2Y9YA

Chromatin remodeling factor isw1a(del_atpase)
Total Genus 63
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
63
sequence length
277
structure length
277
Chain Sequence
STPSHPRMPKPHVFHSHQLQPPQLQVLYEKERMWTAKKTGYVPTMDDVKAAYGKISDQEEQKEKLELLKLSVNNSQPLTEEEEKMKADWESEGFTNWNKLEFRKFITVSGKYGRNSIQAIARELAPGKTLEEVRAYAKAFWSNIERIEDYEKYLKIIENEEEKIKRVKMQQEALRRKLSEYKNPFFDLKLKHPPSSNNKRTYSEEEDRFILLMLFKYGLDRDDVYELVRDEIRDCPLFELDFYFRSRTPVELARRGNTLLQCLEKEFNAGIVLDDAT
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription
molecule keywords IMITATION SWITCH PROTEIN 1 (DEL_ATPASE)
publication title Structure and Mechanism of the Chromatin Remodelling Factor Isw1A.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 63
structure length 277
sequence length 277
ec nomenclature
pdb deposition date 2011-02-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09110 HAND HAND
A PF09111 SLIDE SLIDE
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2y9yA04
1.10.1040.30 Mainly Alpha Orthogonal Bundle N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 N-(1-d-carboxylethyl)-l-norvaline Dehydrogenase; domain 2 2y9yA01
1.20.5.1190 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces iswi atpase 2y9yA03
5C4XJ 5EZHA 1S7EA 4A3GJ 3HEFA 5IYBJ 4JX5A 2R5ZA 1TC3C 1BW5A 4DZJA 2JA8J 1RESA 1JJ8C 4A3KJ 2QF7A 3TP0A 5FLMJ 4FE4A 3JRCA 5EG0B 1GV2A 1POGA 3GTJJ 3FKIJ 3DCFA 3K7AJ 4XK4A 5F0FA 4XRSA 1IRZA 1UMQA 3S1RJ 3RZDJ 4UUSB 5EEAA 3JRAA 4G12A 1ZK8A 4W97A 1LFBA 1WGXA 2K9SA 3WHBA 1R9TJ 5E3OA 2E1OA 1VFCA 3BR5A 2RAEA 4AUXA 1U9NA 5EDNA 1ZGWA 1WI3A 2D5VA 1U78A 2YU9J 4UUTA 3L1PA 1OCTC 5E3NA 2R7ZJ 3LOCA 3S2HJ 1JTXA 3GTGJ 2XPWA 3BR0A 5BNGA 1ENHA 2VI6A 1T33A 1X58A 1K83J 3B6AA 3BQYA 2AHQA 2IBDA 3WHCA 2AO9A 1JGGA 2JA5J 1IDZA 5EYRA 2LFBA 1Q1VA 1VNDA 4M3BA 3NAUA 1ETWA 4BBRJ 1IGNA 5K7ZA 2Y9YA 2ECBA 2EZLA 2DA3A 4CYCB 1H88C 1LE8A 1TWAJ 5F04A 4GFBA 4MLOA 1I3QJ 1ZQ3P 1U9OA 1MBGA 2VPRA 3JREA 1HCRA 3GTOJ 1NK2P 2YUSA 4IHXA 1B8IB 3G1LA 4QIWN 4DYQA 1JTYA 1NTCA 3OSFA 2NS8A 9ANTA 5E3LA 2MW8A 3I4NJ 2JK3A 2WAQN 3O8GA 3B6CA 1QPIA 1LFUP 1P7JA 1NK3P 2DMUA 1P7IA 2L7MP 4C3IJ 2X6OA 2L7FP 3A01B 1RR7A 1F43A 4M3EA 2M2EA 4V2GA 1A6IA 1O4XA 2NOGA 2IEKA 4Y52J 3S16J 5M3MJ 2LTPA 4Y7NJ 2NVYJ 5GPAA 4A3JJ 3LSGA 3IV5A 1GUUA 3Q0UA 4I6ZA 1I50J 4XRMA 5J3LA 2NS7A 3FK7A 2ME0A 3QPLA 1JUPA 2LP0A 1IUFA 1SANA 2TRTA 1MBFA 1QVTA 2L7ZA 3JRDA 2DMQA 1PUFA 5DTDA 2Y2ZA 5F1JA 3GTPJ 3F0CA 2G0EA 2L9RA 3HM5A 1G2HA 1B72B 5C4JJ 3JRFA 5IOZA 5C44J 1AU7A 2NVTJ 1HOMA 4XIDA 3FISA 4D5CA 3OOUA 2R5YA 1F36A 3IH3A 4X6AJ 3RQIA 3JRIA 1ETKA 1FJLA 4BBSJ 4C2MJ 1IG7A 3HGYA 1ITYA 3LSRA 2R0QC 2DA5A 1K61A 3OSGA 2M34A 2Y0SN 3ZQLA 2XGEA 1JKPC 3HOYJ 1X2NA 4BY1J 2FD5A 1ETOA 3ZOBA 3MN2A 2O9LA 3LSJA 4D5FA 5JLXA 1H89C 5J1YA 3JR9A 3HOXJ 1D5YA 2ECCA 2Y31A 5C3EJ 1MBJA 1B8IA 5FKOA 4MFEA 4M6VA 2KDZA 5F0CA 5EGOB 2CRGA 3HOVJ 3BTLA 2JJ7A 1JT0A 3BG3A 1MH3A 5J1UA 3JRGA 2NVXJ 4D7NA 4A3EJ 3ZQHA 3S1NJ 3S17J 1XG1A 1HDDC 1GT0C 3E7LA 1ETQA 1ETYA 3BR2A 3G1MA 2E2HJ 1HF0A 2P81A 1FTTA 1YRNB 2HOTA 4BKXA 1ETVA 2DA4A 3K2AA 4A3CJ 4FTHA 2M0CA 4FCYA 2LKXA 4D7MA 2MSYA 1AKHB 1OFCX 3BG5A 4DYRA 1MBEA 1QRYA 5FKKA 3ZQGA 2LK2A 4QTRA 2XGDA 4ABZA 4C3HJ 2DA7A 4JYKA 2E19A 3M3YJ 2XB0X 2FX0A 2ME6A 2R92J 3GTQJ 2LVSA 2XPUA 1T56A 1MBHA 4MIMA 2LLKA 4V2FA 2GM4A 4A3LJ 1JKQC 1Y1WJ 5M3FJ 4MFDA 3QPSA 1WH5A 2L0KA 3CDLA 2DMTA 1I6HJ 4W1UA 1MH4A 1WPKA 2XPVA 4IEJA 1DU6A 2CJJA 2IAIA 1GV5A 2CUFA 1TWCJ 5FKLA 5IYDJ 4J19A 2GBYA 5J1RA 3H0GJ 3C2BA 1OJLA 3GTKJ 3ZQIA 2O7OA 3CMYA 2VUMJ 2ZB9A 1BJZA 1FIAA 5EG0A 5F0HA 2Y9ZA 2FQ4A 3PO2J 4XICA 2HQ5A 1Z77A 3LNQA 4UUSA 1WCMJ 5FLVA 2XSDC 3D1NI 2X48A 4AYBN 2M8GX 4B3AA 1W0UA 4M3GA 4HNVA 2QCOA 2LR8A 4MO7A 4EEFG 3S1MJ 3S2DJ 4DCKA 1VF9A 1SFOJ 5IP7J 1TWGJ 3I4MJ 4A3MJ 2N8GA 2COBA 3QQAA 4QSHA 2JA7J 3PO3J 1ORKA 3BTCA 1LE8B 4B1RA 5EZGA 2EZKA 5FKNA 1JJ6C 4JPZB 2HXIA 4C3JJ 1WH7A 3BR3A 4DZPA 3BR6A 5FJ8J 2LD5A 1ZR4A 2MG4A 5F27A 2Y30A 3O8HA 1MSEC 3GBGA 2OF7A 3NARA 3SJMA 5FKMA 3G1OA 2CQQA 3TW6A 2HI3A 3S15J 1JKOC 3ZQFA 1JUMA 2VKVA 2KT0A 1AKHA 4RDUA 4XRSG 4CYCA 1IC8A 3S14J 3HOUJ 1ETXA 1QVUA 3H3VK 3GTLJ 4A3IJ 5K7HA 3HKZN 4BY7J 3SFIA 2HOSA 2HYJA 4IHVA 2JMWA 1W0TA 3HOZJ 1XC5A 5JLWA 1RKTA 2EH3A 1UG2A 2ELKA 2B63J 5IP6A 3DEWA 4LOCA 1MBKA 2WV1A 2E2JJ 2DN0A 1FEXA 1UHSA 2R93J 4DW6A 5IPAA 4FE7A 3A01A 3VPRA 1PUFB 3BTIA 3HBLA 2CQXA 4JX4A 3BG9A 4A3FJ 1ZR2A 2DMPA 2I10A 3MKLA 3OIOA 3TEDA 1ZKGA 4AC0A 2HDDA 2LY9A 1HDPA 5EF6A 3LSPA 2HOAA 2XGCA 2EQRA 3FIWA 2R5YB 4IHYA 3SDGA 3TW7A 4FISA 4IHWA 2ID6A 4M3FA 4S0HB 3W6VA 4BXXJ 3S1QJ 2ID3A 3JRBA 3Q0WA 2R5ZB 2X9DA 4A3BJ 5DS9A 3IH2A 3ZQCA 5IP9J 1JT6A 1VI0A 2DA2A 2DA1A 2HXOA 3Q3SA 1B72A 2YS9A 1Z0XA 3M4OJ 3BT9A 3A03A 4X1EA 5IOYA 1BL0A 1MSFC 2GLOA 2K9QA 1BW6A 4JX6A 4NDLA 2O8KA 2H8RA 1GVDA 4JP0A 2WB1N 2DTZA 1U8BA 1E3OC 1CQTA 2DMNA 5GPCA 3TP3A 3IH4A 1JUSA 3BQZA 1FIPA 5F08A 4RBOA 1OCPA 4A3DJ 2CU7A 1HLVA 2H1KA 4JQ0D 4I76A 2VKEA 1RKWA 4L5EA 1XS9A 2NVQJ 2JA6J 3CCYA 1Y1VJ 3HB9A 1EF4A 2MGQA 3MVPA 1IV6A 2CUEA 1JKRC 1AHDP 3JRHA 1X2MA 1FTZA 2XRLA 2EBIA 5IYCJ 5M5WJ 1GDTA 3CQZJ 2W48A 3RKQA 4DYCA 2OPTA 2K40A 5K7FA 2E2IJ 1BA5A 3BR1A 2EZIA 2EZHA 3A02A 4B4CA 3FK6A 3HGGA 2DA6A 2PMZN 2XB5A 5E3MA 3UKGA 2JN6A 2M9HA 3HDDA 1IDYA 4A93J 5EGOA 3PM1A 1H8AC 1MNMC 1A5JA 2K9NA 1IJWC 1TWFJ 5M5XJ 1RPWA 5GP9A 1RETA 5M5YJ 1TWHJ 3RZOJ 2JWTA 5HODA 2DJNA 4M3DA 1DU0A 3Q0VA 1YRNA 4OVNF 1ZTRA 3GTMJ 1APLC 2TCTA 3BTJA 4A69C 2FJ1A 3HOWJ
chains in the Genus database with same CATH superfamily
3H2ZA 1IXRC 2WVRA 2P0WA 1KQSO 2IRFG 3B71A 4BJ6C 2BEZF 3E97A 2ISYA 1MGTA 2K9LA 4RLFA 2E1MB 2IPQX 3HZJA 3CCSP 1TC3C 3RL0C 2CSOA 4DZJA 5JHFA 1L0OC 1MJBA 1P4WA 4A3KJ 4P9FA 1MJAA 1N7SA 1SQVD 3MHVA 1VQOP 1GTWA 4D0PA 2XASA 3OYBA 3A3YB 4FE4A 3JRCA 1VQPP 2PN6A 4HLYA 4KT6A 3MP7B 3OYFA 3FDYA 4EJWA 1NG7A 3DCFA 3FKIJ 3GYHX 1ZRDA 1W5CE 3GW2A 4XRSA 2PI0A 2ZKZA 2MA3A 4IXAA 1WJFA 3DPUA 1OR7A 3ECOA 3JRAA 4G12A 2NPSD 3E5UA 2K9SA 2V26A 4M74A 1UAAA 4N6JA 2BVLA 2EILH 2V4JC 2ZFUA 1JY2O 1NAYA 1YYCA 2W83C 2E1OA 4PD4I 5FB2A 2Z2SB 3CCJP 4U3FJ 2WAFA 3BR5A 4ESJA 3RPUA 2IFNA 3QSGA 2OAZA 4HA8A 2R7XA 2H43A 2D5VA 3GHGC 3CDIA 1U78A 2HLOA 3H1HE 4KJMA 2XRNA 1SVFA 2HKOA 1W7PA 2KJCA 5B66E 4YIIA 2CW0F 2ZNYA 3MMYB 2A06G 3FXMA 1YW7A 3LOCA 1YB4A 2WWWA 3WU2H 4LB6B 2COMA 1T38A 3GTGJ 1BDDA 1T33A 1RHZB 1X58A 3R6SA 2DYRH 2ZXJA 5E8GA 3DPLC 3C7JA 3BRTB 5APWA 2HTJA 2MD0A 2KFDA 4G9YA 3WHCA 2IBDA 1JGGA 5KTBA 2JA5J 1WQ2A 1IDZA 5EYRA 2KJBA 1E0EA 1BCCD 2ZMEC 3C3WA 1G4DA 1Q1VA 2WPVB 3L74J 5DCMA 2B9BA 5AVXB 3FXLA 2R7UA 5CJ4A 1J0RA 4U87A 3DBHB 4N78D 1J1DB 4YFNF 1YFHA 1ETWA 3MZWB 4XFJA 4B3HA 5LRSA 1KB9H 4BBRJ 2ESHA 2X51A 2WY8Q 2R7RA 3BOQA 3KP7A 3NXSA 1LTTC 3Q3CA 3F5HA 4D6TG 2Y9YA 1YJWP 1O3QA 3CXHI 4EYYQ 4ZH4F 4BL0B 1TWAJ 1LJ2A 4MLOA 5IT9Z 4ZYGA 1LDJA 3JREA 1HCRA 1ZREA 3M0AA 1HWTC 2YUSA 2G9WA 3GUDA 3GXOA 2ISZA 4QIWN 3G71I 5HWSA 1QX8A 2GZWA 1JTYA 1NTCA 1FBUA 9ANTA 5E3LA 2J5PA 2MW8A 4O6JA 3QPTA 1DP7P 3WTVC 2ZYGA 3PDUA 3H1JD 2WAQN 2YIUB 2WB1A 2DOFA 3SYTA 1W5TA 1QPIA 1GVJA 1OCOH 1CF7B 4H44D 3CUQC 1P7IA 2L7MP 4LG3A 2XUBA 3C7AA 1KILA 3M1CA 1B9MA 1FOXA 4ZZDA 1JNMA 1VPDA 3HTKA 3Q5RA 1M66A 4J0FA 3DBLB 4V19K 2RQQA 2H89C 1OXZA 2B7EA 1AWCA 3S16J 4RJTA 4KIBA 1FX7A 2JPCA 4AU7A 3CCQI 1ZN5A 4EJVA 3IN6A 2NVYJ 1UELB 3QP5A 4M9SA 1O3RA 1XCBA 2EV5A 1LT9A 4YIFA 2FBWC 1LKXA 3IV5A 3MFKA 2BCCJ 1MZBA 3KP2A 3I83A 3LSMA 2O1JA 4I6ZA 2R7OA 4Y15A 1GU4A 1I50J 4XRMA 3VYRB 5J3LA 4BACA 4HW0A 1LJ8A 2FXMA 2NPSA 1OKRA 1HKTA 3VOPA 4I02A 3PLRA 3NFQA 2ME0A 3ZMDA 2PMHA 1P84D 2LP0A 3KYLA 3Q3DA 4GIFA 1MBFA 2HYFA 4AWXB 2L4MA 4CA0A 4CZZA 4GWKA 1SQBD 3W68A 4BRYB 3TMOA 1U7JA 4E7IA 4Q4ZF 3CCVP 1R5HA 2HS5A 4DOJA 1G8XA 3HM5A 4MHGA 2DU9A 5LHHA 3OYDA 1UFMA 3KZYA 2JQ7A 5E17F 5IOZA 2BW3A 1ON1A 3OR1C 5HLTA 1AU7A 3BJOA 5KK1A 3LSTA 4XQFA 4PJNA 4WCGA 3QYFA 1HOMA 1MFZA 3F6OA 1NTMG 3H5RA 1S4XA 1CGPA 3RI4A 1WJEA 3N7NA 3MD2A 3J81K 3LWFA 4HF0A 1DLIA 3TO9A 4GODA 3JRIA 4ESBA 3CCLI 4IRHA 4EI2A 1AQ5A 4C2MJ 2FBIA 4LG0A 1P4XA 4B47A 1X1AA 5FFXA 1G1JA 3MZYA 1HGVA 4RM3A 3EUKL 1N2DC 4JYCA 3K70D 1MD0A 2QQAA 2Y0SN 1F9NA 3RKYA 5ILVA 3H1KE 1AVYA 4HSRA 2AXLA 1S29A 5CVIA 2E7WA 4EOTA 1X2NA 4D9JA 3Q5PA 3K0LA 2RKLA 3D1LA 1YTZI 3RTRA 2CG4A 4XRFA 2CK3H 4PGHA 4C7NA 2OYIA 5AVZB 1EKEA 2R7SA 1H89C 3M0DC 4JF7A 3B5NB 1LUJB 2BOLA 2ZSIB 1LTBC 3HOXJ 5JVGF 4TLFA 2K3FA 3RYPA 2MBFA 4YFXF 1S1CX 3ZHBA 2P2UA 3H1HJ 2Y31A 2EIJH 1YITI 3HE4A 1R7JA 1VQMI 5GTIC 1MBJA 3K1NA 4HX4A 3KP3A 2VT3A 3GZ5A 3GHYA 1Z67A 1BCCJ 4UB6E 2I76A 2MYSA 3TGUG 3A2AA 4G6TB 2BHZA 1M1KQ 3RK3C 2CRGA 2Z3YA 3HOVJ 4B09A 5FD5A 2DT6A 3H1LE 1JT0A 2XVCA 2EWNA 4CGZA 5B1AH 1P84I 5J1UA 1XTGB 1HKSA 2NVXJ 4ZNCA 4XR6A 4CCOA 4PZEA 4I7ZC 4MEYF 1EXJA 1XGSA 3BJ6A 1MDMB 1P84H 1REPC 3RK2C 2VBYA 3H1LD 3E7LA 1ZN2A 5D5UB 1RUNA 1O7LA 1WSUA 1MMSA 3FXRA 1NTKG 1SQPG 1KZHA 5CQGA 1X79B 1EZVD 3G6EP 2M5AA 2DQLA 3KEOA 3GZNB 4BKXA 2OYHA 3V4GA 1JB0J 2Q1ZB 4HLXA 4A12A 1Z56A 1BDCA 4LJZF 4M3LA 1OLTA 5K5QA 4LFUA 1NOHA 2A3SA 4IJAA 1URQC 3V7RA 1E2XA 1HA8A 2PBIA 3OMYA 1GXPA 3S3NA 5FKKA 1QZYA 1TT5B 4HJGH 3GLLA 4GDOA 4OWRB 3HE5B 3PRJA 3S4RA 1LFPA 3SWFA 3Q9SA 1GD2E 4GOFA 3FR7A 2XB0X 3QOPA 2FX0A 5ICFA 2ME6A 3WTZA 2P67A 2UXNA 2KIQA 3AG1H 2R92J 4S05A 2O61A 5KLVG 1J59A 2QWWA 1T56A 1IO4A 2LH9A 4CH7A 1MBHA 3L73G 2FXOA 3W2VA 3D5SC 4YCAA 1OIPA 3BASA 5LD2C 1NVOA 1JKQC 2V6CA 3QPSA 1WH5A 1XB4A 2QJYB 4EGZA 1U5TB 1PYVA 2ZJSE 2K02A 3B02A 3BY6A 1DU6A 1XGMA 1N7SC 3OBBA 3D0SA 4XNFA 4KJZA 5K5GB 1TWCJ 5FKLA 4PJLA 2L54A 2UZKA 4W80A 5J1RA 1YI2I 3QWLA 2O01H 1LVAA 2WADA 3GTKJ 4HPQA 2ZB9A 2XDJA 4HF2A 1OR7C 3WUUA 2AS5F 2OC6A 5F0HA 2HU9A 4Y33A 3OYMA 3MKZA 4XICA 3H1IE 3AEGC 2Z33A 1WCMJ 1WPQA 5J4YA 1EVZA 2M3BA 5BQTA 4G6DA 4N0BA 4OQYA 4N9IA 5BMZA 1PPJG 2WPQA 1W0UA 1M76A 3PLNA 2QCOA 1D0ZA 2XKMA 1A36A 3HRSA 4YXDC 1AJYA 1NKNA 1TWGJ 1O7FA 5DCFA 4IFDK 4I0BA 4KIFA 1E3HA 3HJEA 1FDOA 1HGZA 3CPWO 2JA7J 4PUSA 4WY4B 1GU5A 1P6RA 4HYTB 3H3ZA 4N4NB 2YX7A 3AG3H 1PDNC 5EZGA 1FLIA 1XTCC 2LF8A 2EPFA 4HNUA 2EW2A 3WU2C 1JXSA 1PGQA 1KV4A 2HXIA 4OAZA 1KQGB 3N4XA 3BCAA 3SXYA 4ASNA 2OYIC 2DBBA 3BR3A 3H9GA 2W24A 3TL4X 1LP1B 5MGBA 1WMKA 3AFHA 3V8JA 2P10A 2XAHA 1T6SA 3I53A 3WFIA 3F8BA 4OGQD 3IP4B 3E5XA 3TW6A 2HI3A 1JKOC 3DXJF 2IDBA 1BG6A 2VKVA 2KT0A 1RUOA 3S14J 4XRSG 2QM3A 2I1KA 3OJAB 5APYA 5K7HA 4BY7J 3B5ND 3KZIE 5E79H 2K5CA 3H5AA 3RK2B 1W0TA 1YVEI 4AIHA 1XC5A 2I8DA 1KILC 2HQAA 2HDHA 3H1LJ 4S3MA 2VRSA 1Y0UA 3LAJA 4DBQA 2ELKA 2YXRB 5KHDA 3WFJA 1N73B 4K3AA 1X19A 3DEWA 4XLEA 2FYUG 4IQJA 5L3EA 2IS2A 2XDVA 2V6EA 2E2JJ 2KLVA 1ONVA 2E1NA 5LEJA 1CF7A 1RZ4A 2O3FA 1GL2D 3S9OA 2KP6A 1UHSA 4L9TA 2GF2A 2NNYA 4DW6A 2R93J 3MUDC 4FE7A 1SFXA 3L37A 2IGOA 4BDYA 3GF2A 1WFXA 1YHQI 3SDBA 1LT9C 1F1ZA 3AEDC 3PIDA 3HBLA 5AW9B 2CQXA 4JX4A 3BG9A 2PGDA 4A3FJ 1ZR2A 1IUYA 5APUA 1ZOYC 1Y8RB 5LBQA 4HX7A 1R71A 3OIOA 2JVGA 3FMRA 1HKQA 4ETSA 2FUG2 4I01A 3FXOA 4AC0A 4U7DA 2HDDA 2H8PD 2ADUA 5EF6A 4LITA 2M3AA 2NPSC 2HOAA 2QQBA 2VJIA 2JSCA 2XGCA 3FIWA 4M9ZA 3CX5D 4IHYA 1IRGA 1XCVA 4HRIA 2KI7B 2PRRA 3CCUP 1FSHA 1TU3F 2ID6A 1WT6A 2YMYA 1AFOA 3RQ4A 3W6VA 1WI9A 3NWTA 4BXXJ 1VQ9P 3L72D 3Q0WA 1R58A 1N7SB 4A2UA 1VQNP 4ON0A 4N4OB 4BRYA 3F3XA 1FS0E 1L4AB 5EEHA 2MKVA 5IP9J 3TDZC 2PFXA 2QM8A 4XSXF 1JT6A 3HL2A 2MJZA 3RSNA 4Q48A 4I2LC 2C9LY 1EXIA 4U7JA 3BPXA 3CCQP 1Z0XA 3ISPA 1BC8C 3BT9A 2A6TA 4LLHA 1Q82Q 1FPQA 5C39A 1XMKA 2K9QA 4D3FA 4JX6A 2ZYAA 3M06A 2ZXWH 4EMSA 2H8RA 3WG7H 3L00A 1Z05A 2NRAC 1ZRTD 2ELHA 4JP0A 3DP7A 1E3PA 3V7SA 2WY7Q 3SFEC 4XLFA 1VF5D 2RVCA 5GPCA 2KXPB 3F22A 1FIPA 2MH2A 4RESB 4A3DJ 4XE5B 1FP1D 2CUZA 4HKZH 3KPEA 3ZGYA 4IL6X 1SQVG 3TDKA 4IL6E 1M1JB 2QSFX 3H1IJ 1U0JA 1R5SA 1KYOI 2K3PA 4I76A 1VQ4I 3FX0A 1JUNA 1YJ9P 4L5EA 4E7LA 4RB2C 3F8FA 2JA6J 2VB6A 5TRDA 1QU3A 2XIGA 1YJ8A 3ZXSA 3WTSC 5A2QK 3TGUE 2DFEA 3HB9A 2VIXA 1LTIC 1T2KD 1JKRC 1L0LE 3CTVA 4ITVA 3B5NA 1FMWA 4J0EA 3OS2A 1KZUB 3GO5A 5L8RJ 4H0LB 3V5BA 4H44C 3CQZJ 4R1NA 4ZTFA 3WTTC 4DYCA 2IZ1A 1VPCA 2BASA 1Q2NA 2NAZA 1MIJA 2FXAA 4NC7A 1CI6B 2CUJA 2EZIA 2KNCB 3A02A 2V7QH 2CH0A 3HGGA 1VQ6I 2WA0A 2CS3A 2N1TB 1GL2A 4CXFA 3CX5H 3IWZA 2M9HA 3PNTA 2EJRA 5EJCA 2EIMH 1BSNA 2JJLA 2FNPA 4L9VA 2K9NA 4WY4D 3ABTA 2HYNA 3OL4A 2WSCJ 3MUDA 3S2WA 1TWFJ 3AE7C 4NNJA 1K05A 4Y17A 3CD6I 2Z99A 1MDMA 5FROA 3I54A 4E13A 3DEUA 2OYHC 2ICWG 1SAUA 2OQGA 1ZV8A 3P5JA 4ENMA 3CLOA 4O5VA 1TQMA 2FU4A 5CVUA 3U1CA 5KAFE 3JC22 4QWQA 1WRGA 2P1JA 4KT0J 4RGSA 3QODA 1ZTRA 1R1TA 1JCCA 2JPBA 1KD1Q 3HSFA 5AVRB 3HOWJ 3ABLH 1SQXE 4N9HA 4MEXF 4OM8A 5EZHA 4Z2YA 2KZIA 1VQLI 4JK1X 5AW2B 3PIOF 3TGNA 3IC7A 2DYSH 4JX5A 2R5ZA 2KSEA 3HE5A 4C2TA 3CI9A 1RESA 5B5EE 2CW8A 3CWBD 3TP0A 1RRJA 4CHUA 1G2CA 4G7ZF 1HQCA 1HC8A 1KFMA 2LXCB 4ESFA 1WWXA 5H2FE 4DZOA 2Y69H 2NPSB 2HPIA 2FNAA 3ZN1A 4JOMA 2Z5UA 3CCEI 4EGYA 2F5FA 3S1RJ 2PAJA 3H1JG 5AW4B 3T5XA 2PLAA 3H92A 3K70C 1HTLC 1BJAA 4QPOA 1MJ9A 2E1MC 2I1JA 1U5TA 3CZ6A 2X6WA 1TLHB 3H9QA 3ZN0A 5E3OA 4FX4A 2W1OA 1X0TA 1Z91A 2P7VB 3FWLA 5D6EA 2RAEA 4L74A 1U9NA 4PFOA 2CQKA 1S9KD 3HIFA 2YU9J 3LSIA 2KZGA 4AUWA 3OY9A 4UUTA 2R4GA 3A0HE 1OCTC 2A05A 3X2QH 5IT3A 1JTXA 3WE2A 2XPWA 3BR0A 1QL2A 3PP5A 3H25A 3CC2P 4H4KC 4U3FD 4I1LA 4U88A 3HRUA 1T2KA 3B6AA 3BQYA 2AHQA 3J7YJ 3VWBA 4GBJA 4NPFX 3IFMA 3U59A 3OYHA 3P32A 1IFNA 2LFBA 1PGPA 2VOOA 3L70G 2AQEA 3A4CA 2VC1A 4HG2A 2P7CB 1SQBG 1WJBA 2R5DA 3J80K 2ETHA 3WGGA 4EJOA 1SVMA 3FBIB 1VNDA 1TW2A 1BGYE 4L73A 2VBZA 3OS0A 1G3WA 3OYGA 1M7LA 1GW3A 3DTEA 3QRFF 2W8ZA 2XAFA 1VQ7P 1HJ0A 2IJLA 5K7ZA 3SHFA 5KAIE 2KPMA 3FGAD 2XROA 4WY4A 2IBZD 2DA3A 1LDDA 4IF4A 4CYCB 4R79A 3L74D 2GXBA 1AA7A 1BIAA 2IS4A 3C9IA 3A7OA 2P4WA 4E4HA 1MBGA 4PV1B 1B4AA 2DK5A 3EWKA 4XLAA 4ZKPA 2CVZA 4B3JA 1NK2P 2XF7A 1I1SA 3M0DA 1ZCJA 2KLUA 4ZTJA 1R8EA 3OSFA 1QLED 1GLNA 5HNFA 3I4NJ 5AYVA 2K3RA 1XDSA 3PQJA 2K1AA 2BY0A 2IP2A 1BE3E 1EVYA 1LP1A 3B6CA 1NK3P 4UB8E 1IC2A 1GW4A 1YX5A 3G3ZA 3MCZA 4C3IJ 3H1KD 2X6OA 3E6BA 3K10A 3F23A 1L0LJ 2X1CA 2MLGA 1D8KA 2M2EA 1P4AA 1MMDA 1BM9A 2GQQA 1R6RA 3EFFK 1T39A 2GOXB 3VEPA 4UXNA 5CJ0A 2MC3A 5LGTA 5LHGA 2OARA 3QH9A 5APQA 5M3MJ 4Y7NJ 3V4WA 4LGWA 2E35A 4KMFA 1KGSA 2I5UA 4D3DA 3VFZA 2YIUC 3JCUE 1AA0A 1D3YA 4H0LD 4I6MC 4ZDLA 1JMMA 2QA4I 1JOCA 2ZJRF 2IS6A 1S5LE 5KJ7D 2CGPA 1T08B 2GUSA 4XM3A 3CCMI 3CC7I 5E79C 1F14A 1IFIA 3AE5C 2WWYA 2E42A 1N73A 4BU2A 3OIQA 4KISA 2M87A 4PD4E 2O1KA 3BJAA 3QPLA 2N1TD 2ZYDA 1FZFA 3N05A 2JO1A 3ML6A 3PHLA 4H13B 1SANA 1X3ZB 1IXSB 3QWOC 3TF5A 1JGSA 2L7ZA 3E6DA 2YO2A 2LY2A 1ZRFA 2X6YA 2VE9A 4ASWA 2O5RA 2Y2ZA 2G0EA 2KIMA 1B72B 3EQLF 3PEFA 3HADA 5HS9A 1NU1E 4DJAA 1RE4A 2NVTJ 4EVIA 1SQXJ 3SFDC 3IHUA 4EM2A 1LTSC 2BYVE 3TOAA 2DDAA 1EZVG 1R36A 3M8JA 3GLMA 1FDIA 1LSJA 1ZMEC 4XLNF 4YTPC 1FJLA 3F21A 5CCGC 5CJ9A 3HGYA 1RY3A 1ITYA 3L2CA 2R0QC 2J58A 2GXGA 5DJUB 3CO7C 2DA5A 3F8NA 2RN0A 3OSGA 4EZBA 3L71E 4DGWB 4DIQA 2E43A 1E5WA 3K69A 1UIXA 1OCRH 2HVQA 2R7TA 2WT7B 1DEEG 3TNUB 1SC7A 1JKPC 1L4AA 3GFLA 3CXHE 2FD5A 1ETOA 3ZOBA 2A5WA 3MAJA 3QAHA 4I09A 1EH8A 4F91B 2HODB 1SD6A 3IAM2 4EJTA 3KQGA 4L9NA 2LXBA 1MMGA 2HQNA 4A0ZA 5GADJ 4G7OF 1JY2P 1XGOA 2K85A 3HUSB 1QZEA 2ECCA 5EEGA 4F3QA 2JUCA 3CF5F 3V6IA 3E7KA 4ENKA 4OGQC 2JWAA 1B8IA 1DUXC 1JHFA 2K9JB 2L91A 3JSVC 4MFEA 4PJ0E 2CMPA 2X4HA 1OYIA 5F0CA 2KDZA 1L0NE 4CO8A 4IOIH 1XMAA 3HHHA 3JW4A 3BTLA 3CP8A 1M1JA 2JT1A 1JMBA 3II6A 3BG3A 3B5NC 5GTHH 3J7ZI 3ONQA 3V8LA 3H1HD 5HLIA 3ROUA 3W67A 2RREA 1FZCB 4BGDA 3S1NJ 4D1QA 2JWDA 4WBAA 4HF1A 1ETQA 2G7HA 1BGYJ 1H8AA 2F4IA 5DJTB 5A9SB 1WHUA 4TT3H 3AE4C 2AEFA 1GL2C 5KJ7A 1KB9I 2QVOA 2ZCWA 3TKYA 1HF0A 4BYYA 1YRNB 2VJJA 3P7NA 3CCRP 2DA4A 5APTA 1CI6A 1W1WE 3K2AA 1QGPA 4A3CJ 4FTHA 5DD8A 1X9VA 4GYIA 4KFCA 2KNCA 2PJRB 2N1TA 3LFKA 2ZJQF 2MSYA 4UUVA 3BG5A 3AE2C 2KRFA 4LK1F 2LK2A 3I5CA 4YFKF 2J5UA 3H1KJ 4JYKA 1SAXA 1FBMA 4BXLA 1IXCA 1FBSA 2GA2A 1EA3A 2BBYA 4XMYA 4NPEA 4PV1D 1FSEA 1Y47A 5ICGA 3H0DA 3HRTA 2LF7A 3NWSA 3L2UA 5HNHA 2IT0A 4WVZA 2L3DA 4A0YA 5D5XB 2LLKA 2KQRA 1OW7A 3WGIA 1SFUA 1PVEA 2IXSA 3E6MA 2VONA 3CDLA 4BQOA 1OW6A 2DMTA 4W1UA 1MH4A 4IEJA 2XPVA 3OYJA 2WAQA 2CJJA 3H9JA 2W7NA 2Q6QA 3VYIA 2RV8A 2EFWA 1GV5A 2VJ5A 3USSA 2CUFA 1NWQA 3OYEA 2VODA 3PIPF 1ZLLA 6PAXA 1BN5A 1FY7A 3I58A 3KYCB 3WG9A 3MZHA 3PUFA 2QSIA 4OIQF 2VUMJ 1SFCD 4P55A 4OQZA 1KMIZ 3BCCE 1IF1A 4LLGF 1L0LK 1OISA 2FRHA 2QJYC 2H6CA 3CESA 3PQKA 5AVVB 3RGUA 2YKQA 1U5TC 1SVLA 2W27A 1B6AA 2FQ4A 3RYRA 1VF5C 2DDBA 2VC0A 3PO2J 4G8XA 3A0BE 3LNQA 1FYKA 2ACJA 4BXUA 3AE8C 1IFPA 5HDGA 2X48A 5B66H 3SWYA 1U57A 2OUMA 2H7HA 2M8GX 4OWFA 4B44A 3HD7B 1DLJA 3WUVA 3P9KA 4HNVA 1T95A 1ZHFA 2OV7A 1NU1J 3KXDA 4H13D 2H8WA 2K4JA 2LR8A 1EJ9A 3S1MJ 4A7PA 3L2RA 3ADPA 2CPSA 3OYCA 4C9YA 1QO0D 5IP7J 1SFOJ 1R4NB 4E7SA 1DD3A 2OQQA 1T8IA 4A3MJ 3M9AA 2N8GA 3FXDA 2COBA 2JUGA 3QQAA 4D3SA 4KUMA 4QSHA 4BQQA 1T2KC 1YQ4C 1MFTA 4W7ZA 1LE8B 4E7HA 1PP9G 3C1LA 1QMGA 3VMYA 4A5NA 2EZKA 3I0TA 3A5TA 4XONA 5FKNA 3LA7A 1VTNC 3L71J 3WODF 3GWZA 4OIOF 3LW5H 3D71A 2RH0A 2JA2A 1RH5B 3L72G 4IFMA 4HSTA 2NYXA 1A6QA 4C3JJ 3AG4H 1Z1DA 1WH7A 3E5QA 4XN3A 5BPIA 4IKFA 1SQXK 2W6BA 1FDMA 4DZPA 1FZAA 4OGQB 2LD5A 2CW7A 4WY4C 3SQNA 2E71A 2FQ3A 1SQQE 2PG4A 1YYVA 2XAJA 1MSEC 1IL0A 1GZLA 3GBGA 3LA3A 3E0JB 1YJNP 3G1OA 4BAYA 2Y0SA 3T8RA 3LSHA 1QZZA 1XSXA 1JUMA 1RF0A 1AKHA 3DLLF 4NC8A 4UVBA 2DFFA 4CYCA 4RDUA 3J7AO 1IZ1A 3HOUJ 1PGOA 2FY8A 3SZTA 4ZKUA 3GTLJ 3K4KA 3M7GA 2WSFJ 3HKZN 2ZXHA 4IHVA 2JMWA 3PL8A 4BJTA 3M1EA 4ZYDA 3CP2A 1U6GA 3HOZJ 3OYIA 3JSPA 1L0NJ 4PJJA 5ICCA 2EH3A 3DV8A 1DH3A 2HDCA 1YRLA 1GL2B 1GK4A 1D7MA 3C2HA 5L3FA 2WPSA 3M9QA 1MBKA 3COAC 3TSIA 1BOAA 2CYYA 3BWGA 1EDLA 3N97A 2DN0A 4GKGA 3PFYA 4O3MA 3K96A 2M4GA 1MW7A 3ZQ7A 1V54H 1FAVA 5ERIA 3VPRA 1PUFB 1KILD 3L75E 2ZXEB 4EV0A 3ZW8A 3R0JA 4XSZF 3WMM0 2M30A 2I10A 2F4MB 2VBWA 2VE8A 2FMYA 2IGKA 2ZSHB 3PNYA 4I0AA 5K5OA 3LW5J 3ABKH 2A61A 2W82A 4HQMA 5DV5A 3CO6C 1FYLA 1HUCA 2WZ7A 2LY9A 2CQ7A 2M8RA 3KYQA 1N73C 2HZDA 1PJRA 3O2PE 2R5YB 1TNTA 3SDGA 2ZXXA 3QU3A 2M7BA 2HPCB 4FISA 3SZGA 4JQFA 3DQVC 2W57A 4BE2A 3B4SA 4WF2A 1V55H 3S1QJ 1NTZE 2ID3A 3Q1MA 4IPAA 1R5LA 2R5ZB 2X9DA 4RAYA 2YO3A 3KZZA 1USTA 2GXAA 1RE4C 3J7AY 3IH2A 1Z21A 1G2CB 3ZQCA 3CL3D 4AD9A 2K27A 3DBRB 3FR8A 2DA2A 2DA1A 4RGXA 2HXOA 3Q3SA 1B72A 1QPMA 2MC4A 3A03A 4X1EA 5AW7B 1LB2A 5A2QZ 1BL0A 1F0YA 3W6ZA 1SD5A 2FF4A 2QENA 3KPHA 3LMMA 4GO1A 4IX7A 3DOJA 2VKDA 2HFHA 1E17A 5AVTB 1WDLA 3KP4A 3VP8A 1GVDA 2W25A 1VF5B 2R5BA 2L9VA 4OIPF 3S32A 2QE7H 4J01A 1L4AC 3BCCJ 2YX4A 2DMNA 3DKYA 2JRMA 1A31A 3TP3A 4LK0F 1UHWA 5CVRA 2E5ZA 2E34A 2B9SA 5AW1B 4EIJA 2KP8A 1SD7A 2CU7A 3FX3A 3CWBG 3I3LA 3W2AA 2WT7A 2HQRA 3WS7A 3TNUA 5CCHD 2LKPA 2VKEA 1RKWA 4BEHB 2XNDH 2VBXA 4F52A 3ULQB 1NKZB 3EDPA 1Y1VJ 5CLSA 1D0YA 4CSWA 2FXPA 2HODA 3BZ6A 1KQ8A 2A06E 2XZRA 4UB6H 1AHDP 1K04A 4ZZLA 4O9BA 3IUOA 2XRLA 3ASOH 2EBIA 2AXTE 2HPMA 1GDTA 5M5WJ 2Q5UA 5JFRA 3H1ID 3HUSA 3KP6A 2QJKB 2P5KA 3OYKA 1Q7YQ 1N77A 1EZVI 2K40A 2E2IJ 1LWUB 1M1JC 3HD7D 3KEYA 1PV3A 4IOAF 3IR9A 1K79A 1BA5A 1UJ8A 3BR1A 3RKXA 3P7KA 3ZW9A 2EZHA 5D5VB 2K9JA 3FK6A 2FKWB 3IF4A 2PMZN 1K8AQ 2QLZA 3UKGA 1FZBA 1USDA 1IDYA 3DFGA 4XOPA 2DLLA 1KYZA 2XF5A 3OYLA 3G4SI 1H8AC 1MNMC 4A93J 2A45I 4CDGA 2KYVA 1KQ9A 4R4MA 3VMAA 2DOAA 3VSLA 3AEFC 4H0LC 3TK1A 1NU1K 3OWTA 1FYMA 1C0WA 1VQ5I 2A45H 4U3FG 1RPWA 1P2FA 1G59A 1RETA 3I55I 4D6TE 3HWRA 1FZCA 3A1YA 1TWHJ 3H36A 4LB5A 4FT8A 5GTHC 1R22A 4PK4A 4E7KA 2JWTA 4Q47A 5CYVA 4A6DA 1VQKI 1SQQJ 2GOMA 4BXFA 2OA4A 1A35A 5A9SA 2HNHA 3WTWC 4HDVA 1Q90D 3EETA 2QKLB 2N1TC 4EM1A 1TNSA 2JVHA 4U0YA 1FZGA 5FO5A 1TQIA 5ED4A 2CO5A 2JP3A 2Y48A 3BZCA 2WITA 1YRNA 1Z9CA 2VQGA 5DUIA 5HVQC 3GTMJ 1FNNA 4RA2A 5CKTA 1Y8QB 2D2CB 1PL5A 3KDPB 5CBOA 5C4XJ 3GEZA 2PJRA 1MNDA 2RN7A 3OOPA 4TV7A 3ZCOA 1Y9BA 3ULKA 3AEBC 1JI8A 2PEXA 1S7EA 1H0MA 4A3GJ 1JO5A 5IYBJ 1LT1A 1BR1A 2PLYA 2IBZG 3L74G 4L5JA 3F72A 2V1UA 1BW5A 3GCMA 4FQGA 1JJ8C 1BOBA 2K37A 3CKYA 1YTZT 2NNNA 4Z6YA 5FLMJ 3ESWB 5EG0B 3CJQB 3ZMSA 1IN4A 3BG7A 2POHA 4OINF 4L0YB 2KUBA 2Z4EA 4XK4A 1HW5A 1R49A 3IAOA 5F0FA 2OTLI 1IRZA 4IRGA 4PJMA 4II2A 3RZDJ 3ZWBA 2E75B 3L75J 4UHTA 1K6OA 1I36A 2IYPA 1S72I 2YU3A 4DT0A 2QGUA 1D1BA 1ZK8A 3I9V2 1WGXA 4W97A 3WHBA 3EFGA 4KUGA 3OA7A 2LREA 1HBWA 4ANJA 4MTEA 1R9TJ 3OS1A 4YPCA 4RGUA 3J80Z 2WSEH 1VFCA 4C2UA 1Z3YA 4UVCA 1L0NK 5F64A 4BQAA 3BVHA 3D6YA 1XTAA 3CF2A 1ZP0C 1KYOE 1ZGWA 2NRGA 2F6CA 4HX8A 1FOKA 2KRCA 3HXLA 2C0XA 2JDIH 3L1PA 5CCHA 2GUVA 1JHHA 1W5CC 2YPRA 5E3NA 2R7ZJ 2IS1A 3S2HJ 2E76D 3G71P 1NTZJ 3OV8A 3KETA 3RQSA 1ENHA 2VI6A 2DXIA 2L01A 1HVVA 3U1AA 1K83J 3CCSI 1IFDA 3W3CA 1VQOI 2BEQD 3K1MA 2KSJA 2K7LA 1NTME 2A5YB 2E5NA 3BPVA 2ZXIA 4CCMA 3BATA 3HD7A 4LMYA 2DCEA 2R3CA 3M8EA 4FGWA 4M3BA 2BCCG 5B66C 3CCEP 1N75A 4RAFA 3NAUA 2HEOA 2QSHX 3EYYA 2STWA 2EFNA 1IGNA 1DD4A 3IRQA 4ZYAA 2WSCH 3CCJI 1BIBA 2Q0OA 3ZGKA 2EZLA 4IOCF 4ZYEA 5IY5H 1LE8A 3VYUB 4GFBA 4DBRA 3U2RA 3QHAA 1IFJA 2IPPA 1I3QJ 2D2WA 3SFZA 2VPRA 5EFWB 2IZ0A 1FOWA 3P9IA 2P8TA 1W36D 4IHXA 1JY2N 3IQDB 1B8IB 4AVZA 2VT2A 1IN5A 4DYQA 2IA0A 2NS8A 5BU8B 2WSEJ 1X1BA 2JK3A 2EV6A 2OCEA 1YE9A 1ZYRF 2PX9A 1AVOA 2XU6A 1V5FA 3ABMH 4A6EA 1XSDA 4C30A 1P7JA 1FZPB 1JDJA 1RF0C 4JBAA 3KZIH 1DEBA 3BLYA 2LOOA 2L7FP 4PV1C 1LEAA 3A01B 2GA1A 2M8EA 4MQ9F 3SZPA 4F55A 1F43A 1GK6A 1OVVA 2K4BA 2NOJB 2WAEA 1I6XA 2A07F 3F89A 1A6IA 4XKCA 1FT9A 2W85A 1O4XA 2WSSH 1TBXA 2V9PA 2NOGA 2IEKA 1R00A 4NQWB 3AKZA 2LTPA 4IO9F 4EQQA 1W4MA 2MFZA 3RBXA 4A3JJ 2FBHA 3TGUD 3CCLP 3G0OA 1YJWI 1GUUA 1L0LD 2KS1B 3WUTA 1GHCA 3CX5I 4U0WA 3U1KA 5HS8A 4MTDA 3E1SA 1UZCA 3DPTA 4QPQA 2Z5IA 1SQPE 1PFIA 1NTKE 5AW3B 2QKMB 3G9RA 2JTVA 2UWJE 1ACIA 2NS7A 4WXDA 2EA4A 2E1CA 2R3SA 3NMDA 1ZAOA 4LIVA 4KUEA 5CMZA 1F5TA 3WU0A 4D6TJ 1JUPA 2MH9A 1X0VA 1ZGAA 2W90A 3ADOA 1IUFA 1SFCC 3H1HG 4K2EA 2O6GE 2DMQA 1PUFA 3IKVA 3PTZA 4NC6A 1RQUA 5E8IA 3PJRA 5DD4A 1LDKB 2OQRA 3DKXA 4NB5A 3F0CA 2L9RA 3GTPJ 1G2HA 5LLQA 1BCCG 4YG2F 1CZQA 1QVGO 3JRFA 4CPGA 2CV0A 1BBYA 3K1PA 5DYMA 1FC3A 1UG0A 5F1RA 2R44A 1YITP 5BVZA 4XIDA 1Z7LA 3FISA 1VQMP 5A9RA 4XLPF 5J47A 1X8YA 2R5YA 1F36A 2BXYA 4H13C 5KLVE 1Y6IA 2QBYB 4R4LA 2HPCA 4X6AJ 4F93B 5LHIA 3QPHA 3O3KA 3RQIA 4E7JA 2C6YA 3AEEC 3L73E 1YG2A 1ETKA 3KFWX 3N4MA 4BBSJ 1IN6A 5HLGA 4HB1A 1ZG3A 1IG7A 1T0FA 2D2CD 1SQQK 2V1XA 1V5EA 3KX2A 4LIUA 1EH7A 3LSRA 1JCDA 1VL2A 2DTRA 1K61A 1SQXD 4GYGA 3L73D 3QYEA 4IQ4A 5GTIE 4HDUA 2XKOA 1BR2A 1DGRM 2M7AA 2RGVA 3ZQLA 1UCRA 1ZW0A 1X4PA 1Y56A 4BY1J 2VKHA 3Q9VA 2PP6A 4WB4A 2GAUA 2ZVNB 2HOEA 1QBJA 3RK3E 4F92B 3MN2A 5DEQA 1KS9A 2WPRA 1OQYA 2VJ4A 5JLXA 4JBZA 3DF8A 1S6LA 2ESNA 2FEZA 2X0LA 2WBMA 3JTHA 5E1ZB 3V7CA 2E75D 1HF9A 1LTGC 3LFUA 4IL6H 5J1YA 5APVA 2OD5A 5LFAA 5J4VA 1ZH5A 2UUZA 3VTPC 2L5GB 1QEXA 2IYOA 1B59A 5FKOA 4M6VA 1YJQA 3FXQA 1PPJE 3UIAA 3S3OA 1TTYA 1STZA 3CTAA 2F5VA 3OR2C 4XL9A 5EGOB 2EB7A 4KDPA 1TL8A 3FZVA 1NTMJ 3PSIA 3GF7A 3ZRGA 2W4SA 3JRGA 3SEQA 1TT0A 4BEHA 4D7NA 2OTKE 4YRVA 3HUSC 4L75A 2A69F 3ZQHA 2F4OB 5TJHA 2IFMA 3FXJA 1WP4A 2YSRA 4PZJA 4LC1A 3OYNA 4ZYHA 4IZZA 2KIUA 1GT0C 3VDXA 3NTNA 1BI3A 3DU5A 3AECC 1QNTA 4B43A 2STTA 2HFED 1YQAA 2LKMA 3G1MA 3AL0B 3ZP5A 3SSUA 1I39A 2KKOA 4UB6C 2P81A 1FTTA 1NTZK 3LIDA 1LWUA 2F5EA 2HOTA 2OTJI 3MIWA 1ETVA 3HUGB 1SP4A 5CQEA 4LGDE 1OCZH 1EC5A 4P5OA 3L4FA 1YI2P 4GGGA 3KE2A 1RIOH 2G8YA 4D7MA 1M57D 1FZCC 4RGRA 1AKHB 2BGCA 2DFIA 2GIZA 4II3A 4ENJA 1BGYD 1OFCX 3S8PA 4ZDOA 2IW5A 4QTRA 5KAFH 4A0XA 1Z7UA 5AVQB 4ABZA 5B1BH 1OYWA 2DA7A 2HWVA 4PSXA 3DLAA 3EUHA 5E1XA 5F6FA 5L3CA 3M3YJ 2QVAA 4XLHA 2F48A 4UY8I 3T1BA 3PH0A 2LSOA 4UV9A 2RQPA 2LVSA 1RF1B 1FMVA 1NHAA 2G7UA 2XPUA 3PUBA 4AIKA 2QRXA 3GG2A 4GOEA 2Q9IA 4MIMA 3V42A 4NBQA 3VODA 1KORA 3TGUJ 3ELKA 1W2EA 5M3FJ 1M90Q 4MFDA 5B5EH 1LNWA 1M2WA 1I6HJ 4BHCA 4PFPA 1HW2A 2V1NA 1BE3D 3AE1C 4G7HF 1YW9A 3LAPA 1IFMA 4NUBA 3P8CE 2Y75A 2IAIA 2FYUE 1UB9A 1HSJA 3NRVA 3G6EI 3K6GA 5H2FH 2P58A 1SFCB 3LSKA 2O8XA 4DNCA 2Z1DA 3H0GJ 2DJIA 2FSWA 4RB0A 2MLKA 1OJLA 3C2BA 1MNEA 1HH0A 2P7JA 3ZMTA 3P8CD 5FGMA 5BOXA 3ZQIA 2O7OA 1NTKJ 1SQPJ 2DO7A 1S5LX 4HAMA 2C0WA 1NJIQ 3LQQA 4P1WA 3J81Z 3I55P 1BJZA 3I4PA 3L7WA 1FIAA 1HJBA 5EG0A 1HXDA 1VQKP 2HDWA 1FBQA 2K9MA 3REOA 2Y9ZA 2FBKA 2H27A 5KKZB 1OWAA 3CMMA 4XA4A 4XN0A 1Z82A 2E7XA 2XSDC 2KRHA 5A9TA 3A0HH 2LDUA 3R60A 1TW3A 4AYBN 4B3AA 2E74B 2HG5D 2M45A 1IRXA 3WU2E 1JTHB 4Y99B 4PD4D 5CCHC 2LMDA 1R1UA 3EYIA 3S2DJ 4KUHA 2LC2A 2W00A 4HV5A 4MO7A 5JHUA 3WTYC 1JM0A 3H1LG 5KJ7C 1OYYA 3F8CA 4KN7X 2BZTA 2CV1A 3I4MJ 1N78A 2IVMA 4BWNA 5KLVJ 3D5RC 5J6XA 4B3IA 2NXNB 4BE0A 3L73J 5LGUA 4HNTA 1R1VA 3VYSB 1M67A 3R2PA 3BTCA 5E20A 2RKHA 2IBZI 1KTMA 2P4QA 1WJDA 1NU1D 4B1RA 3HD7C 2R7DA 2ZC2A 1JE8A 1EDKA 1JJ6C 3FXUA 1S7AA 3MOGA 3PJGA 1KB9E 4JPZB 3CMAI 2A45G 1H88A 5KAIH 4PCQA 2H88C 3MD0A 1NAFA 1YHQP 2BHYA 1UHMA 2O03A 2X1EA 1S3JA 3BR6A 2EFOA 4CCNA 5D5WB 1ZR4A 2MG4A 2L5QA 2CFOA 5F27A 3PNVA 2Y30A 2OBPA 1RQVA 2QJPC 2M5WA 3O8HA 3IRRA 1KYWA 4IVNA 1JY3P 1M75A 3L71D 2OF7A 3HTUA 3NARA 1QHHD 5FKMA 1JY3O 2KHMA 4J00A 3E6CC 1L3LA 3AE3C 4Y28J 1SQVE 5CHXA 4AQRD 2DT7B 3CXHD 2EINH 3S1KA 5GAGJ 2VXZA 1IC8A 1WJCA 1QVUA 1R23A 5JE8A 4UB8H 4N3YB 1SS1A 3SFIA 2OYOA 2HOSA 2HYJA 2J5OA 2D45A 3AE9C 2EIKH 1YLFA 4IHTA 2PMUA 5CVJA 1UG2A 1D8JA 2M0MA 4ENNA 2KZJA 1ULYA 3RCOA 2QSGX 3RJPA 2B63J 1M1EB 4LOCA 1WJAA 2WV1A 2Y0EA 1Z6TA 2NVUB 4K35A 4I98B 3I56I 4OOIA 3JCUH 1RNLA 3UR3C 4YEJA 5IPAA 3FMQA 1D0XA 3A01A 2EV0A 1S5LH 4G6QA 1VZ0A 3BTIA 1L0ND 1T3UA 1X1DA 2YKPA 3V8KA 3AE6C 1YIOA 3S93A 3KZIC 3ZMUA 3CLQA 1LTJB 2ZAEB 4NQWA 3MKLA 4PD4H 2VLAA 2X58A 3L2WA 4FHTA 3E1IA 1ZKGA 1BSHA 2A68F 1TXGA 1FP2A 3FM3A 1X1PA 1PZQA 3LSPA 3H1IG 3V2RA 1NH3A 1NTMK 4GT1A 2KS1A 5ILUA 2XAUA 1X1CA 1ZRCA 2P6SA 1SEUA 3HC7A 1WDMA 3M9BA 1BCCE 4M6YA 4S0HB 4RKUJ 1RI7A 5BU5A 1V3FA 4RS8A 1VQ4P 3A2KA 2H09A 2TDXA 4A3BJ 4N78E 1UIIA 5DS9A 1DPRA 2E76C 1BE3J 2BE5F 3GMEA 1OW8A 4JYBA 1IW7F 4Q5SF 1PGJA 4L0ZB 1Y39A 4PZDA 1T8ZA 3AEAC 3H6PA 2UYYA 4C46A 2FFDB 1IJDB 2RNGA 1N8RQ 2LNBA 2A6EF 4HQEA 3PJSK 2YS9A 2DI3A 3M4OJ 1Y8AA 5IOYA 1MSFC 2GLOA 4R1HA 3FM5A 1T0FC 2JKVA 2FYUJ 2WV0A 2IGMA 2L02A 4KITB 1NO4A 5FD6A 4NDLA 4BH9A 3LQRA 1MMAA 4LLLA 2Q8KA 2QBYA 4BNCA 1VQ6P 4YXWH 4I99C 3L2QA 2WB1N 1FWZA 3CXHH 3H1JE 5KLIB 3JAMK 1F17A 1CQTA 1IN7A 3T97B 3HPHA 3K4MA 5FLXK 3LIEA 1JUSA 2KK7A 1S2EA 2YR2A 2AEJA 3CCUI 2AEMA 5L3GA 3R4KA 3CD6P 1VQ9I 2JEEA 2KOGA 1KU9A 1XS9A 1W36C 3TO7A 2K88A 2DW4A 4HH2A 3BCCD 1ZGJA 1VQNI 1H9TA 2ZT9B 3WTUC 3W6UA 1AQTA 4PJ0H 3TBIA 2IA1A 1EF4A 2FYNC 2WSFH 2QQ9A 3C18A 3W6KB 3JRHA 1FTZA 2E5YA 1SQPK 5IYCJ 1QL1A 2LYCA 1NTKK 2Q7CA 2WTBA 1WRJA 2W48A 2P5LC 2FMLA 3KIOA 2E74D 4IRIA 1VQLP 3HG9A 4IL6C 5JVTA 1WZ2A 1D1CA 1HW1A 1Q1HA 4KN4X 4CICA 4CUGA 1P84E 3L70E 5E3MA 2JN6A 5D8LB 3OL3A 1OVRA 1SQBE 1BC7C 1YW8A 3F9KA 3HDDA 4BS9A 3ECHA 2QJPB 5EGOA 1ZG5A 4DOZA 1NH4A 3I59B 4WWCA 1A5JA 5HDKA 1T3JA 2KIKA 1G3SA 1LNQA 3GMAA 4OU0A 3L70D 5HS7A 1IJWC 2VQLA 2CPBA 3C7DB 5M5XJ 2QJKC 1XN7A 1PP8F 3HHGA 5GP9A 3VOEA 4A5MA 3FHZA 4DYDA 1DIPA 1LWUC 5AW5B 2FOWA 3RZOJ 4C7RA 5KLVK 2OZUA 1B1BA 3H3UA 2L9SA 3KEQA 3W6JB 5HODA 1YJ9I 3RL0B 4WXHA 4B86A 2ZJ2A 2DJNA 4M3DA 2BY1A 4MGRA 4BE1A 2ZO4A 1DU0A 2R7VA 2ZVOB 3F3SA 1SQVJ 3MGNA 2Z16A 1DGWY 2JSPA 3HUGA 1APLC 1Z6RA 3BTJA 4IFFA 5AW8B 3HDHA 5DDGA 3EUHC 5E18F 1SQQD 3BCBA 2DAOA 4GRIA 1PGNA 4W7YA 3V2QA 3HEFA 2FYZA 1FZEA 5AVUB 3QYBA 1X0XA 3KLNA 5KNLA 2PQ8A 3H1CA 2JA8J 3M8FA 1KU7A 2UWMA 1SD4A 1X4OA 2QF7A 1KU2A 3GLXA 4L5IA 4E7ZA 5APSA 1S8NA 4M9XA 3HSRA 5KAFC 4U7BA 1OCCH 2WQYC 1GV2A 1H9GA 1POGA 4ZDPA 2VPLA 3GHGB 3GTJJ 1RF1A 1OMIA 3HKZA 3K7AJ 3DU6A 3RDIA 3CMEI 2HGCA 1UMQA 2D2CC 3NQOA 5APXA 1W2BO 4UUSB 1J9IA 3EUAA 1LGHB 5EEAA 1EV7A 2OFPA 1J2XA 4XKWA 4YELA 2OTJP 4XLCA 1LFBA 4Y3OA 4B48A 1TZLA 4WXCA 2Q2EB 5LEKA 1DPUA 2WTYA 1NG6A 3EPZA 3QP6A 5J8FA 2M3EA 5B5EC 1IRFA 3MWMA 2H94A 3I5UA 1JEKA 3S3MA 5TGTA 4AUXA 2ZBKA 3M07A 5EDNA 1SFCA 2R32A 2E76B 3A0BH 1WI3A 2ZMEB 5KVRA 3HRMA 4WK8F 3L75D 4EJUA 2E75C 4OIRF 4HEA2 5H2FC 2W6JH 1KQLA 3G2BA 1L0LG 4UV8A 5BNGA 1SMTA 3KHUA 2QZ8A 3LA2A 5GAEJ 5CCGA 2XC7A 2CWEA 4KNYA 2RC4A 1DX7A 4RAGA 4CCLA 1J1EC 2AO9A 3H35A 3Q5FA 3HSEA 4KYWA 2QEXI 1EZVE 3D70A 2YMKA 1FJPA 4AYCA 1P92A 4KA4A 1YIJI 2SPZA 2HZTA 2LBFB 5B3SH 1JTHA 1NTZD 2PFBA 3E1RA 1N1GA 1KC8Q 1AOYA 1XDUA 1XSVA 3A0HC 3IKTA 3ERED 2LKSA 1LJ9A 2FOKA 3U21A 2VASA 4DQ2A 1T6AA 3O6QB 2ZJPF 4ZJZA 1FOSE 3KLOA 4GDFA 2Q3IA 1SVOA 4P9UA 2D3TA 2V4HA 3ZMVA 4PGGA 4E12A 4LLNA 3CUQB 2ECBA 1YONA 1IK7A 1OZHA 1H88C 1USEA 3H1JJ 3ZDMA 2QA4P 3E3VA 5F04A 3PSFA 2XV4S 1ZQ3P 1U9OA 1OX3A 3CCMP 3CC7P 3GTOJ 1GMJA 5AW0B 2FYNB 4M72A 3G1LA 2DQRA 5TISE 3EGOA 2MD5A 1YS7A 2X85A 3WU1B 3CC2I 1TQPA 5AVYB 4EDFA 1RR8C 2X6XA 1J5YA 2XV5A 1BI0A 2W84A 2GWRA 4XOTA 3O8GA 5E1WA 3TQNA 5ICEA 1SQXG 2FYUK 2Q3EA 3H32B 2PJPA 1LFUP 3K4BA 2DMUA 3DTKA 1SMYF 1BI2A 4PSWA 5KAIC 1CSBA 5E79E 1SFKA 2QQ8A 4OMZA 2CFXA 3VMXA 1RR7A 4M3EA 1ODDA 1N7LA 4V2GA 3ABUA 3BP8A 1TP4A 2UXXA 1PP7U 2C9NY 4Y52J 2ZT9D 2QYTA 4I2OA 3IL2A 5AVWB 4CYDA 5IT9K 1VQ7I 4GXOA 3BRVB 5GPAA 3L70J 2A06D 4R8HA 4E70A 4UVAA 1Y0NA 2OU2A 3LSGA 3MZ8A 1VQ8I 1S7OA 3Q0UA 1SQBJ 1IO2A 3CMAP 3K4JA 4UB8C 4KICA 2RMZA 1YTYA 2O01N 4P96A 3P8MC 3D5LA 3IAS2 3GFJA 3ZWAA 4FASD 5HOOA 4DLLA 1KFNA 3FK7A 2DODA 1Z3XA 2G3AA 2W6AA 2YKOA 1R4MB 1IZNB 3GX4X 3B73A 1O3SA 2TRTA 4PDKA 4RM2A 1QVTA 2P6TA 2PMZA 3JRDA 1KILE 2OCCH 4AVPA 1FC2C 3OAKA 5DTDA 1PUEE 1H0TB 3CC4I 1KN7A 3C7CB 2BV6A 3JCUC 5F1JA 1XD7A 5K5RA 1LTJA 4S04A 2MABA 5C4JJ 3BZKA 1ZARA 2B87B 3QU6A 1S5LC 5CCGD 3BDDA 1MMNA 1IV8A 4HBLA 5C44J 4D6TD 4F7ZA 3UNGC 2R7QA 3P9CA 1YOVB 3RL0D 4L76A 2DOEA 4D5CA 3OOUA 1XX5A 3IH3A 1U2WA 3T8TA 2QG4A 1A02J 1U8RA 4QMAA 2BVMA 1BGYG 2FE3A 2JR8A 1F12A 3I56P 5GAHJ 1WDKA 4BDZA 2KB7P 4IHSA 4H44B 1LEBA 1KONA 1XPXA 2M34A 4I7HA 2V9VA 4B8XA 1SQVK 2N9BA 2RDPA 1FE6A 3K5BA 2XGEA 3W2WA 4WWIA 3HOYJ 2FFDA 2O01J 1J7KA 1QA6A 1BR4A 1QVFO 4Z1MH 2J59M 2O9LA 3LSJA 4WX9A 1MUUA 5TISH 1WJ5A 4D5FA 3RK3B 3DEEA 4XKBA 1B9NA 1N25A 3R61A 1OPCA 4OMYA 4MNUA 3H1KG 1ZLJA 3JR9A 1ON2A 2XNXA 4I7ZB 4HOBA 2LRDA 1NYHA 1D5YA 1BE3G 2HYGD 3TOBA 4CZCA 1M56D 1J1EB 2QIWA 5BS6A 5C3EJ 4BJ5C 3Q2YA 1Q86Q 4RAZA 3O6BB 1X22A 2BXZA 3T97A 4B3XA 2KISA 4G94A 3TDUC 2LG4A 1FU1A 4KT5C 4QLCU 2AXTH 1A02F 3JSOA 4OL9A 1KYOD 2JJ7A 1L2PA 2H6BA 2WC2A 1MH3A 2V79A 3V4QA 3Q5SA 1K78B 4A3EJ 5D4RA 3WTXC 4OAYA 3T0YA 2DW3A 3S17J 3HRNA 1URQB 1XG1A 3LL7A 1HDDC 2XSJC 1VQPI 2DPUA 3L35A 5J8CA 3VP9A 1QGKB 2N9YB 1ZXGA 2XGXA 4L9JA 3DFUA 5FWNA 5J40A 1K6YA 1PP9E 3CX5E 2H1LA 4PJ0C 1ETYA 3BR2A 2E2HJ 5CPRB 1RC9A 4HZFA 1N86A 1NTMD 3V2PA 4M6XA 4GWGA 5BPDA 3L72E 1PP9D 2KLOA 3CDHA 4GCVA 2HTSA 2M0CA 4FCYA 2DFHA 2IA2A 1DQUA 1FOYA 2LKXA 3HTSB 1K4TA 5D6FA 1JY3N 3RBZA 2ZFWA 4DYRA 3MEXA 1MBEA 1QRYA 3ZQGA 4MQVA 2ITAA 2XGDA 3I59A 2L9NA 1EDIA 1WVRA 4C3HJ 1ZELA 1KA8A 3GZ6A 1NU1G 2E19A 1RE3A 3G17A 2F5DA 1XMXA 3SWKA 2VN2A 3AL0C 1XGNA 2JZYA 3BG6A 3PFIA 3GTQJ 2DK8A 2OGUA 4FETA 3CJRB 3NEUA 2GIVA 4V2FA 4U0VA 2GM4A 4A3LJ 1ZRTE 2NZ2A 1O57A 2L4AA 1Y1WJ 2IGNA 3ITKA 1I1GA 5AONA 3HN2A 2L0KA 3GVAA 4NHJA 3FWEA 3JTGA 1WPKA 1BI1A 3L71G 4L18B 5LGNA 3L9FA 1YBKA 2RNJA 3KYDB 3WGHA 2QM7A 1NGMB 1FOSF 3CCRI 2BY3A 4M73A 4DJGA 2LR2A 5IYDJ 4J19A 2GBYA 1EQ7A 1RF1C 4Y4RA 2VL8A 1P9QC 1W7PB 4ZC3A 2WTEA 3CJNA 3CMYA 5L3BA 2HVRA 2OZ6A 3ZPLA 1G3TA 1CW5A 3GF3A 4OH8B 5D4SA 3H5NA 1FJKA 2FA5A 3GHGA 4RB1A 2O3JA 1LPQA 2QYOA 1KYOH 5H20A 2HQ5A 1Z77A 2B89A 2R7FA 4UUSA 5FLVA 5K1YA 5FRMA 3VYTB 5DUKA 2KZVA 3D1NI 1MKMA 2R7WA 3K4CA 4YIRX 2YXQB 1SQPD 1KQ0A 1NTKD 2HVSA 4CCJA 2Q2EA 5DCMB 5D8KB 2NS0A 4M3GA 1SQBK 1U3EM 5H6RA 2AQFA 4BQNA 1L0NG 3TYYA 4EEFG 4DCKA 1SLQA 2E36A 1VF9A 3C1DA 3ERMA 4RB3C 5LRRA 1IN8A 3C2GA 2Q1KA 3EQ2A 1J75A 2ZMEA 5DM6F 1G6NA 1J09A 3PO3J 3M9HA 5KKZC 1ORKA 2M1BA 2IX7C 2HR3A 1ZLKA 2XF6A 3A0BC 3OIPA 2B0LA 4PZCA 1R5GA 3F6VA 2E74C 3FKJA 2V7FA 1O3TA 4Y99C 3D6ZA 3CMEP 2Z5HA 1I5ZA 1DP3A 2B88A 5KLVD 1K4SA 4AIJA 1G3YA 2CQNA 1ZG1A 2OJED 3R4YA 4XBFA 1YO5C 2LBFA 5FJ8J 2EA2A 2XAQA 2A6HF 2F5CA 4M71A 5KCMA 1X3UA 1AV1A 1X3WB 1KILB 3O6QA 4RMNA 2L7KA 1WKMA 3U9GA 3HTKB 3SJMA 5AIPA 3MTUE 2CQQA 1V5GA 3GFMA 3ZQFA 3HOTA 3CCVI 1LQ1A 3S15J 3CWBE 3O8ZA 5JI6A 2CV2A 2KL4A 3CUQA 1SFEA 1MZ9A 1I3AA 2HKXA 1ETXA 3HYIA 3KCCA 3RK3D 3H3VK 4A3IJ 1E79H 1YQ3C 2Y0MA 1LT9B 3K9TA 4IM7A 5JLWA 3OW2O 4ZMDA 1RKTA 2WMMA 2QEXP 5HDNA 1D1AA 1EH6A 3RK2D 1YIJP 1D5VA 3L2VA 5IP6A 1T98A 5DM7F 3FBNB 3AG2H 3SEZA 3H32A 2V7QJ 2M4KA 2XAGA 1Q81Q 3C8VA 4H0EA 1FEXA 3BROA 1PPJD 3KP5A 2V1DA 1PP9J 1S9KE 2XHKA 3BC8A 4HYEA 1LVKA 3BCCG 3RIRA 3RPQA 3HOSA 2DMPA 1USSA 3ZR8X 1URQD 4KHXA 5FFZA 3TEDA 1R5ID 2BW3B 1HSTA 1S9HA 4AM3A 1YJNI 2ZFCA 3L72J 2KIFA 1HDPA 1K7AA 4U3FE 3OYAA 2EQRA 1KQFB 4EATA 3IWFA 4UNOA 2M0BA 3TW7A 1HBXG 2DPDA 2I9PA 3FXKA 4IHWA 4RLQA 2E60A 4M3FA 3WE3A 3JAMZ 1U7MA 3HPGA 2AXCA 4LG0B 3ZMZA 3JRBA 1LTJC 2O0YA 1LSOA 1I27A 5FLXZ 4XORA 2KMUA 3RKWA 2D1VA 4BHBA 3ABVC 1GXQA 3VB2A 2YNYA 3F8MA 5AW6B 1QHGA 3CUOA 3I64A 1NHLA 1H0TA 1N7SD 3TO6A 1VI0A 5AVSB 2IBZE 5M1BA 2KDOA 2Z9OA 3L74E 2XKPA 3K2ZA 4Y13A 2ZNZA 1L4AD 3MKWB 2B87A 4C7NB 2VOPA 1ERDA 2OYIB 3CJTB 3K4LA 1BW6A 1VQ8P 5GTIH 2O8KA 1PIXA 3V2NA 2L2OA 4RO0A 1A04A 3MKYB 1F4KA 1G1IA 4ASVA 5HLHA 2BEOA 3GFIA 3HE4B 2DTZA 1QQIA 3I71A 1U8BA 1E3OC 3G4SP 5AIQA 1M8OB 1SQQG 2FFDC 1H89A 3L36A 3IH4A 3DWLE 1IK9A 4XKVA 3BQZA 1KU3A 3RPUD 5F08A 2D1HA 1OCPA 4RBOA 1J1DC 1MV8A 4BUPA 2P5VA 2FYUD 2E5TA 3R0AA 1VQ5P 3U1DA 4BHPA 3FHNA 5L3DA 1HLVA 5CBNA 2H1KA 3CC4P 4JQ0D 1W7PD 2UV1A 2VQCA 4AIDA 1EDJA 3FXEA 2QUFA 4E21A 2NVQJ 1DDNA 3FMSA 3CCYA 3VSKA 1IAWA 5KLIC 3L09A 5TJJA 2X1DA 4E6KG 5JR3A 1YS6A 2MGQA 2VQHA 3MVPA 1IV6A 2CUEA 3B8EB 2BY2A 1N1EA 1X2MA 3ASNH 5TISC 1W5SA 3RKQA 5GTHE 3K4NA 4KIGA 2EFPA 2OPTA 2M5AB 2VXDA 5K7FA 2Y0DA 2OYHB 5ILSA 5FRNA 5H6QA 1K9MQ 5CVVA 3FF5A 4AYBA 2JRTA 4B4CA 3DKWA 4MN4C 2DA6A 2XB5A 4HV6A 4CCKA 3L75G 1K73Q 2ZT9C 1V4RA 4NPDA 3K6JA 3L6DA 3ZWCA 4X0GA 3M91A 2BCCE 2LY1A 3PM1A 3ZQQA 2EFQA 4LD5A 3VN0A 1K78A 2OTLP 4FX0A 1OVUA 1J2JB 3RL0g 1LTAC 2AXTC 3DTIA 3QOEA 1VDFA 1URQA 2BCCD 1S72P 5M5YJ 4KMUX 2K9YA 2F2EA 3G73A 2DT5A 1YX3A 2EK5A 4EM0B 3AAFA 2ELJA 1KB9D 1NTZG 3VMZA 3Q0VA 3CWBJ 2V9KA 4OVNF 3FWNA 3GW6A 3MQ0A 2Y0CA 2TCTA 1RE3C 4A69C 2FJ1A 2K86A
chains in the Genus database with same CATH topology
5C4XJ 3H2ZA 4OM8A 5EZHA 3ULKA 1S7EA 1PGNA 4A3GJ 3HEFA 5IYBJ 1X0XA 4JX5A 2R5ZA 1TC3C 1BW5A 4DZJA 2JA8J 1RESA 1JJ8C 4A3KJ 2QF7A 3CKYA 3TP0A 5FLMJ 4FE4A 3JRCA 5EG0B 1GV2A 1POGA 3GTJJ 3FKIJ 3DCFA 3K7AJ 4XK4A 5F0FA 4XRSA 1IRZA 1UMQA 3ZWBA 3S1RJ 3RZDJ 4UUSB 2IYPA 1I36A 5EEAA 3JRAA 2OFPA 4G12A 2PLAA 1ZK8A 4W97A 1LFBA 1WGXA 2K9SA 3WHBA 4KUGA 1R9TJ 5E3OA 2E1OA 1VFCA 3BR5A 2RAEA 4AUXA 3QSGA 1U9NA 5EDNA 1ZGWA 1WI3A 2D5VA 1U78A 2YU9J 4UUTA 3L1PA 1OCTC 5E3NA 2R7ZJ 3LOCA 3S2HJ 1JTXA 1YB4A 3GTGJ 2XPWA 3BR0A 3RQSA 5BNGA 1ENHA 2VI6A 1T33A 1X58A 1K83J 3B6AA 3BQYA 2AHQA 2IBDA 3WHCA 4GBJA 2AO9A 1JGGA 2JA5J 1IDZA 5EYRA 2LFBA 1PGPA 1Q1VA 1N1GA 4FGWA 1VNDA 4M3BA 3NAUA 1ETWA 4B3HA 2W8ZA 4BBRJ 1IGNA 5K7ZA 2D3TA 3Q3CA 2Y9YA 4E12A 1YONA 2ECBA 2EZLA 2DA3A 4CYCB 1H88C 1LE8A 1TWAJ 5F04A 4GFBA 3QHAA 4MLOA 1I3QJ 1ZQ3P 1U9OA 1MBGA 2VPRA 3JREA 1HCRA 3GTOJ 2CVZA 4B3JA 1NK2P 2YUSA 2IZ0A 4IHXA 3IQDB 1B8IB 3G1LA 4QIWN 1ZCJA 5HWSA 4DYQA 1JTYA 1NTCA 3OSFA 2NS8A 9ANTA 5E3LA 2MW8A 3I4NJ 3EGOA 5AYVA 2JK3A 2ZYGA 3PDUA 2WAQN 3O8GA 1EVYA 3B6CA 1QPIA 1LFUP 1JDJA 1P7JA 1NK3P 2DMUA 1P7IA 2L7MP 3C7AA 4C3IJ 2X6OA 2L7FP 3A01B 1RR7A 1VPDA 1F43A 4M3EA 1M66A 2M2EA 4V2GA 4J0FA 1A6IA 1O4XA 2NOGA 2IEKA 4Y52J 3S16J 5M3MJ 2QYTA 2LTPA 4Y7NJ 4D3DA 2NVYJ 5GPAA 4A3JJ 3LSGA 3IV5A 3G0OA 1GUUA 3Q0UA 3I83A 4I6ZA 1F14A 1I50J 4XRMA 5J3LA 1LJ8A 2NS7A 3ZWAA 3PLRA 4KUEA 4DLLA 3FK7A 2ME0A 3QPLA 1JUPA 2ZYDA 1X0VA 2LP0A 2W90A 3ADOA 1IUFA 1SANA 2TRTA 1MBFA 1QVTA 2L7ZA 3JRDA 4GWKA 2DMQA 1PUFA 5DTDA 2Y2ZA 3C7CB 5F1JA 3GTPJ 3F0CA 2G0EA 2L9RA 3HM5A 1G2HA 1B72B 5C4JJ 3PEFA 3HADA 3JRFA 5IOZA 3FR7A 1M67A 5C44J 1AU7A 2NVTJ 1HOMA 4XIDA 3FISA 5A9RA 4D5CA 3OOUA 2R5YA 1F36A 3IH3A 1LSJA 1DLIA 4X6AJ 3RQIA 3JRIA 1ETKA 1FJLA 4BBSJ 4C2MJ 1IG7A 3HGYA 1ITYA 3LSRA 2R0QC 1F12A 1WDKA 2DA5A 1K61A 3OSGA 4EZBA 2M34A 2Y0SN 3ZQLA 2XGEA 1JKPC 3HOYJ 1X2NA 4BY1J 2FD5A 1ETOA 3ZOBA 3MN2A 2O9LA 3LSJA 1KS9A 4D5FA 5JLXA 1H89C 5J1YA 3JR9A 3HOXJ 1D5YA 3ZHBA 2ECCA 2Y31A 5C3EJ 2IYOA 1MBJA 1B8IA 5FKOA 3GHYA 4MFEA 4M6VA 1YJQA 2KDZA 5F0CA 5EGOB 2CRGA 3HOVJ 3BTLA 4OL9A 2JJ7A 1JT0A 3BG3A 1MH3A 5J1UA 3JRGA 2NVXJ 4D7NA 4A3EJ 4PZEA 3ZQHA 3S1NJ 3S17J 1WP4A 1XG1A 1HDDC 1GT0C 3E7LA 1ETQA 5FWNA 3DFUA 5A9SB 1ETYA 3BR2A 3G1MA 2E2HJ 1HF0A 2P81A 1FTTA 1YRNB 4GWGA 2HOTA 4BKXA 1ETVA 2DA4A 3K2AA 4A3CJ 4FTHA 2M0CA 4FCYA 2LKXA 4D7MA 2MSYA 1AKHB 1OFCX 3BG5A 4DYRA 1MBEA 1QRYA 5FKKA 3ZQGA 2LK2A 4QTRA 2XGDA 4ABZA 4C3HJ 2DA7A 4JYKA 2E19A 3G17A 3M3YJ 2XB0X 2FX0A 2ME6A 2R92J 3GTQJ 2LVSA 2XPUA 1T56A 1MBHA 4MIMA 2LLKA 4V2FA 2GM4A 4A3LJ 4YCAA 1JKQC 1Y1WJ 5M3FJ 4MFDA 3QPSA 1WH5A 3HN2A 2L0KA 3CDLA 1M2WA 2DMTA 1I6HJ 4W1UA 1MH4A 1WPKA 2XPVA 4IEJA 1DU6A 2CJJA 3OBBA 2IAIA 1GV5A 2CUFA 1TWCJ 5FKLA 5IYDJ 4J19A 2GBYA 5J1RA 3H0GJ 3C2BA 1OJLA 3GTKJ 3ZQIA 2O7OA 3CMYA 2VUMJ 4OQZA 2ZB9A 1BJZA 1FIAA 5EG0A 5F0HA 2Y9ZA 2FQ4A 3PO2J 4XICA 2HQ5A 1Z77A 3LNQA 4UUSA 1WCMJ 5FLVA 1WPQA 2XSDC 1EVZA 1Z82A 3D1NI 5A9TA 2X48A 4OQYA 4AYBN 2M8GX 4B3AA 1W0UA 1DLJA 4M3GA 4HNVA 1M76A 2QCOA 2LR8A 4MO7A 4EEFG 3S1MJ 3S2DJ 3ADPA 4KUHA 4DCKA 1VF9A 1SFOJ 5IP7J 1TWGJ 3I4MJ 4A3MJ 2N8GA 2COBA 4D3SA 3QQAA 4B3IA 4QSHA 2JA7J 3PO3J 1ORKA 3BTCA 1LE8B 2P4QA 4PZCA 4B1RA 5EZGA 1QMGA 2EZKA 5FKNA 2EW2A 1JJ6C 3MOGA 3PJGA 1PGQA 4JPZB 2HXIA 4C3JJ 1WH7A 3BR3A 4DZPA 5MGBA 3BR6A 5FJ8J 2LD5A 1ZR4A 2MG4A 5F27A 2Y30A 3O8HA 1IL0A 1MSEC 3WFIA 3GBGA 1M75A 2OF7A 3NARA 3SJMA 5FKMA 3G1OA 2CQQA 3TW6A 2HI3A 3S15J 1JKOC 3ZQFA 1JUMA 1BG6A 2VKVA 2KT0A 1AKHA 4RDUA 4XRSG 4CYCA 1IC8A 3S14J 3HOUJ 1ETXA 1QVUA 1PGOA 3H3VK 3GTLJ 4A3IJ 5JE8A 5K7HA 3HKZN 4BY7J 3SFIA 2HOSA 2HYJA 4IHVA 2JMWA 1W0TA 1YVEI 4IM7A 3HOZJ 1XC5A 5JLWA 1RKTA 2EH3A 2HDHA 1UG2A 4S3MA 1YRLA 2ELKA 3WFJA 2B63J 5IP6A 3DEWA 4LOCA 1MBKA 2WV1A 2E2JJ 2DN0A 1FEXA 3K96A 1UHSA 2GF2A 2R93J 4DW6A 5IPAA 4FE7A 3A01A 3VPRA 1PUFB 3BTIA 3PIDA 3HBLA 3ZW8A 2CQXA 4JX4A 3BG9A 2PGDA 4A3FJ 1ZR2A 2DMPA 2I10A 3MKLA 3OIOA 2X58A 3TEDA 1ZKGA 4AC0A 2HDDA 1TXGA 2LY9A 1HDPA 5EF6A 3LSPA 2HOAA 2XGCA 2EQRA 3FIWA 2R5YB 4IHYA 3SDGA 3TW7A 2I9PA 1WDMA 4FISA 4IHWA 2ID6A 4M3FA 4S0HB 3W6VA 4BXXJ 3S1QJ 2ID3A 3JRBA 3Q0WA 1LSOA 2R5ZB 2X9DA 4A3BJ 5DS9A 3IH2A 3ZQCA 1PGJA 5IP9J 4PZDA 1JT6A 2UYYA 1VI0A 2DA2A 3FR8A 2DA1A 2HXOA 3Q3SA 1B72A 2YS9A 1Z0XA 3M4OJ 3BT9A 3A03A 4X1EA 5IOYA 1BL0A 1MSFC 2GLOA 1F0YA 3W6ZA 2K9QA 2JKVA 4D3FA 1BW6A 4JX6A 2ZYAA 3DOJA 4NDLA 2O8KA 1WDLA 2H8RA 1GVDA 4JP0A 2WB1N 2DTZA 1U8BA 1E3OC 1F17A 1CQTA 2DMNA 5GPCA 3TP3A 3IH4A 1JUSA 3BQZA 1FIPA 5F08A 4RBOA 1OCPA 4A3DJ 3ZGYA 2CU7A 1HLVA 2H1KA 3WS7A 4JQ0D 4I76A 2VKEA 1RKWA 4L5EA 1XS9A 2NVQJ 4E21A 2JA6J 3CCYA 1YJ8A 3W6UA 1Y1VJ 3HB9A 1EF4A 2MGQA 3MVPA 1IV6A 2CUEA 1JKRC 1AHDP 3CTVA 3JRHA 1N1EA 1X2MA 1FTZA 4J0EA 2XRLA 2EBIA 5IYCJ 5M5WJ 1GDTA 3CQZJ 2WTBA 4R1NA 2W48A 3RKQA 4DYCA 2OPTA 2K40A 5K7FA 2E2IJ 2IZ1A 1BA5A 3BR1A 3ZW9A 2EZIA 2EZHA 3A02A 4B4CA 3FK6A 3HGGA 2DA6A 2PMZN 2XB5A 5E3MA 3UKGA 2JN6A 2M9HA 3HDDA 3K6JA 3L6DA 3ZWCA 1IDYA 4A93J 5EGOA 3PM1A 1H8AC 1MNMC 1A5JA 2K9NA 1IJWC 1TWFJ 3C7DB 5M5XJ 1RPWA 5GP9A 1RETA 4DYDA 3HWRA 4E13A 5M5YJ 1TWHJ 3RZOJ 2JWTA 5HODA 5A9SA 2DJNA 4M3DA 1DU0A 3F3SA 3Q0VA 1YRNA 4OVNF 3FWNA 1ZTRA 3GTMJ 1APLC 2TCTA 3BTJA 4A69C 3HDHA 2FJ1A 3HOWJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5C4X J;  5EZH A;  1S7E A;  4A3G J;  3HEF A;  5IYB J;  4JX5 A;  2R5Z A;  1TC3 C;  1BW5 A;  4DZJ A;  2JA8 J;  1RES A;  1JJ8 C;  4A3K J;  2QF7 A;  3TP0 A;  5FLM J;  4FE4 A;  3JRC A;  5EG0 B;  1GV2 A;  1POG A;  3GTJ J;  3FKI J;  3DCF A;  3K7A J;  4XK4 A;  5F0F A;  4XRS A;  1IRZ A;  1UMQ A;  3S1R J;  3RZD J;  4UUS B;  5EEA A;  3JRA A;  4G12 A;  1ZK8 A;  4W97 A;  1LFB A;  1WGX A;  2K9S A;  3WHB A;  1R9T J;  5E3O A;  2E1O A;  1VFC A;  3BR5 A;  2RAE A;  4AUX A;  1U9N A;  5EDN A;  1ZGW A;  1WI3 A;  2D5V A;  1U78 A;  2YU9 J;  4UUT A;  3L1P A;  1OCT C;  5E3N A;  2R7Z J;  3LOC A;  3S2H J;  1JTX A;  3GTG J;  2XPW A;  3BR0 A;  5BNG A;  1ENH A;  2VI6 A;  1T33 A;  1X58 A;  1K83 J;  3B6A A;  3BQY A;  2AHQ A;  2IBD A;  3WHC A;  2AO9 A;  1JGG A;  2JA5 J;  1IDZ A;  5EYR A;  2LFB A;  1Q1V A;  1VND A;  4M3B A;  3NAU A;  1ETW A;  4BBR J;  1IGN A;  5K7Z A;  2Y9Y A;  2ECB A;  2EZL A;  2DA3 A;  4CYC B;  1H88 C;  1LE8 A;  1TWA J;  5F04 A;  4GFB A;  4MLO A;  1I3Q J;  1ZQ3 P;  1U9O A;  1MBG A;  2VPR A;  3JRE A;  1HCR A;  3GTO J;  1NK2 P;  2YUS A;  4IHX A;  1B8I B;  3G1L A;  4QIW N;  4DYQ A;  1JTY A;  1NTC A;  3OSF A;  2NS8 A;  9ANT A;  5E3L A;  2MW8 A;  3I4N J;  2JK3 A;  2WAQ N;  3O8G A;  3B6C A;  1QPI A;  1LFU P;  1P7J A;  1NK3 P;  2DMU A;  1P7I A;  2L7M P;  4C3I J;  2X6O A;  2L7F P;  3A01 B;  1RR7 A;  1F43 A;  4M3E A;  2M2E A;  4V2G A;  1A6I A;  1O4X A;  2NOG A;  2IEK A;  4Y52 J;  3S16 J;  5M3M J;  2LTP A;  4Y7N J;  2NVY J;  5GPA A;  4A3J J;  3LSG A;  3IV5 A;  1GUU A;  3Q0U A;  4I6Z A;  1I50 J;  4XRM A;  5J3L A;  2NS7 A;  3FK7 A;  2ME0 A;  3QPL A;  1JUP A;  2LP0 A;  1IUF A;  1SAN A;  2TRT A;  1MBF A;  1QVT A;  2L7Z A;  3JRD A;  2DMQ A;  1PUF A;  5DTD A;  2Y2Z A;  5F1J A;  3GTP J;  3F0C A;  2G0E A;  2L9R A;  3HM5 A;  1G2H A;  1B72 B;  5C4J J;  3JRF A;  5IOZ A;  5C44 J;  1AU7 A;  2NVT J;  1HOM A;  4XID A;  3FIS A;  4D5C A;  3OOU A;  2R5Y A;  1F36 A;  3IH3 A;  4X6A J;  3RQI A;  3JRI A;  1ETK A;  1FJL A;  4BBS J;  4C2M J;  1IG7 A;  3HGY A;  1ITY A;  3LSR A;  2R0Q C;  2DA5 A;  1K61 A;  3OSG A;  2M34 A;  2Y0S N;  3ZQL A;  2XGE A;  1JKP C;  3HOY J;  1X2N A;  4BY1 J;  2FD5 A;  1ETO A;  3ZOB A;  3MN2 A;  2O9L A;  3LSJ A;  4D5F A;  5JLX A;  1H89 C;  5J1Y A;  3JR9 A;  3HOX J;  1D5Y A;  2ECC A;  2Y31 A;  5C3E J;  1MBJ A;  1B8I A;  5FKO A;  4MFE A;  4M6V A;  2KDZ A;  5F0C A;  5EGO B;  2CRG A;  3HOV J;  3BTL A;  2JJ7 A;  1JT0 A;  3BG3 A;  1MH3 A;  5J1U A;  3JRG A;  2NVX J;  4D7N A;  4A3E J;  3ZQH A;  3S1N J;  3S17 J;  1XG1 A;  1HDD C;  1GT0 C;  3E7L A;  1ETQ A;  1ETY A;  3BR2 A;  3G1M A;  2E2H J;  1HF0 A;  2P81 A;  1FTT A;  1YRN B;  2HOT A;  4BKX A;  1ETV A;  2DA4 A;  3K2A A;  4A3C J;  4FTH A;  2M0C A;  4FCY A;  2LKX A;  4D7M A;  2MSY A;  1AKH B;  1OFC X;  3BG5 A;  4DYR A;  1MBE A;  1QRY A;  5FKK A;  3ZQG A;  2LK2 A;  4QTR A;  2XGD A;  4ABZ A;  4C3H J;  2DA7 A;  4JYK A;  2E19 A;  3M3Y J;  2XB0 X;  2FX0 A;  2ME6 A;  2R92 J;  3GTQ J;  2LVS A;  2XPU A;  1T56 A;  1MBH A;  4MIM A;  2LLK A;  4V2F A;  2GM4 A;  4A3L J;  1JKQ C;  1Y1W J;  5M3F J;  4MFD A;  3QPS A;  1WH5 A;  2L0K A;  3CDL A;  2DMT A;  1I6H J;  4W1U A;  1MH4 A;  1WPK A;  2XPV A;  4IEJ A;  1DU6 A;  2CJJ A;  2IAI A;  1GV5 A;  2CUF A;  1TWC J;  5FKL A;  5IYD J;  4J19 A;  2GBY A;  5J1R A;  3H0G J;  3C2B A;  1OJL A;  3GTK J;  3ZQI A;  2O7O A;  3CMY A;  2VUM J;  2ZB9 A;  1BJZ A;  1FIA A;  5EG0 A;  5F0H A;  2Y9Z A;  2FQ4 A;  3PO2 J;  4XIC A;  2HQ5 A;  1Z77 A;  3LNQ A;  4UUS A;  1WCM J;  5FLV A;  2XSD C;  3D1N I;  2X48 A;  4AYB N;  2M8G X;  4B3A A;  1W0U A;  4M3G A;  4HNV A;  2QCO A;  2LR8 A;  4MO7 A;  4EEF G;  3S1M J;  3S2D J;  4DCK A;  1VF9 A;  1SFO J;  5IP7 J;  1TWG J;  3I4M J;  4A3M J;  2N8G A;  2COB A;  3QQA A;  4QSH A;  2JA7 J;  3PO3 J;  1ORK A;  3BTC A;  1LE8 B;  4B1R A;  5EZG A;  2EZK A;  5FKN A;  1JJ6 C;  4JPZ B;  2HXI A;  4C3J J;  1WH7 A;  3BR3 A;  4DZP A;  3BR6 A;  5FJ8 J;  2LD5 A;  1ZR4 A;  2MG4 A;  5F27 A;  2Y30 A;  3O8H A;  1MSE C;  3GBG A;  2OF7 A;  3NAR A;  3SJM A;  5FKM A;  3G1O A;  2CQQ A;  3TW6 A;  2HI3 A;  3S15 J;  1JKO C;  3ZQF A;  1JUM A;  2VKV A;  2KT0 A;  1AKH A;  4RDU A;  4XRS G;  4CYC A;  1IC8 A;  3S14 J;  3HOU J;  1ETX A;  1QVU A;  3H3V K;  3GTL J;  4A3I J;  5K7H A;  3HKZ N;  4BY7 J;  3SFI A;  2HOS A;  2HYJ A;  4IHV A;  2JMW A;  1W0T A;  3HOZ J;  1XC5 A;  5JLW A;  1RKT A;  2EH3 A;  1UG2 A;  2ELK A;  2B63 J;  5IP6 A;  3DEW A;  4LOC A;  1MBK A;  2WV1 A;  2E2J J;  2DN0 A;  1FEX A;  1UHS A;  2R93 J;  4DW6 A;  5IPA A;  4FE7 A;  3A01 A;  3VPR A;  1PUF B;  3BTI A;  3HBL A;  2CQX A;  4JX4 A;  3BG9 A;  4A3F J;  1ZR2 A;  2DMP A;  2I10 A;  3MKL A;  3OIO A;  3TED A;  1ZKG A;  4AC0 A;  2HDD A;  2LY9 A;  1HDP A;  5EF6 A;  3LSP A;  2HOA A;  2XGC A;  2EQR A;  3FIW A;  2R5Y B;  4IHY A;  3SDG A;  3TW7 A;  4FIS A;  4IHW A;  2ID6 A;  4M3F A;  4S0H B;  3W6V A;  4BXX J;  3S1Q J;  2ID3 A;  3JRB A;  3Q0W A;  2R5Z B;  2X9D A;  4A3B J;  5DS9 A;  3IH2 A;  3ZQC A;  5IP9 J;  1JT6 A;  1VI0 A;  2DA2 A;  2DA1 A;  2HXO A;  3Q3S A;  1B72 A;  2YS9 A;  1Z0X A;  3M4O J;  3BT9 A;  3A03 A;  4X1E A;  5IOY A;  1BL0 A;  1MSF C;  2GLO A;  2K9Q A;  1BW6 A;  4JX6 A;  4NDL A;  2O8K A;  2H8R A;  1GVD A;  4JP0 A;  2WB1 N;  2DTZ A;  1U8B A;  1E3O C;  1CQT A;  2DMN A;  5GPC A;  3TP3 A;  3IH4 A;  1JUS A;  3BQZ A;  1FIP A;  5F08 A;  4RBO A;  1OCP A;  4A3D J;  2CU7 A;  1HLV A;  2H1K A;  4JQ0 D;  4I76 A;  2VKE A;  1RKW A;  4L5E A;  1XS9 A;  2NVQ J;  2JA6 J;  3CCY A;  1Y1V J;  3HB9 A;  1EF4 A;  2MGQ A;  3MVP A;  1IV6 A;  2CUE A;  1JKR C;  1AHD P;  3JRH A;  1X2M A;  1FTZ A;  2XRL A;  2EBI A;  5IYC J;  5M5W J;  1GDT A;  3CQZ J;  2W48 A;  3RKQ A;  4DYC A;  2OPT A;  2K40 A;  5K7F A;  2E2I J;  1BA5 A;  3BR1 A;  2EZI A;  2EZH A;  3A02 A;  4B4C A;  3FK6 A;  3HGG A;  2DA6 A;  2PMZ N;  2XB5 A;  5E3M A;  3UKG A;  2JN6 A;  2M9H A;  3HDD A;  1IDY A;  4A93 J;  5EGO A;  3PM1 A;  1H8A C;  1MNM C;  1A5J A;  2K9N A;  1IJW C;  1TWF J;  5M5X J;  1RPW A;  5GP9 A;  1RET A;  5M5Y J;  1TWH J;  3RZO J;  2JWT A;  5HOD A;  2DJN A;  4M3D A;  1DU0 A;  3Q0V A;  1YRN A;  4OVN F;  1ZTR A;  3GTM J;  1APL C;  2TCT A;  3BTJ A;  4A69 C;  2FJ1 A;  3HOW J; 
#chains in the Genus database with same CATH topology
 3H2Z A;  1IXR C;  2WVR A;  2P0W A;  1KQS O;  2IRF G;  3B71 A;  4BJ6 C;  2BEZ F;  3E97 A;  2ISY A;  1MGT A;  2K9L A;  4RLF A;  2E1M B;  2IPQ X;  3HZJ A;  3CCS P;  1TC3 C;  3RL0 C;  2CSO A;  4DZJ A;  5JHF A;  1L0O C;  1MJB A;  1P4W A;  4A3K J;  4P9F A;  1MJA A;  1N7S A;  1SQV D;  3MHV A;  1VQO P;  1GTW A;  4D0P A;  2XAS A;  3OYB A;  3A3Y B;  4FE4 A;  3JRC A;  1VQP P;  2PN6 A;  4HLY A;  4KT6 A;  3MP7 B;  3OYF A;  3FDY A;  4EJW A;  1NG7 A;  3DCF A;  3FKI J;  3GYH X;  1ZRD A;  1W5C E;  3GW2 A;  4XRS A;  2PI0 A;  2ZKZ A;  2MA3 A;  4IXA A;  1WJF A;  3DPU A;  1OR7 A;  3ECO A;  3JRA A;  4G12 A;  2NPS D;  3E5U A;  2K9S A;  2V26 A;  4M74 A;  1UAA A;  4N6J A;  2BVL A;  2EIL H;  2V4J C;  2ZFU A;  1JY2 O;  1NAY A;  1YYC A;  2W83 C;  2E1O A;  4PD4 I;  5FB2 A;  2Z2S B;  3CCJ P;  4U3F J;  2WAF A;  3BR5 A;  4ESJ A;  3RPU A;  2IFN A;  3QSG A;  2OAZ A;  4HA8 A;  2R7X A;  2H43 A;  2D5V A;  3GHG C;  3CDI A;  1U78 A;  2HLO A;  3H1H E;  4KJM A;  2XRN A;  1SVF A;  2HKO A;  1W7P A;  2KJC A;  5B66 E;  4YII A;  2CW0 F;  2ZNY A;  3MMY B;  2A06 G;  3FXM A;  1YW7 A;  3LOC A;  1YB4 A;  2WWW A;  3WU2 H;  4LB6 B;  2COM A;  1T38 A;  3GTG J;  1BDD A;  1T33 A;  1RHZ B;  1X58 A;  3R6S A;  2DYR H;  2ZXJ A;  5E8G A;  3DPL C;  3C7J A;  3BRT B;  5APW A;  2HTJ A;  2MD0 A;  2KFD A;  4G9Y A;  3WHC A;  2IBD A;  1JGG A;  5KTB A;  2JA5 J;  1WQ2 A;  1IDZ A;  5EYR A;  2KJB A;  1E0E A;  1BCC D;  2ZME C;  3C3W A;  1G4D A;  1Q1V A;  2WPV B;  3L74 J;  5DCM A;  2B9B A;  5AVX B;  3FXL A;  2R7U A;  5CJ4 A;  1J0R A;  4U87 A;  3DBH B;  4N78 D;  1J1D B;  4YFN F;  1YFH A;  1ETW A;  3MZW B;  4XFJ A;  4B3H A;  5LRS A;  1KB9 H;  4BBR J;  2ESH A;  2X51 A;  2WY8 Q;  2R7R A;  3BOQ A;  3KP7 A;  3NXS A;  1LTT C;  3Q3C A;  3F5H A;  4D6T G;  2Y9Y A;  1YJW P;  1O3Q A;  3CXH I;  4EYY Q;  4ZH4 F;  4BL0 B;  1TWA J;  1LJ2 A;  4MLO A;  5IT9 Z;  4ZYG A;  1LDJ A;  3JRE A;  1HCR A;  1ZRE A;  3M0A A;  1HWT C;  2YUS A;  2G9W A;  3GUD A;  3GXO A;  2ISZ A;  4QIW N;  3G71 I;  5HWS A;  1QX8 A;  2GZW A;  1JTY A;  1NTC A;  1FBU A;  9ANT A;  5E3L A;  2J5P A;  2MW8 A;  4O6J A;  3QPT A;  1DP7 P;  3WTV C;  2ZYG A;  3PDU A;  3H1J D;  2WAQ N;  2YIU B;  2WB1 A;  2DOF A;  3SYT A;  1W5T A;  1QPI A;  1GVJ A;  1OCO H;  1CF7 B;  4H44 D;  3CUQ C;  1P7I A;  2L7M P;  4LG3 A;  2XUB A;  3C7A A;  1KIL A;  3M1C A;  1B9M A;  1FOX A;  4ZZD A;  1JNM A;  1VPD A;  3HTK A;  3Q5R A;  1M66 A;  4J0F A;  3DBL B;  4V19 K;  2RQQ A;  2H89 C;  1OXZ A;  2B7E A;  1AWC A;  3S16 J;  4RJT A;  4KIB A;  1FX7 A;  2JPC A;  4AU7 A;  3CCQ I;  1ZN5 A;  4EJV A;  3IN6 A;  2NVY J;  1UEL B;  3QP5 A;  4M9S A;  1O3R A;  1XCB A;  2EV5 A;  1LT9 A;  4YIF A;  2FBW C;  1LKX A;  3IV5 A;  3MFK A;  2BCC J;  1MZB A;  3KP2 A;  3I83 A;  3LSM A;  2O1J A;  4I6Z A;  2R7O A;  4Y15 A;  1GU4 A;  1I50 J;  4XRM A;  3VYR B;  5J3L A;  4BAC A;  4HW0 A;  1LJ8 A;  2FXM A;  2NPS A;  1OKR A;  1HKT A;  3VOP A;  4I02 A;  3PLR A;  3NFQ A;  2ME0 A;  3ZMD A;  2PMH A;  1P84 D;  2LP0 A;  3KYL A;  3Q3D A;  4GIF A;  1MBF A;  2HYF A;  4AWX B;  2L4M A;  4CA0 A;  4CZZ A;  4GWK A;  1SQB D;  3W68 A;  4BRY B;  3TMO A;  1U7J A;  4E7I A;  4Q4Z F;  3CCV P;  1R5H A;  2HS5 A;  4DOJ A;  1G8X A;  3HM5 A;  4MHG A;  2DU9 A;  5LHH A;  3OYD A;  1UFM A;  3KZY A;  2JQ7 A;  5E17 F;  5IOZ A;  2BW3 A;  1ON1 A;  3OR1 C;  5HLT A;  1AU7 A;  3BJO A;  5KK1 A;  3LST A;  4XQF A;  4PJN A;  4WCG A;  3QYF A;  1HOM A;  1MFZ A;  3F6O A;  1NTM G;  3H5R A;  1S4X A;  1CGP A;  3RI4 A;  1WJE A;  3N7N A;  3MD2 A;  3J81 K;  3LWF A;  4HF0 A;  1DLI A;  3TO9 A;  4GOD A;  3JRI A;  4ESB A;  3CCL I;  4IRH A;  4EI2 A;  1AQ5 A;  4C2M J;  2FBI A;  4LG0 A;  1P4X A;  4B47 A;  1X1A A;  5FFX A;  1G1J A;  3MZY A;  1HGV A;  4RM3 A;  3EUK L;  1N2D C;  4JYC A;  3K70 D;  1MD0 A;  2QQA A;  2Y0S N;  1F9N A;  3RKY A;  5ILV A;  3H1K E;  1AVY A;  4HSR A;  2AXL A;  1S29 A;  5CVI A;  2E7W A;  4EOT A;  1X2N A;  4D9J A;  3Q5P A;  3K0L A;  2RKL A;  3D1L A;  1YTZ I;  3RTR A;  2CG4 A;  4XRF A;  2CK3 H;  4PGH A;  4C7N A;  2OYI A;  5AVZ B;  1EKE A;  2R7S A;  1H89 C;  3M0D C;  4JF7 A;  3B5N B;  1LUJ B;  2BOL A;  2ZSI B;  1LTB C;  3HOX J;  5JVG F;  4TLF A;  2K3F A;  3RYP A;  2MBF A;  4YFX F;  1S1C X;  3ZHB A;  2P2U A;  3H1H J;  2Y31 A;  2EIJ H;  1YIT I;  3HE4 A;  1R7J A;  1VQM I;  5GTI C;  1MBJ A;  3K1N A;  4HX4 A;  3KP3 A;  2VT3 A;  3GZ5 A;  3GHY A;  1Z67 A;  1BCC J;  4UB6 E;  2I76 A;  2MYS A;  3TGU G;  3A2A A;  4G6T B;  2BHZ A;  1M1K Q;  3RK3 C;  2CRG A;  2Z3Y A;  3HOV J;  4B09 A;  5FD5 A;  2DT6 A;  3H1L E;  1JT0 A;  2XVC A;  2EWN A;  4CGZ A;  5B1A H;  1P84 I;  5J1U A;  1XTG B;  1HKS A;  2NVX J;  4ZNC A;  4XR6 A;  4CCO A;  4PZE A;  4I7Z C;  4MEY F;  1EXJ A;  1XGS A;  3BJ6 A;  1MDM B;  1P84 H;  1REP C;  3RK2 C;  2VBY A;  3H1L D;  3E7L A;  1ZN2 A;  5D5U B;  1RUN A;  1O7L A;  1WSU A;  1MMS A;  3FXR A;  1NTK G;  1SQP G;  1KZH A;  5CQG A;  1X79 B;  1EZV D;  3G6E P;  2M5A A;  2DQL A;  3KEO A;  3GZN B;  4BKX A;  2OYH A;  3V4G A;  1JB0 J;  2Q1Z B;  4HLX A;  4A12 A;  1Z56 A;  1BDC A;  4LJZ F;  4M3L A;  1OLT A;  5K5Q A;  4LFU A;  1NOH A;  2A3S A;  4IJA A;  1URQ C;  3V7R A;  1E2X A;  1HA8 A;  2PBI A;  3OMY A;  1GXP A;  3S3N A;  5FKK A;  1QZY A;  1TT5 B;  4HJG H;  3GLL A;  4GDO A;  4OWR B;  3HE5 B;  3PRJ A;  3S4R A;  1LFP A;  3SWF A;  3Q9S A;  1GD2 E;  4GOF A;  3FR7 A;  2XB0 X;  3QOP A;  2FX0 A;  5ICF A;  2ME6 A;  3WTZ A;  2P67 A;  2UXN A;  2KIQ A;  3AG1 H;  2R92 J;  4S05 A;  2O61 A;  5KLV G;  1J59 A;  2QWW A;  1T56 A;  1IO4 A;  2LH9 A;  4CH7 A;  1MBH A;  3L73 G;  2FXO A;  3W2V A;  3D5S C;  4YCA A;  1OIP A;  3BAS A;  5LD2 C;  1NVO A;  1JKQ C;  2V6C A;  3QPS A;  1WH5 A;  1XB4 A;  2QJY B;  4EGZ A;  1U5T B;  1PYV A;  2ZJS E;  2K02 A;  3B02 A;  3BY6 A;  1DU6 A;  1XGM A;  1N7S C;  3OBB A;  3D0S A;  4XNF A;  4KJZ A;  5K5G B;  1TWC J;  5FKL A;  4PJL A;  2L54 A;  2UZK A;  4W80 A;  5J1R A;  1YI2 I;  3QWL A;  2O01 H;  1LVA A;  2WAD A;  3GTK J;  4HPQ A;  2ZB9 A;  2XDJ A;  4HF2 A;  1OR7 C;  3WUU A;  2AS5 F;  2OC6 A;  5F0H A;  2HU9 A;  4Y33 A;  3OYM A;  3MKZ A;  4XIC A;  3H1I E;  3AEG C;  2Z33 A;  1WCM J;  1WPQ A;  5J4Y A;  1EVZ A;  2M3B A;  5BQT A;  4G6D A;  4N0B A;  4OQY A;  4N9I A;  5BMZ A;  1PPJ G;  2WPQ A;  1W0U A;  1M76 A;  3PLN A;  2QCO A;  1D0Z A;  2XKM A;  1A36 A;  3HRS A;  4YXD C;  1AJY A;  1NKN A;  1TWG J;  1O7F A;  5DCF A;  4IFD K;  4I0B A;  4KIF A;  1E3H A;  3HJE A;  1FDO A;  1HGZ A;  3CPW O;  2JA7 J;  4PUS A;  4WY4 B;  1GU5 A;  1P6R A;  4HYT B;  3H3Z A;  4N4N B;  2YX7 A;  3AG3 H;  1PDN C;  5EZG A;  1FLI A;  1XTC C;  2LF8 A;  2EPF A;  4HNU A;  2EW2 A;  3WU2 C;  1JXS A;  1PGQ A;  1KV4 A;  2HXI A;  4OAZ A;  1KQG B;  3N4X A;  3BCA A;  3SXY A;  4ASN A;  2OYI C;  2DBB A;  3BR3 A;  3H9G A;  2W24 A;  3TL4 X;  1LP1 B;  5MGB A;  1WMK A;  3AFH A;  3V8J A;  2P10 A;  2XAH A;  1T6S A;  3I53 A;  3WFI A;  3F8B A;  4OGQ D;  3IP4 B;  3E5X A;  3TW6 A;  2HI3 A;  1JKO C;  3DXJ F;  2IDB A;  1BG6 A;  2VKV A;  2KT0 A;  1RUO A;  3S14 J;  4XRS G;  2QM3 A;  2I1K A;  3OJA B;  5APY A;  5K7H A;  4BY7 J;  3B5N D;  3KZI E;  5E79 H;  2K5C A;  3H5A A;  3RK2 B;  1W0T A;  1YVE I;  4AIH A;  1XC5 A;  2I8D A;  1KIL C;  2HQA A;  2HDH A;  3H1L J;  4S3M A;  2VRS A;  1Y0U A;  3LAJ A;  4DBQ A;  2ELK A;  2YXR B;  5KHD A;  3WFJ A;  1N73 B;  4K3A A;  1X19 A;  3DEW A;  4XLE A;  2FYU G;  4IQJ A;  5L3E A;  2IS2 A;  2XDV A;  2V6E A;  2E2J J;  2KLV A;  1ONV A;  2E1N A;  5LEJ A;  1CF7 A;  1RZ4 A;  2O3F A;  1GL2 D;  3S9O A;  2KP6 A;  1UHS A;  4L9T A;  2GF2 A;  2NNY A;  4DW6 A;  2R93 J;  3MUD C;  4FE7 A;  1SFX A;  3L37 A;  2IGO A;  4BDY A;  3GF2 A;  1WFX A;  1YHQ I;  3SDB A;  1LT9 C;  1F1Z A;  3AED C;  3PID A;  3HBL A;  5AW9 B;  2CQX A;  4JX4 A;  3BG9 A;  2PGD A;  4A3F J;  1ZR2 A;  1IUY A;  5APU A;  1ZOY C;  1Y8R B;  5LBQ A;  4HX7 A;  1R71 A;  3OIO A;  2JVG A;  3FMR A;  1HKQ A;  4ETS A;  2FUG 2;  4I01 A;  3FXO A;  4AC0 A;  4U7D A;  2HDD A;  2H8P D;  2ADU A;  5EF6 A;  4LIT A;  2M3A A;  2NPS C;  2HOA A;  2QQB A;  2VJI A;  2JSC A;  2XGC A;  3FIW A;  4M9Z A;  3CX5 D;  4IHY A;  1IRG A;  1XCV A;  4HRI A;  2KI7 B;  2PRR A;  3CCU P;  1FSH A;  1TU3 F;  2ID6 A;  1WT6 A;  2YMY A;  1AFO A;  3RQ4 A;  3W6V A;  1WI9 A;  3NWT A;  4BXX J;  1VQ9 P;  3L72 D;  3Q0W A;  1R58 A;  1N7S B;  4A2U A;  1VQN P;  4ON0 A;  4N4O B;  4BRY A;  3F3X A;  1FS0 E;  1L4A B;  5EEH A;  2MKV A;  5IP9 J;  3TDZ C;  2PFX A;  2QM8 A;  4XSX F;  1JT6 A;  3HL2 A;  2MJZ A;  3RSN A;  4Q48 A;  4I2L C;  2C9L Y;  1EXI A;  4U7J A;  3BPX A;  3CCQ P;  1Z0X A;  3ISP A;  1BC8 C;  3BT9 A;  2A6T A;  4LLH A;  1Q82 Q;  1FPQ A;  5C39 A;  1XMK A;  2K9Q A;  4D3F A;  4JX6 A;  2ZYA A;  3M06 A;  2ZXW H;  4EMS A;  2H8R A;  3WG7 H;  3L00 A;  1Z05 A;  2NRA C;  1ZRT D;  2ELH A;  4JP0 A;  3DP7 A;  1E3P A;  3V7S A;  2WY7 Q;  3SFE C;  4XLF A;  1VF5 D;  2RVC A;  5GPC A;  2KXP B;  3F22 A;  1FIP A;  2MH2 A;  4RES B;  4A3D J;  4XE5 B;  1FP1 D;  2CUZ A;  4HKZ H;  3KPE A;  3ZGY A;  4IL6 X;  1SQV G;  3TDK A;  4IL6 E;  1M1J B;  2QSF X;  3H1I J;  1U0J A;  1R5S A;  1KYO I;  2K3P A;  4I76 A;  1VQ4 I;  3FX0 A;  1JUN A;  1YJ9 P;  4L5E A;  4E7L A;  4RB2 C;  3F8F A;  2JA6 J;  2VB6 A;  5TRD A;  1QU3 A;  2XIG A;  1YJ8 A;  3ZXS A;  3WTS C;  5A2Q K;  3TGU E;  2DFE A;  3HB9 A;  2VIX A;  1LTI C;  1T2K D;  1JKR C;  1L0L E;  3CTV A;  4ITV A;  3B5N A;  1FMW A;  4J0E A;  3OS2 A;  1KZU B;  3GO5 A;  5L8R J;  4H0L B;  3V5B A;  4H44 C;  3CQZ J;  4R1N A;  4ZTF A;  3WTT C;  4DYC A;  2IZ1 A;  1VPC A;  2BAS A;  1Q2N A;  2NAZ A;  1MIJ A;  2FXA A;  4NC7 A;  1CI6 B;  2CUJ A;  2EZI A;  2KNC B;  3A02 A;  2V7Q H;  2CH0 A;  3HGG A;  1VQ6 I;  2WA0 A;  2CS3 A;  2N1T B;  1GL2 A;  4CXF A;  3CX5 H;  3IWZ A;  2M9H A;  3PNT A;  2EJR A;  5EJC A;  2EIM H;  1BSN A;  2JJL A;  2FNP A;  4L9V A;  2K9N A;  4WY4 D;  3ABT A;  2HYN A;  3OL4 A;  2WSC J;  3MUD A;  3S2W A;  1TWF J;  3AE7 C;  4NNJ A;  1K05 A;  4Y17 A;  3CD6 I;  2Z99 A;  1MDM A;  5FRO A;  3I54 A;  4E13 A;  3DEU A;  2OYH C;  2ICW G;  1SAU A;  2OQG A;  1ZV8 A;  3P5J A;  4ENM A;  3CLO A;  4O5V A;  1TQM A;  2FU4 A;  5CVU A;  3U1C A;  5KAF E;  3JC2 2;  4QWQ A;  1WRG A;  2P1J A;  4KT0 J;  4RGS A;  3QOD A;  1ZTR A;  1R1T A;  1JCC A;  2JPB A;  1KD1 Q;  3HSF A;  5AVR B;  3HOW J;  3ABL H;  1SQX E;  4N9H A;  4MEX F;  4OM8 A;  5EZH A;  4Z2Y A;  2KZI A;  1VQL I;  4JK1 X;  5AW2 B;  3PIO F;  3TGN A;  3IC7 A;  2DYS H;  4JX5 A;  2R5Z A;  2KSE A;  3HE5 A;  4C2T A;  3CI9 A;  1RES A;  5B5E E;  2CW8 A;  3CWB D;  3TP0 A;  1RRJ A;  4CHU A;  1G2C A;  4G7Z F;  1HQC A;  1HC8 A;  1KFM A;  2LXC B;  4ESF A;  1WWX A;  5H2F E;  4DZO A;  2Y69 H;  2NPS B;  2HPI A;  2FNA A;  3ZN1 A;  4JOM A;  2Z5U A;  3CCE I;  4EGY A;  2F5F A;  3S1R J;  2PAJ A;  3H1J G;  5AW4 B;  3T5X A;  2PLA A;  3H92 A;  3K70 C;  1HTL C;  1BJA A;  4QPO A;  1MJ9 A;  2E1M C;  2I1J A;  1U5T A;  3CZ6 A;  2X6W A;  1TLH B;  3H9Q A;  3ZN0 A;  5E3O A;  4FX4 A;  2W1O A;  1X0T A;  1Z91 A;  2P7V B;  3FWL A;  5D6E A;  2RAE A;  4L74 A;  1U9N A;  4PFO A;  2CQK A;  1S9K D;  3HIF A;  2YU9 J;  3LSI A;  2KZG A;  4AUW A;  3OY9 A;  4UUT A;  2R4G A;  3A0H E;  1OCT C;  2A05 A;  3X2Q H;  5IT3 A;  1JTX A;  3WE2 A;  2XPW A;  3BR0 A;  1QL2 A;  3PP5 A;  3H25 A;  3CC2 P;  4H4K C;  4U3F D;  4I1L A;  4U88 A;  3HRU A;  1T2K A;  3B6A A;  3BQY A;  2AHQ A;  3J7Y J;  3VWB A;  4GBJ A;  4NPF X;  3IFM A;  3U59 A;  3OYH A;  3P32 A;  1IFN A;  2LFB A;  1PGP A;  2VOO A;  3L70 G;  2AQE A;  3A4C A;  2VC1 A;  4HG2 A;  2P7C B;  1SQB G;  1WJB A;  2R5D A;  3J80 K;  2ETH A;  3WGG A;  4EJO A;  1SVM A;  3FBI B;  1VND A;  1TW2 A;  1BGY E;  4L73 A;  2VBZ A;  3OS0 A;  1G3W A;  3OYG A;  1M7L A;  1GW3 A;  3DTE A;  3QRF F;  2W8Z A;  2XAF A;  1VQ7 P;  1HJ0 A;  2IJL A;  5K7Z A;  3SHF A;  5KAI E;  2KPM A;  3FGA D;  2XRO A;  4WY4 A;  2IBZ D;  2DA3 A;  1LDD A;  4IF4 A;  4CYC B;  4R79 A;  3L74 D;  2GXB A;  1AA7 A;  1BIA A;  2IS4 A;  3C9I A;  3A7O A;  2P4W A;  4E4H A;  1MBG A;  4PV1 B;  1B4A A;  2DK5 A;  3EWK A;  4XLA A;  4ZKP A;  2CVZ A;  4B3J A;  1NK2 P;  2XF7 A;  1I1S A;  3M0D A;  1ZCJ A;  2KLU A;  4ZTJ A;  1R8E A;  3OSF A;  1QLE D;  1GLN A;  5HNF A;  3I4N J;  5AYV A;  2K3R A;  1XDS A;  3PQJ A;  2K1A A;  2BY0 A;  2IP2 A;  1BE3 E;  1EVY A;  1LP1 A;  3B6C A;  1NK3 P;  4UB8 E;  1IC2 A;  1GW4 A;  1YX5 A;  3G3Z A;  3MCZ A;  4C3I J;  3H1K D;  2X6O A;  3E6B A;  3K10 A;  3F23 A;  1L0L J;  2X1C A;  2MLG A;  1D8K A;  2M2E A;  1P4A A;  1MMD A;  1BM9 A;  2GQQ A;  1R6R A;  3EFF K;  1T39 A;  2GOX B;  3VEP A;  4UXN A;  5CJ0 A;  2MC3 A;  5LGT A;  5LHG A;  2OAR A;  3QH9 A;  5APQ A;  5M3M J;  4Y7N J;  3V4W A;  4LGW A;  2E35 A;  4KMF A;  1KGS A;  2I5U A;  4D3D A;  3VFZ A;  2YIU C;  3JCU E;  1AA0 A;  1D3Y A;  4H0L D;  4I6M C;  4ZDL A;  1JMM A;  2QA4 I;  1JOC A;  2ZJR F;  2IS6 A;  1S5L E;  5KJ7 D;  2CGP A;  1T08 B;  2GUS A;  4XM3 A;  3CCM I;  3CC7 I;  5E79 C;  1F14 A;  1IFI A;  3AE5 C;  2WWY A;  2E42 A;  1N73 A;  4BU2 A;  3OIQ A;  4KIS A;  2M87 A;  4PD4 E;  2O1K A;  3BJA A;  3QPL A;  2N1T D;  2ZYD A;  1FZF A;  3N05 A;  2JO1 A;  3ML6 A;  3PHL A;  4H13 B;  1SAN A;  1X3Z B;  1IXS B;  3QWO C;  3TF5 A;  1JGS A;  2L7Z A;  3E6D A;  2YO2 A;  2LY2 A;  1ZRF A;  2X6Y A;  2VE9 A;  4ASW A;  2O5R A;  2Y2Z A;  2G0E A;  2KIM A;  1B72 B;  3EQL F;  3PEF A;  3HAD A;  5HS9 A;  1NU1 E;  4DJA A;  1RE4 A;  2NVT J;  4EVI A;  1SQX J;  3SFD C;  3IHU A;  4EM2 A;  1LTS C;  2BYV E;  3TOA A;  2DDA A;  1EZV G;  1R36 A;  3M8J A;  3GLM A;  1FDI A;  1LSJ A;  1ZME C;  4XLN F;  4YTP C;  1FJL A;  3F21 A;  5CCG C;  5CJ9 A;  3HGY A;  1RY3 A;  1ITY A;  3L2C A;  2R0Q C;  2J58 A;  2GXG A;  5DJU B;  3CO7 C;  2DA5 A;  3F8N A;  2RN0 A;  3OSG A;  4EZB A;  3L71 E;  4DGW B;  4DIQ A;  2E43 A;  1E5W A;  3K69 A;  1UIX A;  1OCR H;  2HVQ A;  2R7T A;  2WT7 B;  1DEE G;  3TNU B;  1SC7 A;  1JKP C;  1L4A A;  3GFL A;  3CXH E;  2FD5 A;  1ETO A;  3ZOB A;  2A5W A;  3MAJ A;  3QAH A;  4I09 A;  1EH8 A;  4F91 B;  2HOD B;  1SD6 A;  3IAM 2;  4EJT A;  3KQG A;  4L9N A;  2LXB A;  1MMG A;  2HQN A;  4A0Z A;  5GAD J;  4G7O F;  1JY2 P;  1XGO A;  2K85 A;  3HUS B;  1QZE A;  2ECC A;  5EEG A;  4F3Q A;  2JUC A;  3CF5 F;  3V6I A;  3E7K A;  4ENK A;  4OGQ C;  2JWA A;  1B8I A;  1DUX C;  1JHF A;  2K9J B;  2L91 A;  3JSV C;  4MFE A;  4PJ0 E;  2CMP A;  2X4H A;  1OYI A;  5F0C A;  2KDZ A;  1L0N E;  4CO8 A;  4IOI H;  1XMA A;  3HHH A;  3JW4 A;  3BTL A;  3CP8 A;  1M1J A;  2JT1 A;  1JMB A;  3II6 A;  3BG3 A;  3B5N C;  5GTH H;  3J7Z I;  3ONQ A;  3V8L A;  3H1H D;  5HLI A;  3ROU A;  3W67 A;  2RRE A;  1FZC B;  4BGD A;  3S1N J;  4D1Q A;  2JWD A;  4WBA A;  4HF1 A;  1ETQ A;  2G7H A;  1BGY J;  1H8A A;  2F4I A;  5DJT B;  5A9S B;  1WHU A;  4TT3 H;  3AE4 C;  2AEF A;  1GL2 C;  5KJ7 A;  1KB9 I;  2QVO A;  2ZCW A;  3TKY A;  1HF0 A;  4BYY A;  1YRN B;  2VJJ A;  3P7N A;  3CCR P;  2DA4 A;  5APT A;  1CI6 A;  1W1W E;  3K2A A;  1QGP A;  4A3C J;  4FTH A;  5DD8 A;  1X9V A;  4GYI A;  4KFC A;  2KNC A;  2PJR B;  2N1T A;  3LFK A;  2ZJQ F;  2MSY A;  4UUV A;  3BG5 A;  3AE2 C;  2KRF A;  4LK1 F;  2LK2 A;  3I5C A;  4YFK F;  2J5U A;  3H1K J;  4JYK A;  1SAX A;  1FBM A;  4BXL A;  1IXC A;  1FBS A;  2GA2 A;  1EA3 A;  2BBY A;  4XMY A;  4NPE A;  4PV1 D;  1FSE A;  1Y47 A;  5ICG A;  3H0D A;  3HRT A;  2LF7 A;  3NWS A;  3L2U A;  5HNH A;  2IT0 A;  4WVZ A;  2L3D A;  4A0Y A;  5D5X B;  2LLK A;  2KQR A;  1OW7 A;  3WGI A;  1SFU A;  1PVE A;  2IXS A;  3E6M A;  2VON A;  3CDL A;  4BQO A;  1OW6 A;  2DMT A;  4W1U A;  1MH4 A;  4IEJ A;  2XPV A;  3OYJ A;  2WAQ A;  2CJJ A;  3H9J A;  2W7N A;  2Q6Q A;  3VYI A;  2RV8 A;  2EFW A;  1GV5 A;  2VJ5 A;  3USS A;  2CUF A;  1NWQ A;  3OYE A;  2VOD A;  3PIP F;  1ZLL A;  6PAX A;  1BN5 A;  1FY7 A;  3I58 A;  3KYC B;  3WG9 A;  3MZH A;  3PUF A;  2QSI A;  4OIQ F;  2VUM J;  1SFC D;  4P55 A;  4OQZ A;  1KMI Z;  3BCC E;  1IF1 A;  4LLG F;  1L0L K;  1OIS A;  2FRH A;  2QJY C;  2H6C A;  3CES A;  3PQK A;  5AVV B;  3RGU A;  2YKQ A;  1U5T C;  1SVL A;  2W27 A;  1B6A A;  2FQ4 A;  3RYR A;  1VF5 C;  2DDB A;  2VC0 A;  3PO2 J;  4G8X A;  3A0B E;  3LNQ A;  1FYK A;  2ACJ A;  4BXU A;  3AE8 C;  1IFP A;  5HDG A;  2X48 A;  5B66 H;  3SWY A;  1U57 A;  2OUM A;  2H7H A;  2M8G X;  4OWF A;  4B44 A;  3HD7 B;  1DLJ A;  3WUV A;  3P9K A;  4HNV A;  1T95 A;  1ZHF A;  2OV7 A;  1NU1 J;  3KXD A;  4H13 D;  2H8W A;  2K4J A;  2LR8 A;  1EJ9 A;  3S1M J;  4A7P A;  3L2R A;  3ADP A;  2CPS A;  3OYC A;  4C9Y A;  1QO0 D;  5IP7 J;  1SFO J;  1R4N B;  4E7S A;  1DD3 A;  2OQQ A;  1T8I A;  4A3M J;  3M9A A;  2N8G A;  3FXD A;  2COB A;  2JUG A;  3QQA A;  4D3S A;  4KUM A;  4QSH A;  4BQQ A;  1T2K C;  1YQ4 C;  1MFT A;  4W7Z A;  1LE8 B;  4E7H A;  1PP9 G;  3C1L A;  1QMG A;  3VMY A;  4A5N A;  2EZK A;  3I0T A;  3A5T A;  4XON A;  5FKN A;  3LA7 A;  1VTN C;  3L71 J;  3WOD F;  3GWZ A;  4OIO F;  3LW5 H;  3D71 A;  2RH0 A;  2JA2 A;  1RH5 B;  3L72 G;  4IFM A;  4HST A;  2NYX A;  1A6Q A;  4C3J J;  3AG4 H;  1Z1D A;  1WH7 A;  3E5Q A;  4XN3 A;  5BPI A;  4IKF A;  1SQX K;  2W6B A;  1FDM A;  4DZP A;  1FZA A;  4OGQ B;  2LD5 A;  2CW7 A;  4WY4 C;  3SQN A;  2E71 A;  2FQ3 A;  1SQQ E;  2PG4 A;  1YYV A;  2XAJ A;  1MSE C;  1IL0 A;  1GZL A;  3GBG A;  3LA3 A;  3E0J B;  1YJN P;  3G1O A;  4BAY A;  2Y0S A;  3T8R A;  3LSH A;  1QZZ A;  1XSX A;  1JUM A;  1RF0 A;  1AKH A;  3DLL F;  4NC8 A;  4UVB A;  2DFF A;  4CYC A;  4RDU A;  3J7A O;  1IZ1 A;  3HOU J;  1PGO A;  2FY8 A;  3SZT A;  4ZKU A;  3GTL J;  3K4K A;  3M7G A;  2WSF J;  3HKZ N;  2ZXH A;  4IHV A;  2JMW A;  3PL8 A;  4BJT A;  3M1E A;  4ZYD A;  3CP2 A;  1U6G A;  3HOZ J;  3OYI A;  3JSP A;  1L0N J;  4PJJ A;  5ICC A;  2EH3 A;  3DV8 A;  1DH3 A;  2HDC A;  1YRL A;  1GL2 B;  1GK4 A;  1D7M A;  3C2H A;  5L3F A;  2WPS A;  3M9Q A;  1MBK A;  3COA C;  3TSI A;  1BOA A;  2CYY A;  3BWG A;  1EDL A;  3N97 A;  2DN0 A;  4GKG A;  3PFY A;  4O3M A;  3K96 A;  2M4G A;  1MW7 A;  3ZQ7 A;  1V54 H;  1FAV A;  5ERI A;  3VPR A;  1PUF B;  1KIL D;  3L75 E;  2ZXE B;  4EV0 A;  3ZW8 A;  3R0J A;  4XSZ F;  3WMM 0;  2M30 A;  2I10 A;  2F4M B;  2VBW A;  2VE8 A;  2FMY A;  2IGK A;  2ZSH B;  3PNY A;  4I0A A;  5K5O A;  3LW5 J;  3ABK H;  2A61 A;  2W82 A;  4HQM A;  5DV5 A;  3CO6 C;  1FYL A;  1HUC A;  2WZ7 A;  2LY9 A;  2CQ7 A;  2M8R A;  3KYQ A;  1N73 C;  2HZD A;  1PJR A;  3O2P E;  2R5Y B;  1TNT A;  3SDG A;  2ZXX A;  3QU3 A;  2M7B A;  2HPC B;  4FIS A;  3SZG A;  4JQF A;  3DQV C;  2W57 A;  4BE2 A;  3B4S A;  4WF2 A;  1V55 H;  3S1Q J;  1NTZ E;  2ID3 A;  3Q1M A;  4IPA A;  1R5L A;  2R5Z B;  2X9D A;  4RAY A;  2YO3 A;  3KZZ A;  1UST A;  2GXA A;  1RE4 C;  3J7A Y;  3IH2 A;  1Z21 A;  1G2C B;  3ZQC A;  3CL3 D;  4AD9 A;  2K27 A;  3DBR B;  3FR8 A;  2DA2 A;  2DA1 A;  4RGX A;  2HXO A;  3Q3S A;  1B72 A;  1QPM A;  2MC4 A;  3A03 A;  4X1E A;  5AW7 B;  1LB2 A;  5A2Q Z;  1BL0 A;  1F0Y A;  3W6Z A;  1SD5 A;  2FF4 A;  2QEN A;  3KPH A;  3LMM A;  4GO1 A;  4IX7 A;  3DOJ A;  2VKD A;  2HFH A;  1E17 A;  5AVT B;  1WDL A;  3KP4 A;  3VP8 A;  1GVD A;  2W25 A;  1VF5 B;  2R5B A;  2L9V A;  4OIP F;  3S32 A;  2QE7 H;  4J01 A;  1L4A C;  3BCC J;  2YX4 A;  2DMN A;  3DKY A;  2JRM A;  1A31 A;  3TP3 A;  4LK0 F;  1UHW A;  5CVR A;  2E5Z A;  2E34 A;  2B9S A;  5AW1 B;  4EIJ A;  2KP8 A;  1SD7 A;  2CU7 A;  3FX3 A;  3CWB G;  3I3L A;  3W2A A;  2WT7 A;  2HQR A;  3WS7 A;  3TNU A;  5CCH D;  2LKP A;  2VKE A;  1RKW A;  4BEH B;  2XND H;  2VBX A;  4F52 A;  3ULQ B;  1NKZ B;  3EDP A;  1Y1V J;  5CLS A;  1D0Y A;  4CSW A;  2FXP A;  2HOD A;  3BZ6 A;  1KQ8 A;  2A06 E;  2XZR A;  4UB6 H;  1AHD P;  1K04 A;  4ZZL A;  4O9B A;  3IUO A;  2XRL A;  3ASO H;  2EBI A;  2AXT E;  2HPM A;  1GDT A;  5M5W J;  2Q5U A;  5JFR A;  3H1I D;  3HUS A;  3KP6 A;  2QJK B;  2P5K A;  3OYK A;  1Q7Y Q;  1N77 A;  1EZV I;  2K40 A;  2E2I J;  1LWU B;  1M1J C;  3HD7 D;  3KEY A;  1PV3 A;  4IOA F;  3IR9 A;  1K79 A;  1BA5 A;  1UJ8 A;  3BR1 A;  3RKX A;  3P7K A;  3ZW9 A;  2EZH A;  5D5V B;  2K9J A;  3FK6 A;  2FKW B;  3IF4 A;  2PMZ N;  1K8A Q;  2QLZ A;  3UKG A;  1FZB A;  1USD A;  1IDY A;  3DFG A;  4XOP A;  2DLL A;  1KYZ A;  2XF5 A;  3OYL A;  3G4S I;  1H8A C;  1MNM C;  4A93 J;  2A45 I;  4CDG A;  2KYV A;  1KQ9 A;  4R4M A;  3VMA A;  2DOA A;  3VSL A;  3AEF C;  4H0L C;  3TK1 A;  1NU1 K;  3OWT A;  1FYM A;  1C0W A;  1VQ5 I;  2A45 H;  4U3F G;  1RPW A;  1P2F A;  1G59 A;  1RET A;  3I55 I;  4D6T E;  3HWR A;  1FZC A;  3A1Y A;  1TWH J;  3H36 A;  4LB5 A;  4FT8 A;  5GTH C;  1R22 A;  4PK4 A;  4E7K A;  2JWT A;  4Q47 A;  5CYV A;  4A6D A;  1VQK I;  1SQQ J;  2GOM A;  4BXF A;  2OA4 A;  1A35 A;  5A9S A;  2HNH A;  3WTW C;  4HDV A;  1Q90 D;  3EET A;  2QKL B;  2N1T C;  4EM1 A;  1TNS A;  2JVH A;  4U0Y A;  1FZG A;  5FO5 A;  1TQI A;  5ED4 A;  2CO5 A;  2JP3 A;  2Y48 A;  3BZC A;  2WIT A;  1YRN A;  1Z9C A;  2VQG A;  5DUI A;  5HVQ C;  3GTM J;  1FNN A;  4RA2 A;  5CKT A;  1Y8Q B;  2D2C B;  1PL5 A;  3KDP B;  5CBO A;  5C4X J;  3GEZ A;  2PJR A;  1MND A;  2RN7 A;  3OOP A;  4TV7 A;  3ZCO A;  1Y9B A;  3ULK A;  3AEB C;  1JI8 A;  2PEX A;  1S7E A;  1H0M A;  4A3G J;  1JO5 A;  5IYB J;  1LT1 A;  1BR1 A;  2PLY A;  2IBZ G;  3L74 G;  4L5J A;  3F72 A;  2V1U A;  1BW5 A;  3GCM A;  4FQG A;  1JJ8 C;  1BOB A;  2K37 A;  3CKY A;  1YTZ T;  2NNN A;  4Z6Y A;  5FLM J;  3ESW B;  5EG0 B;  3CJQ B;  3ZMS A;  1IN4 A;  3BG7 A;  2POH A;  4OIN F;  4L0Y B;  2KUB A;  2Z4E A;  4XK4 A;  1HW5 A;  1R49 A;  3IAO A;  5F0F A;  2OTL I;  1IRZ A;  4IRG A;  4PJM A;  4II2 A;  3RZD J;  3ZWB A;  2E75 B;  3L75 J;  4UHT A;  1K6O A;  1I36 A;  2IYP A;  1S72 I;  2YU3 A;  4DT0 A;  2QGU A;  1D1B A;  1ZK8 A;  3I9V 2;  1WGX A;  4W97 A;  3WHB A;  3EFG A;  4KUG A;  3OA7 A;  2LRE A;  1HBW A;  4ANJ A;  4MTE A;  1R9T J;  3OS1 A;  4YPC A;  4RGU A;  3J80 Z;  2WSE H;  1VFC A;  4C2U A;  1Z3Y A;  4UVC A;  1L0N K;  5F64 A;  4BQA A;  3BVH A;  3D6Y A;  1XTA A;  3CF2 A;  1ZP0 C;  1KYO E;  1ZGW A;  2NRG A;  2F6C A;  4HX8 A;  1FOK A;  2KRC A;  3HXL A;  2C0X A;  2JDI H;  3L1P A;  5CCH A;  2GUV A;  1JHH A;  1W5C C;  2YPR A;  5E3N A;  2R7Z J;  2IS1 A;  3S2H J;  2E76 D;  3G71 P;  1NTZ J;  3OV8 A;  3KET A;  3RQS A;  1ENH A;  2VI6 A;  2DXI A;  2L01 A;  1HVV A;  3U1A A;  1K83 J;  3CCS I;  1IFD A;  3W3C A;  1VQO I;  2BEQ D;  3K1M A;  2KSJ A;  2K7L A;  1NTM E;  2A5Y B;  2E5N A;  3BPV A;  2ZXI A;  4CCM A;  3BAT A;  3HD7 A;  4LMY A;  2DCE A;  2R3C A;  3M8E A;  4FGW A;  4M3B A;  2BCC G;  5B66 C;  3CCE P;  1N75 A;  4RAF A;  3NAU A;  2HEO A;  2QSH X;  3EYY A;  2STW A;  2EFN A;  1IGN A;  1DD4 A;  3IRQ A;  4ZYA A;  2WSC H;  3CCJ I;  1BIB A;  2Q0O A;  3ZGK A;  2EZL A;  4IOC F;  4ZYE A;  5IY5 H;  1LE8 A;  3VYU B;  4GFB A;  4DBR A;  3U2R A;  3QHA A;  1IFJ A;  2IPP A;  1I3Q J;  2D2W A;  3SFZ A;  2VPR A;  5EFW B;  2IZ0 A;  1FOW A;  3P9I A;  2P8T A;  1W36 D;  4IHX A;  1JY2 N;  3IQD B;  1B8I B;  4AVZ A;  2VT2 A;  1IN5 A;  4DYQ A;  2IA0 A;  2NS8 A;  5BU8 B;  2WSE J;  1X1B A;  2JK3 A;  2EV6 A;  2OCE A;  1YE9 A;  1ZYR F;  2PX9 A;  1AVO A;  2XU6 A;  1V5F A;  3ABM H;  4A6E A;  1XSD A;  4C30 A;  1P7J A;  1FZP B;  1JDJ A;  1RF0 C;  4JBA A;  3KZI H;  1DEB A;  3BLY A;  2LOO A;  2L7F P;  4PV1 C;  1LEA A;  3A01 B;  2GA1 A;  2M8E A;  4MQ9 F;  3SZP A;  4F55 A;  1F43 A;  1GK6 A;  1OVV A;  2K4B A;  2NOJ B;  2WAE A;  1I6X A;  2A07 F;  3F89 A;  1A6I A;  4XKC A;  1FT9 A;  2W85 A;  1O4X A;  2WSS H;  1TBX A;  2V9P A;  2NOG A;  2IEK A;  1R00 A;  4NQW B;  3AKZ A;  2LTP A;  4IO9 F;  4EQQ A;  1W4M A;  2MFZ A;  3RBX A;  4A3J J;  2FBH A;  3TGU D;  3CCL P;  3G0O A;  1YJW I;  1GUU A;  1L0L D;  2KS1 B;  3WUT A;  1GHC A;  3CX5 I;  4U0W A;  3U1K A;  5HS8 A;  4MTD A;  3E1S A;  1UZC A;  3DPT A;  4QPQ A;  2Z5I A;  1SQP E;  1PFI A;  1NTK E;  5AW3 B;  2QKM B;  3G9R A;  2JTV A;  2UWJ E;  1ACI A;  2NS7 A;  4WXD A;  2EA4 A;  2E1C A;  2R3S A;  3NMD A;  1ZAO A;  4LIV A;  4KUE A;  5CMZ A;  1F5T A;  3WU0 A;  4D6T J;  1JUP A;  2MH9 A;  1X0V A;  1ZGA A;  2W90 A;  3ADO A;  1IUF A;  1SFC C;  3H1H G;  4K2E A;  2O6G E;  2DMQ A;  1PUF A;  3IKV A;  3PTZ A;  4NC6 A;  1RQU A;  5E8I A;  3PJR A;  5DD4 A;  1LDK B;  2OQR A;  3DKX A;  4NB5 A;  3F0C A;  2L9R A;  3GTP J;  1G2H A;  5LLQ A;  1BCC G;  4YG2 F;  1CZQ A;  1QVG O;  3JRF A;  4CPG A;  2CV0 A;  1BBY A;  3K1P A;  5DYM A;  1FC3 A;  1UG0 A;  5F1R A;  2R44 A;  1YIT P;  5BVZ A;  4XID A;  1Z7L A;  3FIS A;  1VQM P;  5A9R A;  4XLP F;  5J47 A;  1X8Y A;  2R5Y A;  1F36 A;  2BXY A;  4H13 C;  5KLV E;  1Y6I A;  2QBY B;  4R4L A;  2HPC A;  4X6A J;  4F93 B;  5LHI A;  3QPH A;  3O3K A;  3RQI A;  4E7J A;  2C6Y A;  3AEE C;  3L73 E;  1YG2 A;  1ETK A;  3KFW X;  3N4M A;  4BBS J;  1IN6 A;  5HLG A;  4HB1 A;  1ZG3 A;  1IG7 A;  1T0F A;  2D2C D;  1SQQ K;  2V1X A;  1V5E A;  3KX2 A;  4LIU A;  1EH7 A;  3LSR A;  1JCD A;  1VL2 A;  2DTR A;  1K61 A;  1SQX D;  4GYG A;  3L73 D;  3QYE A;  4IQ4 A;  5GTI E;  4HDU A;  2XKO A;  1BR2 A;  1DGR M;  2M7A A;  2RGV A;  3ZQL A;  1UCR A;  1ZW0 A;  1X4P A;  1Y56 A;  4BY1 J;  2VKH A;  3Q9V A;  2PP6 A;  4WB4 A;  2GAU A;  2ZVN B;  2HOE A;  1QBJ A;  3RK3 E;  4F92 B;  3MN2 A;  5DEQ A;  1KS9 A;  2WPR A;  1OQY A;  2VJ4 A;  5JLX A;  4JBZ A;  3DF8 A;  1S6L A;  2ESN A;  2FEZ A;  2X0L A;  2WBM A;  3JTH A;  5E1Z B;  3V7C A;  2E75 D;  1HF9 A;  1LTG C;  3LFU A;  4IL6 H;  5J1Y A;  5APV A;  2OD5 A;  5LFA A;  5J4V A;  1ZH5 A;  2UUZ A;  3VTP C;  2L5G B;  1QEX A;  2IYO A;  1B59 A;  5FKO A;  4M6V A;  1YJQ A;  3FXQ A;  1PPJ E;  3UIA A;  3S3O A;  1TTY A;  1STZ A;  3CTA A;  2F5V A;  3OR2 C;  4XL9 A;  5EGO B;  2EB7 A;  4KDP A;  1TL8 A;  3FZV A;  1NTM J;  3PSI A;  3GF7 A;  3ZRG A;  2W4S A;  3JRG A;  3SEQ A;  1TT0 A;  4BEH A;  4D7N A;  2OTK E;  4YRV A;  3HUS C;  4L75 A;  2A69 F;  3ZQH A;  2F4O B;  5TJH A;  2IFM A;  3FXJ A;  1WP4 A;  2YSR A;  4PZJ A;  4LC1 A;  3OYN A;  4ZYH A;  4IZZ A;  2KIU A;  1GT0 C;  3VDX A;  3NTN A;  1BI3 A;  3DU5 A;  3AEC C;  1QNT A;  4B43 A;  2STT A;  2HFE D;  1YQA A;  2LKM A;  3G1M A;  3AL0 B;  3ZP5 A;  3SSU A;  1I39 A;  2KKO A;  4UB6 C;  2P81 A;  1FTT A;  1NTZ K;  3LID A;  1LWU A;  2F5E A;  2HOT A;  2OTJ I;  3MIW A;  1ETV A;  3HUG B;  1SP4 A;  5CQE A;  4LGD E;  1OCZ H;  1EC5 A;  4P5O A;  3L4F A;  1YI2 P;  4GGG A;  3KE2 A;  1RIO H;  2G8Y A;  4D7M A;  1M57 D;  1FZC C;  4RGR A;  1AKH B;  2BGC A;  2DFI A;  2GIZ A;  4II3 A;  4ENJ A;  1BGY D;  1OFC X;  3S8P A;  4ZDO A;  2IW5 A;  4QTR A;  5KAF H;  4A0X A;  1Z7U A;  5AVQ B;  4ABZ A;  5B1B H;  1OYW A;  2DA7 A;  2HWV A;  4PSX A;  3DLA A;  3EUH A;  5E1X A;  5F6F A;  5L3C A;  3M3Y J;  2QVA A;  4XLH A;  2F48 A;  4UY8 I;  3T1B A;  3PH0 A;  2LSO A;  4UV9 A;  2RQP A;  2LVS A;  1RF1 B;  1FMV A;  1NHA A;  2G7U A;  2XPU A;  3PUB A;  4AIK A;  2QRX A;  3GG2 A;  4GOE A;  2Q9I A;  4MIM A;  3V42 A;  4NBQ A;  3VOD A;  1KOR A;  3TGU J;  3ELK A;  1W2E A;  5M3F J;  1M90 Q;  4MFD A;  5B5E H;  1LNW A;  1M2W A;  1I6H J;  4BHC A;  4PFP A;  1HW2 A;  2V1N A;  1BE3 D;  3AE1 C;  4G7H F;  1YW9 A;  3LAP A;  1IFM A;  4NUB A;  3P8C E;  2Y75 A;  2IAI A;  2FYU E;  1UB9 A;  1HSJ A;  3NRV A;  3G6E I;  3K6G A;  5H2F H;  2P58 A;  1SFC B;  3LSK A;  2O8X A;  4DNC A;  2Z1D A;  3H0G J;  2DJI A;  2FSW A;  4RB0 A;  2MLK A;  1OJL A;  3C2B A;  1MNE A;  1HH0 A;  2P7J A;  3ZMT A;  3P8C D;  5FGM A;  5BOX A;  3ZQI A;  2O7O A;  1NTK J;  1SQP J;  2DO7 A;  1S5L X;  4HAM A;  2C0W A;  1NJI Q;  3LQQ A;  4P1W A;  3J81 Z;  3I55 P;  1BJZ A;  3I4P A;  3L7W A;  1FIA A;  1HJB A;  5EG0 A;  1HXD A;  1VQK P;  2HDW A;  1FBQ A;  2K9M A;  3REO A;  2Y9Z A;  2FBK A;  2H27 A;  5KKZ B;  1OWA A;  3CMM A;  4XA4 A;  4XN0 A;  1Z82 A;  2E7X A;  2XSD C;  2KRH A;  5A9T A;  3A0H H;  2LDU A;  3R60 A;  1TW3 A;  4AYB N;  4B3A A;  2E74 B;  2HG5 D;  2M45 A;  1IRX A;  3WU2 E;  1JTH B;  4Y99 B;  4PD4 D;  5CCH C;  2LMD A;  1R1U A;  3EYI A;  3S2D J;  4KUH A;  2LC2 A;  2W00 A;  4HV5 A;  4MO7 A;  5JHU A;  3WTY C;  1JM0 A;  3H1L G;  5KJ7 C;  1OYY A;  3F8C A;  4KN7 X;  2BZT A;  2CV1 A;  3I4M J;  1N78 A;  2IVM A;  4BWN A;  5KLV J;  3D5R C;  5J6X A;  4B3I A;  2NXN B;  4BE0 A;  3L73 J;  5LGU A;  4HNT A;  1R1V A;  3VYS B;  1M67 A;  3R2P A;  3BTC A;  5E20 A;  2RKH A;  2IBZ I;  1KTM A;  2P4Q A;  1WJD A;  1NU1 D;  4B1R A;  3HD7 C;  2R7D A;  2ZC2 A;  1JE8 A;  1EDK A;  1JJ6 C;  3FXU A;  1S7A A;  3MOG A;  3PJG A;  1KB9 E;  4JPZ B;  3CMA I;  2A45 G;  1H88 A;  5KAI H;  4PCQ A;  2H88 C;  3MD0 A;  1NAF A;  1YHQ P;  2BHY A;  1UHM A;  2O03 A;  2X1E A;  1S3J A;  3BR6 A;  2EFO A;  4CCN A;  5D5W B;  1ZR4 A;  2MG4 A;  2L5Q A;  2CFO A;  5F27 A;  3PNV A;  2Y30 A;  2OBP A;  1RQV A;  2QJP C;  2M5W A;  3O8H A;  3IRR A;  1KYW A;  4IVN A;  1JY3 P;  1M75 A;  3L71 D;  2OF7 A;  3HTU A;  3NAR A;  1QHH D;  5FKM A;  1JY3 O;  2KHM A;  4J00 A;  3E6C C;  1L3L A;  3AE3 C;  4Y28 J;  1SQV E;  5CHX A;  4AQR D;  2DT7 B;  3CXH D;  2EIN H;  3S1K A;  5GAG J;  2VXZ A;  1IC8 A;  1WJC A;  1QVU A;  1R23 A;  5JE8 A;  4UB8 H;  4N3Y B;  1SS1 A;  3SFI A;  2OYO A;  2HOS A;  2HYJ A;  2J5O A;  2D45 A;  3AE9 C;  2EIK H;  1YLF A;  4IHT A;  2PMU A;  5CVJ A;  1UG2 A;  1D8J A;  2M0M A;  4ENN A;  2KZJ A;  1ULY A;  3RCO A;  2QSG X;  3RJP A;  2B63 J;  1M1E B;  4LOC A;  1WJA A;  2WV1 A;  2Y0E A;  1Z6T A;  2NVU B;  4K35 A;  4I98 B;  3I56 I;  4OOI A;  3JCU H;  1RNL A;  3UR3 C;  4YEJ A;  5IPA A;  3FMQ A;  1D0X A;  3A01 A;  2EV0 A;  1S5L H;  4G6Q A;  1VZ0 A;  3BTI A;  1L0N D;  1T3U A;  1X1D A;  2YKP A;  3V8K A;  3AE6 C;  1YIO A;  3S93 A;  3KZI C;  3ZMU A;  3CLQ A;  1LTJ B;  2ZAE B;  4NQW A;  3MKL A;  4PD4 H;  2VLA A;  2X58 A;  3L2W A;  4FHT A;  3E1I A;  1ZKG A;  1BSH A;  2A68 F;  1TXG A;  1FP2 A;  3FM3 A;  1X1P A;  1PZQ A;  3LSP A;  3H1I G;  3V2R A;  1NH3 A;  1NTM K;  4GT1 A;  2KS1 A;  5ILU A;  2XAU A;  1X1C A;  1ZRC A;  2P6S A;  1SEU A;  3HC7 A;  1WDM A;  3M9B A;  1BCC E;  4M6Y A;  4S0H B;  4RKU J;  1RI7 A;  5BU5 A;  1V3F A;  4RS8 A;  1VQ4 P;  3A2K A;  2H09 A;  2TDX A;  4A3B J;  4N78 E;  1UII A;  5DS9 A;  1DPR A;  2E76 C;  1BE3 J;  2BE5 F;  3GME A;  1OW8 A;  4JYB A;  1IW7 F;  4Q5S F;  1PGJ A;  4L0Z B;  1Y39 A;  4PZD A;  1T8Z A;  3AEA C;  3H6P A;  2UYY A;  4C46 A;  2FFD B;  1IJD B;  2RNG A;  1N8R Q;  2LNB A;  2A6E F;  4HQE A;  3PJS K;  2YS9 A;  2DI3 A;  3M4O J;  1Y8A A;  5IOY A;  1MSF C;  2GLO A;  4R1H A;  3FM5 A;  1T0F C;  2JKV A;  2FYU J;  2WV0 A;  2IGM A;  2L02 A;  4KIT B;  1NO4 A;  5FD6 A;  4NDL A;  4BH9 A;  3LQR A;  1MMA A;  4LLL A;  2Q8K A;  2QBY A;  4BNC A;  1VQ6 P;  4YXW H;  4I99 C;  3L2Q A;  2WB1 N;  1FWZ A;  3CXH H;  3H1J E;  5KLI B;  3JAM K;  1F17 A;  1CQT A;  1IN7 A;  3T97 B;  3HPH A;  3K4M A;  5FLX K;  3LIE A;  1JUS A;  2KK7 A;  1S2E A;  2YR2 A;  2AEJ A;  3CCU I;  2AEM A;  5L3G A;  3R4K A;  3CD6 P;  1VQ9 I;  2JEE A;  2KOG A;  1KU9 A;  1XS9 A;  1W36 C;  3TO7 A;  2K88 A;  2DW4 A;  4HH2 A;  3BCC D;  1ZGJ A;  1VQN I;  1H9T A;  2ZT9 B;  3WTU C;  3W6U A;  1AQT A;  4PJ0 H;  3TBI A;  2IA1 A;  1EF4 A;  2FYN C;  2WSF H;  2QQ9 A;  3C18 A;  3W6K B;  3JRH A;  1FTZ A;  2E5Y A;  1SQP K;  5IYC J;  1QL1 A;  2LYC A;  1NTK K;  2Q7C A;  2WTB A;  1WRJ A;  2W48 A;  2P5L C;  2FML A;  3KIO A;  2E74 D;  4IRI A;  1VQL P;  3HG9 A;  4IL6 C;  5JVT A;  1WZ2 A;  1D1C A;  1HW1 A;  1Q1H A;  4KN4 X;  4CIC A;  4CUG A;  1P84 E;  3L70 E;  5E3M A;  2JN6 A;  5D8L B;  3OL3 A;  1OVR A;  1SQB E;  1BC7 C;  1YW8 A;  3F9K A;  3HDD A;  4BS9 A;  3ECH A;  2QJP B;  5EGO A;  1ZG5 A;  4DOZ A;  1NH4 A;  3I59 B;  4WWC A;  1A5J A;  5HDK A;  1T3J A;  2KIK A;  1G3S A;  1LNQ A;  3GMA A;  4OU0 A;  3L70 D;  5HS7 A;  1IJW C;  2VQL A;  2CPB A;  3C7D B;  5M5X J;  2QJK C;  1XN7 A;  1PP8 F;  3HHG A;  5GP9 A;  3VOE A;  4A5M A;  3FHZ A;  4DYD A;  1DIP A;  1LWU C;  5AW5 B;  2FOW A;  3RZO J;  4C7R A;  5KLV K;  2OZU A;  1B1B A;  3H3U A;  2L9S A;  3KEQ A;  3W6J B;  5HOD A;  1YJ9 I;  3RL0 B;  4WXH A;  4B86 A;  2ZJ2 A;  2DJN A;  4M3D A;  2BY1 A;  4MGR A;  4BE1 A;  2ZO4 A;  1DU0 A;  2R7V A;  2ZVO B;  3F3S A;  1SQV J;  3MGN A;  2Z16 A;  1DGW Y;  2JSP A;  3HUG A;  1APL C;  1Z6R A;  3BTJ A;  4IFF A;  5AW8 B;  3HDH A;  5DDG A;  3EUH C;  5E18 F;  1SQQ D;  3BCB A;  2DAO A;  4GRI A;  1PGN A;  4W7Y A;  3V2Q A;  3HEF A;  2FYZ A;  1FZE A;  5AVU B;  3QYB A;  1X0X A;  3KLN A;  5KNL A;  2PQ8 A;  3H1C A;  2JA8 J;  3M8F A;  1KU7 A;  2UWM A;  1SD4 A;  1X4O A;  2QF7 A;  1KU2 A;  3GLX A;  4L5I A;  4E7Z A;  5APS A;  1S8N A;  4M9X A;  3HSR A;  5KAF C;  4U7B A;  1OCC H;  2WQY C;  1GV2 A;  1H9G A;  1POG A;  4ZDP A;  2VPL A;  3GHG B;  3GTJ J;  1RF1 A;  1OMI A;  3HKZ A;  3K7A J;  3DU6 A;  3RDI A;  3CME I;  2HGC A;  1UMQ A;  2D2C C;  3NQO A;  5APX A;  1W2B O;  4UUS B;  1J9I A;  3EUA A;  1LGH B;  5EEA A;  1EV7 A;  2OFP A;  1J2X A;  4XKW A;  4YEL A;  2OTJ P;  4XLC A;  1LFB A;  4Y3O A;  4B48 A;  1TZL A;  4WXC A;  2Q2E B;  5LEK A;  1DPU A;  2WTY A;  1NG6 A;  3EPZ A;  3QP6 A;  5J8F A;  2M3E A;  5B5E C;  1IRF A;  3MWM A;  2H94 A;  3I5U A;  1JEK A;  3S3M A;  5TGT A;  4AUX A;  2ZBK A;  3M07 A;  5EDN A;  1SFC A;  2R32 A;  2E76 B;  3A0B H;  1WI3 A;  2ZME B;  5KVR A;  3HRM A;  4WK8 F;  3L75 D;  4EJU A;  2E75 C;  4OIR F;  4HEA 2;  5H2F C;  2W6J H;  1KQL A;  3G2B A;  1L0L G;  4UV8 A;  5BNG A;  1SMT A;  3KHU A;  2QZ8 A;  3LA2 A;  5GAE J;  5CCG A;  2XC7 A;  2CWE A;  4KNY A;  2RC4 A;  1DX7 A;  4RAG A;  4CCL A;  1J1E C;  2AO9 A;  3H35 A;  3Q5F A;  3HSE A;  4KYW A;  2QEX I;  1EZV E;  3D70 A;  2YMK A;  1FJP A;  4AYC A;  1P92 A;  4KA4 A;  1YIJ I;  2SPZ A;  2HZT A;  2LBF B;  5B3S H;  1JTH A;  1NTZ D;  2PFB A;  3E1R A;  1N1G A;  1KC8 Q;  1AOY A;  1XDU A;  1XSV A;  3A0H C;  3IKT A;  3ERE D;  2LKS A;  1LJ9 A;  2FOK A;  3U21 A;  2VAS A;  4DQ2 A;  1T6A A;  3O6Q B;  2ZJP F;  4ZJZ A;  1FOS E;  3KLO A;  4GDF A;  2Q3I A;  1SVO A;  4P9U A;  2D3T A;  2V4H A;  3ZMV A;  4PGG A;  4E12 A;  4LLN A;  3CUQ B;  2ECB A;  1YON A;  1IK7 A;  1OZH A;  1H88 C;  1USE A;  3H1J J;  3ZDM A;  2QA4 P;  3E3V A;  5F04 A;  3PSF A;  2XV4 S;  1ZQ3 P;  1U9O A;  1OX3 A;  3CCM P;  3CC7 P;  3GTO J;  1GMJ A;  5AW0 B;  2FYN B;  4M72 A;  3G1L A;  2DQR A;  5TIS E;  3EGO A;  2MD5 A;  1YS7 A;  2X85 A;  3WU1 B;  3CC2 I;  1TQP A;  5AVY B;  4EDF A;  1RR8 C;  2X6X A;  1J5Y A;  2XV5 A;  1BI0 A;  2W84 A;  2GWR A;  4XOT A;  3O8G A;  5E1W A;  3TQN A;  5ICE A;  1SQX G;  2FYU K;  2Q3E A;  3H32 B;  2PJP A;  1LFU P;  3K4B A;  2DMU A;  3DTK A;  1SMY F;  1BI2 A;  4PSW A;  5KAI C;  1CSB A;  5E79 E;  1SFK A;  2QQ8 A;  4OMZ A;  2CFX A;  3VMX A;  1RR7 A;  4M3E A;  1ODD A;  1N7L A;  4V2G A;  3ABU A;  3BP8 A;  1TP4 A;  2UXX A;  1PP7 U;  2C9N Y;  4Y52 J;  2ZT9 D;  2QYT A;  4I2O A;  3IL2 A;  5AVW B;  4CYD A;  5IT9 K;  1VQ7 I;  4GXO A;  3BRV B;  5GPA A;  3L70 J;  2A06 D;  4R8H A;  4E70 A;  4UVA A;  1Y0N A;  2OU2 A;  3LSG A;  3MZ8 A;  1VQ8 I;  1S7O A;  3Q0U A;  1SQB J;  1IO2 A;  3CMA P;  3K4J A;  4UB8 C;  4KIC A;  2RMZ A;  1YTY A;  2O01 N;  4P96 A;  3P8M C;  3D5L A;  3IAS 2;  3GFJ A;  3ZWA A;  4FAS D;  5HOO A;  4DLL A;  1KFN A;  3FK7 A;  2DOD A;  1Z3X A;  2G3A A;  2W6A A;  2YKO A;  1R4M B;  1IZN B;  3GX4 X;  3B73 A;  1O3S A;  2TRT A;  4PDK A;  4RM2 A;  1QVT A;  2P6T A;  2PMZ A;  3JRD A;  1KIL E;  2OCC H;  4AVP A;  1FC2 C;  3OAK A;  5DTD A;  1PUE E;  1H0T B;  3CC4 I;  1KN7 A;  3C7C B;  2BV6 A;  3JCU C;  5F1J A;  1XD7 A;  5K5R A;  1LTJ A;  4S04 A;  2MAB A;  5C4J J;  3BZK A;  1ZAR A;  2B87 B;  3QU6 A;  1S5L C;  5CCG D;  3BDD A;  1MMN A;  1IV8 A;  4HBL A;  5C44 J;  4D6T D;  4F7Z A;  3UNG C;  2R7Q A;  3P9C A;  1YOV B;  3RL0 D;  4L76 A;  2DOE A;  4D5C A;  3OOU A;  1XX5 A;  3IH3 A;  1U2W A;  3T8T A;  2QG4 A;  1A02 J;  1U8R A;  4QMA A;  2BVM A;  1BGY G;  2FE3 A;  2JR8 A;  1F12 A;  3I56 P;  5GAH J;  1WDK A;  4BDZ A;  2KB7 P;  4IHS A;  4H44 B;  1LEB A;  1KON A;  1XPX A;  2M34 A;  4I7H A;  2V9V A;  4B8X A;  1SQV K;  2N9B A;  2RDP A;  1FE6 A;  3K5B A;  2XGE A;  3W2W A;  4WWI A;  3HOY J;  2FFD A;  2O01 J;  1J7K A;  1QA6 A;  1BR4 A;  1QVF O;  4Z1M H;  2J59 M;  2O9L A;  3LSJ A;  4WX9 A;  1MUU A;  5TIS H;  1WJ5 A;  4D5F A;  3RK3 B;  3DEE A;  4XKB A;  1B9N A;  1N25 A;  3R61 A;  1OPC A;  4OMY A;  4MNU A;  3H1K G;  1ZLJ A;  3JR9 A;  1ON2 A;  2XNX A;  4I7Z B;  4HOB A;  2LRD A;  1NYH A;  1D5Y A;  1BE3 G;  2HYG D;  3TOB A;  4CZC A;  1M56 D;  1J1E B;  2QIW A;  5BS6 A;  5C3E J;  4BJ5 C;  3Q2Y A;  1Q86 Q;  4RAZ A;  3O6B B;  1X22 A;  2BXZ A;  3T97 A;  4B3X A;  2KIS A;  4G94 A;  3TDU C;  2LG4 A;  1FU1 A;  4KT5 C;  4QLC U;  2AXT H;  1A02 F;  3JSO A;  4OL9 A;  1KYO D;  2JJ7 A;  1L2P A;  2H6B A;  2WC2 A;  1MH3 A;  2V79 A;  3V4Q A;  3Q5S A;  1K78 B;  4A3E J;  5D4R A;  3WTX C;  4OAY A;  3T0Y A;  2DW3 A;  3S17 J;  3HRN A;  1URQ B;  1XG1 A;  3LL7 A;  1HDD C;  2XSJ C;  1VQP I;  2DPU A;  3L35 A;  5J8C A;  3VP9 A;  1QGK B;  2N9Y B;  1ZXG A;  2XGX A;  4L9J A;  3DFU A;  5FWN A;  5J40 A;  1K6Y A;  1PP9 E;  3CX5 E;  2H1L A;  4PJ0 C;  1ETY A;  3BR2 A;  2E2H J;  5CPR B;  1RC9 A;  4HZF A;  1N86 A;  1NTM D;  3V2P A;  4M6X A;  4GWG A;  5BPD A;  3L72 E;  1PP9 D;  2KLO A;  3CDH A;  4GCV A;  2HTS A;  2M0C A;  4FCY A;  2DFH A;  2IA2 A;  1DQU A;  1FOY A;  2LKX A;  3HTS B;  1K4T A;  5D6F A;  1JY3 N;  3RBZ A;  2ZFW A;  4DYR A;  3MEX A;  1MBE A;  1QRY A;  3ZQG A;  4MQV A;  2ITA A;  2XGD A;  3I59 A;  2L9N A;  1EDI A;  1WVR A;  4C3H J;  1ZEL A;  1KA8 A;  3GZ6 A;  1NU1 G;  2E19 A;  1RE3 A;  3G17 A;  2F5D A;  1XMX A;  3SWK A;  2VN2 A;  3AL0 C;  1XGN A;  2JZY A;  3BG6 A;  3PFI A;  3GTQ J;  2DK8 A;  2OGU A;  4FET A;  3CJR B;  3NEU A;  2GIV A;  4V2F A;  4U0V A;  2GM4 A;  4A3L J;  1ZRT E;  2NZ2 A;  1O57 A;  2L4A A;  1Y1W J;  2IGN A;  3ITK A;  1I1G A;  5AON A;  3HN2 A;  2L0K A;  3GVA A;  4NHJ A;  3FWE A;  3JTG A;  1WPK A;  1BI1 A;  3L71 G;  4L18 B;  5LGN A;  3L9F A;  1YBK A;  2RNJ A;  3KYD B;  3WGH A;  2QM7 A;  1NGM B;  1FOS F;  3CCR I;  2BY3 A;  4M73 A;  4DJG A;  2LR2 A;  5IYD J;  4J19 A;  2GBY A;  1EQ7 A;  1RF1 C;  4Y4R A;  2VL8 A;  1P9Q C;  1W7P B;  4ZC3 A;  2WTE A;  3CJN A;  3CMY A;  5L3B A;  2HVR A;  2OZ6 A;  3ZPL A;  1G3T A;  1CW5 A;  3GF3 A;  4OH8 B;  5D4S A;  3H5N A;  1FJK A;  2FA5 A;  3GHG A;  4RB1 A;  2O3J A;  1LPQ A;  2QYO A;  1KYO H;  5H20 A;  2HQ5 A;  1Z77 A;  2B89 A;  2R7F A;  4UUS A;  5FLV A;  5K1Y A;  5FRM A;  3VYT B;  5DUK A;  2KZV A;  3D1N I;  1MKM A;  2R7W A;  3K4C A;  4YIR X;  2YXQ B;  1SQP D;  1KQ0 A;  1NTK D;  2HVS A;  4CCJ A;  2Q2E A;  5DCM B;  5D8K B;  2NS0 A;  4M3G A;  1SQB K;  1U3E M;  5H6R A;  2AQF A;  4BQN A;  1L0N G;  3TYY A;  4EEF G;  4DCK A;  1SLQ A;  2E36 A;  1VF9 A;  3C1D A;  3ERM A;  4RB3 C;  5LRR A;  1IN8 A;  3C2G A;  2Q1K A;  3EQ2 A;  1J75 A;  2ZME A;  5DM6 F;  1G6N A;  1J09 A;  3PO3 J;  3M9H A;  5KKZ C;  1ORK A;  2M1B A;  2IX7 C;  2HR3 A;  1ZLK A;  2XF6 A;  3A0B C;  3OIP A;  2B0L A;  4PZC A;  1R5G A;  3F6V A;  2E74 C;  3FKJ A;  2V7F A;  1O3T A;  4Y99 C;  3D6Z A;  3CME P;  2Z5H A;  1I5Z A;  1DP3 A;  2B88 A;  5KLV D;  1K4S A;  4AIJ A;  1G3Y A;  2CQN A;  1ZG1 A;  2OJE D;  3R4Y A;  4XBF A;  1YO5 C;  2LBF A;  5FJ8 J;  2EA2 A;  2XAQ A;  2A6H F;  2F5C A;  4M71 A;  5KCM A;  1X3U A;  1AV1 A;  1X3W B;  1KIL B;  3O6Q A;  4RMN A;  2L7K A;  1WKM A;  3U9G A;  3HTK B;  3SJM A;  5AIP A;  3MTU E;  2CQQ A;  1V5G A;  3GFM A;  3ZQF A;  3HOT A;  3CCV I;  1LQ1 A;  3S15 J;  3CWB E;  3O8Z A;  5JI6 A;  2CV2 A;  2KL4 A;  3CUQ A;  1SFE A;  1MZ9 A;  1I3A A;  2HKX A;  1ETX A;  3HYI A;  3KCC A;  3RK3 D;  3H3V K;  4A3I J;  1E79 H;  1YQ3 C;  2Y0M A;  1LT9 B;  3K9T A;  4IM7 A;  5JLW A;  3OW2 O;  4ZMD A;  1RKT A;  2WMM A;  2QEX P;  5HDN A;  1D1A A;  1EH6 A;  3RK2 D;  1YIJ P;  1D5V A;  3L2V A;  5IP6 A;  1T98 A;  5DM7 F;  3FBN B;  3AG2 H;  3SEZ A;  3H32 A;  2V7Q J;  2M4K A;  2XAG A;  1Q81 Q;  3C8V A;  4H0E A;  1FEX A;  3BRO A;  1PPJ D;  3KP5 A;  2V1D A;  1PP9 J;  1S9K E;  2XHK A;  3BC8 A;  4HYE A;  1LVK A;  3BCC G;  3RIR A;  3RPQ A;  3HOS A;  2DMP A;  1USS A;  3ZR8 X;  1URQ D;  4KHX A;  5FFZ A;  3TED A;  1R5I D;  2BW3 B;  1HST A;  1S9H A;  4AM3 A;  1YJN I;  2ZFC A;  3L72 J;  2KIF A;  1HDP A;  1K7A A;  4U3F E;  3OYA A;  2EQR A;  1KQF B;  4EAT A;  3IWF A;  4UNO A;  2M0B A;  3TW7 A;  1HBX G;  2DPD A;  2I9P A;  3FXK A;  4IHW A;  4RLQ A;  2E60 A;  4M3F A;  3WE3 A;  3JAM Z;  1U7M A;  3HPG A;  2AXC A;  4LG0 B;  3ZMZ A;  3JRB A;  1LTJ C;  2O0Y A;  1LSO A;  1I27 A;  5FLX Z;  4XOR A;  2KMU A;  3RKW A;  2D1V A;  4BHB A;  3ABV C;  1GXQ A;  3VB2 A;  2YNY A;  3F8M A;  5AW6 B;  1QHG A;  3CUO A;  3I64 A;  1NHL A;  1H0T A;  1N7S D;  3TO6 A;  1VI0 A;  5AVS B;  2IBZ E;  5M1B A;  2KDO A;  2Z9O A;  3L74 E;  2XKP A;  3K2Z A;  4Y13 A;  2ZNZ A;  1L4A D;  3MKW B;  2B87 A;  4C7N B;  2VOP A;  1ERD A;  2OYI B;  3CJT B;  3K4L A;  1BW6 A;  1VQ8 P;  5GTI H;  2O8K A;  1PIX A;  3V2N A;  2L2O A;  4RO0 A;  1A04 A;  3MKY B;  1F4K A;  1G1I A;  4ASV A;  5HLH A;  2BEO A;  3GFI A;  3HE4 B;  2DTZ A;  1QQI A;  3I71 A;  1U8B A;  1E3O C;  3G4S P;  5AIQ A;  1M8O B;  1SQQ G;  2FFD C;  1H89 A;  3L36 A;  3IH4 A;  3DWL E;  1IK9 A;  4XKV A;  3BQZ A;  1KU3 A;  3RPU D;  5F08 A;  2D1H A;  1OCP A;  4RBO A;  1J1D C;  1MV8 A;  4BUP A;  2P5V A;  2FYU D;  2E5T A;  3R0A A;  1VQ5 P;  3U1D A;  4BHP A;  3FHN A;  5L3D A;  1HLV A;  5CBN A;  2H1K A;  3CC4 P;  4JQ0 D;  1W7P D;  2UV1 A;  2VQC A;  4AID A;  1EDJ A;  3FXE A;  2QUF A;  4E21 A;  2NVQ J;  1DDN A;  3FMS A;  3CCY A;  3VSK A;  1IAW A;  5KLI C;  3L09 A;  5TJJ A;  2X1D A;  4E6K G;  5JR3 A;  1YS6 A;  2MGQ A;  2VQH A;  3MVP A;  1IV6 A;  2CUE A;  3B8E B;  2BY2 A;  1N1E A;  1X2M A;  3ASN H;  5TIS C;  1W5S A;  3RKQ A;  5GTH E;  3K4N A;  4KIG A;  2EFP A;  2OPT A;  2M5A B;  2VXD A;  5K7F A;  2Y0D A;  2OYH B;  5ILS A;  5FRN A;  5H6Q A;  1K9M Q;  5CVV A;  3FF5 A;  4AYB A;  2JRT A;  4B4C A;  3DKW A;  4MN4 C;  2DA6 A;  2XB5 A;  4HV6 A;  4CCK A;  3L75 G;  1K73 Q;  2ZT9 C;  1V4R A;  4NPD A;  3K6J A;  3L6D A;  3ZWC A;  4X0G A;  3M91 A;  2BCC E;  2LY1 A;  3PM1 A;  3ZQQ A;  2EFQ A;  4LD5 A;  3VN0 A;  1K78 A;  2OTL P;  4FX0 A;  1OVU A;  1J2J B;  3RL0 g;  1LTA C;  2AXT C;  3DTI A;  3QOE A;  1VDF A;  1URQ A;  2BCC D;  1S72 P;  5M5Y J;  4KMU X;  2K9Y A;  2F2E A;  3G73 A;  2DT5 A;  1YX3 A;  2EK5 A;  4EM0 B;  3AAF A;  2ELJ A;  1KB9 D;  1NTZ G;  3VMZ A;  3Q0V A;  3CWB J;  2V9K A;  4OVN F;  3FWN A;  3GW6 A;  3MQ0 A;  2Y0C A;  2TCT A;  1RE3 C;  4A69 C;  2FJ1 A;  2K86 A; 
#chains in the Genus database with same CATH homology
 5C4X J;  3H2Z A;  4OM8 A;  5EZH A;  3ULK A;  1S7E A;  1PGN A;  4A3G J;  3HEF A;  5IYB J;  1X0X A;  4JX5 A;  2R5Z A;  1TC3 C;  1BW5 A;  4DZJ A;  2JA8 J;  1RES A;  1JJ8 C;  4A3K J;  2QF7 A;  3CKY A;  3TP0 A;  5FLM J;  4FE4 A;  3JRC A;  5EG0 B;  1GV2 A;  1POG A;  3GTJ J;  3FKI J;  3DCF A;  3K7A J;  4XK4 A;  5F0F A;  4XRS A;  1IRZ A;  1UMQ A;  3ZWB A;  3S1R J;  3RZD J;  4UUS B;  2IYP A;  1I36 A;  5EEA A;  3JRA A;  2OFP A;  4G12 A;  2PLA A;  1ZK8 A;  4W97 A;  1LFB A;  1WGX A;  2K9S A;  3WHB A;  4KUG A;  1R9T J;  5E3O A;  2E1O A;  1VFC A;  3BR5 A;  2RAE A;  4AUX A;  3QSG A;  1U9N A;  5EDN A;  1ZGW A;  1WI3 A;  2D5V A;  1U78 A;  2YU9 J;  4UUT A;  3L1P A;  1OCT C;  5E3N A;  2R7Z J;  3LOC A;  3S2H J;  1JTX A;  1YB4 A;  3GTG J;  2XPW A;  3BR0 A;  3RQS A;  5BNG A;  1ENH A;  2VI6 A;  1T33 A;  1X58 A;  1K83 J;  3B6A A;  3BQY A;  2AHQ A;  2IBD A;  3WHC A;  4GBJ A;  2AO9 A;  1JGG A;  2JA5 J;  1IDZ A;  5EYR A;  2LFB A;  1PGP A;  1Q1V A;  1N1G A;  4FGW A;  1VND A;  4M3B A;  3NAU A;  1ETW A;  4B3H A;  2W8Z A;  4BBR J;  1IGN A;  5K7Z A;  2D3T A;  3Q3C A;  2Y9Y A;  4E12 A;  1YON A;  2ECB A;  2EZL A;  2DA3 A;  4CYC B;  1H88 C;  1LE8 A;  1TWA J;  5F04 A;  4GFB A;  3QHA A;  4MLO A;  1I3Q J;  1ZQ3 P;  1U9O A;  1MBG A;  2VPR A;  3JRE A;  1HCR A;  3GTO J;  2CVZ A;  4B3J A;  1NK2 P;  2YUS A;  2IZ0 A;  4IHX A;  3IQD B;  1B8I B;  3G1L A;  4QIW N;  1ZCJ A;  5HWS A;  4DYQ A;  1JTY A;  1NTC A;  3OSF A;  2NS8 A;  9ANT A;  5E3L A;  2MW8 A;  3I4N J;  3EGO A;  5AYV A;  2JK3 A;  2ZYG A;  3PDU A;  2WAQ N;  3O8G A;  1EVY A;  3B6C A;  1QPI A;  1LFU P;  1JDJ A;  1P7J A;  1NK3 P;  2DMU A;  1P7I A;  2L7M P;  3C7A A;  4C3I J;  2X6O A;  2L7F P;  3A01 B;  1RR7 A;  1VPD A;  1F43 A;  4M3E A;  1M66 A;  2M2E A;  4V2G A;  4J0F A;  1A6I A;  1O4X A;  2NOG A;  2IEK A;  4Y52 J;  3S16 J;  5M3M J;  2QYT A;  2LTP A;  4Y7N J;  4D3D A;  2NVY J;  5GPA A;  4A3J J;  3LSG A;  3IV5 A;  3G0O A;  1GUU A;  3Q0U A;  3I83 A;  4I6Z A;  1F14 A;  1I50 J;  4XRM A;  5J3L A;  1LJ8 A;  2NS7 A;  3ZWA A;  3PLR A;  4KUE A;  4DLL A;  3FK7 A;  2ME0 A;  3QPL A;  1JUP A;  2ZYD A;  1X0V A;  2LP0 A;  2W90 A;  3ADO A;  1IUF A;  1SAN A;  2TRT A;  1MBF A;  1QVT A;  2L7Z A;  3JRD A;  4GWK A;  2DMQ A;  1PUF A;  5DTD A;  2Y2Z A;  3C7C B;  5F1J A;  3GTP J;  3F0C A;  2G0E A;  2L9R A;  3HM5 A;  1G2H A;  1B72 B;  5C4J J;  3PEF A;  3HAD A;  3JRF A;  5IOZ A;  3FR7 A;  1M67 A;  5C44 J;  1AU7 A;  2NVT J;  1HOM A;  4XID A;  3FIS A;  5A9R A;  4D5C A;  3OOU A;  2R5Y A;  1F36 A;  3IH3 A;  1LSJ A;  1DLI A;  4X6A J;  3RQI A;  3JRI A;  1ETK A;  1FJL A;  4BBS J;  4C2M J;  1IG7 A;  3HGY A;  1ITY A;  3LSR A;  2R0Q C;  1F12 A;  1WDK A;  2DA5 A;  1K61 A;  3OSG A;  4EZB A;  2M34 A;  2Y0S N;  3ZQL A;  2XGE A;  1JKP C;  3HOY J;  1X2N A;  4BY1 J;  2FD5 A;  1ETO A;  3ZOB A;  3MN2 A;  2O9L A;  3LSJ A;  1KS9 A;  4D5F A;  5JLX A;  1H89 C;  5J1Y A;  3JR9 A;  3HOX J;  1D5Y A;  3ZHB A;  2ECC A;  2Y31 A;  5C3E J;  2IYO A;  1MBJ A;  1B8I A;  5FKO A;  3GHY A;  4MFE A;  4M6V A;  1YJQ A;  2KDZ A;  5F0C A;  5EGO B;  2CRG A;  3HOV J;  3BTL A;  4OL9 A;  2JJ7 A;  1JT0 A;  3BG3 A;  1MH3 A;  5J1U A;  3JRG A;  2NVX J;  4D7N A;  4A3E J;  4PZE A;  3ZQH A;  3S1N J;  3S17 J;  1WP4 A;  1XG1 A;  1HDD C;  1GT0 C;  3E7L A;  1ETQ A;  5FWN A;  3DFU A;  5A9S B;  1ETY A;  3BR2 A;  3G1M A;  2E2H J;  1HF0 A;  2P81 A;  1FTT A;  1YRN B;  4GWG A;  2HOT A;  4BKX A;  1ETV A;  2DA4 A;  3K2A A;  4A3C J;  4FTH A;  2M0C A;  4FCY A;  2LKX A;  4D7M A;  2MSY A;  1AKH B;  1OFC X;  3BG5 A;  4DYR A;  1MBE A;  1QRY A;  5FKK A;  3ZQG A;  2LK2 A;  4QTR A;  2XGD A;  4ABZ A;  4C3H J;  2DA7 A;  4JYK A;  2E19 A;  3G17 A;  3M3Y J;  2XB0 X;  2FX0 A;  2ME6 A;  2R92 J;  3GTQ J;  2LVS A;  2XPU A;  1T56 A;  1MBH A;  4MIM A;  2LLK A;  4V2F A;  2GM4 A;  4A3L J;  4YCA A;  1JKQ C;  1Y1W J;  5M3F J;  4MFD A;  3QPS A;  1WH5 A;  3HN2 A;  2L0K A;  3CDL A;  1M2W A;  2DMT A;  1I6H J;  4W1U A;  1MH4 A;  1WPK A;  2XPV A;  4IEJ A;  1DU6 A;  2CJJ A;  3OBB A;  2IAI A;  1GV5 A;  2CUF A;  1TWC J;  5FKL A;  5IYD J;  4J19 A;  2GBY A;  5J1R A;  3H0G J;  3C2B A;  1OJL A;  3GTK J;  3ZQI A;  2O7O A;  3CMY A;  2VUM J;  4OQZ A;  2ZB9 A;  1BJZ A;  1FIA A;  5EG0 A;  5F0H A;  2Y9Z A;  2FQ4 A;  3PO2 J;  4XIC A;  2HQ5 A;  1Z77 A;  3LNQ A;  4UUS A;  1WCM J;  5FLV A;  1WPQ A;  2XSD C;  1EVZ A;  1Z82 A;  3D1N I;  5A9T A;  2X48 A;  4OQY A;  4AYB N;  2M8G X;  4B3A A;  1W0U A;  1DLJ A;  4M3G A;  4HNV A;  1M76 A;  2QCO A;  2LR8 A;  4MO7 A;  4EEF G;  3S1M J;  3S2D J;  3ADP A;  4KUH A;  4DCK A;  1VF9 A;  1SFO J;  5IP7 J;  1TWG J;  3I4M J;  4A3M J;  2N8G A;  2COB A;  4D3S A;  3QQA A;  4B3I A;  4QSH A;  2JA7 J;  3PO3 J;  1ORK A;  3BTC A;  1LE8 B;  2P4Q A;  4PZC A;  4B1R A;  5EZG A;  1QMG A;  2EZK A;  5FKN A;  2EW2 A;  1JJ6 C;  3MOG A;  3PJG A;  1PGQ A;  4JPZ B;  2HXI A;  4C3J J;  1WH7 A;  3BR3 A;  4DZP A;  5MGB A;  3BR6 A;  5FJ8 J;  2LD5 A;  1ZR4 A;  2MG4 A;  5F27 A;  2Y30 A;  3O8H A;  1IL0 A;  1MSE C;  3WFI A;  3GBG A;  1M75 A;  2OF7 A;  3NAR A;  3SJM A;  5FKM A;  3G1O A;  2CQQ A;  3TW6 A;  2HI3 A;  3S15 J;  1JKO C;  3ZQF A;  1JUM A;  1BG6 A;  2VKV A;  2KT0 A;  1AKH A;  4RDU A;  4XRS G;  4CYC A;  1IC8 A;  3S14 J;  3HOU J;  1ETX A;  1QVU A;  1PGO A;  3H3V K;  3GTL J;  4A3I J;  5JE8 A;  5K7H A;  3HKZ N;  4BY7 J;  3SFI A;  2HOS A;  2HYJ A;  4IHV A;  2JMW A;  1W0T A;  1YVE I;  4IM7 A;  3HOZ J;  1XC5 A;  5JLW A;  1RKT A;  2EH3 A;  2HDH A;  1UG2 A;  4S3M A;  1YRL A;  2ELK A;  3WFJ A;  2B63 J;  5IP6 A;  3DEW A;  4LOC A;  1MBK A;  2WV1 A;  2E2J J;  2DN0 A;  1FEX A;  3K96 A;  1UHS A;  2GF2 A;  2R93 J;  4DW6 A;  5IPA A;  4FE7 A;  3A01 A;  3VPR A;  1PUF B;  3BTI A;  3PID A;  3HBL A;  3ZW8 A;  2CQX A;  4JX4 A;  3BG9 A;  2PGD A;  4A3F J;  1ZR2 A;  2DMP A;  2I10 A;  3MKL A;  3OIO A;  2X58 A;  3TED A;  1ZKG A;  4AC0 A;  2HDD A;  1TXG A;  2LY9 A;  1HDP A;  5EF6 A;  3LSP A;  2HOA A;  2XGC A;  2EQR A;  3FIW A;  2R5Y B;  4IHY A;  3SDG A;  3TW7 A;  2I9P A;  1WDM A;  4FIS A;  4IHW A;  2ID6 A;  4M3F A;  4S0H B;  3W6V A;  4BXX J;  3S1Q J;  2ID3 A;  3JRB A;  3Q0W A;  1LSO A;  2R5Z B;  2X9D A;  4A3B J;  5DS9 A;  3IH2 A;  3ZQC A;  1PGJ A;  5IP9 J;  4PZD A;  1JT6 A;  2UYY A;  1VI0 A;  2DA2 A;  3FR8 A;  2DA1 A;  2HXO A;  3Q3S A;  1B72 A;  2YS9 A;  1Z0X A;  3M4O J;  3BT9 A;  3A03 A;  4X1E A;  5IOY A;  1BL0 A;  1MSF C;  2GLO A;  1F0Y A;  3W6Z A;  2K9Q A;  2JKV A;  4D3F A;  1BW6 A;  4JX6 A;  2ZYA A;  3DOJ A;  4NDL A;  2O8K A;  1WDL A;  2H8R A;  1GVD A;  4JP0 A;  2WB1 N;  2DTZ A;  1U8B A;  1E3O C;  1F17 A;  1CQT A;  2DMN A;  5GPC A;  3TP3 A;  3IH4 A;  1JUS A;  3BQZ A;  1FIP A;  5F08 A;  4RBO A;  1OCP A;  4A3D J;  3ZGY A;  2CU7 A;  1HLV A;  2H1K A;  3WS7 A;  4JQ0 D;  4I76 A;  2VKE A;  1RKW A;  4L5E A;  1XS9 A;  2NVQ J;  4E21 A;  2JA6 J;  3CCY A;  1YJ8 A;  3W6U A;  1Y1V J;  3HB9 A;  1EF4 A;  2MGQ A;  3MVP A;  1IV6 A;  2CUE A;  1JKR C;  1AHD P;  3CTV A;  3JRH A;  1N1E A;  1X2M A;  1FTZ A;  4J0E A;  2XRL A;  2EBI A;  5IYC J;  5M5W J;  1GDT A;  3CQZ J;  2WTB A;  4R1N A;  2W48 A;  3RKQ A;  4DYC A;  2OPT A;  2K40 A;  5K7F A;  2E2I J;  2IZ1 A;  1BA5 A;  3BR1 A;  3ZW9 A;  2EZI A;  2EZH A;  3A02 A;  4B4C A;  3FK6 A;  3HGG A;  2DA6 A;  2PMZ N;  2XB5 A;  5E3M A;  3UKG A;  2JN6 A;  2M9H A;  3HDD A;  3K6J A;  3L6D A;  3ZWC A;  1IDY A;  4A93 J;  5EGO A;  3PM1 A;  1H8A C;  1MNM C;  1A5J A;  2K9N A;  1IJW C;  1TWF J;  3C7D B;  5M5X J;  1RPW A;  5GP9 A;  1RET A;  4DYD A;  3HWR A;  4E13 A;  5M5Y J;  1TWH J;  3RZO J;  2JWT A;  5HOD A;  5A9S A;  2DJN A;  4M3D A;  1DU0 A;  3F3S A;  3Q0V A;  1YRN A;  4OVN F;  3FWN A;  1ZTR A;  3GTM J;  1APL C;  2TCT A;  3BTJ A;  4A69 C;  3HDH A;  2FJ1 A;  3HOW J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...