2Y9YA

Chromatin remodeling factor isw1a(del_atpase)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
STPSHPRMPKPHVFHSHQLQPPQLQVLYEKERMWTAKKTGYVPTMDDVKAAYGKISDQEEQKEKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
total genus 63
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9yA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9yA03
1JGGA 2DMTA 3TW6A 2MGQA 2CUEA 2R5YB 1A5JA 2XB0X 2XGEA 2XPWA 1XS9A 5IP7J 2H8RA 1MBGA 1D5YA 4AYBN 4CYCB 3OIOA 2D5VA 2HOSA 4MLOA 3NAUA 2XPUA 3GTJJ 3JRGA 5HODA 2CQXA 2LP0A 1IGNA 4XICA 1SFOJ 3HOWJ 5J1UA 2YUSA 5DS9A 3TEDA 4OVNF 3MN2A 2B63J 1HF0A 1VNDA 3OOUA 1IV6A 5E3NA 3BTJA 3IH4A 2CRGA 4G12A 4DYCA 1K83J 1E3OC 2GBYA 2HYJA 5F0HA 1XG1A 2WV1A 1WCMJ 1U9OA 2M34A 4J19A 1P7IA 5IP6A 4A3IJ 3IH2A 1BW6A 3JRBA 2YU9J 1MH3A 2AHQA 2MW8A 1EF4A 4D7NA 3HOUJ 1AKHB 3HGYA 4A3DJ 2FQ4A 4V2FA 1H88C 3GTGJ 4HNVA 3IV5A 2DMQA 2ELKA 4AUXA 4BKXA 2L7ZA 3FIWA 1IG7A 3S16J 4I76A 2HI3A 3BTLA 2E1OA 4BXXJ 2DJNA 2TCTA 1NTCA 1VI0A 1QRYA 4D5FA 3IH3A 3CMYA 4MFEA 3HKZN 2JA6J 5EGOB 1NK2P 1ZTRA 3LSRA 3E7LA 1HDPA 4QSHA 5FKMA 4A3JJ 5C44J 4M3BA 2PMZN 2NVQJ 4MIMA 1ETKA 3DEWA 4ABZA 3HEFA 3RQIA 4NDLA 2NS8A 3CQZJ 2XB5A 1JTXA 2QF7A 3JREA 1PUFB 1LFUP 1ZR4A 1FTTA 2IBDA 3HBLA 3GTOJ 2N8GA 1B72B 5IPAA 4W1UA 2L0KA 1W0UA 3S1RJ 5K7HA 3JRFA 1YRNA 2XGCA 2R92J 1ZK8A 4X1EA 4MFDA 2EQRA 2M0CA 4FISA 1YRNB 3L1PA 3WHBA 4A3MJ 1TWHJ 4RBOA 4DZJA 2JA5J 2EH3A 2LVSA 4BY7J 1Z77A 2COBA 3SJMA 5EGOA 1JKPC 4X6AJ 1TWAJ 1AU7A 2LR8A 2DMUA 1MNMC 2KT0A 1QVTA 1X2MA 3RZDJ 1WPKA 3RKQA 3BR0A 1RR7A 1AHDP 2JA7J 2VKEA 3BR6A 4UUSB 3BG9A 3G1LA 1I3QJ 1TWFJ 2M8GX 1ETQA 2CJJA 4JP0A 3ZOBA 4M3GA 1NK3P 2DA5A 5J1RA 3TW7A 1ETWA 4W97A 3DCFA 3PM1A 4FE7A 3B6CA 3I4NJ 3HOVJ 1ZKGA 5F1JA 1RPWA 3FISA 3GTPJ 5F04A 1JJ8C 4XRSG 5FJ8J 1POGA 2NS7A 1LE8A 2JN6A 2E2HJ 1OFCX 3OSGA 1UHSA 2ME6A 1Y1WJ 2GLOA 2HDDA 2ZB9A 4DYRA 2K9NA 1ZR2A 3HOZJ 1MBJA 2O7OA 5GPCA 5M3MJ 3QPLA 3O8HA 1T33A 2VPRA 4A3GJ 1CQTA 1IRZA 4A69C 3I4MJ 1JUSA 3A01B 2O9LA 2CU7A 3ZQHA 1A6IA 3LSPA 2QCOA 3S17J 1U8BA 1OCTC 3WHCA 1MSFC 1H89C 1I50J 2FJ1A 1IUFA 1HLVA 1GV5A 3Q0VA 2K9SA 2R0QC 5M5YJ 5IYBJ 2Y9ZA 5K7FA 1R9TJ 4AC0A 4DCKA 2HOTA 3JRIA 4BBRJ 2ID6A 1TWCJ 2ECCA 5IP9J 5GPAA 1JT0A 3Q3SA 2O8KA 2RAEA 2E2IJ 1PUFA 2HXIA 4A3CJ 1BJZA 3CCYA 1MBKA 1LFBA 3ZQGA 2FD5A 3A02A 2DA3A 1P7JA 4C2MJ 2NOGA 2L9RA 4DZPA 1LE8B 1B72A 5FKOA 2ID3A 2DMNA 1WI3A 2LTPA 4IHYA 3A01A 3D1NI 3S15J 5F27A 3JRHA 3S1QJ 4JQ0D 1TWGJ 2R5ZA 5M5XJ 1APLC 3BTIA 3HGGA 5J3LA 3HOYJ 1GV2A 4XRSA 2R5YA 3MVPA 3QPSA 2L7MP 3ZQIA 3JRAA 3BT9A 2VUMJ 3PO3J 2X48A 5EYRA 1Z0XA 1XC5A 3BG5A 4A3FJ 1FIPA 3S1NJ 2K40A 1JUPA 3LOCA 4C3IJ 5J1YA 3CDLA 1WH5A 1MBEA 5FLMJ 2IAIA 2ECBA 2JMWA 1FTZA 5EG0B 3Q0UA 2HOAA 2K9QA 3GBGA 1GVDA 2X6OA 5C4XJ 1IC8A 1QVUA 3LNQA 1UG2A 2W48A 2NVYJ 5IOZA 2LD5A 1Y1VJ 3SDGA 3SFIA 3RZOJ 3JR9A 4EEFG 2M2EA 2WAQN 3TP3A 4B3AA 4JYKA 1X2NA 2KDZA 3ZQCA 5FLVA 4JX4A 3W6VA 3M4OJ 1ETYA 4M3FA 3FKIJ 4V2GA 2H1KA 2OPTA 5M3FJ 1RKWA 2EBIA 1MBFA 4D7MA 4A3BJ 1BL0A 3B6AA 5FKKA 3HM5A 3BR5A 3ZQLA 5EG0A 1HDDC 2E19A 2JJ7A 2XGDA 5FKLA 5EEAA 4M3EA 1U9NA 3HB9A 4D5CA 1SANA 1UMQA 1HOMA 2DA4A 1FIAA 2ME0A 3JRDA 1OJLA 5C3EJ 2I10A 4FCYA 2M9HA 3A03A 3JRCA 3S14J 2FX0A 2TRTA 2Y30A 4CYCA 2XRLA 2R7ZJ 1ETVA 3K2AA 1B8IB 2AO9A 3LSJA 3S2DJ 4MO7A 1TC3C 4QTRA 3C2BA 2NVXJ 4C3JJ 3HOXJ 1JT6A 2IEKA 4L5EA 5BNGA 4B1RA 5E3MA 3K7AJ 3ZQFA 4A93J 4QIWN 2JK3A 3Q0WA 4M3DA 1WGXA 5K7ZA 1W0TA 2XSDC 1MSEC 4DYQA 2CUFA 2EZHA 2Y9YA 1ORKA 4FE4A 5M5WJ 1GDTA 1ETXA 2DA1A 5EZGA 2MG4A 3BR1A 4I6ZA 4C3HJ 3G1MA 1U78A 1RETA 2CQQA 1JKRC 2DA7A 2HQ5A 2DA2A 1T56A 3HDDA 1X58A 2E2JJ 3QQAA 5JLXA 5EDNA 1IDYA 2XPVA 1FEXA 4BY1J 1H8AC 3H0GJ 2EZLA 4A3EJ 1DU6A 2DTZA 4IEJA 2YS9A 4IHWA 3BR2A 1JTYA 1ITYA 1B8IA 1MBHA 5FKNA 2LK2A 1IDZA 3BQYA 3BQZA 4UUTA 2OF7A 4S0HB 2VKVA 1GT0C 1JJ6C 2JWTA 5E3OA 2L7FP 1OCPA 1F36A 5C4JJ 1VF9A 4Y52J 2JA8J 3TP0A 2DN0A 2DA6A 1I6HJ 2P81A 5JLWA 3S1MJ 3GTQJ 1K61A 3H3VK 5E3LA 1QPIA 1VFCA 2GM4A 2HXOA 3GTLJ 3BG3A 1ZGWA 4IHVA 3GTKJ 3FK6A 3UKGA 1JKOC 5IOYA 3F0CA 4LOCA 2NVTJ 3LSGA 5EZHA 1S7EA 2EZIA 4GFBA 4BBSJ 4M6VA 1F43A 5F0CA 4A3LJ 2G0EA 5DTDA 1Q1VA 5EF6A 1ZQ3P 4JX5A 4UUSA 1JUMA 4XK4A 3FK7A 4JPZB 4FTHA 3G1OA 4RDUA 2Y2ZA 1O4XA 4XIDA 2MSYA 3PO2J 5IYCJ 3O8GA 2R93J 2R5ZB 2EZKA 1G2HA 2LFBA 2DMPA 5F0FA 1BW5A 1FJLA 5IYDJ 3VPRA 5GP9A 2Y31A 2X9DA 1BA5A 1GUUA 1DU0A 4A3KJ 3MKLA 1ETOA 4Y7NJ 1WH7A 1AKHA 4XRMA 2LKXA 2VI6A 1JKQC 1HCRA 2LLKA 2WB1N 5F08A 3M3YJ 4DW6A 3OSFA 2LY9A 3BTCA 3NARA 3S2HJ 9ANTA 1MH4A 1IJWC 4JX6A 3BR3A 1RKTA 4IHXA 3GTMJ 1ENHA 2Y0SN 4B4CA 1RESA
chains in the Genus database with same CATH superfamily
1KQSO 1LDJA 4EM1A 1JY3O 1HTLC 2VT3A 1S5LH 4IRHA 2XPWA 1L0NJ 4G94A 4LB5A 1XS9A 1NGMB 3SZTA 2H8RA 3WTWC 1MBGA 2IVMA 2HOSA 1EZVI 3GHGC 1NTKJ 5GTIE 2XPUA 5IT9K 4GDFA 1YJWP 2OTJP 4I99C 2CFOA 1LB2A 2E5ZA 2HGCA 4LFUA 4XLFA 3J7AO 2L4MA 1NU1J 1SFOJ 5LGNA 3BPXA 3I64A 3PUFA 5J1UA 3OYNA 3CCSI 3U2RA 1O3SA 1PDNC 1P84D 4M9ZA 2GUSA 3R4YA 4ZKPA 3PEFA 1KD1Q 3SYTA 3RL0B 4OVNF 3DKXA 4IX7A 3MQ0A 1HF0A 1VNDA 3MGNA 1IV6A 3CO7C 1MD0A 4XN3A 3L70J 2P6TA 2M4KA 4XBFA 1NTZJ 3IH4A 2CRGA 3VYTB 3CXHD 1TXGA 1E3OC 3L75E 5C39A 3V2RA 5BVZA 2HYJA 3DU5A 1EH8A 5D6EA 2L9NA 1XG1A 1H9TA 1HSTA 2CW0F 2M34A 1ZRCA 1K4TA 2F5FA 1KILD 3BZKA 3IH2A 5IT3A 3IQDB 3I56P 1DP7P 2DQLA 2RH0A 2XSJC 1T98A 2AHQA 2MW8A 5ICEA 1UFMA 1USEA 3NXSA 4RKUJ 5BU8B 4V2FA 1H88C 3GTGJ 2A45I 4HNVA 5AVVB 3R0AA 4L9VA 2QSFX 2I76A 1SQQJ 1MNEA 5D5XB 1BSHA 2IGNA 3SEZA 5KVRA 3WS7A 1IG7A 4XKCA 3S16J 1LVAA 4I76A 1LFPA 2JRTA 1VQPI 1SEUA 2TCTA 3AE5C 2LY1A 2QQAA 3CCEI 3L74G 1KZHA 5H20A 1NH3A 2D2CC 2BW3B 1U2WA 4AVZA 3C7DB 3HKZN 3K70C 1NK2P 4KN7X 1ERDA 2YKQA 1VQ8P 4OIPF 5FKMA 2ISZA 2B0LA 3CLOA 2FEZA 5C44J 4PD4H 3AEEC 4MIMA 4BHBA 4UV9A 3DEWA 4AUWA 2WPVB 4H0LD 4CCNA 1X1DA 3IFMA 2OYOA 1TW2A 2MYSA 3GCMA 4RS8A 1YTZI 2M8RA 1LFUP 4YEJA 1WFXA 3S32A 3T1BA 2IBDA 2L5QA 3HBLA 3GTOJ 2UYYA 1IO2A 3WU0A 3V7CA 5L3CA 1R5GA 1P4WA 3MD0A 4CH7A 3HSEA 2L0KA 3PRJA 1IXCA 4CCLA 1B59A 3HHHA 3S1RJ 4Y28J 1K9MQ 2W83C 1RIOH 3KFWX 2J5UA 1T95A 1TQIA 2YX7A 3FMQA 4MFDA 3RSNA 2OFPA 2QJYC 2Y0DA 4KA4A 5LHIA 2E76D 2M0MA 4WY4C 4RAYA 4A0YA 3C3WA 4FISA 3MKYB 5K1YA 1YRNB 3F6OA 4M6YA 2LF7A 1HA8A 3L1PA 1LUJB 2I1KA 3H1ID 4GDOA 2O03A 1YO5C 3QU3A 4V19K 2JA5J 1I39A 2EINH 3OAKA 4AQRD 3QAHA 2Z5UA 1MMGA 3KLNA 2IYOA 4KITB 3SJMA 1W1WE 1HGVA 1JKPC 4N9IA 1NU1E 3VFZA 1GL2B 4ASVA 2Q1ZB 3F23A 2P67A 1RQVA 1URQB 5E79H 1U8RA 2MC3A 4QLCU 1BI1A 3RKQA 1EDIA 3BR0A 3JTHA 3HUSC 3ELKA 2JDIH 3I71A 1BI0A 2VKEA 3VMZA 2QBYB 2ESNA 1I3QJ 5H2FE 4JP0A 3ZOBA 3L70E 3GEZA 4OL9A 3PSIA 2CO5A 5EEHA 5J1RA 1Y47A 3RYRA 3W67A 4ON0A 3WTYC 4BE2A 3DCFA 2X51A 5DYMA 3B6CA 2V79A 5GADJ 3KYCB 3U1AA 2NPSB 1FBSA 2JZYA 2Z2SB 5KKZC 4P5OA 5KAIC 3FISA 2QEXI 2V4HA 3TK1A 3E1RA 3GTPJ 1FX7A 5F04A 2KUBA 3PQKA 4F91B 3CD6I 1SFEA 1FZPB 3VSLA 1IFDA 5APXA 2OZ6A 1RE4C 3N97A 1Z56A 2HVQA 4WY4B 3OYAA 3P7KA 1TLHB 2HDDA 4KHXA 1WT6A 3BJAA 2DFIA 2BVLA 3DWLE 1NTZK 3BCCE 3MHVA 1SVFA 2K9NA 3LA3A 2VONA 4L5IA 1FYMA 2O7OA 4Y4RA 4RM2A 3CTVA 2HOEA 2QVAA 1Z1DA 1URQA 4B43A 1T33A 4B47A 4N9HA 2NVUB 3G71I 4NQWB 4D0PA 3LSIA 1IRZA 2VT2A 4A5MA 1F12A 3H9JA 1FJKA 3AE2C 3I4MJ 3H1JJ 2HLOA 3A01B 3L72J 2CU7A 5AW5B 2XAFA 3DPTA 3TSIA 3ZQHA 3S8PA 4UVBA 2AEFA 2Z5IA 3PLNA 1SQQK 3CWBJ 2A5WA 4DJAA 1GL2D 2NPSD 2BEZF 1A02F 4FETA 1X1BA 1I50J 1YRLA 1KU2A 4H13C 2DJIA 5KAIH 3F89A 1GV5A 1GW3A 3GWZA 1URQC 3OYLA 1MIJA 3K4CA 4EATA 2RGVA 2R0QC 3VYSB 1ON2A 1D8KA 1Q81Q 3ROUA 2LNBA 1WJDA 3IP4B 2ZJQF 4BXLA 4DCKA 1DEBA 3HD7A 1E0EA 4M71A 1YI2P 1EV7A 3K4BA 4IXAA 5IP9J 3MKZA 2VLAA 5GPAA 1BGYD 3PP5A 2RAEA 1VPDA 5AW6B 3CO6C 3CLQA 2JA2A 1OKRA 4YELA 3E6CC 3CC2I 4A3CJ 1USSA 3CKYA 1TZLA 1LFBA 1TNSA 1LWUC 1KILA 1FOSE 5J8CA 1RQUA 1P7JA 2R7DA 1MKMA 4IPAA 1S9KE 2V4JC 3M8EA 1B72A 4M9SA 5FKOA 1SD6A 1WI3A 2KMUA 2LTPA 4JBAA 3H1LD 4OWRB 3PL8A 4LIUA 3C2GA 1P92A 4I2LC 2VKHA 3MZHA 3S1QJ 4O5VA 2CK3H 4JQ0D 3H6PA 3TO9A 3MD2A 4IHTA 2FYUE 1X1PA 1I1GA 1SQXK 2Q8KA 1EDKA 2QJKB 5JI6A 1SQBE 3WUUA 2EIJH 1OWAA 2QQ8A 5M5XJ 4H4KC 1W4MA 1APLC 3MIWA 1O7LA 4RGUA 2OQGA 2Q2EB 2R7TA 2IS1A 4CZCA 1DP3A 1GV2A 1LTSC 5EFWB 5AVRB 2DPDA 3E0JB 3JAMZ 4XRSA 2DW3A 4WB4A 3AG2H 2R5YA 3MVPA 2GAUA 3QPSA 3H9GA 1HKQA 5GTIH 4Y99B 1YOVB 2O3FA 2O61A 3B71A 2MC4A 1UJ8A 2KIQA 5LD2C 3KP5A 1KU7A 4N0BA 4HNUA 1R6RA 1YQAA 2H6CA 2G8YA 2K86A 1K4SA 3RI4A 2H8PD 4ZKUA 4UVAA 3BG5A 2H1LA 2AEMA 1QLED 5CBOA 1Q86Q 3LOCA 2QA4P 2PRRA 3H1LE 4G7ZF 1O3TA 1EZVD 2ECBA 3A5TA 2Q5UA 1S29A 5KAIE 5EG0B 3TQNA 3T97B 1I6XA 1XSVA 1FDMA 4ZH4F 2XAJA 1EXJA 4BEHB 5KLVJ 2NRAC 1SQBD 4XLEA 1MMSA 1HJ0A 2K37A 4LC1A 2M5WA 4OIOF 3Q3DA 3DPUA 2W8ZA 2NS0A 2PFBA 2XF5A 2ZSHB 5H6QA 4OM8A 1QVUA 3E7KA 3VYUB 2DFEA 3AECC 3HJEA 1OW7A 2FFDB 4DT0A 1QHHD 3M1CA 3GW6A 4E12A 1M76A 4IHSA 2E75D 3RZOJ 5FD6A 1IFMA 3EDPA 2WQYC 3CXHI 3L75J 2ZMEB 4L18B 1L0LE 1NYHA 2L02A 1XCBA 5KK1A 2UXXA 1A35A 5FLVA 1IXRC 4EJVA 4JX4A 5MGBA 5GTHE 5B5EE 3EETA 1ETYA 5GTIC 1KMIZ 2Z99A 4M3FA 1NAYA 3S93A 2O0YA 3ABMH 1YYVA 3GZNB 2H1KA 2IYPA 2BVMA 1GMJA 2M1BA 2ZJRF 2PMUA 1RKWA 5M3FJ 5CLSA 1G2CB 4NPDA 2QJKC 4R1NA 2Z4EA 3Q5RA 3DTKA 2ESHA 2O01J 3OYGA 1BL0A 1BI3A 2LH9A 3MKWB 2IBZE 2V7QJ 2G9WA 4ITVA 4OU0A 4D6TE 2N1TC 1D1BA 4YIIA 5EG0A 3H1HD 1BR2A 1OR7A 3CCRI 4JYCA 2KRFA 5BQTA 5FKLA 4M3EA 1SVOA 4HX8A 2SPZA 3K9TA 1HOMA 2BEQD 1Y0NA 3RYPA 1QU3A 3MMYB 1W5CC 2ME0A 1PL5A 1M75A 3G9RA 4I7ZB 5APYA 2WSEJ 3QP6A 3OYCA 1H89A 3BZ6A 4HLYA 4FCYA 2N9BA 3QOPA 3I3LA 3NTNA 2Z16A 1WJ5A 4OAZA 1LP1B 3HG9A 2XRLA 4A2UA 4BJ5C 4N6JA 1QQIA 1FC2C 4UB8E 5CBNA 2L3DA 3PIPF 3K69A 3K5BA 3SFDC 4CSWA 3L2RA 5HWSA 4G6TB 4MO7A 2W6AA 2QJYB 2WB1A 3JCUC 5JVTA 2V1NA 1RE3C 3HUGA 5D4SA 1NTME 3FR8A 1QZZA 2M5AB 5CVIA 2QKMB 1AVYA 2ETHA 3NFQA 5GAHJ 3DFGA 2G7UA 4HZFA 3K7AJ 4NBQA 4A93J 3H1KE 1EDLA 3EYIA 2XKMA 1TNTA 4YFXF 5CQGA 3FX0A 1J59A 1YE9A 3H1HE 5HLHA 4YXDC 5DUKA 2W24A 5K7ZA 2I8DA 2KZVA 3K6GA 1SQXJ 1FBMA 3L74J 2C6YA 2GWRA 3FF5A 4ENJA 3FXOA 4R8HA 4YTPC 3UR3C 3HE5B 3M06A 1FSEA 3T8TA 1RC9A 1OW6A 5B5EH 2C9LY 2DA1A 4EDFA 1ZAOA 3ONQA 1B9MA 1LT1A 2L54A 4ZYEA 2CUZA 2YXQB 3I55P 5K5QA 1N77A 1GK4A 3ULKA 1HW1A 2XHKA 4C3HJ 1K79A 5KCMA 3GLMA 2ZXIA 2CQQA 3OL4A 1EVZA 2HQ5A 3HHGA 2VODA 3QHAA 1SQXG 1UIXA 3IR9A 2J58A 2CPSA 3ZWCA 1T56A 2FYZA 3E5QA 2BY2A 1HKTA 5CJ0A 5J4VA 1DLJA 3WTTC 2E71A 2P5KA 1SC7A 2M7AA 2P7JA 2XDJA 4P55A 1IFNA 5JLXA 1VQLI 5LRSA 3HIFA 3RCOA 3JCUH 2ELJA 1YVEI 1PV3A 3U1KA 2FA5A 2HQAA 2XGXA 4BY1J 1S2EA 5CHXA 4ENMA 5TISC 3H0GJ 3TKYA 4A3EJ 2FQ3A 3DKWA 1FZBA 2DYRH 4IEJA 1K05A 2ZJSE 1FU1A 4IHWA 1N86A 3ZWBA 1S3JA 2P4QA 3CCMP 4E21A 3KYDB 5FKNA 2KIKA 4OGQB 3DBLB 2IPPA 3PIOF 1U7MA 3V2NA 4HOBA 4NC8A 3BQYA 3OS0A 4ZJZA 4C7NB 1KB9D 2R5BA 1MJBA 2L7FP 3CCLP 1OCPA 3BDDA 2X6YA 4Y52J 3CDHA 1L3LA 1S7AA 5B5EC 4DYDA 3MUDA 4H0LC 2WTYA 2CV1A 2GXGA 2DA6A 1I6HJ 4HX7A 3FWEA 5JLWA 3S1MJ 2IBZG 3QPTA 3R60A 4RAFA 1SVMA 5DCFA 2XAHA 3IAOA 3TO7A 4BQQA 2QENA 2DQRA 1XN7A 2JPCA 2DI3A 1P84H 1K78B 4EOTA 3LMMA 3LW5H 1VFCA 1YJWI 1P6RA 2GM4A 2OTJI 2F4IA 1SQQG 1RF1A 1M57D 4ZZLA 3GTKJ 4HAMA 3UKGA 2RKHA 1JKOC 2E35A 2KDOA 4LLHA 3RK2B 1KGSA 2AEJA 3F0CA 4XOTA 2V7FA 3DXJF 1Z21A 3NEUA 1X79B 1CW5A 1XX5A 4GFBA 2F4MB 2Z3YA 4CCKA 1WQ2A 1F43A 2KSEA 1N7LA 4H44B 3FBIB 3I56I 1JXSA 4D3DA 2G0EA 2LKPA 1VQNI 1LT9B 1HQCA 4P1WA 2XKOA 3WFJA 2E75B 1D1CA 2QLZA 2QBYA 1R1TA 3IAM2 2W25A 4FASD 1YJQA 3L2CA 1KC8Q 3FK7A 3EFGA 3W2WA 1Z7LA 1SQBK 4FTHA 2AXTH 1M1JB 2PP6A 2E43A 3SZPA 1BGYJ 2L9SA 1LP1A 3PSFA 1LT9A 3AE1C 2ZNZA 2CWEA 3G1OA 3QP5A 2VJIA 4WF2A 4XMYA 5CJ9A 3V8LA 1R4MB 3F8CA 3ISPA 2Y75A 3S2WA 2WPRA 1V55H 1W7PB 3WG9A 2AS5F 3RK3E 1WDLA 3RK3C 3HUGB 2H09A 1DPUA 1LGHB 1N75A 4MQVA 1AOYA 5ILUA 2R93J 2QM8A 2C9NY 4A0XA 1VF5B 3FXKA 1HF9A 1W7PA 4HB1A 1F14A 2DMPA 1JY2N 3ZGKA 2I1JA 3VPRA 2N1TD 1S7OA 2DLLA 1X1AA 4FX0A 2WC2A 3P9CA 2X9DA 4PZJA 2PMZA 1YTYA 4H44D 4S3MA 4U3FE 1GUUA 2VQGA 2JQ7A 4PJMA 2H8WA 4A3KJ 1NOHA 1R49A 3C9IA 3CCLI 3FKJA 3R4KA 1AKHA 2LKXA 3VEPA 1L0NG 3DTIA 3J80K 2FXOA 2E1NA 1YX3A 2WB1N 1JHHA 5F08A 3WODF 3OMYA 1VQ7I 1N1GA 1SFCB 5APTA 1UG0A 1JB0J 1BR4A 2P5LC 4BH9A 2CW8A 2A07F 5TGTA 9ANTA 3CMEI 3DOJA 1MUUA 1XTCC 4EJTA 2O5RA 3V2PA 2EIMH 2KK7A 3GTMJ 2KQRA 3K1MA 1ENHA 3Q9VA 3FXEA 3GHGA 5B66H 1RESA 4PV1C 3LAJA 4LK0F 4WXDA 2CUEA 1A5JA 2XB0X 2KSJA 4OIRF 5IP7J 5DCMA 1ZRDA 3H3ZA 1R1VA 4EZBA 4N4OB 3OA7A 1D5YA 3OIOA 4E70A 4MLOA 1OCZH 2HKXA 2HQNA 1BR1A 3LSTA 1LT9C 2K9LA 3JRGA 2BGCA 2NOJB 1BN5A 3ZQQA 2LP0A 3JAMK 4OGQC 4U3FD 4XICA 3BCAA 4DGWB 1PGNA 2E74C 1VQ9P 3KPEA 4CA0A 3H1IE 2ZXHA 2L2OA 4XORA 5DS9A 1YITI 1LJ8A 3B8EB 3V42A 4CO8A 2K88A 3MN2A 1GU5A 1YYCA 4ZTFA 4CCOA 2WADA 1VQMI 5E3NA 3A3YB 3P9IA 3KCCA 2XV4S 4LGDE 3GFLA 1XMXA 4ZC3A 1TQMA 2M3AA 1SAXA 1Z67A 3Q5FA 4JK1X 2EW2A 4AM3A 1WMKA 2BE5F 1K83J 4DLLA 4KN4X 3C18A 3WTZA 3PFYA 4PJ0H 1VTNC 2WV1A 2ZXWH 1N78A 1WCMJ 3Q3CA 1T3UA 4J19A 1R5LA 2EWNA 1MZ9A 5IP6A 3LWFA 2ZMEC 2OZUA 4A3IJ 2CYYA 1K78A 1BW6A 3G17A 1RF1B 3M9AA 4D7NA 5H2FH 1Q7YQ 3BRTB 2ZT9B 2FQ4A 5CJ4A 2COMA 3ZCOA 2P6SA 1YB4A 3ITKA 1FOSF 1KQFB 1ZRFA 1Y6IA 2DMQA 3KP6A 4XNFA 1J1EC 3II6A 1NHAA 1M56D 3FIWA 4E4HA 2HI3A 2BY0A 1NTZD 5AVWB 3BTLA 2E1OA 2IRFG 2DJNA 4E7KA 1ZRTD 1JM0A 3TOAA 1FZAA 3BPVA 2QSGX 2L5GB 4AVPA 3IH3A 1AQTA 3PH0A 3V4QA 1AQ5A 4MFEA 1NTKG 3MEXA 4RGSA 2JA6J 1M90Q 1U7JA 2YIUB 1HDPA 2QYOA 4RGXA 2OQRA 4JQFA 3CC7I 2WAEA 3BCCD 4M3BA 4XR6A 2PEXA 3T5XA 4ABZA 3OWTA 4KNYA 3TNUB 2ZYGA 3CP2A 4NDLA 3ZDMA 4JPZB 3CQZJ 4HA8A 5L3BA 2XB5A 2RVCA 4EQQA 3QYBA 3OYBA 1T39A 1WZ2A 4HJGH 4G6QA 1AFOA 1XCVA 1N25A 5D5UB 1YW9A 2BV6A 2E5NA 1PUFB 1KQ8A 3O6QA 1ZR4A 1FTTA 3L7WA 2XU6A 1OVVA 2EK5A 4EMSA 5LHGA 4BACA 4PJ0C 4YG2F 1FSHA 2D45A 2KS1B 3EUAA 3TGUJ 2N8GA 3GFIA 5FFZA 4GOEA 5IPAA 1LTJA 3AE4C 1W0UA 5AIPA 2O6GE 1RF0C 1NG7A 2FFDA 1YRNA 2L01A 2R92J 3OYMA 2P10A 4DOZA 4HYTB 2XASA 2MKVA 3BRVB 1NJIQ 5AVUB 2E1MC 2K4BA 4F3QA 5DUIA 2M0CA 3RL0g 3HXLA 3COAC 5KJ7C 4A3MJ 1TWHJ 1I3AA 3R6SA 4C2UA 4DZJA 4QPOA 2JUCA 1E3PA 2EH3A 3I9V2 2LVSA 5DD8A 4C30A 3T8RA 3GZ6A 1VQOI 4BDZA 1KFMA 3E6DA 5EGOA 1JMMA 3H2ZA 3TGNA 3C7AA 1AU7A 1E3HA 2JVGA 1MNMC 3HADA 1FNNA 1X2MA 3L70D 1RR7A 1FMWA 1AHDP 1FWZA 1M1EB 1FDOA 1OIPA 2X1CA 4L73A 1HGZA 3BG9A 3G1LA 3AG4H 1IUYA 3KX2A 5FWNA 4XLHA 2EA2A 2VQHA 1MJ9A 1OVUA 3H32A 1S9KD 2BW3A 1ZV8A 4HF2A 1LWUB 2EIKH 2MD0A 1I1SA 3I59A 2QYTA 2IX7C 4A7PA 4ETSA 2A45G 4PV1B 3H32B 5FGMA 2KZGA 4XL9A 3A2KA 1ZKGA 4WVZA 1RPWA 2YX4A 3FM5A 1MMAA 3HPHA 2XC7A 3VN0A 1VQ6P 4IL6C 1OR7C 1POGA 4XKVA 1H0MA 2NS7A 1LE8A 2AQFA 2HYGD 4CPGA 1HKSA 1BOBA 1MMNA 2ME6A 2HPIA 2V26A 4I7HA 4F92B 3AE8C 1Y39A 3CMAP 4PZEA 4DYRA 4XM3A 2PQ8A 1YJNI 2ZYAA 3QODA 3BCCG 2H94A 1ZYRF 1B1BA 4RESB 3D0SA 4EJUA 1QZYA 1RHZB 2CG4A 3O8HA 4I2OA 1FOYA 3GFJA 5H6RA 2IGOA 1CQTA 3KZIC 5HLTA 2STWA 5CVUA 1QO0D 3P9KA 4PK4A 3H1JD 4A69C 4IQ4A 3GHYA 4LITA 2O9LA 4BJ6C 5LLQA 5JE8A 1U5TB 4EVIA 1EZVE 2AXCA 1A6IA 2K3RA 5APSA 3R61A 3LSPA 4LGWA 2BHZA 1SFUA 5CVJA 2HQRA 2DOEA 2QCOA 3KPHA 3CC2P 2P5VA 2WMMA 1LKXA 3J7ZI 1SQPK 2B9BA 4KJZA 2ZAEB 2XNDH 2FSWA 1H89C 1DD4A 4M3LA 4DNCA 3CMAI 4XOPA 1PJRA 1OW8A 2WSFH 2FJ1A 1T3JA 1IUFA 4AIHA 4L76A 2Z1DA 1KYZA 1W5SA 5DCMB 5CCHA 3KP3A 1QNTA 2DK5A 4G9YA 3C7JA 5E8IA 1W36C 5M5YJ 1AWCA 2IXSA 5IYBJ 1SFKA 4CICA 4RB1A 2Y9ZA 5KTBA 1K04A 1BGYE 5K5RA 3QYEA 4E7ZA 1E79H 4AC0A 1G3SA 1JY2P 1W5CE 1ONVA 5DDGA 2D2CB 3RPQA 2ZYDA 3VOPA 4IFDK 3JRIA 4C2TA 3CI9A 1OYWA 4BBRJ 1R4NB 2HTJA 1TWCJ 1YHQP 5CVRA 1DIPA 1Y9BA 1JT0A 4O6JA 1HXDA 1PUFA 2KNCB 5KLVE 2HYNA 4I02A 5E1XA 2PBIA 2YMKA 5GTHH 1LTBC 3ZQGA 1FE6A 3OV8A 2DU9A 2XV5A 3A02A 2DA3A 2IGKA 2O3JA 1G3WA 2NOGA 4WY4D 2KNCA 1QGPA 2DMNA 2IBZD 3ZQ7A 4IHYA 4KT5C 1XGSA 2EILH 4BEHA 1IAWA 2OU2A 4DZOA 3R0JA 1G1IA 2IA0A 3L74D 3JRHA 3GX4X 4CUGA 5JHUA 4I09A 3IRQA 1OVRA 2EV6A 3HSFA 1JEKA 1QHGA 1JI8A 2UV1A 1F17A 3HKZA 2I9PA 4I7ZC 4D9JA 1BC8C 4X0GA 2FY8A 2QJPC 1F9NA 3HGGA 5J3LA 2R7FA 4NPEA 4DBQA 2F2EA 3C2HA 1DH3A 4M73A 3B73A 2CMPA 3KEOA 4WCGA 3O2PE 1MFZA 3L71G 2DFHA 4B86A 4I0AA 3ZQIA 1NTMJ 1YQ3C 4R4MA 3BT9A 2VUMJ 1N7SD 4HDUA 3I4PA 2W82A 5AW8B 1IN8A 1VDFA 4LB6B 1VQMP 2IW5A 2OYHB 1Z0XA 3DLAA 3ML6A 1MV8A 2XZRA 1YBKA 1SFXA 2VL8A 3AEDC 3HD7C 2K40A 1JUPA 3I5UA 3OR1C 4Z2YA 4EGYA 2WSCJ 5AW2B 2HWVA 3MP7B 5JHFA 3S1KA 3TDKA 4HSTA 2EFNA 4BJTA 5FLMJ 2IAIA 4OOIA 3L2QA 1FTZA 3L74E 2JEEA 3M8JA 4XSZF 2YO3A 2KOGA 4ZYGA 1WRGA 4S05A 3G71P 1GVJA 2FOWA 1SQBG 2K9QA 3BJOA 3CX5I 3L72G 4M72A 4B44A 4BE1A 1GVDA 2PLAA 2NZ2A 3CJNA 2X6OA 3LA7A 3M7GA 3OYIA 1NHLA 2A6HF 3OS1A 4C46A 2W48A 3FMSA 4BXFA 3CCVI 1VZ0A 5BPIA 2V6EA 3GLXA 2IDBA 2LD5A 1Y1VJ 3SDGA 4EEFG 2M2EA 1SFCA 1YIOA 3TP3A 2IZ0A 1J09A 3GXOA 3F3SA 3K4MA 2YPRA 3G2BA 1E2XA 2KDZA 1IFIA 1JGSA 1PGJA 2DDAA 2HFED 4YPCA 2KLOA 3DLLF 2B9SA 1L4AB 1ZP0C 3L36A 1UHWA 4V2GA 3GMAA 1X4OA 1D3YA 4NQWA 2OPTA 4Y13A 3L73J 4D7MA 4HLXA 1X0VA 3E97A 3HM5A 1R5ID 3WUVA 3BR5A 1SQPJ 3QWLA 4WK8F 4A5NA 1HDDC 2JJ7A 3A0HC 4J01A 3D5RC 2YXRB 4L9TA 1SS1A 4I6MC 2BYVE 3HB9A 2Q7CA 4R4LA 3CC7P 2DA4A 4JBZA 4I01A 4CZZA 2YSRA 1A6QA 4P9UA 3J81K 4NPFX 1N7SC 2FU4A 2I10A 1OISA 5C3EJ 5BOXA 4JYBA 1RE3A 2NNNA 3HD7B 3WGIA 3I58A 4G8XA 3JRCA 3S14J 2TRTA 2Y30A 4BHPA 4BDYA 3G3ZA 1VQ9I 1G6NA 1PP9D 2R3CA 5GAGJ 3ZMDA 3M0DC 3ZXSA 2B7EA 1SMTA 3FHNA 2PGDA 3WGGA 2D1HA 3AKZA 1J1DC 1NWQA 2NVXJ 4C3JJ 1GK6A 3L4FA 4B3JA 1JT6A 1OCRH 2XAGA 4XONA 3L6DA 5E3MA 1RZ4A 3M91A 4L75A 4HNTA 2OUMA 1Q90D 4BAYA 3KHUA 3MZYA 2PI0A 3H5NA 1WGXA 4LD5A 5LEKA 1SQVK 2HDCA 4UB6H 3ZN0A 4BE0A 1W0TA 2MFZA 1T38A 5HVQC 1XTGB 3L9FA 1MSEC 3LIEA 2CUFA 2YKOA 5A2QK 3CWBG 2EZHA 4AU7A 3L70G 5APUA 3M9BA 2Y9YA 1U5TA 3H1LJ 4FE4A 1IZNB 1FDIA 3LA2A 4L74A 4ASWA 4KICA 3BZCA 1ETXA 1V54H 2LYCA 2PJRB 1R7JA 2ZT9D 4FQGA 2JO1A 2EV0A 3D6YA 2MG4A 2V1DA 5CCHC 3BR1A 3KEQA 3TO6A 4BYYA 3VODA 1U78A 1NTMK 3BVHA 3CCEP 2LC2A 3VP8A 3BLYA 1JKRC 1F4KA 1JHFA 3ECHA 2HPCA 2A5YB 2K5CA 4AD9A 2OJED 3M9QA 3S3OA 5KAFH 3AAFA 4L9NA 1BE3E 4GWGA 3H1KG 3TYYA 5AVSB 3DQVC 1YFHA 2DTRA 5EDNA 3VSKA 4GRIA 1NTKK 2PLYA 1BSNA 2PMHA 1RRJA 5APVA 1ULYA 4O3MA 1NU1K 2RMZA 2I5UA 3F3XA 2ZVOB 1WJEA 2EZLA 3LIDA 1PGPA 3PJSK 2TDXA 2DTZA 3HN2A 1LSOA 3BR2A 2LG4A 2LF8A 4KUGA 1Y56A 2K02A 4LG3A 2KLVA 3F9KA 2HEOA 1S6LA 3D1LA 2HU9A 2QRXA 2P4WA 2MD5A 1KZUB 1VQ5P 2VC0A 1GT0C 4KDPA 2ZXEB 2JWTA 4IKFA 2L4AA 4U7JA 1VF9A 2FYNC 2JSCA 1QEXA 1OPCA 1GTWA 4LG0A 1SD4A 1G59A 2OYIA 4AYBA 4M74A 2IA2A 4EM0B 3HRSA 4P96A 2WV0A 4RB3C 3H3VK 5E3LA 4LG0B 1QPIA 2KISA 1MDMB 2HPCB 5A9TA 1D1AA 1S5LE 1KFNA 2OYIB 3GTLJ 3K96A 5KJ7D 4G7HF 2VJ5A 1YIJI 2EPFA 1YJ9I 2XUBA 2ZJ2A 1S72I 3C7CB 3HE5A 3CF2A 5IOYA 4LOCA 1WSUA 4ZYHA 2K27A 1FYLA 2ZXXA 1S7EA 2VBYA 1GHCA 4NHJA 2W27A 4M6VA 4HH2A 1M1KQ 5FD5A 1PP8F 1EH6A 3ZN1A 1ZH5A 2BHYA 2E1CA 1VQ5I 4DBRA 1WDMA 2ZFUA 5FFXA 5EF6A 3AG1H 4WXHA 1ZQ3P 2IS4A 4JX5A 2HVRA 3H1CA 3B5NA 4A6EA 1JUMA 2VJJA 4HW0A 1YTZT 4MTEA 2X6XA 1VPCA 1X8YA 2DT7B 4N4NB 4UB8C 3L71D 4MGRA 3BCBA 1EJ9A 4S04A 1SLQA 2HDWA 3PNVA 3E6MA 5FO5A 3TGUG 3ZW8A 2Y0EA 4IOIH 3ERED 4MN4C 1P4AA 2B87B 2LOOA 1UB9A 2QM3A 4L0YB 1N1EA 2ZC2A 2M5AA 2FRHA 2IS2A 4GIFA 3CWBE 2MH2A 1ZGJA 2R5ZB 1G2HA 4IM7A 2LFBA 2J59M 3U59A 1O3QA 3AE3C 2HFHA 5D5VB 2R7VA 1FJLA 1I27A 3ADOA 3HOTA 4FGWA 1VL2A 3L73E 5JR3A 3I55I 2QIWA 3SFEC 2ZNYA 5J6XA 1NTZG 1BA5A 1XD7A 1LTGC 3K4JA 2J5OA 1BJAA 3AL0B 3WFIA 1SQPE 4LJZF 3L2VA 1WH7A 3CCQI 2VI6A 1JKQC 2CSOA 1L0NE 3NMDA 3VMYA 4OMZA 3QYFA 3CCMI 3OSFA 1HH0A 3S2HJ 2O1JA 3KYQA 2ZXJA 1DGRM 3OYDA 5ICFA 4AIJA 1XTAA 2KJCA 4R1HA 2KB7P 3HE4B 3QWOC 3S3NA 1IJWC 2YR2A 3BR3A 3FZVA 4XSXF 3W2VA 2VOOA 3T0YA 3I54A 2Y0SN 3Q9SA 1T2KC 1JGGA 2DMTA 2D1VA 5DEQA 2JUGA 2R5YB 1A36A 2OA4A 2XGEA 5CCGA 1T2KD 3ESWB 4ZMDA 1N73B 1R36A 3OJAB 2NPSA 2EB7A 3GTJJ 1PIXA 1JOCA 5HODA 2HVSA 1H8AA 1Z05A 1IGNA 2DOFA 3VYRB 2VOPA 2GXBA 4QPQA 1QGKB 4KJMA 4L0ZB 1OMIA 2YUSA 3JSOA 2CGPA 2CPBA 3AE9C 5F1RA 3GZ5A 3CC4P 2VBWA 4G6DA 1LTJC 1L4AC 2QSIA 2WTBA 5KKZB 4F93B 2W1OA 3BTJA 5JFRA 1K73Q 4PD4D 4C7NA 2A05A 3K70D 1BOAA 3HZJA 4G12A 4II2A 1NTMG 2D2CD 2GBYA 2RNGA 1FOXA 2MJZA 1B4AA 5F0HA 2A06E 2W6BA 2KS1A 2POHA 2OYIC 3ZMSA 5ILVA 3PIDA 1U9OA 4IF4A 2JRMA 2IFMA 3GMEA 2R7RA 1GD2E 1FMVA 1CF7A 2DT6A 2LXCB 2FNPA 2OYHA 2OTLI 3N4XA 3HOUJ 4OWFA 1AKHB 3HGYA 4A3DJ 3WMM0 1ZXGA 1NTZE 1Q2NA 4D3SA 5AVTB 1ZLLA 2ELKA 2R4GA 3B02A 2DDBA 3EUHA 4AUXA 1N73A 2L7ZA 4KMFA 2IGMA 2QJPB 2GF2A 4BXXJ 3FXDA 2AXTE 1NTCA 4KFCA 3CCVP 5EJCA 4D5FA 4PD4I 3WGHA 1NTKD 4KISA 1T6SA 2VXZA 5EGOB 4A6DA 1ZTRA 1KA8A 3E7LA 3LSRA 1ZREA 1LNQA 3P8CD 2VE8A 4GOFA 1TU3F 4N3YB 4HBLA 2DPUA 3CP8A 2V1UA 1E17A 2NVQJ 1A31A 1KB9H 2GOMA 3H1HG 3L37A 1ETKA 2M8EA 3HEFA 4OQYA 3LSHA 1NO4A 4U3FJ 3G73A 3CCRP 1YJNP 3RKWA 3RQIA 4E7LA 2A06D 2NS8A 4PUSA 5FB2A 5HNFA 3RPUD 1JTXA 4O9BA 4UB6E 1WWXA 2V9VA 1I5ZA 2KIFA 2ZCWA 3RIRA 3ZMVA 2QQBA 3G6EP 1B72B 2O01N 2MABA 4Y3OA 1SQPG 3KDPB 4C9YA 5K7HA 1ODDA 3JRFA 2FYUD 2XGCA 2RN0A 1KQ9A 3H1HJ 3Q1MA 3AL0C 1TT5B 2CQ7A 4XQFA 1RUOA 2GZWA 1OCCH 1P4XA 3B4SA 3C1LA 1PFIA 1ZHFA 5HS7A 3ECOA 4RAZA 2OD5A 3U21A 2MLKA 4JOMA 2P7CB 1USTA 4B3HA 1NTKE 3JC22 4RLQA 1FZGA 4KT0J 2K3FA 3RK3D 4RBOA 4HV5A 3EQLF 1IK9A 3UNGC 3OS2A 2E5TA 3WU2C 4B09A 4BY7J 1Z77A 3ZRGA 2BCCE 2COBA 4E13A 3A7OA 1H0TB 4ZYAA 2E1MB 2FXAA 3H1JG 4Z1MH 2P8TA 3QRFF 1QVGO 4X6AJ 1TWAJ 4F7ZA 1XDUA 1KYOI 1QVTA 2DOAA 3AG3H 3RZDJ 2CV2A 1JTHA 1FOWA 2MA3A 1J5YA 3BY6A 4EYYQ 1GXPA 4KIGA 2JA7J 3BR6A 1IF1A 1T0FA 1UHMA 4I0BA 1OCOH 4KMUX 5A2QZ 2M8GX 1ETQA 4UUSB 4J00A 1L0NK 2X1DA 5J40A 2DA5A 3VWBA 5LEJA 5CKTA 1ETWA 1VQ6I 4W97A 4FE7A 3I4NJ 1YHQI 3VMXA 2WPSA 3F8NA 1Z6TA 2WAQA 4YIRX 2IBZI 3L35A 3HRTA 2A45H 5F1JA 1ACIA 1PVEA 5KLIB 5KLVK 3HTSB 1OLTA 1R22A 1V5FA 1R1UA 3KIOA 2PN6A 4XRSG 5FJ8J 1D8JA 1OXZA 3CCJP 1FC3A 3IKVA 2E2HJ 1OFCX 2VXDA 3OSGA 2A06G 2JTVA 1JE8A 4J0EA 3MTUE 4PD4E 1NKNA 1P84E 1L0LD 2GIZA 4RB0A 1Y1WJ 2ZB9A 1LEBA 1Y8AA 1NAFA 3B5ND 2F5EA 2PAJA 3WU2H 4HF1A 1RH5B 1ZR2A 3HOZJ 3RJPA 2X4HA 3K1PA 2KKOA 3ZP5A 3AE7C 3TF5A 5GPCA 1J1DB 4RJTA 3WUTA 2LMDA 5M3MJ 2VJ4A 4A3GJ 3ASOH 3D5SC 5E79C 5D8KB 3RBZA 1LDDA 3SWKA 3A2AA 5APWA 1IL0A 1JUSA 3OW2O 4PJNA 1AJYA 4IJAA 4U3FG 3EYYA 1QL1A 2YKPA 2OCEA 1LVKA 4RM3A 4AIDA 3S17J 3CD6P 1U8BA 3H5RA 1OCTC 3CTAA 1MSFC 2ZT9C 2EA4A 3GYHX 3FXJA 2R5DA 4FT8A 3RDIA 1WI9A 1SQVE 3C1DA 3HUSA 2RN7A 3USSA 2M0BA 2CQNA 2K9SA 4D6TG 3PFIA 3CXHH 3WTVC 1PYVA 1ZELA 3O3KA 4WX9A 3CMMA 2V6CA 5K7FA 1USDA 2H6BA 3O8ZA 2HOTA 3IWZA 1X19A 5E79E 3TNUA 3QU6A 2QZ8A 3CCQP 3SDBA 3Q3SA 1IC2A 1V5EA 1KYOE 3OY9A 1SD7A 1ZLJA 2OC6A 2HXIA 1R8EA 1BJZA 1T8ZA 1MBKA 3IUOA 1U57A 3BASA 1ZG3A 2FD5A 1P2FA 4D6TJ 4DZPA 2ID3A 1GU4A 1FZEA 3VMAA 5CCGD 3FXRA 1T8IA 4OQZA 3BC8A 5LBQA 3D1NI 1CSBA 1YLFA 4GYIA 3S15J 5F27A 2BEOA 2C0XA 3KXDA 2CH0A 2P7VB 1W5TA 1WHUA 2J5PA 3HYIA 4GGGA 2FMLA 4MQ9F 2R5ZA 2QE7H 2A6EF 1MNDA 2Y0MA 4Q5SF 1NU1G 1S5LX 2KIMA 1UIIA 1G2CA 3ZWAA 3J7YJ 3HUSB 1WRJA 3BTIA 4HX4A 2OTKE 1ZOYC 5F64A 3ULQB 1AA7A 4KUEA 3TBIA 3PDUA 1WJBA 2PG4A 1YS6A 2NNYA 5E20A 1GZLA 1IZ1A 2L7MP 4FHTA 1EA3A 4PGGA 3JRAA 1J9IA 3REOA 5CCGC 2QEXP 1M2WA 1NU1D 1W2EA 1KQ0A 1K6OA 5EYRA 4K35A 1XC5A 4N78E 1FIPA 2GA1A 1P9QC 3DP7A 3S1NJ 1AA0A 1BCCE 5J1YA 3HPGA 1J2JB 3BOQA 3JSPA 1WH5A 1MBEA 3H35A 1G8XA 5TJJA 1JCCA 5E1ZB 1G3TA 3BJ6A 3Q0UA 4HV6A 4HQEA 3P5JA 1QPMA 5FROA 2JKVA 3HWRA 2YIUC 1SAUA 3H25A 3SQNA 3V8JA 5C4XJ 4G7OF 1DD3A 3LNQA 1K8AQ 1ZGAA 2ISYA 2QQ9A 3V7RA 5IOZA 1VQPP 5E17F 2FMYA 4QWQA 1Z82A 4ZDPA 1NG6A 3O6BB 4B3AA 4BRYA 3DBRB 4JYKA 1IRGA 3ZQCA 4B48A 1MGTA 3BG6A 3W6VA 3A0BE 3M4OJ 2H7HA 1JDJA 4P9FA 3CF5F 1BE3D 2F4OB 1HJBA 3FKIJ 2PFXA 1FZFA 3GO5A 3F8BA 4CYDA 3GUDA 3KP4A 3MOGA 1SQVG 2K1AA 1MBFA 3CJRB 4NC7A 1A04A 4A3BJ 1YQ4C 5FKKA 5HLIA 4RB2C 3J80Z 1VF5D 5AW4B 3TDZC 3OYKA 5A9SB 2FKWB 2XF6A 1U5TC 3ZQLA 3B5NC 2D2WA 1LJ9A 1PPJD 2E19A 5CVVA 2FBWC 2XGDA 4CCJA 1FP2A 3OBBA 1DPRA 2OBPA 2UXNA 1J0RA 2STTA 4XKWA 4U7BA 2KLUA 2L9VA 2VN2A 3JRDA 1MMDA 1OJLA 3N4MA 5ILSA 2K85A 1E5WA 2BASA 1XSDA 1SQBJ 2NYXA 1PP9E 2E74B 5ICGA 4FX4A 3A03A 4ZNCA 4CYCA 3HRMA 1FJPA 2FBKA 2XF7A 2VE9A 1PUEE 1M66A 2E76C 1A02J 1ZARA 3K2AA 2HPMA 1B8IB 3LSJA 3HRUA 4UVCA 3S2DJ 4OGQD 2KPMA 3W6JB 1RI7A 2JT1A 3C2BA 4QTRA 1GW4A 1DX7A 5HOOA 3L75G 4KUHA 2IEKA 3PNYA 2NAZA 5L8RJ 3V8KA 3HC7A 4B1RA 1S1CX 4F55A 4QIWN 3ZW9A 5TISH 2KXPB 4Y15A 3ZR8X 5AW0B 1DQUA 4KT6A 2K3PA 3V2QA 1ZMEC 1KILC 4HQMA 1XPXA 4IOAF 1W36D 5AYVA 4RAGA 1HSJA 2WSCH 1GL2A 1SMYF 5DJUB 1IN6A 1ORKA 4RO0A 2DK8A 4LLLA 1PGOA 1R00A 4NC6A 4RGRA 5M5WJ 4AIKA 1GDTA 2FXPA 4HKZH 2W85A 1PGQA 3A0BH 1S4XA 2K4JA 3VOEA 3F8MA 1WPQA 3HTKB 5CMZA 1BCCG 1WJFA 2EFWA 2A61A 4DJGA 1WKMA 3SSUA 3CCSP 1GLNA 4I6ZA 1QMGA 3G1MA 2BXZA 4XLCA 2GXAA 2K9JB 1EZVG 1KS9A 2DA7A 1OQYA 5J4YA 5JVGF 4UNOA 3HTUA 2DA2A 4ESBA 5DM7F 4BQAA 1L0LK 1IK7A 3HTKA 1DDNA 2V9KA 3SFZA 3HDDA 4H44C 1Q82Q 1X58A 2E2JJ 4YIFA 3O6QB 4H13D 5HDKA 3QQAA 4NUBA 2G7HA 1TBXA 4IOCF 3UIAA 3M07A 1EKEA 1JUNA 2OTLP 1IDYA 1W2BO 2FUG2 1H8AC 2RDPA 3RL0C 3WU2E 5ED4A 1I36A 3PQJA 2UUZA 4GO1A 2HDHA 1FY7A 2DO7A 4II3A 2LKSA 1VQ4P 2YS9A 4GXOA 1IXSB 2IJLA 3P8MC 1PP9G 4GT1A 1L0ND 1VQLP 3IHUA 4GYGA 1LPQA 2AXTC 3FMRA 3VDXA 1BBYA 2VB6A 3HL2A 2ZJPF 1KQLA 1IDZA 1X4PA 3BQZA 4UUTA 1Y0UA 2A68F 2ADUA 2VKVA 1KB9I 5KLVG 4K3AA 2N1TA 1F36A 1RE4A 3A0BC 3IC7A 2JA8J 3FGAD 3FWLA 2UZKA 2WT7A 4C7RA 2DN0A 3PUBA 1OX3A 1ZLKA 4BWNA 1PP7U 4ZTJA 3BG7A 1DLIA 3W68A 5ICCA 1ZN5A 3RK2C 1RF0A 3CJQB 3L72D 2KZJA 3HOSA 1Z7UA 3V6IA 1RY3A 4XA4A 4Y99C 1J75A 4WWCA 1SP4A 3BG3A 1STZA 1OYYA 1WP4A 4BHCA 4BXUA 3AEBC 3TGUD 3HRNA 3RKXA 5FRNA 4DQ2A 2NVTJ 1XSXA 3SHFA 2A3SA 5DV5A 3WTXC 2XKPA 2E75C 4BBSJ 5F0CA 1YW7A 4YFKF 1LNWA 5J47A 2Z33A 1RF1C 1X9VA 2DT5A 4E7IA 2ZSIB 3CDIA 3L71E 1X3ZB 2WWWA 1Q1VA 3CUQC 4D6TD 4EM2A 2E60A 3G0OA 3LSMA 3BCCJ 4UUSA 4XK4A 2Y0SA 5K5GB 1HW5A 5KNLA 3QSGA 2GQQA 5E1WA 3FWNA 3NWSA 3SZGA 3W6ZA 1YONA 5B66C 1G4DA 1QZEA 4PZCA 2ITAA 4RDUA 3F6VA 3GG2A 5AVXB 2Y69H 1X0XA 1N73C 2FFDC 4M9XA 4HF0A 3J7AY 3L72E 4XIDA 1LTAC 1AVOA 2VQLA 1R71A 4W7ZA 2MSYA 1U6GA 2F48A 4Y17A 2K9YA 5IYCJ 2UWJE 3L73D 3FR7A 2ZVNB 4ANJA 3N05A 1JY2O 2KP8A 4WXCA 1SD5A 5F0FA 1O3RA 3C8VA 3L2WA 5IYDJ 5GP9A 3L73G 1U0JA 3D5LA 1KQGB 1NKZB 2NXNB 1DU0A 3Q2YA 2QA4I 1RUNA 3MKLA 1ETOA 3MWMA 4PFPA 1WJCA 3QPHA 3OYEA 3G4SI 1YJ8A 3D6ZA 3MZWB 1HCRA 3IL2A 1X3WB 3M3YJ 3RBXA 4HSRA 4DW6A 3RPUA 3CMEP 3NARA 2CW7A 2B88A 2O1KA 5IY5H 1T0FC 1VQ4I 3S4RA 2W7NA 2UWMA 1RNLA 1TQPA 1IRXA 1MH4A 3V5BA 2P2UA 4LMYA 1BC7C 2RC4A 2KIUA 2P81A 2KRCA 4B4CA 3LAPA 3V4GA 5L3DA 4XLNF 3F21A 1L0LJ 4TLFA 3KP7A 2IPQX 3K4KA 2MGQA 2RV8A 3TW6A 5H2FC 1L0OC 1IRFA 5HLGA 1CZQA 3PLRA 2KP6A 3PHLA 2BZTA 1DUXC 2R7QA 3EGOA 2O8XA 1S72P 1FOKA 4AYBN 4CYCB 2D5VA 2G3AA 2WTEA 3NAUA 3CUQB 2KI7B 1HWTC 4ESFA 5D8LB 1NH4A 4IZZA 2CQXA 2FBHA 2H27A 2WY8Q 2VC1A 4KUMA 3HOWJ 1IJDB 2L7KA 3CZ6A 5AVZB 2EJRA 2MLGA 4E7SA 4A0ZA 4CXFA 2FE3A 3TEDA 3R2PA 3GLLA 2B63J 2H89C 2LSOA 3OOUA 5CYVA 4BNCA 2V1XA 4UY8I 2CQKA 2E74D 5AW1B 3H3UA 4BQOA 2HG5D 2LDUA 3NWTA 1MFTA 1DGWY 4U7DA 2WSEH 4DYCA 2X58A 3K10A 4W7YA 3IF4A 2M3EA 2FYUG 2OGUA 2WBMA 2ZO4A 3CCJI 1P7IA 2FYNB 3GW2A 3H36A 2OQQA 3L75D 4IFFA 3IN6A 3JRBA 1N7SA 1BM9A 5EEGA 3V7SA 2YU9J 2R44A 3J81Z 1MH3A 3TL4X 1BIAA 1B9NA 3LFKA 2M30A 1EF4A 3RGUA 4ZYDA 3GF7A 2HODA 2DCEA 1X0TA 1KYWA 3IV5A 1N8RQ 3QOEA 3OIQA 4UHTA 2E36A 2VASA 1MJAA 4BKXA 1CI6B 2RQPA 2Q6QA 1Z3XA 1YIJP 1YJ9P 1LJ2A 3GVAA 5D5WB 2X1EA 1EC5A 1G1JA 2GOXB 3WTUC 1T2KA 4J0FA 3P8CE 1VI0A 3LFUA 1QRYA 4YFNF 4JF7A 2LY2A 3GHGB 3CMYA 2VKDA 1Z9CA 2KL4A 1KN7A 3B5NB 2EFQA 5BS6A 1W7PD 3W6UA 4QSHA 3F22A 3CJTB 2HR3A 3KE2A 4A3JJ 2JR8A 2OYHC 1O7FA 2PMZN 2VBXA 3KP2A 4Y33A 1M8OB 5KLVD 2LR2A 1M1JA 4LK1F 3E5XA 5LRRA 5TISE 4HRIA 4XFJA 2RREA 2AQEA 1BGYG 2QF7A 3D70A 2JVHA 3L00A 1Y8RB 3JREA 5HDNA 1F0YA 2FF4A 2Z9OA 3A4CA 1KILB 1IV8A 1FLIA 1EVYA 4L9JA 1L4AA 1LDKB 4W1UA 1LQ1A 3Q5PA 3U1CA 2EV5A 4E7HA 3AE6C 5K5OA 3X2QH 2IT0A 1FPQA 1EQ7A 5CCHD 1LTIC 1ZK8A 4X1EA 5AW7B 3G6EI 4I98B 1FZCB 2XRNA 1TT0A 3E1SA 5GAEJ 1CI6A 3IAS2 2EQRA 2JSPA 5A9SA 2LXBA 3LQRA 3WHBA 2IA1A 3ABUA 2IS6A 4PFOA 3M8FA 1J2XA 3H0DA 5LFAA 5A9RA 3ZGYA 4OINF 2QGUA 3DF8A 3D71A 1FS0E 3HE4A 3RQ4A 5FLXK 1KYOD 4IL6E 3K1NA 2LR8A 2DMUA 3ZHBA 3CXHE 4PJ0E 2KT0A 3KZIH 2FYUK 2W4SA 2ACJA 1WPKA 2W6JH 3WTSC 1FBUA 1M1JC 1TWFJ 1UELB 2A6TA 2CJJA 2K7LA 3ZPLA 1KILE 2OAZA 5ERIA 4M3GA 1NK3P 1KYOH 1X22A 2K9JA 4YXWH 3MFKA 2MH9A 4HYEA 1XDSA 2Q0OA 3LW5J 2DXIA 3TW7A 1UCRA 2Q9IA 3H9QA 1XGOA 2AXLA 1BI2A 2HKOA 3PM1A 4IRGA 2LBFA 1VQKP 3HOVJ 2RNJA 2XNXA 2QKLB 3DBHB 1VQKI 4Z6YA 2QVOA 3ABLH 4BGDA 1H9GA 1JJ8C 4XKBA 4M6XA 2JN6A 2JWDA 5D6FA 5CPRB 3A0HE 2Q3IA 2BCCG 1UHSA 4RLFA 4QMAA 2R7OA 3WU1B 2YMYA 3GF2A 2GLOA 1TP4A 1XMAA 1LTTC 1K6YA 1T6AA 2VPLA 4BS9A 3CCUP 3M9HA 3OYFA 2ELHA 3CC4I 2PJPA 1MBJA 3TMOA 5E8GA 5GTHC 1IW7F 2ZBKA 3EWKA 4GODA 3VB2A 2FOKA 3IWFA 3QPLA 5APQA 1VQ8I 2VPRA 1ON1A 4K2EA 1U3EM 2YU3A 1BCCD 4EV0A 3HDHA 4H13B 3M0AA 1B6AA 5FRMA 5B1AH 1ZG1A 1Q1HA 3IRRA 4BQNA 1ZN2A 2KHMA 2P0WA 1JY3P 1SQVD 3CCUI 3LL7A 4PV1D 2Q1KA 2CFXA 2W00A 1SFCC 3DKYA 1IO4A 3WHCA 1DEEG 2ZKZA 2DAOA 5LGUA 1HVVA 4CGZA 2LBFB 1URQD 1C0WA 3I5CA 3E6BA 3ZMZA 1Z91A 1BIBA 3L2UA 3SWFA 5DM6F 2A69F 1HLVA 3MCZA 3Q0VA 4IL6H 2WY7Q 3L09A 1LSJA 1GL2C 1ZRTE 3RQSA 2D3TA 2CVZA 1MW7A 1V3FA 4ENKA 1R9TJ 1JNMA 4IVNA 3BATA 3MUDC 5AVYB 2H43A 2M87A 3FXQA 1FYKA 4YCAA 2ID6A 2O01H 3F5HA 2ECCA 2V7QH 1V4RA 2O8KA 5F6FA 4MEYF 3RKYA 4MTDA 4PSXA 1QBJA 3DEUA 2E2IJ 5KJ7A 2WT7B 1KU3A 4XLPF 6PAXA 2P1JA 3CCYA 3RL0D 2IFNA 4BL0B 4CHUA 3HD7D 2L91A 3ABTA 2PX9A 4RMNA 3A1YA 2HTSA 4C2MJ 4U0VA 1LE8B 2L9RA 3Q5SA 1QVFO 4B8XA 3E5UA 1WJAA 2KRHA 4HG2A 3F72A 2ZMEA 4EJOA 3A01A 3CUOA 1CGPA 2FXMA 2QM7A 3H1LG 3RK2D 4AWXB 4HPQA 2BXYA 2K9MA 1KONA 1TWGJ 4OMYA 2E5YA 4BU2A 2R7XA 3EPZA 4UV8A 1PPJG 1D0ZA 1L4AD 1GXQA 3JW4A 3M0DA 2OCCH 2HYFA 1UAAA 2HODB 1MZBA 2CS3A 3IKTA 3OOPA 1BCCJ 3H1IJ 3KZIE 4Q48A 3FHZA 1XB4A 4OH8B 4F52A 3OYJA 2HS5A 3HOYJ 2KYVA 2YNYA 4BRYB 1FZCC 5TJHA 3H1KJ 4D1QA 1O57A 2MBFA 1S9HA 3ADPA 4N78D 3DTEA 1KU9A 1D7MA 2LREA 4U0WA 3PO3J 2FYUJ 4AYCA 3BROA 2X48A 3N7NA 2RQQA 3KETA 1YW8A 2WZ7A 3JSVC 4A3FJ 1IN7A 1M7LA 3CPWO 5AIQA 1RR8C 4C3IJ 5M1BA 1F1ZA 3QH9A 3VTPC 4IFMA 3CDLA 4EGZA 1NVOA 1Z6RA 2JMWA 2JPBA 2OV7A 4RA2A 5AVQB 4UUVA 1REPC 1YX5A 3A0HH 2WWYA 2HOAA 2E7WA 3GBGA 4U88A 2VRSA 3JCUE 1XGMA 1LEAA 2RKLA 1IC8A 3FXLA 2R32A 1QX8A 1HC8A 5HDGA 1UG2A 3H5AA 2NVYJ 5L3FA 2GUVA 1F5TA 1YI2I 5BPDA 1TW3A 3WG7H 2OARA 3K0LA 2CV0A 3SFIA 4E7JA 3EQ2A 3JR9A 4I1LA 2WAQN 3DV8A 3PJGA 2XIGA 1L0LG 1X2NA 3GF3A 2IP2A 1TTYA 3NQOA 1Z3YA 4D3FA 5L3EA 1R58A 4CCMA 2W84A 5HNHA 4OAYA 5AW3B 4NB5A 1XGNA 4IO9F 4LIVA 4H0EA 5KAFE 1AV1A 2WAFA 3OIPA 2EBIA 2XAUA 3FXMA 1PPJE 2V9PA 5KLIC 2JWAA 1FBQA 2VQCA 3B6AA 3EUHC 3FXUA 3H1JE 3PTZA 4ZDOA 2Y0CA 1EXIA 1CF7B 1J7KA 1BG6A 1N2DC 4DIQA 4HDVA 2B89A 1L2PA 2H88C 3W2AA 5BU5A 3TDUC 4EJWA 4OIQF 3MZ8A 2X6WA 2XROA 1JMBA 4KYWA 5EEAA 2F5DA 1U9NA 4D5CA 1PZQA 1SANA 1UMQA 1FIAA 4A12A 2E42A 4KIFA 3VP9A 1HBXG 4NNJA 3AFHA 4E6KG 4Q4ZF 2M9HA 3KZYA 4ZZDA 1XMKA 2FX0A 4LLNA 3BWGA 2R7ZJ 1ETVA 5KAFC 1LTJB 2AO9A 5IT9Z 1D5VA 1VF5C 3H1IG 2QUFA 3CWBD 1TC3C 1LWUA 1YG2A 1HUCA 3HOXJ 3ERMA 3I59B 2IZ1A 4L5EA 2XAQA 5BNGA 5D4RA 3TGUE 4GWKA 3ZQFA 4U0YA 4PGHA 2JK3A 3Q0WA 3DEEA 4M3DA 1NTMD 3HSRA 1ZG5A 5E18F 1SQPD 4IL6X 3G4SP 1SFCD 4WWIA 5AONA 3H1KD 3K4NA 3CESA 2XSDC 1J1EB 4DYQA 1V5GA 3AEFC 4WY4A 3E3VA 3OR2C 2E7XA 3W3CA 4PSWA 3CX5H 2BY1A 1KTMA 1QA6A 2WVRA 2BCCJ 2N1TB 2YO2A 5B3SH 1D0YA 1IN4A 4PJJA 1EH7A 2FNAA 2W90A 4PZDA 4ENNA 5EZGA 3ZMUA 2DW4A 4XN0A 5LHHA 1SVLA 2GA2A 1H88A 5TRDA 1VQOP 2M45A 2BY3A 1RETA 4XLAA 4UXNA 3LSKA 1ZCJA 1ZW0A 1SQXE 2WITA 4W80A 3DU6A 3SXYA 4DOJA 2EFPA 3JTGA 2R3SA 2WPQA 5LGTA 3L71J 3ZMTA 3OYHA 3P32A 2Z5HA 2BOLA 2M7BA 4GCVA 4MHGA 3I53A 3SWYA 3M1EA 2ZFWA 2VBZA 2DFFA 2LRDA 5CQEA 4PJLA 3W6KB 4BUPA 5HS9A 1FAVA 5B66E 1UZCA 2XPVA 1FEXA 2JJLA 1WDKA 5FLXZ 1OYIA 3U9GA 2B87A 1DU6A 3EUKL 3KZZA 3OL3A 1X1CA 3KLOA 4UB6C 1JTYA 1ITYA 3NRVA 1B8IA 2WSFJ 1MBHA 4R79A 2X85A 4UB8H 2LK2A 3WE2A 3F8FA 2OF7A 3I0TA 4S0HB 2XDVA 1JJ6C 5E3OA 1TL8A 5L3GA 5C4JJ 4PDKA 3CL3D 1H0TA 4B3XA 2LKMA 1SQXD 5DJTB 3TP0A 5KHDA 3VYIA 2F6CA 4IQJA 3DFUA 1FZCA 3GTQJ 1K61A 3P7NA 3FDYA 2Q2EA 5BMZA 1R5HA 1WVRA 3PJRA 2R7SA 1SQQE 2ICWG 2P58A 4CDGA 2HXOA 4GBJA 1ZGWA 4IHVA 2KJBA 2R7UA 3FK6A 5J8FA 4HEA2 2Q3EA 3ABVC 3K4LA 4XE5B 1IFJA 2EFOA 3CX5E 3LSGA 5EZHA 1N7SB 2KZIA 1IN5A 2EZIA 1HBWA 2DBBA 3V4WA 5HS8A 2X0LA 2E34A 4Q47A 3MAJA 4A3LJ 1R23A 3FBNB 4L5JA 4ESJA 2VIXA 3E1IA 3ASNH 5DTDA 4PCQA 5B1BH 3I83A 2M3BA 3S9OA 3KYLA 4TV7A 1FP1D 3FM3A 4MNUA 3RK3B 3GFMA 2QWWA 2F5VA 3EFFK 2WA0A 1VQ7P 3K2ZA 4ASNA 4U87A 3LQQA 4YRVA 3SEQA 2W57A 2DYSH 2Y2ZA 3PNTA 1JY3N 4IRIA 3AEGC 4EIJA 1S5LC 4XRFA 5DD4A 4WBAA 2QG4A 1O4XA 3BP8A 5AW9B 1YITP 1T08B 2FBIA 1M67A 2HZDA 4KIBA 1Y8QB 2R7WA 1SQQD 2N9YB 1X3UA 2E76B 3S3MA 3PO2J 2ZFCA 4H0LB 3CUQA 3O8GA 1BDDA 1K7AA 3T97A 2EZKA 3K6JA 3TOBA 3CX5D 3DPLC 1BW5A 1BE3J 2BBYA 1KORA 3ABKH 3U1DA 1IFPA 2M4GA 2Y31A 1SQVJ 2DODA 2HZTA 4MEXF 3AEAC 4Y7NJ 1OZHA 3WE3A 2WSSH 4EI2A 1JO5A 2BCCD 1G3YA 2NRGA 2QSHX 4XRMA 1BDCA 1R5SA 3H92A 1YS7A 2LLKA 3FX3A 1MDMA 2XVCA 1D0XA 2KFDA 2LY9A 3BTCA 2HNHA 2PJRA 4B3IA 1JCDA 1FT9A 2F5CA 2Y48A 4ZDLA 1HW2A 1KB9E 1P84I 3KQGA 1BE3G 1VQNP 1QL2A 2C0WA 4JX6A 1JTHB 4LLGF 2JP3A 1PP9J 2GIVA 4GKGA 3KEYA 4TT3H 1RKTA 4IHXA 1EDJA 1KV4A 2CUJA 3RTRA 1S8NA 2NPSC
chains in the Genus database with same CATH topology
1JGGA 2DMTA 3TW6A 2MGQA 2CUEA 2R5YB 1A5JA 3PLRA 2XB0X 2XGEA 2XPWA 1XS9A 5IP7J 3EGOA 2H8RA 4EZBA 1MBGA 1D5YA 4AYBN 4CYCB 3OIOA 2D5VA 2HOSA 4MLOA 3NAUA 2XPUA 3GTJJ 3JRGA 5HODA 2CQXA 2LP0A 1IGNA 4XICA 1SFOJ 3HOWJ 1PGNA 5J1UA 2YUSA 5DS9A 3PEFA 1LJ8A 3TEDA 4OVNF 3MN2A 2B63J 1HF0A 1VNDA 3OOUA 1IV6A 2WTBA 5E3NA 3BTJA 3IH4A 2CRGA 2EW2A 4G12A 4DYCA 2X58A 1K83J 1TXGA 1E3OC 4DLLA 2GBYA 2HYJA 5F0HA 1XG1A 2WV1A 3Q3CA 1WCMJ 3PIDA 1U9OA 2M34A 4J19A 1P7IA 5IP6A 4A3IJ 3IH2A 1BW6A 3JRBA 2YU9J 3IQDB 3G17A 1MH3A 2AHQA 2MW8A 1EF4A 4D7NA 3HOUJ 1AKHB 3HGYA 4A3DJ 2FQ4A 4V2FA 1H88C 3GTGJ 4HNVA 4D3SA 3IV5A 1YB4A 2DMQA 2ELKA 4AUXA 4BKXA 2L7ZA 3WS7A 3FIWA 1IG7A 3S16J 4I76A 2HI3A 2GF2A 3BTLA 2E1OA 4BXXJ 2DJNA 2TCTA 4J0FA 1NTCA 1VI0A 1QRYA 4D5FA 3IH3A 3CMYA 4MFEA 3C7DB 3HKZN 2JA6J 5EGOB 1NK2P 1ZTRA 3LSRA 3E7LA 1HDPA 3W6UA 4QSHA 5FKMA 4A3JJ 5C44J 4M3BA 2PMZN 2NVQJ 4MIMA 1ETKA 3DEWA 4ABZA 3HEFA 2ZYGA 4OQYA 3RQIA 4NDLA 2NS8A 3CQZJ 2XB5A 1JTXA 2QF7A 1F0YA 3JREA 1PUFB 1LFUP 1ZR4A 1FTTA 2IBDA 3HBLA 3GTOJ 2UYYA 2N8GA 1B72B 1EVYA 5IPAA 4W1UA 2L0KA 1W0UA 3S1RJ 5K7HA 3JRFA 1YRNA 2XGCA 2R92J 1ZK8A 4X1EA 4MFDA 2OFPA 2EQRA 2M0CA 5A9SA 4FISA 4B3HA 1YRNB 3L1PA 3WHBA 4A3MJ 1TWHJ 4RBOA 4DZJA 2JA5J 2EH3A 2LVSA 5A9RA 3ZGYA 4BY7J 1Z77A 2IYOA 2COBA 3SJMA 4E13A 5EGOA 1JKPC 4X6AJ 1TWAJ 3H2ZA 3C7AA 1AU7A 3ZHBA 2LR8A 2DMUA 3HADA 1MNMC 2KT0A 1QVTA 1X2MA 3RZDJ 1WPKA 3RKQA 3BR0A 1RR7A 1AHDP 2JA7J 2VKEA 3BR6A 4UUSB 3BG9A 3G1LA 1I3QJ 1TWFJ 2M8GX 1ETQA 2CJJA 5FWNA 4JP0A 3ZOBA 4M3GA 1NK3P 2DA5A 4OL9A 5J1RA 3TW7A 1ETWA 4W97A 3DCFA 3PM1A 4FE7A 3B6CA 3I4NJ 2QYTA 3HOVJ 1ZKGA 5F1JA 1RPWA 3FISA 3GTPJ 5F04A 1JJ8C 4XRSG 5FJ8J 1POGA 2NS7A 1LE8A 2JN6A 2E2HJ 1OFCX 3OSGA 4J0EA 1UHSA 2ME6A 1Y1WJ 2GLOA 2HDDA 2ZB9A 4PZEA 4DYRA 2ZYAA 2K9NA 1ZR2A 3HOZJ 1MBJA 2O7OA 5GPCA 3CTVA 5M3MJ 3QPLA 3O8HA 1T33A 2VPRA 4A3GJ 1CQTA 1IRZA 1IL0A 1F12A 4A69C 3I4MJ 1JUSA 3GHYA 3A01B 2O9LA 2CU7A 3HDHA 5JE8A 3ZQHA 1A6IA 3LSPA 2QCOA 3S17J 1U8BA 1OCTC 3WHCA 1MSFC 1H89C 1I50J 1YRLA 2FJ1A 1IUFA 1HLVA 1GV5A 3Q0VA 2K9SA 2R0QC 1LSJA 5M5YJ 5IYBJ 3RQSA 2Y9ZA 2D3TA 2CVZA 5K7FA 1R9TJ 4AC0A 2ZYDA 2HOTA 4DCKA 3JRIA 4BBRJ 4YCAA 2ID6A 1TWCJ 2ECCA 5IP9J 5GPAA 1JT0A 3Q3SA 2O8KA 2RAEA 2E2IJ 1PUFA 1VPDA 2HXIA 3CKYA 4A3CJ 1BJZA 3CCYA 1MBKA 1LFBA 3ZQGA 2FD5A 3A02A 2DA3A 1P7JA 4C2MJ 2NOGA 2L9RA 4DZPA 1LE8B 1B72A 5FKOA 2ID3A 2DMNA 1WI3A 2LTPA 4IHYA 3A01A 4OQZA 3D1NI 3S15J 5F27A 3JRHA 3S1QJ 4JQ0D 1TWGJ 2R5ZA 1F17A 2I9PA 5M5XJ 3ZWAA 1APLC 3BTIA 3HGGA 5J3LA 3HOYJ 1GV2A 4XRSA 4KUEA 2R5YA 3PDUA 3MVPA 3QPSA 3ADPA 2L7MP 3ZQIA 3JRAA 3BT9A 2VUMJ 3PO3J 1M2WA 2X48A 5EYRA 1Z0XA 1XC5A 3BG5A 4A3FJ 1FIPA 3S1NJ 2K40A 1JUPA 3LOCA 4C3IJ 5J1YA 3CDLA 1WH5A 1MBEA 5FLMJ 2IAIA 2ECBA 2JMWA 1FTZA 5EG0B 3Q0UA 2HOAA 2K9QA 3GBGA 2JKVA 3HWRA 2W8ZA 1GVDA 2PLAA 4OM8A 2X6OA 5C4XJ 1IC8A 1QVUA 3LNQA 1UG2A 2W48A 2NVYJ 5IOZA 4E12A 1M76A 2LD5A 1Y1VJ 3SDGA 3SFIA 3RZOJ 1Z82A 3JR9A 4EEFG 2M2EA 2WAQN 3TP3A 4B3AA 2IZ0A 3PJGA 4JYKA 3F3SA 1X2NA 2KDZA 3ZQCA 5FLVA 4D3FA 4JX4A 1PGJA 5MGBA 3W6VA 3M4OJ 1ETYA 1JDJA 4M3FA 3FKIJ 4V2GA 2IYPA 2H1KA 2OPTA 5M3FJ 1RKWA 3MOGA 2EBIA 1MBFA 4R1NA 4D7MA 1X0VA 4A3BJ 1BL0A 3B6AA 5FKKA 3HM5A 3BR5A 5A9SB 1BG6A 3ZQLA 5EG0A 1HDDC 2E19A 2JJ7A 2XGDA 5FKLA 5EEAA 4M3EA 1U9NA 3HB9A 4D5CA 1SANA 3OBBA 1UMQA 1HOMA 2DA4A 1FIAA 2ME0A 1M75A 3JRDA 1OJLA 5C3EJ 2I10A 4FCYA 2M9HA 3A03A 3JRCA 3S14J 2FX0A 2TRTA 2Y30A 4CYCA 2XRLA 2R7ZJ 1M66A 1ETVA 3K2AA 1B8IB 2AO9A 3LSJA 5HWSA 2PGDA 3S2DJ 4MO7A 1TC3C 4QTRA 3C2BA 2NVXJ 4C3JJ 3FR8A 4KUHA 3HOXJ 1JT6A 2IEKA 2IZ1A 3L6DA 4B3JA 4L5EA 5BNGA 4B1RA 5E3MA 4GWKA 3K7AJ 3ZQFA 4A93J 3ZW9A 4QIWN 2JK3A 3Q0WA 4M3DA 1WGXA 5K7ZA 1W0TA 5AYVA 2XSDC 1MSEC 4DYQA 2CUFA 2EZHA 2Y9YA 1ORKA 4FE4A 1PGOA 5M5WJ 1GDTA 1ETXA 1PGQA 2DA1A 2W90A 4PZDA 1WPQA 5EZGA 2MG4A 3BR1A 4I6ZA 1QMGA 4C3HJ 3G1MA 1U78A 3ULKA 1RETA 1ZCJA 2CQQA 1JKRC 1KS9A 2DA7A 1EVZA 2HQ5A 3QHAA 2DA2A 3ZWCA 1T56A 3HDDA 1DLJA 4GWGA 1X58A 2E2JJ 3QQAA 5JLXA 5EDNA 1YVEI 1IDYA 2XPVA 1FEXA 1WDKA 4BY1J 1H8AC 3H0GJ 1I36A 2EZLA 4A3EJ 1PGPA 2HDHA 1DU6A 2DTZA 4IEJA 2YS9A 4IHWA 1LSOA 3BR2A 1JTYA 1ITYA 3HN2A 1B8IA 2P4QA 4KUGA 3ZWBA 4E21A 1MBHA 5FKNA 2LK2A 1IDZA 3BQYA 3BQZA 4UUTA 2OF7A 4S0HB 2VKVA 1GT0C 1JJ6C 2JWTA 5E3OA 2L7FP 1OCPA 1F36A 5C4JJ 1VF9A 4Y52J 4DYDA 2JA8J 3TP0A 2DN0A 2DA6A 1I6HJ 2P81A 5JLWA 3S1MJ 3DFUA 3GTQJ 1DLIA 1K61A 3H3VK 5E3LA 1QPIA 1VFCA 5A9TA 2GM4A 2HXOA 4GBJA 3GTLJ 3K96A 3BG3A 1ZGWA 4IHVA 3GTKJ 3FK6A 3UKGA 1WP4A 1JKOC 3C7CB 5IOYA 3F0CA 4LOCA 2NVTJ 3LSGA 5EZHA 1S7EA 2EZIA 4GFBA 4BBSJ 4M6VA 1F43A 5F0CA 4D3DA 4A3LJ 2G0EA 5DTDA 1WDMA 3I83A 1Q1VA 5EF6A 3WFJA 1ZQ3P 3G0OA 4JX5A 4UUSA 1JUMA 4XK4A 1YJQA 3FK7A 4JPZB 4FTHA 3QSGA 3W6ZA 3FWNA 3G1OA 1YONA 4PZCA 4RDUA 2Y2ZA 1X0XA 3ZW8A 1O4XA 4XIDA 1M67A 1WDLA 2MSYA 3PO2J 5IYCJ 1N1EA 3O8GA 2R93J 3FR7A 2R5ZB 2EZKA 1G2HA 1F14A 2LFBA 2DMPA 3K6JA 4IM7A 5F0FA 1BW5A 1FJLA 5IYDJ 3ADOA 4FGWA 3VPRA 5GP9A 2Y31A 2X9DA 4S3MA 1BA5A 1GUUA 1DU0A 4A3KJ 3MKLA 1ETOA 4Y7NJ 3WFIA 1YJ8A 1WH7A 1AKHA 4XRMA 2LKXA 2VI6A 1JKQC 1HCRA 2LLKA 1N1GA 2WB1N 5F08A 3M3YJ 4DW6A 3OSFA 2LY9A 3BTCA 3NARA 4B3IA 3S2HJ 3DOJA 9ANTA 1MH4A 1IJWC 4JX6A 3BR3A 1RKTA 4IHXA 3GTMJ 1ENHA 2Y0SN 4B4CA 1RESA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JGG A;  2DMT A;  3TW6 A;  2MGQ A;  2CUE A;  2R5Y B;  1A5J A;  2XB0 X;  2XGE A;  2XPW A;  1XS9 A;  5IP7 J;  2H8R A;  1MBG A;  1D5Y A;  4AYB N;  4CYC B;  3OIO A;  2D5V A;  2HOS A;  4MLO A;  3NAU A;  2XPU A;  3GTJ J;  3JRG A;  5HOD A;  2CQX A;  2LP0 A;  1IGN A;  4XIC A;  1SFO J;  3HOW J;  5J1U A;  2YUS A;  5DS9 A;  3TED A;  4OVN F;  3MN2 A;  2B63 J;  1HF0 A;  1VND A;  3OOU A;  1IV6 A;  5E3N A;  3BTJ A;  3IH4 A;  2CRG A;  4G12 A;  4DYC A;  1K83 J;  1E3O C;  2GBY A;  2HYJ A;  5F0H A;  1XG1 A;  2WV1 A;  1WCM J;  1U9O A;  2M34 A;  4J19 A;  1P7I A;  5IP6 A;  4A3I J;  3IH2 A;  1BW6 A;  3JRB A;  2YU9 J;  1MH3 A;  2AHQ A;  2MW8 A;  1EF4 A;  4D7N A;  3HOU J;  1AKH B;  3HGY A;  4A3D J;  2FQ4 A;  4V2F A;  1H88 C;  3GTG J;  4HNV A;  3IV5 A;  2DMQ A;  2ELK A;  4AUX A;  4BKX A;  2L7Z A;  3FIW A;  1IG7 A;  3S16 J;  4I76 A;  2HI3 A;  3BTL A;  2E1O A;  4BXX J;  2DJN A;  2TCT A;  1NTC A;  1VI0 A;  1QRY A;  4D5F A;  3IH3 A;  3CMY A;  4MFE A;  3HKZ N;  2JA6 J;  5EGO B;  1NK2 P;  1ZTR A;  3LSR A;  3E7L A;  1HDP A;  4QSH A;  5FKM A;  4A3J J;  5C44 J;  4M3B A;  2PMZ N;  2NVQ J;  4MIM A;  1ETK A;  3DEW A;  4ABZ A;  3HEF A;  3RQI A;  4NDL A;  2NS8 A;  3CQZ J;  2XB5 A;  1JTX A;  2QF7 A;  3JRE A;  1PUF B;  1LFU P;  1ZR4 A;  1FTT A;  2IBD A;  3HBL A;  3GTO J;  2N8G A;  1B72 B;  5IPA A;  4W1U A;  2L0K A;  1W0U A;  3S1R J;  5K7H A;  3JRF A;  1YRN A;  2XGC A;  2R92 J;  1ZK8 A;  4X1E A;  4MFD A;  2EQR A;  2M0C A;  4FIS A;  1YRN B;  3L1P A;  3WHB A;  4A3M J;  1TWH J;  4RBO A;  4DZJ A;  2JA5 J;  2EH3 A;  2LVS A;  4BY7 J;  1Z77 A;  2COB A;  3SJM A;  5EGO A;  1JKP C;  4X6A J;  1TWA J;  1AU7 A;  2LR8 A;  2DMU A;  1MNM C;  2KT0 A;  1QVT A;  1X2M A;  3RZD J;  1WPK A;  3RKQ A;  3BR0 A;  1RR7 A;  1AHD P;  2JA7 J;  2VKE A;  3BR6 A;  4UUS B;  3BG9 A;  3G1L A;  1I3Q J;  1TWF J;  2M8G X;  1ETQ A;  2CJJ A;  4JP0 A;  3ZOB A;  4M3G A;  1NK3 P;  2DA5 A;  5J1R A;  3TW7 A;  1ETW A;  4W97 A;  3DCF A;  3PM1 A;  4FE7 A;  3B6C A;  3I4N J;  3HOV J;  1ZKG A;  5F1J A;  1RPW A;  3FIS A;  3GTP J;  5F04 A;  1JJ8 C;  4XRS G;  5FJ8 J;  1POG A;  2NS7 A;  1LE8 A;  2JN6 A;  2E2H J;  1OFC X;  3OSG A;  1UHS A;  2ME6 A;  1Y1W J;  2GLO A;  2HDD A;  2ZB9 A;  4DYR A;  2K9N A;  1ZR2 A;  3HOZ J;  1MBJ A;  2O7O A;  5GPC A;  5M3M J;  3QPL A;  3O8H A;  1T33 A;  2VPR A;  4A3G J;  1CQT A;  1IRZ A;  4A69 C;  3I4M J;  1JUS A;  3A01 B;  2O9L A;  2CU7 A;  3ZQH A;  1A6I A;  3LSP A;  2QCO A;  3S17 J;  1U8B A;  1OCT C;  3WHC A;  1MSF C;  1H89 C;  1I50 J;  2FJ1 A;  1IUF A;  1HLV A;  1GV5 A;  3Q0V A;  2K9S A;  2R0Q C;  5M5Y J;  5IYB J;  2Y9Z A;  5K7F A;  1R9T J;  4AC0 A;  4DCK A;  2HOT A;  3JRI A;  4BBR J;  2ID6 A;  1TWC J;  2ECC A;  5IP9 J;  5GPA A;  1JT0 A;  3Q3S A;  2O8K A;  2RAE A;  2E2I J;  1PUF A;  2HXI A;  4A3C J;  1BJZ A;  3CCY A;  1MBK A;  1LFB A;  3ZQG A;  2FD5 A;  3A02 A;  2DA3 A;  1P7J A;  4C2M J;  2NOG A;  2L9R A;  4DZP A;  1LE8 B;  1B72 A;  5FKO A;  2ID3 A;  2DMN A;  1WI3 A;  2LTP A;  4IHY A;  3A01 A;  3D1N I;  3S15 J;  5F27 A;  3JRH A;  3S1Q J;  4JQ0 D;  1TWG J;  2R5Z A;  5M5X J;  1APL C;  3BTI A;  3HGG A;  5J3L A;  3HOY J;  1GV2 A;  4XRS A;  2R5Y A;  3MVP A;  3QPS A;  2L7M P;  3ZQI A;  3JRA A;  3BT9 A;  2VUM J;  3PO3 J;  2X48 A;  5EYR A;  1Z0X A;  1XC5 A;  3BG5 A;  4A3F J;  1FIP A;  3S1N J;  2K40 A;  1JUP A;  3LOC A;  4C3I J;  5J1Y A;  3CDL A;  1WH5 A;  1MBE A;  5FLM J;  2IAI A;  2ECB A;  2JMW A;  1FTZ A;  5EG0 B;  3Q0U A;  2HOA A;  2K9Q A;  3GBG A;  1GVD A;  2X6O A;  5C4X J;  1IC8 A;  1QVU A;  3LNQ A;  1UG2 A;  2W48 A;  2NVY J;  5IOZ A;  2LD5 A;  1Y1V J;  3SDG A;  3SFI A;  3RZO J;  3JR9 A;  4EEF G;  2M2E A;  2WAQ N;  3TP3 A;  4B3A A;  4JYK A;  1X2N A;  2KDZ A;  3ZQC A;  5FLV A;  4JX4 A;  3W6V A;  3M4O J;  1ETY A;  4M3F A;  3FKI J;  4V2G A;  2H1K A;  2OPT A;  5M3F J;  1RKW A;  2EBI A;  1MBF A;  4D7M A;  4A3B J;  1BL0 A;  3B6A A;  5FKK A;  3HM5 A;  3BR5 A;  3ZQL A;  5EG0 A;  1HDD C;  2E19 A;  2JJ7 A;  2XGD A;  5FKL A;  5EEA A;  4M3E A;  1U9N A;  3HB9 A;  4D5C A;  1SAN A;  1UMQ A;  1HOM A;  2DA4 A;  1FIA A;  2ME0 A;  3JRD A;  1OJL A;  5C3E J;  2I10 A;  4FCY A;  2M9H A;  3A03 A;  3JRC A;  3S14 J;  2FX0 A;  2TRT A;  2Y30 A;  4CYC A;  2XRL A;  2R7Z J;  1ETV A;  3K2A A;  1B8I B;  2AO9 A;  3LSJ A;  3S2D J;  4MO7 A;  1TC3 C;  4QTR A;  3C2B A;  2NVX J;  4C3J J;  3HOX J;  1JT6 A;  2IEK A;  4L5E A;  5BNG A;  4B1R A;  5E3M A;  3K7A J;  3ZQF A;  4A93 J;  4QIW N;  2JK3 A;  3Q0W A;  4M3D A;  1WGX A;  5K7Z A;  1W0T A;  2XSD C;  1MSE C;  4DYQ A;  2CUF A;  2EZH A;  2Y9Y A;  1ORK A;  4FE4 A;  5M5W J;  1GDT A;  1ETX A;  2DA1 A;  5EZG A;  2MG4 A;  3BR1 A;  4I6Z A;  4C3H J;  3G1M A;  1U78 A;  1RET A;  2CQQ A;  1JKR C;  2DA7 A;  2HQ5 A;  2DA2 A;  1T56 A;  3HDD A;  1X58 A;  2E2J J;  3QQA A;  5JLX A;  5EDN A;  1IDY A;  2XPV A;  1FEX A;  4BY1 J;  1H8A C;  3H0G J;  2EZL A;  4A3E J;  1DU6 A;  2DTZ A;  4IEJ A;  2YS9 A;  4IHW A;  3BR2 A;  1JTY A;  1ITY A;  1B8I A;  1MBH A;  5FKN A;  2LK2 A;  1IDZ A;  3BQY A;  3BQZ A;  4UUT A;  2OF7 A;  4S0H B;  2VKV A;  1GT0 C;  1JJ6 C;  2JWT A;  5E3O A;  2L7F P;  1OCP A;  1F36 A;  5C4J J;  1VF9 A;  4Y52 J;  2JA8 J;  3TP0 A;  2DN0 A;  2DA6 A;  1I6H J;  2P81 A;  5JLW A;  3S1M J;  3GTQ J;  1K61 A;  3H3V K;  5E3L A;  1QPI A;  1VFC A;  2GM4 A;  2HXO A;  3GTL J;  3BG3 A;  1ZGW A;  4IHV A;  3GTK J;  3FK6 A;  3UKG A;  1JKO C;  5IOY A;  3F0C A;  4LOC A;  2NVT J;  3LSG A;  5EZH A;  1S7E A;  2EZI A;  4GFB A;  4BBS J;  4M6V A;  1F43 A;  5F0C A;  4A3L J;  2G0E A;  5DTD A;  1Q1V A;  5EF6 A;  1ZQ3 P;  4JX5 A;  4UUS A;  1JUM A;  4XK4 A;  3FK7 A;  4JPZ B;  4FTH A;  3G1O A;  4RDU A;  2Y2Z A;  1O4X A;  4XID A;  2MSY A;  3PO2 J;  5IYC J;  3O8G A;  2R93 J;  2R5Z B;  2EZK A;  1G2H A;  2LFB A;  2DMP A;  5F0F A;  1BW5 A;  1FJL A;  5IYD J;  3VPR A;  5GP9 A;  2Y31 A;  2X9D A;  1BA5 A;  1GUU A;  1DU0 A;  4A3K J;  3MKL A;  1ETO A;  4Y7N J;  1WH7 A;  1AKH A;  4XRM A;  2LKX A;  2VI6 A;  1JKQ C;  1HCR A;  2LLK A;  2WB1 N;  5F08 A;  3M3Y J;  4DW6 A;  3OSF A;  2LY9 A;  3BTC A;  3NAR A;  3S2H J;  9ANT A;  1MH4 A;  1IJW C;  4JX6 A;  3BR3 A;  1RKT A;  4IHX A;  3GTM J;  1ENH A;  2Y0S N;  4B4C A;  1RES A; 
#chains in the Genus database with same CATH topology
 1KQS O;  1LDJ A;  4EM1 A;  1JY3 O;  1HTL C;  2VT3 A;  1S5L H;  4IRH A;  2XPW A;  1L0N J;  4G94 A;  4LB5 A;  1XS9 A;  1NGM B;  3SZT A;  2H8R A;  3WTW C;  1MBG A;  2IVM A;  2HOS A;  1EZV I;  3GHG C;  1NTK J;  5GTI E;  2XPU A;  5IT9 K;  4GDF A;  1YJW P;  2OTJ P;  4I99 C;  2CFO A;  1LB2 A;  2E5Z A;  2HGC A;  4LFU A;  4XLF A;  3J7A O;  2L4M A;  1NU1 J;  1SFO J;  5LGN A;  3BPX A;  3I64 A;  3PUF A;  5J1U A;  3OYN A;  3CCS I;  3U2R A;  1O3S A;  1PDN C;  1P84 D;  4M9Z A;  2GUS A;  3R4Y A;  4ZKP A;  3PEF A;  1KD1 Q;  3SYT A;  3RL0 B;  4OVN F;  3DKX A;  4IX7 A;  3MQ0 A;  1HF0 A;  1VND A;  3MGN A;  1IV6 A;  3CO7 C;  1MD0 A;  4XN3 A;  3L70 J;  2P6T A;  2M4K A;  4XBF A;  1NTZ J;  3IH4 A;  2CRG A;  3VYT B;  3CXH D;  1TXG A;  1E3O C;  3L75 E;  5C39 A;  3V2R A;  5BVZ A;  2HYJ A;  3DU5 A;  1EH8 A;  5D6E A;  2L9N A;  1XG1 A;  1H9T A;  1HST A;  2CW0 F;  2M34 A;  1ZRC A;  1K4T A;  2F5F A;  1KIL D;  3BZK A;  3IH2 A;  5IT3 A;  3IQD B;  3I56 P;  1DP7 P;  2DQL A;  2RH0 A;  2XSJ C;  1T98 A;  2AHQ A;  2MW8 A;  5ICE A;  1UFM A;  1USE A;  3NXS A;  4RKU J;  5BU8 B;  4V2F A;  1H88 C;  3GTG J;  2A45 I;  4HNV A;  5AVV B;  3R0A A;  4L9V A;  2QSF X;  2I76 A;  1SQQ J;  1MNE A;  5D5X B;  1BSH A;  2IGN A;  3SEZ A;  5KVR A;  3WS7 A;  1IG7 A;  4XKC A;  3S16 J;  1LVA A;  4I76 A;  1LFP A;  2JRT A;  1VQP I;  1SEU A;  2TCT A;  3AE5 C;  2LY1 A;  2QQA A;  3CCE I;  3L74 G;  1KZH A;  5H20 A;  1NH3 A;  2D2C C;  2BW3 B;  1U2W A;  4AVZ A;  3C7D B;  3HKZ N;  3K70 C;  1NK2 P;  4KN7 X;  1ERD A;  2YKQ A;  1VQ8 P;  4OIP F;  5FKM A;  2ISZ A;  2B0L A;  3CLO A;  2FEZ A;  5C44 J;  4PD4 H;  3AEE C;  4MIM A;  4BHB A;  4UV9 A;  3DEW A;  4AUW A;  2WPV B;  4H0L D;  4CCN A;  1X1D A;  3IFM A;  2OYO A;  1TW2 A;  2MYS A;  3GCM A;  4RS8 A;  1YTZ I;  2M8R A;  1LFU P;  4YEJ A;  1WFX A;  3S32 A;  3T1B A;  2IBD A;  2L5Q A;  3HBL A;  3GTO J;  2UYY A;  1IO2 A;  3WU0 A;  3V7C A;  5L3C A;  1R5G A;  1P4W A;  3MD0 A;  4CH7 A;  3HSE A;  2L0K A;  3PRJ A;  1IXC A;  4CCL A;  1B59 A;  3HHH A;  3S1R J;  4Y28 J;  1K9M Q;  2W83 C;  1RIO H;  3KFW X;  2J5U A;  1T95 A;  1TQI A;  2YX7 A;  3FMQ A;  4MFD A;  3RSN A;  2OFP A;  2QJY C;  2Y0D A;  4KA4 A;  5LHI A;  2E76 D;  2M0M A;  4WY4 C;  4RAY A;  4A0Y A;  3C3W A;  4FIS A;  3MKY B;  5K1Y A;  1YRN B;  3F6O A;  4M6Y A;  2LF7 A;  1HA8 A;  3L1P A;  1LUJ B;  2I1K A;  3H1I D;  4GDO A;  2O03 A;  1YO5 C;  3QU3 A;  4V19 K;  2JA5 J;  1I39 A;  2EIN H;  3OAK A;  4AQR D;  3QAH A;  2Z5U A;  1MMG A;  3KLN A;  2IYO A;  4KIT B;  3SJM A;  1W1W E;  1HGV A;  1JKP C;  4N9I A;  1NU1 E;  3VFZ A;  1GL2 B;  4ASV A;  2Q1Z B;  3F23 A;  2P67 A;  1RQV A;  1URQ B;  5E79 H;  1U8R A;  2MC3 A;  4QLC U;  1BI1 A;  3RKQ A;  1EDI A;  3BR0 A;  3JTH A;  3HUS C;  3ELK A;  2JDI H;  3I71 A;  1BI0 A;  2VKE A;  3VMZ A;  2QBY B;  2ESN A;  1I3Q J;  5H2F E;  4JP0 A;  3ZOB A;  3L70 E;  3GEZ A;  4OL9 A;  3PSI A;  2CO5 A;  5EEH A;  5J1R A;  1Y47 A;  3RYR A;  3W67 A;  4ON0 A;  3WTY C;  4BE2 A;  3DCF A;  2X51 A;  5DYM A;  3B6C A;  2V79 A;  5GAD J;  3KYC B;  3U1A A;  2NPS B;  1FBS A;  2JZY A;  2Z2S B;  5KKZ C;  4P5O A;  5KAI C;  3FIS A;  2QEX I;  2V4H A;  3TK1 A;  3E1R A;  3GTP J;  1FX7 A;  5F04 A;  2KUB A;  3PQK A;  4F91 B;  3CD6 I;  1SFE A;  1FZP B;  3VSL A;  1IFD A;  5APX A;  2OZ6 A;  1RE4 C;  3N97 A;  1Z56 A;  2HVQ A;  4WY4 B;  3OYA A;  3P7K A;  1TLH B;  2HDD A;  4KHX A;  1WT6 A;  3BJA A;  2DFI A;  2BVL A;  3DWL E;  1NTZ K;  3BCC E;  3MHV A;  1SVF A;  2K9N A;  3LA3 A;  2VON A;  4L5I A;  1FYM A;  2O7O A;  4Y4R A;  4RM2 A;  3CTV A;  2HOE A;  2QVA A;  1Z1D A;  1URQ A;  4B43 A;  1T33 A;  4B47 A;  4N9H A;  2NVU B;  3G71 I;  4NQW B;  4D0P A;  3LSI A;  1IRZ A;  2VT2 A;  4A5M A;  1F12 A;  3H9J A;  1FJK A;  3AE2 C;  3I4M J;  3H1J J;  2HLO A;  3A01 B;  3L72 J;  2CU7 A;  5AW5 B;  2XAF A;  3DPT A;  3TSI A;  3ZQH A;  3S8P A;  4UVB A;  2AEF A;  2Z5I A;  3PLN A;  1SQQ K;  3CWB J;  2A5W A;  4DJA A;  1GL2 D;  2NPS D;  2BEZ F;  1A02 F;  4FET A;  1X1B A;  1I50 J;  1YRL A;  1KU2 A;  4H13 C;  2DJI A;  5KAI H;  3F89 A;  1GV5 A;  1GW3 A;  3GWZ A;  1URQ C;  3OYL A;  1MIJ A;  3K4C A;  4EAT A;  2RGV A;  2R0Q C;  3VYS B;  1ON2 A;  1D8K A;  1Q81 Q;  3ROU A;  2LNB A;  1WJD A;  3IP4 B;  2ZJQ F;  4BXL A;  4DCK A;  1DEB A;  3HD7 A;  1E0E A;  4M71 A;  1YI2 P;  1EV7 A;  3K4B A;  4IXA A;  5IP9 J;  3MKZ A;  2VLA A;  5GPA A;  1BGY D;  3PP5 A;  2RAE A;  1VPD A;  5AW6 B;  3CO6 C;  3CLQ A;  2JA2 A;  1OKR A;  4YEL A;  3E6C C;  3CC2 I;  4A3C J;  1USS A;  3CKY A;  1TZL A;  1LFB A;  1TNS A;  1LWU C;  1KIL A;  1FOS E;  5J8C A;  1RQU A;  1P7J A;  2R7D A;  1MKM A;  4IPA A;  1S9K E;  2V4J C;  3M8E A;  1B72 A;  4M9S A;  5FKO A;  1SD6 A;  1WI3 A;  2KMU A;  2LTP A;  4JBA A;  3H1L D;  4OWR B;  3PL8 A;  4LIU A;  3C2G A;  1P92 A;  4I2L C;  2VKH A;  3MZH A;  3S1Q J;  4O5V A;  2CK3 H;  4JQ0 D;  3H6P A;  3TO9 A;  3MD2 A;  4IHT A;  2FYU E;  1X1P A;  1I1G A;  1SQX K;  2Q8K A;  1EDK A;  2QJK B;  5JI6 A;  1SQB E;  3WUU A;  2EIJ H;  1OWA A;  2QQ8 A;  5M5X J;  4H4K C;  1W4M A;  1APL C;  3MIW A;  1O7L A;  4RGU A;  2OQG A;  2Q2E B;  2R7T A;  2IS1 A;  4CZC A;  1DP3 A;  1GV2 A;  1LTS C;  5EFW B;  5AVR B;  2DPD A;  3E0J B;  3JAM Z;  4XRS A;  2DW3 A;  4WB4 A;  3AG2 H;  2R5Y A;  3MVP A;  2GAU A;  3QPS A;  3H9G A;  1HKQ A;  5GTI H;  4Y99 B;  1YOV B;  2O3F A;  2O61 A;  3B71 A;  2MC4 A;  1UJ8 A;  2KIQ A;  5LD2 C;  3KP5 A;  1KU7 A;  4N0B A;  4HNU A;  1R6R A;  1YQA A;  2H6C A;  2G8Y A;  2K86 A;  1K4S A;  3RI4 A;  2H8P D;  4ZKU A;  4UVA A;  3BG5 A;  2H1L A;  2AEM A;  1QLE D;  5CBO A;  1Q86 Q;  3LOC A;  2QA4 P;  2PRR A;  3H1L E;  4G7Z F;  1O3T A;  1EZV D;  2ECB A;  3A5T A;  2Q5U A;  1S29 A;  5KAI E;  5EG0 B;  3TQN A;  3T97 B;  1I6X A;  1XSV A;  1FDM A;  4ZH4 F;  2XAJ A;  1EXJ A;  4BEH B;  5KLV J;  2NRA C;  1SQB D;  4XLE A;  1MMS A;  1HJ0 A;  2K37 A;  4LC1 A;  2M5W A;  4OIO F;  3Q3D A;  3DPU A;  2W8Z A;  2NS0 A;  2PFB A;  2XF5 A;  2ZSH B;  5H6Q A;  4OM8 A;  1QVU A;  3E7K A;  3VYU B;  2DFE A;  3AEC C;  3HJE A;  1OW7 A;  2FFD B;  4DT0 A;  1QHH D;  3M1C A;  3GW6 A;  4E12 A;  1M76 A;  4IHS A;  2E75 D;  3RZO J;  5FD6 A;  1IFM A;  3EDP A;  2WQY C;  3CXH I;  3L75 J;  2ZME B;  4L18 B;  1L0L E;  1NYH A;  2L02 A;  1XCB A;  5KK1 A;  2UXX A;  1A35 A;  5FLV A;  1IXR C;  4EJV A;  4JX4 A;  5MGB A;  5GTH E;  5B5E E;  3EET A;  1ETY A;  5GTI C;  1KMI Z;  2Z99 A;  4M3F A;  1NAY A;  3S93 A;  2O0Y A;  3ABM H;  1YYV A;  3GZN B;  2H1K A;  2IYP A;  2BVM A;  1GMJ A;  2M1B A;  2ZJR F;  2PMU A;  1RKW A;  5M3F J;  5CLS A;  1G2C B;  4NPD A;  2QJK C;  4R1N A;  2Z4E A;  3Q5R A;  3DTK A;  2ESH A;  2O01 J;  3OYG A;  1BL0 A;  1BI3 A;  2LH9 A;  3MKW B;  2IBZ E;  2V7Q J;  2G9W A;  4ITV A;  4OU0 A;  4D6T E;  2N1T C;  1D1B A;  4YII A;  5EG0 A;  3H1H D;  1BR2 A;  1OR7 A;  3CCR I;  4JYC A;  2KRF A;  5BQT A;  5FKL A;  4M3E A;  1SVO A;  4HX8 A;  2SPZ A;  3K9T A;  1HOM A;  2BEQ D;  1Y0N A;  3RYP A;  1QU3 A;  3MMY B;  1W5C C;  2ME0 A;  1PL5 A;  1M75 A;  3G9R A;  4I7Z B;  5APY A;  2WSE J;  3QP6 A;  3OYC A;  1H89 A;  3BZ6 A;  4HLY A;  4FCY A;  2N9B A;  3QOP A;  3I3L A;  3NTN A;  2Z16 A;  1WJ5 A;  4OAZ A;  1LP1 B;  3HG9 A;  2XRL A;  4A2U A;  4BJ5 C;  4N6J A;  1QQI A;  1FC2 C;  4UB8 E;  5CBN A;  2L3D A;  3PIP F;  3K69 A;  3K5B A;  3SFD C;  4CSW A;  3L2R A;  5HWS A;  4G6T B;  4MO7 A;  2W6A A;  2QJY B;  2WB1 A;  3JCU C;  5JVT A;  2V1N A;  1RE3 C;  3HUG A;  5D4S A;  1NTM E;  3FR8 A;  1QZZ A;  2M5A B;  5CVI A;  2QKM B;  1AVY A;  2ETH A;  3NFQ A;  5GAH J;  3DFG A;  2G7U A;  4HZF A;  3K7A J;  4NBQ A;  4A93 J;  3H1K E;  1EDL A;  3EYI A;  2XKM A;  1TNT A;  4YFX F;  5CQG A;  3FX0 A;  1J59 A;  1YE9 A;  3H1H E;  5HLH A;  4YXD C;  5DUK A;  2W24 A;  5K7Z A;  2I8D A;  2KZV A;  3K6G A;  1SQX J;  1FBM A;  3L74 J;  2C6Y A;  2GWR A;  3FF5 A;  4ENJ A;  3FXO A;  4R8H A;  4YTP C;  3UR3 C;  3HE5 B;  3M06 A;  1FSE A;  3T8T A;  1RC9 A;  1OW6 A;  5B5E H;  2C9L Y;  2DA1 A;  4EDF A;  1ZAO A;  3ONQ A;  1B9M A;  1LT1 A;  2L54 A;  4ZYE A;  2CUZ A;  2YXQ B;  3I55 P;  5K5Q A;  1N77 A;  1GK4 A;  3ULK A;  1HW1 A;  2XHK A;  4C3H J;  1K79 A;  5KCM A;  3GLM A;  2ZXI A;  2CQQ A;  3OL4 A;  1EVZ A;  2HQ5 A;  3HHG A;  2VOD A;  3QHA A;  1SQX G;  1UIX A;  3IR9 A;  2J58 A;  2CPS A;  3ZWC A;  1T56 A;  2FYZ A;  3E5Q A;  2BY2 A;  1HKT A;  5CJ0 A;  5J4V A;  1DLJ A;  3WTT C;  2E71 A;  2P5K A;  1SC7 A;  2M7A A;  2P7J A;  2XDJ A;  4P55 A;  1IFN A;  5JLX A;  1VQL I;  5LRS A;  3HIF A;  3RCO A;  3JCU H;  2ELJ A;  1YVE I;  1PV3 A;  3U1K A;  2FA5 A;  2HQA A;  2XGX A;  4BY1 J;  1S2E A;  5CHX A;  4ENM A;  5TIS C;  3H0G J;  3TKY A;  4A3E J;  2FQ3 A;  3DKW A;  1FZB A;  2DYR H;  4IEJ A;  1K05 A;  2ZJS E;  1FU1 A;  4IHW A;  1N86 A;  3ZWB A;  1S3J A;  2P4Q A;  3CCM P;  4E21 A;  3KYD B;  5FKN A;  2KIK A;  4OGQ B;  3DBL B;  2IPP A;  3PIO F;  1U7M A;  3V2N A;  4HOB A;  4NC8 A;  3BQY A;  3OS0 A;  4ZJZ A;  4C7N B;  1KB9 D;  2R5B A;  1MJB A;  2L7F P;  3CCL P;  1OCP A;  3BDD A;  2X6Y A;  4Y52 J;  3CDH A;  1L3L A;  1S7A A;  5B5E C;  4DYD A;  3MUD A;  4H0L C;  2WTY A;  2CV1 A;  2GXG A;  2DA6 A;  1I6H J;  4HX7 A;  3FWE A;  5JLW A;  3S1M J;  2IBZ G;  3QPT A;  3R60 A;  4RAF A;  1SVM A;  5DCF A;  2XAH A;  3IAO A;  3TO7 A;  4BQQ A;  2QEN A;  2DQR A;  1XN7 A;  2JPC A;  2DI3 A;  1P84 H;  1K78 B;  4EOT A;  3LMM A;  3LW5 H;  1VFC A;  1YJW I;  1P6R A;  2GM4 A;  2OTJ I;  2F4I A;  1SQQ G;  1RF1 A;  1M57 D;  4ZZL A;  3GTK J;  4HAM A;  3UKG A;  2RKH A;  1JKO C;  2E35 A;  2KDO A;  4LLH A;  3RK2 B;  1KGS A;  2AEJ A;  3F0C A;  4XOT A;  2V7F A;  3DXJ F;  1Z21 A;  3NEU A;  1X79 B;  1CW5 A;  1XX5 A;  4GFB A;  2F4M B;  2Z3Y A;  4CCK A;  1WQ2 A;  1F43 A;  2KSE A;  1N7L A;  4H44 B;  3FBI B;  3I56 I;  1JXS A;  4D3D A;  2G0E A;  2LKP A;  1VQN I;  1LT9 B;  1HQC A;  4P1W A;  2XKO A;  3WFJ A;  2E75 B;  1D1C A;  2QLZ A;  2QBY A;  1R1T A;  3IAM 2;  2W25 A;  4FAS D;  1YJQ A;  3L2C A;  1KC8 Q;  3FK7 A;  3EFG A;  3W2W A;  1Z7L A;  1SQB K;  4FTH A;  2AXT H;  1M1J B;  2PP6 A;  2E43 A;  3SZP A;  1BGY J;  2L9S A;  1LP1 A;  3PSF A;  1LT9 A;  3AE1 C;  2ZNZ A;  2CWE A;  3G1O A;  3QP5 A;  2VJI A;  4WF2 A;  4XMY A;  5CJ9 A;  3V8L A;  1R4M B;  3F8C A;  3ISP A;  2Y75 A;  3S2W A;  2WPR A;  1V55 H;  1W7P B;  3WG9 A;  2AS5 F;  3RK3 E;  1WDL A;  3RK3 C;  3HUG B;  2H09 A;  1DPU A;  1LGH B;  1N75 A;  4MQV A;  1AOY A;  5ILU A;  2R93 J;  2QM8 A;  2C9N Y;  4A0X A;  1VF5 B;  3FXK A;  1HF9 A;  1W7P A;  4HB1 A;  1F14 A;  2DMP A;  1JY2 N;  3ZGK A;  2I1J A;  3VPR A;  2N1T D;  1S7O A;  2DLL A;  1X1A A;  4FX0 A;  2WC2 A;  3P9C A;  2X9D A;  4PZJ A;  2PMZ A;  1YTY A;  4H44 D;  4S3M A;  4U3F E;  1GUU A;  2VQG A;  2JQ7 A;  4PJM A;  2H8W A;  4A3K J;  1NOH A;  1R49 A;  3C9I A;  3CCL I;  3FKJ A;  3R4K A;  1AKH A;  2LKX A;  3VEP A;  1L0N G;  3DTI A;  3J80 K;  2FXO A;  2E1N A;  1YX3 A;  2WB1 N;  1JHH A;  5F08 A;  3WOD F;  3OMY A;  1VQ7 I;  1N1G A;  1SFC B;  5APT A;  1UG0 A;  1JB0 J;  1BR4 A;  2P5L C;  4BH9 A;  2CW8 A;  2A07 F;  5TGT A;  9ANT A;  3CME I;  3DOJ A;  1MUU A;  1XTC C;  4EJT A;  2O5R A;  3V2P A;  2EIM H;  2KK7 A;  3GTM J;  2KQR A;  3K1M A;  1ENH A;  3Q9V A;  3FXE A;  3GHG A;  5B66 H;  1RES A;  4PV1 C;  3LAJ A;  4LK0 F;  4WXD A;  2CUE A;  1A5J A;  2XB0 X;  2KSJ A;  4OIR F;  5IP7 J;  5DCM A;  1ZRD A;  3H3Z A;  1R1V A;  4EZB A;  4N4O B;  3OA7 A;  1D5Y A;  3OIO A;  4E70 A;  4MLO A;  1OCZ H;  2HKX A;  2HQN A;  1BR1 A;  3LST A;  1LT9 C;  2K9L A;  3JRG A;  2BGC A;  2NOJ B;  1BN5 A;  3ZQQ A;  2LP0 A;  3JAM K;  4OGQ C;  4U3F D;  4XIC A;  3BCA A;  4DGW B;  1PGN A;  2E74 C;  1VQ9 P;  3KPE A;  4CA0 A;  3H1I E;  2ZXH A;  2L2O A;  4XOR A;  5DS9 A;  1YIT I;  1LJ8 A;  3B8E B;  3V42 A;  4CO8 A;  2K88 A;  3MN2 A;  1GU5 A;  1YYC A;  4ZTF A;  4CCO A;  2WAD A;  1VQM I;  5E3N A;  3A3Y B;  3P9I A;  3KCC A;  2XV4 S;  4LGD E;  3GFL A;  1XMX A;  4ZC3 A;  1TQM A;  2M3A A;  1SAX A;  1Z67 A;  3Q5F A;  4JK1 X;  2EW2 A;  4AM3 A;  1WMK A;  2BE5 F;  1K83 J;  4DLL A;  4KN4 X;  3C18 A;  3WTZ A;  3PFY A;  4PJ0 H;  1VTN C;  2WV1 A;  2ZXW H;  1N78 A;  1WCM J;  3Q3C A;  1T3U A;  4J19 A;  1R5L A;  2EWN A;  1MZ9 A;  5IP6 A;  3LWF A;  2ZME C;  2OZU A;  4A3I J;  2CYY A;  1K78 A;  1BW6 A;  3G17 A;  1RF1 B;  3M9A A;  4D7N A;  5H2F H;  1Q7Y Q;  3BRT B;  2ZT9 B;  2FQ4 A;  5CJ4 A;  2COM A;  3ZCO A;  2P6S A;  1YB4 A;  3ITK A;  1FOS F;  1KQF B;  1ZRF A;  1Y6I A;  2DMQ A;  3KP6 A;  4XNF A;  1J1E C;  3II6 A;  1NHA A;  1M56 D;  3FIW A;  4E4H A;  2HI3 A;  2BY0 A;  1NTZ D;  5AVW B;  3BTL A;  2E1O A;  2IRF G;  2DJN A;  4E7K A;  1ZRT D;  1JM0 A;  3TOA A;  1FZA A;  3BPV A;  2QSG X;  2L5G B;  4AVP A;  3IH3 A;  1AQT A;  3PH0 A;  3V4Q A;  1AQ5 A;  4MFE A;  1NTK G;  3MEX A;  4RGS A;  2JA6 J;  1M90 Q;  1U7J A;  2YIU B;  1HDP A;  2QYO A;  4RGX A;  2OQR A;  4JQF A;  3CC7 I;  2WAE A;  3BCC D;  4M3B A;  4XR6 A;  2PEX A;  3T5X A;  4ABZ A;  3OWT A;  4KNY A;  3TNU B;  2ZYG A;  3CP2 A;  4NDL A;  3ZDM A;  4JPZ B;  3CQZ J;  4HA8 A;  5L3B A;  2XB5 A;  2RVC A;  4EQQ A;  3QYB A;  3OYB A;  1T39 A;  1WZ2 A;  4HJG H;  4G6Q A;  1AFO A;  1XCV A;  1N25 A;  5D5U B;  1YW9 A;  2BV6 A;  2E5N A;  1PUF B;  1KQ8 A;  3O6Q A;  1ZR4 A;  1FTT A;  3L7W A;  2XU6 A;  1OVV A;  2EK5 A;  4EMS A;  5LHG A;  4BAC A;  4PJ0 C;  4YG2 F;  1FSH A;  2D45 A;  2KS1 B;  3EUA A;  3TGU J;  2N8G A;  3GFI A;  5FFZ A;  4GOE A;  5IPA A;  1LTJ A;  3AE4 C;  1W0U A;  5AIP A;  2O6G E;  1RF0 C;  1NG7 A;  2FFD A;  1YRN A;  2L01 A;  2R92 J;  3OYM A;  2P10 A;  4DOZ A;  4HYT B;  2XAS A;  2MKV A;  3BRV B;  1NJI Q;  5AVU B;  2E1M C;  2K4B A;  4F3Q A;  5DUI A;  2M0C A;  3RL0 g;  3HXL A;  3COA C;  5KJ7 C;  4A3M J;  1TWH J;  1I3A A;  3R6S A;  4C2U A;  4DZJ A;  4QPO A;  2JUC A;  1E3P A;  2EH3 A;  3I9V 2;  2LVS A;  5DD8 A;  4C30 A;  3T8R A;  3GZ6 A;  1VQO I;  4BDZ A;  1KFM A;  3E6D A;  5EGO A;  1JMM A;  3H2Z A;  3TGN A;  3C7A A;  1AU7 A;  1E3H A;  2JVG A;  1MNM C;  3HAD A;  1FNN A;  1X2M A;  3L70 D;  1RR7 A;  1FMW A;  1AHD P;  1FWZ A;  1M1E B;  1FDO A;  1OIP A;  2X1C A;  4L73 A;  1HGZ A;  3BG9 A;  3G1L A;  3AG4 H;  1IUY A;  3KX2 A;  5FWN A;  4XLH A;  2EA2 A;  2VQH A;  1MJ9 A;  1OVU A;  3H32 A;  1S9K D;  2BW3 A;  1ZV8 A;  4HF2 A;  1LWU B;  2EIK H;  2MD0 A;  1I1S A;  3I59 A;  2QYT A;  2IX7 C;  4A7P A;  4ETS A;  2A45 G;  4PV1 B;  3H32 B;  5FGM A;  2KZG A;  4XL9 A;  3A2K A;  1ZKG A;  4WVZ A;  1RPW A;  2YX4 A;  3FM5 A;  1MMA A;  3HPH A;  2XC7 A;  3VN0 A;  1VQ6 P;  4IL6 C;  1OR7 C;  1POG A;  4XKV A;  1H0M A;  2NS7 A;  1LE8 A;  2AQF A;  2HYG D;  4CPG A;  1HKS A;  1BOB A;  1MMN A;  2ME6 A;  2HPI A;  2V26 A;  4I7H A;  4F92 B;  3AE8 C;  1Y39 A;  3CMA P;  4PZE A;  4DYR A;  4XM3 A;  2PQ8 A;  1YJN I;  2ZYA A;  3QOD A;  3BCC G;  2H94 A;  1ZYR F;  1B1B A;  4RES B;  3D0S A;  4EJU A;  1QZY A;  1RHZ B;  2CG4 A;  3O8H A;  4I2O A;  1FOY A;  3GFJ A;  5H6R A;  2IGO A;  1CQT A;  3KZI C;  5HLT A;  2STW A;  5CVU A;  1QO0 D;  3P9K A;  4PK4 A;  3H1J D;  4A69 C;  4IQ4 A;  3GHY A;  4LIT A;  2O9L A;  4BJ6 C;  5LLQ A;  5JE8 A;  1U5T B;  4EVI A;  1EZV E;  2AXC A;  1A6I A;  2K3R A;  5APS A;  3R61 A;  3LSP A;  4LGW A;  2BHZ A;  1SFU A;  5CVJ A;  2HQR A;  2DOE A;  2QCO A;  3KPH A;  3CC2 P;  2P5V A;  2WMM A;  1LKX A;  3J7Z I;  1SQP K;  2B9B A;  4KJZ A;  2ZAE B;  2XND H;  2FSW A;  1H89 C;  1DD4 A;  4M3L A;  4DNC A;  3CMA I;  4XOP A;  1PJR A;  1OW8 A;  2WSF H;  2FJ1 A;  1T3J A;  1IUF A;  4AIH A;  4L76 A;  2Z1D A;  1KYZ A;  1W5S A;  5DCM B;  5CCH A;  3KP3 A;  1QNT A;  2DK5 A;  4G9Y A;  3C7J A;  5E8I A;  1W36 C;  5M5Y J;  1AWC A;  2IXS A;  5IYB J;  1SFK A;  4CIC A;  4RB1 A;  2Y9Z A;  5KTB A;  1K04 A;  1BGY E;  5K5R A;  3QYE A;  4E7Z A;  1E79 H;  4AC0 A;  1G3S A;  1JY2 P;  1W5C E;  1ONV A;  5DDG A;  2D2C B;  3RPQ A;  2ZYD A;  3VOP A;  4IFD K;  3JRI A;  4C2T A;  3CI9 A;  1OYW A;  4BBR J;  1R4N B;  2HTJ A;  1TWC J;  1YHQ P;  5CVR A;  1DIP A;  1Y9B A;  1JT0 A;  4O6J A;  1HXD A;  1PUF A;  2KNC B;  5KLV E;  2HYN A;  4I02 A;  5E1X A;  2PBI A;  2YMK A;  5GTH H;  1LTB C;  3ZQG A;  1FE6 A;  3OV8 A;  2DU9 A;  2XV5 A;  3A02 A;  2DA3 A;  2IGK A;  2O3J A;  1G3W A;  2NOG A;  4WY4 D;  2KNC A;  1QGP A;  2DMN A;  2IBZ D;  3ZQ7 A;  4IHY A;  4KT5 C;  1XGS A;  2EIL H;  4BEH A;  1IAW A;  2OU2 A;  4DZO A;  3R0J A;  1G1I A;  2IA0 A;  3L74 D;  3JRH A;  3GX4 X;  4CUG A;  5JHU A;  4I09 A;  3IRQ A;  1OVR A;  2EV6 A;  3HSF A;  1JEK A;  1QHG A;  1JI8 A;  2UV1 A;  1F17 A;  3HKZ A;  2I9P A;  4I7Z C;  4D9J A;  1BC8 C;  4X0G A;  2FY8 A;  2QJP C;  1F9N A;  3HGG A;  5J3L A;  2R7F A;  4NPE A;  4DBQ A;  2F2E A;  3C2H A;  1DH3 A;  4M73 A;  3B73 A;  2CMP A;  3KEO A;  4WCG A;  3O2P E;  1MFZ A;  3L71 G;  2DFH A;  4B86 A;  4I0A A;  3ZQI A;  1NTM J;  1YQ3 C;  4R4M A;  3BT9 A;  2VUM J;  1N7S D;  4HDU A;  3I4P A;  2W82 A;  5AW8 B;  1IN8 A;  1VDF A;  4LB6 B;  1VQM P;  2IW5 A;  2OYH B;  1Z0X A;  3DLA A;  3ML6 A;  1MV8 A;  2XZR A;  1YBK A;  1SFX A;  2VL8 A;  3AED C;  3HD7 C;  2K40 A;  1JUP A;  3I5U A;  3OR1 C;  4Z2Y A;  4EGY A;  2WSC J;  5AW2 B;  2HWV A;  3MP7 B;  5JHF A;  3S1K A;  3TDK A;  4HST A;  2EFN A;  4BJT A;  5FLM J;  2IAI A;  4OOI A;  3L2Q A;  1FTZ A;  3L74 E;  2JEE A;  3M8J A;  4XSZ F;  2YO3 A;  2KOG A;  4ZYG A;  1WRG A;  4S05 A;  3G71 P;  1GVJ A;  2FOW A;  1SQB G;  2K9Q A;  3BJO A;  3CX5 I;  3L72 G;  4M72 A;  4B44 A;  4BE1 A;  1GVD A;  2PLA A;  2NZ2 A;  3CJN A;  2X6O A;  3LA7 A;  3M7G A;  3OYI A;  1NHL A;  2A6H F;  3OS1 A;  4C46 A;  2W48 A;  3FMS A;  4BXF A;  3CCV I;  1VZ0 A;  5BPI A;  2V6E A;  3GLX A;  2IDB A;  2LD5 A;  1Y1V J;  3SDG A;  4EEF G;  2M2E A;  1SFC A;  1YIO A;  3TP3 A;  2IZ0 A;  1J09 A;  3GXO A;  3F3S A;  3K4M A;  2YPR A;  3G2B A;  1E2X A;  2KDZ A;  1IFI A;  1JGS A;  1PGJ A;  2DDA A;  2HFE D;  4YPC A;  2KLO A;  3DLL F;  2B9S A;  1L4A B;  1ZP0 C;  3L36 A;  1UHW A;  4V2G A;  3GMA A;  1X4O A;  1D3Y A;  4NQW A;  2OPT A;  4Y13 A;  3L73 J;  4D7M A;  4HLX A;  1X0V A;  3E97 A;  3HM5 A;  1R5I D;  3WUV A;  3BR5 A;  1SQP J;  3QWL A;  4WK8 F;  4A5N A;  1HDD C;  2JJ7 A;  3A0H C;  4J01 A;  3D5R C;  2YXR B;  4L9T A;  1SS1 A;  4I6M C;  2BYV E;  3HB9 A;  2Q7C A;  4R4L A;  3CC7 P;  2DA4 A;  4JBZ A;  4I01 A;  4CZZ A;  2YSR A;  1A6Q A;  4P9U A;  3J81 K;  4NPF X;  1N7S C;  2FU4 A;  2I10 A;  1OIS A;  5C3E J;  5BOX A;  4JYB A;  1RE3 A;  2NNN A;  3HD7 B;  3WGI A;  3I58 A;  4G8X A;  3JRC A;  3S14 J;  2TRT A;  2Y30 A;  4BHP A;  4BDY A;  3G3Z A;  1VQ9 I;  1G6N A;  1PP9 D;  2R3C A;  5GAG J;  3ZMD A;  3M0D C;  3ZXS A;  2B7E A;  1SMT A;  3FHN A;  2PGD A;  3WGG A;  2D1H A;  3AKZ A;  1J1D C;  1NWQ A;  2NVX J;  4C3J J;  1GK6 A;  3L4F A;  4B3J A;  1JT6 A;  1OCR H;  2XAG A;  4XON A;  3L6D A;  5E3M A;  1RZ4 A;  3M91 A;  4L75 A;  4HNT A;  2OUM A;  1Q90 D;  4BAY A;  3KHU A;  3MZY A;  2PI0 A;  3H5N A;  1WGX A;  4LD5 A;  5LEK A;  1SQV K;  2HDC A;  4UB6 H;  3ZN0 A;  4BE0 A;  1W0T A;  2MFZ A;  1T38 A;  5HVQ C;  1XTG B;  3L9F A;  1MSE C;  3LIE A;  2CUF A;  2YKO A;  5A2Q K;  3CWB G;  2EZH A;  4AU7 A;  3L70 G;  5APU A;  3M9B A;  2Y9Y A;  1U5T A;  3H1L J;  4FE4 A;  1IZN B;  1FDI A;  3LA2 A;  4L74 A;  4ASW A;  4KIC A;  3BZC A;  1ETX A;  1V54 H;  2LYC A;  2PJR B;  1R7J A;  2ZT9 D;  4FQG A;  2JO1 A;  2EV0 A;  3D6Y A;  2MG4 A;  2V1D A;  5CCH C;  3BR1 A;  3KEQ A;  3TO6 A;  4BYY A;  3VOD A;  1U78 A;  1NTM K;  3BVH A;  3CCE P;  2LC2 A;  3VP8 A;  3BLY A;  1JKR C;  1F4K A;  1JHF A;  3ECH A;  2HPC A;  2A5Y B;  2K5C A;  4AD9 A;  2OJE D;  3M9Q A;  3S3O A;  5KAF H;  3AAF A;  4L9N A;  1BE3 E;  4GWG A;  3H1K G;  3TYY A;  5AVS B;  3DQV C;  1YFH A;  2DTR A;  5EDN A;  3VSK A;  4GRI A;  1NTK K;  2PLY A;  1BSN A;  2PMH A;  1RRJ A;  5APV A;  1ULY A;  4O3M A;  1NU1 K;  2RMZ A;  2I5U A;  3F3X A;  2ZVO B;  1WJE A;  2EZL A;  3LID A;  1PGP A;  3PJS K;  2TDX A;  2DTZ A;  3HN2 A;  1LSO A;  3BR2 A;  2LG4 A;  2LF8 A;  4KUG A;  1Y56 A;  2K02 A;  4LG3 A;  2KLV A;  3F9K A;  2HEO A;  1S6L A;  3D1L A;  2HU9 A;  2QRX A;  2P4W A;  2MD5 A;  1KZU B;  1VQ5 P;  2VC0 A;  1GT0 C;  4KDP A;  2ZXE B;  2JWT A;  4IKF A;  2L4A A;  4U7J A;  1VF9 A;  2FYN C;  2JSC A;  1QEX A;  1OPC A;  1GTW A;  4LG0 A;  1SD4 A;  1G59 A;  2OYI A;  4AYB A;  4M74 A;  2IA2 A;  4EM0 B;  3HRS A;  4P96 A;  2WV0 A;  4RB3 C;  3H3V K;  5E3L A;  4LG0 B;  1QPI A;  2KIS A;  1MDM B;  2HPC B;  5A9T A;  1D1A A;  1S5L E;  1KFN A;  2OYI B;  3GTL J;  3K96 A;  5KJ7 D;  4G7H F;  2VJ5 A;  1YIJ I;  2EPF A;  1YJ9 I;  2XUB A;  2ZJ2 A;  1S72 I;  3C7C B;  3HE5 A;  3CF2 A;  5IOY A;  4LOC A;  1WSU A;  4ZYH A;  2K27 A;  1FYL A;  2ZXX A;  1S7E A;  2VBY A;  1GHC A;  4NHJ A;  2W27 A;  4M6V A;  4HH2 A;  1M1K Q;  5FD5 A;  1PP8 F;  1EH6 A;  3ZN1 A;  1ZH5 A;  2BHY A;  2E1C A;  1VQ5 I;  4DBR A;  1WDM A;  2ZFU A;  5FFX A;  5EF6 A;  3AG1 H;  4WXH A;  1ZQ3 P;  2IS4 A;  4JX5 A;  2HVR A;  3H1C A;  3B5N A;  4A6E A;  1JUM A;  2VJJ A;  4HW0 A;  1YTZ T;  4MTE A;  2X6X A;  1VPC A;  1X8Y A;  2DT7 B;  4N4N B;  4UB8 C;  3L71 D;  4MGR A;  3BCB A;  1EJ9 A;  4S04 A;  1SLQ A;  2HDW A;  3PNV A;  3E6M A;  5FO5 A;  3TGU G;  3ZW8 A;  2Y0E A;  4IOI H;  3ERE D;  4MN4 C;  1P4A A;  2B87 B;  2LOO A;  1UB9 A;  2QM3 A;  4L0Y B;  1N1E A;  2ZC2 A;  2M5A A;  2FRH A;  2IS2 A;  4GIF A;  3CWB E;  2MH2 A;  1ZGJ A;  2R5Z B;  1G2H A;  4IM7 A;  2LFB A;  2J59 M;  3U59 A;  1O3Q A;  3AE3 C;  2HFH A;  5D5V B;  2R7V A;  1FJL A;  1I27 A;  3ADO A;  3HOT A;  4FGW A;  1VL2 A;  3L73 E;  5JR3 A;  3I55 I;  2QIW A;  3SFE C;  2ZNY A;  5J6X A;  1NTZ G;  1BA5 A;  1XD7 A;  1LTG C;  3K4J A;  2J5O A;  1BJA A;  3AL0 B;  3WFI A;  1SQP E;  4LJZ F;  3L2V A;  1WH7 A;  3CCQ I;  2VI6 A;  1JKQ C;  2CSO A;  1L0N E;  3NMD A;  3VMY A;  4OMZ A;  3QYF A;  3CCM I;  3OSF A;  1HH0 A;  3S2H J;  2O1J A;  3KYQ A;  2ZXJ A;  1DGR M;  3OYD A;  5ICF A;  4AIJ A;  1XTA A;  2KJC A;  4R1H A;  2KB7 P;  3HE4 B;  3QWO C;  3S3N A;  1IJW C;  2YR2 A;  3BR3 A;  3FZV A;  4XSX F;  3W2V A;  2VOO A;  3T0Y A;  3I54 A;  2Y0S N;  3Q9S A;  1T2K C;  1JGG A;  2DMT A;  2D1V A;  5DEQ A;  2JUG A;  2R5Y B;  1A36 A;  2OA4 A;  2XGE A;  5CCG A;  1T2K D;  3ESW B;  4ZMD A;  1N73 B;  1R36 A;  3OJA B;  2NPS A;  2EB7 A;  3GTJ J;  1PIX A;  1JOC A;  5HOD A;  2HVS A;  1H8A A;  1Z05 A;  1IGN A;  2DOF A;  3VYR B;  2VOP A;  2GXB A;  4QPQ A;  1QGK B;  4KJM A;  4L0Z B;  1OMI A;  2YUS A;  3JSO A;  2CGP A;  2CPB A;  3AE9 C;  5F1R A;  3GZ5 A;  3CC4 P;  2VBW A;  4G6D A;  1LTJ C;  1L4A C;  2QSI A;  2WTB A;  5KKZ B;  4F93 B;  2W1O A;  3BTJ A;  5JFR A;  1K73 Q;  4PD4 D;  4C7N A;  2A05 A;  3K70 D;  1BOA A;  3HZJ A;  4G12 A;  4II2 A;  1NTM G;  2D2C D;  2GBY A;  2RNG A;  1FOX A;  2MJZ A;  1B4A A;  5F0H A;  2A06 E;  2W6B A;  2KS1 A;  2POH A;  2OYI C;  3ZMS A;  5ILV A;  3PID A;  1U9O A;  4IF4 A;  2JRM A;  2IFM A;  3GME A;  2R7R A;  1GD2 E;  1FMV A;  1CF7 A;  2DT6 A;  2LXC B;  2FNP A;  2OYH A;  2OTL I;  3N4X A;  3HOU J;  4OWF A;  1AKH B;  3HGY A;  4A3D J;  3WMM 0;  1ZXG A;  1NTZ E;  1Q2N A;  4D3S A;  5AVT B;  1ZLL A;  2ELK A;  2R4G A;  3B02 A;  2DDB A;  3EUH A;  4AUX A;  1N73 A;  2L7Z A;  4KMF A;  2IGM A;  2QJP B;  2GF2 A;  4BXX J;  3FXD A;  2AXT E;  1NTC A;  4KFC A;  3CCV P;  5EJC A;  4D5F A;  4PD4 I;  3WGH A;  1NTK D;  4KIS A;  1T6S A;  2VXZ A;  5EGO B;  4A6D A;  1ZTR A;  1KA8 A;  3E7L A;  3LSR A;  1ZRE A;  1LNQ A;  3P8C D;  2VE8 A;  4GOF A;  1TU3 F;  4N3Y B;  4HBL A;  2DPU A;  3CP8 A;  2V1U A;  1E17 A;  2NVQ J;  1A31 A;  1KB9 H;  2GOM A;  3H1H G;  3L37 A;  1ETK A;  2M8E A;  3HEF A;  4OQY A;  3LSH A;  1NO4 A;  4U3F J;  3G73 A;  3CCR P;  1YJN P;  3RKW A;  3RQI A;  4E7L A;  2A06 D;  2NS8 A;  4PUS A;  5FB2 A;  5HNF A;  3RPU D;  1JTX A;  4O9B A;  4UB6 E;  1WWX A;  2V9V A;  1I5Z A;  2KIF A;  2ZCW A;  3RIR A;  3ZMV A;  2QQB A;  3G6E P;  1B72 B;  2O01 N;  2MAB A;  4Y3O A;  1SQP G;  3KDP B;  4C9Y A;  5K7H A;  1ODD A;  3JRF A;  2FYU D;  2XGC A;  2RN0 A;  1KQ9 A;  3H1H J;  3Q1M A;  3AL0 C;  1TT5 B;  2CQ7 A;  4XQF A;  1RUO A;  2GZW A;  1OCC H;  1P4X A;  3B4S A;  3C1L A;  1PFI A;  1ZHF A;  5HS7 A;  3ECO A;  4RAZ A;  2OD5 A;  3U21 A;  2MLK A;  4JOM A;  2P7C B;  1UST A;  4B3H A;  1NTK E;  3JC2 2;  4RLQ A;  1FZG A;  4KT0 J;  2K3F A;  3RK3 D;  4RBO A;  4HV5 A;  3EQL F;  1IK9 A;  3UNG C;  3OS2 A;  2E5T A;  3WU2 C;  4B09 A;  4BY7 J;  1Z77 A;  3ZRG A;  2BCC E;  2COB A;  4E13 A;  3A7O A;  1H0T B;  4ZYA A;  2E1M B;  2FXA A;  3H1J G;  4Z1M H;  2P8T A;  3QRF F;  1QVG O;  4X6A J;  1TWA J;  4F7Z A;  1XDU A;  1KYO I;  1QVT A;  2DOA A;  3AG3 H;  3RZD J;  2CV2 A;  1JTH A;  1FOW A;  2MA3 A;  1J5Y A;  3BY6 A;  4EYY Q;  1GXP A;  4KIG A;  2JA7 J;  3BR6 A;  1IF1 A;  1T0F A;  1UHM A;  4I0B A;  1OCO H;  4KMU X;  5A2Q Z;  2M8G X;  1ETQ A;  4UUS B;  4J00 A;  1L0N K;  2X1D A;  5J40 A;  2DA5 A;  3VWB A;  5LEJ A;  5CKT A;  1ETW A;  1VQ6 I;  4W97 A;  4FE7 A;  3I4N J;  1YHQ I;  3VMX A;  2WPS A;  3F8N A;  1Z6T A;  2WAQ A;  4YIR X;  2IBZ I;  3L35 A;  3HRT A;  2A45 H;  5F1J A;  1ACI A;  1PVE A;  5KLI B;  5KLV K;  3HTS B;  1OLT A;  1R22 A;  1V5F A;  1R1U A;  3KIO A;  2PN6 A;  4XRS G;  5FJ8 J;  1D8J A;  1OXZ A;  3CCJ P;  1FC3 A;  3IKV A;  2E2H J;  1OFC X;  2VXD A;  3OSG A;  2A06 G;  2JTV A;  1JE8 A;  4J0E A;  3MTU E;  4PD4 E;  1NKN A;  1P84 E;  1L0L D;  2GIZ A;  4RB0 A;  1Y1W J;  2ZB9 A;  1LEB A;  1Y8A A;  1NAF A;  3B5N D;  2F5E A;  2PAJ A;  3WU2 H;  4HF1 A;  1RH5 B;  1ZR2 A;  3HOZ J;  3RJP A;  2X4H A;  3K1P A;  2KKO A;  3ZP5 A;  3AE7 C;  3TF5 A;  5GPC A;  1J1D B;  4RJT A;  3WUT A;  2LMD A;  5M3M J;  2VJ4 A;  4A3G J;  3ASO H;  3D5S C;  5E79 C;  5D8K B;  3RBZ A;  1LDD A;  3SWK A;  3A2A A;  5APW A;  1IL0 A;  1JUS A;  3OW2 O;  4PJN A;  1AJY A;  4IJA A;  4U3F G;  3EYY A;  1QL1 A;  2YKP A;  2OCE A;  1LVK A;  4RM3 A;  4AID A;  3S17 J;  3CD6 P;  1U8B A;  3H5R A;  1OCT C;  3CTA A;  1MSF C;  2ZT9 C;  2EA4 A;  3GYH X;  3FXJ A;  2R5D A;  4FT8 A;  3RDI A;  1WI9 A;  1SQV E;  3C1D A;  3HUS A;  2RN7 A;  3USS A;  2M0B A;  2CQN A;  2K9S A;  4D6T G;  3PFI A;  3CXH H;  3WTV C;  1PYV A;  1ZEL A;  3O3K A;  4WX9 A;  3CMM A;  2V6C A;  5K7F A;  1USD A;  2H6B A;  3O8Z A;  2HOT A;  3IWZ A;  1X19 A;  5E79 E;  3TNU A;  3QU6 A;  2QZ8 A;  3CCQ P;  3SDB A;  3Q3S A;  1IC2 A;  1V5E A;  1KYO E;  3OY9 A;  1SD7 A;  1ZLJ A;  2OC6 A;  2HXI A;  1R8E A;  1BJZ A;  1T8Z A;  1MBK A;  3IUO A;  1U57 A;  3BAS A;  1ZG3 A;  2FD5 A;  1P2F A;  4D6T J;  4DZP A;  2ID3 A;  1GU4 A;  1FZE A;  3VMA A;  5CCG D;  3FXR A;  1T8I A;  4OQZ A;  3BC8 A;  5LBQ A;  3D1N I;  1CSB A;  1YLF A;  4GYI A;  3S15 J;  5F27 A;  2BEO A;  2C0X A;  3KXD A;  2CH0 A;  2P7V B;  1W5T A;  1WHU A;  2J5P A;  3HYI A;  4GGG A;  2FML A;  4MQ9 F;  2R5Z A;  2QE7 H;  2A6E F;  1MND A;  2Y0M A;  4Q5S F;  1NU1 G;  1S5L X;  2KIM A;  1UII A;  1G2C A;  3ZWA A;  3J7Y J;  3HUS B;  1WRJ A;  3BTI A;  4HX4 A;  2OTK E;  1ZOY C;  5F64 A;  3ULQ B;  1AA7 A;  4KUE A;  3TBI A;  3PDU A;  1WJB A;  2PG4 A;  1YS6 A;  2NNY A;  5E20 A;  1GZL A;  1IZ1 A;  2L7M P;  4FHT A;  1EA3 A;  4PGG A;  3JRA A;  1J9I A;  3REO A;  5CCG C;  2QEX P;  1M2W A;  1NU1 D;  1W2E A;  1KQ0 A;  1K6O A;  5EYR A;  4K35 A;  1XC5 A;  4N78 E;  1FIP A;  2GA1 A;  1P9Q C;  3DP7 A;  3S1N J;  1AA0 A;  1BCC E;  5J1Y A;  3HPG A;  1J2J B;  3BOQ A;  3JSP A;  1WH5 A;  1MBE A;  3H35 A;  1G8X A;  5TJJ A;  1JCC A;  5E1Z B;  1G3T A;  3BJ6 A;  3Q0U A;  4HV6 A;  4HQE A;  3P5J A;  1QPM A;  5FRO A;  2JKV A;  3HWR A;  2YIU C;  1SAU A;  3H25 A;  3SQN A;  3V8J A;  5C4X J;  4G7O F;  1DD3 A;  3LNQ A;  1K8A Q;  1ZGA A;  2ISY A;  2QQ9 A;  3V7R A;  5IOZ A;  1VQP P;  5E17 F;  2FMY A;  4QWQ A;  1Z82 A;  4ZDP A;  1NG6 A;  3O6B B;  4B3A A;  4BRY A;  3DBR B;  4JYK A;  1IRG A;  3ZQC A;  4B48 A;  1MGT A;  3BG6 A;  3W6V A;  3A0B E;  3M4O J;  2H7H A;  1JDJ A;  4P9F A;  3CF5 F;  1BE3 D;  2F4O B;  1HJB A;  3FKI J;  2PFX A;  1FZF A;  3GO5 A;  3F8B A;  4CYD A;  3GUD A;  3KP4 A;  3MOG A;  1SQV G;  2K1A A;  1MBF A;  3CJR B;  4NC7 A;  1A04 A;  4A3B J;  1YQ4 C;  5FKK A;  5HLI A;  4RB2 C;  3J80 Z;  1VF5 D;  5AW4 B;  3TDZ C;  3OYK A;  5A9S B;  2FKW B;  2XF6 A;  1U5T C;  3ZQL A;  3B5N C;  2D2W A;  1LJ9 A;  1PPJ D;  2E19 A;  5CVV A;  2FBW C;  2XGD A;  4CCJ A;  1FP2 A;  3OBB A;  1DPR A;  2OBP A;  2UXN A;  1J0R A;  2STT A;  4XKW A;  4U7B A;  2KLU A;  2L9V A;  2VN2 A;  3JRD A;  1MMD A;  1OJL A;  3N4M A;  5ILS A;  2K85 A;  1E5W A;  2BAS A;  1XSD A;  1SQB J;  2NYX A;  1PP9 E;  2E74 B;  5ICG A;  4FX4 A;  3A03 A;  4ZNC A;  4CYC A;  3HRM A;  1FJP A;  2FBK A;  2XF7 A;  2VE9 A;  1PUE E;  1M66 A;  2E76 C;  1A02 J;  1ZAR A;  3K2A A;  2HPM A;  1B8I B;  3LSJ A;  3HRU A;  4UVC A;  3S2D J;  4OGQ D;  2KPM A;  3W6J B;  1RI7 A;  2JT1 A;  3C2B A;  4QTR A;  1GW4 A;  1DX7 A;  5HOO A;  3L75 G;  4KUH A;  2IEK A;  3PNY A;  2NAZ A;  5L8R J;  3V8K A;  3HC7 A;  4B1R A;  1S1C X;  4F55 A;  4QIW N;  3ZW9 A;  5TIS H;  2KXP B;  4Y15 A;  3ZR8 X;  5AW0 B;  1DQU A;  4KT6 A;  2K3P A;  3V2Q A;  1ZME C;  1KIL C;  4HQM A;  1XPX A;  4IOA F;  1W36 D;  5AYV A;  4RAG A;  1HSJ A;  2WSC H;  1GL2 A;  1SMY F;  5DJU B;  1IN6 A;  1ORK A;  4RO0 A;  2DK8 A;  4LLL A;  1PGO A;  1R00 A;  4NC6 A;  4RGR A;  5M5W J;  4AIK A;  1GDT A;  2FXP A;  4HKZ H;  2W85 A;  1PGQ A;  3A0B H;  1S4X A;  2K4J A;  3VOE A;  3F8M A;  1WPQ A;  3HTK B;  5CMZ A;  1BCC G;  1WJF A;  2EFW A;  2A61 A;  4DJG A;  1WKM A;  3SSU A;  3CCS P;  1GLN A;  4I6Z A;  1QMG A;  3G1M A;  2BXZ A;  4XLC A;  2GXA A;  2K9J B;  1EZV G;  1KS9 A;  2DA7 A;  1OQY A;  5J4Y A;  5JVG F;  4UNO A;  3HTU A;  2DA2 A;  4ESB A;  5DM7 F;  4BQA A;  1L0L K;  1IK7 A;  3HTK A;  1DDN A;  2V9K A;  3SFZ A;  3HDD A;  4H44 C;  1Q82 Q;  1X58 A;  2E2J J;  4YIF A;  3O6Q B;  4H13 D;  5HDK A;  3QQA A;  4NUB A;  2G7H A;  1TBX A;  4IOC F;  3UIA A;  3M07 A;  1EKE A;  1JUN A;  2OTL P;  1IDY A;  1W2B O;  2FUG 2;  1H8A C;  2RDP A;  3RL0 C;  3WU2 E;  5ED4 A;  1I36 A;  3PQJ A;  2UUZ A;  4GO1 A;  2HDH A;  1FY7 A;  2DO7 A;  4II3 A;  2LKS A;  1VQ4 P;  2YS9 A;  4GXO A;  1IXS B;  2IJL A;  3P8M C;  1PP9 G;  4GT1 A;  1L0N D;  1VQL P;  3IHU A;  4GYG A;  1LPQ A;  2AXT C;  3FMR A;  3VDX A;  1BBY A;  2VB6 A;  3HL2 A;  2ZJP F;  1KQL A;  1IDZ A;  1X4P A;  3BQZ A;  4UUT A;  1Y0U A;  2A68 F;  2ADU A;  2VKV A;  1KB9 I;  5KLV G;  4K3A A;  2N1T A;  1F36 A;  1RE4 A;  3A0B C;  3IC7 A;  2JA8 J;  3FGA D;  3FWL A;  2UZK A;  2WT7 A;  4C7R A;  2DN0 A;  3PUB A;  1OX3 A;  1ZLK A;  4BWN A;  1PP7 U;  4ZTJ A;  3BG7 A;  1DLI A;  3W68 A;  5ICC A;  1ZN5 A;  3RK2 C;  1RF0 A;  3CJQ B;  3L72 D;  2KZJ A;  3HOS A;  1Z7U A;  3V6I A;  1RY3 A;  4XA4 A;  4Y99 C;  1J75 A;  4WWC A;  1SP4 A;  3BG3 A;  1STZ A;  1OYY A;  1WP4 A;  4BHC A;  4BXU A;  3AEB C;  3TGU D;  3HRN A;  3RKX A;  5FRN A;  4DQ2 A;  2NVT J;  1XSX A;  3SHF A;  2A3S A;  5DV5 A;  3WTX C;  2XKP A;  2E75 C;  4BBS J;  5F0C A;  1YW7 A;  4YFK F;  1LNW A;  5J47 A;  2Z33 A;  1RF1 C;  1X9V A;  2DT5 A;  4E7I A;  2ZSI B;  3CDI A;  3L71 E;  1X3Z B;  2WWW A;  1Q1V A;  3CUQ C;  4D6T D;  4EM2 A;  2E60 A;  3G0O A;  3LSM A;  3BCC J;  4UUS A;  4XK4 A;  2Y0S A;  5K5G B;  1HW5 A;  5KNL A;  3QSG A;  2GQQ A;  5E1W A;  3FWN A;  3NWS A;  3SZG A;  3W6Z A;  1YON A;  5B66 C;  1G4D A;  1QZE A;  4PZC A;  2ITA A;  4RDU A;  3F6V A;  3GG2 A;  5AVX B;  2Y69 H;  1X0X A;  1N73 C;  2FFD C;  4M9X A;  4HF0 A;  3J7A Y;  3L72 E;  4XID A;  1LTA C;  1AVO A;  2VQL A;  1R71 A;  4W7Z A;  2MSY A;  1U6G A;  2F48 A;  4Y17 A;  2K9Y A;  5IYC J;  2UWJ E;  3L73 D;  3FR7 A;  2ZVN B;  4ANJ A;  3N05 A;  1JY2 O;  2KP8 A;  4WXC A;  1SD5 A;  5F0F A;  1O3R A;  3C8V A;  3L2W A;  5IYD J;  5GP9 A;  3L73 G;  1U0J A;  3D5L A;  1KQG B;  1NKZ B;  2NXN B;  1DU0 A;  3Q2Y A;  2QA4 I;  1RUN A;  3MKL A;  1ETO A;  3MWM A;  4PFP A;  1WJC A;  3QPH A;  3OYE A;  3G4S I;  1YJ8 A;  3D6Z A;  3MZW B;  1HCR A;  3IL2 A;  1X3W B;  3M3Y J;  3RBX A;  4HSR A;  4DW6 A;  3RPU A;  3CME P;  3NAR A;  2CW7 A;  2B88 A;  2O1K A;  5IY5 H;  1T0F C;  1VQ4 I;  3S4R A;  2W7N A;  2UWM A;  1RNL A;  1TQP A;  1IRX A;  1MH4 A;  3V5B A;  2P2U A;  4LMY A;  1BC7 C;  2RC4 A;  2KIU A;  2P81 A;  2KRC A;  4B4C A;  3LAP A;  3V4G A;  5L3D A;  4XLN F;  3F21 A;  1L0L J;  4TLF A;  3KP7 A;  2IPQ X;  3K4K A;  2MGQ A;  2RV8 A;  3TW6 A;  5H2F C;  1L0O C;  1IRF A;  5HLG A;  1CZQ A;  3PLR A;  2KP6 A;  3PHL A;  2BZT A;  1DUX C;  2R7Q A;  3EGO A;  2O8X A;  1S72 P;  1FOK A;  4AYB N;  4CYC B;  2D5V A;  2G3A A;  2WTE A;  3NAU A;  3CUQ B;  2KI7 B;  1HWT C;  4ESF A;  5D8L B;  1NH4 A;  4IZZ A;  2CQX A;  2FBH A;  2H27 A;  2WY8 Q;  2VC1 A;  4KUM A;  3HOW J;  1IJD B;  2L7K A;  3CZ6 A;  5AVZ B;  2EJR A;  2MLG A;  4E7S A;  4A0Z A;  4CXF A;  2FE3 A;  3TED A;  3R2P A;  3GLL A;  2B63 J;  2H89 C;  2LSO A;  3OOU A;  5CYV A;  4BNC A;  2V1X A;  4UY8 I;  2CQK A;  2E74 D;  5AW1 B;  3H3U A;  4BQO A;  2HG5 D;  2LDU A;  3NWT A;  1MFT A;  1DGW Y;  4U7D A;  2WSE H;  4DYC A;  2X58 A;  3K10 A;  4W7Y A;  3IF4 A;  2M3E A;  2FYU G;  2OGU A;  2WBM A;  2ZO4 A;  3CCJ I;  1P7I A;  2FYN B;  3GW2 A;  3H36 A;  2OQQ A;  3L75 D;  4IFF A;  3IN6 A;  3JRB A;  1N7S A;  1BM9 A;  5EEG A;  3V7S A;  2YU9 J;  2R44 A;  3J81 Z;  1MH3 A;  3TL4 X;  1BIA A;  1B9N A;  3LFK A;  2M30 A;  1EF4 A;  3RGU A;  4ZYD A;  3GF7 A;  2HOD A;  2DCE A;  1X0T A;  1KYW A;  3IV5 A;  1N8R Q;  3QOE A;  3OIQ A;  4UHT A;  2E36 A;  2VAS A;  1MJA A;  4BKX A;  1CI6 B;  2RQP A;  2Q6Q A;  1Z3X A;  1YIJ P;  1YJ9 P;  1LJ2 A;  3GVA A;  5D5W B;  2X1E A;  1EC5 A;  1G1J A;  2GOX B;  3WTU C;  1T2K A;  4J0F A;  3P8C E;  1VI0 A;  3LFU A;  1QRY A;  4YFN F;  4JF7 A;  2LY2 A;  3GHG B;  3CMY A;  2VKD A;  1Z9C A;  2KL4 A;  1KN7 A;  3B5N B;  2EFQ A;  5BS6 A;  1W7P D;  3W6U A;  4QSH A;  3F22 A;  3CJT B;  2HR3 A;  3KE2 A;  4A3J J;  2JR8 A;  2OYH C;  1O7F A;  2PMZ N;  2VBX A;  3KP2 A;  4Y33 A;  1M8O B;  5KLV D;  2LR2 A;  1M1J A;  4LK1 F;  3E5X A;  5LRR A;  5TIS E;  4HRI A;  4XFJ A;  2RRE A;  2AQE A;  1BGY G;  2QF7 A;  3D70 A;  2JVH A;  3L00 A;  1Y8R B;  3JRE A;  5HDN A;  1F0Y A;  2FF4 A;  2Z9O A;  3A4C A;  1KIL B;  1IV8 A;  1FLI A;  1EVY A;  4L9J A;  1L4A A;  1LDK B;  4W1U A;  1LQ1 A;  3Q5P A;  3U1C A;  2EV5 A;  4E7H A;  3AE6 C;  5K5O A;  3X2Q H;  2IT0 A;  1FPQ A;  1EQ7 A;  5CCH D;  1LTI C;  1ZK8 A;  4X1E A;  5AW7 B;  3G6E I;  4I98 B;  1FZC B;  2XRN A;  1TT0 A;  3E1S A;  5GAE J;  1CI6 A;  3IAS 2;  2EQR A;  2JSP A;  5A9S A;  2LXB A;  3LQR A;  3WHB A;  2IA1 A;  3ABU A;  2IS6 A;  4PFO A;  3M8F A;  1J2X A;  3H0D A;  5LFA A;  5A9R A;  3ZGY A;  4OIN F;  2QGU A;  3DF8 A;  3D71 A;  1FS0 E;  3HE4 A;  3RQ4 A;  5FLX K;  1KYO D;  4IL6 E;  3K1N A;  2LR8 A;  2DMU A;  3ZHB A;  3CXH E;  4PJ0 E;  2KT0 A;  3KZI H;  2FYU K;  2W4S A;  2ACJ A;  1WPK A;  2W6J H;  3WTS C;  1FBU A;  1M1J C;  1TWF J;  1UEL B;  2A6T A;  2CJJ A;  2K7L A;  3ZPL A;  1KIL E;  2OAZ A;  5ERI A;  4M3G A;  1NK3 P;  1KYO H;  1X22 A;  2K9J A;  4YXW H;  3MFK A;  2MH9 A;  4HYE A;  1XDS A;  2Q0O A;  3LW5 J;  2DXI A;  3TW7 A;  1UCR A;  2Q9I A;  3H9Q A;  1XGO A;  2AXL A;  1BI2 A;  2HKO A;  3PM1 A;  4IRG A;  2LBF A;  1VQK P;  3HOV J;  2RNJ A;  2XNX A;  2QKL B;  3DBH B;  1VQK I;  4Z6Y A;  2QVO A;  3ABL H;  4BGD A;  1H9G A;  1JJ8 C;  4XKB A;  4M6X A;  2JN6 A;  2JWD A;  5D6F A;  5CPR B;  3A0H E;  2Q3I A;  2BCC G;  1UHS A;  4RLF A;  4QMA A;  2R7O A;  3WU1 B;  2YMY A;  3GF2 A;  2GLO A;  1TP4 A;  1XMA A;  1LTT C;  1K6Y A;  1T6A A;  2VPL A;  4BS9 A;  3CCU P;  3M9H A;  3OYF A;  2ELH A;  3CC4 I;  2PJP A;  1MBJ A;  3TMO A;  5E8G A;  5GTH C;  1IW7 F;  2ZBK A;  3EWK A;  4GOD A;  3VB2 A;  2FOK A;  3IWF A;  3QPL A;  5APQ A;  1VQ8 I;  2VPR A;  1ON1 A;  4K2E A;  1U3E M;  2YU3 A;  1BCC D;  4EV0 A;  3HDH A;  4H13 B;  3M0A A;  1B6A A;  5FRM A;  5B1A H;  1ZG1 A;  1Q1H A;  3IRR A;  4BQN A;  1ZN2 A;  2KHM A;  2P0W A;  1JY3 P;  1SQV D;  3CCU I;  3LL7 A;  4PV1 D;  2Q1K A;  2CFX A;  2W00 A;  1SFC C;  3DKY A;  1IO4 A;  3WHC A;  1DEE G;  2ZKZ A;  2DAO A;  5LGU A;  1HVV A;  4CGZ A;  2LBF B;  1URQ D;  1C0W A;  3I5C A;  3E6B A;  3ZMZ A;  1Z91 A;  1BIB A;  3L2U A;  3SWF A;  5DM6 F;  2A69 F;  1HLV A;  3MCZ A;  3Q0V A;  4IL6 H;  2WY7 Q;  3L09 A;  1LSJ A;  1GL2 C;  1ZRT E;  3RQS A;  2D3T A;  2CVZ A;  1MW7 A;  1V3F A;  4ENK A;  1R9T J;  1JNM A;  4IVN A;  3BAT A;  3MUD C;  5AVY B;  2H43 A;  2M87 A;  3FXQ A;  1FYK A;  4YCA A;  2ID6 A;  2O01 H;  3F5H A;  2ECC A;  2V7Q H;  1V4R A;  2O8K A;  5F6F A;  4MEY F;  3RKY A;  4MTD A;  4PSX A;  1QBJ A;  3DEU A;  2E2I J;  5KJ7 A;  2WT7 B;  1KU3 A;  4XLP F;  6PAX A;  2P1J A;  3CCY A;  3RL0 D;  2IFN A;  4BL0 B;  4CHU A;  3HD7 D;  2L91 A;  3ABT A;  2PX9 A;  4RMN A;  3A1Y A;  2HTS A;  4C2M J;  4U0V A;  1LE8 B;  2L9R A;  3Q5S A;  1QVF O;  4B8X A;  3E5U A;  1WJA A;  2KRH A;  4HG2 A;  3F72 A;  2ZME A;  4EJO A;  3A01 A;  3CUO A;  1CGP A;  2FXM A;  2QM7 A;  3H1L G;  3RK2 D;  4AWX B;  4HPQ A;  2BXY A;  2K9M A;  1KON A;  1TWG J;  4OMY A;  2E5Y A;  4BU2 A;  2R7X A;  3EPZ A;  4UV8 A;  1PPJ G;  1D0Z A;  1L4A D;  1GXQ A;  3JW4 A;  3M0D A;  2OCC H;  2HYF A;  1UAA A;  2HOD B;  1MZB A;  2CS3 A;  3IKT A;  3OOP A;  1BCC J;  3H1I J;  3KZI E;  4Q48 A;  3FHZ A;  1XB4 A;  4OH8 B;  4F52 A;  3OYJ A;  2HS5 A;  3HOY J;  2KYV A;  2YNY A;  4BRY B;  1FZC C;  5TJH A;  3H1K J;  4D1Q A;  1O57 A;  2MBF A;  1S9H A;  3ADP A;  4N78 D;  3DTE A;  1KU9 A;  1D7M A;  2LRE A;  4U0W A;  3PO3 J;  2FYU J;  4AYC A;  3BRO A;  2X48 A;  3N7N A;  2RQQ A;  3KET A;  1YW8 A;  2WZ7 A;  3JSV C;  4A3F J;  1IN7 A;  1M7L A;  3CPW O;  5AIQ A;  1RR8 C;  4C3I J;  5M1B A;  1F1Z A;  3QH9 A;  3VTP C;  4IFM A;  3CDL A;  4EGZ A;  1NVO A;  1Z6R A;  2JMW A;  2JPB A;  2OV7 A;  4RA2 A;  5AVQ B;  4UUV A;  1REP C;  1YX5 A;  3A0H H;  2WWY A;  2HOA A;  2E7W A;  3GBG A;  4U88 A;  2VRS A;  3JCU E;  1XGM A;  1LEA A;  2RKL A;  1IC8 A;  3FXL A;  2R32 A;  1QX8 A;  1HC8 A;  5HDG A;  1UG2 A;  3H5A A;  2NVY J;  5L3F A;  2GUV A;  1F5T A;  1YI2 I;  5BPD A;  1TW3 A;  3WG7 H;  2OAR A;  3K0L A;  2CV0 A;  3SFI A;  4E7J A;  3EQ2 A;  3JR9 A;  4I1L A;  2WAQ N;  3DV8 A;  3PJG A;  2XIG A;  1L0L G;  1X2N A;  3GF3 A;  2IP2 A;  1TTY A;  3NQO A;  1Z3Y A;  4D3F A;  5L3E A;  1R58 A;  4CCM A;  2W84 A;  5HNH A;  4OAY A;  5AW3 B;  4NB5 A;  1XGN A;  4IO9 F;  4LIV A;  4H0E A;  5KAF E;  1AV1 A;  2WAF A;  3OIP A;  2EBI A;  2XAU A;  3FXM A;  1PPJ E;  2V9P A;  5KLI C;  2JWA A;  1FBQ A;  2VQC A;  3B6A A;  3EUH C;  3FXU A;  3H1J E;  3PTZ A;  4ZDO A;  2Y0C A;  1EXI A;  1CF7 B;  1J7K A;  1BG6 A;  1N2D C;  4DIQ A;  4HDV A;  2B89 A;  1L2P A;  2H88 C;  3W2A A;  5BU5 A;  3TDU C;  4EJW A;  4OIQ F;  3MZ8 A;  2X6W A;  2XRO A;  1JMB A;  4KYW A;  5EEA A;  2F5D A;  1U9N A;  4D5C A;  1PZQ A;  1SAN A;  1UMQ A;  1FIA A;  4A12 A;  2E42 A;  4KIF A;  3VP9 A;  1HBX G;  4NNJ A;  3AFH A;  4E6K G;  4Q4Z F;  2M9H A;  3KZY A;  4ZZD A;  1XMK A;  2FX0 A;  4LLN A;  3BWG A;  2R7Z J;  1ETV A;  5KAF C;  1LTJ B;  2AO9 A;  5IT9 Z;  1D5V A;  1VF5 C;  3H1I G;  2QUF A;  3CWB D;  1TC3 C;  1LWU A;  1YG2 A;  1HUC A;  3HOX J;  3ERM A;  3I59 B;  2IZ1 A;  4L5E A;  2XAQ A;  5BNG A;  5D4R A;  3TGU E;  4GWK A;  3ZQF A;  4U0Y A;  4PGH A;  2JK3 A;  3Q0W A;  3DEE A;  4M3D A;  1NTM D;  3HSR A;  1ZG5 A;  5E18 F;  1SQP D;  4IL6 X;  3G4S P;  1SFC D;  4WWI A;  5AON A;  3H1K D;  3K4N A;  3CES A;  2XSD C;  1J1E B;  4DYQ A;  1V5G A;  3AEF C;  4WY4 A;  3E3V A;  3OR2 C;  2E7X A;  3W3C A;  4PSW A;  3CX5 H;  2BY1 A;  1KTM A;  1QA6 A;  2WVR A;  2BCC J;  2N1T B;  2YO2 A;  5B3S H;  1D0Y A;  1IN4 A;  4PJJ A;  1EH7 A;  2FNA A;  2W90 A;  4PZD A;  4ENN A;  5EZG A;  3ZMU A;  2DW4 A;  4XN0 A;  5LHH A;  1SVL A;  2GA2 A;  1H88 A;  5TRD A;  1VQO P;  2M45 A;  2BY3 A;  1RET A;  4XLA A;  4UXN A;  3LSK A;  1ZCJ A;  1ZW0 A;  1SQX E;  2WIT A;  4W80 A;  3DU6 A;  3SXY A;  4DOJ A;  2EFP A;  3JTG A;  2R3S A;  2WPQ A;  5LGT A;  3L71 J;  3ZMT A;  3OYH A;  3P32 A;  2Z5H A;  2BOL A;  2M7B A;  4GCV A;  4MHG A;  3I53 A;  3SWY A;  3M1E A;  2ZFW A;  2VBZ A;  2DFF A;  2LRD A;  5CQE A;  4PJL A;  3W6K B;  4BUP A;  5HS9 A;  1FAV A;  5B66 E;  1UZC A;  2XPV A;  1FEX A;  2JJL A;  1WDK A;  5FLX Z;  1OYI A;  3U9G A;  2B87 A;  1DU6 A;  3EUK L;  3KZZ A;  3OL3 A;  1X1C A;  3KLO A;  4UB6 C;  1JTY A;  1ITY A;  3NRV A;  1B8I A;  2WSF J;  1MBH A;  4R79 A;  2X85 A;  4UB8 H;  2LK2 A;  3WE2 A;  3F8F A;  2OF7 A;  3I0T A;  4S0H B;  2XDV A;  1JJ6 C;  5E3O A;  1TL8 A;  5L3G A;  5C4J J;  4PDK A;  3CL3 D;  1H0T A;  4B3X A;  2LKM A;  1SQX D;  5DJT B;  3TP0 A;  5KHD A;  3VYI A;  2F6C A;  4IQJ A;  3DFU A;  1FZC A;  3GTQ J;  1K61 A;  3P7N A;  3FDY A;  2Q2E A;  5BMZ A;  1R5H A;  1WVR A;  3PJR A;  2R7S A;  1SQQ E;  2ICW G;  2P58 A;  4CDG A;  2HXO A;  4GBJ A;  1ZGW A;  4IHV A;  2KJB A;  2R7U A;  3FK6 A;  5J8F A;  4HEA 2;  2Q3E A;  3ABV C;  3K4L A;  4XE5 B;  1IFJ A;  2EFO A;  3CX5 E;  3LSG A;  5EZH A;  1N7S B;  2KZI A;  1IN5 A;  2EZI A;  1HBW A;  2DBB A;  3V4W A;  5HS8 A;  2X0L A;  2E34 A;  4Q47 A;  3MAJ A;  4A3L J;  1R23 A;  3FBN B;  4L5J A;  4ESJ A;  2VIX A;  3E1I A;  3ASN H;  5DTD A;  4PCQ A;  5B1B H;  3I83 A;  2M3B A;  3S9O A;  3KYL A;  4TV7 A;  1FP1 D;  3FM3 A;  4MNU A;  3RK3 B;  3GFM A;  2QWW A;  2F5V A;  3EFF K;  2WA0 A;  1VQ7 P;  3K2Z A;  4ASN A;  4U87 A;  3LQQ A;  4YRV A;  3SEQ A;  2W57 A;  2DYS H;  2Y2Z A;  3PNT A;  1JY3 N;  4IRI A;  3AEG C;  4EIJ A;  1S5L C;  4XRF A;  5DD4 A;  4WBA A;  2QG4 A;  1O4X A;  3BP8 A;  5AW9 B;  1YIT P;  1T08 B;  2FBI A;  1M67 A;  2HZD A;  4KIB A;  1Y8Q B;  2R7W A;  1SQQ D;  2N9Y B;  1X3U A;  2E76 B;  3S3M A;  3PO2 J;  2ZFC A;  4H0L B;  3CUQ A;  3O8G A;  1BDD A;  1K7A A;  3T97 A;  2EZK A;  3K6J A;  3TOB A;  3CX5 D;  3DPL C;  1BW5 A;  1BE3 J;  2BBY A;  1KOR A;  3ABK H;  3U1D A;  1IFP A;  2M4G A;  2Y31 A;  1SQV J;  2DOD A;  2HZT A;  4MEX F;  3AEA C;  4Y7N J;  1OZH A;  3WE3 A;  2WSS H;  4EI2 A;  1JO5 A;  2BCC D;  1G3Y A;  2NRG A;  2QSH X;  4XRM A;  1BDC A;  1R5S A;  3H92 A;  1YS7 A;  2LLK A;  3FX3 A;  1MDM A;  2XVC A;  1D0X A;  2KFD A;  2LY9 A;  3BTC A;  2HNH A;  2PJR A;  4B3I A;  1JCD A;  1FT9 A;  2F5C A;  2Y48 A;  4ZDL A;  1HW2 A;  1KB9 E;  1P84 I;  3KQG A;  1BE3 G;  1VQN P;  1QL2 A;  2C0W A;  4JX6 A;  1JTH B;  4LLG F;  2JP3 A;  1PP9 J;  2GIV A;  4GKG A;  3KEY A;  4TT3 H;  1RKT A;  4IHX A;  1EDJ A;  1KV4 A;  2CUJ A;  3RTR A;  1S8N A;  2NPS C; 
#chains in the Genus database with same CATH homology
 1JGG A;  2DMT A;  3TW6 A;  2MGQ A;  2CUE A;  2R5Y B;  1A5J A;  3PLR A;  2XB0 X;  2XGE A;  2XPW A;  1XS9 A;  5IP7 J;  3EGO A;  2H8R A;  4EZB A;  1MBG A;  1D5Y A;  4AYB N;  4CYC B;  3OIO A;  2D5V A;  2HOS A;  4MLO A;  3NAU A;  2XPU A;  3GTJ J;  3JRG A;  5HOD A;  2CQX A;  2LP0 A;  1IGN A;  4XIC A;  1SFO J;  3HOW J;  1PGN A;  5J1U A;  2YUS A;  5DS9 A;  3PEF A;  1LJ8 A;  3TED A;  4OVN F;  3MN2 A;  2B63 J;  1HF0 A;  1VND A;  3OOU A;  1IV6 A;  2WTB A;  5E3N A;  3BTJ A;  3IH4 A;  2CRG A;  2EW2 A;  4G12 A;  4DYC A;  2X58 A;  1K83 J;  1TXG A;  1E3O C;  4DLL A;  2GBY A;  2HYJ A;  5F0H A;  1XG1 A;  2WV1 A;  3Q3C A;  1WCM J;  3PID A;  1U9O A;  2M34 A;  4J19 A;  1P7I A;  5IP6 A;  4A3I J;  3IH2 A;  1BW6 A;  3JRB A;  2YU9 J;  3IQD B;  3G17 A;  1MH3 A;  2AHQ A;  2MW8 A;  1EF4 A;  4D7N A;  3HOU J;  1AKH B;  3HGY A;  4A3D J;  2FQ4 A;  4V2F A;  1H88 C;  3GTG J;  4HNV A;  4D3S A;  3IV5 A;  1YB4 A;  2DMQ A;  2ELK A;  4AUX A;  4BKX A;  2L7Z A;  3WS7 A;  3FIW A;  1IG7 A;  3S16 J;  4I76 A;  2HI3 A;  2GF2 A;  3BTL A;  2E1O A;  4BXX J;  2DJN A;  2TCT A;  4J0F A;  1NTC A;  1VI0 A;  1QRY A;  4D5F A;  3IH3 A;  3CMY A;  4MFE A;  3C7D B;  3HKZ N;  2JA6 J;  5EGO B;  1NK2 P;  1ZTR A;  3LSR A;  3E7L A;  1HDP A;  3W6U A;  4QSH A;  5FKM A;  4A3J J;  5C44 J;  4M3B A;  2PMZ N;  2NVQ J;  4MIM A;  1ETK A;  3DEW A;  4ABZ A;  3HEF A;  2ZYG A;  4OQY A;  3RQI A;  4NDL A;  2NS8 A;  3CQZ J;  2XB5 A;  1JTX A;  2QF7 A;  1F0Y A;  3JRE A;  1PUF B;  1LFU P;  1ZR4 A;  1FTT A;  2IBD A;  3HBL A;  3GTO J;  2UYY A;  2N8G A;  1B72 B;  1EVY A;  5IPA A;  4W1U A;  2L0K A;  1W0U A;  3S1R J;  5K7H A;  3JRF A;  1YRN A;  2XGC A;  2R92 J;  1ZK8 A;  4X1E A;  4MFD A;  2OFP A;  2EQR A;  2M0C A;  5A9S A;  4FIS A;  4B3H A;  1YRN B;  3L1P A;  3WHB A;  4A3M J;  1TWH J;  4RBO A;  4DZJ A;  2JA5 J;  2EH3 A;  2LVS A;  5A9R A;  3ZGY A;  4BY7 J;  1Z77 A;  2IYO A;  2COB A;  3SJM A;  4E13 A;  5EGO A;  1JKP C;  4X6A J;  1TWA J;  3H2Z A;  3C7A A;  1AU7 A;  3ZHB A;  2LR8 A;  2DMU A;  3HAD A;  1MNM C;  2KT0 A;  1QVT A;  1X2M A;  3RZD J;  1WPK A;  3RKQ A;  3BR0 A;  1RR7 A;  1AHD P;  2JA7 J;  2VKE A;  3BR6 A;  4UUS B;  3BG9 A;  3G1L A;  1I3Q J;  1TWF J;  2M8G X;  1ETQ A;  2CJJ A;  5FWN A;  4JP0 A;  3ZOB A;  4M3G A;  1NK3 P;  2DA5 A;  4OL9 A;  5J1R A;  3TW7 A;  1ETW A;  4W97 A;  3DCF A;  3PM1 A;  4FE7 A;  3B6C A;  3I4N J;  2QYT A;  3HOV J;  1ZKG A;  5F1J A;  1RPW A;  3FIS A;  3GTP J;  5F04 A;  1JJ8 C;  4XRS G;  5FJ8 J;  1POG A;  2NS7 A;  1LE8 A;  2JN6 A;  2E2H J;  1OFC X;  3OSG A;  4J0E A;  1UHS A;  2ME6 A;  1Y1W J;  2GLO A;  2HDD A;  2ZB9 A;  4PZE A;  4DYR A;  2ZYA A;  2K9N A;  1ZR2 A;  3HOZ J;  1MBJ A;  2O7O A;  5GPC A;  3CTV A;  5M3M J;  3QPL A;  3O8H A;  1T33 A;  2VPR A;  4A3G J;  1CQT A;  1IRZ A;  1IL0 A;  1F12 A;  4A69 C;  3I4M J;  1JUS A;  3GHY A;  3A01 B;  2O9L A;  2CU7 A;  3HDH A;  5JE8 A;  3ZQH A;  1A6I A;  3LSP A;  2QCO A;  3S17 J;  1U8B A;  1OCT C;  3WHC A;  1MSF C;  1H89 C;  1I50 J;  1YRL A;  2FJ1 A;  1IUF A;  1HLV A;  1GV5 A;  3Q0V A;  2K9S A;  2R0Q C;  1LSJ A;  5M5Y J;  5IYB J;  3RQS A;  2Y9Z A;  2D3T A;  2CVZ A;  5K7F A;  1R9T J;  4AC0 A;  2ZYD A;  2HOT A;  4DCK A;  3JRI A;  4BBR J;  4YCA A;  2ID6 A;  1TWC J;  2ECC A;  5IP9 J;  5GPA A;  1JT0 A;  3Q3S A;  2O8K A;  2RAE A;  2E2I J;  1PUF A;  1VPD A;  2HXI A;  3CKY A;  4A3C J;  1BJZ A;  3CCY A;  1MBK A;  1LFB A;  3ZQG A;  2FD5 A;  3A02 A;  2DA3 A;  1P7J A;  4C2M J;  2NOG A;  2L9R A;  4DZP A;  1LE8 B;  1B72 A;  5FKO A;  2ID3 A;  2DMN A;  1WI3 A;  2LTP A;  4IHY A;  3A01 A;  4OQZ A;  3D1N I;  3S15 J;  5F27 A;  3JRH A;  3S1Q J;  4JQ0 D;  1TWG J;  2R5Z A;  1F17 A;  2I9P A;  5M5X J;  3ZWA A;  1APL C;  3BTI A;  3HGG A;  5J3L A;  3HOY J;  1GV2 A;  4XRS A;  4KUE A;  2R5Y A;  3PDU A;  3MVP A;  3QPS A;  3ADP A;  2L7M P;  3ZQI A;  3JRA A;  3BT9 A;  2VUM J;  3PO3 J;  1M2W A;  2X48 A;  5EYR A;  1Z0X A;  1XC5 A;  3BG5 A;  4A3F J;  1FIP A;  3S1N J;  2K40 A;  1JUP A;  3LOC A;  4C3I J;  5J1Y A;  3CDL A;  1WH5 A;  1MBE A;  5FLM J;  2IAI A;  2ECB A;  2JMW A;  1FTZ A;  5EG0 B;  3Q0U A;  2HOA A;  2K9Q A;  3GBG A;  2JKV A;  3HWR A;  2W8Z A;  1GVD A;  2PLA A;  4OM8 A;  2X6O A;  5C4X J;  1IC8 A;  1QVU A;  3LNQ A;  1UG2 A;  2W48 A;  2NVY J;  5IOZ A;  4E12 A;  1M76 A;  2LD5 A;  1Y1V J;  3SDG A;  3SFI A;  3RZO J;  1Z82 A;  3JR9 A;  4EEF G;  2M2E A;  2WAQ N;  3TP3 A;  4B3A A;  2IZ0 A;  3PJG A;  4JYK A;  3F3S A;  1X2N A;  2KDZ A;  3ZQC A;  5FLV A;  4D3F A;  4JX4 A;  1PGJ A;  5MGB A;  3W6V A;  3M4O J;  1ETY A;  1JDJ A;  4M3F A;  3FKI J;  4V2G A;  2IYP A;  2H1K A;  2OPT A;  5M3F J;  1RKW A;  3MOG A;  2EBI A;  1MBF A;  4R1N A;  4D7M A;  1X0V A;  4A3B J;  1BL0 A;  3B6A A;  5FKK A;  3HM5 A;  3BR5 A;  5A9S B;  1BG6 A;  3ZQL A;  5EG0 A;  1HDD C;  2E19 A;  2JJ7 A;  2XGD A;  5FKL A;  5EEA A;  4M3E A;  1U9N A;  3HB9 A;  4D5C A;  1SAN A;  3OBB A;  1UMQ A;  1HOM A;  2DA4 A;  1FIA A;  2ME0 A;  1M75 A;  3JRD A;  1OJL A;  5C3E J;  2I10 A;  4FCY A;  2M9H A;  3A03 A;  3JRC A;  3S14 J;  2FX0 A;  2TRT A;  2Y30 A;  4CYC A;  2XRL A;  2R7Z J;  1M66 A;  1ETV A;  3K2A A;  1B8I B;  2AO9 A;  3LSJ A;  5HWS A;  2PGD A;  3S2D J;  4MO7 A;  1TC3 C;  4QTR A;  3C2B A;  2NVX J;  4C3J J;  3FR8 A;  4KUH A;  3HOX J;  1JT6 A;  2IEK A;  2IZ1 A;  3L6D A;  4B3J A;  4L5E A;  5BNG A;  4B1R A;  5E3M A;  4GWK A;  3K7A J;  3ZQF A;  4A93 J;  3ZW9 A;  4QIW N;  2JK3 A;  3Q0W A;  4M3D A;  1WGX A;  5K7Z A;  1W0T A;  5AYV A;  2XSD C;  1MSE C;  4DYQ A;  2CUF A;  2EZH A;  2Y9Y A;  1ORK A;  4FE4 A;  1PGO A;  5M5W J;  1GDT A;  1ETX A;  1PGQ A;  2DA1 A;  2W90 A;  4PZD A;  1WPQ A;  5EZG A;  2MG4 A;  3BR1 A;  4I6Z A;  1QMG A;  4C3H J;  3G1M A;  1U78 A;  3ULK A;  1RET A;  1ZCJ A;  2CQQ A;  1JKR C;  1KS9 A;  2DA7 A;  1EVZ A;  2HQ5 A;  3QHA A;  2DA2 A;  3ZWC A;  1T56 A;  3HDD A;  1DLJ A;  4GWG A;  1X58 A;  2E2J J;  3QQA A;  5JLX A;  5EDN A;  1YVE I;  1IDY A;  2XPV A;  1FEX A;  1WDK A;  4BY1 J;  1H8A C;  3H0G J;  1I36 A;  2EZL A;  4A3E J;  1PGP A;  2HDH A;  1DU6 A;  2DTZ A;  4IEJ A;  2YS9 A;  4IHW A;  1LSO A;  3BR2 A;  1JTY A;  1ITY A;  3HN2 A;  1B8I A;  2P4Q A;  4KUG A;  3ZWB A;  4E21 A;  1MBH A;  5FKN A;  2LK2 A;  1IDZ A;  3BQY A;  3BQZ A;  4UUT A;  2OF7 A;  4S0H B;  2VKV A;  1GT0 C;  1JJ6 C;  2JWT A;  5E3O A;  2L7F P;  1OCP A;  1F36 A;  5C4J J;  1VF9 A;  4Y52 J;  4DYD A;  2JA8 J;  3TP0 A;  2DN0 A;  2DA6 A;  1I6H J;  2P81 A;  5JLW A;  3S1M J;  3DFU A;  3GTQ J;  1DLI A;  1K61 A;  3H3V K;  5E3L A;  1QPI A;  1VFC A;  5A9T A;  2GM4 A;  2HXO A;  4GBJ A;  3GTL J;  3K96 A;  3BG3 A;  1ZGW A;  4IHV A;  3GTK J;  3FK6 A;  3UKG A;  1WP4 A;  1JKO C;  3C7C B;  5IOY A;  3F0C A;  4LOC A;  2NVT J;  3LSG A;  5EZH A;  1S7E A;  2EZI A;  4GFB A;  4BBS J;  4M6V A;  1F43 A;  5F0C A;  4D3D A;  4A3L J;  2G0E A;  5DTD A;  1WDM A;  3I83 A;  1Q1V A;  5EF6 A;  3WFJ A;  1ZQ3 P;  3G0O A;  4JX5 A;  4UUS A;  1JUM A;  4XK4 A;  1YJQ A;  3FK7 A;  4JPZ B;  4FTH A;  3QSG A;  3W6Z A;  3FWN A;  3G1O A;  1YON A;  4PZC A;  4RDU A;  2Y2Z A;  1X0X A;  3ZW8 A;  1O4X A;  4XID A;  1M67 A;  1WDL A;  2MSY A;  3PO2 J;  5IYC J;  1N1E A;  3O8G A;  2R93 J;  3FR7 A;  2R5Z B;  2EZK A;  1G2H A;  1F14 A;  2LFB A;  2DMP A;  3K6J A;  4IM7 A;  5F0F A;  1BW5 A;  1FJL A;  5IYD J;  3ADO A;  4FGW A;  3VPR A;  5GP9 A;  2Y31 A;  2X9D A;  4S3M A;  1BA5 A;  1GUU A;  1DU0 A;  4A3K J;  3MKL A;  1ETO A;  4Y7N J;  3WFI A;  1YJ8 A;  1WH7 A;  1AKH A;  4XRM A;  2LKX A;  2VI6 A;  1JKQ C;  1HCR A;  2LLK A;  1N1G A;  2WB1 N;  5F08 A;  3M3Y J;  4DW6 A;  3OSF A;  2LY9 A;  3BTC A;  3NAR A;  4B3I A;  3S2H J;  3DOJ A;  9ANT A;  1MH4 A;  1IJW C;  4JX6 A;  3BR3 A;  1RKT A;  4IHX A;  3GTM J;  1ENH A;  2Y0S N;  4B4C A;  1RES A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...