2Y9YA

Chromatin remodeling factor isw1a(del_atpase)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
STPSHPRMPKPHVFHSHQLQPPQLQVLYEKERMWTAKKTGYVPTMDDVKAAYGKISDQEEQKEKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
total genus 63
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9yA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9yA03
5F0CA 4QIWN 2DMPA 3IH2A 3A02A 4JX5A 4AYBN 5F0FA 2LTPA 3IH3A 4FCYA 1AKHA 3JRGA 1MSEC 2Y2ZA 5IYBJ 1O4XA 1FIPA 2HQ5A 1APLC 1IC8A 4EEFG 2RAEA 1QPIA 2JJ7A 1JUPA 5K7FA 3BG3A 3Q3SA 1I3QJ 3JRHA 2R0QC 3GTGJ 4X1EA 4C3JJ 4A3CJ 1JKOC 1W0TA 1JTYA 1MBHA 2JMWA 1XC5A 5EZGA 2OPTA 3M4OJ 1Z77A 3VPRA 4XRSG 2DA1A 2WB1N 2E2IJ 1MBEA 3HM5A 4FTHA 4A3DJ 3DEWA 2K9QA 2XPVA 1AHDP 3BR6A 3BR5A 4D7MA 5IOYA 3I4MJ 2L7FP 1ETKA 4C3HJ 3B6CA 3LSJA 1GVDA 4A93J 2LP0A 3OSFA 4OVNF 2FJ1A 2LVSA 2NVQJ 1ZKGA 3Q0WA 3BTLA 3D1NI 2Y9ZA 2EH3A 2K9SA 2CUEA 2ZB9A 2MW8A 3S16J 2LLKA 1DU6A 2VPRA 3S1MJ 3TP3A 1VNDA 4MIMA 3LSGA 2R5ZA 5C4XJ 2XRLA 2NVXJ 2ECCA 1IRZA 4B4CA 4ABZA 4A3FJ 1PUFB 5FLVA 4DYRA 1B72B 1F43A 1XS9A 1H8AC 2DA4A 2VI6A 5EYRA 4X6AJ 4FISA 5E3MA 5EG0B 3ZQFA 4AC0A 4NDLA 5M5YJ 1JKRC 2DA2A 5IPAA 1JKQC 3JRCA 1BW5A 2DA7A 4BXXJ 1IG7A 2EBIA 1ETVA 4LOCA 5GPCA 3O8GA 5FKLA 5FKKA 1X2NA 2E2JJ 1WGXA 3S15J 4UUSB 2JA5J 1U8BA 5IP7J 1YRNB 2MSYA 5E3NA 5FKMA 5M5XJ 4UUTA 4CYCB 3GTLJ 5K7ZA 3HGGA 3RQIA 2DTZA 2B63J 1BL0A 3CDLA 3QQAA 4MFDA 3HB9A 3HGYA 4JX4A 1ETQA 4C3IJ 3FIWA 1JT6A 1MBKA 2X6OA 4D5FA 2L7ZA 1F36A 5M3MJ 2R5YB 4W97A 1MBFA 2ID3A 2MGQA 2CUFA 2ME0A 1TWCJ 4MO7A 2XSDC 1RKWA 4XK4A 3JRBA 3E7LA 2YUSA 3H3VK 1BJZA 5EEAA 1HDDC 3OOUA 3RZOJ 5IYCJ 1JJ6C 3S2HJ 3HOZJ 4Y7NJ 2Y0SN 5C4JJ 2MG4A 2N8GA 1Q1VA 4IHVA 2ELKA 5IP9J 3S2DJ 4AUXA 1TWHJ 3W6VA 2R92J 3S1QJ 2DA3A 5FLMJ 1MNMC 3GTMJ 5C3EJ 1GUUA 2XB0X 4M6VA 5DS9A 4FE7A 2DMUA 3K2AA 3LOCA 4MFEA 3FK7A 4XICA 1ETYA 4W1UA 3BTCA 2HYJA 4A3LJ 3JRFA 3QPLA 2AO9A 1TWAJ 1G2HA 9ANTA 1MH3A 3FISA 1X58A 3G1LA 1HCRA 3MKLA 4A3EJ 1Y1WJ 2KT0A 2XGDA 4A3JJ 1PUFA 2CQQA 1ZK8A 1B72A 1HDPA 1ZQ3P 2VUMJ 2JN6A 1A6IA 1QRYA 2LD5A 3A01B 5C44J 4C2MJ 5K7HA 4DZJA 3PM1A 4M3BA 2M9HA 1SFOJ 1IGNA 3UKGA 1K83J 3I4NJ 1U78A 2JA6J 4D5CA 5EG0A 4Y52J 3C2BA 3BT9A 1BW6A 5F0HA 1K61A 2KDZA 2L7MP 1JTXA 4M3EA 2H8RA 3G1OA 3GBGA 1IDYA 2CJJA 5EZHA 5F08A 2W48A 2JK3A 3GTOJ 4BKXA 1ZR4A 2LK2A 2DN0A 1TC3C 2NS7A 4UUSA 3TW7A 4DZPA 1YRNA 5J1UA 5IOZA 3HBLA 2ECBA 4CYCA 2LR8A 1ITYA 4JYKA 1GV5A 1HOMA 1RR7A 2FD5A 3A03A 5J3LA 1GDTA 5FKNA 1QVTA 4XIDA 1ETOA 2DJNA 1ETXA 2R5YA 1NK3P 3JRDA 2DMNA 4S0HB 4IHWA 2Y9YA 5IP6A 2EZKA 2WV1A 4XRSA 2DA5A 4A3GJ 3ZQLA 3HOUJ 3JREA 5HODA 5FKOA 3FKIJ 1EF4A 2HXIA 4JP0A 5F27A 4HNVA 1JJ8C 1LE8B 1FEXA 1AU7A 2XGCA 2IEKA 4B1RA 1SANA 4FE4A 3RZDJ 1B8IA 2NVTJ 4B3AA 4JX6A 2I10A 2M2EA 1NTCA 2DMQA 1S7EA 1WPKA 3TP0A 1MH4A 1H88C 3SDGA 2L0KA 2E19A 5GPAA 4I6ZA 1IDZA 4IEJA 5F1JA 1W0UA 1MBGA 3GTQJ 3QPSA 5J1YA 3LNQA 3TEDA 5EGOB 3BQZA 1CQTA 1OFCX 4A3IJ 1NK2P 3S1NJ 1JUSA 1TWFJ 1LFBA 4BBSJ 1FTZA 2E1OA 2LY9A 2DMTA 3HKZN 1Z0XA 4G12A 4RDUA 2JA7J 2HDDA 3BQYA 1ZR2A 3F0CA 4DCKA 3ZQGA 3Q0UA 3ZOBA 2O9LA 1H89C 1B8IB 2L9RA 3SJMA 5BNGA 2M0CA 2LFBA 1TWGJ 3S14J 1UMQA 2GM4A 2IBDA 5F04A 3JRIA 1Y1VJ 2O7OA 2FX0A 3A01A 3S17J 1FIAA 4I76A 2NS8A 1UG2A 3IH4A 3BTIA 2LKXA 2HXOA 3MVPA 1I6HJ 3G1MA 3WHCA 3HEFA 1U9OA 5E3LA 1RPWA 2XPWA 3OSGA 2XGEA 2M34A 4JPZB 1GV2A 2AHQA 2EZIA 1FJLA 2R7ZJ 2M8GX 5DTDA 2X9DA 4M3DA 4BY7J 4BBRJ 1JKPC 4IHYA 2HOSA 4A3KJ 1OJLA 3LSRA 1E3OC 1ZTRA 1DU0A 3BG9A 1P7IA 3BG5A 1WH7A 3ZQIA 3H0GJ 3HOWJ 3S1RJ 2ID6A 2P81A 1D5YA 1I50J 4V2FA 2HOTA 3HDDA 4BY1J 4L5EA 1AKHB 5EF6A 1ENHA 2Y31A 2TRTA 5GP9A 3GTJJ 4A3MJ 3GTKJ 2X48A 1JUMA 5J1RA 3HOYJ 2GBYA 4D7NA 1VI0A 2XPUA 4M3GA 4DYQA 4M3FA 2QCOA 1OCTC 2TCTA 3CCYA 2CRGA 2ME6A 1T56A 1WI3A 2WAQN 3NAUA 3CMYA 1WH5A 1JT0A 2PMZN 1VF9A 1A5JA 1GT0C 1LE8A 3L1PA 2CU7A 3OIOA 1JGGA 2E2HJ 3M3YJ 4MLOA 3NARA 1VFCA 3PO3J 1IJWC 1X2MA 3ZQHA 4XRMA 3GTPJ 2EZLA 5JLXA 3JR9A 1BA5A 1WCMJ 1XG1A 5M3FJ 3LSPA 4GFBA 3BTJA 2DA6A 3SFIA 1POGA 2K40A 3K7AJ 1IV6A 3IV5A 2FQ4A 1QVUA 3HOXJ 3HOVJ 2G0EA 4A69C 1IUFA 1RESA 5EGOA 4V2GA 2NVYJ 2HI3A 2EQRA 3B6AA 1MBJA 1HLVA 5E3OA 1LFUP 2EZHA 2CQXA 2R93J 2D5VA 5FJ8J 3FK6A 4RBOA 2IAIA 1HF0A 2R5ZB 4DYCA 1U9NA 2GLOA 1RKTA 2NOGA 4J19A 4QTRA 1UHSA 3BR1A 3DCFA 5M5WJ 1MSFC 3BR3A 2Y30A 4JQ0D 4DW6A 2H1KA 5IYDJ 2VKVA 1P7JA 2JWTA 4IHXA 1FTTA 2QF7A 2YU9J 4A3BJ 3CQZJ 5EDNA 1R9TJ 3Q0VA 2K9NA 1ZGWA 2HOAA 4QSHA 3WHBA 3O8HA 3PO2J 2OF7A 1RETA 3MN2A 3BR2A 3BR0A 2COBA 3ZQCA 1OCPA 3TW6A 3RKQA 1T33A 2JA8J 1ORKA 2XB5A 3JRAA 2O8KA 5JLWA 1ETWA 2YS9A 2VKEA
chains in the Genus database with same CATH superfamily
5HDKA 4JOMA 2LYCA 2KZIA 4QIWN 2VQHA 4Q4ZF 3QRFF 3CKYA 1SC7A 4BAYA 1MD0A 4XOTA 4A6DA 1X79B 1N77A 1S1CX 2WAQA 4XORA 3PQKA 3ZGYA 4UB8C 2LTPA 1I3AA 2A45G 4PV1B 1FDMA 2ZMEA 1AKHA 1RR8C 2BW3A 2FOWA 2Y2ZA 3PSIA 4A0XA 3AEFC 1R22A 1QVGO 5IYBJ 2R7FA 4I0BA 3B02A 2FYUJ 4P5OA 1SS1A 1APLC 3WTYC 3L72D 4KUGA 1BIBA 1QQIA 2RAEA 4RS8A 1QPIA 3II6A 4IL6E 4L73A 1AFOA 1QVFO 3P8CE 2RNGA 3CP8A 3JRHA 3WTVC 3L2RA 3GTGJ 4HW0A 5H20A 4X1EA 3WTUC 3UNGC 1MFZA 2AXTH 2FYUE 2Q6QA 2FMLA 4YEJA 1FZCA 1PP9J 3P32A 1ZLLA 3JCUE 1NH3A 3SFZA 1PZQA 2H27A 2J5PA 2H8PD 1JTYA 1MBHA 3ZMSA 2YMYA 5GTIH 1S9HA 1LTAC 3SFEC 3EUAA 4GXOA 5B5EH 2DXIA 4PZEA 5AW2B 2BXZA 5LD2C 2HYFA 1IFMA 3M4OJ 1Z77A 3VPRA 1PP9E 2A68F 4MTDA 4GWGA 1GL2A 2N1TC 1J75A 2E76B 3DEWA 2ICWG 5L3DA 2XPVA 1KU3A 5J4VA 1AHDP 1LJ2A 1FYKA 3HXLA 1FSHA 2HFED 1X4OA 3K0LA 2Y0MA 3ZQ7A 1GD2E 1T8IA 1GMJA 1GVDA 1HW1A 3M07A 4JQFA 2PJRB 2X1EA 3BCAA 4GCVA 3GF3A 1HWTC 2HPIA 4IJAA 3BDDA 2KKOA 2NVQJ 1OYYA 3Q0WA 4PCQA 2OGUA 3JAMK 5KJ7A 5AVZB 1X19A 1LT9A 1O3SA 4RM3A 1HH0A 2JA2A 2ZB9A 2QEXP 3SZGA 4HV6A 1N73B 2JVGA 2LKMA 5CYVA 2VPRA 2IS6A 2FXPA 1VQKP 1LQ1A 2IGNA 1Z56A 1VNDA 4KN4X 4MIMA 4C30A 1M1JC 2PI0A 4KYWA 3L75G 1ODDA 2ECCA 3M9HA 1J2JB 3QH9A 3IL2A 3B71A 5E1ZB 4A5NA 4ABZA 1X1DA 4A3FJ 1NTZK 1PUFB 1XMXA 5ICFA 2RKLA 3OYLA 5CHXA 5KAFH 1VQPP 4M6YA 1ZELA 3LSIA 2DYSH 1VQ7I 3E1SA 1KQLA 5EFWB 1PYVA 1Z1DA 1XS9A 5AIQA 3H36A 1K7AA 3GHYA 3DQVC 3N05A 4D3DA 5AW1B 1QGPA 1YS6A 2UXXA 1H89A 2LRDA 4QPQA 4DGWB 1KC8Q 4WB4A 2PQ8A 3MEXA 1KILE 3C18A 1Q86Q 1J1EC 3WTXC 2R7QA 3OYIA 3BJAA 2R7VA 3H1LG 3JW4A 2E75C 2MD0A 1MMNA 5JR3A 3C3WA 3RL0g 1WJAA 2GA1A 2OYHC 5LGUA 1BG6A 1FSEA 5ILSA 1UELB 2JP3A 1LJ9A 4XN3A 1KQ8A 2HPCB 2YU3A 1N75A 2A6EF 5IPAA 1ULYA 2KIQA 1JKQC 1LTJB 3AKZA 2ZNZA 3IP4B 4ENMA 4GODA 3M91A 4H44B 5AVRB 2DA7A 5DUIA 3P9CA 3RKWA 2EBIA 2HQNA 4YIRX 3ZDMA 1WGXA 1XDSA 2JA5J 4XM3A 3L2WA 3CCEI 3OOPA 5F64A 2O1KA 2QJKB 3J7AY 1URQD 1ZG5A 3RQ4A 3GTLJ 2W1OA 1KFNA 3ZMTA 5BS6A 1Y8RB 3ADPA 1KB9D 3RQIA 1VQ6I 3VYSB 4KA4A 2B63J 2IPPA 3HSRA 4L5JA 1KGSA 1SVLA 2K5CA 3Q1MA 3QQAA 2G7UA 4MFDA 1NTMG 2W27A 3HPHA 3HGYA 1YOVB 3GYHX 2QE7H 3O6QB 4Z1MH 1ETQA 1T6SA 1RF0C 3M8JA 1QO0D 3U9GA 4I99C 3K4JA 2B9BA 3L00A 2KZJA 1WZ2A 4KFCA 2X6OA 3IHUA 1W2BO 3VOEA 2QLZA 2HVRA 3PNYA 4HQEA 4MO7A 2ME0A 1TWCJ 2E74B 2VBYA 4RLQA 1AVOA 2R7XA 3KCCA 2ZFWA 4MN4C 4S05A 4XK4A 3JSOA 3JRBA 3E7LA 2QSHX 4P9UA 3BCCD 3F3XA 5JE8A 1OISA 4XKCA 3H9GA 4LK0F 1G1IA 1IRGA 3FGAD 2M1BA 2CQKA 2QSFX 2E35A 3NRVA 2VT3A 1PGJA 5H2FE 3HOZJ 4Y7NJ 1UCRA 2MG4A 1FDIA 4GOEA 1Q1VA 2STTA 2OARA 5LLQA 3QWLA 3OYJA 2ZJPF 1SQXJ 2HZDA 4XR6A 1ON1A 3HZJA 4AUXA 5LEKA 2AEFA 4H0LD 1GU5A 1PUEE 3L73G 1KTMA 1S7OA 1KYZA 1X0XA 2CO5A 3SWFA 3U21A 5J8FA 2POHA 1XGOA 3RKXA 3VWBA 1D5VA 2IFMA 5C3EJ 4WXDA 1GUUA 1OCCH 1SQXE 4LLNA 2OZ6A 1YTYA 2AEMA 2PG4A 4NC8A 4XLHA 1KZUB 4XL9A 1FZAA 4Y13A 3GG2A 4ETSA 1P4XA 4MFEA 4C46A 4XICA 4W1UA 1T39A 3DPTA 2GZWA 2HYJA 1FZEA 1LB2A 1RC9A 1G2CB 3ASNH 4U0WA 2R5DA 2R3CA 2DYRH 3WE2A 2AO9A 1J0RA 4CCKA 1TWAJ 1SFUA 1NOHA 1MH3A 3FISA 2L9VA 1S72I 3BLYA 4L9NA 3K4NA 3MKLA 2R3SA 1Y1WJ 1HCRA 4M9ZA 3E7KA 3H1ID 1K8AQ 4OIQF 2ZJ2A 5AIPA 3T8TA 4GWKA 3L72J 3G6EP 1G3WA 1DD3A 2N1TD 3D6ZA 1QZEA 1J1DC 3S93A 1URQA 4PGGA 1PFIA 5C44J 1T08B 5K7HA 4IHSA 4CCMA 3L72E 4IO9F 3FZVA 3MWMA 4JF7A 2M45A 4DOZA 2M9HA 2PX9A 2H6BA 3B73A 4XLFA 2KP6A 5BQTA 3I4NJ 3SFDC 1SQPD 2DT7B 2VODA 1VQOI 3J80Z 1OCOH 5D5XB 4BQAA 1R58A 1BCCD 3G73A 5F0HA 1K61A 2KDZA 3Q5PA 1IUYA 1RUNA 1JTXA 3CPWO 2RREA 3FM3A 3BROA 2W83C 2K86A 3U1KA 5APQA 5ILVA 4PUSA 4UVCA 3KYQA 1ZRDA 3AE2C 5KCMA 2V1XA 2DN0A 3RQSA 4UUSA 1L4AC 3TW7A 4DZPA 2M5WA 1VPCA 1YRNA 5J1UA 2QSIA 3A0BC 3L74E 2O1JA 1RF1A 1PGOA 3CD6P 1G8XA 4IXAA 2ZXXA 3HD7C 3E6BA 1F9NA 2A3SA 1C0WA 1RR7A 4P96A 3A03A 5J3LA 5FWNA 1SQBJ 3G4SI 2HTSA 1TU3F 1ZMEC 1Y56A 1HA8A 1J2XA 3FXOA 1QVTA 4XIDA 2B89A 3GHGC 1OIPA 2QJPC 4LK1F 1TNTA 5E79C 4BNCA 4M6XA 5HOOA 2KZGA 1ETXA 4QPOA 4ZYAA 3V4GA 3X2QH 4U7DA 1J9IA 1YJ8A 3JRDA 1WVRA 1SQBE 1D0ZA 5B66C 4S0HB 4NPDA 3WUUA 3ABUA 1KQFB 5IP6A 3ZPLA 2E75D 4H13B 1EH8A 2PMHA 4F52A 1FOXA 1SQQG 2KLOA 2KJBA 2DA5A 3M7GA 2QBYB 3HUGB 4HF2A 4A3GJ 4J0EA 4M9SA 2WC2A 3ZQLA 2YX7A 2FY8A 2KLUA 5AVSB 1IFJA 2VL8A 2DI3A 1DP3A 2M4KA 1LKXA 3FKIJ 2HXIA 3QP6A 1SQVJ 3H1JD 1TQIA 2STWA 1JJ8C 4U7JA 4AQRD 4PGHA 1T2KC 3NWTA 1OYWA 2ZXWH 1LVAA 1AU7A 1VQ8I 2XGCA 3WG7H 4XKBA 4B3XA 2JKVA 2VJ5A 3RIRA 1RH5B 2IP2A 4B1RA 1SANA 1SQVE 3RBZA 5APUA 4B3AA 3QHAA 1TNSA 1X3WB 3OYBA 1QA6A 1AOYA 4EI2A 2N1TA 3LA7A 3R0AA 1SFCC 1KQSO 1EDIA 4QMAA 5KKZB 3TP0A 4R1HA 1MNDA 1H88C 3SDGA 1L0LK 4ZMDA 4BGDA 1T3UA 3W3CA 1VQ7P 4ZYDA 2Q3EA 3ITKA 1PGQA 1MBGA 4KJZA 3G2BA 3L71J 2KMUA 1J5YA 1EJ9A 2B7EA 2YXQB 5J1YA 2PFXA 1NTKG 4YIFA 3D70A 1UG0A 3HHHA 2WQYC 1NK2P 3K4LA 4MQVA 3KZIC 1KYOE 1LFBA 1SD4A 2KRCA 3KP5A 1MMGA 2DMTA 3L71E 4G12A 2C9NY 1KB9H 4LG0B 1QHHD 4DCKA 1XCVA 2WAEA 4DQ2A 3Q0UA 1SFKA 3RGUA 1A04A 5HNHA 1WJ5A 1I6XA 1EXIA 2UYYA 2HR3A 2MLGA 4E7HA 1TWGJ 2WT7A 2ZFUA 3FBIB 2B9SA 3R61A 3PJRA 2GM4A 1KB9E 2MBFA 2F5EA 3HTKA 1M1JA 2IBDA 5F04A 3MGNA 2O7OA 3GZ6A 5BPDA 3ONQA 5KLVK 1WJEA 4RO0A 4ANJA 3IH4A 5ILUA 3H1KG 4E13A 1YHQI 2JZYA 1KA8A 2DO7A 2FMYA 3KZYA 2F5CA 1I6HJ 1MNEA 2BY3A 2KHMA 3G1MA 3HEFA 1HW2A 2KNCB 4OGQC 4DJGA 1N25A 1RPWA 1XX5A 2P5VA 3IKVA 2M34A 1SLQA 1GV2A 1VQ6P 1G6NA 1Z05A 3CO6C 2R7ZJ 5DTDA 1USDA 1Z6TA 2X9DA 2VB6A 3RK3D 3IAS2 4UV9A 1T95A 1JKPC 4IHYA 4OINF 2HOSA 4EDFA 2IA2A 2K9JB 4A3KJ 1OJLA 3LSRA 3CTVA 1SD5A 5FLXK 4RAFA 2MC3A 2X1DA 1OKRA 4EGZA 4PV1C 1TW2A 2OYHA 5A9SB 1L0ND 2D3TA 2WY7Q 3ZQIA 2H09A 4XNFA 3WTWC 5HS9A 2L5GB 1P9QC 4RAYA 5FRNA 3S1RJ 2JRMA 2UV1A 3E5UA 3V7RA 2P81A 3L2VA 1CF7B 4XA4A 2IZ1A 2X85A 4BY1J 4L0ZB 1FDOA 5DYMA 4LJZF 2Y31A 3L75D 5GP9A 3LSHA 3GTJJ 1ZG3A 2EV6A 4AVZA 3HPGA 2X48A 3HRSA 1IAWA 1HGZA 1N7LA 2WWWA 1RIOH 4HOBA 2OC6A 1YW7A 2K3PA 1EZVE 3DF8A 2OTLI 1TQPA 2XPUA 3C2GA 1YONA 4M3FA 3H1HD 5AVWB 2IDBA 2Z16A 1OCTC 2V79A 2TCTA 2RC4A 3H1IJ 2V9PA 3CCYA 2DPUA 2E5TA 2CRGA 4JK1X 2ME6A 2KJCA 4WX9A 1QEXA 2R7RA 2R7WA 2FQ3A 4ESJA 3AE4C 3CMYA 4EMSA 3H92A 5AVYB 4AU7A 1A5JA 2ZFCA 3CZ6A 2CQ7A 2MFZA 3NARA 3AECC 3PO3J 1W7PD 2ZO4A 1YW9A 1IJWC 3HKZA 1SD7A 3E5QA 4HZFA 5LHGA 1JE8A 4C2UA 1F12A 2Y0SA 3GTPJ 4O6JA 5JLXA 3WG9A 1L4AD 2QM7A 4U87A 3CF2A 4KISA 1AA0A 1QL2A 2W6BA 1WCMJ 3CDIA 1BCCJ 4R1NA 4OMZA 1S72P 1N73C 3SFIA 3HD7D 1A02F 2VC0A 2PFBA 3HRTA 1ZYRF 4F93B 1P4AA 2FQ4A 2YIUB 1G3YA 3BP8A 3HOXJ 2FFDB 1JY2O 2G0EA 2KRFA 3KHUA 3TDUC 2J5OA 2G3AA 4A69C 4UB6H 3PL8A 1Y9BA 1IUFA 2KB7P 1XCBA 2KIFA 3FR7A 3W2VA 3RK2D 2BOLA 3M1CA 3GMAA 1HLVA 1I5ZA 3O6BB 5LHHA 1FNNA 2EZHA 1U7JA 3MTUE 4ENKA 1BM9A 3RPUA 3PSFA 4KNYA 4RBOA 4UB6E 2E7XA 4LIUA 2NPSD 3VB2A 3MUDA 1HF0A 1VQOP 2R5ZB 5CBNA 4DYCA 1U9NA 1FE6A 2W24A 1SVOA 2WVRA 2DBBA 3KEQA 5GTHE 3N97A 1IN6A 2FXMA 1UAAA 3M06A 3GF2A 2QENA 2VLAA 3J80K 3OS1A 3PIPF 1LT9C 4FX0A 3DCFA 2L9SA 2HKXA 3L37A 3WGIA 4JQ0D 3WUTA 1T2KD 3GW6A 5C39A 5A9TA 1V3FA 2VKVA 4OQYA 4PZDA 3CCEP 2JVHA 1I1GA 3CQZJ 4A3BJ 1BDDA 1KU2A 1R9TJ 3Q0VA 2L4AA 4S3MA 4A5MA 2HOAA 3HRMA 1ZGWA 3MMYB 2P10A 1LTJC 2K7LA 4OIPF 2ZSHB 1SFCD 2M5AB 4H44C 1EC5A 2K9YA 4D6TG 3HSFA 3PNVA 3SZPA 3H1JJ 3Q5SA 4LD5A 3K6JA 2O3JA 3BR2A 1U7MA 1HUCA 3G4SP 1JY3N 3H25A 2JA8J 3FF5A 2QJKC 3JRAA 2O8KA 1NU1G 1O7FA 1ETWA 3L73D 4V19K 3HG9A 3E6CC 2CG4A 1TP4A 3H0DA 3S8PA 1R7JA 3KP4A 4J00A 1YJQA 3ULKA 1HKQA 4UXNA 3HTSB 5DJUB 4JX5A 3HIFA 1R5ID 1AQ5A 2QUFA 1XB4A 2RGVA 3WMM0 4BEHA 4YIIA 1D1CA 4AYCA 1K78A 4FCYA 1S5LX 3JRGA 1EH6A 3BCCG 4WBAA 1NTZD 1OCRH 2F2EA 1SMYF 2A45H 1L4AA 3R4KA 2HQ5A 2OJED 3K9TA 1VQ8P 2E74C 4MTEA 1FBUA 3SEQA 4RGRA 3FWEA 4ZKPA 2EIKH 2W00A 2XAFA 3FXMA 1JUPA 3HD7A 4G6TB 1Q7YQ 1D8JA 2NNNA 3HSEA 2R0QC 1I3QJ 3OIQA 2OV7A 2QWWA 3I5CA 3H3UA 3QOPA 2IFNA 3VOPA 4XLAA 1FAVA 4A3CJ 1JKOC 1EKEA 2VC1A 3DFUA 3CO7C 1AA7A 4QWQA 2WPRA 4II3A 3GHGA 2ZT9C 3DPUA 1XC5A 5EZGA 3ECOA 3W6UA 4XN0A 2WB1N 4BXUA 1JB0J 3HADA 2DT5A 4FTHA 4A3DJ 2N9BA 4XLNF 3KEOA 2RN0A 2K9QA 1JCDA 5DCFA 3BASA 3PP5A 4PV1D 3BR6A 3BR5A 3FX0A 2RH0A 3PUFA 4D7MA 2FXOA 2O8XA 4RAZA 3VYTB 1EDKA 2UUZA 1F1ZA 1DGWY 1ETKA 1Z6RA 2F5DA 3B6CA 3LSJA 2G9WA 4E7LA 3NEUA 2VJJA 4DIQA 1T2KA 1FC2C 3E3VA 2LMDA 1OR7C 1BN5A 2LP0A 2Z1DA 2ESHA 2LVSA 2XSJC 1I39A 4TV7A 3BTLA 1G3TA 2ZC2A 2Y9ZA 3RK3E 2K9SA 4HQMA 1PP8F 4PZCA 2MW8A 1T38A 1SFCA 2FBHA 1MZBA 4Y33A 2FBKA 1EDLA 1YHQP 3H35A 2LLKA 3BZCA 1VF5B 3S1KA 1G3SA 1FS0E 1SQPG 1PP7U 3U1CA 1WT6A 5C4XJ 1FLIA 3LSGA 3IN6A 2E71A 2XRLA 1JMBA 3OYGA 1KQ9A 4U3FG 3GXOA 4HBLA 1YFHA 2NVXJ 3L75J 5L3FA 1IRZA 2OAZA 2DOAA 2KS1B 3ESWB 3WGHA 1G1JA 4DYRA 1O7LA 3GFLA 1BGYG 1F43A 2J5UA 3TO9A 1IN5A 2ZCWA 2K9LA 2PN6A 3C9IA 3T0YA 1S6LA 4OIRF 1KD1Q 2DA4A 2QYTA 4PZJA 2L01A 3KLNA 3W6JB 2CK3H 1B59A 2V7QJ 1K79A 1GLNA 3DBRB 4OH8B 4BJ6C 1K73Q 2PJPA 5L3EA 5EG0B 5AYVA 3H1LJ 1WJDA 3HE5B 1BIAA 4KMUX 4BE0A 4ZDLA 4AC0A 2HVSA 1NAYA 4NDLA 4ZH4F 3F8CA 1Q82Q 4XFJA 4BACA 2LY1A 2X6WA 3H1LE 2HLOA 2XKOA 2OTLP 1NG7A 3OV8A 5CVRA 5FFZA 4BXXJ 2E34A 2QQ9A 5J6XA 2Y0EA 3A0BH 5AVVB 4HLYA 3O8GA 1Y0NA 4CPGA 2E2JJ 4GDOA 3VEPA 2DOEA 3S15J 1U8BA 2E60A 5D8LB 5E8IA 3CCLI 1W5CC 5K7ZA 1LPQA 5DCMB 5KJ7D 3OYKA 3H1JG 4PJ0H 1BL0A 4AD9A 2W7NA 5TJJA 1G4DA 1ZLJA 4F3QA 3V7SA 3CF5F 3FXDA 4AIDA 2DK8A 4H13C 1M1EB 2HTJA 3KP7A 1R5LA 2AXLA 5HLTA 3BZ6A 1TL8A 5DM7F 1AWCA 2BHYA 4C3IJ 3PIDA 1NTMJ 1JT6A 4PJ0E 5B66H 5BU5A 3FBNB 1X0TA 1MBKA 4D5FA 4MEXF 1BDCA 3WFJA 5DM6F 1F36A 5M3MJ 3QOEA 2R5YB 3CP2A 4XLEA 2MLKA 3QU6A 5KK1A 4IZZA 2YNYA 2DOFA 2ID3A 2IS1A 4LB5A 4H44D 4KJMA 4WY4B 4D3SA 2EIMH 1YW8A 5J40A 1RKWA 1NTME 3H1KD 2DFEA 2HOEA 2EFOA 2ACJA 4OIOF 2YUSA 3H3VK 2ZT9B 4HB1A 3TO7A 1TT0A 3V2RA 1Y47A 3OYCA 3CXHI 2JSPA 1X1CA 1JJ6C 3H32B 5KKZC 3G17A 5FFXA 2BZTA 1X3ZB 2QIWA 3F5HA 2Y0SN 4K3AA 1OYIA 3IRRA 2QQ8A 3ZCOA 5DEQA 3F9KA 4AIJA 3MZHA 1L0NJ 2PJRA 1DDNA 3HRNA 3L7WA 2KL4A 3KYDB 2W82A 4CDGA 4A0YA 4U7BA 2ITAA 1MNMC 2R7UA 5AVUB 3ZMVA 3L73J 4GT1A 1WFXA 1TT5B 2OCCH 2K02A 5KHDA 1WDKA 5LGNA 2IVMA 2RDPA 1YI2I 4CCJA 2HYNA 2DMUA 3FWLA 2AXTE 3QYFA 1QBJA 1N73A 1DH3A 2DFIA 3MD0A 2JPBA 4RGXA 1XSDA 1ETYA 1E79H 2I9PA 3I54A 4DNCA 2IT0A 1WPQA 3LSKA 1KILB 5GTIE 5B5EE 3DTKA 1FBQA 2QM3A 1LFPA 4AIHA 1G2HA 3IF4A 4QLCU 2X58A 1HJ0A 3USSA 1D1BA 4PD4I 5BMZA 2IGKA 2CPBA 4B3HA 2XGDA 5HDNA 2L2OA 3M9QA 1PUFA 2CQQA 3NTNA 5TISC 2JT1A 1HDPA 2XAUA 1QLED 1R8EA 3ZHBA 2VUMJ 2WTBA 1V5GA 4IL6X 4PD4D 2R4GA 1L0NG 1V54H 1XMKA 1T0FC 3ABKH 3V5BA 3SWKA 4E7SA 4C2MJ 4DZJA 4HH2A 1FBMA 2IJLA 1X9VA 4M3BA 2QM8A 4PFPA 3H9QA 3OJAB 4Y28J 4EZBA 1K6OA 1IGNA 2P5LC 1PJRA 2I5UA 4XBFA 2CVZA 2WBMA 5BVZA 1U78A 3D1LA 4G8XA 4DYDA 3JTHA 2JA6J 2EFNA 1FOKA 4IHTA 1J09A 5KAIC 4GOFA 1L0LD 3IQDB 2M3EA 1RZ4A 1ZLKA 4RESB 2C0WA 1Z7UA 1LWUB 3WFIA 1MMSA 2CJJA 2FYUK 2HPCA 1BI1A 4KITB 4GBJA 4XMYA 2X1CA 3BVHA 2E7WA 5F08A 5F6FA 1LTJA 3MIWA 2JK3A 1JEKA 1K4TA 3GTOJ 5AW8B 1ZR4A 3H1HG 4C2TA 2CUZA 4HG2A 2NS7A 6PAXA 1N8RQ 1KQGB 5IOZA 5CQEA 2ECBA 2IXSA 1YS7A 1JI8A 1LSJA 4XSZF 2A05A 4LGWA 3CWBD 3S9OA 1ITYA 1HF9A 5KAFE 2GUVA 1OWAA 1JHFA 1TW3A 4BL0B 1D0XA 2BY0A 1KN7A 2FD5A 2RVCA 3IC7A 3ZGKA 3MKWB 1R6RA 1GDTA 3V8LA 4CGZA 2CYYA 3FXLA 3O6QA 3CMAI 5KLVD 2WY8Q 4B86A 1S5LC 3DWLE 2DJNA 4IOAF 4GGGA 3R60A 1MGTA 3EUKL 3WS7A 4ZKUA 1X3UA 1SVFA 2Y9YA 1HW5A 2EZKA 3U2RA 4XRSA 4ASVA 2BHZA 5JVTA 4EM0B 1NJIQ 1IRXA 2W25A 1SQQJ 1OX3A 5HODA 1YQ4C 2WWYA 5FKOA 2FUG2 3PFYA 2LKPA 1MDMB 1PGNA 1YQAA 1LE8B 3OR2C 2BV6A 4D6TD 4KUHA 3L4FA 1YX5A 4G94A 5FLXZ 1SQQE 2IEKA 2G8YA 2YIUC 4ASWA 3DTEA 2FFDC 3AE6C 4FE4A 2LC2A 1NU1D 2NXNB 2M2EA 2HWVA 4OQZA 2FA5A 3QPTA 2P1JA 3DEEA 1W36C 3KP6A 1LNWA 1MH4A 4E4HA 3TK1A 1DIPA 4GYIA 3V6IA 2Q1ZB 4HSRA 5GPAA 3REOA 4I6ZA 1IDZA 4IEJA 2QG4A 3GMEA 1OW7A 4E6KG 5F1JA 2VQCA 5F1RA 3Q3DA 2QQAA 3VMAA 3QPSA 3PH0A 3ABMH 3VSLA 4Q47A 3LNQA 1OR7A 2FBIA 5B1AH 3TEDA 2MA3A 4E21A 5CKTA 5E17F 1OFCX 4A3IJ 3RTRA 1NTKJ 1TWFJ 1G2CA 3PTZA 2YPRA 2E1OA 4MNUA 1Z0XA 4KHXA 1VQMI 5LRSA 2H43A 3BQYA 4XSXF 2VOOA 1OXZA 2IW5A 2UWJE 1DX7A 2NAZA 3SJMA 1R23A 1NTKE 1FT9A 3VDXA 1GU4A 1UMQA 2R7OA 3MZ8A 5CVIA 5D8KB 3I0TA 5HLHA 3L70D 2JWDA 3HUSB 1B4AA 3S17J 2JUGA 1YO5C 1VQ9I 2QRXA 4I76A 4GDFA 2F5VA 5AW6B 4RM2A 2NS8A 3MUDC 3BTIA 2LKXA 1UHWA 2E5NA 3CCLP 3WHCA 4BQOA 3HL2A 1ZRCA 3H1KJ 1W5SA 3BOQA 3K1MA 3F8BA 3F21A 2XRNA 1BC8C 2JUCA 3S3MA 3PRJA 2EZIA 1WSUA 4OWRB 2E36A 2M8GX 3K4KA 4A6EA 1NTZG 3K69A 2VASA 4CXFA 4BY7J 3K1PA 3H1CA 1HTLC 1JMMA 4ZZDA 1RHZB 1X4PA 1F0YA 5K5GB 3ECHA 1E0EA 1UFMA 4NQWB 5KTBA 2JQ7A 3BG5A 1Z21A 1WWXA 3QAHA 3FXEA 4N9HA 1F4KA 3LFKA 4I98B 1F5TA 2ZSIB 2P7CB 3GFIA 3QPHA 2W84A 4KDPA 1YJWI 5DV5A 3OR1C 4FETA 4I2OA 4BXLA 4V2FA 2HOTA 3HDDA 4L5EA 2L7KA 3QODA 3AE3C 1U0JA 2VBXA 1Y39A 1XD7A 2A5YB 2B0LA 1NHAA 2EV5A 2TRTA 2XASA 4E7JA 3HHGA 4A3MJ 3GTKJ 1XGNA 2IYOA 1IJDB 1S2EA 4U3FD 5JHFA 4EJVA 2M0MA 1WJCA 3TOAA 2CV0A 3CUQB 2GBYA 3DEUA 3WU2C 3P7NA 1BGYD 4M3GA 1HGVA 3L2UA 2UWMA 1SQXK 4CSWA 1P92A 4ZTFA 5CPRB 4RGSA 5LFAA 4L76A 2QBYA 3HUGA 4BH9A 3PFIA 4ZTJA 1T56A 2VONA 3LIDA 1FP2A 2WAQN 4JBAA 1JT0A 2G7HA 4PD4H 4IRHA 1YI2P 2FF4A 1A35A 2E2HJ 3KQGA 1JGGA 2YSRA 3ZMZA 2E1NA 1IZNB 1P84I 1RE4C 2JPCA 5K5OA 2P5KA 3M3YJ 1Q2NA 1VFCA 1SVMA 1FZFA 4AIKA 3G71I 3K96A 3DV8A 2YO3A 4XRMA 4HNTA 4CUGA 4U88A 2CW7A 4LC1A 3W6KB 1VQ5I 1GZLA 1XG1A 1BE3D 3LSPA 4OAYA 4GFBA 3BTJA 5A2QZ 2W57A 3ZN0A 1PP9D 1P6RA 1POGA 2E5YA 3IV5A 4AVPA 2FSWA 1J7KA 1UB9A 3L2QA 1KFMA 2DK5A 1KZHA 1VF5C 3CJTB 3A0HH 1M90Q 1KV4A 3HOVJ 2CWEA 2IBZI 4GO1A 4O9BA 4PDKA 3GF7A 1SEUA 3OBBA 2MYSA 5BPIA 4B3IA 1CI6B 3K2ZA 4KIBA 1RESA 3ASOH 3PNTA 1K6YA 2NVYJ 3A0HE 2QKMB 4ENJA 1HJBA 4HF1A 1MBJA 2IBZD 2Z99A 3ZXSA 3F23A 5E3OA 2XIGA 4PJJA 1GTWA 2KFDA 3FK6A 2XC7A 2OYIB 2WA0A 3FKJA 4LG0A 4D0PA 2WITA 1LDDA 2O6GE 2Q3IA 4R79A 2GLOA 4NPEA 3M0AA 3O3KA 3K70C 3VYUB 1W5TA 4J19A 1I1SA 4B09A 1DLIA 1MUUA 1ZREA 4QTRA 3JSVC 1UHSA 2HQRA 2Y30A 4DW6A 3L09A 2DU9A 1L0OC 3LMMA 4CICA 3CCQI 5D6EA 2WSCH 2WSCJ 3ISPA 2NNYA 1FTTA 1ZRTD 2QF7A 2BEOA 2Z33A 4N78D 4G7ZF 3KZZA 2QZ8A 5KNLA 3I59B 3WU1B 5EDNA 4L18B 1BOAA 3F8MA 1LSOA 1X0VA 2KNCA 1O3TA 4BRYB 4QSHA 4UV8A 1M67A 2ZYAA 4IL6C 3WHBA 1W36D 1T0FA 1JTHB 2GUSA 3KPEA 5L3BA 1EVYA 3AE7C 2R7DA 3K10A 1SQBK 4D6TJ 4XONA 4H0LB 5EJCA 1D0YA 5K1YA 1USEA 2K9JA 2P7VB 3AE8C 2BE5F 1T8ZA 2HODA 3CMAP 4DBQA 3JCUC 1ZOYC 4HNUA 3GFMA 4HKZH 1IO4A 5A9SA 1FY7A 3DXJF 5F0CA 1NU1J 4BXFA 4D6TE 5HDGA 5HWSA 4L74A 1U5TB 2ZBKA 3F72A 5E1WA 1D1AA 3A02A 2ZXIA 3DKXA 2F4IA 3F22A 1K05A 3HC7A 1MMDA 1CF7A 1NU1E 3BG7A 5F0FA 2PMZA 2NRAC 4IQJA 1M75A 5K5QA 4F92B 2EK5A 1MSEC 1LP1B 1SQVK 4B47A 4CCOA 3OA7A 1O4XA 2V4JC 1YJNI 1FIPA 2VT2A 1MFTA 1OZHA 2OU2A 3OYDA 3BCCJ 4ASNA 4WY4C 4EEFG 5CJ0A 2MKVA 3CCSI 1FZGA 3DBHB 5H6RA 3RPUD 3Q3SA 2GOXB 3DLLF 1REPC 5FRMA 2BYVE 1Z82A 5IT9Z 2OYOA 1U2WA 2KZVA 3Q9SA 3SYTA 1VQLI 2HODB 3BCCE 3SHFA 4C7RA 2R7TA 2BCCG 3DP7A 4BS9A 1CGPA 1WI9A 2NYXA 3J7AO 4CHUA 1X22A 1X1PA 2FKWB 2YKOA 3C2HA 2QA4I 1W0TA 2A6HF 2EA2A 2JMWA 3KLOA 5DD4A 4ZDPA 4UB8H 2A06D 2OPTA 1DQUA 5HS8A 1O57A 4XRSG 2CS3A 2DA1A 3BJOA 3HM5A 2Q0OA 2OD5A 4H0EA 3CJRB 2D45A 3AE1C 2KSJA 2CW0F 2K37A 3WU0A 2FNAA 4GKGA 4UB8E 2I8DA 2VBZA 3FXJA 5IOYA 2PBIA 4RB2C 3TL4X 5L3GA 3W67A 2JR8A 2V6CA 5EEGA 4C3HJ 1VQMP 4HA8A 4R8HA 2WPVB 5J4YA 2NRGA 3OIPA 3KP3A 3HE4B 2QVOA 1YIJI 4A93J 5GADJ 2IA0A 3OSFA 2FJ1A 2FFDA 2BVMA 1ZKGA 1KILC 3C7CB 3FDYA 3KP2A 5D6FA 1S9KD 3VTPC 1VQ9P 2CUEA 4KMFA 1FPQA 1WJFA 4BHBA 1W2EA 1KMIZ 3S16J 2DT6A 1M7LA 4B8XA 1FOSE 1OVUA 2PP6A 4HYTB 3H1IE 3NWSA 3S1MJ 2LREA 4HAMA 4A12A 1EXJA 3L6DA 3CX5I 4BQQA 2R5ZA 3L74G 2FYNB 1JOCA 1E2XA 3OYNA 4M74A 1L0LG 4O3MA 1YVEI 1SQPJ 5TISH 2HFHA 1WQ2A 5CLSA 1YJ9I 4EIJA 1FC3A 3AEAC 2K3FA 3CX5D 4U3FJ 5D5VB 3V4QA 3NXSA 4I7ZB 1B72B 1FMVA 4IOIH 1SQPE 1IL0A 2HGCA 3H9JA 3I9V2 1BGYJ 1H8AC 3TDZC 1SFXA 2EPFA 4DBRA 1BCCE 3MCZA 5KLIB 1LWUC 3F8NA 4W7ZA 4EATA 1H0TB 1RNLA 4X6AJ 1QMGA 2W85A 1LTTC 2O03A 1YJWP 2M5AA 1XSXA 4ESBA 2I1KA 3CWBG 4FISA 3CCMI 1EDJA 5E8GA 1MJBA 4A7PA 3ZQFA 4ITVA 3CC4I 1BR2A 1ZAOA 1VF5D 2B87B 5M5YJ 2XV5A 2VKDA 2WZ7A 1JKRC 1XGMA 2DA2A 1WMKA 1WRGA 4N3YB 4DLLA 5KLVG 2ISYA 1BW5A 4YFXF 5CCHC 1IG7A 1I36A 1EV7A 2FRHA 3PQJA 4LOCA 4CCLA 4CYDA 2VOPA 1NHLA 2P6SA 5CVUA 1VPDA 1X2NA 5D4SA 2IRFG 2BEQD 3VYRB 3AEBC 2M87A 5E20A 2MSYA 5IP7J 5E3NA 5FKMA 3MFKA 4CYCB 3GZNB 2LBFB 2GIZA 3PEFA 5H2FC 3K70D 4R4MA 2VE8A 3HGGA 3BPXA 2P4QA 2VXDA 1YYCA 3BRTB 3R2PA 3HDHA 4HSTA 3GLMA 4PSWA 2F48A 3HTUA 3J81Z 1S5LH 1RY3A 5BOXA 2GQQA 2KI7B 1Z91A 5CBOA 3G71P 3I83A 1E5WA 3OL4A 3H3ZA 2L7ZA 1VQ5P 1FZBA 3IWFA 3GEZA 1Z3YA 3F6VA 4RGUA 4ZYHA 1MBFA 3PJGA 4BHCA 2F4OB 2HNHA 2GWRA 3CLOA 1NGMB 2MGQA 3COAC 1QGKB 1ACIA 4W80A 3MP7B 3RL0B 3TGUG 4BUPA 2DW4A 3P8CD 1BBYA 5A2QK 1OMIA 5EEAA 3D5SC 2FYUD 2KYVA 1HDDC 4G7HF 4P55A 1WP4A 3CJNA 4YCAA 1CSBA 3RZOJ 1R5SA 3I71A 3RK3B 1WRJA 3ZR8X 3CDHA 3WTTC 2V1UA 4Y17A 5CVJA 5HLGA 4E7ZA 5C4JJ 3OWTA 2Z5HA 2XNDH 2ELKA 1IFIA 2EWNA 2HS5A 3KPHA 5IP9J 2FOKA 2K4JA 1RE4A 2BBYA 3MQ0A 3R0JA 2LH9A 2FEZA 4GRIA 4N6JA 4RB3C 1S29A 2AQEA 1SMTA 5HNFA 4OGQD 2WAFA 2QVAA 4XLCA 1UHMA 2BGCA 3HOSA 3CC7I 2XAJA 2W6AA 3L70G 2XB0X 1ZARA 4M6VA 2F5FA 3Q5RA 3CCQP 4FE7A 4UY8I 2E1MB 1BI0A 3GO5A 1DLJA 3A7OA 1R36A 2ZT9D 4CZCA 5AW7B 3T97B 3BTCA 1M2WA 3LQQA 4A3LJ 2HKOA 3TDKA 2GF2A 3JRFA 1V4RA 2QSGX 4DOJA 3AAFA 3ZMDA 3HUSC 1I27A 1HSTA 2Z2SB 3LW5J 3P8MC 3LW5H 1X58A 3P9IA 2WSEH 4A3EJ 2UXNA 4E7KA 2KS1A 4FHTA 2ETHA 3C1LA 3VN0A 3I56I 4I0AA 3V8KA 1AQTA 4HX8A 1K4SA 4XE5B 2IS2A 2OQRA 4RA2A 3ZN1A 2JN6A 2VE9A 3RBXA 1A6IA 3FHNA 3L36A 3DPLC 3A01B 2PGDA 4YFNF 2X0LA 1O3QA 3EFFK 5ERIA 3H2ZA 3JTGA 1KU9A 1HKSA 3PM1A 1FP1D 4YG2F 4PK4A 1LDJA 1EZVG 2L02A 2Q2EB 1EA3A 1KONA 1Z7LA 1SFOJ 4IRGA 2P8TA 1W7PB 1GW3A 3UIAA 4P1WA 3D0SA 1K04A 1B9NA 2XAGA 2ISZA 1JCCA 4D5CA 5EG0A 3C2BA 2DAOA 1BR4A 4G7OF 3N4MA 1X1AA 4IQ4A 3ZP5A 3HE5A 3U1AA 1L0NE 1B1BA 2L7MP 1YJNP 4M3EA 3G1OA 3GBGA 1PPJG 1IDYA 2F4MB 5EZHA 1R00A 3TO6A 2BVLA 1H0MA 3CCSP 2JEEA 1SAUA 3KE2A 4O5VA 2JDIH 3T5XA 1GHCA 1XTAA 4NNJA 3TNUB 4BKXA 1VQLP 1BSNA 3WODF 3H1JE 4WWIA 1U57A 4YXWH 3RK2B 1XTGB 5JI6A 1JY2P 4PSXA 3L75E 5IT9K 3HBLA 3H1HJ 2PLYA 1QX8A 2QA4P 2LR8A 1DEBA 5DCMA 4N4NB 3CUQC 5HLIA 4JYKA 3TGNA 4XRFA 1GV5A 4AYBA 2NPSB 4I02A 5ICEA 2YXRB 3M1EA 3LSTA 4EJTA 4MEYF 3H1HE 2WTEA 4LITA 1FOYA 4RB0A 3OS0A 1DPUA 2ZAEB 2XROA 2N9YB 2HDHA 4LMYA 1ETOA 5D5UB 3GX4X 2XU6A 3PIOF 1ZN5A 2R5YA 2OTKE 4JYBA 4IHWA 1TXGA 1BE3G 2XNXA 1XN7A 1TZLA 2WV1A 2EW2A 4WY4A 1YIJP 1Z9CA 2DPDA 3OYMA 2ZYGA 5IY5H 4OOIA 4UNOA 2L5QA 1N78A 4LGDE 1YTZI 2OBPA 3JREA 1M76A 1MIJA 3IUOA 1WJBA 1EF4A 3ADOA 4JP0A 1XMAA 2O3FA 3P5JA 4WXHA 1E17A 2Z5IA 3IR9A 2ZVNB 3A0BE 2YKPA 3H32A 1FX7A 3FM5A 2KQRA 3LQRA 2IBZG 4A0ZA 5CCHD 3IKTA 1F17A 3AG4H 3WTZA 1IF1A 5E79H 2O61A 1VQNI 3LAJA 1PL5A 3J7YJ 4JX6A 2PEXA 1DEEG 2PAJA 5AW3B 1NTCA 4BQNA 1T3JA 3EFGA 1IV8A 3TKYA 1YJ9P 1R49A 3GFJA 1GK6A 2IX7C 1WPKA 2KP8A 4WVZA 5E79E 5APWA 4GIFA 5L8RJ 4EV0A 4EM1A 2Y75A 4Z6YA 5B66E 1SAXA 1ERDA 2KIKA 4I7HA 1W0UA 2J58A 2OYIC 1OCZH 3B5NB 1OW6A 2QKLB 5EGOB 1M8OB 5APYA 3DU5A 1Z3XA 3ABVC 4M9XA 3W2WA 2XKMA 1IZ1A 1JUSA 1KILA 3R4YA 3KX2A 2CW8A 2DLLA 3K4CA 3CCJI 1FTZA 1SQXD 4C7NB 3HKZN 3CCMP 3TMOA 2XZRA 1K9MQ 3I64A 2D2CB 2QJYB 3PDUA 2KPMA 1W4MA 1R1TA 2P6TA 2AEJA 3ZOBA 1LUJB 3CXHD 3CC4P 1FWZA 5BNGA 1R4MB 2LFBA 4M3LA 4B43A 5LBQA 3S14J 2BCCD 5CQGA 2EILH 3EDPA 2H7HA 3DFGA 2BY1A 1S8NA 5GAEJ 1Y1VJ 3EQ2A 4PJLA 2DTRA 1N1GA 3K6GA 3RJPA 2CGPA 3H6PA 1UG2A 3DKWA 4H0LC 2E74D 4IL6H 2HXOA 3MVPA 3KXDA 3KZIH 4KT5C 1JGSA 1LTBC 5E3LA 2XPWA 1S7AA 4EJUA 3OSGA 1FJKA 1ZP0C 2Q5UA 2V4HA 3L73E 2GAUA 2WPQA 3LA3A 3S3OA 3ELKA 4JPZB 2AHQA 1H8AA 1U5TC 3M8EA 1YRLA 2RNJA 2K27A 2ZYDA 1LWUA 3JCUH 3KZIE 3EYYA 1GW4A 2NVUB 1NTZJ 2P7JA 3BJ6A 1A6QA 2X4HA 2O5RA 3A1YA 1N7SB 3SZTA 2VRSA 1ZTRA 1USTA 1NTMK 3K4MA 3CC2I 1P7IA 4WF2A 4WK8F 1LVKA 3AL0B 3J81K 2DFFA 3CD6I 1JY2N 1FOSF 3KETA 4BDZA 1NTZE 1ZV8A 2C0XA 2L91A 2EJRA 3A2AA 3M0DC 3CMEI 4ZNCA 4NBQA 3UR3C 2QGUA 2ID6A 3MD2A 1MKMA 1Y8AA 5AW9B 1I50J 2VJIA 2LF7A 2A06G 5CCHA 2ZMEB 1AKHB 3HRUA 2BW3B 5APXA 1YG2A 1R1VA 3L74D 2COMA 2IZ0A 1YYVA 3DU6A 4E12A 2Q8KA 3DLAA 4LB6B 3I3LA 4D7NA 2P2UA 1GXQA 3OYHA 4A2UA 3O8ZA 5APSA 2K4BA 3B8EB 4DYQA 2FU4A 2QCOA 3CJQB 4TT3H 3SSUA 1FZCB 1PVEA 1X1BA 4CH7A 1WDMA 4OAZA 2EFWA 1SQBD 3CC7P 1RUOA 1JNMA 1WH5A 4KIGA 1MDMA 2HU9A 4UB6C 1TBXA 1VF9A 3D5RC 1GT0C 3L1PA 4EGYA 1LE8A 1YITI 3H5AA 1QU3A 4N9IA 1GL2B 3RDIA 3L35A 5GTHC 4MLOA 2PRRA 1DGRM 3TBIA 1X2MA 1NO4A 2MJZA 1HKTA 2EZLA 3DOJA 3E97A 4H4KC 4RAGA 2XDVA 2LR2A 5CCGC 4YFKF 2YKQA 2BASA 3BWGA 2LF8A 3K7AJ 2XHKA 4N4OB 5JFRA 1AV1A 4YTPC 3TQNA 1SQVD 3I56P 3G9RA 2FXAA 1FMWA 2OCEA 3KFWX 1UZCA 4HRIA 4UUVA 3GUDA 2OQGA 5FD5A 1L2PA 3PUBA 4U0VA 3FMRA 1Q90D 2FYNC 4EOTA 1LTIC 4PFOA 1LT9B 3HWRA 2KUBA 1Y8QB 2KRHA 4V2GA 2HI3A 3KEYA 3B6AA 3T1BA 4RMNA 1LDKB 3C1DA 1LFUP 2Y48A 2CQXA 4I7ZC 1KYOI 4UHTA 2Q9IA 2IAIA 4HX7A 3U1DA 3AE5C 4BYYA 4OMYA 1RKTA 2HPMA 2BEZF 1STZA 2NOGA 1YLFA 5KLIC 1KYOD 1A02J 5HS7A 4JYCA 3BR1A 1KU7A 1MSFC 2ELHA 3L71D 4MHGA 1KB9I 4ZYGA 3HUSA 3TGUD 5IYDJ 1KYWA 4I01A 3ZW8A 5EEHA 5ICCA 3QWOC 1HQCA 1P7JA 1R4NB 2LY2A 3DTIA 4IHXA 2A5WA 3KYCB 4H13D 2KDOA 3R6SA 2Z9OA 1MJ9A 4ON0A 1NYHA 3A2KA 4XQFA 4YRVA 4AM3A 2IYPA 1XTCC 4FQGA 5J47A 1IK9A 4NUBA 2E1CA 3E6DA 5E1XA 3PO2J 1UIXA 3GLLA 1U6GA 2WADA 1JDJA 2OZUA 3MN2A 2DW3A 4IX7A 2E76C 3BR0A 4NB5A 3SDBA 2MD5A 3MKYB 1SFEA 1A31A 2LXCB 2QQBA 4W7YA 4F55A 2ZXJA 2XB5A 1IFNA 3F6OA 4NQWA 4GYGA 2IA1A 5DUKA 5JLWA 1YX3A 1JM0A 3FX3A 4M71A 5E18F 1IK7A 2VKEA 3N4XA 4Y99B 2M8RA 3MOGA 1FYLA 2DMPA 3IH2A 4Q5SF 2EIJH 3KIOA 1R71A 4Y15A 3W2AA 2E5ZA 1RE3C 4XKVA 5H2FH 2L9NA 1WHUA 2V9VA 4HYEA 4AYBN 3DKYA 2P67A 3FMSA 2CH0A 3AFHA 5GAHJ 3IH3A 2I76A 2V9KA 3Q3CA 1SQQK 2FYUG 2NS0A 4G6DA 1TTYA 3D71A 3CESA 1IC8A 3EYIA 2TDXA 5HVQC 1QNTA 1YBKA 3RL0C 1HVVA 2JSCA 3LSMA 2JJ7A 3A4CA 5K7FA 2OUMA 1Y6IA 2F6CA 3BG3A 3CUQA 1H9GA 4E70A 1LNQA 3H1KE 2M3AA 3VP8A 1VQNP 3GCMA 1PP9G 3ROUA 1XPXA 3EGOA 1EZVI 2D1HA 4IVNA 2KOGA 2P4WA 5TRDA 3AG2H 4C3JJ 3CXHH 3RK3C 3GZ5A 4L9VA 3JSPA 1USSA 2BCCJ 4NC6A 1S3JA 1EZVD 3HOTA 2KLVA 3S4RA 2BXYA 2NOJB 2KISA 4IPAA 2GXGA 2DFHA 1XDUA 3CXHE 4L9TA 2E2IJ 1MBEA 1RQUA 2JTVA 2BCCE 1FYMA 3QSGA 3FMQA 1PDNC 3I4MJ 1PPJD 3VMXA 2V1NA 1NTKK 3NMDA 4IM7A 2L7FP 2LNBA 3CCJP 1JY3O 1LEBA 2M3BA 2E1MC 3AG3H 1IXCA 3GWZA 3AG1H 5APTA 4OVNF 2DODA 3OYEA 1BC7C 2W90A 4RLFA 2ZJQF 3P7KA 2LSOA 4N0BA 1MMAA 3D1NI 3CCRI 2X51A 3V42A 1CI6A 3ZWCA 2EH3A 2XKPA 3E1RA 4L0YB 4PJMA 3BZKA 1OLTA 1N1EA 3DBLB 2XDJA 4EJOA 1ZGJA 2VN2A 1ZG1A 3F3SA 2A61A 1DU6A 1NVOA 1ONVA 4WCGA 3HYIA 2H89C 3TP3A 2OYIA 3VYIA 1ZH5A 1XGSA 4PD4E 3EUHC 3SWYA 3E0JB 2NZ2A 3LIEA 2RQPA 2OTJI 3EWKA 4HLXA 2EB7A 3L74J 1ZCJA 1P84D 4RJTA 1LT1A 1VQ4I 3E6MA 3VSKA 2EINH 4B4CA 1L0LJ 3I5UA 4KICA 5FLVA 1LEAA 3CCVI 2FYZA 3RCOA 1IFDA 4BE1A 2H8WA 3CC2P 4YPCA 1YTZT 4D1QA 1URQB 2LG4A 1QHGA 2VI6A 2ZNYA 4LFUA 5EYRA 1L0LE 3I59A 2R7SA 3PJSK 4BWNA 1QZZA 1UJ8A 2GA2A 4BRYA 3CMEP 3F8FA 3IAM2 5AONA 5CCGD 1UIIA 4KT6A 1PV3A 1EH7A 4CO8A 1JTHA 1V5EA 4PJ0C 5E3MA 4DT0A 3CWBJ 3RYPA 3HJEA 4B3JA 2KXPB 2C9LY 2KIUA 4D3FA 1RQVA 1BI2A 3RK2C 4NHJA 5CVVA 1NKZB 4YELA 2AQFA 1CZQA 3JRCA 2V26A 3CWBE 1CW5A 2NPSC 3I4PA 5KLVJ 1U5TA 1ETVA 5GPCA 5TGTA 1V5FA 2OQQA 5FKLA 5FKKA 2L3DA 2DJIA 4R4LA 5AW0B 4UUSB 1YRNB 2C6YA 3FXKA 4KUMA 5M5XJ 4UUTA 1RF1B 3S32A 5H6QA 4XLPF 5KLVE 2W8ZA 2RQQA 4IRIA 2W4SA 1KQ0A 2DTZA 2WB1A 3BCBA 4F7ZA 2HEOA 1LP1A 2GIVA 5APVA 3CDLA 5LEJA 1D8KA 2FE3A 2VXZA 1YITP 1H9TA 1JO5A 2IS4A 2K1AA 2CSOA 2XAHA 3HB9A 3M0DA 3SQNA 3I55I 1TQMA 4JX4A 3E1IA 3ZWAA 4ZDOA 3JC22 2KSEA 3N7NA 3LFUA 2X6YA 3WE3A 4B44A 2GXAA 4BU2A 1EVZA 3FIWA 3LA2A 3WUVA 3ERMA 3M8FA 3OYAA 2CFOA 2A45I 4W97A 3CL3D 1MW7A 2CUFA 2XSDC 2AXTC 3VMZA 1KYOH 3K4BA 4UVBA 2E76D 2P58A 2WPSA 1MV8A 3AE9C 3OW2O 2CFXA 1BJZA 3TGUJ 1LJ8A 3U59A 3Q2YA 5GTIC 3V8JA 3OOUA 5B5EC 4HDVA 2OFPA 1HC8A 3C7AA 1JHHA 2ELJA 2ZJSE 1QZYA 3GW2A 5IYCJ 3LL7A 3S2HJ 1W5CE 1OVVA 4LLLA 3TGUE 2HDWA 2PLAA 2W6JH 1VTNC 3M9AA 4AUWA 3FXQA 1IW7F 2N8GA 2HDCA 4IHVA 1SQXG 2O01J 3BG6A 2MH2A 4EVIA 2O01H 1BR1A 3B5NC 2A69F 3HE4A 3S2DJ 1OW8A 2N1TB 2EA4A 2XUBA 1TWHJ 1VDFA 3W6VA 4HF0A 2R92J 3S1QJ 5AVTB 1GVJA 2DA3A 3IAOA 5FLMJ 4RB1A 2HZTA 1FU1A 2XF5A 3GTMJ 1EQ7A 4U0YA 2XF7A 3A3YB 4BJTA 3OAKA 3M9BA 2Q7CA 2ZKZA 3RL0D 2D2CC 2QJYC 3OMYA 5DS9A 5CCGA 3PHLA 3K2AA 4EYYQ 3LOCA 3L70J 3FK7A 1ON2A 5DDGA 4XKWA 3G3ZA 4D9JA 4ZZLA 1PIXA 1IN7A 3QPLA 2KIMA 4CCNA 3PLNA 1IO2A 2Y0CA 3C7JA 1M57D 3L70E 9ANTA 3G1LA 1D7MA 1MJAA 1JY3P 3L72G 3GVAA 3MZWB 2XF6A 2KT0A 3V7CA 3F89A 2ZVOB 1ZGAA 2VIXA 4A3JJ 1ZK8A 2V7FA 2M4GA 1B72A 2ADUA 5AVXB 4HEA2 1NKNA 2WT7B 4MGRA 1XSVA 1ZQ3P 5MGBA 3HTKB 2ZXEB 2H94A 3BATA 1M1JB 2Y0DA 1E3HA 2DDBA 1QRYA 3CCUI 5KAFC 2LD5A 1RRJA 1IFPA 1NU1K 5CJ4A 2V6EA 1N86A 1DP7P 1GK4A 2YMKA 1G59A 4I6MC 4IFDK 1H0TA 2GXBA 5L3CA 2FNPA 3UKGA 1K83J 5LGTA 1GXPA 1N7SC 1WKMA 3VODA 3WGGA 4Y52J 3BT9A 3EPZA 3AL0C 1BW6A 4J01A 2GOMA 1F14A 2MABA 3ZMUA 2B87A 2MC4A 4FT8A 1O3RA 1HBWA 4IKFA 2H8RA 4LG3A 3AEDC 5DJTB 3V2QA 1FBSA 2WMMA 1ZHFA 1J1EB 3KDPB 5B1BH 3CUOA 5TJHA 4CA0A 1VL2A 2E75B 2W48A 4K35A 2KK7A 2ZMEC 2FBWC 1FOWA 2OYHB 2O0YA 1RF0A 5FO5A 2LK2A 1TC3C 5TISE 3W68A 3OYFA 2XAQA 4Q48A 1JXSA 4FASD 1OVRA 1PPJE 4NPFX 3RSNA 2IPQX 4CYCA 2LBFA 3H1LD 4U3FE 3FR8A 4TLFA 5ED4A 1YIOA 2A07F 2YO2A 1SQBG 4BE2A 5B3SH 5KAIH 1BJAA 1IC2A 2IGMA 2Y69H 3QYBA 5JHUA 3L2CA 2VPLA 1HOMA 2JJLA 3Q9VA 4ENNA 1BGYE 3V2NA 3G0OA 1RE3A 2EFQA 1ZW0A 1FZCC 1T98A 5FKNA 1M66A 1Q1HA 2RKHA 3OL3A 3HN2A 5KAIE 3L9FA 2E43A 2A6TA 2HVQA 1OQYA 1BI3A 1VZ0A 4WWCA 3VFZA 3ZQQA 2DMNA 1NK3P 4ZYEA 2CV1A 1GL2C 4S04A 3VMYA 1P84H 1MZ9A 2V1DA 4BDYA 3SXYA 1BE3J 2WTYA 1SQVG 4Z2YA 3HOUJ 4HDUA 2R44A 2WV0A 3CCRP 1IRFA 5F27A 1SD6A 2RV8A 4HNVA 3K1NA 2OA4A 3J7ZI 2HQAA 1P84E 5GTHH 1S4XA 1M1KQ 2E42A 5AW5B 1FEXA 1BE3E 2ESNA 1NTMD 5AVQB 3S3NA 1YE9A 1KS9A 3BPVA 4DJAA 1J59A 1T6AA 4Y4RA 5A9RA 5M1BA 5LRRA 3ULQB 2IGOA 3I58A 2K3RA 3RZDJ 1B8IA 5FB2A 1PGPA 2LXBA 2NVTJ 4FX4A 5KJ7C 2I10A 4E7IA 3ZW9A 5CJ9A 3FWNA 2OTJP 2M7BA 1W1WE 1A36A 2DMQA 1SP4A 1SQPK 1AJYA 1IN4A 2VQGA 1DUXC 1VQ4P 1S7EA 4LLHA 2M8EA 5FROA 1IXRC 2LKSA 2L0KA 2E19A 1S5LE 2IBZE 4OL9A 3CCVP 2K85A 2X6XA 3L71G 4NC7A 1D3YA 2O01N 3O2PE 2DQLA 4FGWA 3GTQJ 1B6AA 3BQZA 3T97A 2CPSA 5DD8A 1CQTA 3I53A 2LDUA 4DZOA 3S1NJ 4EQQA 4BBSJ 3FHZA 2LY9A 3LAPA 4RDUA 2JA7J 5FD6A 4RKUJ 2HDDA 4B48A 1ZR2A 3F0CA 4OWFA 3BC8A 3ZQGA 2O9LA 5LHIA 3JAMZ 1H89C 1B8IB 2L9RA 4HV5A 1TLHB 1KORA 2M0CA 4PJNA 1ZRTE 2AXCA 2JO1A 2JWAA 3K5BA 2B88A 4N78E 3AEGC 2DDAA 3FXUA 4XOPA 4IFFA 4J0FA 3OY9A 3JRIA 2M30A 2M7AA 3EUHA 1P2FA 2FX0A 4ESFA 1FIAA 3A01A 2QYOA 1U8RA 3W6ZA 3IFMA 3BY6A 2QEXI 2DQRA 3CLQA 3PLRA 3MHVA 3D6YA 3H5NA 4WY4D 2Q2EA 2YX4A 4K2EA 1BSHA 3NFQA 1NAFA 2VJ4A 1W7PA 3FXRA 1VQKI 3B5ND 1U9OA 3VP9A 2XGEA 1J1DB 4Y99C 3MAJA 3IWZA 5AW4B 1FJLA 3GLXA 4M3DA 5D4RA 4BBRJ 4KIFA 1V55H 3I55P 2D2CD 2WSEJ 1VQPI 5BU8B 1E3OC 1QL1A 2CV2A 4HJGH 1FZPB 3TNUA 1DU0A 2YR2A 3BG9A 2WSSH 3OS2A 3AEEC 1WH7A 3H0GJ 4L75A 1E3PA 1R5GA 2CUJA 5KVRA 3CI9A 3HOWJ 3RPQA 5JVGF 3ABTA 1FJPA 4G9YA 1ZXGA 3ML6A 3QP5A 4EM2A 1IN8A 1IXSB 3WTSC 1D5YA 5CMZA 2NPSA 4BEHB 1HSJA 1K78B 3LWFA 5EF6A 1ENHA 4HX4A 1DPRA 1DD4A 1L4AB 2VQLA 2SPZA 3TOBA 2D2WA 3MZYA 1KILD 1JUMA 5J1RA 3HOYJ 1AVYA 2I1JA 3HD7B 1R5HA 4KUEA 2CMPA 1VI0A 2L54A 3D5LA 4OU0A 2A06E 3H1IG 4II2A 1QPMA 1N7SD 4I1LA 3NQOA 1LGHB 2R32A 2ZXHA 3MKZA 2AS5F 4M72A 2VBWA 1Y0UA 4JBZA 2BY2A 2H1LA 3A0HC 4IOCF 1X8YA 2H6CA 4Y3OA 2QJPB 3GHGB 3TYYA 2PMUA 1WI3A 3NAUA 3V2PA 1BOBA 1H88A 2HYGD 2PMZN 3KYLA 2Q1KA 3ZWBA 4LLGF 2J59M 2CU7A 3CTAA 3EETA 3OIOA 3T8RA 5K5RA 4HPQA 3IRQA 2XV4S 3RI4A 4G6QA 4OM8A 4I2LC 3Q5FA 1NH4A 1L3LA 2K9MA 4I09A 2Z4EA 2EFPA 4X0GA 4UVAA 3RYRA 1BCCG 3ZQHA 2P0WA 3WU2H 2K88A 3RKYA 3JR9A 1B9MA 4ZJZA 3TF5A 3EQLF 1BA5A 5M3FJ 1S9KE 2H88C 2DA6A 2MH9A 2WSFJ 2WSFH 1SQQD 2K40A 1IV6A 2Z3YA 2R5BA 3WU2E 1QVUA 3H5RA 5GAGJ 1U3EM 3QYEA 3V4WA 3B4SA 5D5WB 3B5NA 3C8VA 2V7QH 3CX5H 3CCUP 5EGOA 1ZRFA 1SFCB 1P4WA 2EQRA 3S2WA 1RI7A 1HBXG 1L0NK 3BRVB 1WDLA 1YB4A 2UZKA 2R93J 1HXDA 4L9JA 3CX5E 5FGMA 2D5VA 3TSIA 1YQ3C 2HG5D 5FJ8J 4C7NA 2ZJRF 1GL2D 1URQC 4KT0J 2CQNA 2XGXA 3E5XA 2EV0A 4CZZA 1NWQA 3ABLH 3P9KA 3SEZA 1Z67A 2XVCA 5ICGA 5M5WJ 5IT3A 4IFMA 3BR3A 2L4MA 5J8CA 2H1KA 4IF4A 1NG6A 1LTSC 2D1VA 4YXDC 2JWTA 2RMZA 4L5IA 2YU9J 3CMMA 1NTKD 2Z5UA 2JRTA 4F91B 4MQ9F 3QU3A 4BJ5C 2K9NA 4WXCA 4KN7X 3A5TA 1R1UA 4M73A 2M0BA 2LOOA 4EJWA 3O8HA 2OF7A 4AWXB 1RETA 3C7DB 2VKHA 2DCEA 2RN7A 4C9YA 2COBA 3ZQCA 1LTGC 1OCPA 3TW6A 3RKQA 1M56D 4LIVA 1T33A 4ZC3A 4BHPA 1ORKA 3ERED 1OPCA 3G6EI 1N7SA 4OGQB 3ZRGA 1N2DC 1Q81Q 1RF1C 1JUNA 4P9FA 2YS9A 1ZN2A
chains in the Genus database with same CATH topology
5F0CA 3ULKA 3MOGA 1YJQA 5HWSA 4QIWN 2DMPA 3IH2A 3CKYA 3A02A 4JX5A 4AYBN 3ZGYA 5F0FA 2LTPA 1M75A 3IH3A 3Q3CA 4FCYA 1AKHA 3JRGA 1MSEC 2Y2ZA 5IYBJ 1O4XA 1FIPA 2HQ5A 1APLC 1IC8A 4EEFG 2RAEA 4KUGA 1QPIA 2JJ7A 1JUPA 5K7FA 3BG3A 3Q3SA 1I3QJ 3JRHA 2R0QC 3GTGJ 1Z82A 4X1EA 3EGOA 4C3JJ 4A3CJ 1JKOC 3DFUA 1W0TA 1JTYA 1MBHA 2JMWA 4PZEA 1XC5A 5EZGA 2OPTA 3M4OJ 1Z77A 3VPRA 4XRSG 2DA1A 2WB1N 3W6UA 3HADA 2E2IJ 1MBEA 3HM5A 4FTHA 4A3DJ 4GWGA 3DEWA 2K9QA 2XPVA 3QSGA 1AHDP 3BR6A 3BR5A 4D7MA 5IOYA 3I4MJ 4IM7A 2L7FP 1ETKA 4C3HJ 3B6CA 3LSJA 1GVDA 4A93J 2LP0A 3OSFA 4OVNF 2FJ1A 2W90A 2LVSA 2NVQJ 1ZKGA 3Q0WA 3BTLA 3D1NI 3C7CB 3ZWCA 2Y9ZA 2EH3A 2K9SA 2CUEA 4PZCA 2ZB9A 2MW8A 3S16J 1N1EA 3F3SA 2LLKA 1DU6A 2VPRA 3S1MJ 3TP3A 3L6DA 1VNDA 4MIMA 3LSGA 2R5ZA 5C4XJ 2XRLA 1YVEI 2NVXJ 1ZCJA 2ECCA 1IRZA 4B4CA 4ABZA 4A3FJ 1PUFB 5FLVA 4DYRA 1B72B 1F43A 1IL0A 1XS9A 3GHYA 4D3DA 1H8AC 2DA4A 2VI6A 2QYTA 5EYRA 4X6AJ 1QMGA 4FISA 5E3MA 5EG0B 5AYVA 3ZQFA 4B3JA 1BG6A 4D3FA 4AC0A 4NDLA 5M5YJ 1JKRC 2DA2A 4DLLA 5IPAA 1JKQC 3JRCA 1BW5A 2DA7A 4BXXJ 1IG7A 1I36A 2EBIA 1ETVA 4LOCA 5GPCA 3O8GA 1VPDA 5FKLA 5FKKA 1X2NA 2E2JJ 1WGXA 3S15J 4UUSB 2JA5J 1U8BA 5IP7J 1YRNB 2MSYA 5E3NA 3PEFA 5FKMA 5M5XJ 4UUTA 4CYCB 3GTLJ 5K7ZA 2W8ZA 3ADPA 3HGGA 3RQIA 2DTZA 2P4QA 2B63J 1BL0A 3HDHA 3CDLA 3QQAA 4MFDA 3HB9A 3HGYA 4JX4A 3ZWAA 1ETQA 1EVZA 4C3IJ 3PIDA 3FIWA 1JT6A 3I83A 1MBKA 2X6OA 4D5FA 5A9SA 2L7ZA 3WFJA 1F36A 5M3MJ 2R5YB 4W97A 3PJGA 1MBFA 2ID3A 2MGQA 2CUFA 2ME0A 1TWCJ 4MO7A 2XSDC 4D3SA 1RKWA 4XK4A 3JRBA 3E7LA 2YUSA 3H3VK 1BJZA 5EEAA 1LJ8A 1HDDC 5JE8A 3OOUA 2OFPA 1WP4A 4YCAA 3C7AA 3RZOJ 5IYCJ 1JJ6C 3S2HJ 3G17A 1PGJA 3HOZJ 4Y7NJ 2Y0SN 2PLAA 5C4JJ 2MG4A 2N8GA 1Q1VA 4IHVA 2ELKA 5IP9J 3S2DJ 4AUXA 1TWHJ 3W6VA 2R92J 3S1QJ 1X0XA 2DA3A 5FLMJ 1MNMC 3GTMJ 5C3EJ 1WDKA 1GUUA 2XB0X 4M6VA 5DS9A 4FE7A 2DMUA 3K2AA 3LOCA 1DLJA 4MFEA 3FK7A 4XICA 1ETYA 4W1UA 2I9PA 3BTCA 2HYJA 1M2WA 1WPQA 4A3LJ 2GF2A 3JRFA 3QPLA 2AO9A 1TWAJ 1G2HA 9ANTA 2X58A 1MH3A 3FISA 1X58A 3G1LA 1HCRA 3MKLA 4A3EJ 1Y1WJ 2KT0A 4B3HA 2XGDA 4GWKA 4A3JJ 1PUFA 2CQQA 1ZK8A 1B72A 1HDPA 5MGBA 1ZQ3P 3ZHBA 2VUMJ 2JN6A 2WTBA 1A6IA 1QRYA 2LD5A 3A01B 2PGDA 5C44J 4C2MJ 5K7HA 3H2ZA 4DZJA 3PM1A 4M3BA 2M9HA 4EZBA 1SFOJ 1IGNA 2CVZA 3UKGA 1K83J 3I4NJ 1U78A 4DYDA 2JA6J 4D5CA 5EG0A 4Y52J 3C2BA 3BT9A 1BW6A 3IQDB 1F14A 5F0HA 1K61A 2KDZA 2L7MP 1JTXA 4M3EA 2H8RA 3G1OA 3GBGA 3WFIA 1IDYA 2CJJA 5EZHA 4GBJA 5F08A 2W48A 2JK3A 3GTOJ 4BKXA 1ZR4A 2LK2A 2DN0A 1TC3C 2NS7A 4UUSA 3TW7A 4DZPA 3RQSA 1YRNA 5J1UA 5IOZA 3HBLA 2ECBA 4CYCA 1LSJA 1PGOA 3FR8A 2LR8A 1ITYA 4JYKA 1GV5A 1HOMA 5FWNA 1RR7A 2FD5A 3A03A 5J3LA 3G0OA 1GDTA 5FKNA 1QVTA 4XIDA 1M66A 3HN2A 2HDHA 1ETOA 2DJNA 1ETXA 1YJ8A 2R5YA 1NK3P 3JRDA 3WS7A 2DMNA 4S0HB 4IHWA 1TXGA 2Y9YA 5IP6A 2EZKA 2WV1A 4XRSA 2EW2A 2ZYGA 2DA5A 4J0EA 4A3GJ 3ZQLA 3HOUJ 3JREA 5HODA 1M76A 5FKOA 3FKIJ 1EF4A 3ADOA 2HXIA 4JP0A 5F27A 4HNVA 1JJ8C 1PGNA 1LE8B 1FEXA 1AU7A 4KUHA 2XGCA 2IEKA 1KS9A 2JKVA 1F17A 4B1RA 5A9RA 1SANA 4FE4A 3RZDJ 1B8IA 1PGPA 2NVTJ 4B3AA 3QHAA 4JX6A 2I10A 3ZW9A 2M2EA 3FWNA 4OQZA 1NTCA 2DMQA 1S7EA 1WPKA 3TP0A 1MH4A 1H88C 3SDGA 2L0KA 2E19A 4OL9A 5GPAA 4I6ZA 1IDZA 4IEJA 5F1JA 1W0UA 1PGQA 1MBGA 4FGWA 3GTQJ 3QPSA 5J1YA 3LNQA 3TEDA 5EGOB 3BQZA 1CQTA 4E21A 1OFCX 4A3IJ 1NK2P 3S1NJ 1JUSA 1TWFJ 1LFBA 4BBSJ 1FTZA 2E1OA 2LY9A 2DMTA 3HKZN 1Z0XA 4G12A 4RDUA 2JA7J 2HDDA 3PDUA 3BQYA 1ZR2A 3F0CA 4DCKA 3ZQGA 3Q0UA 3ZOBA 2O9LA 1H89C 1B8IB 2L9RA 3SJMA 5BNGA 2M0CA 2LFBA 2UYYA 1TWGJ 3S14J 1UMQA 2GM4A 2IBDA 4J0FA 5F04A 3JRIA 1Y1VJ 2O7OA 2FX0A 3A01A 3S17J 1FIAA 3W6ZA 1N1GA 4I76A 3PLRA 2NS8A 1UG2A 3IH4A 4E13A 3BTIA 2LKXA 2HXOA 3MVPA 1I6HJ 3G1MA 3WHCA 3HEFA 1U9OA 5E3LA 1RPWA 2XPWA 3OSGA 2XGEA 2M34A 4JPZB 1GV2A 2AHQA 2EZIA 1FJLA 2R7ZJ 2M8GX 5DTDA 2X9DA 4M3DA 1YRLA 2ZYDA 4BY7J 4BBRJ 1JKPC 4IHYA 2HOSA 4A3KJ 1OJLA 1F0YA 3LSRA 3CTVA 1E3OC 1ZTRA 1DU0A 3BG9A 1P7IA 3BG5A 5A9SB 2D3TA 1WH7A 3ZQIA 3H0GJ 3HOWJ 3S1RJ 2ID6A 2P81A 1D5YA 1I50J 2IZ1A 4V2FA 2HOTA 3HDDA 4BY1J 4L5EA 1AKHB 5EF6A 1ENHA 2Y31A 2TRTA 5GP9A 3GTJJ 4A3MJ 3GTKJ 2IYOA 2IZ0A 4E12A 2X48A 1JUMA 5J1RA 3HOYJ 4KUEA 2GBYA 4D7NA 1VI0A 2XPUA 4M3GA 4DYQA 4M3FA 1YONA 2QCOA 1OCTC 2TCTA 3CCYA 2CRGA 2ME6A 1T56A 1WDMA 1WI3A 2WAQN 3NAUA 3CMYA 1WH5A 1JT0A 2PMZN 1VF9A 1A5JA 1GT0C 1LE8A 3L1PA 2CU7A 3OIOA 1JGGA 2E2HJ 3ZWBA 3M3YJ 4OM8A 4MLOA 3NARA 1VFCA 3PO3J 1IJWC 1X2MA 1F12A 3K96A 3ZQHA 4XRMA 3GTPJ 2EZLA 5JLXA 3DOJA 3JR9A 1BA5A 1WCMJ 1XG1A 5M3FJ 3LSPA 4GFBA 4R1NA 3BTJA 2DA6A 3SFIA 1POGA 2K40A 3K7AJ 1IV6A 3IV5A 2FQ4A 1QVUA 3HOXJ 3HOVJ 2G0EA 3OBBA 4B3IA 4A69C 1IUFA 1RESA 5EGOA 3HWRA 4V2GA 2NVYJ 3FR7A 2HI3A 2EQRA 3B6AA 1MBJA 1HLVA 1WDLA 5E3OA 1YB4A 1LFUP 2EZHA 2CQXA 2R93J 2D5VA 5FJ8J 3FK6A 4RBOA 2IAIA 1HF0A 2R5ZB 4DYCA 1U9NA 2GLOA 1RKTA 2NOGA 4J19A 1DLIA 4QTRA 1UHSA 3BR1A 3DCFA 5M5WJ 1MSFC 3BR3A 2Y30A 4JQ0D 4DW6A 2H1KA 5IYDJ 5A9TA 4OQYA 2VKVA 3ZW8A 4PZDA 1P7JA 2JWTA 4IHXA 1FTTA 2QF7A 2YU9J 4A3BJ 3CQZJ 5EDNA 1R9TJ 3Q0VA 1LSOA 1X0VA 2IYPA 2K9NA 4S3MA 1ZGWA 2HOAA 4QSHA 1M67A 2ZYAA 3WHBA 3O8HA 3PO2J 2OF7A 1JDJA 1RETA 3C7DB 3MN2A 3K6JA 1EVYA 3BR2A 3BR0A 2COBA 3ZQCA 1OCPA 3TW6A 3RKQA 1T33A 2JA8J 1ORKA 2XB5A 3JRAA 2O8KA 5JLWA 1ETWA 2YS9A 2VKEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F0C A;  4QIW N;  2DMP A;  3IH2 A;  3A02 A;  4JX5 A;  4AYB N;  5F0F A;  2LTP A;  3IH3 A;  4FCY A;  1AKH A;  3JRG A;  1MSE C;  2Y2Z A;  5IYB J;  1O4X A;  1FIP A;  2HQ5 A;  1APL C;  1IC8 A;  4EEF G;  2RAE A;  1QPI A;  2JJ7 A;  1JUP A;  5K7F A;  3BG3 A;  3Q3S A;  1I3Q J;  3JRH A;  2R0Q C;  3GTG J;  4X1E A;  4C3J J;  4A3C J;  1JKO C;  1W0T A;  1JTY A;  1MBH A;  2JMW A;  1XC5 A;  5EZG A;  2OPT A;  3M4O J;  1Z77 A;  3VPR A;  4XRS G;  2DA1 A;  2WB1 N;  2E2I J;  1MBE A;  3HM5 A;  4FTH A;  4A3D J;  3DEW A;  2K9Q A;  2XPV A;  1AHD P;  3BR6 A;  3BR5 A;  4D7M A;  5IOY A;  3I4M J;  2L7F P;  1ETK A;  4C3H J;  3B6C A;  3LSJ A;  1GVD A;  4A93 J;  2LP0 A;  3OSF A;  4OVN F;  2FJ1 A;  2LVS A;  2NVQ J;  1ZKG A;  3Q0W A;  3BTL A;  3D1N I;  2Y9Z A;  2EH3 A;  2K9S A;  2CUE A;  2ZB9 A;  2MW8 A;  3S16 J;  2LLK A;  1DU6 A;  2VPR A;  3S1M J;  3TP3 A;  1VND A;  4MIM A;  3LSG A;  2R5Z A;  5C4X J;  2XRL A;  2NVX J;  2ECC A;  1IRZ A;  4B4C A;  4ABZ A;  4A3F J;  1PUF B;  5FLV A;  4DYR A;  1B72 B;  1F43 A;  1XS9 A;  1H8A C;  2DA4 A;  2VI6 A;  5EYR A;  4X6A J;  4FIS A;  5E3M A;  5EG0 B;  3ZQF A;  4AC0 A;  4NDL A;  5M5Y J;  1JKR C;  2DA2 A;  5IPA A;  1JKQ C;  3JRC A;  1BW5 A;  2DA7 A;  4BXX J;  1IG7 A;  2EBI A;  1ETV A;  4LOC A;  5GPC A;  3O8G A;  5FKL A;  5FKK A;  1X2N A;  2E2J J;  1WGX A;  3S15 J;  4UUS B;  2JA5 J;  1U8B A;  5IP7 J;  1YRN B;  2MSY A;  5E3N A;  5FKM A;  5M5X J;  4UUT A;  4CYC B;  3GTL J;  5K7Z A;  3HGG A;  3RQI A;  2DTZ A;  2B63 J;  1BL0 A;  3CDL A;  3QQA A;  4MFD A;  3HB9 A;  3HGY A;  4JX4 A;  1ETQ A;  4C3I J;  3FIW A;  1JT6 A;  1MBK A;  2X6O A;  4D5F A;  2L7Z A;  1F36 A;  5M3M J;  2R5Y B;  4W97 A;  1MBF A;  2ID3 A;  2MGQ A;  2CUF A;  2ME0 A;  1TWC J;  4MO7 A;  2XSD C;  1RKW A;  4XK4 A;  3JRB A;  3E7L A;  2YUS A;  3H3V K;  1BJZ A;  5EEA A;  1HDD C;  3OOU A;  3RZO J;  5IYC J;  1JJ6 C;  3S2H J;  3HOZ J;  4Y7N J;  2Y0S N;  5C4J J;  2MG4 A;  2N8G A;  1Q1V A;  4IHV A;  2ELK A;  5IP9 J;  3S2D J;  4AUX A;  1TWH J;  3W6V A;  2R92 J;  3S1Q J;  2DA3 A;  5FLM J;  1MNM C;  3GTM J;  5C3E J;  1GUU A;  2XB0 X;  4M6V A;  5DS9 A;  4FE7 A;  2DMU A;  3K2A A;  3LOC A;  4MFE A;  3FK7 A;  4XIC A;  1ETY A;  4W1U A;  3BTC A;  2HYJ A;  4A3L J;  3JRF A;  3QPL A;  2AO9 A;  1TWA J;  1G2H A;  9ANT A;  1MH3 A;  3FIS A;  1X58 A;  3G1L A;  1HCR A;  3MKL A;  4A3E J;  1Y1W J;  2KT0 A;  2XGD A;  4A3J J;  1PUF A;  2CQQ A;  1ZK8 A;  1B72 A;  1HDP A;  1ZQ3 P;  2VUM J;  2JN6 A;  1A6I A;  1QRY A;  2LD5 A;  3A01 B;  5C44 J;  4C2M J;  5K7H A;  4DZJ A;  3PM1 A;  4M3B A;  2M9H A;  1SFO J;  1IGN A;  3UKG A;  1K83 J;  3I4N J;  1U78 A;  2JA6 J;  4D5C A;  5EG0 A;  4Y52 J;  3C2B A;  3BT9 A;  1BW6 A;  5F0H A;  1K61 A;  2KDZ A;  2L7M P;  1JTX A;  4M3E A;  2H8R A;  3G1O A;  3GBG A;  1IDY A;  2CJJ A;  5EZH A;  5F08 A;  2W48 A;  2JK3 A;  3GTO J;  4BKX A;  1ZR4 A;  2LK2 A;  2DN0 A;  1TC3 C;  2NS7 A;  4UUS A;  3TW7 A;  4DZP A;  1YRN A;  5J1U A;  5IOZ A;  3HBL A;  2ECB A;  4CYC A;  2LR8 A;  1ITY A;  4JYK A;  1GV5 A;  1HOM A;  1RR7 A;  2FD5 A;  3A03 A;  5J3L A;  1GDT A;  5FKN A;  1QVT A;  4XID A;  1ETO A;  2DJN A;  1ETX A;  2R5Y A;  1NK3 P;  3JRD A;  2DMN A;  4S0H B;  4IHW A;  2Y9Y A;  5IP6 A;  2EZK A;  2WV1 A;  4XRS A;  2DA5 A;  4A3G J;  3ZQL A;  3HOU J;  3JRE A;  5HOD A;  5FKO A;  3FKI J;  1EF4 A;  2HXI A;  4JP0 A;  5F27 A;  4HNV A;  1JJ8 C;  1LE8 B;  1FEX A;  1AU7 A;  2XGC A;  2IEK A;  4B1R A;  1SAN A;  4FE4 A;  3RZD J;  1B8I A;  2NVT J;  4B3A A;  4JX6 A;  2I10 A;  2M2E A;  1NTC A;  2DMQ A;  1S7E A;  1WPK A;  3TP0 A;  1MH4 A;  1H88 C;  3SDG A;  2L0K A;  2E19 A;  5GPA A;  4I6Z A;  1IDZ A;  4IEJ A;  5F1J A;  1W0U A;  1MBG A;  3GTQ J;  3QPS A;  5J1Y A;  3LNQ A;  3TED A;  5EGO B;  3BQZ A;  1CQT A;  1OFC X;  4A3I J;  1NK2 P;  3S1N J;  1JUS A;  1TWF J;  1LFB A;  4BBS J;  1FTZ A;  2E1O A;  2LY9 A;  2DMT A;  3HKZ N;  1Z0X A;  4G12 A;  4RDU A;  2JA7 J;  2HDD A;  3BQY A;  1ZR2 A;  3F0C A;  4DCK A;  3ZQG A;  3Q0U A;  3ZOB A;  2O9L A;  1H89 C;  1B8I B;  2L9R A;  3SJM A;  5BNG A;  2M0C A;  2LFB A;  1TWG J;  3S14 J;  1UMQ A;  2GM4 A;  2IBD A;  5F04 A;  3JRI A;  1Y1V J;  2O7O A;  2FX0 A;  3A01 A;  3S17 J;  1FIA A;  4I76 A;  2NS8 A;  1UG2 A;  3IH4 A;  3BTI A;  2LKX A;  2HXO A;  3MVP A;  1I6H J;  3G1M A;  3WHC A;  3HEF A;  1U9O A;  5E3L A;  1RPW A;  2XPW A;  3OSG A;  2XGE A;  2M34 A;  4JPZ B;  1GV2 A;  2AHQ A;  2EZI A;  1FJL A;  2R7Z J;  2M8G X;  5DTD A;  2X9D A;  4M3D A;  4BY7 J;  4BBR J;  1JKP C;  4IHY A;  2HOS A;  4A3K J;  1OJL A;  3LSR A;  1E3O C;  1ZTR A;  1DU0 A;  3BG9 A;  1P7I A;  3BG5 A;  1WH7 A;  3ZQI A;  3H0G J;  3HOW J;  3S1R J;  2ID6 A;  2P81 A;  1D5Y A;  1I50 J;  4V2F A;  2HOT A;  3HDD A;  4BY1 J;  4L5E A;  1AKH B;  5EF6 A;  1ENH A;  2Y31 A;  2TRT A;  5GP9 A;  3GTJ J;  4A3M J;  3GTK J;  2X48 A;  1JUM A;  5J1R A;  3HOY J;  2GBY A;  4D7N A;  1VI0 A;  2XPU A;  4M3G A;  4DYQ A;  4M3F A;  2QCO A;  1OCT C;  2TCT A;  3CCY A;  2CRG A;  2ME6 A;  1T56 A;  1WI3 A;  2WAQ N;  3NAU A;  3CMY A;  1WH5 A;  1JT0 A;  2PMZ N;  1VF9 A;  1A5J A;  1GT0 C;  1LE8 A;  3L1P A;  2CU7 A;  3OIO A;  1JGG A;  2E2H J;  3M3Y J;  4MLO A;  3NAR A;  1VFC A;  3PO3 J;  1IJW C;  1X2M A;  3ZQH A;  4XRM A;  3GTP J;  2EZL A;  5JLX A;  3JR9 A;  1BA5 A;  1WCM J;  1XG1 A;  5M3F J;  3LSP A;  4GFB A;  3BTJ A;  2DA6 A;  3SFI A;  1POG A;  2K40 A;  3K7A J;  1IV6 A;  3IV5 A;  2FQ4 A;  1QVU A;  3HOX J;  3HOV J;  2G0E A;  4A69 C;  1IUF A;  1RES A;  5EGO A;  4V2G A;  2NVY J;  2HI3 A;  2EQR A;  3B6A A;  1MBJ A;  1HLV A;  5E3O A;  1LFU P;  2EZH A;  2CQX A;  2R93 J;  2D5V A;  5FJ8 J;  3FK6 A;  4RBO A;  2IAI A;  1HF0 A;  2R5Z B;  4DYC A;  1U9N A;  2GLO A;  1RKT A;  2NOG A;  4J19 A;  4QTR A;  1UHS A;  3BR1 A;  3DCF A;  5M5W J;  1MSF C;  3BR3 A;  2Y30 A;  4JQ0 D;  4DW6 A;  2H1K A;  5IYD J;  2VKV A;  1P7J A;  2JWT A;  4IHX A;  1FTT A;  2QF7 A;  2YU9 J;  4A3B J;  3CQZ J;  5EDN A;  1R9T J;  3Q0V A;  2K9N A;  1ZGW A;  2HOA A;  4QSH A;  3WHB A;  3O8H A;  3PO2 J;  2OF7 A;  1RET A;  3MN2 A;  3BR2 A;  3BR0 A;  2COB A;  3ZQC A;  1OCP A;  3TW6 A;  3RKQ A;  1T33 A;  2JA8 J;  1ORK A;  2XB5 A;  3JRA A;  2O8K A;  5JLW A;  1ETW A;  2YS9 A;  2VKE A; 
#chains in the Genus database with same CATH topology
 5HDK A;  4JOM A;  2LYC A;  2KZI A;  4QIW N;  2VQH A;  4Q4Z F;  3QRF F;  3CKY A;  1SC7 A;  4BAY A;  1MD0 A;  4XOT A;  4A6D A;  1X79 B;  1N77 A;  1S1C X;  2WAQ A;  4XOR A;  3PQK A;  3ZGY A;  4UB8 C;  2LTP A;  1I3A A;  2A45 G;  4PV1 B;  1FDM A;  2ZME A;  1AKH A;  1RR8 C;  2BW3 A;  2FOW A;  2Y2Z A;  3PSI A;  4A0X A;  3AEF C;  1R22 A;  1QVG O;  5IYB J;  2R7F A;  4I0B A;  3B02 A;  2FYU J;  4P5O A;  1SS1 A;  1APL C;  3WTY C;  3L72 D;  4KUG A;  1BIB A;  1QQI A;  2RAE A;  4RS8 A;  1QPI A;  3II6 A;  4IL6 E;  4L73 A;  1AFO A;  1QVF O;  3P8C E;  2RNG A;  3CP8 A;  3JRH A;  3WTV C;  3L2R A;  3GTG J;  4HW0 A;  5H20 A;  4X1E A;  3WTU C;  3UNG C;  1MFZ A;  2AXT H;  2FYU E;  2Q6Q A;  2FML A;  4YEJ A;  1FZC A;  1PP9 J;  3P32 A;  1ZLL A;  3JCU E;  1NH3 A;  3SFZ A;  1PZQ A;  2H27 A;  2J5P A;  2H8P D;  1JTY A;  1MBH A;  3ZMS A;  2YMY A;  5GTI H;  1S9H A;  1LTA C;  3SFE C;  3EUA A;  4GXO A;  5B5E H;  2DXI A;  4PZE A;  5AW2 B;  2BXZ A;  5LD2 C;  2HYF A;  1IFM A;  3M4O J;  1Z77 A;  3VPR A;  1PP9 E;  2A68 F;  4MTD A;  4GWG A;  1GL2 A;  2N1T C;  1J75 A;  2E76 B;  3DEW A;  2ICW G;  5L3D A;  2XPV A;  1KU3 A;  5J4V A;  1AHD P;  1LJ2 A;  1FYK A;  3HXL A;  1FSH A;  2HFE D;  1X4O A;  3K0L A;  2Y0M A;  3ZQ7 A;  1GD2 E;  1T8I A;  1GMJ A;  1GVD A;  1HW1 A;  3M07 A;  4JQF A;  2PJR B;  2X1E A;  3BCA A;  4GCV A;  3GF3 A;  1HWT C;  2HPI A;  4IJA A;  3BDD A;  2KKO A;  2NVQ J;  1OYY A;  3Q0W A;  4PCQ A;  2OGU A;  3JAM K;  5KJ7 A;  5AVZ B;  1X19 A;  1LT9 A;  1O3S A;  4RM3 A;  1HH0 A;  2JA2 A;  2ZB9 A;  2QEX P;  3SZG A;  4HV6 A;  1N73 B;  2JVG A;  2LKM A;  5CYV A;  2VPR A;  2IS6 A;  2FXP A;  1VQK P;  1LQ1 A;  2IGN A;  1Z56 A;  1VND A;  4KN4 X;  4MIM A;  4C30 A;  1M1J C;  2PI0 A;  4KYW A;  3L75 G;  1ODD A;  2ECC A;  3M9H A;  1J2J B;  3QH9 A;  3IL2 A;  3B71 A;  5E1Z B;  4A5N A;  4ABZ A;  1X1D A;  4A3F J;  1NTZ K;  1PUF B;  1XMX A;  5ICF A;  2RKL A;  3OYL A;  5CHX A;  5KAF H;  1VQP P;  4M6Y A;  1ZEL A;  3LSI A;  2DYS H;  1VQ7 I;  3E1S A;  1KQL A;  5EFW B;  1PYV A;  1Z1D A;  1XS9 A;  5AIQ A;  3H36 A;  1K7A A;  3GHY A;  3DQV C;  3N05 A;  4D3D A;  5AW1 B;  1QGP A;  1YS6 A;  2UXX A;  1H89 A;  2LRD A;  4QPQ A;  4DGW B;  1KC8 Q;  4WB4 A;  2PQ8 A;  3MEX A;  1KIL E;  3C18 A;  1Q86 Q;  1J1E C;  3WTX C;  2R7Q A;  3OYI A;  3BJA A;  2R7V A;  3H1L G;  3JW4 A;  2E75 C;  2MD0 A;  1MMN A;  5JR3 A;  3C3W A;  3RL0 g;  1WJA A;  2GA1 A;  2OYH C;  5LGU A;  1BG6 A;  1FSE A;  5ILS A;  1UEL B;  2JP3 A;  1LJ9 A;  4XN3 A;  1KQ8 A;  2HPC B;  2YU3 A;  1N75 A;  2A6E F;  5IPA A;  1ULY A;  2KIQ A;  1JKQ C;  1LTJ B;  3AKZ A;  2ZNZ A;  3IP4 B;  4ENM A;  4GOD A;  3M91 A;  4H44 B;  5AVR B;  2DA7 A;  5DUI A;  3P9C A;  3RKW A;  2EBI A;  2HQN A;  4YIR X;  3ZDM A;  1WGX A;  1XDS A;  2JA5 J;  4XM3 A;  3L2W A;  3CCE I;  3OOP A;  5F64 A;  2O1K A;  2QJK B;  3J7A Y;  1URQ D;  1ZG5 A;  3RQ4 A;  3GTL J;  2W1O A;  1KFN A;  3ZMT A;  5BS6 A;  1Y8R B;  3ADP A;  1KB9 D;  3RQI A;  1VQ6 I;  3VYS B;  4KA4 A;  2B63 J;  2IPP A;  3HSR A;  4L5J A;  1KGS A;  1SVL A;  2K5C A;  3Q1M A;  3QQA A;  2G7U A;  4MFD A;  1NTM G;  2W27 A;  3HPH A;  3HGY A;  1YOV B;  3GYH X;  2QE7 H;  3O6Q B;  4Z1M H;  1ETQ A;  1T6S A;  1RF0 C;  3M8J A;  1QO0 D;  3U9G A;  4I99 C;  3K4J A;  2B9B A;  3L00 A;  2KZJ A;  1WZ2 A;  4KFC A;  2X6O A;  3IHU A;  1W2B O;  3VOE A;  2QLZ A;  2HVR A;  3PNY A;  4HQE A;  4MO7 A;  2ME0 A;  1TWC J;  2E74 B;  2VBY A;  4RLQ A;  1AVO A;  2R7X A;  3KCC A;  2ZFW A;  4MN4 C;  4S05 A;  4XK4 A;  3JSO A;  3JRB A;  3E7L A;  2QSH X;  4P9U A;  3BCC D;  3F3X A;  5JE8 A;  1OIS A;  4XKC A;  3H9G A;  4LK0 F;  1G1I A;  1IRG A;  3FGA D;  2M1B A;  2CQK A;  2QSF X;  2E35 A;  3NRV A;  2VT3 A;  1PGJ A;  5H2F E;  3HOZ J;  4Y7N J;  1UCR A;  2MG4 A;  1FDI A;  4GOE A;  1Q1V A;  2STT A;  2OAR A;  5LLQ A;  3QWL A;  3OYJ A;  2ZJP F;  1SQX J;  2HZD A;  4XR6 A;  1ON1 A;  3HZJ A;  4AUX A;  5LEK A;  2AEF A;  4H0L D;  1GU5 A;  1PUE E;  3L73 G;  1KTM A;  1S7O A;  1KYZ A;  1X0X A;  2CO5 A;  3SWF A;  3U21 A;  5J8F A;  2POH A;  1XGO A;  3RKX A;  3VWB A;  1D5V A;  2IFM A;  5C3E J;  4WXD A;  1GUU A;  1OCC H;  1SQX E;  4LLN A;  2OZ6 A;  1YTY A;  2AEM A;  2PG4 A;  4NC8 A;  4XLH A;  1KZU B;  4XL9 A;  1FZA A;  4Y13 A;  3GG2 A;  4ETS A;  1P4X A;  4MFE A;  4C46 A;  4XIC A;  4W1U A;  1T39 A;  3DPT A;  2GZW A;  2HYJ A;  1FZE A;  1LB2 A;  1RC9 A;  1G2C B;  3ASN H;  4U0W A;  2R5D A;  2R3C A;  2DYR H;  3WE2 A;  2AO9 A;  1J0R A;  4CCK A;  1TWA J;  1SFU A;  1NOH A;  1MH3 A;  3FIS A;  2L9V A;  1S72 I;  3BLY A;  4L9N A;  3K4N A;  3MKL A;  2R3S A;  1Y1W J;  1HCR A;  4M9Z A;  3E7K A;  3H1I D;  1K8A Q;  4OIQ F;  2ZJ2 A;  5AIP A;  3T8T A;  4GWK A;  3L72 J;  3G6E P;  1G3W A;  1DD3 A;  2N1T D;  3D6Z A;  1QZE A;  1J1D C;  3S93 A;  1URQ A;  4PGG A;  1PFI A;  5C44 J;  1T08 B;  5K7H A;  4IHS A;  4CCM A;  3L72 E;  4IO9 F;  3FZV A;  3MWM A;  4JF7 A;  2M45 A;  4DOZ A;  2M9H A;  2PX9 A;  2H6B A;  3B73 A;  4XLF A;  2KP6 A;  5BQT A;  3I4N J;  3SFD C;  1SQP D;  2DT7 B;  2VOD A;  1VQO I;  3J80 Z;  1OCO H;  5D5X B;  4BQA A;  1R58 A;  1BCC D;  3G73 A;  5F0H A;  1K61 A;  2KDZ A;  3Q5P A;  1IUY A;  1RUN A;  1JTX A;  3CPW O;  2RRE A;  3FM3 A;  3BRO A;  2W83 C;  2K86 A;  3U1K A;  5APQ A;  5ILV A;  4PUS A;  4UVC A;  3KYQ A;  1ZRD A;  3AE2 C;  5KCM A;  2V1X A;  2DN0 A;  3RQS A;  4UUS A;  1L4A C;  3TW7 A;  4DZP A;  2M5W A;  1VPC A;  1YRN A;  5J1U A;  2QSI A;  3A0B C;  3L74 E;  2O1J A;  1RF1 A;  1PGO A;  3CD6 P;  1G8X A;  4IXA A;  2ZXX A;  3HD7 C;  3E6B A;  1F9N A;  2A3S A;  1C0W A;  1RR7 A;  4P96 A;  3A03 A;  5J3L A;  5FWN A;  1SQB J;  3G4S I;  2HTS A;  1TU3 F;  1ZME C;  1Y56 A;  1HA8 A;  1J2X A;  3FXO A;  1QVT A;  4XID A;  2B89 A;  3GHG C;  1OIP A;  2QJP C;  4LK1 F;  1TNT A;  5E79 C;  4BNC A;  4M6X A;  5HOO A;  2KZG A;  1ETX A;  4QPO A;  4ZYA A;  3V4G A;  3X2Q H;  4U7D A;  1J9I A;  1YJ8 A;  3JRD A;  1WVR A;  1SQB E;  1D0Z A;  5B66 C;  4S0H B;  4NPD A;  3WUU A;  3ABU A;  1KQF B;  5IP6 A;  3ZPL A;  2E75 D;  4H13 B;  1EH8 A;  2PMH A;  4F52 A;  1FOX A;  1SQQ G;  2KLO A;  2KJB A;  2DA5 A;  3M7G A;  2QBY B;  3HUG B;  4HF2 A;  4A3G J;  4J0E A;  4M9S A;  2WC2 A;  3ZQL A;  2YX7 A;  2FY8 A;  2KLU A;  5AVS B;  1IFJ A;  2VL8 A;  2DI3 A;  1DP3 A;  2M4K A;  1LKX A;  3FKI J;  2HXI A;  3QP6 A;  1SQV J;  3H1J D;  1TQI A;  2STW A;  1JJ8 C;  4U7J A;  4AQR D;  4PGH A;  1T2K C;  3NWT A;  1OYW A;  2ZXW H;  1LVA A;  1AU7 A;  1VQ8 I;  2XGC A;  3WG7 H;  4XKB A;  4B3X A;  2JKV A;  2VJ5 A;  3RIR A;  1RH5 B;  2IP2 A;  4B1R A;  1SAN A;  1SQV E;  3RBZ A;  5APU A;  4B3A A;  3QHA A;  1TNS A;  1X3W B;  3OYB A;  1QA6 A;  1AOY A;  4EI2 A;  2N1T A;  3LA7 A;  3R0A A;  1SFC C;  1KQS O;  1EDI A;  4QMA A;  5KKZ B;  3TP0 A;  4R1H A;  1MND A;  1H88 C;  3SDG A;  1L0L K;  4ZMD A;  4BGD A;  1T3U A;  3W3C A;  1VQ7 P;  4ZYD A;  2Q3E A;  3ITK A;  1PGQ A;  1MBG A;  4KJZ A;  3G2B A;  3L71 J;  2KMU A;  1J5Y A;  1EJ9 A;  2B7E A;  2YXQ B;  5J1Y A;  2PFX A;  1NTK G;  4YIF A;  3D70 A;  1UG0 A;  3HHH A;  2WQY C;  1NK2 P;  3K4L A;  4MQV A;  3KZI C;  1KYO E;  1LFB A;  1SD4 A;  2KRC A;  3KP5 A;  1MMG A;  2DMT A;  3L71 E;  4G12 A;  2C9N Y;  1KB9 H;  4LG0 B;  1QHH D;  4DCK A;  1XCV A;  2WAE A;  4DQ2 A;  3Q0U A;  1SFK A;  3RGU A;  1A04 A;  5HNH A;  1WJ5 A;  1I6X A;  1EXI A;  2UYY A;  2HR3 A;  2MLG A;  4E7H A;  1TWG J;  2WT7 A;  2ZFU A;  3FBI B;  2B9S A;  3R61 A;  3PJR A;  2GM4 A;  1KB9 E;  2MBF A;  2F5E A;  3HTK A;  1M1J A;  2IBD A;  5F04 A;  3MGN A;  2O7O A;  3GZ6 A;  5BPD A;  3ONQ A;  5KLV K;  1WJE A;  4RO0 A;  4ANJ A;  3IH4 A;  5ILU A;  3H1K G;  4E13 A;  1YHQ I;  2JZY A;  1KA8 A;  2DO7 A;  2FMY A;  3KZY A;  2F5C A;  1I6H J;  1MNE A;  2BY3 A;  2KHM A;  3G1M A;  3HEF A;  1HW2 A;  2KNC B;  4OGQ C;  4DJG A;  1N25 A;  1RPW A;  1XX5 A;  2P5V A;  3IKV A;  2M34 A;  1SLQ A;  1GV2 A;  1VQ6 P;  1G6N A;  1Z05 A;  3CO6 C;  2R7Z J;  5DTD A;  1USD A;  1Z6T A;  2X9D A;  2VB6 A;  3RK3 D;  3IAS 2;  4UV9 A;  1T95 A;  1JKP C;  4IHY A;  4OIN F;  2HOS A;  4EDF A;  2IA2 A;  2K9J B;  4A3K J;  1OJL A;  3LSR A;  3CTV A;  1SD5 A;  5FLX K;  4RAF A;  2MC3 A;  2X1D A;  1OKR A;  4EGZ A;  4PV1 C;  1TW2 A;  2OYH A;  5A9S B;  1L0N D;  2D3T A;  2WY7 Q;  3ZQI A;  2H09 A;  4XNF A;  3WTW C;  5HS9 A;  2L5G B;  1P9Q C;  4RAY A;  5FRN A;  3S1R J;  2JRM A;  2UV1 A;  3E5U A;  3V7R A;  2P81 A;  3L2V A;  1CF7 B;  4XA4 A;  2IZ1 A;  2X85 A;  4BY1 J;  4L0Z B;  1FDO A;  5DYM A;  4LJZ F;  2Y31 A;  3L75 D;  5GP9 A;  3LSH A;  3GTJ J;  1ZG3 A;  2EV6 A;  4AVZ A;  3HPG A;  2X48 A;  3HRS A;  1IAW A;  1HGZ A;  1N7L A;  2WWW A;  1RIO H;  4HOB A;  2OC6 A;  1YW7 A;  2K3P A;  1EZV E;  3DF8 A;  2OTL I;  1TQP A;  2XPU A;  3C2G A;  1YON A;  4M3F A;  3H1H D;  5AVW B;  2IDB A;  2Z16 A;  1OCT C;  2V79 A;  2TCT A;  2RC4 A;  3H1I J;  2V9P A;  3CCY A;  2DPU A;  2E5T A;  2CRG A;  4JK1 X;  2ME6 A;  2KJC A;  4WX9 A;  1QEX A;  2R7R A;  2R7W A;  2FQ3 A;  4ESJ A;  3AE4 C;  3CMY A;  4EMS A;  3H92 A;  5AVY B;  4AU7 A;  1A5J A;  2ZFC A;  3CZ6 A;  2CQ7 A;  2MFZ A;  3NAR A;  3AEC C;  3PO3 J;  1W7P D;  2ZO4 A;  1YW9 A;  1IJW C;  3HKZ A;  1SD7 A;  3E5Q A;  4HZF A;  5LHG A;  1JE8 A;  4C2U A;  1F12 A;  2Y0S A;  3GTP J;  4O6J A;  5JLX A;  3WG9 A;  1L4A D;  2QM7 A;  4U87 A;  3CF2 A;  4KIS A;  1AA0 A;  1QL2 A;  2W6B A;  1WCM J;  3CDI A;  1BCC J;  4R1N A;  4OMZ A;  1S72 P;  1N73 C;  3SFI A;  3HD7 D;  1A02 F;  2VC0 A;  2PFB A;  3HRT A;  1ZYR F;  4F93 B;  1P4A A;  2FQ4 A;  2YIU B;  1G3Y A;  3BP8 A;  3HOX J;  2FFD B;  1JY2 O;  2G0E A;  2KRF A;  3KHU A;  3TDU C;  2J5O A;  2G3A A;  4A69 C;  4UB6 H;  3PL8 A;  1Y9B A;  1IUF A;  2KB7 P;  1XCB A;  2KIF A;  3FR7 A;  3W2V A;  3RK2 D;  2BOL A;  3M1C A;  3GMA A;  1HLV A;  1I5Z A;  3O6B B;  5LHH A;  1FNN A;  2EZH A;  1U7J A;  3MTU E;  4ENK A;  1BM9 A;  3RPU A;  3PSF A;  4KNY A;  4RBO A;  4UB6 E;  2E7X A;  4LIU A;  2NPS D;  3VB2 A;  3MUD A;  1HF0 A;  1VQO P;  2R5Z B;  5CBN A;  4DYC A;  1U9N A;  1FE6 A;  2W24 A;  1SVO A;  2WVR A;  2DBB A;  3KEQ A;  5GTH E;  3N97 A;  1IN6 A;  2FXM A;  1UAA A;  3M06 A;  3GF2 A;  2QEN A;  2VLA A;  3J80 K;  3OS1 A;  3PIP F;  1LT9 C;  4FX0 A;  3DCF A;  2L9S A;  2HKX A;  3L37 A;  3WGI A;  4JQ0 D;  3WUT A;  1T2K D;  3GW6 A;  5C39 A;  5A9T A;  1V3F A;  2VKV A;  4OQY A;  4PZD A;  3CCE P;  2JVH A;  1I1G A;  3CQZ J;  4A3B J;  1BDD A;  1KU2 A;  1R9T J;  3Q0V A;  2L4A A;  4S3M A;  4A5M A;  2HOA A;  3HRM A;  1ZGW A;  3MMY B;  2P10 A;  1LTJ C;  2K7L A;  4OIP F;  2ZSH B;  1SFC D;  2M5A B;  4H44 C;  1EC5 A;  2K9Y A;  4D6T G;  3HSF A;  3PNV A;  3SZP A;  3H1J J;  3Q5S A;  4LD5 A;  3K6J A;  2O3J A;  3BR2 A;  1U7M A;  1HUC A;  3G4S P;  1JY3 N;  3H25 A;  2JA8 J;  3FF5 A;  2QJK C;  3JRA A;  2O8K A;  1NU1 G;  1O7F A;  1ETW A;  3L73 D;  4V19 K;  3HG9 A;  3E6C C;  2CG4 A;  1TP4 A;  3H0D A;  3S8P A;  1R7J A;  3KP4 A;  4J00 A;  1YJQ A;  3ULK A;  1HKQ A;  4UXN A;  3HTS B;  5DJU B;  4JX5 A;  3HIF A;  1R5I D;  1AQ5 A;  2QUF A;  1XB4 A;  2RGV A;  3WMM 0;  4BEH A;  4YII A;  1D1C A;  4AYC A;  1K78 A;  4FCY A;  1S5L X;  3JRG A;  1EH6 A;  3BCC G;  4WBA A;  1NTZ D;  1OCR H;  2F2E A;  1SMY F;  2A45 H;  1L4A A;  3R4K A;  2HQ5 A;  2OJE D;  3K9T A;  1VQ8 P;  2E74 C;  4MTE A;  1FBU A;  3SEQ A;  4RGR A;  3FWE A;  4ZKP A;  2EIK H;  2W00 A;  2XAF A;  3FXM A;  1JUP A;  3HD7 A;  4G6T B;  1Q7Y Q;  1D8J A;  2NNN A;  3HSE A;  2R0Q C;  1I3Q J;  3OIQ A;  2OV7 A;  2QWW A;  3I5C A;  3H3U A;  3QOP A;  2IFN A;  3VOP A;  4XLA A;  1FAV A;  4A3C J;  1JKO C;  1EKE A;  2VC1 A;  3DFU A;  3CO7 C;  1AA7 A;  4QWQ A;  2WPR A;  4II3 A;  3GHG A;  2ZT9 C;  3DPU A;  1XC5 A;  5EZG A;  3ECO A;  3W6U A;  4XN0 A;  2WB1 N;  4BXU A;  1JB0 J;  3HAD A;  2DT5 A;  4FTH A;  4A3D J;  2N9B A;  4XLN F;  3KEO A;  2RN0 A;  2K9Q A;  1JCD A;  5DCF A;  3BAS A;  3PP5 A;  4PV1 D;  3BR6 A;  3BR5 A;  3FX0 A;  2RH0 A;  3PUF A;  4D7M A;  2FXO A;  2O8X A;  4RAZ A;  3VYT B;  1EDK A;  2UUZ A;  1F1Z A;  1DGW Y;  1ETK A;  1Z6R A;  2F5D A;  3B6C A;  3LSJ A;  2G9W A;  4E7L A;  3NEU A;  2VJJ A;  4DIQ A;  1T2K A;  1FC2 C;  3E3V A;  2LMD A;  1OR7 C;  1BN5 A;  2LP0 A;  2Z1D A;  2ESH A;  2LVS A;  2XSJ C;  1I39 A;  4TV7 A;  3BTL A;  1G3T A;  2ZC2 A;  2Y9Z A;  3RK3 E;  2K9S A;  4HQM A;  1PP8 F;  4PZC A;  2MW8 A;  1T38 A;  1SFC A;  2FBH A;  1MZB A;  4Y33 A;  2FBK A;  1EDL A;  1YHQ P;  3H35 A;  2LLK A;  3BZC A;  1VF5 B;  3S1K A;  1G3S A;  1FS0 E;  1SQP G;  1PP7 U;  3U1C A;  1WT6 A;  5C4X J;  1FLI A;  3LSG A;  3IN6 A;  2E71 A;  2XRL A;  1JMB A;  3OYG A;  1KQ9 A;  4U3F G;  3GXO A;  4HBL A;  1YFH A;  2NVX J;  3L75 J;  5L3F A;  1IRZ A;  2OAZ A;  2DOA A;  2KS1 B;  3ESW B;  3WGH A;  1G1J A;  4DYR A;  1O7L A;  3GFL A;  1BGY G;  1F43 A;  2J5U A;  3TO9 A;  1IN5 A;  2ZCW A;  2K9L A;  2PN6 A;  3C9I A;  3T0Y A;  1S6L A;  4OIR F;  1KD1 Q;  2DA4 A;  2QYT A;  4PZJ A;  2L01 A;  3KLN A;  3W6J B;  2CK3 H;  1B59 A;  2V7Q J;  1K79 A;  1GLN A;  3DBR B;  4OH8 B;  4BJ6 C;  1K73 Q;  2PJP A;  5L3E A;  5EG0 B;  5AYV A;  3H1L J;  1WJD A;  3HE5 B;  1BIA A;  4KMU X;  4BE0 A;  4ZDL A;  4AC0 A;  2HVS A;  1NAY A;  4NDL A;  4ZH4 F;  3F8C A;  1Q82 Q;  4XFJ A;  4BAC A;  2LY1 A;  2X6W A;  3H1L E;  2HLO A;  2XKO A;  2OTL P;  1NG7 A;  3OV8 A;  5CVR A;  5FFZ A;  4BXX J;  2E34 A;  2QQ9 A;  5J6X A;  2Y0E A;  3A0B H;  5AVV B;  4HLY A;  3O8G A;  1Y0N A;  4CPG A;  2E2J J;  4GDO A;  3VEP A;  2DOE A;  3S15 J;  1U8B A;  2E60 A;  5D8L B;  5E8I A;  3CCL I;  1W5C C;  5K7Z A;  1LPQ A;  5DCM B;  5KJ7 D;  3OYK A;  3H1J G;  4PJ0 H;  1BL0 A;  4AD9 A;  2W7N A;  5TJJ A;  1G4D A;  1ZLJ A;  4F3Q A;  3V7S A;  3CF5 F;  3FXD A;  4AID A;  2DK8 A;  4H13 C;  1M1E B;  2HTJ A;  3KP7 A;  1R5L A;  2AXL A;  5HLT A;  3BZ6 A;  1TL8 A;  5DM7 F;  1AWC A;  2BHY A;  4C3I J;  3PID A;  1NTM J;  1JT6 A;  4PJ0 E;  5B66 H;  5BU5 A;  3FBN B;  1X0T A;  1MBK A;  4D5F A;  4MEX F;  1BDC A;  3WFJ A;  5DM6 F;  1F36 A;  5M3M J;  3QOE A;  2R5Y B;  3CP2 A;  4XLE A;  2MLK A;  3QU6 A;  5KK1 A;  4IZZ A;  2YNY A;  2DOF A;  2ID3 A;  2IS1 A;  4LB5 A;  4H44 D;  4KJM A;  4WY4 B;  4D3S A;  2EIM H;  1YW8 A;  5J40 A;  1RKW A;  1NTM E;  3H1K D;  2DFE A;  2HOE A;  2EFO A;  2ACJ A;  4OIO F;  2YUS A;  3H3V K;  2ZT9 B;  4HB1 A;  3TO7 A;  1TT0 A;  3V2R A;  1Y47 A;  3OYC A;  3CXH I;  2JSP A;  1X1C A;  1JJ6 C;  3H32 B;  5KKZ C;  3G17 A;  5FFX A;  2BZT A;  1X3Z B;  2QIW A;  3F5H A;  2Y0S N;  4K3A A;  1OYI A;  3IRR A;  2QQ8 A;  3ZCO A;  5DEQ A;  3F9K A;  4AIJ A;  3MZH A;  1L0N J;  2PJR A;  1DDN A;  3HRN A;  3L7W A;  2KL4 A;  3KYD B;  2W82 A;  4CDG A;  4A0Y A;  4U7B A;  2ITA A;  1MNM C;  2R7U A;  5AVU B;  3ZMV A;  3L73 J;  4GT1 A;  1WFX A;  1TT5 B;  2OCC H;  2K02 A;  5KHD A;  1WDK A;  5LGN A;  2IVM A;  2RDP A;  1YI2 I;  4CCJ A;  2HYN A;  2DMU A;  3FWL A;  2AXT E;  3QYF A;  1QBJ A;  1N73 A;  1DH3 A;  2DFI A;  3MD0 A;  2JPB A;  4RGX A;  1XSD A;  1ETY A;  1E79 H;  2I9P A;  3I54 A;  4DNC A;  2IT0 A;  1WPQ A;  3LSK A;  1KIL B;  5GTI E;  5B5E E;  3DTK A;  1FBQ A;  2QM3 A;  1LFP A;  4AIH A;  1G2H A;  3IF4 A;  4QLC U;  2X58 A;  1HJ0 A;  3USS A;  1D1B A;  4PD4 I;  5BMZ A;  2IGK A;  2CPB A;  4B3H A;  2XGD A;  5HDN A;  2L2O A;  3M9Q A;  1PUF A;  2CQQ A;  3NTN A;  5TIS C;  2JT1 A;  1HDP A;  2XAU A;  1QLE D;  1R8E A;  3ZHB A;  2VUM J;  2WTB A;  1V5G A;  4IL6 X;  4PD4 D;  2R4G A;  1L0N G;  1V54 H;  1XMK A;  1T0F C;  3ABK H;  3V5B A;  3SWK A;  4E7S A;  4C2M J;  4DZJ A;  4HH2 A;  1FBM A;  2IJL A;  1X9V A;  4M3B A;  2QM8 A;  4PFP A;  3H9Q A;  3OJA B;  4Y28 J;  4EZB A;  1K6O A;  1IGN A;  2P5L C;  1PJR A;  2I5U A;  4XBF A;  2CVZ A;  2WBM A;  5BVZ A;  1U78 A;  3D1L A;  4G8X A;  4DYD A;  3JTH A;  2JA6 J;  2EFN A;  1FOK A;  4IHT A;  1J09 A;  5KAI C;  4GOF A;  1L0L D;  3IQD B;  2M3E A;  1RZ4 A;  1ZLK A;  4RES B;  2C0W A;  1Z7U A;  1LWU B;  3WFI A;  1MMS A;  2CJJ A;  2FYU K;  2HPC A;  1BI1 A;  4KIT B;  4GBJ A;  4XMY A;  2X1C A;  3BVH A;  2E7W A;  5F08 A;  5F6F A;  1LTJ A;  3MIW A;  2JK3 A;  1JEK A;  1K4T A;  3GTO J;  5AW8 B;  1ZR4 A;  3H1H G;  4C2T A;  2CUZ A;  4HG2 A;  2NS7 A;  6PAX A;  1N8R Q;  1KQG B;  5IOZ A;  5CQE A;  2ECB A;  2IXS A;  1YS7 A;  1JI8 A;  1LSJ A;  4XSZ F;  2A05 A;  4LGW A;  3CWB D;  3S9O A;  1ITY A;  1HF9 A;  5KAF E;  2GUV A;  1OWA A;  1JHF A;  1TW3 A;  4BL0 B;  1D0X A;  2BY0 A;  1KN7 A;  2FD5 A;  2RVC A;  3IC7 A;  3ZGK A;  3MKW B;  1R6R A;  1GDT A;  3V8L A;  4CGZ A;  2CYY A;  3FXL A;  3O6Q A;  3CMA I;  5KLV D;  2WY8 Q;  4B86 A;  1S5L C;  3DWL E;  2DJN A;  4IOA F;  4GGG A;  3R60 A;  1MGT A;  3EUK L;  3WS7 A;  4ZKU A;  1X3U A;  1SVF A;  2Y9Y A;  1HW5 A;  2EZK A;  3U2R A;  4XRS A;  4ASV A;  2BHZ A;  5JVT A;  4EM0 B;  1NJI Q;  1IRX A;  2W25 A;  1SQQ J;  1OX3 A;  5HOD A;  1YQ4 C;  2WWY A;  5FKO A;  2FUG 2;  3PFY A;  2LKP A;  1MDM B;  1PGN A;  1YQA A;  1LE8 B;  3OR2 C;  2BV6 A;  4D6T D;  4KUH A;  3L4F A;  1YX5 A;  4G94 A;  5FLX Z;  1SQQ E;  2IEK A;  2G8Y A;  2YIU C;  4ASW A;  3DTE A;  2FFD C;  3AE6 C;  4FE4 A;  2LC2 A;  1NU1 D;  2NXN B;  2M2E A;  2HWV A;  4OQZ A;  2FA5 A;  3QPT A;  2P1J A;  3DEE A;  1W36 C;  3KP6 A;  1LNW A;  1MH4 A;  4E4H A;  3TK1 A;  1DIP A;  4GYI A;  3V6I A;  2Q1Z B;  4HSR A;  5GPA A;  3REO A;  4I6Z A;  1IDZ A;  4IEJ A;  2QG4 A;  3GME A;  1OW7 A;  4E6K G;  5F1J A;  2VQC A;  5F1R A;  3Q3D A;  2QQA A;  3VMA A;  3QPS A;  3PH0 A;  3ABM H;  3VSL A;  4Q47 A;  3LNQ A;  1OR7 A;  2FBI A;  5B1A H;  3TED A;  2MA3 A;  4E21 A;  5CKT A;  5E17 F;  1OFC X;  4A3I J;  3RTR A;  1NTK J;  1TWF J;  1G2C A;  3PTZ A;  2YPR A;  2E1O A;  4MNU A;  1Z0X A;  4KHX A;  1VQM I;  5LRS A;  2H43 A;  3BQY A;  4XSX F;  2VOO A;  1OXZ A;  2IW5 A;  2UWJ E;  1DX7 A;  2NAZ A;  3SJM A;  1R23 A;  1NTK E;  1FT9 A;  3VDX A;  1GU4 A;  1UMQ A;  2R7O A;  3MZ8 A;  5CVI A;  5D8K B;  3I0T A;  5HLH A;  3L70 D;  2JWD A;  3HUS B;  1B4A A;  3S17 J;  2JUG A;  1YO5 C;  1VQ9 I;  2QRX A;  4I76 A;  4GDF A;  2F5V A;  5AW6 B;  4RM2 A;  2NS8 A;  3MUD C;  3BTI A;  2LKX A;  1UHW A;  2E5N A;  3CCL P;  3WHC A;  4BQO A;  3HL2 A;  1ZRC A;  3H1K J;  1W5S A;  3BOQ A;  3K1M A;  3F8B A;  3F21 A;  2XRN A;  1BC8 C;  2JUC A;  3S3M A;  3PRJ A;  2EZI A;  1WSU A;  4OWR B;  2E36 A;  2M8G X;  3K4K A;  4A6E A;  1NTZ G;  3K69 A;  2VAS A;  4CXF A;  4BY7 J;  3K1P A;  3H1C A;  1HTL C;  1JMM A;  4ZZD A;  1RHZ B;  1X4P A;  1F0Y A;  5K5G B;  3ECH A;  1E0E A;  1UFM A;  4NQW B;  5KTB A;  2JQ7 A;  3BG5 A;  1Z21 A;  1WWX A;  3QAH A;  3FXE A;  4N9H A;  1F4K A;  3LFK A;  4I98 B;  1F5T A;  2ZSI B;  2P7C B;  3GFI A;  3QPH A;  2W84 A;  4KDP A;  1YJW I;  5DV5 A;  3OR1 C;  4FET A;  4I2O A;  4BXL A;  4V2F A;  2HOT A;  3HDD A;  4L5E A;  2L7K A;  3QOD A;  3AE3 C;  1U0J A;  2VBX A;  1Y39 A;  1XD7 A;  2A5Y B;  2B0L A;  1NHA A;  2EV5 A;  2TRT A;  2XAS A;  4E7J A;  3HHG A;  4A3M J;  3GTK J;  1XGN A;  2IYO A;  1IJD B;  1S2E A;  4U3F D;  5JHF A;  4EJV A;  2M0M A;  1WJC A;  3TOA A;  2CV0 A;  3CUQ B;  2GBY A;  3DEU A;  3WU2 C;  3P7N A;  1BGY D;  4M3G A;  1HGV A;  3L2U A;  2UWM A;  1SQX K;  4CSW A;  1P92 A;  4ZTF A;  5CPR B;  4RGS A;  5LFA A;  4L76 A;  2QBY A;  3HUG A;  4BH9 A;  3PFI A;  4ZTJ A;  1T56 A;  2VON A;  3LID A;  1FP2 A;  2WAQ N;  4JBA A;  1JT0 A;  2G7H A;  4PD4 H;  4IRH A;  1YI2 P;  2FF4 A;  1A35 A;  2E2H J;  3KQG A;  1JGG A;  2YSR A;  3ZMZ A;  2E1N A;  1IZN B;  1P84 I;  1RE4 C;  2JPC A;  5K5O A;  2P5K A;  3M3Y J;  1Q2N A;  1VFC A;  1SVM A;  1FZF A;  4AIK A;  3G71 I;  3K96 A;  3DV8 A;  2YO3 A;  4XRM A;  4HNT A;  4CUG A;  4U88 A;  2CW7 A;  4LC1 A;  3W6K B;  1VQ5 I;  1GZL A;  1XG1 A;  1BE3 D;  3LSP A;  4OAY A;  4GFB A;  3BTJ A;  5A2Q Z;  2W57 A;  3ZN0 A;  1PP9 D;  1P6R A;  1POG A;  2E5Y A;  3IV5 A;  4AVP A;  2FSW A;  1J7K A;  1UB9 A;  3L2Q A;  1KFM A;  2DK5 A;  1KZH A;  1VF5 C;  3CJT B;  3A0H H;  1M90 Q;  1KV4 A;  3HOV J;  2CWE A;  2IBZ I;  4GO1 A;  4O9B A;  4PDK A;  3GF7 A;  1SEU A;  3OBB A;  2MYS A;  5BPI A;  4B3I A;  1CI6 B;  3K2Z A;  4KIB A;  1RES A;  3ASO H;  3PNT A;  1K6Y A;  2NVY J;  3A0H E;  2QKM B;  4ENJ A;  1HJB A;  4HF1 A;  1MBJ A;  2IBZ D;  2Z99 A;  3ZXS A;  3F23 A;  5E3O A;  2XIG A;  4PJJ A;  1GTW A;  2KFD A;  3FK6 A;  2XC7 A;  2OYI B;  2WA0 A;  3FKJ A;  4LG0 A;  4D0P A;  2WIT A;  1LDD A;  2O6G E;  2Q3I A;  4R79 A;  2GLO A;  4NPE A;  3M0A A;  3O3K A;  3K70 C;  3VYU B;  1W5T A;  4J19 A;  1I1S A;  4B09 A;  1DLI A;  1MUU A;  1ZRE A;  4QTR A;  3JSV C;  1UHS A;  2HQR A;  2Y30 A;  4DW6 A;  3L09 A;  2DU9 A;  1L0O C;  3LMM A;  4CIC A;  3CCQ I;  5D6E A;  2WSC H;  2WSC J;  3ISP A;  2NNY A;  1FTT A;  1ZRT D;  2QF7 A;  2BEO A;  2Z33 A;  4N78 D;  4G7Z F;  3KZZ A;  2QZ8 A;  5KNL A;  3I59 B;  3WU1 B;  5EDN A;  4L18 B;  1BOA A;  3F8M A;  1LSO A;  1X0V A;  2KNC A;  1O3T A;  4BRY B;  4QSH A;  4UV8 A;  1M67 A;  2ZYA A;  4IL6 C;  3WHB A;  1W36 D;  1T0F A;  1JTH B;  2GUS A;  3KPE A;  5L3B A;  1EVY A;  3AE7 C;  2R7D A;  3K10 A;  1SQB K;  4D6T J;  4XON A;  4H0L B;  5EJC A;  1D0Y A;  5K1Y A;  1USE A;  2K9J A;  2P7V B;  3AE8 C;  2BE5 F;  1T8Z A;  2HOD A;  3CMA P;  4DBQ A;  3JCU C;  1ZOY C;  4HNU A;  3GFM A;  4HKZ H;  1IO4 A;  5A9S A;  1FY7 A;  3DXJ F;  5F0C A;  1NU1 J;  4BXF A;  4D6T E;  5HDG A;  5HWS A;  4L74 A;  1U5T B;  2ZBK A;  3F72 A;  5E1W A;  1D1A A;  3A02 A;  2ZXI A;  3DKX A;  2F4I A;  3F22 A;  1K05 A;  3HC7 A;  1MMD A;  1CF7 A;  1NU1 E;  3BG7 A;  5F0F A;  2PMZ A;  2NRA C;  4IQJ A;  1M75 A;  5K5Q A;  4F92 B;  2EK5 A;  1MSE C;  1LP1 B;  1SQV K;  4B47 A;  4CCO A;  3OA7 A;  1O4X A;  2V4J C;  1YJN I;  1FIP A;  2VT2 A;  1MFT A;  1OZH A;  2OU2 A;  3OYD A;  3BCC J;  4ASN A;  4WY4 C;  4EEF G;  5CJ0 A;  2MKV A;  3CCS I;  1FZG A;  3DBH B;  5H6R A;  3RPU D;  3Q3S A;  2GOX B;  3DLL F;  1REP C;  5FRM A;  2BYV E;  1Z82 A;  5IT9 Z;  2OYO A;  1U2W A;  2KZV A;  3Q9S A;  3SYT A;  1VQL I;  2HOD B;  3BCC E;  3SHF A;  4C7R A;  2R7T A;  2BCC G;  3DP7 A;  4BS9 A;  1CGP A;  1WI9 A;  2NYX A;  3J7A O;  4CHU A;  1X22 A;  1X1P A;  2FKW B;  2YKO A;  3C2H A;  2QA4 I;  1W0T A;  2A6H F;  2EA2 A;  2JMW A;  3KLO A;  5DD4 A;  4ZDP A;  4UB8 H;  2A06 D;  2OPT A;  1DQU A;  5HS8 A;  1O57 A;  4XRS G;  2CS3 A;  2DA1 A;  3BJO A;  3HM5 A;  2Q0O A;  2OD5 A;  4H0E A;  3CJR B;  2D45 A;  3AE1 C;  2KSJ A;  2CW0 F;  2K37 A;  3WU0 A;  2FNA A;  4GKG A;  4UB8 E;  2I8D A;  2VBZ A;  3FXJ A;  5IOY A;  2PBI A;  4RB2 C;  3TL4 X;  5L3G A;  3W67 A;  2JR8 A;  2V6C A;  5EEG A;  4C3H J;  1VQM P;  4HA8 A;  4R8H A;  2WPV B;  5J4Y A;  2NRG A;  3OIP A;  3KP3 A;  3HE4 B;  2QVO A;  1YIJ I;  4A93 J;  5GAD J;  2IA0 A;  3OSF A;  2FJ1 A;  2FFD A;  2BVM A;  1ZKG A;  1KIL C;  3C7C B;  3FDY A;  3KP2 A;  5D6F A;  1S9K D;  3VTP C;  1VQ9 P;  2CUE A;  4KMF A;  1FPQ A;  1WJF A;  4BHB A;  1W2E A;  1KMI Z;  3S16 J;  2DT6 A;  1M7L A;  4B8X A;  1FOS E;  1OVU A;  2PP6 A;  4HYT B;  3H1I E;  3NWS A;  3S1M J;  2LRE A;  4HAM A;  4A12 A;  1EXJ A;  3L6D A;  3CX5 I;  4BQQ A;  2R5Z A;  3L74 G;  2FYN B;  1JOC A;  1E2X A;  3OYN A;  4M74 A;  1L0L G;  4O3M A;  1YVE I;  1SQP J;  5TIS H;  2HFH A;  1WQ2 A;  5CLS A;  1YJ9 I;  4EIJ A;  1FC3 A;  3AEA C;  2K3F A;  3CX5 D;  4U3F J;  5D5V B;  3V4Q A;  3NXS A;  4I7Z B;  1B72 B;  1FMV A;  4IOI H;  1SQP E;  1IL0 A;  2HGC A;  3H9J A;  3I9V 2;  1BGY J;  1H8A C;  3TDZ C;  1SFX A;  2EPF A;  4DBR A;  1BCC E;  3MCZ A;  5KLI B;  1LWU C;  3F8N A;  4W7Z A;  4EAT A;  1H0T B;  1RNL A;  4X6A J;  1QMG A;  2W85 A;  1LTT C;  2O03 A;  1YJW P;  2M5A A;  1XSX A;  4ESB A;  2I1K A;  3CWB G;  4FIS A;  3CCM I;  1EDJ A;  5E8G A;  1MJB A;  4A7P A;  3ZQF A;  4ITV A;  3CC4 I;  1BR2 A;  1ZAO A;  1VF5 D;  2B87 B;  5M5Y J;  2XV5 A;  2VKD A;  2WZ7 A;  1JKR C;  1XGM A;  2DA2 A;  1WMK A;  1WRG A;  4N3Y B;  4DLL A;  5KLV G;  2ISY A;  1BW5 A;  4YFX F;  5CCH C;  1IG7 A;  1I36 A;  1EV7 A;  2FRH A;  3PQJ A;  4LOC A;  4CCL A;  4CYD A;  2VOP A;  1NHL A;  2P6S A;  5CVU A;  1VPD A;  1X2N A;  5D4S A;  2IRF G;  2BEQ D;  3VYR B;  3AEB C;  2M87 A;  5E20 A;  2MSY A;  5IP7 J;  5E3N A;  5FKM A;  3MFK A;  4CYC B;  3GZN B;  2LBF B;  2GIZ A;  3PEF A;  5H2F C;  3K70 D;  4R4M A;  2VE8 A;  3HGG A;  3BPX A;  2P4Q A;  2VXD A;  1YYC A;  3BRT B;  3R2P A;  3HDH A;  4HST A;  3GLM A;  4PSW A;  2F48 A;  3HTU A;  3J81 Z;  1S5L H;  1RY3 A;  5BOX A;  2GQQ A;  2KI7 B;  1Z91 A;  5CBO A;  3G71 P;  3I83 A;  1E5W A;  3OL4 A;  3H3Z A;  2L7Z A;  1VQ5 P;  1FZB A;  3IWF A;  3GEZ A;  1Z3Y A;  3F6V A;  4RGU A;  4ZYH A;  1MBF A;  3PJG A;  4BHC A;  2F4O B;  2HNH A;  2GWR A;  3CLO A;  1NGM B;  2MGQ A;  3COA C;  1QGK B;  1ACI A;  4W80 A;  3MP7 B;  3RL0 B;  3TGU G;  4BUP A;  2DW4 A;  3P8C D;  1BBY A;  5A2Q K;  1OMI A;  5EEA A;  3D5S C;  2FYU D;  2KYV A;  1HDD C;  4G7H F;  4P55 A;  1WP4 A;  3CJN A;  4YCA A;  1CSB A;  3RZO J;  1R5S A;  3I71 A;  3RK3 B;  1WRJ A;  3ZR8 X;  3CDH A;  3WTT C;  2V1U A;  4Y17 A;  5CVJ A;  5HLG A;  4E7Z A;  5C4J J;  3OWT A;  2Z5H A;  2XND H;  2ELK A;  1IFI A;  2EWN A;  2HS5 A;  3KPH A;  5IP9 J;  2FOK A;  2K4J A;  1RE4 A;  2BBY A;  3MQ0 A;  3R0J A;  2LH9 A;  2FEZ A;  4GRI A;  4N6J A;  4RB3 C;  1S29 A;  2AQE A;  1SMT A;  5HNF A;  4OGQ D;  2WAF A;  2QVA A;  4XLC A;  1UHM A;  2BGC A;  3HOS A;  3CC7 I;  2XAJ A;  2W6A A;  3L70 G;  2XB0 X;  1ZAR A;  4M6V A;  2F5F A;  3Q5R A;  3CCQ P;  4FE7 A;  4UY8 I;  2E1M B;  1BI0 A;  3GO5 A;  1DLJ A;  3A7O A;  1R36 A;  2ZT9 D;  4CZC A;  5AW7 B;  3T97 B;  3BTC A;  1M2W A;  3LQQ A;  4A3L J;  2HKO A;  3TDK A;  2GF2 A;  3JRF A;  1V4R A;  2QSG X;  4DOJ A;  3AAF A;  3ZMD A;  3HUS C;  1I27 A;  1HST A;  2Z2S B;  3LW5 J;  3P8M C;  3LW5 H;  1X58 A;  3P9I A;  2WSE H;  4A3E J;  2UXN A;  4E7K A;  2KS1 A;  4FHT A;  2ETH A;  3C1L A;  3VN0 A;  3I56 I;  4I0A A;  3V8K A;  1AQT A;  4HX8 A;  1K4S A;  4XE5 B;  2IS2 A;  2OQR A;  4RA2 A;  3ZN1 A;  2JN6 A;  2VE9 A;  3RBX A;  1A6I A;  3FHN A;  3L36 A;  3DPL C;  3A01 B;  2PGD A;  4YFN F;  2X0L A;  1O3Q A;  3EFF K;  5ERI A;  3H2Z A;  3JTG A;  1KU9 A;  1HKS A;  3PM1 A;  1FP1 D;  4YG2 F;  4PK4 A;  1LDJ A;  1EZV G;  2L02 A;  2Q2E B;  1EA3 A;  1KON A;  1Z7L A;  1SFO J;  4IRG A;  2P8T A;  1W7P B;  1GW3 A;  3UIA A;  4P1W A;  3D0S A;  1K04 A;  1B9N A;  2XAG A;  2ISZ A;  1JCC A;  4D5C A;  5EG0 A;  3C2B A;  2DAO A;  1BR4 A;  4G7O F;  3N4M A;  1X1A A;  4IQ4 A;  3ZP5 A;  3HE5 A;  3U1A A;  1L0N E;  1B1B A;  2L7M P;  1YJN P;  4M3E A;  3G1O A;  3GBG A;  1PPJ G;  1IDY A;  2F4M B;  5EZH A;  1R00 A;  3TO6 A;  2BVL A;  1H0M A;  3CCS P;  2JEE A;  1SAU A;  3KE2 A;  4O5V A;  2JDI H;  3T5X A;  1GHC A;  1XTA A;  4NNJ A;  3TNU B;  4BKX A;  1VQL P;  1BSN A;  3WOD F;  3H1J E;  4WWI A;  1U57 A;  4YXW H;  3RK2 B;  1XTG B;  5JI6 A;  1JY2 P;  4PSX A;  3L75 E;  5IT9 K;  3HBL A;  3H1H J;  2PLY A;  1QX8 A;  2QA4 P;  2LR8 A;  1DEB A;  5DCM A;  4N4N B;  3CUQ C;  5HLI A;  4JYK A;  3TGN A;  4XRF A;  1GV5 A;  4AYB A;  2NPS B;  4I02 A;  5ICE A;  2YXR B;  3M1E A;  3LST A;  4EJT A;  4MEY F;  3H1H E;  2WTE A;  4LIT A;  1FOY A;  4RB0 A;  3OS0 A;  1DPU A;  2ZAE B;  2XRO A;  2N9Y B;  2HDH A;  4LMY A;  1ETO A;  5D5U B;  3GX4 X;  2XU6 A;  3PIO F;  1ZN5 A;  2R5Y A;  2OTK E;  4JYB A;  4IHW A;  1TXG A;  1BE3 G;  2XNX A;  1XN7 A;  1TZL A;  2WV1 A;  2EW2 A;  4WY4 A;  1YIJ P;  1Z9C A;  2DPD A;  3OYM A;  2ZYG A;  5IY5 H;  4OOI A;  4UNO A;  2L5Q A;  1N78 A;  4LGD E;  1YTZ I;  2OBP A;  3JRE A;  1M76 A;  1MIJ A;  3IUO A;  1WJB A;  1EF4 A;  3ADO A;  4JP0 A;  1XMA A;  2O3F A;  3P5J A;  4WXH A;  1E17 A;  2Z5I A;  3IR9 A;  2ZVN B;  3A0B E;  2YKP A;  3H32 A;  1FX7 A;  3FM5 A;  2KQR A;  3LQR A;  2IBZ G;  4A0Z A;  5CCH D;  3IKT A;  1F17 A;  3AG4 H;  3WTZ A;  1IF1 A;  5E79 H;  2O61 A;  1VQN I;  3LAJ A;  1PL5 A;  3J7Y J;  4JX6 A;  2PEX A;  1DEE G;  2PAJ A;  5AW3 B;  1NTC A;  4BQN A;  1T3J A;  3EFG A;  1IV8 A;  3TKY A;  1YJ9 P;  1R49 A;  3GFJ A;  1GK6 A;  2IX7 C;  1WPK A;  2KP8 A;  4WVZ A;  5E79 E;  5APW A;  4GIF A;  5L8R J;  4EV0 A;  4EM1 A;  2Y75 A;  4Z6Y A;  5B66 E;  1SAX A;  1ERD A;  2KIK A;  4I7H A;  1W0U A;  2J58 A;  2OYI C;  1OCZ H;  3B5N B;  1OW6 A;  2QKL B;  5EGO B;  1M8O B;  5APY A;  3DU5 A;  1Z3X A;  3ABV C;  4M9X A;  3W2W A;  2XKM A;  1IZ1 A;  1JUS A;  1KIL A;  3R4Y A;  3KX2 A;  2CW8 A;  2DLL A;  3K4C A;  3CCJ I;  1FTZ A;  1SQX D;  4C7N B;  3HKZ N;  3CCM P;  3TMO A;  2XZR A;  1K9M Q;  3I64 A;  2D2C B;  2QJY B;  3PDU A;  2KPM A;  1W4M A;  1R1T A;  2P6T A;  2AEJ A;  3ZOB A;  1LUJ B;  3CXH D;  3CC4 P;  1FWZ A;  5BNG A;  1R4M B;  2LFB A;  4M3L A;  4B43 A;  5LBQ A;  3S14 J;  2BCC D;  5CQG A;  2EIL H;  3EDP A;  2H7H A;  3DFG A;  2BY1 A;  1S8N A;  5GAE J;  1Y1V J;  3EQ2 A;  4PJL A;  2DTR A;  1N1G A;  3K6G A;  3RJP A;  2CGP A;  3H6P A;  1UG2 A;  3DKW A;  4H0L C;  2E74 D;  4IL6 H;  2HXO A;  3MVP A;  3KXD A;  3KZI H;  4KT5 C;  1JGS A;  1LTB C;  5E3L A;  2XPW A;  1S7A A;  4EJU A;  3OSG A;  1FJK A;  1ZP0 C;  2Q5U A;  2V4H A;  3L73 E;  2GAU A;  2WPQ A;  3LA3 A;  3S3O A;  3ELK A;  4JPZ B;  2AHQ A;  1H8A A;  1U5T C;  3M8E A;  1YRL A;  2RNJ A;  2K27 A;  2ZYD A;  1LWU A;  3JCU H;  3KZI E;  3EYY A;  1GW4 A;  2NVU B;  1NTZ J;  2P7J A;  3BJ6 A;  1A6Q A;  2X4H A;  2O5R A;  3A1Y A;  1N7S B;  3SZT A;  2VRS A;  1ZTR A;  1UST A;  1NTM K;  3K4M A;  3CC2 I;  1P7I A;  4WF2 A;  4WK8 F;  1LVK A;  3AL0 B;  3J81 K;  2DFF A;  3CD6 I;  1JY2 N;  1FOS F;  3KET A;  4BDZ A;  1NTZ E;  1ZV8 A;  2C0X A;  2L91 A;  2EJR A;  3A2A A;  3M0D C;  3CME I;  4ZNC A;  4NBQ A;  3UR3 C;  2QGU A;  2ID6 A;  3MD2 A;  1MKM A;  1Y8A A;  5AW9 B;  1I50 J;  2VJI A;  2LF7 A;  2A06 G;  5CCH A;  2ZME B;  1AKH B;  3HRU A;  2BW3 B;  5APX A;  1YG2 A;  1R1V A;  3L74 D;  2COM A;  2IZ0 A;  1YYV A;  3DU6 A;  4E12 A;  2Q8K A;  3DLA A;  4LB6 B;  3I3L A;  4D7N A;  2P2U A;  1GXQ A;  3OYH A;  4A2U A;  3O8Z A;  5APS A;  2K4B A;  3B8E B;  4DYQ A;  2FU4 A;  2QCO A;  3CJQ B;  4TT3 H;  3SSU A;  1FZC B;  1PVE A;  1X1B A;  4CH7 A;  1WDM A;  4OAZ A;  2EFW A;  1SQB D;  3CC7 P;  1RUO A;  1JNM A;  1WH5 A;  4KIG A;  1MDM A;  2HU9 A;  4UB6 C;  1TBX A;  1VF9 A;  3D5R C;  1GT0 C;  3L1P A;  4EGY A;  1LE8 A;  1YIT I;  3H5A A;  1QU3 A;  4N9I A;  1GL2 B;  3RDI A;  3L35 A;  5GTH C;  4MLO A;  2PRR A;  1DGR M;  3TBI A;  1X2M A;  1NO4 A;  2MJZ A;  1HKT A;  2EZL A;  3DOJ A;  3E97 A;  4H4K C;  4RAG A;  2XDV A;  2LR2 A;  5CCG C;  4YFK F;  2YKQ A;  2BAS A;  3BWG A;  2LF8 A;  3K7A J;  2XHK A;  4N4O B;  5JFR A;  1AV1 A;  4YTP C;  3TQN A;  1SQV D;  3I56 P;  3G9R A;  2FXA A;  1FMW A;  2OCE A;  3KFW X;  1UZC A;  4HRI A;  4UUV A;  3GUD A;  2OQG A;  5FD5 A;  1L2P A;  3PUB A;  4U0V A;  3FMR A;  1Q90 D;  2FYN C;  4EOT A;  1LTI C;  4PFO A;  1LT9 B;  3HWR A;  2KUB A;  1Y8Q B;  2KRH A;  4V2G A;  2HI3 A;  3KEY A;  3B6A A;  3T1B A;  4RMN A;  1LDK B;  3C1D A;  1LFU P;  2Y48 A;  2CQX A;  4I7Z C;  1KYO I;  4UHT A;  2Q9I A;  2IAI A;  4HX7 A;  3U1D A;  3AE5 C;  4BYY A;  4OMY A;  1RKT A;  2HPM A;  2BEZ F;  1STZ A;  2NOG A;  1YLF A;  5KLI C;  1KYO D;  1A02 J;  5HS7 A;  4JYC A;  3BR1 A;  1KU7 A;  1MSF C;  2ELH A;  3L71 D;  4MHG A;  1KB9 I;  4ZYG A;  3HUS A;  3TGU D;  5IYD J;  1KYW A;  4I01 A;  3ZW8 A;  5EEH A;  5ICC A;  3QWO C;  1HQC A;  1P7J A;  1R4N B;  2LY2 A;  3DTI A;  4IHX A;  2A5W A;  3KYC B;  4H13 D;  2KDO A;  3R6S A;  2Z9O A;  1MJ9 A;  4ON0 A;  1NYH A;  3A2K A;  4XQF A;  4YRV A;  4AM3 A;  2IYP A;  1XTC C;  4FQG A;  5J47 A;  1IK9 A;  4NUB A;  2E1C A;  3E6D A;  5E1X A;  3PO2 J;  1UIX A;  3GLL A;  1U6G A;  2WAD A;  1JDJ A;  2OZU A;  3MN2 A;  2DW3 A;  4IX7 A;  2E76 C;  3BR0 A;  4NB5 A;  3SDB A;  2MD5 A;  3MKY B;  1SFE A;  1A31 A;  2LXC B;  2QQB A;  4W7Y A;  4F55 A;  2ZXJ A;  2XB5 A;  1IFN A;  3F6O A;  4NQW A;  4GYG A;  2IA1 A;  5DUK A;  5JLW A;  1YX3 A;  1JM0 A;  3FX3 A;  4M71 A;  5E18 F;  1IK7 A;  2VKE A;  3N4X A;  4Y99 B;  2M8R A;  3MOG A;  1FYL A;  2DMP A;  3IH2 A;  4Q5S F;  2EIJ H;  3KIO A;  1R71 A;  4Y15 A;  3W2A A;  2E5Z A;  1RE3 C;  4XKV A;  5H2F H;  2L9N A;  1WHU A;  2V9V A;  4HYE A;  4AYB N;  3DKY A;  2P67 A;  3FMS A;  2CH0 A;  3AFH A;  5GAH J;  3IH3 A;  2I76 A;  2V9K A;  3Q3C A;  1SQQ K;  2FYU G;  2NS0 A;  4G6D A;  1TTY A;  3D71 A;  3CES A;  1IC8 A;  3EYI A;  2TDX A;  5HVQ C;  1QNT A;  1YBK A;  3RL0 C;  1HVV A;  2JSC A;  3LSM A;  2JJ7 A;  3A4C A;  5K7F A;  2OUM A;  1Y6I A;  2F6C A;  3BG3 A;  3CUQ A;  1H9G A;  4E70 A;  1LNQ A;  3H1K E;  2M3A A;  3VP8 A;  1VQN P;  3GCM A;  1PP9 G;  3ROU A;  1XPX A;  3EGO A;  1EZV I;  2D1H A;  4IVN A;  2KOG A;  2P4W A;  5TRD A;  3AG2 H;  4C3J J;  3CXH H;  3RK3 C;  3GZ5 A;  4L9V A;  3JSP A;  1USS A;  2BCC J;  4NC6 A;  1S3J A;  1EZV D;  3HOT A;  2KLV A;  3S4R A;  2BXY A;  2NOJ B;  2KIS A;  4IPA A;  2GXG A;  2DFH A;  1XDU A;  3CXH E;  4L9T A;  2E2I J;  1MBE A;  1RQU A;  2JTV A;  2BCC E;  1FYM A;  3QSG A;  3FMQ A;  1PDN C;  3I4M J;  1PPJ D;  3VMX A;  2V1N A;  1NTK K;  3NMD A;  4IM7 A;  2L7F P;  2LNB A;  3CCJ P;  1JY3 O;  1LEB A;  2M3B A;  2E1M C;  3AG3 H;  1IXC A;  3GWZ A;  3AG1 H;  5APT A;  4OVN F;  2DOD A;  3OYE A;  1BC7 C;  2W90 A;  4RLF A;  2ZJQ F;  3P7K A;  2LSO A;  4N0B A;  1MMA A;  3D1N I;  3CCR I;  2X51 A;  3V42 A;  1CI6 A;  3ZWC A;  2EH3 A;  2XKP A;  3E1R A;  4L0Y B;  4PJM A;  3BZK A;  1OLT A;  1N1E A;  3DBL B;  2XDJ A;  4EJO A;  1ZGJ A;  2VN2 A;  1ZG1 A;  3F3S A;  2A61 A;  1DU6 A;  1NVO A;  1ONV A;  4WCG A;  3HYI A;  2H89 C;  3TP3 A;  2OYI A;  3VYI A;  1ZH5 A;  1XGS A;  4PD4 E;  3EUH C;  3SWY A;  3E0J B;  2NZ2 A;  3LIE A;  2RQP A;  2OTJ I;  3EWK A;  4HLX A;  2EB7 A;  3L74 J;  1ZCJ A;  1P84 D;  4RJT A;  1LT1 A;  1VQ4 I;  3E6M A;  3VSK A;  2EIN H;  4B4C A;  1L0L J;  3I5U A;  4KIC A;  5FLV A;  1LEA A;  3CCV I;  2FYZ A;  3RCO A;  1IFD A;  4BE1 A;  2H8W A;  3CC2 P;  4YPC A;  1YTZ T;  4D1Q A;  1URQ B;  2LG4 A;  1QHG A;  2VI6 A;  2ZNY A;  4LFU A;  5EYR A;  1L0L E;  3I59 A;  2R7S A;  3PJS K;  4BWN A;  1QZZ A;  1UJ8 A;  2GA2 A;  4BRY A;  3CME P;  3F8F A;  3IAM 2;  5AON A;  5CCG D;  1UII A;  4KT6 A;  1PV3 A;  1EH7 A;  4CO8 A;  1JTH A;  1V5E A;  4PJ0 C;  5E3M A;  4DT0 A;  3CWB J;  3RYP A;  3HJE A;  4B3J A;  2KXP B;  2C9L Y;  2KIU A;  4D3F A;  1RQV A;  1BI2 A;  3RK2 C;  4NHJ A;  5CVV A;  1NKZ B;  4YEL A;  2AQF A;  1CZQ A;  3JRC A;  2V26 A;  3CWB E;  1CW5 A;  2NPS C;  3I4P A;  5KLV J;  1U5T A;  1ETV A;  5GPC A;  5TGT A;  1V5F A;  2OQQ A;  5FKL A;  5FKK A;  2L3D A;  2DJI A;  4R4L A;  5AW0 B;  4UUS B;  1YRN B;  2C6Y A;  3FXK A;  4KUM A;  5M5X J;  4UUT A;  1RF1 B;  3S32 A;  5H6Q A;  4XLP F;  5KLV E;  2W8Z A;  2RQQ A;  4IRI A;  2W4S A;  1KQ0 A;  2DTZ A;  2WB1 A;  3BCB A;  4F7Z A;  2HEO A;  1LP1 A;  2GIV A;  5APV A;  3CDL A;  5LEJ A;  1D8K A;  2FE3 A;  2VXZ A;  1YIT P;  1H9T A;  1JO5 A;  2IS4 A;  2K1A A;  2CSO A;  2XAH A;  3HB9 A;  3M0D A;  3SQN A;  3I55 I;  1TQM A;  4JX4 A;  3E1I A;  3ZWA A;  4ZDO A;  3JC2 2;  2KSE A;  3N7N A;  3LFU A;  2X6Y A;  3WE3 A;  4B44 A;  2GXA A;  4BU2 A;  1EVZ A;  3FIW A;  3LA2 A;  3WUV A;  3ERM A;  3M8F A;  3OYA A;  2CFO A;  2A45 I;  4W97 A;  3CL3 D;  1MW7 A;  2CUF A;  2XSD C;  2AXT C;  3VMZ A;  1KYO H;  3K4B A;  4UVB A;  2E76 D;  2P58 A;  2WPS A;  1MV8 A;  3AE9 C;  3OW2 O;  2CFX A;  1BJZ A;  3TGU J;  1LJ8 A;  3U59 A;  3Q2Y A;  5GTI C;  3V8J A;  3OOU A;  5B5E C;  4HDV A;  2OFP A;  1HC8 A;  3C7A A;  1JHH A;  2ELJ A;  2ZJS E;  1QZY A;  3GW2 A;  5IYC J;  3LL7 A;  3S2H J;  1W5C E;  1OVV A;  4LLL A;  3TGU E;  2HDW A;  2PLA A;  2W6J H;  1VTN C;  3M9A A;  4AUW A;  3FXQ A;  1IW7 F;  2N8G A;  2HDC A;  4IHV A;  1SQX G;  2O01 J;  3BG6 A;  2MH2 A;  4EVI A;  2O01 H;  1BR1 A;  3B5N C;  2A69 F;  3HE4 A;  3S2D J;  1OW8 A;  2N1T B;  2EA4 A;  2XUB A;  1TWH J;  1VDF A;  3W6V A;  4HF0 A;  2R92 J;  3S1Q J;  5AVT B;  1GVJ A;  2DA3 A;  3IAO A;  5FLM J;  4RB1 A;  2HZT A;  1FU1 A;  2XF5 A;  3GTM J;  1EQ7 A;  4U0Y A;  2XF7 A;  3A3Y B;  4BJT A;  3OAK A;  3M9B A;  2Q7C A;  2ZKZ A;  3RL0 D;  2D2C C;  2QJY C;  3OMY A;  5DS9 A;  5CCG A;  3PHL A;  3K2A A;  4EYY Q;  3LOC A;  3L70 J;  3FK7 A;  1ON2 A;  5DDG A;  4XKW A;  3G3Z A;  4D9J A;  4ZZL A;  1PIX A;  1IN7 A;  3QPL A;  2KIM A;  4CCN A;  3PLN A;  1IO2 A;  2Y0C A;  3C7J A;  1M57 D;  3L70 E;  9ANT A;  3G1L A;  1D7M A;  1MJA A;  1JY3 P;  3L72 G;  3GVA A;  3MZW B;  2XF6 A;  2KT0 A;  3V7C A;  3F89 A;  2ZVO B;  1ZGA A;  2VIX A;  4A3J J;  1ZK8 A;  2V7F A;  2M4G A;  1B72 A;  2ADU A;  5AVX B;  4HEA 2;  1NKN A;  2WT7 B;  4MGR A;  1XSV A;  1ZQ3 P;  5MGB A;  3HTK B;  2ZXE B;  2H94 A;  3BAT A;  1M1J B;  2Y0D A;  1E3H A;  2DDB A;  1QRY A;  3CCU I;  5KAF C;  2LD5 A;  1RRJ A;  1IFP A;  1NU1 K;  5CJ4 A;  2V6E A;  1N86 A;  1DP7 P;  1GK4 A;  2YMK A;  1G59 A;  4I6M C;  4IFD K;  1H0T A;  2GXB A;  5L3C A;  2FNP A;  3UKG A;  1K83 J;  5LGT A;  1GXP A;  1N7S C;  1WKM A;  3VOD A;  3WGG A;  4Y52 J;  3BT9 A;  3EPZ A;  3AL0 C;  1BW6 A;  4J01 A;  2GOM A;  1F14 A;  2MAB A;  3ZMU A;  2B87 A;  2MC4 A;  4FT8 A;  1O3R A;  1HBW A;  4IKF A;  2H8R A;  4LG3 A;  3AED C;  5DJT B;  3V2Q A;  1FBS A;  2WMM A;  1ZHF A;  1J1E B;  3KDP B;  5B1B H;  3CUO A;  5TJH A;  4CA0 A;  1VL2 A;  2E75 B;  2W48 A;  4K35 A;  2KK7 A;  2ZME C;  2FBW C;  1FOW A;  2OYH B;  2O0Y A;  1RF0 A;  5FO5 A;  2LK2 A;  1TC3 C;  5TIS E;  3W68 A;  3OYF A;  2XAQ A;  4Q48 A;  1JXS A;  4FAS D;  1OVR A;  1PPJ E;  4NPF X;  3RSN A;  2IPQ X;  4CYC A;  2LBF A;  3H1L D;  4U3F E;  3FR8 A;  4TLF A;  5ED4 A;  1YIO A;  2A07 F;  2YO2 A;  1SQB G;  4BE2 A;  5B3S H;  5KAI H;  1BJA A;  1IC2 A;  2IGM A;  2Y69 H;  3QYB A;  5JHU A;  3L2C A;  2VPL A;  1HOM A;  2JJL A;  3Q9V A;  4ENN A;  1BGY E;  3V2N A;  3G0O A;  1RE3 A;  2EFQ A;  1ZW0 A;  1FZC C;  1T98 A;  5FKN A;  1M66 A;  1Q1H A;  2RKH A;  3OL3 A;  3HN2 A;  5KAI E;  3L9F A;  2E43 A;  2A6T A;  2HVQ A;  1OQY A;  1BI3 A;  1VZ0 A;  4WWC A;  3VFZ A;  3ZQQ A;  2DMN A;  1NK3 P;  4ZYE A;  2CV1 A;  1GL2 C;  4S04 A;  3VMY A;  1P84 H;  1MZ9 A;  2V1D A;  4BDY A;  3SXY A;  1BE3 J;  2WTY A;  1SQV G;  4Z2Y A;  3HOU J;  4HDU A;  2R44 A;  2WV0 A;  3CCR P;  1IRF A;  5F27 A;  1SD6 A;  2RV8 A;  4HNV A;  3K1N A;  2OA4 A;  3J7Z I;  2HQA A;  1P84 E;  5GTH H;  1S4X A;  1M1K Q;  2E42 A;  5AW5 B;  1FEX A;  1BE3 E;  2ESN A;  1NTM D;  5AVQ B;  3S3N A;  1YE9 A;  1KS9 A;  3BPV A;  4DJA A;  1J59 A;  1T6A A;  4Y4R A;  5A9R A;  5M1B A;  5LRR A;  3ULQ B;  2IGO A;  3I58 A;  2K3R A;  3RZD J;  1B8I A;  5FB2 A;  1PGP A;  2LXB A;  2NVT J;  4FX4 A;  5KJ7 C;  2I10 A;  4E7I A;  3ZW9 A;  5CJ9 A;  3FWN A;  2OTJ P;  2M7B A;  1W1W E;  1A36 A;  2DMQ A;  1SP4 A;  1SQP K;  1AJY A;  1IN4 A;  2VQG A;  1DUX C;  1VQ4 P;  1S7E A;  4LLH A;  2M8E A;  5FRO A;  1IXR C;  2LKS A;  2L0K A;  2E19 A;  1S5L E;  2IBZ E;  4OL9 A;  3CCV P;  2K85 A;  2X6X A;  3L71 G;  4NC7 A;  1D3Y A;  2O01 N;  3O2P E;  2DQL A;  4FGW A;  3GTQ J;  1B6A A;  3BQZ A;  3T97 A;  2CPS A;  5DD8 A;  1CQT A;  3I53 A;  2LDU A;  4DZO A;  3S1N J;  4EQQ A;  4BBS J;  3FHZ A;  2LY9 A;  3LAP A;  4RDU A;  2JA7 J;  5FD6 A;  4RKU J;  2HDD A;  4B48 A;  1ZR2 A;  3F0C A;  4OWF A;  3BC8 A;  3ZQG A;  2O9L A;  5LHI A;  3JAM Z;  1H89 C;  1B8I B;  2L9R A;  4HV5 A;  1TLH B;  1KOR A;  2M0C A;  4PJN A;  1ZRT E;  2AXC A;  2JO1 A;  2JWA A;  3K5B A;  2B88 A;  4N78 E;  3AEG C;  2DDA A;  3FXU A;  4XOP A;  4IFF A;  4J0F A;  3OY9 A;  3JRI A;  2M30 A;  2M7A A;  3EUH A;  1P2F A;  2FX0 A;  4ESF A;  1FIA A;  3A01 A;  2QYO A;  1U8R A;  3W6Z A;  3IFM A;  3BY6 A;  2QEX I;  2DQR A;  3CLQ A;  3PLR A;  3MHV A;  3D6Y A;  3H5N A;  4WY4 D;  2Q2E A;  2YX4 A;  4K2E A;  1BSH A;  3NFQ A;  1NAF A;  2VJ4 A;  1W7P A;  3FXR A;  1VQK I;  3B5N D;  1U9O A;  3VP9 A;  2XGE A;  1J1D B;  4Y99 C;  3MAJ A;  3IWZ A;  5AW4 B;  1FJL A;  3GLX A;  4M3D A;  5D4R A;  4BBR J;  4KIF A;  1V55 H;  3I55 P;  2D2C D;  2WSE J;  1VQP I;  5BU8 B;  1E3O C;  1QL1 A;  2CV2 A;  4HJG H;  1FZP B;  3TNU A;  1DU0 A;  2YR2 A;  3BG9 A;  2WSS H;  3OS2 A;  3AEE C;  1WH7 A;  3H0G J;  4L75 A;  1E3P A;  1R5G A;  2CUJ A;  5KVR A;  3CI9 A;  3HOW J;  3RPQ A;  5JVG F;  3ABT A;  1FJP A;  4G9Y A;  1ZXG A;  3ML6 A;  3QP5 A;  4EM2 A;  1IN8 A;  1IXS B;  3WTS C;  1D5Y A;  5CMZ A;  2NPS A;  4BEH B;  1HSJ A;  1K78 B;  3LWF A;  5EF6 A;  1ENH A;  4HX4 A;  1DPR A;  1DD4 A;  1L4A B;  2VQL A;  2SPZ A;  3TOB A;  2D2W A;  3MZY A;  1KIL D;  1JUM A;  5J1R A;  3HOY J;  1AVY A;  2I1J A;  3HD7 B;  1R5H A;  4KUE A;  2CMP A;  1VI0 A;  2L54 A;  3D5L A;  4OU0 A;  2A06 E;  3H1I G;  4II2 A;  1QPM A;  1N7S D;  4I1L A;  3NQO A;  1LGH B;  2R32 A;  2ZXH A;  3MKZ A;  2AS5 F;  4M72 A;  2VBW A;  1Y0U A;  4JBZ A;  2BY2 A;  2H1L A;  3A0H C;  4IOC F;  1X8Y A;  2H6C A;  4Y3O A;  2QJP B;  3GHG B;  3TYY A;  2PMU A;  1WI3 A;  3NAU A;  3V2P A;  1BOB A;  1H88 A;  2HYG D;  2PMZ N;  3KYL A;  2Q1K A;  3ZWB A;  4LLG F;  2J59 M;  2CU7 A;  3CTA A;  3EET A;  3OIO A;  3T8R A;  5K5R A;  4HPQ A;  3IRQ A;  2XV4 S;  3RI4 A;  4G6Q A;  4OM8 A;  4I2L C;  3Q5F A;  1NH4 A;  1L3L A;  2K9M A;  4I09 A;  2Z4E A;  2EFP A;  4X0G A;  4UVA A;  3RYR A;  1BCC G;  3ZQH A;  2P0W A;  3WU2 H;  2K88 A;  3RKY A;  3JR9 A;  1B9M A;  4ZJZ A;  3TF5 A;  3EQL F;  1BA5 A;  5M3F J;  1S9K E;  2H88 C;  2DA6 A;  2MH9 A;  2WSF J;  2WSF H;  1SQQ D;  2K40 A;  1IV6 A;  2Z3Y A;  2R5B A;  3WU2 E;  1QVU A;  3H5R A;  5GAG J;  1U3E M;  3QYE A;  3V4W A;  3B4S A;  5D5W B;  3B5N A;  3C8V A;  2V7Q H;  3CX5 H;  3CCU P;  5EGO A;  1ZRF A;  1SFC B;  1P4W A;  2EQR A;  3S2W A;  1RI7 A;  1HBX G;  1L0N K;  3BRV B;  1WDL A;  1YB4 A;  2UZK A;  2R93 J;  1HXD A;  4L9J A;  3CX5 E;  5FGM A;  2D5V A;  3TSI A;  1YQ3 C;  2HG5 D;  5FJ8 J;  4C7N A;  2ZJR F;  1GL2 D;  1URQ C;  4KT0 J;  2CQN A;  2XGX A;  3E5X A;  2EV0 A;  4CZZ A;  1NWQ A;  3ABL H;  3P9K A;  3SEZ A;  1Z67 A;  2XVC A;  5ICG A;  5M5W J;  5IT3 A;  4IFM A;  3BR3 A;  2L4M A;  5J8C A;  2H1K A;  4IF4 A;  1NG6 A;  1LTS C;  2D1V A;  4YXD C;  2JWT A;  2RMZ A;  4L5I A;  2YU9 J;  3CMM A;  1NTK D;  2Z5U A;  2JRT A;  4F91 B;  4MQ9 F;  3QU3 A;  4BJ5 C;  2K9N A;  4WXC A;  4KN7 X;  3A5T A;  1R1U A;  4M73 A;  2M0B A;  2LOO A;  4EJW A;  3O8H A;  2OF7 A;  4AWX B;  1RET A;  3C7D B;  2VKH A;  2DCE A;  2RN7 A;  4C9Y A;  2COB A;  3ZQC A;  1LTG C;  1OCP A;  3TW6 A;  3RKQ A;  1M56 D;  4LIV A;  1T33 A;  4ZC3 A;  4BHP A;  1ORK A;  3ERE D;  1OPC A;  3G6E I;  1N7S A;  4OGQ B;  3ZRG A;  1N2D C;  1Q81 Q;  1RF1 C;  1JUN A;  4P9F A;  2YS9 A;  1ZN2 A; 
#chains in the Genus database with same CATH homology
 5F0C A;  3ULK A;  3MOG A;  1YJQ A;  5HWS A;  4QIW N;  2DMP A;  3IH2 A;  3CKY A;  3A02 A;  4JX5 A;  4AYB N;  3ZGY A;  5F0F A;  2LTP A;  1M75 A;  3IH3 A;  3Q3C A;  4FCY A;  1AKH A;  3JRG A;  1MSE C;  2Y2Z A;  5IYB J;  1O4X A;  1FIP A;  2HQ5 A;  1APL C;  1IC8 A;  4EEF G;  2RAE A;  4KUG A;  1QPI A;  2JJ7 A;  1JUP A;  5K7F A;  3BG3 A;  3Q3S A;  1I3Q J;  3JRH A;  2R0Q C;  3GTG J;  1Z82 A;  4X1E A;  3EGO A;  4C3J J;  4A3C J;  1JKO C;  3DFU A;  1W0T A;  1JTY A;  1MBH A;  2JMW A;  4PZE A;  1XC5 A;  5EZG A;  2OPT A;  3M4O J;  1Z77 A;  3VPR A;  4XRS G;  2DA1 A;  2WB1 N;  3W6U A;  3HAD A;  2E2I J;  1MBE A;  3HM5 A;  4FTH A;  4A3D J;  4GWG A;  3DEW A;  2K9Q A;  2XPV A;  3QSG A;  1AHD P;  3BR6 A;  3BR5 A;  4D7M A;  5IOY A;  3I4M J;  4IM7 A;  2L7F P;  1ETK A;  4C3H J;  3B6C A;  3LSJ A;  1GVD A;  4A93 J;  2LP0 A;  3OSF A;  4OVN F;  2FJ1 A;  2W90 A;  2LVS A;  2NVQ J;  1ZKG A;  3Q0W A;  3BTL A;  3D1N I;  3C7C B;  3ZWC A;  2Y9Z A;  2EH3 A;  2K9S A;  2CUE A;  4PZC A;  2ZB9 A;  2MW8 A;  3S16 J;  1N1E A;  3F3S A;  2LLK A;  1DU6 A;  2VPR A;  3S1M J;  3TP3 A;  3L6D A;  1VND A;  4MIM A;  3LSG A;  2R5Z A;  5C4X J;  2XRL A;  1YVE I;  2NVX J;  1ZCJ A;  2ECC A;  1IRZ A;  4B4C A;  4ABZ A;  4A3F J;  1PUF B;  5FLV A;  4DYR A;  1B72 B;  1F43 A;  1IL0 A;  1XS9 A;  3GHY A;  4D3D A;  1H8A C;  2DA4 A;  2VI6 A;  2QYT A;  5EYR A;  4X6A J;  1QMG A;  4FIS A;  5E3M A;  5EG0 B;  5AYV A;  3ZQF A;  4B3J A;  1BG6 A;  4D3F A;  4AC0 A;  4NDL A;  5M5Y J;  1JKR C;  2DA2 A;  4DLL A;  5IPA A;  1JKQ C;  3JRC A;  1BW5 A;  2DA7 A;  4BXX J;  1IG7 A;  1I36 A;  2EBI A;  1ETV A;  4LOC A;  5GPC A;  3O8G A;  1VPD A;  5FKL A;  5FKK A;  1X2N A;  2E2J J;  1WGX A;  3S15 J;  4UUS B;  2JA5 J;  1U8B A;  5IP7 J;  1YRN B;  2MSY A;  5E3N A;  3PEF A;  5FKM A;  5M5X J;  4UUT A;  4CYC B;  3GTL J;  5K7Z A;  2W8Z A;  3ADP A;  3HGG A;  3RQI A;  2DTZ A;  2P4Q A;  2B63 J;  1BL0 A;  3HDH A;  3CDL A;  3QQA A;  4MFD A;  3HB9 A;  3HGY A;  4JX4 A;  3ZWA A;  1ETQ A;  1EVZ A;  4C3I J;  3PID A;  3FIW A;  1JT6 A;  3I83 A;  1MBK A;  2X6O A;  4D5F A;  5A9S A;  2L7Z A;  3WFJ A;  1F36 A;  5M3M J;  2R5Y B;  4W97 A;  3PJG A;  1MBF A;  2ID3 A;  2MGQ A;  2CUF A;  2ME0 A;  1TWC J;  4MO7 A;  2XSD C;  4D3S A;  1RKW A;  4XK4 A;  3JRB A;  3E7L A;  2YUS A;  3H3V K;  1BJZ A;  5EEA A;  1LJ8 A;  1HDD C;  5JE8 A;  3OOU A;  2OFP A;  1WP4 A;  4YCA A;  3C7A A;  3RZO J;  5IYC J;  1JJ6 C;  3S2H J;  3G17 A;  1PGJ A;  3HOZ J;  4Y7N J;  2Y0S N;  2PLA A;  5C4J J;  2MG4 A;  2N8G A;  1Q1V A;  4IHV A;  2ELK A;  5IP9 J;  3S2D J;  4AUX A;  1TWH J;  3W6V A;  2R92 J;  3S1Q J;  1X0X A;  2DA3 A;  5FLM J;  1MNM C;  3GTM J;  5C3E J;  1WDK A;  1GUU A;  2XB0 X;  4M6V A;  5DS9 A;  4FE7 A;  2DMU A;  3K2A A;  3LOC A;  1DLJ A;  4MFE A;  3FK7 A;  4XIC A;  1ETY A;  4W1U A;  2I9P A;  3BTC A;  2HYJ A;  1M2W A;  1WPQ A;  4A3L J;  2GF2 A;  3JRF A;  3QPL A;  2AO9 A;  1TWA J;  1G2H A;  9ANT A;  2X58 A;  1MH3 A;  3FIS A;  1X58 A;  3G1L A;  1HCR A;  3MKL A;  4A3E J;  1Y1W J;  2KT0 A;  4B3H A;  2XGD A;  4GWK A;  4A3J J;  1PUF A;  2CQQ A;  1ZK8 A;  1B72 A;  1HDP A;  5MGB A;  1ZQ3 P;  3ZHB A;  2VUM J;  2JN6 A;  2WTB A;  1A6I A;  1QRY A;  2LD5 A;  3A01 B;  2PGD A;  5C44 J;  4C2M J;  5K7H A;  3H2Z A;  4DZJ A;  3PM1 A;  4M3B A;  2M9H A;  4EZB A;  1SFO J;  1IGN A;  2CVZ A;  3UKG A;  1K83 J;  3I4N J;  1U78 A;  4DYD A;  2JA6 J;  4D5C A;  5EG0 A;  4Y52 J;  3C2B A;  3BT9 A;  1BW6 A;  3IQD B;  1F14 A;  5F0H A;  1K61 A;  2KDZ A;  2L7M P;  1JTX A;  4M3E A;  2H8R A;  3G1O A;  3GBG A;  3WFI A;  1IDY A;  2CJJ A;  5EZH A;  4GBJ A;  5F08 A;  2W48 A;  2JK3 A;  3GTO J;  4BKX A;  1ZR4 A;  2LK2 A;  2DN0 A;  1TC3 C;  2NS7 A;  4UUS A;  3TW7 A;  4DZP A;  3RQS A;  1YRN A;  5J1U A;  5IOZ A;  3HBL A;  2ECB A;  4CYC A;  1LSJ A;  1PGO A;  3FR8 A;  2LR8 A;  1ITY A;  4JYK A;  1GV5 A;  1HOM A;  5FWN A;  1RR7 A;  2FD5 A;  3A03 A;  5J3L A;  3G0O A;  1GDT A;  5FKN A;  1QVT A;  4XID A;  1M66 A;  3HN2 A;  2HDH A;  1ETO A;  2DJN A;  1ETX A;  1YJ8 A;  2R5Y A;  1NK3 P;  3JRD A;  3WS7 A;  2DMN A;  4S0H B;  4IHW A;  1TXG A;  2Y9Y A;  5IP6 A;  2EZK A;  2WV1 A;  4XRS A;  2EW2 A;  2ZYG A;  2DA5 A;  4J0E A;  4A3G J;  3ZQL A;  3HOU J;  3JRE A;  5HOD A;  1M76 A;  5FKO A;  3FKI J;  1EF4 A;  3ADO A;  2HXI A;  4JP0 A;  5F27 A;  4HNV A;  1JJ8 C;  1PGN A;  1LE8 B;  1FEX A;  1AU7 A;  4KUH A;  2XGC A;  2IEK A;  1KS9 A;  2JKV A;  1F17 A;  4B1R A;  5A9R A;  1SAN A;  4FE4 A;  3RZD J;  1B8I A;  1PGP A;  2NVT J;  4B3A A;  3QHA A;  4JX6 A;  2I10 A;  3ZW9 A;  2M2E A;  3FWN A;  4OQZ A;  1NTC A;  2DMQ A;  1S7E A;  1WPK A;  3TP0 A;  1MH4 A;  1H88 C;  3SDG A;  2L0K A;  2E19 A;  4OL9 A;  5GPA A;  4I6Z A;  1IDZ A;  4IEJ A;  5F1J A;  1W0U A;  1PGQ A;  1MBG A;  4FGW A;  3GTQ J;  3QPS A;  5J1Y A;  3LNQ A;  3TED A;  5EGO B;  3BQZ A;  1CQT A;  4E21 A;  1OFC X;  4A3I J;  1NK2 P;  3S1N J;  1JUS A;  1TWF J;  1LFB A;  4BBS J;  1FTZ A;  2E1O A;  2LY9 A;  2DMT A;  3HKZ N;  1Z0X A;  4G12 A;  4RDU A;  2JA7 J;  2HDD A;  3PDU A;  3BQY A;  1ZR2 A;  3F0C A;  4DCK A;  3ZQG A;  3Q0U A;  3ZOB A;  2O9L A;  1H89 C;  1B8I B;  2L9R A;  3SJM A;  5BNG A;  2M0C A;  2LFB A;  2UYY A;  1TWG J;  3S14 J;  1UMQ A;  2GM4 A;  2IBD A;  4J0F A;  5F04 A;  3JRI A;  1Y1V J;  2O7O A;  2FX0 A;  3A01 A;  3S17 J;  1FIA A;  3W6Z A;  1N1G A;  4I76 A;  3PLR A;  2NS8 A;  1UG2 A;  3IH4 A;  4E13 A;  3BTI A;  2LKX A;  2HXO A;  3MVP A;  1I6H J;  3G1M A;  3WHC A;  3HEF A;  1U9O A;  5E3L A;  1RPW A;  2XPW A;  3OSG A;  2XGE A;  2M34 A;  4JPZ B;  1GV2 A;  2AHQ A;  2EZI A;  1FJL A;  2R7Z J;  2M8G X;  5DTD A;  2X9D A;  4M3D A;  1YRL A;  2ZYD A;  4BY7 J;  4BBR J;  1JKP C;  4IHY A;  2HOS A;  4A3K J;  1OJL A;  1F0Y A;  3LSR A;  3CTV A;  1E3O C;  1ZTR A;  1DU0 A;  3BG9 A;  1P7I A;  3BG5 A;  5A9S B;  2D3T A;  1WH7 A;  3ZQI A;  3H0G J;  3HOW J;  3S1R J;  2ID6 A;  2P81 A;  1D5Y A;  1I50 J;  2IZ1 A;  4V2F A;  2HOT A;  3HDD A;  4BY1 J;  4L5E A;  1AKH B;  5EF6 A;  1ENH A;  2Y31 A;  2TRT A;  5GP9 A;  3GTJ J;  4A3M J;  3GTK J;  2IYO A;  2IZ0 A;  4E12 A;  2X48 A;  1JUM A;  5J1R A;  3HOY J;  4KUE A;  2GBY A;  4D7N A;  1VI0 A;  2XPU A;  4M3G A;  4DYQ A;  4M3F A;  1YON A;  2QCO A;  1OCT C;  2TCT A;  3CCY A;  2CRG A;  2ME6 A;  1T56 A;  1WDM A;  1WI3 A;  2WAQ N;  3NAU A;  3CMY A;  1WH5 A;  1JT0 A;  2PMZ N;  1VF9 A;  1A5J A;  1GT0 C;  1LE8 A;  3L1P A;  2CU7 A;  3OIO A;  1JGG A;  2E2H J;  3ZWB A;  3M3Y J;  4OM8 A;  4MLO A;  3NAR A;  1VFC A;  3PO3 J;  1IJW C;  1X2M A;  1F12 A;  3K96 A;  3ZQH A;  4XRM A;  3GTP J;  2EZL A;  5JLX A;  3DOJ A;  3JR9 A;  1BA5 A;  1WCM J;  1XG1 A;  5M3F J;  3LSP A;  4GFB A;  4R1N A;  3BTJ A;  2DA6 A;  3SFI A;  1POG A;  2K40 A;  3K7A J;  1IV6 A;  3IV5 A;  2FQ4 A;  1QVU A;  3HOX J;  3HOV J;  2G0E A;  3OBB A;  4B3I A;  4A69 C;  1IUF A;  1RES A;  5EGO A;  3HWR A;  4V2G A;  2NVY J;  3FR7 A;  2HI3 A;  2EQR A;  3B6A A;  1MBJ A;  1HLV A;  1WDL A;  5E3O A;  1YB4 A;  1LFU P;  2EZH A;  2CQX A;  2R93 J;  2D5V A;  5FJ8 J;  3FK6 A;  4RBO A;  2IAI A;  1HF0 A;  2R5Z B;  4DYC A;  1U9N A;  2GLO A;  1RKT A;  2NOG A;  4J19 A;  1DLI A;  4QTR A;  1UHS A;  3BR1 A;  3DCF A;  5M5W J;  1MSF C;  3BR3 A;  2Y30 A;  4JQ0 D;  4DW6 A;  2H1K A;  5IYD J;  5A9T A;  4OQY A;  2VKV A;  3ZW8 A;  4PZD A;  1P7J A;  2JWT A;  4IHX A;  1FTT A;  2QF7 A;  2YU9 J;  4A3B J;  3CQZ J;  5EDN A;  1R9T J;  3Q0V A;  1LSO A;  1X0V A;  2IYP A;  2K9N A;  4S3M A;  1ZGW A;  2HOA A;  4QSH A;  1M67 A;  2ZYA A;  3WHB A;  3O8H A;  3PO2 J;  2OF7 A;  1JDJ A;  1RET A;  3C7D B;  3MN2 A;  3K6J A;  1EVY A;  3BR2 A;  3BR0 A;  2COB A;  3ZQC A;  1OCP A;  3TW6 A;  3RKQ A;  1T33 A;  2JA8 J;  1ORK A;  2XB5 A;  3JRA A;  2O8K A;  5JLW A;  1ETW A;  2YS9 A;  2VKE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...