3GFMA 4ESBA 3RK2D 3M7GA 1N73B 1R4NB 1PFIA 1FDMA 5GTIH 1ZW0A 4HYTB 4KNYA 2YXRB 1ETOA 1NGMB 3FWNA 4KITB 3IHUA 3A2AA 4HBLA 4N9HA 1PGNA 2DAOA 4KYWA 3HTKB 3M0DC 2X58A 3A03A 4KMFA 4W7ZA 2HFHA 2HKXA 2HPCB 4HX4A 2HYJA 1QBJA 2YO3A 2R7SA 3K1PA 2R7TA 2MYSA 1E17A 5KAIE 3SFDC 4DJGA 2CFOA 1YONA 4ZZDA 1FTTA 2H7HA 4WY4B 1PUFB 1OWAA 3KEOA 2FMYA 2QE7H 4F52A 3KYLA 3TOAA 2VJ4A 3I56P 3B6AA 3S14J 2DMQA 3KFWX 1SFEA 2NNYA 3K7AJ 2A45I 1BE3J 1S8NA 1RQUA 3IN6A 4D3SA 4Y99B 3CCEI 1BCCG 2BE5F 2Y48A 3AFHA 3GTJJ 3DEEA 3F23A 2QG4A 2IW5A 3O6QB 4GYIA 1LWUB 2O1JA 4XA4A 2VKHA 3OYGA 1PGQA 3H1LG 4CCJA 1X0VA 1SQBJ 3HUSA 1YO5C 2QCOA 3IWZA 4A69C 3QAHA 3BLYA 3K4MA 2E74C 1RZ4A 2MD5A 3BR3A 3GLMA 5D5VB 3QHAA 4PZCA 1RR7A 1WI3A 2ZSHB 5IP6A 2P7CB 1KILB 1ZRFA 1P4XA 1FZCA 3ERMA 2XGXA 2VC1A 1GV2A 4LB6B 2VXZA 3I5CA 4BQNA 1ZR4A 2JA2A 4O5VA 1WHUA 2MABA 2ID3A 2OUMA 1GK4A 2BHYA 5JR3A 5L3FA 2XF6A 3HGYA 1K7AA 2COBA 3JW4A 4M72A 1I50J 4B3XA 1EDIA 3U2RA 4FX0A 3ELKA 2CS3A 2HVRA 2OD5A 1S6LA 3ZMSA 2JA5J 1KU2A 5EEAA 4BBSJ 1D8JA 4HW0A 2R92J 3RKQA 2QIWA 3HD7C 3BTLA 3ULQB 1M56D 4I99C 1IO4A 4GDOA 2QA4P 2R93J 1JY2N 4IVNA 3LA3A 1FBUA 3TO7A 1BSNA 4UB8E 4XN0A 1D1CA 5K7HA 1CF7A 2WZ7A 3V4QA 3L75D 2XU6A 3TSIA 2OF7A 3ZMZA 3AEFC 3GMAA 1LTBC 3ZXSA 2WPVB 4BBRJ 2ZMEB 3FXDA 3HXLA 3E7LA 2IX7C 2DMNA 2Q3IA 4E7IA 1B1BA 1BI3A 2K9LA 1EF4A 1SQXG 5FFZA 1BOBA 2FBKA 5HNHA 2ZBKA 3I4MJ 1KILE 4PD4H 1HCRA 4OMZA 2PMHA 5GP9A 1S72P 5J8FA 4ETSA 4N4OB 3L1PA 3L2QA 1NU1E 2CRGA 2HXOA 2LVSA 3R6SA 1JHFA 2OQRA 3CD6P 5HLHA 2P0WA 3CC4I 1Z67A 2WPRA 4XICA 5CJ9A 2ZNZA 3M91A 4BHCA 3HOSA 5IP7J 2KLVA 1VQLP 2GIZA 4M3BA 3BG5A 1ON1A 4BE1A 2OAZA 4MO7A 1R1UA 3PP5A 1LJ8A 2ZMEA 2HVSA 3F8MA 5E1XA 1H89C 1I1GA 1SQXJ 5H2FH 4KIGA 2ISYA 2K4JA 4BYYA 1QVUA 3PNTA 3O8HA 1B8IB 2AEMA 2JEEA 3H6PA 4NPEA 1YQ4C 3IH3A 2GF2A 3VOEA 1L0NJ 4CPGA 1ZP0C 1XSXA 2HOAA 4BY1J 3OYBA 3BZCA 3L2CA 2TDXA 2CMPA 1TW3A 1JUMA 2JT1A 2E76D 3D5SC 5L3EA 2PRRA 3IQDB 2R3SA 1LDKB 1TWHJ 3VYRB 3HGGA 5LRSA 4RBOA 3S3MA 1Y39A 1X4OA 2E5ZA 3WE2A 4TT3H 1LNWA 1TWCJ 5J3LA 2VC0A 3F8CA 1WJBA 5LEJA 1HGZA 1N86A 4WY4D 3LQQA 1QMGA 1Q86Q 4CICA 1GT0C 1YQAA 3FX3A 3TK1A 4QPQA 1L0LG 2GBYA 4UB8C 3LSRA 2Y9ZA 3W2VA 3A4CA 4G6DA 3PL8A 1BC8C 3GHGA 4H13C 1L4AD 2UXNA 2EBIA 5CVUA 2CG4A 3HOWJ 1SQBD 1NU1G 5FD5A 3BPVA 1YS6A 3H3ZA 5FKKA 3OYEA 1JJ6C 3G17A 5J1YA 4KDPA 2QLZA 5AIQA 2VODA 2WSEJ 3DKXA 1G2CA 2FJ1A 1X1AA 1KZHA 4DQ2A 3F0CA 2LXBA 5DD4A 1R9TJ 2B89A 2N1TD 5KJ7A 1U2WA 2FEZA 3HE5B 2NAZA 2WA0A 1W5SA 3DLLF 4AYBN 4PUSA 3SWFA 3LAJA 3EYYA 1Y6IA 5HODA 2ESNA 5KNLA 2K5CA 2VL8A 1RE3A 2F6CA 3PQJA 2LKSA 2ELHA 2EPFA 3I0TA 3QOEA 4LK1F 4HDVA 4L0YB 3M4OJ 1SD4A 1M8OB 4G6QA 3ERED 4JYCA 1VQ9P 3Q2YA 1JGGA 1K04A 1YX5A 2OTJP 3OYAA 3CMMA 3HBLA 3GYHX 4FHTA 1N7SC 1RHZB 1XD7A 1ZRTE 1LTJA 4MGRA 1KORA 2V7QH 4JP0A 3VSLA 1D1BA 2FMLA 1DU6A 1HW5A 4GWGA 3G2BA 1BDDA 4X6AJ 2STTA 2UWJE 2Y2ZA 1YTYA 1BR1A 2CYYA 3G71I 3JCUE 5A2QK 3L75J 1ZKGA 2Z1DA 3CCQP 4Y33A 1SD7A 4BNCA 4RB1A 3ESWB 5KHDA 3OBBA 1JMMA 4GIFA 1NKNA 2F5EA 3A1YA 2FQ4A 5J4YA 1ZN2A 3WUUA 2JVGA 5APSA 2M45A 3M9BA 3FM3A 3OOPA 1FLIA 3KX2A 3B71A 3QP6A 4QPOA 2MH2A 4IFFA 2P6TA 4ASNA 3AECC 4BEHA 4EM0B 4OOIA 4ZTJA 3X2QH 2R5ZB 2LTPA 3TO6A 3V7RA 4MFDA 3RQSA 3PO2J 4U0YA 5C3EJ 1VQNI 2VOPA 1KQ8A 2JWAA 3UKGA 3L71E 3OIQA 4NBQA 1WRJA 3I53A 3VYSB 3AG1H 1I36A 4J0EA 4GT1A 1JM0A 4WWIA 1YJWP 1FY7A 2HEOA 1JMBA 3IP4B 3RI4A 1X3ZB 3CDIA 3CUQC 4RB2C 1YE9A 2J5PA 3QOPA 4UUSB 1UCRA 2D1HA 4NC6A 1VQOP 1RKWA 3BDDA 1QO0D 1O4XA 1S5LC 1R5ID 2IFNA 5IYBJ 5TISE 2E2IJ 4RAYA 2B9BA 1AVOA 1D8KA 5KCMA 3OJAB 4Z6YA 1OYWA 2M7AA 2JRTA 4CH7A 5APQA 2JUCA 4TV7A 2MC4A 3S2HJ 1SFCC 3CCMI 4N78D 4AD9A 3CKYA 4L73A 4I1LA 1V5FA 3FKIJ 4BY7J 2VT3A 2DA6A 3LL7A 4LG0A 1U8RA 2DU9A 3WE3A 2M1BA 2XKMA 2IBZE 2YU9J 2LK2A 2H89C 2W7NA 2XSDC 1ACIA 3WU2C 2HNHA 1GHCA 3MEXA 2KP8A 2OTKE 1HOMA 2WSFH 2TRTA 4FISA 2CW0F 5AW9B 2ZJPF 1W0UA 2XV4S 3CCYA 2JN6A 3DBRB 1MNEA 2JPCA 2IBZG 3JCUH 2FQ3A 4S05A 2D45A 3KYCB 1M1JC 1WPKA 5F64A 1PP9E 3PJGA 1XTCC 5AVYB 2K9JB 4U87A 5HVQC 2DA4A 5EFWB 1RUOA 4KUMA 2LP0A 1MSEC 3VYTB 1MMGA 1PP9G 3C18A 2W1OA 5E3OA 1N7SA 3VMXA 1GZLA 4BH9A 1WWXA 2E5YA 2LR2A 2M5AA 3IL2A 2JVHA 4HLXA 1J59A 4YPCA 3OS2A 2QYTA 4CCNA 1ZGWA 5HS8A 1E3PA 2EZLA 2W90A 4LMYA 2A6TA 3K1NA 1R49A 4BXUA 1FBMA 1LTJC 4NPDA 1R1TA 1S7AA 1K05A 1MJBA 1M1JB 2OFPA 1TT5B 1KYWA 5GPAA 4IZZA 1GXPA 3U21A 3REOA 3K4JA 4I02A 4RAFA 2RVCA 1XGMA 1J1DB 1ZN5A 3KP3A 3RPQA 3TEDA 4DNCA 4KUEA 3JREA 1IV6A 2OYHA 2FYUD 5TGTA 1Z82A 4D5FA 3P8CD 1FZEA 1X3UA 3C2GA 1T39A 3L09A 1QEXA 3CTVA 1RF0C 3JRCA 2X85A 2K7LA 1H8AA 4N4NB 3PEFA 1YYCA 1S5LE 2OYOA 4KISA 1IW7F 3BG7A 5GPCA 2R5YA 1EDJA 3ABKH 2R7XA 3ZQIA 1Z77A 2QF7A 5IOYA 5AW8B 2XKOA 2NPSA 3D6ZA 2OYHB 1B9NA 4A6DA 5CVJA 1SQBG 4RAGA 1ZV8A 3HDDA 3OMYA 5ICGA 1GU4A 2DO7A 3QQAA 5DUIA 1KYOE 5CQGA 1U0JA 3C9IA 3BATA 3VFZA 2W24A 4J19A 2MH9A 5E20A 3ASNH 4A3IJ 1BA5A 3A7OA 3VMZA 3I64A 1IC2A 3DU6A 3K4LA 3OW2O 3AE1C 5AONA 3KZIH 3Q5PA 5ILVA 4MTDA 1K83J 5B66E 1G3WA 3B4SA 5AVSB 3CI9A 3AE8C 1QNTA 1SANA 2Y31A 2V1NA 3K10A 3EUKL 3GTKJ 4R8HA 5EEHA 5IY5H 1SQQJ 1W1WE 2HPMA 3DXJF 2POHA 2EV5A 5FRNA 3F5HA 4MEXF 1N7LA 4XNFA 4LGDE 4KHXA 3P9CA 2O5RA 4ASVA 3L74D 2E5TA 1BE3E 1TWGJ 1MSFC 1ZHFA 4CYCB 4IO9F 5D4SA 1UIXA 3RZDJ 1B72B 3PJSK 5J4VA 1HW2A 3AEBC 1F14A 2R5DA 2DOFA 3EUAA 1T33A 2L01A 2QM7A 3R0JA 3KQGA 1D7MA 3E1IA 4IKFA 4KJMA 5AW2B 2Q7CA 2FNAA 4G7HF 1X19A 2JWTA 4DBQA 2VPRA 1BR4A 3H1HD 3RIRA 3EDPA 2L4MA 3AG4H 1RE3C
chains in the Genus database with same CATH topology
2XRLA 1HLVA 1GUUA 3BR5A 2L7ZA 3JR9A 2O8KA 2CUFA 1ZTRA 2ID6A 3BTCA 1ETVA 4KUHA 5C4JJ 2X48A 5M5XJ 2XB0X 4E13A 1VNDA 2MG4A 5BNGA 4X1EA 4A93J 2NVYJ 3WHBA 5DTDA 5M5WJ 5A9SB 1OJLA 5F0FA 1IRZA 4UUTA 2RAEA 3Q0UA 3BG3A 1IG7A 4C3IJ 3OSFA 5AYVA 1M2WA 3BG9A 3QPSA 3ADOA 1PGOA 1ORKA 3IH2A 1PGJA 2IZ1A 1WDLA 5EZGA 4RDUA 3G1OA 2E2HJ 1GDTA 3S1RJ 1Y1WJ 4B1RA 3CDLA 1XC5A 4M6VA 2NVQJ 1YRLA 2WTBA 3WS7A 3A01A 4DZPA 4A3CJ 3S1QJ 5FJ8J 4OVNF 3TP0A 1QVTA 1HF0A 1X2NA 2XPUA 1MBKA 4FTHA 3HOVJ 4AUXA 1P7JA 1LE8A 4XRSG 2CJJA 2JK3A 1Y1VJ 5FKOA 2MGQA 9ANTA 5A9RA 1MH3A 2XPVA 4FE4A 1JKPC 1VPDA 1AKHA 3GTPJ 2KT0A 1WGXA 4QTRA 4EEFG 2HXIA 3BR2A 4IM7A 1HDPA 1AKHB 1UHSA 1JTYA 4JQ0D 2WB1N 2ELKA 2FD5A 1E3OC 3S2DJ 5K7ZA 1LE8B 1BL0A 2UYYA 1X2MA 5E3MA 1BG6A 3Q0VA 1MH4A 4I6ZA 4W97A 3RZOJ 1NK2P 3ZW9A 4MIMA 1RETA 3ZQFA 2D5VA 1YJ8A 5MGBA 2M0CA 3LNQA 4A3DJ 3GTQJ 2H1KA 2HDHA 2XPWA 5M3MJ 2HQ5A 3H0GJ 1MNMC 2JKVA 4W1UA 2EZIA 1FIPA 3F3SA 5EZHA 2M2EA 1P7IA 2PGDA 3FK6A 4A3LJ 3G1MA 2IYPA 2NS7A 2LY9A 3JRFA 4XIDA 3DOJA 3CMYA 3DEWA 1WPQA 4JYKA 3HEFA 2NVTJ 1FTZA 3PIDA 1TWAJ 1APLC 4IHXA 1ETKA 1TXGA 1BJZA 4NDLA 1ETXA 1NK3P 5F04A 1W0TA 2ZYAA 1ZR2A 3IH4A 1HDDC 3C7DB 2R0QC 1IC8A 4BXXJ 4A3BJ 3TP3A 5JLXA 1I3QJ 1YJQA 1UMQA 1D5YA 1BW5A 1ETOA 1T56A 4B3AA 3FWNA 1YRNA 4XRSA 2IBDA 1PGNA 2VKEA 3ZHBA 4DLLA 4XRMA 2X58A 3A03A 2PMZN 4D7NA 1RPWA 1IDZA 3VPRA 2HYJA 1WH7A 2P81A 2K9NA 1NTCA 1YONA 1FTTA 1PUFB 5E3NA 3BQZA 2ECBA 3DFUA 5C44J 2G0EA 4FE7A 3B6AA 1WDKA 3S14J 2DMQA 2E2JJ 3K7AJ 4D3SA 2VUMJ 3GTJJ 3NAUA 2CUEA 1FEXA 3BQYA 4D7MA 1A5JA 4OM8A 3Q0WA 4V2FA 2DA7A 1VF9A 3WHCA 1U9OA 3JRAA 4QIWN 1N1GA 1M76A 1DU0A 1PGQA 3Q3CA 4JX5A 1X0VA 3BR6A 1MBEA 2QCOA 4A69C 4DYRA 2CQXA 1ZK8A 1K61A 3BR3A 3LOCA 3QHAA 3OSGA 1RR7A 1WI3A 3NARA 4MLOA 5IP6A 5J1RA 2GM4A 5EYRA 4PZCA 2EZKA 4V2GA 4DW6A 1GV2A 3QSGA 3Q3SA 2R5YB 1ZR4A 3HOUJ 1LFBA 4R1NA 2ID3A 2LR8A 3L6DA 3HDHA 3HGYA 2COBA 2XB5A 3ZQLA 1XS9A 1I50J 4S3MA 5A9TA 4DCKA 2M8GX 5IYDJ 1DLJA 1H88C 2JA5J 4BBSJ 4KUGA 5EEAA 2AHQA 2NS8A 2R92J 1AHDP 3RKQA 3QPLA 3BTLA 1IGNA 2OPTA 4C3JJ 1JT6A 2R93J 2WV1A 5FKLA 2L9RA 2M34A 1F17A 1H8AC 5K7HA 1ETYA 2P4QA 3S1MJ 4B3HA 2OF7A 4DYCA 4BBRJ 3E7LA 1IJWC 2DMNA 2LKXA 2NVXJ 1U9NA 3LSJA 2FX0A 1EF4A 2E1OA 3FK7A 3I4MJ 5JLWA 2YS9A 5EG0A 5F0HA 1HCRA 5F08A 3W6VA 3S16J 5GP9A 1U8BA 2PLAA 5M3FJ 3L1PA 2CRGA 2HXOA 2LVSA 5M5YJ 3MKLA 2LD5A 1A6IA 3ZWBA 4XICA 3WFJA 3BR1A 2HI3A 5IP7J 2L7MP 1U78A 5IPAA 4M3BA 3BG5A 1EVZA 3FIWA 4MO7A 5J1UA 1LJ8A 1M75A 1RESA 5FLMJ 1H89C 1FJLA 2ME0A 1OCTC 2DA3A 3JRHA 1QVUA 2XGEA 3O8HA 1B8IB 3SJMA 3SFIA 3IH3A 1F36A 1GV5A 4M3EA 2GF2A 4BY1J 2HOAA 2XGDA 1ITYA 3A01B 5IYCJ 1WCMJ 1JUMA 1X58A 3ZGYA 1G2HA 2CVZA 4A3EJ 3IQDB 1JTXA 1TWHJ 3HGGA 2KDZA 4C3HJ 4RBOA 2O9LA 2E19A 1QPIA 4UUSA 2CQQA 3K6JA 4J0FA 1TWCJ 5J3LA 2B63J 2MW8A 1YB4A 4FCYA 3ZW8A 1ETQA 3DCFA 4MFEA 1QMGA 4D5CA 5F1JA 1GT0C 3C7AA 1DLIA 4GBJA 2X6OA 5HWSA 2GBYA 3LSRA 2Y9ZA 5F0CA 5EGOB 1GVDA 2DJNA 2I9PA 3I4NJ 1WDMA 2EBIA 2R5ZA 3HOWJ 4JPZB 2DN0A 3G17A 4B3JA 1JJ6C 5FKKA 5IOZA 4M3DA 5J1YA 1POGA 4PZEA 1ETWA 2ME6A 1JDJA 2FJ1A 4JX6A 3MN2A 3F0CA 1OCPA 2LLKA 2AO9A 1R9TJ 2ZB9A 3ULKA 5F27A 3K2AA 4AYBN 3O8GA 2I10A 3JRIA 5HODA 5EF6A 4DYDA 3M4OJ 3OOUA 2L0KA 2DA5A 3FISA 3PLRA 3W6ZA 1F43A 1MBJA 1JGGA 1B72A 3ZWAA 4CYCA 3HBLA 1YVEI 3HN2A 3S15J 1F12A 4JP0A 1DU6A 3BR0A 4GWGA 2EQRA 2JJ7A 4X6AJ 3PDUA 2Y2ZA 3S1NJ 4D3FA 2NOGA 4A3GJ 4IEJA 3HOYJ 1ZKGA 4GWKA 3ZQHA 3SDGA 5EG0B 3OIOA 3ZQCA 1Z0XA 1RKTA 3EGOA 3OBBA 2FQ4A 3PM1A 2R7ZJ 3IV5A 3H3VK 1KS9A 1JKOC 1WH5A 3TW7A 1ENHA 4I76A 1VI0A 2R5ZB 2JA8J 2LTPA 4GFBA 2JA7J 2W8ZA 3RQSA 2Y0SN 4MFDA 3FR8A 3PO2J 3MOGA 5C3EJ 3BTIA 2HOSA 3UKGA 2D3TA 2HOTA 4FGWA 5FWNA 1JKRC 1I36A 4J0EA 2L7FP 3BTJA 1CQTA 3LSGA 2EZHA 5IP9J 4UUSB 2K9QA 1RKWA 1EVYA 1O4XA 1M67A 4EZBA 4DZJA 3D1NI 5IYBJ 4B4CA 2E2IJ 2CU7A 2GLOA 4YCAA 3S2HJ 3ZQGA 4IHWA 3CKYA 3HKZN 3FKIJ 4BY7J 2DA6A 3GBGA 3FR7A 2LFBA 2YUSA 2YU9J 2K9SA 2LK2A 3G0OA 3M3YJ 2H8RA 2XSDC 2MSYA 4Y52J 1Q1VA 2ZYGA 1LSJA 1OFCX 5FKMA 1HOMA 2TRTA 4FISA 4OQYA 1N1EA 1PGPA 4M3GA 1W0UA 1JUPA 3CQZJ 2Y30A 3ADPA 2K40A 2JN6A 3CCYA 1JKQC 1MBGA 3GTOJ 1LFUP 1ZCJA 3HWRA 1FIAA 1SFOJ 1WPKA 1VFCA 3PJGA 2TCTA 3MVPA 2DA4A 2VI6A 3GHYA 3GTGJ 2LP0A 4JX4A 2Y9YA 1MSEC 2JA6J 1ZQ3P 5JE8A 2EH3A 2VKVA 5E3OA 4B3IA 3C7CB 2IYOA 4A3MJ 3LSPA 2JMWA 2QYTA 1ZGWA 1JT0A 2ZYDA 2EZLA 2W90A 1YRNB 3PO3J 3HADA 2OFPA 5GPAA 3B6CA 4AC0A 3TW6A 2DMPA 2DTZA 3TEDA 4M3FA 5E3LA 4KUEA 1BW6A 3JREA 1X0XA 3W6UA 3JRBA 1IV6A 4C2MJ 4HNVA 4L5EA 1Z82A 4D3DA 5A9SA 2DMTA 4D5FA 2XGCA 3CTVA 4PZDA 2DMUA 3JRCA 2IEKA 3PEFA 2WAQN 5EGOA 3HOXJ 4OL9A 4Y7NJ 3GTMJ 3ZWCA 1JUSA 5GPCA 2R5YA 1M66A 3WFIA 2IAIA 1Z77A 2QF7A 3ZQIA 5IOYA 1QRYA 3K96A 3I83A 4E12A 4A3JJ 3HDDA 2IZ0A 1TWFJ 3QQAA 2X9DA 1AU7A 3JRDA 3S17J 3HM5A 1B8IA 3G1LA 3ZOBA 4J19A 2DA2A 1IDYA 4A3IJ 2DA1A 3A02A 1WP4A 1BA5A 2HDDA 1F0YA 4A3FJ 4G12A 5K7FA 1TC3C 5FKNA 3HOZJ 4E21A 1K83J 1I6HJ 1S7EA 1LSOA 1SANA 2Y31A 3BT9A 4S0HB 4IHVA 3GTKJ 2EW2A 1PUFA 4DYQA 1MBHA 2ECCA 3JRGA 5DS9A 3H2ZA 4IHYA 2O7OA 1UG2A 2M9HA 3HB9A 1TWGJ 3RQIA 1MSFC 5FLVA 5EDNA 4CYCB 4A3KJ 3RZDJ 1B72B 2W48A 4OQZA 1F14A 5C4XJ 1T33A 4QSHA 4LOCA 3GTLJ 3C2BA 4ABZA 1IL0A 1JJ8C 4XK4A 4BKXA 2JWTA 1IUFA 2N8GA 2VPRA 1XG1A 1MBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XRL A;  1HLV A;  1GUU A;  3BR5 A;  2L7Z A;  3JR9 A;  2O8K A;  2CUF A;  1ZTR A;  2ID6 A;  3BTC A;  1ETV A;  5C4J J;  2X48 A;  5M5X J;  2XB0 X;  1VND A;  2MG4 A;  5BNG A;  4X1E A;  4A93 J;  2NVY J;  3WHB A;  5DTD A;  5M5W J;  1OJL A;  5F0F A;  1IRZ A;  4UUT A;  2RAE A;  3Q0U A;  3BG3 A;  1IG7 A;  4C3I J;  3OSF A;  3BG9 A;  3QPS A;  1ORK A;  3IH2 A;  5EZG A;  4RDU A;  3G1O A;  2E2H J;  1GDT A;  3S1R J;  1Y1W J;  4B1R A;  3CDL A;  1XC5 A;  4M6V A;  2NVQ J;  3A01 A;  4DZP A;  4A3C J;  3S1Q J;  5FJ8 J;  4OVN F;  3TP0 A;  1QVT A;  1HF0 A;  1X2N A;  2XPU A;  1MBK A;  4FTH A;  3HOV J;  4AUX A;  1P7J A;  1LE8 A;  4XRS G;  2CJJ A;  2JK3 A;  1Y1V J;  5FKO A;  2MGQ A;  9ANT A;  1MH3 A;  2XPV A;  4FE4 A;  1JKP C;  1AKH A;  3GTP J;  2KT0 A;  1WGX A;  4QTR A;  4EEF G;  2HXI A;  3BR2 A;  1HDP A;  1AKH B;  1UHS A;  1JTY A;  4JQ0 D;  2WB1 N;  2ELK A;  2FD5 A;  1E3O C;  3S2D J;  5K7Z A;  1LE8 B;  1BL0 A;  1X2M A;  5E3M A;  3Q0V A;  1MH4 A;  4I6Z A;  4W97 A;  3RZO J;  1NK2 P;  4MIM A;  1RET A;  3ZQF A;  2D5V A;  2M0C A;  3LNQ A;  4A3D J;  3GTQ J;  2H1K A;  2XPW A;  5M3M J;  2HQ5 A;  3H0G J;  1MNM C;  4W1U A;  2EZI A;  1FIP A;  5EZH A;  2M2E A;  1P7I A;  3FK6 A;  4A3L J;  3G1M A;  2NS7 A;  2LY9 A;  3JRF A;  4XID A;  3CMY A;  3DEW A;  4JYK A;  3HEF A;  2NVT J;  1FTZ A;  1TWA J;  1APL C;  4IHX A;  1ETK A;  1BJZ A;  4NDL A;  1ETX A;  1NK3 P;  5F04 A;  1W0T A;  1ZR2 A;  3IH4 A;  1HDD C;  2R0Q C;  1IC8 A;  4BXX J;  4A3B J;  3TP3 A;  5JLX A;  1I3Q J;  1UMQ A;  1D5Y A;  1BW5 A;  1ETO A;  1T56 A;  4B3A A;  1YRN A;  4XRS A;  2IBD A;  2VKE A;  4XRM A;  3A03 A;  2PMZ N;  4D7N A;  1RPW A;  1IDZ A;  3VPR A;  2HYJ A;  1WH7 A;  2P81 A;  2K9N A;  1NTC A;  1FTT A;  1PUF B;  5E3N A;  3BQZ A;  2ECB A;  5C44 J;  2G0E A;  4FE7 A;  3B6A A;  3S14 J;  2DMQ A;  2E2J J;  3K7A J;  2VUM J;  3GTJ J;  3NAU A;  2CUE A;  1FEX A;  3BQY A;  4D7M A;  1A5J A;  3Q0W A;  4V2F A;  2DA7 A;  1VF9 A;  3WHC A;  1U9O A;  3JRA A;  4QIW N;  1DU0 A;  4JX5 A;  3BR6 A;  1MBE A;  2QCO A;  4A69 C;  4DYR A;  2CQX A;  1ZK8 A;  1K61 A;  3BR3 A;  3LOC A;  3OSG A;  1RR7 A;  1WI3 A;  3NAR A;  4MLO A;  5IP6 A;  5J1R A;  2GM4 A;  5EYR A;  2EZK A;  4V2G A;  4DW6 A;  1GV2 A;  3Q3S A;  2R5Y B;  1ZR4 A;  3HOU J;  1LFB A;  2ID3 A;  2LR8 A;  3HGY A;  2COB A;  2XB5 A;  3ZQL A;  1XS9 A;  1I50 J;  4DCK A;  2M8G X;  5IYD J;  1H88 C;  2JA5 J;  4BBS J;  5EEA A;  2AHQ A;  2NS8 A;  2R92 J;  1AHD P;  3RKQ A;  3QPL A;  3BTL A;  1IGN A;  2OPT A;  4C3J J;  1JT6 A;  2R93 J;  2WV1 A;  5FKL A;  2L9R A;  2M34 A;  1H8A C;  5K7H A;  1ETY A;  3S1M J;  2OF7 A;  4DYC A;  4BBR J;  3E7L A;  1IJW C;  2DMN A;  2LKX A;  2NVX J;  1U9N A;  3LSJ A;  2FX0 A;  1EF4 A;  2E1O A;  3FK7 A;  3I4M J;  5JLW A;  2YS9 A;  5EG0 A;  5F0H A;  1HCR A;  5F08 A;  3W6V A;  3S16 J;  5GP9 A;  1U8B A;  5M3F J;  3L1P A;  2CRG A;  2HXO A;  2LVS A;  5M5Y J;  3MKL A;  2LD5 A;  1A6I A;  4XIC A;  3BR1 A;  2HI3 A;  5IP7 J;  2L7M P;  1U78 A;  5IPA A;  4M3B A;  3BG5 A;  3FIW A;  4MO7 A;  5J1U A;  1RES A;  5FLM J;  1H89 C;  1FJL A;  2ME0 A;  1OCT C;  2DA3 A;  3JRH A;  1QVU A;  2XGE A;  3O8H A;  1B8I B;  3SJM A;  3SFI A;  3IH3 A;  1F36 A;  1GV5 A;  4M3E A;  4BY1 J;  2HOA A;  2XGD A;  1ITY A;  3A01 B;  5IYC J;  1WCM J;  1JUM A;  1X58 A;  1G2H A;  4A3E J;  1JTX A;  1TWH J;  3HGG A;  2KDZ A;  4C3H J;  4RBO A;  2O9L A;  2E19 A;  1QPI A;  4UUS A;  2CQQ A;  1TWC J;  5J3L A;  2B63 J;  2MW8 A;  4FCY A;  1ETQ A;  3DCF A;  4MFE A;  4D5C A;  5F1J A;  1GT0 C;  2X6O A;  2GBY A;  3LSR A;  2Y9Z A;  5F0C A;  5EGO B;  1GVD A;  2DJN A;  3I4N J;  2EBI A;  2R5Z A;  3HOW J;  4JPZ B;  2DN0 A;  1JJ6 C;  5FKK A;  5IOZ A;  4M3D A;  5J1Y A;  1POG A;  1ETW A;  2ME6 A;  2FJ1 A;  4JX6 A;  3MN2 A;  3F0C A;  1OCP A;  2LLK A;  2AO9 A;  1R9T J;  2ZB9 A;  5F27 A;  3K2A A;  4AYB N;  3O8G A;  2I10 A;  3JRI A;  5HOD A;  5EF6 A;  3M4O J;  3OOU A;  2L0K A;  2DA5 A;  3FIS A;  1F43 A;  1MBJ A;  1JGG A;  1B72 A;  4CYC A;  3HBL A;  3S15 J;  4JP0 A;  1DU6 A;  3BR0 A;  2EQR A;  2JJ7 A;  4X6A J;  2Y2Z A;  3S1N J;  2NOG A;  4A3G J;  4IEJ A;  3HOY J;  1ZKG A;  3ZQH A;  3SDG A;  5EG0 B;  3OIO A;  3ZQC A;  1Z0X A;  1RKT A;  2FQ4 A;  3PM1 A;  2R7Z J;  3IV5 A;  3H3V K;  1JKO C;  1WH5 A;  3TW7 A;  1ENH A;  4I76 A;  1VI0 A;  2R5Z B;  2JA8 J;  2LTP A;  4GFB A;  2JA7 J;  2Y0S N;  4MFD A;  3PO2 J;  5C3E J;  3BTI A;  2HOS A;  3UKG A;  2HOT A;  1JKR C;  2L7F P;  3BTJ A;  1CQT A;  3LSG A;  2EZH A;  5IP9 J;  4UUS B;  2K9Q A;  1RKW A;  1O4X A;  4DZJ A;  3D1N I;  5IYB J;  4B4C A;  2E2I J;  2CU7 A;  2GLO A;  3S2H J;  3ZQG A;  4IHW A;  3HKZ N;  3FKI J;  4BY7 J;  2DA6 A;  3GBG A;  2LFB A;  2YUS A;  2YU9 J;  2K9S A;  2LK2 A;  3M3Y J;  2H8R A;  2XSD C;  2MSY A;  4Y52 J;  1Q1V A;  1OFC X;  5FKM A;  1HOM A;  2TRT A;  4FIS A;  4M3G A;  1W0U A;  1JUP A;  3CQZ J;  2Y30 A;  2K40 A;  2JN6 A;  3CCY A;  1JKQ C;  1MBG A;  3GTO J;  1LFU P;  1FIA A;  1SFO J;  1WPK A;  1VFC A;  2TCT A;  3MVP A;  2DA4 A;  2VI6 A;  3GTG J;  2LP0 A;  4JX4 A;  2Y9Y A;  1MSE C;  2JA6 J;  1ZQ3 P;  2EH3 A;  2VKV A;  5E3O A;  4A3M J;  3LSP A;  2JMW A;  1ZGW A;  1JT0 A;  2EZL A;  1YRN B;  3PO3 J;  5GPA A;  3B6C A;  4AC0 A;  3TW6 A;  2DMP A;  2DTZ A;  3TED A;  4M3F A;  5E3L A;  1BW6 A;  3JRE A;  3JRB A;  1IV6 A;  4C2M J;  4HNV A;  4L5E A;  2DMT A;  4D5F A;  2XGC A;  2DMU A;  3JRC A;  2IEK A;  2WAQ N;  5EGO A;  3HOX J;  4Y7N J;  3GTM J;  1JUS A;  5GPC A;  2R5Y A;  2IAI A;  1Z77 A;  2QF7 A;  3ZQI A;  5IOY A;  1QRY A;  4A3J J;  3HDD A;  1TWF J;  3QQA A;  2X9D A;  1AU7 A;  3JRD A;  3S17 J;  3HM5 A;  1B8I A;  3G1L A;  3ZOB A;  4J19 A;  2DA2 A;  1IDY A;  4A3I J;  2DA1 A;  3A02 A;  1BA5 A;  2HDD A;  4A3F J;  4G12 A;  5K7F A;  1TC3 C;  5FKN A;  3HOZ J;  1K83 J;  1I6H J;  1S7E A;  1SAN A;  2Y31 A;  3BT9 A;  4S0H B;  4IHV A;  3GTK J;  1PUF A;  4DYQ A;  1MBH A;  2ECC A;  3JRG A;  5DS9 A;  4IHY A;  2O7O A;  1UG2 A;  2M9H A;  3HB9 A;  1TWG J;  3RQI A;  1MSF C;  5FLV A;  5EDN A;  4CYC B;  4A3K J;  3RZD J;  1B72 B;  2W48 A;  5C4X J;  1T33 A;  4QSH A;  4LOC A;  3GTL J;  3C2B A;  4ABZ A;  1JJ8 C;  4XK4 A;  4BKX A;  2JWT A;  1IUF A;  2N8G A;  2VPR A;  1XG1 A;  1MBF A; 
#chains in the Genus database with same CATH topology
 1EH8 A;  1RNL A;  4WK8 F;  2FXM A;  1AQT A;  1W2B O;  3K70 D;  2ZXI A;  3DP7 A;  4HX8 A;  4YII A;  1R7J A;  2KIF A;  2L7Z A;  2ID6 A;  4EMS A;  1LQ1 A;  3ONQ A;  4BAY A;  1W5T A;  2X48 A;  2G8Y A;  3Q5R A;  4BQA A;  2VN2 A;  5K5G B;  5CVI A;  3VP8 A;  5ERI A;  1KYZ A;  2NVY J;  2M5W A;  2MKV A;  4PJ0 C;  3FHN A;  3HOT A;  2GQQ A;  3KZY A;  3WHB A;  3RK3 B;  2QUF A;  3EUH C;  4DOZ A;  5A9S B;  1OJL A;  5F0F A;  3W3C A;  3L74 G;  2HZT A;  3BRT B;  4U3F J;  3DPT A;  4PFP A;  4P1W A;  4BQQ A;  2N9Y B;  2X0L A;  2OQQ A;  4EV0 A;  1PGO A;  1ORK A;  2QEN A;  3FDY A;  3HUS B;  3VOD A;  1X1D A;  1Z56 A;  2L9N A;  3BZ6 A;  2QSH X;  3G9R A;  3RTR A;  5KVR A;  1FP2 A;  1UHW A;  3SZT A;  3RBX A;  4EJW A;  1XC5 A;  1BIB A;  5J47 A;  1U6G A;  2DFF A;  1RC9 A;  3AG3 H;  1G4D A;  4A3C J;  2LDU A;  4OVN F;  1HF0 A;  5D4R A;  3OS0 A;  1X2N A;  3MUD A;  5CVV A;  4M6X A;  2QBY B;  2RMZ A;  3C2H A;  5CCH C;  1GTW A;  1P7J A;  3BCA A;  1YIJ P;  4QWQ A;  4U0W A;  2A3S A;  2O3F A;  3GCM A;  3MQ0 A;  4M74 A;  4FE4 A;  3I55 I;  1T3U A;  1VPD A;  4Q5S F;  2X1D A;  1ZG5 A;  1MZ9 A;  1LTJ B;  1DDN A;  1DIP A;  2KT0 A;  3M07 A;  3V2P A;  3ML6 A;  5ICC A;  1SMY F;  1PJR A;  5KAI C;  3V8L A;  3N97 A;  1AKH B;  2WT7 A;  1ULY A;  4WXH A;  2VJJ A;  4Y15 A;  3EQ2 A;  2RN7 A;  2ELK A;  2FD5 A;  2WB1 N;  2R7W A;  1E3O C;  4BJT A;  1VQK I;  3S2D J;  1LTS C;  3CCQ I;  1BL0 A;  2QRX A;  3L71 D;  4HPQ A;  1NO4 A;  3KEQ A;  3A3Y B;  1IV8 A;  3KCC A;  3Q0V A;  5HS9 A;  2CV2 A;  1L0N E;  5BU5 A;  3TGU E;  2G7U A;  3HRT A;  1NK2 P;  3RZO J;  3ZW9 A;  1XMA A;  4MIM A;  4A7P A;  4R4M A;  2K9M A;  1FOK A;  3OYH A;  2M0C A;  3LNQ A;  1IK7 A;  3GTQ J;  4XLE A;  2H1K A;  1ZRT D;  2HDH A;  1T0F C;  2KK7 A;  3GW6 A;  2XPW A;  3GHY A;  2HQ5 A;  2WTE A;  3H0G J;  3F3S A;  3EFF K;  2EZI A;  3QP5 A;  5HNF A;  1WJD A;  3HPH A;  3HSR A;  3QWL A;  2WSC J;  1VQ7 P;  2QZ8 A;  2WAD A;  3ISP A;  2V6C A;  4OWF A;  1FNN A;  4OMY A;  3O2P E;  1MMA A;  3LA7 A;  2B87 A;  4AIK A;  3ZP5 A;  1S9K D;  3K9T A;  4CCO A;  4KFC A;  2VE9 A;  3HEF A;  2NVT J;  3F8N A;  2Y0D A;  2BVL A;  3GZN B;  1ETK A;  3G3Z A;  1TXG A;  2DLL A;  3DBH B;  4NDL A;  2FSW A;  1ETX A;  1NK3 P;  3W2A A;  3CXH H;  3HD7 B;  2A6H F;  1W0T A;  1BCC E;  1ZR2 A;  1RUN A;  2WPS A;  3OY9 A;  1HDD C;  2YPR A;  4UVC A;  1MW7 A;  4BXX J;  3D5L A;  5BQT A;  5CCG A;  3V8J A;  2EFP A;  1Z6R A;  3NWT A;  3JSO A;  1I3Q J;  2L9V A;  1P84 E;  4CHU A;  1WMK A;  1VQP P;  3H5N A;  4RLQ A;  4LK0 F;  3FKJ A;  3H1K G;  3TNU B;  3ZGK A;  4D6T D;  4QLC U;  2IBD A;  4IRH A;  1OR7 A;  2KIM A;  5GAG J;  4I01 A;  3ZHB A;  3FWE A;  4DLL A;  4XRM A;  3KDP B;  3O8Z A;  4XFJ A;  1M90 Q;  2PMZ N;  2W85 A;  1QGP A;  1RPW A;  1XDS A;  3VPR A;  2OZ6 A;  1D5V A;  1IDZ A;  2JJL A;  2KOG A;  4XQF A;  3H1K J;  2P81 A;  3K0L A;  3T8R A;  1QZY A;  2Z99 A;  3OYD A;  1NTC A;  2ZO4 A;  1HWT C;  3CCJ P;  1L4A A;  2ECB A;  2F5F A;  1GD2 E;  2HOE A;  2Q2E B;  3TL4 X;  4YFX F;  3S2W A;  2DDA A;  3L37 A;  3FBI B;  1JY2 O;  3AL0 B;  4HNU A;  5HDK A;  2VUM J;  2N1T A;  5KJ7 D;  1BC7 C;  2CUE A;  4IOI H;  3BQY A;  4D7M A;  2JTV A;  1IRX A;  1NG6 A;  3WG9 A;  3WHC A;  4OM8 A;  5KLV G;  2IRF G;  1QGK B;  3V6I A;  1MUU A;  3LSH A;  5D6E A;  3H1H G;  3CMA P;  1OCC H;  4LG0 B;  3GFJ A;  2ZJR F;  1MBE A;  2DOE A;  4F91 B;  3WTY C;  4EGZ A;  1EV7 A;  3S3O A;  2P58 A;  2CQX A;  1VQ8 I;  1ZK8 A;  3OA7 A;  1FT9 A;  2E35 A;  3LOC A;  2OYH C;  4I0B A;  5J1R A;  1IRF A;  3R2P A;  2QJP C;  1DP3 A;  2XAU A;  1L2P A;  4RM2 A;  4V2G A;  3CZ6 A;  4DW6 A;  3Q3S A;  3HOU J;  2CV0 A;  1SQV D;  4G94 A;  4R1N A;  4BHB A;  1YI2 I;  5TIS C;  1NTK G;  1XS9 A;  1PP8 F;  3L7W A;  3VYU B;  3PIO F;  4S3M A;  5D5U B;  2HOD A;  3DTI A;  4OAZ A;  5A9T A;  1WZ2 A;  4LLG F;  2NVU B;  1IAW A;  4KUG A;  4UB6 C;  3NTN A;  1RI7 A;  3PLN A;  5APV A;  4ENK A;  1U7M A;  3Q1M A;  2P10 A;  3H0D A;  5KKZ B;  3N7N A;  4XON A;  3AE9 C;  1T0F A;  4G8X A;  3FWL A;  3J7Y J;  2MC3 A;  1UZC A;  5FKL A;  1OIP A;  3CCE P;  1FOX A;  5J40 A;  2HYG D;  2VBY A;  5BU8 B;  3PNY A;  4B3H A;  2OA4 A;  2ZXJ A;  5ICF A;  1M1J A;  3CUO A;  2BEZ F;  2Z3Y A;  1SFK A;  2XAG A;  2XC7 A;  4DYC A;  5ILS A;  1BI2 A;  2LKX A;  2BW3 B;  1DUX C;  1FZA A;  3W6J B;  1URQ C;  3TF5 A;  1YHQ P;  4XL9 A;  2GZW A;  2FX0 A;  4DJA A;  3N4M A;  4HNT A;  5BPD A;  5AVU B;  1CI6 B;  1FZP B;  3S32 A;  4HH2 A;  2QQB A;  3FK7 A;  4A5N A;  1LP1 B;  1Q82 Q;  2FFD B;  1ZAO A;  4GXO A;  3V2N A;  5F0H A;  3J81 K;  3S16 J;  2W82 A;  1NU1 D;  2GIV A;  1U8B A;  4PV1 B;  4PV1 D;  2VE8 A;  4OWR B;  5M3F J;  3RK3 C;  4IX7 A;  3M06 A;  1J1E C;  1O7F A;  2G7H A;  4LB5 A;  1GL2 D;  4G6T B;  5AVX B;  4XSX F;  1NJI Q;  4I7Z C;  1OR7 C;  5M5Y J;  2LD5 A;  1IF1 A;  1A6I A;  1LP1 A;  2FFD A;  1MFT A;  2ZT9 C;  2O03 A;  2R7Q A;  2DFI A;  1U78 A;  1VQM P;  2D1V A;  1FX7 A;  2VJI A;  3K4C A;  4M9Z A;  4BU2 A;  1JY2 P;  2UV1 A;  1VQN P;  1WQ2 A;  1Y56 A;  3CCJ I;  4BDZ A;  1XTA A;  3HPG A;  2BYV E;  5HOO A;  1S4X A;  2ME0 A;  2ZFC A;  2DA3 A;  1W36 D;  3GG2 A;  4ANJ A;  3SWY A;  1OPC A;  3JAM Z;  1Z7L A;  3SFI A;  1F36 A;  3KPH A;  4M3E A;  2YMY A;  3IF4 A;  4ZMD A;  3Q5S A;  2XZR A;  2PJR A;  1EH6 A;  3DPL C;  1NG7 A;  2LMD A;  3WG7 H;  1VL2 A;  2XGD A;  2O3J A;  3A01 B;  2C0X A;  2CSO A;  1X58 A;  1P92 A;  3VWB A;  2Y0E A;  3FBN B;  1JTX A;  1C0W A;  2YU3 A;  1RF1 C;  3RGU A;  1AFO A;  1EH7 A;  3GF3 A;  3MZ8 A;  2E19 A;  2PMU A;  4ITV A;  5F6F A;  3G6E I;  1QPI A;  1PPJ E;  2M3E A;  4J0F A;  1I6X A;  4GGG A;  1SQV K;  2WSS H;  1S9H A;  1KN7 A;  2EFQ A;  1IXC A;  5GTH C;  4CZC A;  5KAF C;  2LBF A;  4MNU A;  2O6G E;  2UWM A;  1BM9 A;  1SQQ G;  1NTM G;  4CGZ A;  3V2R A;  1DH3 A;  3C7A A;  2RQQ A;  2KMU A;  1L0L K;  3VSK A;  1OW7 A;  2VIX A;  3OYM A;  4XLF A;  1YTZ I;  3F8B A;  2LSO A;  4CZZ A;  2I9P A;  2K86 A;  2P2U A;  1YI2 P;  3M0D A;  5BMZ A;  1WDM A;  4Q47 A;  2V9P A;  5DD8 A;  3RDI A;  2G9W A;  2R5Z A;  3AAF A;  1ZLK A;  2LKM A;  1DGW Y;  2FOK A;  4OIR F;  4JPZ B;  3WGI A;  2UZK A;  3RJP A;  3VOP A;  4M3D A;  4IL6 H;  1K4T A;  3HL2 A;  1LT1 A;  2P5K A;  4IF4 A;  2DT6 A;  3RCO A;  1R23 A;  5F27 A;  3ULK A;  1P4W A;  3OL3 A;  2Y69 H;  3OR1 C;  2MD0 A;  1BJA A;  3N05 A;  1F9N A;  1ZG1 A;  2JSC A;  3O8G A;  2I10 A;  3RKY A;  3F21 A;  5APT A;  3HC7 A;  2L54 A;  5HS7 A;  4ZYE A;  2FU4 A;  3L36 A;  4PFO A;  4CYD A;  4QMA A;  4IHS A;  3OOU A;  3W6Z A;  3PLR A;  1IFJ A;  5KJ7 C;  5K1Y A;  4PJ0 E;  2NYX A;  3D1L A;  1BGY G;  2Y0M A;  3A0B H;  1VDF A;  1XSV A;  2HKO A;  4EM2 A;  1B72 A;  4DOJ A;  2E1M B;  1NAF A;  4XRF A;  4BE0 A;  3HN2 A;  3NQO A;  4F3Q A;  3LQR A;  3LFK A;  5APU A;  1GMJ A;  3S1N J;  1B4A A;  3BCB A;  1V5E A;  2P67 A;  2LXC B;  2DJI A;  3D6Y A;  3FMR A;  4ESJ A;  3A0H C;  3BWG A;  5BS6 A;  3E6C C;  3QYE A;  1DP7 P;  1LT9 C;  3JSV C;  4PV1 C;  2D2C C;  4W7Y A;  2FNP A;  3VMA A;  4FET A;  3W6K B;  3IWF A;  1QL1 A;  1TNS A;  4M71 A;  2EV6 A;  4HF2 A;  2V4H A;  1JKO C;  1WH5 A;  1JHH A;  1ENH A;  3A5T A;  2IGK A;  3NEU A;  1T2K A;  1KU9 A;  2ZXH A;  3V8K A;  1VQ4 P;  4AVZ A;  2VBW A;  4XMY A;  1XCV A;  5TJH A;  5D8L B;  2W8Z A;  2VKD A;  3TMO A;  2Y0S N;  4HDU A;  3CCR P;  1QVF O;  2XAQ A;  4P9F A;  4HSR A;  3PUF A;  2D3T A;  2HOT A;  5FWN A;  2Z2S B;  1SFU A;  1JKR C;  3E6B A;  2V9V A;  2KLO A;  2LY2 A;  2ZXW H;  2BEQ D;  3GX4 X;  1XDU A;  2OTJ I;  3LSG A;  3EPZ A;  2BBY A;  1O3S A;  1FP1 D;  1SVL A;  3KP2 A;  1HKS A;  4Y13 A;  3J80 Z;  4I6M C;  4B48 A;  4A12 A;  4EOT A;  1IFD A;  2RN0 A;  4H4K C;  4B4C A;  1NTZ G;  3E1S A;  4U0V A;  2WSC H;  1VQ6 P;  5APW A;  1FOS E;  4CXF A;  5K5R A;  1LVA A;  1YJN I;  1PP7 U;  1FOS F;  3FXR A;  1F1Z A;  4IHW A;  2QJP B;  2XDJ A;  3LAP A;  5KK1 A;  1L0L J;  1X3W B;  2ICW G;  4AIH A;  4P55 A;  1NTZ J;  3ECH A;  2O0Y A;  4JK1 X;  1LDD A;  4LG3 A;  1A31 A;  3ZRG A;  3GBG A;  2HYN A;  2A5W A;  1MKM A;  3AG2 H;  3A0B E;  3CCS P;  3HTU A;  1RE4 C;  1OQY A;  3G0O A;  2B7E A;  3PNV A;  1HF9 A;  2MSY A;  1Q1V A;  3MWM A;  3RK2 C;  4IHT A;  2WT7 B;  2P6S A;  2PN6 A;  5FKM A;  1R8E A;  1JEK A;  1FMV A;  2ITA A;  2E42 A;  2R7F A;  1N1E A;  3ZMU A;  1PGP A;  4XLC A;  1JUP A;  2LC2 A;  3ADP A;  2K40 A;  4IOC F;  3GTO J;  2XIG A;  1Q90 D;  1LFU P;  2O1K A;  4HST A;  4L5J A;  2TCT A;  3MVP A;  5AVV B;  2RQP A;  2Y9Y A;  1ZQ3 P;  4RKU J;  1LEA A;  2EH3 A;  3U1D A;  5JE8 A;  2YSR A;  1XB4 A;  1LT9 B;  4A0Z A;  4HQE A;  2EFN A;  2BZT A;  4Y3O A;  5B1B H;  3LSP A;  4A3M J;  1YIJ I;  3AEA C;  3PQK A;  1QA6 A;  2ZYD A;  2IVM A;  3V2Q A;  1YRN B;  2WWY A;  3I55 P;  3HAD A;  1HUC A;  5IT3 A;  2A68 F;  2VQC A;  4RMN A;  3E1R A;  4ZDO A;  4EJU A;  2LRE A;  2L91 A;  1R6R A;  3B6C A;  4RJT A;  4PK4 A;  4RM3 A;  4L9T A;  4AC0 A;  3CC7 I;  3IC7 A;  2KIS A;  3TGN A;  1EZV D;  3GF7 A;  1XMK A;  1KYO H;  2DPD A;  2AXT H;  1R36 A;  1Q7Y Q;  3DV8 A;  3L72 J;  2W84 A;  1R5S A;  1J5Y A;  1BSH A;  4U3F E;  3RL0 C;  2XF5 A;  4HNV A;  5A9S A;  2DMT A;  2XGC A;  1VQ4 I;  1OLT A;  1SFC A;  2YXQ B;  4HJG H;  1TNT A;  1WJF A;  2E75 D;  2IS1 A;  1YOV B;  1G8X A;  4IL6 E;  4ZZL A;  2IA0 A;  3HYI A;  1UAA A;  1M7L A;  1NHA A;  1IN6 A;  4W80 A;  5JI6 A;  2WAQ N;  2F4I A;  4Y7N J;  4L5I A;  1JUS A;  3F6V A;  3OV8 A;  4RAZ A;  2VQH A;  1FZG A;  3F9K A;  2H27 A;  1KQG B;  3CLQ A;  1H9T A;  1VF5 C;  2QEX P;  2STW A;  4LLL A;  2GA1 A;  4IRG A;  1FBQ A;  4H0E A;  4LLH A;  3K96 A;  4EJO A;  2XVC A;  4BS9 A;  3I83 A;  1FC3 A;  4EQQ A;  1QVG O;  1MGT A;  3S8P A;  3L2V A;  1AU7 A;  3C7J A;  2BY3 A;  1LTG C;  5E79 H;  3HM5 A;  3MKZ A;  1IN7 A;  3G1L A;  4PJJ A;  2W4S A;  3CDH A;  3OYJ A;  1BIA A;  4NC7 A;  3ZOB A;  2R7R A;  1SEU A;  1IDY A;  2DW4 A;  2DA1 A;  3A02 A;  1CGP A;  3V7C A;  1F0Y A;  1IZN B;  1L0O C;  2ZAE B;  3WU2 E;  2ZT9 B;  2ZT9 D;  4G12 A;  1FDO A;  5K7F A;  1SQP D;  3H9Q A;  1SQB E;  4U3F G;  4DT0 A;  3LID A;  2QQ8 A;  1S3J A;  4XR6 A;  3HOZ J;  3WGG A;  1IRG A;  3KET A;  4NPF X;  3E6M A;  1FBS A;  4RLF A;  4S0H B;  4LFU A;  2KIQ A;  1FE6 A;  1SLQ A;  1XSD A;  5LLQ A;  1IUY A;  3H1J G;  1NTK D;  4DYQ A;  1G3S A;  1UEL B;  2M8E A;  3I54 A;  1T8I A;  3H2Z A;  2IGM A;  4IHY A;  2O7O A;  1UG2 A;  3HB9 A;  3L70 D;  5EDN A;  2W48 A;  1PPJ D;  2ZVN B;  3EFG A;  3QPT A;  1YG2 A;  2JWD A;  2XAH A;  1X0T A;  4LOC A;  1N77 A;  2DK8 A;  3C2B A;  4B44 A;  4CCK A;  4GCV A;  1IL0 A;  1Q81 Q;  1OCR H;  2XF7 A;  3HRU A;  1JB0 J;  2UUZ A;  4BKX A;  5AW1 B;  1TQP A;  1IUF A;  1PIX A;  1XG1 A;  4L75 A;  1BI0 A;  2XV5 A;  1ODD A;  2YMK A;  3DPU A;  5JHU A;  2Q8K A;  1EZV I;  2YO2 A;  1KQS O;  2K1A A;  3O3K A;  3GW2 A;  3BR5 A;  2O8K A;  3FXL A;  3C3W A;  2CUF A;  2DK5 A;  4Q48 A;  3BTC A;  4XOT A;  1ETV A;  1MMN A;  5C4J J;  1HKT A;  3CO6 C;  1S5L X;  1QLE D;  5E8G A;  2R7V A;  2XB0 X;  4EJV A;  3L4F A;  2KZG A;  2MG4 A;  3L73 E;  3LST A;  3BRV B;  3OYI A;  2E5N A;  5BNG A;  4A5M A;  3CC7 P;  2VRS A;  5CJ4 A;  3KP7 A;  1YFH A;  1IFM A;  1LTT C;  2ETH A;  1SFC B;  1D0X A;  3DQV C;  1T38 A;  4XOP A;  1I5Z A;  2CW7 A;  5M5W J;  2LKP A;  2FOW A;  2CUZ A;  1XPX A;  1URQ D;  2OJE D;  2BCC J;  3NXS A;  3HUG A;  3Q0U A;  3BG3 A;  1IG7 A;  4UB8 H;  1JCC A;  1T2K C;  1M2W A;  3BG9 A;  3QPS A;  3V42 A;  3HKZ A;  3OYN A;  3MUD C;  1CW5 A;  4MTE A;  5EZG A;  4RDU A;  3B5N B;  2DFE A;  3DKW A;  3LSK A;  2PX9 A;  3H1I E;  2IXS A;  2QJY C;  4IFM A;  1LVK A;  2GAU A;  1R5G A;  2VQL A;  4B09 A;  4CA0 A;  3MKY B;  4B1R A;  2HTS A;  1G3T A;  3R60 A;  4KIB A;  3Q5F A;  3K6G A;  5K5O A;  4PD4 D;  4D6T E;  4ZDL A;  5B5E C;  5FJ8 J;  2OTL I;  5JVG F;  5KLV E;  2VB6 A;  1MBK A;  1F4K A;  3HOV J;  2BXZ A;  1KMI Z;  4XRS G;  5H20 A;  2PFB A;  2JK3 A;  3EYI A;  1MH3 A;  2XPV A;  5GAD J;  4PJN A;  1Y8R B;  1FYM A;  1JGS A;  3WTZ A;  3SFE C;  3WU1 B;  4BXL A;  1UB9 A;  2XKP A;  1U3E M;  1D0Y A;  2X6W A;  4EI2 A;  2OZU A;  3RYP A;  2DYR H;  2OBP A;  2HDW A;  4QTR A;  5IT9 K;  2CK3 H;  3H32 B;  2BY1 A;  3CL3 D;  1AV1 A;  2QM3 A;  1SMT A;  2V9K A;  1NU1 K;  2OCE A;  3WTS C;  2P7V B;  1NTM J;  1SFC D;  3CX5 I;  2D2C D;  3V5B A;  5B66 H;  5TRD A;  2DOD A;  1VQO I;  3D70 A;  2K9J A;  2H94 A;  3TNU A;  2HFE D;  4RGU A;  1NTZ D;  4WB4 A;  3RL0 B;  4EJT A;  2UYY A;  1X2M A;  1BG6 A;  1N73 A;  2BGC A;  2K3F A;  3CME P;  3LSI A;  2DCE A;  3HG9 A;  4ENM A;  2HS5 A;  4EDF A;  2E36 A;  2Z5H A;  1OCO H;  1YBK A;  1KA8 A;  1RET A;  1U5T A;  3ZQF A;  5MGB A;  4WWC A;  3AE7 C;  1OMI A;  2P7J A;  1MJ9 A;  1BBY A;  2M8R A;  2V7F A;  1J2J B;  1GLN A;  3P9I A;  1SQX K;  1JE8 A;  2V1X A;  5M3M J;  1MNM C;  3B5N A;  1IXR C;  1FIP A;  3GO5 A;  3B8E B;  2VPL A;  5DYM A;  1VQ5 P;  2CUJ A;  5EZH A;  2JO1 A;  1P7I A;  2V4J C;  5JVT A;  2PGD A;  2ZJS E;  2Z16 A;  4A3L J;  2DDB A;  4WCG A;  4E7L A;  4NUB A;  3FXE A;  2LRD A;  4XID A;  4L18 B;  1S9K E;  1KIL C;  2E74 D;  3CJN A;  4OGQ D;  4YTP C;  3FMQ A;  2LBF B;  1WPQ A;  1MND A;  2X1E A;  1D3Y A;  3CX5 D;  2B0L A;  3J80 K;  1FTZ A;  4ESF A;  2VOO A;  1HKQ A;  1U7J A;  5CQE A;  1IK9 A;  4KT0 J;  1TWA J;  2Q0O A;  3WGH A;  3DU5 A;  2L2O A;  1APL C;  2FYU E;  3K4K A;  1FZC C;  3CJR B;  1Y8Q B;  5DM7 F;  2CQN A;  4D9J A;  2PI0 A;  1S5L H;  3QU3 A;  2BXY A;  4A0Y A;  1LWU C;  5HDG A;  1YX3 A;  2PAJ A;  5JHF A;  1N75 A;  1KFM A;  5AVQ B;  3KYD B;  2RKL A;  2EIL H;  4HZF A;  5CPR B;  3Q9V A;  5JLX A;  3TP3 A;  2P1J A;  3G6E P;  4I0A A;  4JBA A;  1YJQ A;  2AXT E;  1EXJ A;  4NNJ A;  3IFM A;  2OV7 A;  1GW4 A;  1T56 A;  2CO5 A;  1KB9 I;  1PPJ G;  3CCS I;  3NWS A;  1M1K Q;  5BOX A;  2VKE A;  2CH0 A;  2FFD C;  3QRF F;  3R4K A;  3E5Q A;  3WU2 H;  3CCV P;  3E97 A;  1EA3 A;  3R0A A;  4BJ6 C;  4D7N A;  2A45 G;  2H8P D;  3AE5 C;  1V4R A;  4FX4 A;  1URQ B;  3GZ5 A;  3D71 A;  3FXJ A;  1EZV E;  5DM6 F;  2FA5 A;  3CP8 A;  4MQV A;  4KIC A;  2IS6 A;  3L00 A;  5AVT B;  3AEE C;  1OXZ A;  3BQZ A;  3ZQ7 A;  3L73 G;  2G0E A;  2DPU A;  1N7S D;  4L76 A;  4OGQ B;  1WDK A;  1URQ A;  1K6O A;  2L4A A;  4Z1M H;  2E2J J;  3F89 A;  2GXA A;  2K9Y A;  1V55 H;  2BV6 A;  3KIO A;  3MFK A;  4B86 A;  5FRM A;  2PEX A;  3H3U A;  2AQF A;  3GXO A;  1A5J A;  1DEB A;  2ZFU A;  3Q0W A;  2HLO A;  3JRA A;  2P8T A;  4B8X A;  3Q3C A;  1DU0 A;  2IGN A;  4GOF A;  1D0Z A;  3ABM H;  3BR6 A;  1G6N A;  2IS2 A;  4WBA A;  2H6B A;  4DYR A;  4E7H A;  1TU3 F;  5H6R A;  3G73 A;  5FB2 A;  1K61 A;  1ZYR F;  2EV0 A;  2L3D A;  2A06 E;  3OSG A;  3HSE A;  3NAR A;  4MLO A;  2GM4 A;  5EYR A;  2KKO A;  2EZK A;  1KB9 H;  5CVR A;  1R22 A;  2KSJ A;  1SQP J;  3I58 A;  4C2T A;  4M6Y A;  1MFZ A;  3VTP C;  1AA7 A;  3RSN A;  4H44 C;  2WY7 Q;  1LFB A;  1HTL C;  3P9K A;  2LR8 A;  1K73 Q;  1K6Y A;  4XKW A;  5FFX A;  1VQ5 I;  1PL5 A;  3QOD A;  3FX0 A;  1BR2 A;  3CXH E;  4DCK A;  2NPS D;  2M8G X;  1H88 C;  1JI8 A;  1YTZ T;  3EQL F;  1SC7 A;  2AHQ A;  3K70 C;  2NS8 A;  1YJW I;  2WIT A;  3MTU E;  2BCC D;  3USS A;  3H5R A;  3JTH A;  2QA4 I;  5DJT B;  2WAQ A;  1HQC A;  4XKB A;  3SZG A;  1S1C X;  1IZ1 A;  1JT6 A;  2WV1 A;  3KEY A;  2J58 A;  1P4A A;  1LJ9 A;  2M34 A;  2VBZ A;  1F17 A;  2O01 H;  2KYV A;  1ETY A;  1KB9 E;  3L70 E;  2P4Q A;  1UII A;  1KON A;  3CUQ A;  3K4B A;  1AJY A;  2PLY A;  4G9Y A;  2KI7 B;  5KLI C;  4GYG A;  2EIM H;  1SVF A;  2W6B A;  3SFZ A;  2KZI A;  4PSW A;  1U9N A;  1SAX A;  3J7Z I;  4CDG A;  1E0E A;  2NZ2 A;  3CCM P;  3LSJ A;  1PVE A;  3PIP F;  3QWO C;  1OYI A;  5AW0 B;  3WTX C;  1KQL A;  5JLW A;  3W6V A;  2CW8 A;  2V1D A;  1ZG3 A;  4FT8 A;  4I98 B;  5F08 A;  2W27 A;  1KYO I;  2PLA A;  3B5N D;  4O3M A;  1LGH B;  3M1C A;  2K27 A;  1T08 B;  3P7N A;  5HDN A;  3EET A;  4XN3 A;  1JTH A;  2G3A A;  3AE3 C;  1O3T A;  4PD4 I;  2NXN B;  2KQR A;  3MKL A;  1T95 A;  1TT0 A;  2ZJQ F;  1TQI A;  3HRS A;  2VLA A;  3BR1 A;  3WFJ A;  3H1C A;  4OAY A;  1X79 B;  2HI3 A;  3CC2 P;  3KP6 A;  3L70 J;  5IPA A;  2BW3 A;  1RIO H;  3CTA A;  1Z1D A;  3FIW A;  4OIN F;  5J1U A;  2GXB A;  2E71 A;  1EVZ A;  1G1J A;  4C9Y A;  1ZLJ A;  1RES A;  5ILU A;  2H88 C;  3U59 A;  4BDY A;  4B47 A;  3KZI E;  2E1C A;  3JRH A;  3L72 E;  1RF0 A;  1KQF B;  3SJM A;  3TDU C;  1JXS A;  1T6A A;  1BGY J;  1R5L A;  3QYB A;  1KU3 A;  3H1L E;  2ACJ A;  4KN4 X;  5B3S H;  4A2U A;  1ITY A;  1FSH A;  5DJU B;  5IYC J;  1WCM J;  3NRV A;  1SD5 A;  1G2H A;  4A3E J;  4IL6 X;  3BRO A;  1YJN P;  2L9S A;  2P5L C;  4E7S A;  2KDZ A;  3ABT A;  2Z33 A;  2K37 A;  3TGU J;  1N73 C;  2CQQ A;  5KLV J;  3K6J A;  1USD A;  4BHP A;  2HWV A;  2B63 J;  2E60 A;  2MW8 A;  1YB4 A;  1KZU B;  3VYI A;  4R4L A;  3V7S A;  5GAH J;  3VP9 A;  4FCY A;  1J09 A;  3DCF A;  4MFE A;  4D5C A;  5F1J A;  2X6O A;  4PSX A;  4U88 A;  3TO9 A;  2M4K A;  5HWS A;  4GOE A;  5D5W B;  2QJY B;  2K4B A;  4XLP F;  3DFG A;  1VQK P;  2DJN A;  3GUD A;  3OS1 A;  3MP7 B;  3T0Y A;  4GKG A;  1HC8 A;  4L9N A;  5L3G A;  2DN0 A;  3PUB A;  4B3J A;  5IOZ A;  1Z91 A;  2HQN A;  2KDO A;  3L73 D;  4UUV A;  2ZSI B;  1LEB A;  2PJP A;  1SD6 A;  3H36 A;  4JX6 A;  3TGU G;  1I27 A;  1AWC A;  2C9L Y;  2LLK A;  1Q1H A;  2AO9 A;  3L35 A;  2OAR A;  3K2A A;  4F55 A;  1VTN C;  3M0A A;  2O8X A;  4P9U A;  2PBI A;  1WJA A;  2AXL A;  3JRI A;  5EF6 A;  3CXH I;  5M1B A;  4ZJZ A;  1NWQ A;  3L9F A;  5H2F C;  2L0K A;  2WQY C;  1YQ3 C;  1VPC A;  4K2E A;  4AVP A;  1MBJ A;  4CO8 A;  3M9Q A;  4IQ4 A;  4D6T G;  3I4P A;  2XAF A;  2HYF A;  3H1K D;  3ZWA A;  1PUE E;  3I56 I;  1HBX G;  4YIF A;  1HH0 A;  3CF5 F;  1LT9 A;  1YVE I;  3H32 A;  2HR3 A;  3S15 J;  3M9H A;  1JNM A;  1SQP G;  4TLF A;  3CPW O;  3RL0 g;  1TBX A;  1A04 A;  1IO2 A;  4S04 A;  2JJ7 A;  2M0M A;  1QU3 A;  3PDU A;  5CCG C;  5H6Q A;  5KAI H;  2NOG A;  2ESH A;  3BCC G;  4IEJ A;  2KIK A;  4GWK A;  2QVA A;  1LKX A;  3SDG A;  1AOY A;  4E6K G;  3HUS C;  3NMD A;  3QU6 A;  3OIO A;  1W2E A;  3P7K A;  3ZQC A;  2E43 A;  3EGO A;  2DI3 A;  3CX5 E;  4LGW A;  3KP4 A;  4AIJ A;  1LTA C;  3IV5 A;  3H3V K;  1STZ A;  3WUV A;  3CUQ B;  2C6Y A;  2V1U A;  5LBQ A;  2M30 A;  3E5U A;  2AQE A;  2QSI A;  2BHZ A;  1V3F A;  3H1J E;  3E3V A;  2I76 A;  5FLX K;  3MD2 A;  4GFB A;  4HOB A;  2JA7 J;  4H13 D;  2OYI C;  2E75 C;  4L0Z B;  3FR8 A;  1GW3 A;  3CF2 A;  1D1A A;  3HE4 A;  2J59 M;  3BG6 A;  2HOS A;  4H0L C;  2RNG A;  2WY8 Q;  2KRC A;  2L7F P;  4AU7 A;  3AE2 C;  3HSF A;  1BN5 A;  1XX5 A;  5FLX Z;  1OVR A;  2W6A A;  2BOL A;  1WFX A;  1QX8 A;  1Z9C A;  2EZH A;  2QJK B;  5IP9 J;  4DZO A;  1Y0N A;  1MD0 A;  4N6J A;  2I8D A;  5LHH A;  2K9Q A;  3BPX A;  3CCL P;  1EVY A;  2ZNY A;  2A05 A;  1M67 A;  2QQ9 A;  4DZJ A;  4EZB A;  1MJA A;  3U9G A;  5E18 F;  2NRA C;  3WU0 A;  4A6E A;  1WKM A;  4YCA A;  3A0H E;  2MBF A;  3CMA I;  1A02 F;  3V4G A;  1BI1 A;  3ZQG A;  3ABU A;  3ZQQ A;  1EDL A;  5GTI C;  3JTG A;  2OGU A;  2VAS A;  1VQ8 P;  1X1C A;  3PFY A;  2KZJ A;  2K02 A;  3FR7 A;  1Y8A A;  2LFB A;  3I71 A;  1KU7 A;  5D6F A;  3CX5 H;  2K9S A;  4Y52 J;  2ZYG A;  2IBZ D;  1OFC X;  5DCM A;  4HRI A;  1DPU A;  1LTI C;  2IA2 A;  2K85 A;  2M5A B;  3BAS A;  3CD6 I;  2MFZ A;  1TQM A;  5DUK A;  1IXS B;  5AW4 B;  3K2Z A;  3GLL A;  3GFI A;  3CCR I;  1TTY A;  5CYV A;  1VQL I;  3TBI A;  2DOA A;  1FIA A;  3HRM A;  1SFO J;  1ZCJ A;  3HWR A;  4HAM A;  4Y99 C;  1LB2 A;  1VFC A;  2F5V A;  2VBX A;  3BVH A;  1SQX D;  2VI6 A;  2KLU A;  3GTG J;  3MZH A;  4XLH A;  3WTW C;  3BJ6 A;  4NHJ A;  3B73 A;  2JA6 J;  4II2 A;  2RV8 A;  5E1Z B;  4PJM A;  5CCH A;  2IPP A;  2Y75 A;  1R5H A;  4B3I A;  5LHI A;  2ZXE B;  3C7C B;  3CWB J;  3P8M C;  4XE5 B;  2X4H A;  2JMW A;  2ZCW A;  4Y4R A;  1JT0 A;  2Q6Q A;  2DQL A;  1K78 B;  2DFH A;  1YLF A;  4PGH A;  1BDC A;  3C1D A;  1CF7 B;  3EUH A;  4HB1 A;  3TW6 A;  4U7D A;  3MGN A;  3IAM 2;  1MDM B;  3BY6 A;  4M3F A;  4RES B;  5E79 E;  1YW8 A;  1TW2 A;  2OQG A;  3Q3D A;  4C2M J;  5DCF A;  4L5E A;  4D3D A;  1AQ5 A;  4PGG A;  3L73 J;  2XRN A;  1O3Q A;  1J1D C;  2GUS A;  1NH3 A;  1L0L E;  2HOD B;  5FGM A;  3CJQ B;  3T1B A;  4FAS D;  3IKV A;  2DMU A;  2EJR A;  3WOD F;  3BOQ A;  2HQR A;  4AWX B;  4E7K A;  4GDF A;  5TIS H;  5EGO A;  3HOX J;  1P84 D;  4OL9 A;  1KQ9 A;  2QWW A;  2M7B A;  3ZWC A;  1M66 A;  3WUT A;  3WFI A;  5DV5 A;  4OU0 A;  2YNY A;  1H0T A;  2IAI A;  1JUN A;  1TL8 A;  2IS4 A;  1N78 A;  1JOC A;  1I1S A;  2OU2 A;  4ENJ A;  3AEG C;  1KYO D;  2KNC B;  3FXU A;  1IN5 A;  5L3C A;  4E12 A;  2IZ0 A;  3H1H J;  4F7Z A;  1TWF J;  1FZB A;  3MIW A;  3PH0 A;  3FXM A;  1U57 A;  2AXC A;  2MLG A;  3JRD A;  2WMM A;  3BJO A;  2ZC2 A;  5KLV D;  3TKY A;  2A6E F;  1HJ0 A;  2ZFW A;  2JDI H;  4PJ0 H;  3ZMD A;  2DA2 A;  2GUV A;  1NTM D;  2E34 A;  1K79 A;  2HDD A;  4RA2 A;  3WTT C;  4A3F J;  1WP4 A;  3RYR A;  2KS1 A;  2PP6 A;  1PZQ A;  1VQ9 I;  1TC3 C;  3RL0 D;  3L74 J;  5FKN A;  3DBL B;  2DT7 B;  2DBB A;  4E21 A;  2GWR A;  5D8K B;  1I6H J;  1LNQ A;  4HV5 A;  1BOA A;  2YKO A;  4BRY A;  3HIF A;  3R61 A;  1XGS A;  1Z6T A;  1BGY D;  3E5X A;  1S7E A;  1NTK E;  3BT9 A;  1JY3 P;  3H1I G;  2H43 A;  4DGW B;  2BCC E;  4WXD A;  4R1H A;  1T98 A;  3GHG C;  4DBR A;  2KFD A;  1PUF A;  5CBN A;  2IDB A;  1MBH A;  2ECC A;  4I2L C;  5LGU A;  1DGR M;  2V26 A;  3M9A A;  4C30 A;  1JCD A;  3FM5 A;  1WI9 A;  1NTZ E;  2DYS H;  2M9H A;  1N25 A;  2VJ5 A;  4EGY A;  2PFX A;  1SVO A;  4IRI A;  4OQZ A;  4L9J A;  5HLI A;  3S3N A;  5DCM B;  4LIV A;  1FYL A;  5C4X J;  2DTR A;  1W5C C;  2F48 A;  2LF8 A;  4C7N A;  1M1E B;  2L5Q A;  2HZD A;  2Y0S A;  4XK4 A;  5J6X A;  1YIT P;  4OIP F;  2N8G A;  2IGO A;  1M57 D;  2F4M B;  1MBF A;  4BQO A;  4HF0 A;  2EIJ H;  1EJ9 A;  2VON A;  1HLV A;  1RY3 A;  3HE5 A;  2JUG A;  1KGS A;  3JR9 A;  3AE6 C;  4UVB A;  1ZTR A;  2KB7 P;  1ZRD A;  2NPS C;  3H9J A;  4E13 A;  2ISZ A;  4N3Y B;  1N2D C;  1ZME C;  1S2E A;  1QQI A;  1XMX A;  2MLK A;  5AVR B;  1WJE A;  4HEA 2;  1K8A Q;  4OGQ C;  2YX7 A;  1K9M Q;  2NRG A;  4BUP A;  1Q2N A;  2FBW C;  4XM3 A;  5DTD A;  1UFM A;  5J8C A;  3L72 D;  4NB5 A;  1LDJ A;  1IRZ A;  3OL4 A;  4HQM A;  1SP4 A;  2RAE A;  1OVU A;  1WRG A;  2KSE A;  2WPQ A;  3L75 E;  1USS A;  4ZNC A;  3HE4 B;  3BZK A;  3KZI C;  2P4W A;  4C3I J;  3CCV I;  3OSF A;  2YR2 A;  4JBZ A;  2F4O B;  3JAM K;  2IZ1 A;  3L72 G;  2H6C A;  3G1O A;  1DEE G;  2D2C B;  3OYF A;  2KUB A;  5AW6 B;  2FYN C;  2XSJ C;  3QYF A;  4CUG A;  1Y1W J;  4KT5 C;  1SQV J;  4UB6 E;  1R58 A;  5KLV K;  5APY A;  5CCH D;  2YKP A;  4IL6 C;  4M6V A;  1G3Y A;  1YRL A;  2WTB A;  4JQF A;  3DKY A;  1SAU A;  1FMW A;  4DZP A;  2CPS A;  3SSU A;  3S1Q J;  4BAC A;  2JSP A;  4EIJ A;  3F6O A;  1N7S B;  1QVT A;  3L71 G;  1Y47 A;  2XPU A;  1SQV G;  2RC4 A;  2VT2 A;  3C1L A;  2E1M C;  1E5W A;  1LE8 A;  2V6E A;  2F2E A;  2Q9I A;  5LRR A;  2CJJ A;  1L4A B;  1Y1V J;  5FKO A;  2MGQ A;  5A9R A;  4C7N B;  3F3X A;  3I59 A;  4D1Q A;  4BWN A;  3H25 A;  5CJ0 A;  1YHQ I;  2XAJ A;  3GZ6 A;  2KRF A;  4PDK A;  2L7K A;  3CES A;  3A0B C;  2RDP A;  3I3L A;  1J75 A;  2NNN A;  1VF5 D;  1WGX A;  1YW9 A;  4EEF G;  4HYE A;  2CFX A;  3D0S A;  1N8R Q;  4YFK F;  4IM7 A;  2AS5 F;  1DPR A;  3L70 G;  4G7Z F;  3L71 J;  3I59 B;  1VQ6 I;  2FRH A;  4J00 A;  3S4R A;  3TQN A;  2QQA A;  2FKW B;  3PRJ A;  5E3M A;  4Y17 A;  1NTM K;  2M0B A;  3H1L J;  1T6S A;  2HVQ A;  3K1M A;  5ED4 A;  1NKZ B;  4W97 A;  1LJ2 A;  1FJK A;  1R71 A;  2E7X A;  1SQQ E;  2FBI A;  3ASO H;  1GL2 C;  1QHH D;  2D5V A;  1YJ8 A;  2A06 D;  2YIU C;  1IJD B;  3PFI A;  2R7D A;  1FOW A;  1SQQ K;  4D6T J;  3FZV A;  2ZJ2 A;  4XKV A;  1K4S A;  2QM8 A;  2YKQ A;  4JYB A;  4LLN A;  1R4M B;  1P9Q C;  2GA2 A;  3GME A;  2IPQ X;  3SHF A;  1IFP A;  2M2E A;  1VZ0 A;  3HRN A;  4J01 A;  4YEJ A;  3G1M A;  5BPI A;  2NS7 A;  2QVO A;  3W2W A;  3JRF A;  5LEK A;  3DOJ A;  3CMY A;  4IXA A;  2XAS A;  2XHK A;  3DEW A;  3IRR A;  2FBH A;  1NOH A;  1O57 A;  1KD1 Q;  4JYK A;  3II6 A;  4F93 B;  1OX3 A;  5APX A;  3MMY B;  3PID A;  2RH0 A;  2IBZ I;  4UNO A;  5CHX A;  4IHX A;  1UG0 A;  2AEJ A;  4CCL A;  1BJZ A;  2ADU A;  5KKZ C;  5AVW B;  3I5U A;  3LIE A;  3VEP A;  3CWB D;  1YW7 A;  2ZYA A;  3SQN A;  4YEL A;  4XSZ F;  2GOM A;  2FF4 A;  2IA1 A;  3LSM A;  2R0Q C;  1IC8 A;  1BCC D;  4H0L B;  4A3B J;  2DQR A;  2GOX B;  3CC2 I;  1X8Y A;  4BEH B;  1UMQ A;  3ZMT A;  1FAV A;  5CMZ A;  1D5Y A;  1BW5 A;  2EB7 A;  2QGU A;  4B3A A;  1YRN A;  1B6A A;  4XRS A;  4E7J A;  3CP2 A;  4MEY F;  4UB6 H;  1U5T B;  3B5N C;  3O6Q A;  2Y0C A;  2N1T B;  4PCQ A;  3S9O A;  5KTB A;  3KZZ A;  2EWN A;  4R79 A;  5K5Q A;  3JCU C;  1WJC A;  1W36 C;  2IP2 A;  1NVO A;  1WH7 A;  3VMY A;  1B59 A;  1U5T C;  2K9N A;  3R4Y A;  4II3 A;  5LFA A;  3FXK A;  4RS8 A;  3OWT A;  2QSG X;  1SQP E;  5E3N A;  3DFU A;  1I39 A;  5C44 J;  5AW5 B;  3DWL E;  4FE7 A;  2OCC H;  1QPM A;  5F1R A;  2FXA A;  1SQP K;  3K5B A;  3HTK A;  1XN7 A;  3NAU A;  3KLN A;  1FEX A;  3L2U A;  3MKW B;  1OKR A;  4A0X A;  4V2F A;  2DA7 A;  1VF9 A;  3GF2 A;  4E7Z A;  1U9O A;  3E6D A;  6PAX A;  4QIW N;  1N1G A;  1M76 A;  2M4G A;  1NAY A;  2Q1K A;  4JX5 A;  1IFI A;  1MZB A;  4UVA A;  1YJ9 I;  3CCU I;  1SQQ D;  2E76 B;  3D5R C;  2KP6 A;  1GU5 A;  3UNG C;  3T8T A;  2ZXX A;  3LW5 H;  2A07 F;  4BXF A;  3H35 A;  4YRV A;  1W7P A;  1BE3 G;  1SQX E;  1E2X A;  1UJ8 A;  2J5U A;  2KPM A;  5GTI E;  2FUG 2;  2AXT C;  3QSG A;  2VQG A;  1SQV E;  2R5Y B;  3H1H E;  1NYH A;  2R44 A;  2E74 B;  2F5C A;  3L6D A;  3KXD A;  4XLA A;  4RB3 C;  3HDH A;  2QYO A;  2W57 A;  2XB5 A;  3ZQL A;  2FYZ A;  1L4A C;  3OYK A;  4Y28 J;  5IYD J;  4M9S A;  1DLJ A;  5LGN A;  4ZYD A;  5ICE A;  4ZH4 F;  3DEU A;  3HUG B;  2YIU B;  1AHD P;  3QPL A;  1IGN A;  1X9V A;  1OYY A;  2OPT A;  1JO5 A;  4C3J J;  1KIL A;  2ELJ A;  1P84 H;  2DW3 A;  1FZC B;  4HA8 A;  4I09 A;  2PJR B;  2L9R A;  3OAK A;  2KJC A;  2PMZ A;  3ZN0 A;  1H8A C;  3AL0 C;  3GVA A;  5AVZ B;  2LOO A;  3S1M J;  2O01 J;  5LD2 C;  2JR8 A;  2CGP A;  2KRH A;  4XLN F;  1YS7 A;  1P84 I;  2BY2 A;  2XND H;  1IJW C;  4HV6 A;  2NVX J;  4ASW A;  3MCZ A;  1MMD A;  1OIS A;  2RGV A;  3B02 A;  5EEG A;  3OYC A;  3RK3 E;  1SS1 A;  1X22 A;  3RPU D;  2E1O A;  3H1K E;  5L8R J;  3F72 A;  4UHT A;  2YS9 A;  4BL0 B;  3HZJ A;  5EG0 A;  5E1W A;  2A5Y B;  3KHU A;  2W6J H;  1FYK A;  1S7O A;  3SEZ A;  4H13 B;  1ZEL A;  4I2O A;  4IPA A;  1ERD A;  2C9N Y;  3OR2 C;  3ZWB A;  2R7O A;  3L75 G;  1H0M A;  2KL4 A;  1VQM I;  3SXY A;  2L7M P;  3MAJ A;  3KLO A;  1T8Z A;  3OIP A;  1NTM E;  1E3H A;  4MQ9 F;  2CV1 A;  1L0N K;  3ZMV A;  5LHG A;  2E1N A;  1M75 A;  1HJB A;  2LF7 A;  3V4W A;  5FLM J;  5BVZ A;  1NTK J;  1FJL A;  1OCT C;  4G7O F;  2XGE A;  1Z05 A;  4EAT A;  4YG2 F;  1GK6 A;  3KYQ A;  1GV5 A;  3P8C E;  1IN4 A;  1DX7 A;  1AVY A;  1VQ7 I;  4M3L A;  3RKW A;  3ZGY A;  2PQ8 A;  4MN4 C;  2CVZ A;  3RBZ A;  2KS1 B;  4EVI A;  3HD7 A;  2RKH A;  1A02 J;  4C3H J;  1YJ9 P;  1FOY A;  2O9L A;  4BGD A;  2D2W A;  1WVR A;  1MMS A;  3TGU D;  2EK5 A;  4UUS A;  2ZKZ A;  1YYV A;  4JF7 A;  4V19 K;  3MZY A;  2O01 N;  3GHG B;  1DQU A;  2KNC A;  3ZCO A;  1HW1 A;  4OIO F;  3ZW8 A;  1J2X A;  1ETQ A;  1FS0 E;  2B87 B;  2WB1 A;  4GBJ A;  2A61 A;  2MA3 A;  1E79 H;  1L0N G;  1DLI A;  2NPS B;  5AW3 B;  4YXW H;  1KQ0 A;  1XGO A;  2HU9 A;  4YFN F;  2OYI B;  3P5J A;  2FXP A;  4DIQ A;  3A2K A;  3VDX A;  1Z21 A;  5F0C A;  1GVD A;  2H8W A;  1WJ5 A;  5EGO B;  2A45 H;  3SDB A;  3I4N J;  3IAO A;  1X1P A;  1TZL A;  3IR9 A;  3CME I;  2SPZ A;  1EKE A;  2Z5U A;  4LJZ F;  4ZYH A;  4CCM A;  2P5V A;  4KJZ A;  3SYT A;  2WSE H;  1K78 A;  4PZE A;  1POG A;  2ZVO B;  1ETW A;  3DF8 A;  2BAS A;  2ME6 A;  5AIP A;  2QEX I;  3HJE A;  2Z9O A;  1JDJ A;  5AW7 B;  3MN2 A;  1OCP A;  4ZKP A;  2ZB9 A;  4IOA F;  1KV4 A;  3ITK A;  4X0G A;  1Z3Y A;  4RGS A;  3LWF A;  1W5C E;  4IFD K;  4BE2 A;  3N4X A;  3SWK A;  3GEZ A;  3H92 A;  2CQ7 A;  3TYY A;  2KXP B;  1O3R A;  4HF1 A;  2QKM B;  4U7B A;  3I9V 2;  1Z7U A;  3JSP A;  4DYD A;  1OW8 A;  2DA5 A;  3FIS A;  3H9G A;  1NU1 J;  1F43 A;  1JY3 O;  3IRQ A;  1FPQ A;  2BEO A;  3M8E A;  4CYC A;  1SFX A;  3W67 A;  2Z4E A;  4XOR A;  3KE2 A;  4I7H A;  4F92 B;  2IJL A;  2V7Q J;  4IQJ A;  1P6R A;  4L9V A;  1F12 A;  3U1C A;  4WXC A;  2M87 A;  2Q2E A;  3BR0 A;  1DD3 A;  2EQR A;  1NHL A;  3VB2 A;  4D3F A;  1P2F A;  1T3J A;  2L02 A;  2WV0 A;  3HOY J;  4A3G J;  2FXO A;  1RQV A;  2WWW A;  3ZQH A;  1HA8 A;  2NS0 A;  5EG0 B;  2M3B A;  2HTJ A;  3J81 Z;  4O6J A;  1ONV A;  5GTH H;  1QZZ A;  1W4M A;  1Z0X A;  1RKT A;  3UR3 C;  4Z2Y A;  1CSB A;  3ABV C;  3AE4 C;  4AQR D;  2HG5 D;  2WBM A;  1OVV A;  3CJT B;  3PM1 A;  2R7Z J;  2K3R A;  2UXX A;  2CQK A;  2CWE A;  1WSU A;  1KS9 A;  5DEQ A;  2JP3 A;  4GO1 A;  4ZDP A;  3TW7 A;  5B1A H;  1R1V A;  3G4S I;  2R5B A;  2W83 C;  4I76 A;  1TLH B;  3GWZ A;  1KC8 Q;  2QKL B;  1J7K A;  3DTK A;  5D5X B;  1VI0 A;  4WVZ A;  3S1K A;  3BCC D;  1L0L D;  2JA8 J;  2N9B A;  4AYB A;  1FC2 C;  1QL2 A;  3E7K A;  3MOG A;  2FYU G;  1L3L A;  1Y0U A;  2QSF X;  3ZDM A;  4AM3 A;  1H0T B;  3BTI A;  5FO5 A;  4FGW A;  3BJA A;  1RH5 B;  3BTJ A;  1CQT A;  1O7L A;  3ABL H;  4WY4 C;  1ZGA A;  1YIT I;  1EXI A;  4P5O A;  2R4G A;  1USE A;  2EIK H;  1ZGJ A;  1EDK A;  1WT6 A;  4HG2 A;  4H44 D;  3D1N I;  3WMM 0;  3BC8 A;  1X4P A;  2H1L A;  1HSJ A;  2CU7 A;  2GLO A;  3M1E A;  4ZC3 A;  1DD4 A;  4LD5 A;  3CXH D;  3T97 A;  4C46 A;  3HKZ N;  3U1A A;  5EJC A;  4XBF A;  1ZAR A;  4HLY A;  5CCG D;  2X6Y A;  1X1B A;  2GXG A;  3L2R A;  2YUS A;  2V79 A;  2EFO A;  3ZN1 A;  3M3Y J;  3M8J A;  1XGN A;  2H8R A;  1KFN A;  1IN8 A;  1LSJ A;  3T5X A;  4OQY A;  2E7W A;  2BY0 A;  1KB9 D;  4M3G A;  3HD7 D;  3CQZ J;  2Y30 A;  2FYN B;  1JKQ C;  3RQ4 A;  1MBG A;  3M8F A;  4KMU X;  3S93 A;  1FU1 A;  1L0N D;  4FQG A;  1OZH A;  2WVR A;  5E79 C;  3QH9 A;  1FJP A;  4UY8 I;  1ON2 A;  2E75 B;  1JTH B;  4WY4 A;  5E17 F;  4K35 A;  4UXN A;  1AA0 A;  1PYV A;  2FE3 A;  3FXQ A;  3DTE A;  1OW6 A;  4JX4 A;  3ZPL A;  4RB0 A;  4IJA A;  3WTU C;  1EQ7 A;  1NTK K;  2VKV A;  3UIA A;  1RF1 B;  2LH9 A;  3PSI A;  5IT9 Z;  1F5T A;  4B43 A;  2IYO A;  5KLI B;  3Q9S A;  1CZQ A;  4RGX A;  2JRM A;  3PO3 J;  4LIT A;  4P96 A;  1G59 A;  2HGC A;  1QZE A;  2VXD A;  2YX4 A;  3KPE A;  5FD6 A;  5C39 A;  1A6Q A;  1VQP I;  4KIF A;  1W7P D;  3OYL A;  2QBY A;  2WAE A;  4YIR X;  3H1J J;  2DMP A;  2DTZ A;  4U3F D;  2X1C A;  2WTY A;  2W25 A;  5E3L A;  1BW6 A;  1X0X A;  4M9X A;  3W6U A;  3JRB A;  3K4N A;  3TDK A;  4ZKU A;  3HHG A;  3PSF A;  4KA4 A;  2NOJ B;  3BCC E;  2J5O A;  4U7J A;  1MV8 A;  2RRE A;  4PZD A;  2AEF A;  2IEK A;  3FMS A;  4RGR A;  3PHL A;  4I7Z B;  3RK3 D;  3JC2 2;  5CLS A;  1V54 H;  4EM1 A;  5KAF E;  1KIL D;  3GTM J;  2DT5 A;  2X51 A;  1FSE A;  1A35 A;  3LW5 J;  2OYI A;  4Q4Z F;  1V5G A;  2XUB A;  1QRY A;  4A3J J;  2F5D A;  2X9D A;  4ZYG A;  5L3B A;  3S17 J;  1B8I A;  2X6X A;  5A2Q Z;  1UHM A;  1UST A;  4WX9 A;  2HDC A;  4HKZ H;  4AUW A;  1HBW A;  2Q5U A;  3MD0 A;  3W68 A;  2JZY A;  4K3A A;  2EFW A;  1PP9 J;  1GVJ A;  3BP8 A;  1FZF A;  5DDG A;  1RR8 C;  1BGY E;  1GL2 B;  2BCC G;  1RF1 A;  3P32 A;  4GOD A;  1S72 I;  1R00 A;  4O9B A;  1LSO A;  4MHG A;  1SQB K;  2I1J A;  4IHV A;  1G1I A;  3H5A A;  2EW2 A;  1XTG B;  1HVV A;  3CC4 P;  3JRG A;  3MZW B;  5GAE J;  5DS9 A;  4CSW A;  5B5E H;  2HPC A;  1GL2 A;  5LGT A;  3RQI A;  5FLV A;  1H88 A;  4A3K J;  3L74 E;  1PP9 D;  1BE3 D;  4LC1 A;  2Q1Z B;  4QSH A;  3GTL J;  1QHG A;  1NTZ K;  3FF5 A;  3E0J B;  4ABZ A;  3QPH A;  2XRO A;  4ON0 A;  1JJ8 C;  3FGA D;  1OCZ H;  3ROU A;  3HHH A;  4OIQ F;  3VN0 A;  2R7U A;  4BRY B;  2LY1 A;  1IFN A;  1CI6 A;  5HLG A;  2XRL A;  5GTH E;  5TJJ A;  2BVM A;  4KN7 X;  5CKT A;  1GUU A;  3WTV C;  2HQA A;  5B66 C;  4KUH A;  2A69 F;  1JY3 N;  2LYC A;  5M5X J;  4D0P A;  2B88 A;  4N9I A;  2EA2 A;  5B5E E;  1KTM A;  1VND A;  2JPB A;  4ENN A;  4AYC A;  1XCB A;  4X1E A;  3F22 A;  1RRJ A;  4A93 J;  2IFM A;  5KAF H;  3HTS B;  1ZH5 A;  4KT6 A;  3IAS 2;  2H09 A;  3CO7 C;  2FYU J;  1PDN C;  1B9M A;  3COA C;  2L5G B;  3AED C;  5H2F E;  1MIJ A;  5CBO A;  1BCC J;  4YXD C;  4UUT A;  1Z3X A;  3LMM A;  4EYY Q;  3U1K A;  3DLA A;  1MDM A;  1VF5 B;  5AYV A;  2E76 C;  3H1J D;  4GRI A;  1YIO A;  3SEQ A;  3ADO A;  3IH2 A;  4ZYA A;  1PGJ A;  2PG4 A;  3LFU A;  1WDL A;  3H1I D;  3CCU P;  2K88 A;  1A36 A;  3PJR A;  2COM A;  3K69 A;  2E2H J;  4LIU A;  1RE4 A;  2QJK C;  1GDT A;  3S1R J;  3FHZ A;  3O6B B;  3CDL A;  2NVQ J;  3GFL A;  4E4H A;  2Z5I A;  1W7P B;  3WS7 A;  1FDI A;  3A01 A;  2WC2 A;  1HGV A;  1ZXG A;  4HX7 A;  1LUJ B;  1ZOY C;  3TP0 A;  4PD4 E;  2MJZ A;  2OTL P;  5FRO A;  3CLO A;  3TOB A;  4FTH A;  3CWB G;  2KJB A;  4N0B A;  4AUX A;  3GLX A;  2W00 A;  3RK2 B;  1H9G A;  4WF2 A;  9ANT A;  3RKX A;  1HST A;  2KIU A;  4NQW A;  4UV8 A;  4ZTF A;  1REP C;  1JKP C;  1AKH A;  1ZRE A;  1LWU A;  3J7A Y;  3MHV A;  3GTP J;  4C7R A;  2N1T C;  2I1K A;  1I3A A;  1J0R A;  3EWK A;  1EC5 A;  2HXI A;  3H1L D;  3BR2 A;  1ZRC A;  1HDP A;  1UHS A;  3CCL I;  1J9I A;  3FXO A;  3G71 P;  3F8F A;  1JTY A;  3A0H H;  4JQ0 D;  4NQW B;  2I5U A;  1HXD A;  4L74 A;  3IKT A;  1GXQ A;  2B9S A;  3NFQ A;  1FWZ A;  4AID A;  5E8I A;  2LNB A;  5K7Z A;  1LE8 B;  3J7A O;  1PV3 A;  2HPI A;  2M3A A;  2K3P A;  3KP5 A;  3LA2 A;  2KZV A;  1MH4 A;  3T97 B;  4C2U A;  4NC8 A;  4I6Z A;  2XDV A;  2A06 G;  2OC6 A;  4RO0 A;  3AKZ A;  5L3D A;  1EZV G;  4M73 A;  1G2C B;  4A3D J;  2Q3E A;  1TP4 A;  4PJL A;  3TDZ C;  3RPU A;  1J1E B;  1LFP A;  3ZR8 X;  1Y9B A;  2R32 A;  1H89 A;  3G4S P;  1SVM A;  2C0W A;  3SZP A;  4BJ5 C;  4UV9 A;  2JKV A;  4W1U A;  2LG4 A;  1ZLL A;  4OH8 B;  2FY8 A;  1T2K D;  4N78 E;  2EIN H;  2EA4 A;  3FK6 A;  1LPQ A;  2ZME C;  4H44 B;  2IYP A;  3PTZ A;  2LY9 A;  4E70 A;  3L2W A;  2CPB A;  2RNJ A;  3ECO A;  2R3C A;  3BCC J;  2DXI A;  4JOM A;  3IUO A;  2IT0 A;  3C8V A;  5HLT A;  3H1I J;  3CWB E;  2KHM A;  1NH4 A;  5F04 A;  2WSF J;  2XNX A;  2O61 A;  4PZJ A;  4XKC A;  3IH4 A;  3C7D B;  1S29 A;  4H0L D;  2FYU K;  5JFR A;  2JQ7 A;  2WAF A;  3GFM A;  4ESB A;  3RK2 D;  3M7G A;  1N73 B;  1R4N B;  1PFI A;  1FDM A;  5GTI H;  1ZW0 A;  4HYT B;  4KNY A;  2YXR B;  1ETO A;  1NGM B;  3FWN A;  4KIT B;  3IHU A;  3A2A A;  4HBL A;  4N9H A;  1PGN A;  2DAO A;  4KYW A;  3HTK B;  3M0D C;  2X58 A;  3A03 A;  4KMF A;  4W7Z A;  2HFH A;  2HKX A;  2HPC B;  4HX4 A;  2HYJ A;  1QBJ A;  2YO3 A;  2R7S A;  3K1P A;  2R7T A;  2MYS A;  1E17 A;  5KAI E;  3SFD C;  4DJG A;  2CFO A;  1YON A;  4ZZD A;  1FTT A;  2H7H A;  4WY4 B;  1PUF B;  1OWA A;  3KEO A;  2FMY A;  2QE7 H;  4F52 A;  3KYL A;  3TOA A;  2VJ4 A;  3I56 P;  3B6A A;  3S14 J;  2DMQ A;  3KFW X;  1SFE A;  2NNY A;  3K7A J;  2A45 I;  1BE3 J;  1S8N A;  1RQU A;  3IN6 A;  4D3S A;  4Y99 B;  3CCE I;  1BCC G;  2BE5 F;  2Y48 A;  3AFH A;  3GTJ J;  3DEE A;  3F23 A;  2QG4 A;  2IW5 A;  3O6Q B;  4GYI A;  1LWU B;  2O1J A;  4XA4 A;  2VKH A;  3OYG A;  1PGQ A;  3H1L G;  4CCJ A;  1X0V A;  1SQB J;  3HUS A;  1YO5 C;  2QCO A;  3IWZ A;  4A69 C;  3QAH A;  3BLY A;  3K4M A;  2E74 C;  1RZ4 A;  2MD5 A;  3BR3 A;  3GLM A;  5D5V B;  3QHA A;  4PZC A;  1RR7 A;  1WI3 A;  2ZSH B;  5IP6 A;  2P7C B;  1KIL B;  1ZRF A;  1P4X A;  1FZC A;  3ERM A;  2XGX A;  2VC1 A;  1GV2 A;  4LB6 B;  2VXZ A;  3I5C A;  4BQN A;  1ZR4 A;  2JA2 A;  4O5V A;  1WHU A;  2MAB A;  2ID3 A;  2OUM A;  1GK4 A;  2BHY A;  5JR3 A;  5L3F A;  2XF6 A;  3HGY A;  1K7A A;  2COB A;  3JW4 A;  4M72 A;  1I50 J;  4B3X A;  1EDI A;  3U2R A;  4FX0 A;  3ELK A;  2CS3 A;  2HVR A;  2OD5 A;  1S6L A;  3ZMS A;  2JA5 J;  1KU2 A;  5EEA A;  4BBS J;  1D8J A;  4HW0 A;  2R92 J;  3RKQ A;  2QIW A;  3HD7 C;  3BTL A;  3ULQ B;  1M56 D;  4I99 C;  1IO4 A;  4GDO A;  2QA4 P;  2R93 J;  1JY2 N;  4IVN A;  3LA3 A;  1FBU A;  3TO7 A;  1BSN A;  4UB8 E;  4XN0 A;  1D1C A;  5K7H A;  1CF7 A;  2WZ7 A;  3V4Q A;  3L75 D;  2XU6 A;  3TSI A;  2OF7 A;  3ZMZ A;  3AEF C;  3GMA A;  1LTB C;  3ZXS A;  2WPV B;  4BBR J;  2ZME B;  3FXD A;  3HXL A;  3E7L A;  2IX7 C;  2DMN A;  2Q3I A;  4E7I A;  1B1B A;  1BI3 A;  2K9L A;  1EF4 A;  1SQX G;  5FFZ A;  1BOB A;  2FBK A;  5HNH A;  2ZBK A;  3I4M J;  1KIL E;  4PD4 H;  1HCR A;  4OMZ A;  2PMH A;  5GP9 A;  1S72 P;  5J8F A;  4ETS A;  4N4O B;  3L1P A;  3L2Q A;  1NU1 E;  2CRG A;  2HXO A;  2LVS A;  3R6S A;  1JHF A;  2OQR A;  3CD6 P;  5HLH A;  2P0W A;  3CC4 I;  1Z67 A;  2WPR A;  4XIC A;  5CJ9 A;  2ZNZ A;  3M91 A;  4BHC A;  3HOS A;  5IP7 J;  2KLV A;  1VQL P;  2GIZ A;  4M3B A;  3BG5 A;  1ON1 A;  4BE1 A;  2OAZ A;  4MO7 A;  1R1U A;  3PP5 A;  1LJ8 A;  2ZME A;  2HVS A;  3F8M A;  5E1X A;  1H89 C;  1I1G A;  1SQX J;  5H2F H;  4KIG A;  2ISY A;  2K4J A;  4BYY A;  1QVU A;  3PNT A;  3O8H A;  1B8I B;  2AEM A;  2JEE A;  3H6P A;  4NPE A;  1YQ4 C;  3IH3 A;  2GF2 A;  3VOE A;  1L0N J;  4CPG A;  1ZP0 C;  1XSX A;  2HOA A;  4BY1 J;  3OYB A;  3BZC A;  3L2C A;  2TDX A;  2CMP A;  1TW3 A;  1JUM A;  2JT1 A;  2E76 D;  3D5S C;  5L3E A;  2PRR A;  3IQD B;  2R3S A;  1LDK B;  1TWH J;  3VYR B;  3HGG A;  5LRS A;  4RBO A;  3S3M A;  1Y39 A;  1X4O A;  2E5Z A;  3WE2 A;  4TT3 H;  1LNW A;  1TWC J;  5J3L A;  2VC0 A;  3F8C A;  1WJB A;  5LEJ A;  1HGZ A;  1N86 A;  4WY4 D;  3LQQ A;  1QMG A;  1Q86 Q;  4CIC A;  1GT0 C;  1YQA A;  3FX3 A;  3TK1 A;  4QPQ A;  1L0L G;  2GBY A;  4UB8 C;  3LSR A;  2Y9Z A;  3W2V A;  3A4C A;  4G6D A;  3PL8 A;  1BC8 C;  3GHG A;  4H13 C;  1L4A D;  2UXN A;  2EBI A;  5CVU A;  2CG4 A;  3HOW J;  1SQB D;  1NU1 G;  5FD5 A;  3BPV A;  1YS6 A;  3H3Z A;  5FKK A;  3OYE A;  1JJ6 C;  3G17 A;  5J1Y A;  4KDP A;  2QLZ A;  5AIQ A;  2VOD A;  2WSE J;  3DKX A;  1G2C A;  2FJ1 A;  1X1A A;  1KZH A;  4DQ2 A;  3F0C A;  2LXB A;  5DD4 A;  1R9T J;  2B89 A;  2N1T D;  5KJ7 A;  1U2W A;  2FEZ A;  3HE5 B;  2NAZ A;  2WA0 A;  1W5S A;  3DLL F;  4AYB N;  4PUS A;  3SWF A;  3LAJ A;  3EYY A;  1Y6I A;  5HOD A;  2ESN A;  5KNL A;  2K5C A;  2VL8 A;  1RE3 A;  2F6C A;  3PQJ A;  2LKS A;  2ELH A;  2EPF A;  3I0T A;  3QOE A;  4LK1 F;  4HDV A;  4L0Y B;  3M4O J;  1SD4 A;  1M8O B;  4G6Q A;  3ERE D;  4JYC A;  1VQ9 P;  3Q2Y A;  1JGG A;  1K04 A;  1YX5 A;  2OTJ P;  3OYA A;  3CMM A;  3HBL A;  3GYH X;  4FHT A;  1N7S C;  1RHZ B;  1XD7 A;  1ZRT E;  1LTJ A;  4MGR A;  1KOR A;  2V7Q H;  4JP0 A;  3VSL A;  1D1B A;  2FML A;  1DU6 A;  1HW5 A;  4GWG A;  3G2B A;  1BDD A;  4X6A J;  2STT A;  2UWJ E;  2Y2Z A;  1YTY A;  1BR1 A;  2CYY A;  3G71 I;  3JCU E;  5A2Q K;  3L75 J;  1ZKG A;  2Z1D A;  3CCQ P;  4Y33 A;  1SD7 A;  4BNC A;  4RB1 A;  3ESW B;  5KHD A;  3OBB A;  1JMM A;  4GIF A;  1NKN A;  2F5E A;  3A1Y A;  2FQ4 A;  5J4Y A;  1ZN2 A;  3WUU A;  2JVG A;  5APS A;  2M45 A;  3M9B A;  3FM3 A;  3OOP A;  1FLI A;  3KX2 A;  3B71 A;  3QP6 A;  4QPO A;  2MH2 A;  4IFF A;  2P6T A;  4ASN A;  3AEC C;  4BEH A;  4EM0 B;  4OOI A;  4ZTJ A;  3X2Q H;  2R5Z B;  2LTP A;  3TO6 A;  3V7R A;  4MFD A;  3RQS A;  3PO2 J;  4U0Y A;  5C3E J;  1VQN I;  2VOP A;  1KQ8 A;  2JWA A;  3UKG A;  3L71 E;  3OIQ A;  4NBQ A;  1WRJ A;  3I53 A;  3VYS B;  3AG1 H;  1I36 A;  4J0E A;  4GT1 A;  1JM0 A;  4WWI A;  1YJW P;  1FY7 A;  2HEO A;  1JMB A;  3IP4 B;  3RI4 A;  1X3Z B;  3CDI A;  3CUQ C;  4RB2 C;  1YE9 A;  2J5P A;  3QOP A;  4UUS B;  1UCR A;  2D1H A;  4NC6 A;  1VQO P;  1RKW A;  3BDD A;  1QO0 D;  1O4X A;  1S5L C;  1R5I D;  2IFN A;  5IYB J;  5TIS E;  2E2I J;  4RAY A;  2B9B A;  1AVO A;  1D8K A;  5KCM A;  3OJA B;  4Z6Y A;  1OYW A;  2M7A A;  2JRT A;  4CH7 A;  5APQ A;  2JUC A;  4TV7 A;  2MC4 A;  3S2H J;  1SFC C;  3CCM I;  4N78 D;  4AD9 A;  3CKY A;  4L73 A;  4I1L A;  1V5F A;  3FKI J;  4BY7 J;  2VT3 A;  2DA6 A;  3LL7 A;  4LG0 A;  1U8R A;  2DU9 A;  3WE3 A;  2M1B A;  2XKM A;  2IBZ E;  2YU9 J;  2LK2 A;  2H89 C;  2W7N A;  2XSD C;  1ACI A;  3WU2 C;  2HNH A;  1GHC A;  3MEX A;  2KP8 A;  2OTK E;  1HOM A;  2WSF H;  2TRT A;  4FIS A;  2CW0 F;  5AW9 B;  2ZJP F;  1W0U A;  2XV4 S;  3CCY A;  2JN6 A;  3DBR B;  1MNE A;  2JPC A;  2IBZ G;  3JCU H;  2FQ3 A;  4S05 A;  2D45 A;  3KYC B;  1M1J C;  1WPK A;  5F64 A;  1PP9 E;  3PJG A;  1XTC C;  5AVY B;  2K9J B;  4U87 A;  5HVQ C;  2DA4 A;  5EFW B;  1RUO A;  4KUM A;  2LP0 A;  1MSE C;  3VYT B;  1MMG A;  1PP9 G;  3C18 A;  2W1O A;  5E3O A;  1N7S A;  3VMX A;  1GZL A;  4BH9 A;  1WWX A;  2E5Y A;  2LR2 A;  2M5A A;  3IL2 A;  2JVH A;  4HLX A;  1J59 A;  4YPC A;  3OS2 A;  2QYT A;  4CCN A;  1ZGW A;  5HS8 A;  1E3P A;  2EZL A;  2W90 A;  4LMY A;  2A6T A;  3K1N A;  1R49 A;  4BXU A;  1FBM A;  1LTJ C;  4NPD A;  1R1T A;  1S7A A;  1K05 A;  1MJB A;  1M1J B;  2OFP A;  1TT5 B;  1KYW A;  5GPA A;  4IZZ A;  1GXP A;  3U21 A;  3REO A;  3K4J A;  4I02 A;  4RAF A;  2RVC A;  1XGM A;  1J1D B;  1ZN5 A;  3KP3 A;  3RPQ A;  3TED A;  4DNC A;  4KUE A;  3JRE A;  1IV6 A;  2OYH A;  2FYU D;  5TGT A;  1Z82 A;  4D5F A;  3P8C D;  1FZE A;  1X3U A;  3C2G A;  1T39 A;  3L09 A;  1QEX A;  3CTV A;  1RF0 C;  3JRC A;  2X85 A;  2K7L A;  1H8A A;  4N4N B;  3PEF A;  1YYC A;  1S5L E;  2OYO A;  4KIS A;  1IW7 F;  3BG7 A;  5GPC A;  2R5Y A;  1EDJ A;  3ABK H;  2R7X A;  3ZQI A;  1Z77 A;  2QF7 A;  5IOY A;  5AW8 B;  2XKO A;  2NPS A;  3D6Z A;  2OYH B;  1B9N A;  4A6D A;  5CVJ A;  1SQB G;  4RAG A;  1ZV8 A;  3HDD A;  3OMY A;  5ICG A;  1GU4 A;  2DO7 A;  3QQA A;  5DUI A;  1KYO E;  5CQG A;  1U0J A;  3C9I A;  3BAT A;  3VFZ A;  2W24 A;  4J19 A;  2MH9 A;  5E20 A;  3ASN H;  4A3I J;  1BA5 A;  3A7O A;  3VMZ A;  3I64 A;  1IC2 A;  3DU6 A;  3K4L A;  3OW2 O;  3AE1 C;  5AON A;  3KZI H;  3Q5P A;  5ILV A;  4MTD A;  1K83 J;  5B66 E;  1G3W A;  3B4S A;  5AVS B;  3CI9 A;  3AE8 C;  1QNT A;  1SAN A;  2Y31 A;  2V1N A;  3K10 A;  3EUK L;  3GTK J;  4R8H A;  5EEH A;  5IY5 H;  1SQQ J;  1W1W E;  2HPM A;  3DXJ F;  2POH A;  2EV5 A;  5FRN A;  3F5H A;  4MEX F;  1N7L A;  4XNF A;  4LGD E;  4KHX A;  3P9C A;  2O5R A;  4ASV A;  3L74 D;  2E5T A;  1BE3 E;  1TWG J;  1MSF C;  1ZHF A;  4CYC B;  4IO9 F;  5D4S A;  1UIX A;  3RZD J;  1B72 B;  3PJS K;  5J4V A;  1HW2 A;  3AEB C;  1F14 A;  2R5D A;  2DOF A;  3EUA A;  1T33 A;  2L01 A;  2QM7 A;  3R0J A;  3KQG A;  1D7M A;  3E1I A;  4IKF A;  4KJM A;  5AW2 B;  2Q7C A;  2FNA A;  4G7H F;  1X19 A;  2JWT A;  4DBQ A;  2VPR A;  1BR4 A;  3H1H D;  3RIR A;  3EDP A;  2L4M A;  3AG4 H;  1RE3 C; 
#chains in the Genus database with same CATH homology
 2XRL A;  1HLV A;  1GUU A;  3BR5 A;  2L7Z A;  3JR9 A;  2O8K A;  2CUF A;  1ZTR A;  2ID6 A;  3BTC A;  1ETV A;  4KUH A;  5C4J J;  2X48 A;  5M5X J;  2XB0 X;  4E13 A;  1VND A;  2MG4 A;  5BNG A;  4X1E A;  4A93 J;  2NVY J;  3WHB A;  5DTD A;  5M5W J;  5A9S B;  1OJL A;  5F0F A;  1IRZ A;  4UUT A;  2RAE A;  3Q0U A;  3BG3 A;  1IG7 A;  4C3I J;  3OSF A;  5AYV A;  1M2W A;  3BG9 A;  3QPS A;  3ADO A;  1PGO A;  1ORK A;  3IH2 A;  1PGJ A;  2IZ1 A;  1WDL A;  5EZG A;  4RDU A;  3G1O A;  2E2H J;  1GDT A;  3S1R J;  1Y1W J;  4B1R A;  3CDL A;  1XC5 A;  4M6V A;  2NVQ J;  1YRL A;  2WTB A;  3WS7 A;  3A01 A;  4DZP A;  4A3C J;  3S1Q J;  5FJ8 J;  4OVN F;  3TP0 A;  1QVT A;  1HF0 A;  1X2N A;  2XPU A;  1MBK A;  4FTH A;  3HOV J;  4AUX A;  1P7J A;  1LE8 A;  4XRS G;  2CJJ A;  2JK3 A;  1Y1V J;  5FKO A;  2MGQ A;  9ANT A;  5A9R A;  1MH3 A;  2XPV A;  4FE4 A;  1JKP C;  1VPD A;  1AKH A;  3GTP J;  2KT0 A;  1WGX A;  4QTR A;  4EEF G;  2HXI A;  3BR2 A;  4IM7 A;  1HDP A;  1AKH B;  1UHS A;  1JTY A;  4JQ0 D;  2WB1 N;  2ELK A;  2FD5 A;  1E3O C;  3S2D J;  5K7Z A;  1LE8 B;  1BL0 A;  2UYY A;  1X2M A;  5E3M A;  1BG6 A;  3Q0V A;  1MH4 A;  4I6Z A;  4W97 A;  3RZO J;  1NK2 P;  3ZW9 A;  4MIM A;  1RET A;  3ZQF A;  2D5V A;  1YJ8 A;  5MGB A;  2M0C A;  3LNQ A;  4A3D J;  3GTQ J;  2H1K A;  2HDH A;  2XPW A;  5M3M J;  2HQ5 A;  3H0G J;  1MNM C;  2JKV A;  4W1U A;  2EZI A;  1FIP A;  3F3S A;  5EZH A;  2M2E A;  1P7I A;  2PGD A;  3FK6 A;  4A3L J;  3G1M A;  2IYP A;  2NS7 A;  2LY9 A;  3JRF A;  4XID A;  3DOJ A;  3CMY A;  3DEW A;  1WPQ A;  4JYK A;  3HEF A;  2NVT J;  1FTZ A;  3PID A;  1TWA J;  1APL C;  4IHX A;  1ETK A;  1TXG A;  1BJZ A;  4NDL A;  1ETX A;  1NK3 P;  5F04 A;  1W0T A;  2ZYA A;  1ZR2 A;  3IH4 A;  1HDD C;  3C7D B;  2R0Q C;  1IC8 A;  4BXX J;  4A3B J;  3TP3 A;  5JLX A;  1I3Q J;  1YJQ A;  1UMQ A;  1D5Y A;  1BW5 A;  1ETO A;  1T56 A;  4B3A A;  3FWN A;  1YRN A;  4XRS A;  2IBD A;  1PGN A;  2VKE A;  3ZHB A;  4DLL A;  4XRM A;  2X58 A;  3A03 A;  2PMZ N;  4D7N A;  1RPW A;  1IDZ A;  3VPR A;  2HYJ A;  1WH7 A;  2P81 A;  2K9N A;  1NTC A;  1YON A;  1FTT A;  1PUF B;  5E3N A;  3BQZ A;  2ECB A;  3DFU A;  5C44 J;  2G0E A;  4FE7 A;  3B6A A;  1WDK A;  3S14 J;  2DMQ A;  2E2J J;  3K7A J;  4D3S A;  2VUM J;  3GTJ J;  3NAU A;  2CUE A;  1FEX A;  3BQY A;  4D7M A;  1A5J A;  4OM8 A;  3Q0W A;  4V2F A;  2DA7 A;  1VF9 A;  3WHC A;  1U9O A;  3JRA A;  4QIW N;  1N1G A;  1M76 A;  1DU0 A;  1PGQ A;  3Q3C A;  4JX5 A;  1X0V A;  3BR6 A;  1MBE A;  2QCO A;  4A69 C;  4DYR A;  2CQX A;  1ZK8 A;  1K61 A;  3BR3 A;  3LOC A;  3QHA A;  3OSG A;  1RR7 A;  1WI3 A;  3NAR A;  4MLO A;  5IP6 A;  5J1R A;  2GM4 A;  5EYR A;  4PZC A;  2EZK A;  4V2G A;  4DW6 A;  1GV2 A;  3QSG A;  3Q3S A;  2R5Y B;  1ZR4 A;  3HOU J;  1LFB A;  4R1N A;  2ID3 A;  2LR8 A;  3L6D A;  3HDH A;  3HGY A;  2COB A;  2XB5 A;  3ZQL A;  1XS9 A;  1I50 J;  4S3M A;  5A9T A;  4DCK A;  2M8G X;  5IYD J;  1DLJ A;  1H88 C;  2JA5 J;  4BBS J;  4KUG A;  5EEA A;  2AHQ A;  2NS8 A;  2R92 J;  1AHD P;  3RKQ A;  3QPL A;  3BTL A;  1IGN A;  2OPT A;  4C3J J;  1JT6 A;  2R93 J;  2WV1 A;  5FKL A;  2L9R A;  2M34 A;  1F17 A;  1H8A C;  5K7H A;  1ETY A;  2P4Q A;  3S1M J;  4B3H A;  2OF7 A;  4DYC A;  4BBR J;  3E7L A;  1IJW C;  2DMN A;  2LKX A;  2NVX J;  1U9N A;  3LSJ A;  2FX0 A;  1EF4 A;  2E1O A;  3FK7 A;  3I4M J;  5JLW A;  2YS9 A;  5EG0 A;  5F0H A;  1HCR A;  5F08 A;  3W6V A;  3S16 J;  5GP9 A;  1U8B A;  2PLA A;  5M3F J;  3L1P A;  2CRG A;  2HXO A;  2LVS A;  5M5Y J;  3MKL A;  2LD5 A;  1A6I A;  3ZWB A;  4XIC A;  3WFJ A;  3BR1 A;  2HI3 A;  5IP7 J;  2L7M P;  1U78 A;  5IPA A;  4M3B A;  3BG5 A;  1EVZ A;  3FIW A;  4MO7 A;  5J1U A;  1LJ8 A;  1M75 A;  1RES A;  5FLM J;  1H89 C;  1FJL A;  2ME0 A;  1OCT C;  2DA3 A;  3JRH A;  1QVU A;  2XGE A;  3O8H A;  1B8I B;  3SJM A;  3SFI A;  3IH3 A;  1F36 A;  1GV5 A;  4M3E A;  2GF2 A;  4BY1 J;  2HOA A;  2XGD A;  1ITY A;  3A01 B;  5IYC J;  1WCM J;  1JUM A;  1X58 A;  3ZGY A;  1G2H A;  2CVZ A;  4A3E J;  3IQD B;  1JTX A;  1TWH J;  3HGG A;  2KDZ A;  4C3H J;  4RBO A;  2O9L A;  2E19 A;  1QPI A;  4UUS A;  2CQQ A;  3K6J A;  4J0F A;  1TWC J;  5J3L A;  2B63 J;  2MW8 A;  1YB4 A;  4FCY A;  3ZW8 A;  1ETQ A;  3DCF A;  4MFE A;  1QMG A;  4D5C A;  5F1J A;  1GT0 C;  3C7A A;  1DLI A;  4GBJ A;  2X6O A;  5HWS A;  2GBY A;  3LSR A;  2Y9Z A;  5F0C A;  5EGO B;  1GVD A;  2DJN A;  2I9P A;  3I4N J;  1WDM A;  2EBI A;  2R5Z A;  3HOW J;  4JPZ B;  2DN0 A;  3G17 A;  4B3J A;  1JJ6 C;  5FKK A;  5IOZ A;  4M3D A;  5J1Y A;  1POG A;  4PZE A;  1ETW A;  2ME6 A;  1JDJ A;  2FJ1 A;  4JX6 A;  3MN2 A;  3F0C A;  1OCP A;  2LLK A;  2AO9 A;  1R9T J;  2ZB9 A;  3ULK A;  5F27 A;  3K2A A;  4AYB N;  3O8G A;  2I10 A;  3JRI A;  5HOD A;  5EF6 A;  4DYD A;  3M4O J;  3OOU A;  2L0K A;  2DA5 A;  3FIS A;  3PLR A;  3W6Z A;  1F43 A;  1MBJ A;  1JGG A;  1B72 A;  3ZWA A;  4CYC A;  3HBL A;  1YVE I;  3HN2 A;  3S15 J;  1F12 A;  4JP0 A;  1DU6 A;  3BR0 A;  4GWG A;  2EQR A;  2JJ7 A;  4X6A J;  3PDU A;  2Y2Z A;  3S1N J;  4D3F A;  2NOG A;  4A3G J;  4IEJ A;  3HOY J;  1ZKG A;  4GWK A;  3ZQH A;  3SDG A;  5EG0 B;  3OIO A;  3ZQC A;  1Z0X A;  1RKT A;  3EGO A;  3OBB A;  2FQ4 A;  3PM1 A;  2R7Z J;  3IV5 A;  3H3V K;  1KS9 A;  1JKO C;  1WH5 A;  3TW7 A;  1ENH A;  4I76 A;  1VI0 A;  2R5Z B;  2JA8 J;  2LTP A;  4GFB A;  2JA7 J;  2W8Z A;  3RQS A;  2Y0S N;  4MFD A;  3FR8 A;  3PO2 J;  3MOG A;  5C3E J;  3BTI A;  2HOS A;  3UKG A;  2D3T A;  2HOT A;  4FGW A;  5FWN A;  1JKR C;  1I36 A;  4J0E A;  2L7F P;  3BTJ A;  1CQT A;  3LSG A;  2EZH A;  5IP9 J;  4UUS B;  2K9Q A;  1RKW A;  1EVY A;  1O4X A;  1M67 A;  4EZB A;  4DZJ A;  3D1N I;  5IYB J;  4B4C A;  2E2I J;  2CU7 A;  2GLO A;  4YCA A;  3S2H J;  3ZQG A;  4IHW A;  3CKY A;  3HKZ N;  3FKI J;  4BY7 J;  2DA6 A;  3GBG A;  3FR7 A;  2LFB A;  2YUS A;  2YU9 J;  2K9S A;  2LK2 A;  3G0O A;  3M3Y J;  2H8R A;  2XSD C;  2MSY A;  4Y52 J;  1Q1V A;  2ZYG A;  1LSJ A;  1OFC X;  5FKM A;  1HOM A;  2TRT A;  4FIS A;  4OQY A;  1N1E A;  1PGP A;  4M3G A;  1W0U A;  1JUP A;  3CQZ J;  2Y30 A;  3ADP A;  2K40 A;  2JN6 A;  3CCY A;  1JKQ C;  1MBG A;  3GTO J;  1LFU P;  1ZCJ A;  3HWR A;  1FIA A;  1SFO J;  1WPK A;  1VFC A;  3PJG A;  2TCT A;  3MVP A;  2DA4 A;  2VI6 A;  3GHY A;  3GTG J;  2LP0 A;  4JX4 A;  2Y9Y A;  1MSE C;  2JA6 J;  1ZQ3 P;  5JE8 A;  2EH3 A;  2VKV A;  5E3O A;  4B3I A;  3C7C B;  2IYO A;  4A3M J;  3LSP A;  2JMW A;  2QYT A;  1ZGW A;  1JT0 A;  2ZYD A;  2EZL A;  2W90 A;  1YRN B;  3PO3 J;  3HAD A;  2OFP A;  5GPA A;  3B6C A;  4AC0 A;  3TW6 A;  2DMP A;  2DTZ A;  3TED A;  4M3F A;  5E3L A;  4KUE A;  1BW6 A;  3JRE A;  1X0X A;  3W6U A;  3JRB A;  1IV6 A;  4C2M J;  4HNV A;  4L5E A;  1Z82 A;  4D3D A;  5A9S A;  2DMT A;  4D5F A;  2XGC A;  3CTV A;  4PZD A;  2DMU A;  3JRC A;  2IEK A;  3PEF A;  2WAQ N;  5EGO A;  3HOX J;  4OL9 A;  4Y7N J;  3GTM J;  3ZWC A;  1JUS A;  5GPC A;  2R5Y A;  1M66 A;  3WFI A;  2IAI A;  1Z77 A;  2QF7 A;  3ZQI A;  5IOY A;  1QRY A;  3K96 A;  3I83 A;  4E12 A;  4A3J J;  3HDD A;  2IZ0 A;  1TWF J;  3QQA A;  2X9D A;  1AU7 A;  3JRD A;  3S17 J;  3HM5 A;  1B8I A;  3G1L A;  3ZOB A;  4J19 A;  2DA2 A;  1IDY A;  4A3I J;  2DA1 A;  3A02 A;  1WP4 A;  1BA5 A;  2HDD A;  1F0Y A;  4A3F J;  4G12 A;  5K7F A;  1TC3 C;  5FKN A;  3HOZ J;  4E21 A;  1K83 J;  1I6H J;  1S7E A;  1LSO A;  1SAN A;  2Y31 A;  3BT9 A;  4S0H B;  4IHV A;  3GTK J;  2EW2 A;  1PUF A;  4DYQ A;  1MBH A;  2ECC A;  3JRG A;  5DS9 A;  3H2Z A;  4IHY A;  2O7O A;  1UG2 A;  2M9H A;  3HB9 A;  1TWG J;  3RQI A;  1MSF C;  5FLV A;  5EDN A;  4CYC B;  4A3K J;  3RZD J;  1B72 B;  2W48 A;  4OQZ A;  1F14 A;  5C4X J;  1T33 A;  4QSH A;  4LOC A;  3GTL J;  3C2B A;  4ABZ A;  1IL0 A;  1JJ8 C;  4XK4 A;  4BKX A;  2JWT A;  1IUF A;  2N8G A;  2VPR A;  1XG1 A;  1MBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...