4JBZA

Structure of mcm10 coiled-coil region
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
401
structure length
401
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMGVCQEKSKDELEDELRKMQAQMKKLQEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mcm10 self-association is mediated by an N-terminal coiled-coil domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication
molecule keywords MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH XENOPUS LAEVI
total genus 131
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4jbzA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA01
1MY3A 1B05A 4KFQA 4GODA 1OLCA 3QIMA 2DWIA 1FQBA 3H6WA 1MPDA 1Y3QA 4KYSA 4JB7A 5F7VA 4F19A 4IGRA 3FVNA 2H99A 4GFRA 1R9QA 4XXUA 4MF3A 1LBCA 4U1ZA 2GFEA 4FECA 3C9HA 4BDOA 2CMOA 4U23A 3RPWA 2F5XA 4R2BA 2IA4A 2O1MA 3EQ1A 4EXLA 3SESA 2ESNA 4WEPA 5TPAA 1B52A 1AMFA 3M3FA 4OEVA 2UVJA 3KN8A 1PDAA 5FHNA 4F1UA 3ECRA 1QKAA 2DE3A 1B5JA 3EHTA 3S9NC 1WDNA 4HJGH 5CRYA 3LSLA 2D5WA 2Y7PA 4LZ7A 1LP1A 4C0RA 1SBPA 3GBAA 4F1YA 2VD2A 3PPRA 3K6WA 5CI5A 4PFWA 1Y4CA 4LQ2A 1XVYA 2QS1A 4OFLA 2DVZA 1S9TA 3U1OA 1ELJA 2A5TB 1ZW0A 2DWJA 3K00A 1PBPA 2XXTA 1B1HA 1UIVA 4KYEA 4LQ5A 2V84A 2O7IA 3A3CA 4NEDA 3KSXA 3OO6A 2KZJA 1ZU0A 2SPZA 5AA1A 5A5XB 2GH9A 2PX1A 2R71A 2UVIA 4G8HA 1URGA 2I3WA 4N13A 2F78A 3N6UA 3C31A 1ZIUA 3PH0A 4Q8RA 3IJOB 1ATGA 4O3BA 5CM6A 1JM0A 5TPAB 1S50A 3EHUA 4F1VA 4OHNA 5AA2A 4OYVA 1DTZA 5FHMA 4PP0A 3K1NA 3KSJA 2NOOA 1DPEA 3RGYA 1Y9UA 4HTGA 4FE8A 3OO7A 4KPTA 4RY1A 4XKQA 1UTBB 1IXIA 4MFIA 2H9BA 4ELPA 2I0CA 3O9PA 3ZKLA 4TLMB 2I0BA 4KI0E 3MVWA 1H76A 2AL4A 3IR1A 1BP5A 3FXEA 1OVTA 1FTOA 4QF9A 1LBBA 4LZ8A 1RYXA 3O29A 4ECFA 4AQ4A 3C36A 3T9HB 4U22A 4JXIA 3HN0A 1TFDA 1VE4A 1X0TA 2AIXA 3M8UA 3FUZA 5J1DA 4GOEA 3HO7A 5B70A 1YCJA 5JEIA 5HPQA 2UVHA 1B32A 1FTKA 2KZIA 4JWOA 4NF8B 2PMSA 4EF1A 1B5IA 3K6XA 4M4GA 1LSTA 1PB8A 2XD2A 4P11A 3CVGA 5TP9A 5JTYA 3O6GA 1A8FA 1BTJA 1MQDA 3UP9A 1HSJA 2I48A 4IO7A 3PPQA 1EU8A 3MZWB 2P58A 4I62A 3W9VA 2F7AA 3U93A 3O66A 3N26A 3K0VA 4OEUA 4JBZA 2VD3A 3CFXA 2ALUA 3V8XB 4K3AA 2QPQA 4XKNA 3FGSA 2G93A 3H6TA 1B46A 1QULA 4OQOA 5KDTA 4U1OA 4UACA 1N7XA 1TFAA 4G77A 5L9SA 4NWCA 3CG1A 1SDXA 2XXIA 1QUKA 3G3HA 4GIZA 4DLDA 2UWJE 1ZTYA 2DS9A 2B87A 1B0HA 3VVEA 3TAJA 1U7JA 3CSGA 3RQTA 4R6YA 3VFJA 4QSDA 1AIVA 1OVBA 4R72A 3B6TA 2Z22A 4G68C 1B9JA 4ZMDA 3IJXB 1I6AA 1PEBA 3IORA 3VVDA 3K6VA 5I59B 4GQOA 3T66A 2E1SA 5CMKA 3H6UA 2V25A 4RJZA 4MLVA 3VXBA 5C39A 1OVVA 4XKRA 2KI7B 4XKPA 3H03A 4F29A 5LOMA 2OCUA 3K4UA 3C4MA 4JDFA 1B7UA 3GXAA 3MP8A 2P0SA 1OQGA 1FQFA 3CFLA 1H3DA 1EC5A 2Y7IA 3TCGA 4TOZA 3TUSA 1EZOA 3MVXA 2XX9A 2ONSA 3PGFA 2HCAA 3TKDA 3LSXA 1Q35A 3SEXA 3ONMA 1ZKBA 2NXOA 4G8NA 5CMMA 4G2ZA 1WVJA 4ZS9A 2ZNTA 1NH7A 4IY6A 2Q88A 3K01A 1MM7A 4P0GA 3MJNA 1LAHE 3Q27A 2PYYA 4I9DA 4ESWA 4EXKA 3PU5A 4GL0A 4GOFA 4ELQA 3FATA 2KLFA 4F3BA 1UTBA 4EYYQ 4YZZA 3U94A 2QS4A 5CBOA 3T9UA 1MY1A 3BBRA 3RTWB 5H8QA 4QRZA 2F36A 1CB6A 1MXYA 4BDQA 4Q5TA 2NWJA 1Q1KA 3Q26A 1MY0A 3PPPA 2PBWA 3G7WA 4R6HA 1B5HA 1NNKA 4MH5A 4JWXA 3KEIA 3TQWA 3UORA 4R75A 3T9VA 2R6GE 3E4RA 2B88A 4EQ9A 3EPEA 4WKMA 3UIFA 1IEJA 2FYIA 3FJMA 1L5TA 1OVRA 2QJEA 2B3BA 1T0KA 1QUJA 3E13X 4IO4A 5DEXB 4NWDA 3OEMA 2HFBA 1Q2NA 4M1VA 4NF8A 1P1UA 3AXFA 4HCYA 3OD7A 4GLIA 1CE2A 4WXJA 4BLAA 4ZEDA 1EZ9A 4LP2B 2Q8JA 1MQIA 2Z23A 4WEDA 3C33A 4LA9A 2QS2A 4R2FA 2V3QA 2WKYA 3TPAA 3I3VA 1NL5A 3BFUA 1POTA 1DSNA 3CR9A 1MQJA 1XHYA 3PD8A 4KQPA 3KG2A 4IO5A 1FCKA 2ZNUA 2OBGA 4FIMA 4R9GA 3MZ9A 3K1PA 2Y84A 1QJMA 4POWA 5CBNA 2I58A 4K3FA 1S3JA 3N94A 1XVXA 4F3SA 3GLBA 1P1QA 1UTHA 1S7YA 5ISUA 1FTLA 3KOTA 4ZZEA 5I2NB 5B7DA 1DTGA 3F11A 4OTEA 1JQFA 4AB5A 2XD3A 1B6HA 2B87B 1FW0A 3IB0A 3QAXA 3ZS6A 5H8HA 4ZNCA 3MZBA 4FAJA 1D9YA 3M3KA 4ZE9A 2XXUA 4YB5A 1P1NA 2HEUA 3D4CA 1BIYA 4GXSB 1FQAA 3S1KA 1GV8A 4O3AA 2DOJA 1Y3PA 4FEDA 4O3CA 1FQEA 1FQCA 1YPNA 3ZKKA 1LT1A 3CIJA 1OVUA 2VP1A 4X9TA 3H7MA 3TFLA 1Y4TA 1QVSA 3CSBA 4E0WA 5I56B 2B65A 1LAXA 1JVYA 3MUQA 1NFTA 3I6VA 4RXLA 1IXHA 1H45A 4OERA 1RYOA 4LONB 3VXCA 4R9FA 4HW8A 3SEVA 1OIBA 4KR5A 1MDP1 1SD3A 4YICA 3KGCA 1FTMA 5I58A 4QFOA 4BDLA 2H98A 4DIGA 5AA2B 5HM4B 2B89A 2Q89A 3S9LC 1B3FA 2XXXA 4G8MA 1R1NA 1NNFA 2NUVA 5ELVA 2F6PA 3IO6A 4HCWA 3HHFA 5BWJA 1B3GA 1AOVA 4F31B 4P0IA 2ZNSA 3H6VA 4OZ9A 3OO8A 3MWBA 5DVIA 1JMBA 1M5CA 1A7LA 1B58A 1LFGA 3A3UA 3O28A 3DLNA 2LXCB 5I2KB 4EQ7A 4G68B 3MQ9A 1US4A 3PV0E 1EDIA 3IX1A 3RT8A 1BDDA 4YU0A 2HAUA 3GZGA 3TYHA 1H0TA 4OETA 3SEWA 4YAHX 3T9XB 3FXRA 2ZYNA 1SYHA 3C34A 3TTRA 2PT1A 4Q30B 3UGWA 1GR2A 1AL3A 4NF6B 3O97A 3PMXA 4ZECA 2RF1A 3EF7A 3DM0A 1MQGA 4KCDA 4YB6A 4ASWA 2KIKA 3LSWA 2XHDA 5KZTA 2DSFA 4GWOA 3R7XA 4DXUA 4FEBA 4QFLA 1B51A 1YTVA 5HBCA 3G3FA 4ZEBA 3FVGA 4GRKA 2LXBA 1UTHB 4QFKA 2OJTA 1TWYA 4OVJA 3TTMA 4BDMA 4FORA 4YMAA 2XXWA 3S2VA 2DWHA 3DP8A 2QMWA 2UVGA 1I69A 1QUIA 2OWTA 3RN8A 2QMXA 1FTJA 4NPEA 3MBPA 1IITA 3O2AA 1SW2A 1DPPA 4XIGQ 4ZE8A 3K6UA 1LGBC 4ASVA 1LCTA 2I6EA 1IQ7A 3FVKA 3TODA 5K5GB 3GBBA 3OO9A 5CBRA 1N0TA 3FXQA 1XS5A 2XXPA 4KCCA 2REJA 2F97A 3B6QA 4H5GA 4OWDA 5I84A 3IOWA 3TQLA 3TTLA 4QSEA 4EDPA 1Z7NE 4DCYA 1DMBA 3PUVE 4H0WA 4YKJA 2ZMBA 2VHAA 3C35A 4X1BA 4MBPA 2Q1KA 3K2DA 5L9MA 1P99A 1POY1 3CFZA 3DP6A 1N84A 1SI0A 1VSOA 4OMBA 2O84X 4G68A 1D4NA 4F39A 4OENA 1F9BA 1N04A 3U8QA 1P1WA 3W15C 1B7HA 3FD3A 2KUBA 3RUMA 3R26A 3IOTA 1LFHA 1SW1A 4RK9A 4KD5A 4FJPA 3IOUA 3IOVA 4BXLA 1URSA 4DXCA 2ZAEB 3O6IA 5CMCA 1SW4A 3IO4A 1B3HA 5DT6A 2ZYOA 2A5TA 2F8DA 2FNCA 5I2KA 3L6GA 2HXWA 5KCJA 4X1DA 1B0LA 3EN3A 2DVCA 5FTIA 3TDJA 2Y7RA 3S4UA 5DYHA 1UIUA 2OWSA 3CG3A 1LB8A 1USYE 2R44A 4E0XA 4F2QA 3B7DA 4QSCA 5H8NA 4XTCQ 3ZSFA 4OFOA 2V93A 1USYH 2AYSA 2VOZA 3PPNA 3FXUA 3FJ7A 3RY3A 5DVFA 4TQUQ 2B3FA 4JWYA 5AA4B 1MH4A 3IL1B 5K2YA 3JV9A 3FXDA 2X7PA 4EQBA 3H3GA 3N5LA 3M3LA 2LAOA 3T96B 2O1LA 3E9XA 4DZ1A 2I4CA 1ZLQA 1JETA 4KHZE 4Z0IA 3FIRA 3LBSA 2W7YA 4WWIA 2E0SA 1MDQA 1PC3A 2M8CA 1B1XA 5H8FA 4CPGA 2ONKE 1M5FA 1NNTA 4OESA 4UA8A 1KWHA 4DE8A 1HSEA 4RPNA 1Y1MA 3FJGA 1GVCA 1SVXB 4HKZH 3IK6B 4IO6A 3MP1A 1JW4A 4F3PA 5EFWB 2P1SA 4RA1A 2RC9A 1ZMGA 1R9LA 2P2AA 4DXBA 3VLVA 1N7WA 2QS3A 2Q2AA 3VLUA 2OLBA 2GRVA 3TMGA 1LFIA 1A99A 4AB6A 2RC7A 3MPKA 1B4ZA 4H1XA 4PFTA 2FA7A 2RCBA 1MY4A 3Q29A 3HHGA 1EDJA 1MXUA 2H5YA 4YKPA 3MZ1A 3QSLA 4LZ5A 5EYFA 5TU0A 3QUFA 4IO2A 3PPOA 2NVUB 4EF2A 1MG1A 3TEPA 4NF4B 3EHSA 2GHAA 4QFPA 3RNNA 4X48A 1MXXA 4ZDMA 3WAFA 4R73A 2Q9TA 3QUJA 2RCAA 3OMBA 2OTKE 1XT8A 4L17A 2GHBA 3RT6B 1MM6A 5I57A 4NMYA 4IY5A 2XXRA 1JW1A 5DJUB 1LCFA 3V83A 3THIA 5CMBA 3MPLA 1D9VA 1II5A 2DYXA 1N3XA 4K35A 3MC2A 1LAFE 2VGQA 2F7BA 5ITOA 5AA2D 1TT1A 1SS1A 4ELRA 4H8IA 1MS7A 1IXCA 1MXWA 3PUWE 1Y1ZA 3K1MA 4IO3A 3PUYE 2D3IA 5M2VA 2I4BA 2X26A 1NNPA 5DJTB 1MPCA 3VDFA 3FZVA 2O68A 1B3LA 2WMMA 2R9JA 1H0TB 2QL3A 1UQWA 1HSLA 4LUBA 4DCXA 1LB9A 3BKIB 1IZ1A 5A5XA 3KFMA 5DEXA 4NPDA 4H5FA 4I8CA 2HZKA 3E3KA 3G3KA 4F22A 4LATA 1VFEA 4ND9A 3ZDMA 1XC1A 5H8SA 1FQDA 3L6HA 3V89B 2ZXTA 2ONRA 3KN3A 2YJPA 3USDA 4MN4C 1QKBA 1O7TA 4GVOA 3H06B 4ESXA 4YKKA 1MXVA 4KYDA 4H6DA 5JTYB 3B6WA 4MLQA 3U92A 3PMWA 1MRPA 3VV5A 4PE5B 3BFTA 3TTKA 1SYIA 3PD9A 2O6AA 5FHOA 3OELA 3C32A 2HR3A 3VE1B 2V3UA 1LAGE 1JVXA 2BJJX 4KJMA 2HAVA 1A54A 2JWDA 4NPFX 3T22A 1MQHA 4HB1A 3JZJA 1M5EA 4QFNA 2XX8A 3RLFE 3ILUB 3OEKA 1NMUA 4JSDA 4GXAA 1MPBA 4PETA 1A40A 2REGA 5IKBA 3FASA 4ISUA 1EZPA 4NE4A 2PT2A 5DVJA 2ABHA 3RTFB 4N6PA 3KN7A 4U2RA 3HPIA 2ANJA 4N07A 5CBSA 3KJTA 3S9EA 2XXQA 2DE4A 4H67A 2H25A 1H44A 3SEYA 4IOIH 3TCHA 2K3RA 1OQHA 2IEEA 4ELOA 1IXGA 3QYTA 5KDTB 3FVOA 1M5DA 1I6QA 3IAZA 5AA3A 4PFYA 3LSFB 5EHMA 1A8EA 3PMVA 3G3IA 3KOSA 5AA4A 2DQVA 3ILTB 5H8HB 3LR1A 5I58B 5IAIA 4YB7A 1B2HA 2O69A 1FC2C 3OOAA 3IB1A 5EHSA 2XXYA 1Y47A 1BKAA 1P1OA 1OLAA 3MVYA 3LUYA 1JW5A 3T93B 5KCJB 1QW0A 1EDLA 1I6BA 1Y3NA 4F3GA 1A55A 1WODA 4JSOA 3OSQA 2XXVA 2X7QA 3HSTA 2Z8DA 2Q2CA 3HCQA 5I57B 1JNFA 2DP8A 4GF8A 4H8JA 1N3WA 3K02A 2ZYKA 2M5AB 3CRBA 1NKXA 4LVQA 2UYFA 2F35A 4BDRA 5L8DA 5L9OA 3UA8A 3R6UA 2XX7A 2F6GA 3MHVA 4OXVA 3O6HA 4RPOA 3PUXE 2M0BA 2XXHA 1PBQA 5DTBA 5JK4A 1DEEG 1GGGA 2KS1B 3KJ7A 2RKMA 2QSXA 1EDKA 4U21A 4FATA 4GD5A 2THIA 3TCFA 3D4GA 3U72A 1SI1A 2Y7KA 3SEUA 2O7UA 3QWOC 2RC8A 4F2OA 1PB7A 4NF6A 3SKPA 3W9WA 2H4IA 4R6KA 3MVZA 1M5BA 3SETA 3OXNA 5ICTA 2I3VA 2QVAA 5K2XA 3A09A 3PUZE 1IUDA 4Q0CA 4ZZAA 2OK2A 3FV2A 1PB9A 4ONYA 1AH5A 1ZXGA 4EUOA 3N6TA 2DE2A 4C1UA 2DXYA 4H65A 2A5SA 2D21A 3MW0A 4QHQA 4Z7EA 3QXMA 5AE4A 1NVOA 4YMBA 2RINA 4ZEIA 2HQ0A 4RYAA 1B3EA 3G3JA 4R74A 4NTLA 1Y20A 1YAEA 3DP4A 3OSRA 4U4XA 1O64A 2O51A 3MP6A 2DXRA 5I56A 3WAEA 3TELA 1JEVA 5H8FB 3JYRA 4RK2A 3ODBA 2YLNA 4GL8A 1BDCA 2Z8FA 4OFJA 1J1NA 2Z8EA 1VFDA 1O63A 4I1DA 2F7CA 3DELB 5CC2A 4TLLB 5FTHA 1R6ZA 1N76A 1MXZA 1RKMA 3G3GA 3OENA 1URDA 2V3TA 2YPNA 1VR5A 2G29A 1H43A 3RGUA 2M5AA 4PQJA 4NF5A 1LLSA 1Z7ME 3HV1A 4RNSA 3UK4A 3MAMA 4BDNA 2Y7WA 2HZLA 4YKIA 4ZEFA 3I5OA 1D3KA 5H8QB 5ITPA 2LR2A 4HS7A 1B7ZA 4F18A 3Q25A 2QRXA 3TTNA 4NF5B 1ANFA 5I59A 5H8NB 3S9MC 4THIA 3SDFA 3IB2A 4G4PA 1XOCA 1EH3A 4POXA 1BLFA 1IIWA 3FV1A 2QRYA 3V5AA 3TZAA 3VLWA 3UN6A 2ZYMA 5F1QA 1OMPA 3CI8A 2OZZA 2CZLA 3LC8A 1B40A 1MFTA 1GTKA 5TP9B 1ZBMA 1U7MA 1US5A 3QK6A 2UYEA 2RKLA 2I49A 4C1TA 3KBRA 4U4SA 4NF4A 4DDDA 5ICQA 1LP1B 1ZJLA 3H4ZA 1JEUA 2F34A 5BUUA 1NH8A 1MY2A 4IB2A 4IGTA 5I2NA 1DOTA 2I8DA 2DWAA 3P7IA 2UXAA 4ZEKA 3VVFA 2AL5A 4PFUA 3SERA 1SW5A 1SQYA 1B4HA 2PVUA 4GOTA 1MH3A 1TXFA 3Q28A 3KZGA
chains in the Genus database with same CATH superfamily
1MY3A 1T8ZA 3SWYA 1B05A 4KFQA 1M1JB 4GODA 1OLCA 4PV1B 3KZIH 4L73A 3H32A 3QH9A 3QIMA 2DWIA 1FQBA 3H6WA 1MPDA 1Y3QA 1HGVA 2FY8A 4HE0A 4KYSA 4JB7A 5F7VA 1LTSC 3TDKA 3NOHA 1JY2O 2V4HA 1YIJP 4IGRA 4F19A 3FVNA 2H99A 4GFRA 2WSFH 1R9QA 2JJLA 3W67A 4XXUA 5GTHH 4MF3A 4N78D 2HPCA 1LBCA 4D6TE 1CZQA 1LTJB 4U1ZA 3C9IA 2GFEA 4FECA 3C9HA 4N8YA 4BDOA 2CMOA 1MFZA 4U23A 2JDIH 2JJKA 3RPWA 5AVTB 2F5XA 4R2BA 3CCMP 1PGOA 4JVDA 2IA4A 2KSJA 3L70E 3SWFA 3HD7A 1BCCJ 4GIFA 2O1MA 3K5BA 4GT1A 1NU1K 5KKZB 1IMEA 1IK9A 3EQ1A 4GBVA 4GWUA 3SESA 2ESNA 4EXLA 2HXRA 1KYOH 1NV5A 4WEPA 1FZFA 1N7SD 5TPAA 3RL0D 2BCCE 2QEXP 1B52A 1AMFA 1SQPK 3M3FA 2UVJA 3KN8A 4OEVA 1PDAA 2JR8A 5FHNA 4F1UA 4HXVA 3ECRA 1QKAA 2DE3A 1B5JA 3EHTA 3S9NC 1HF9A 1WDNA 4HJGH 4PGNA 3LSLA 5CRYA 5IZZA 2D5WA 2Y7PA 4KT0J 4LZ7A 2K9JB 4BRYB 1LP1A 4C0RA 1SBPA 3GBAA 3RYDA 4F1YA 5AW1B 1SLQA 2VD2A 2JKVA 2H7HA 2P3VA 3PPRA 3K6WA 5CI5A 2CPBA 4PFWA 1Y4CA 4LQ2A 1MKMA 5AW8B 3L74J 1XVYA 2QS1A 4OFLA 5I3SA 2DVZA 1S9TA 3U1OA 3HTKB 1SQBG 1ELJA 4OVSA 2A5TB 1ZW0A 3H1KD 2DWJA 4DJGA 3K00A 1PBPA 3AE9C 1NV1A 3RPLB 2XXTA 1B1HA 1UIVA 3PP5A 4KYEA 1BGYE 4LQ5A 1VQNP 3CXHH 1FBMA 4PV1C 2V84A 1M8OB 2CZIA 2KSEA 2O7IA 3A3CA 4NEDA 3KSXA 1RF1B 3OO6A 2KZJA 1QL1A 2SPZA 1ZU0A 2AXTE 5AA1A 5A5XB 3WUUA 2GH9A 3OW2O 2PX1A 2R71A 2UVIA 4G8HA 2WZ7A 1SQVJ 3GF3A 1NTZK 1FPDA 1URGA 2I3WA 4N13A 2F78A 5APXA 3N6UA 3C31A 1KILB 1ZIUA 1FZCA 3PH0A 4ELQA 2Y9YA 4Q8RA 2Q8MA 3IJOB 2MKVA 1ATGA 3HD7C 4O3BA 2W8ZA 5CM6A 1JM0A 2ZFCA 5TPAB 1IJDB 2GA1A 1HWTC 1S50A 1N7LA 3EHUA 4F1VA 5ET5A 4OHNA 2XV5A 5AA2A 1QEXA 1NOHA 1IFPA 2C0WA 4OYVA 3A0HE 1DTZA 5FHMA 4PP0A 3K1NA 3KSJA 3I55P 1DBZA 2NOOA 1DPEA 3RGYA 1Y9UA 4PBQA 4HTGA 4IL6H 1A02F 4PD4E 4FE8A 3OO7A 4KPTA 4RY1A 4XKQA 1UTBB 3Q2YA 1IXIA 3JCUE 4MFIA 3NMDA 2XKMA 1JO5A 2H9BA 1VQ8P 4ELPA 2I0CA 2PGDA 3U1AA 1FJ9A 4I40A 3O9PA 3ZKLA 4TLMB 2I0BA 3MSTA 4H0LB 3MVWA 4KI0E 4WVZA 2W83C 4I3YA 1Z56A 3RK3B 1H76A 3S9OA 2AL4A 3IR1A 1BP5A 4OGQC 5J16A 3FXEA 1NU1E 1OVTA 1FTOA 4QF9A 1W2BO 1LBBA 2YXRB 4LZ8A 5AVVB 3L71E 1RYXA 1LEVA 1KILD 3O29A 3TK1A 4ECFA 3LIEA 2FKWB 1KYOD 4AQ4A 2E74B 4XF5A 5CHXA 3WMM0 3C36A 3T9HB 4U22A 4JXIA 1HJ0A 3HN0A 1KA0A 3E79A 1FBFA 1TFDA 1VE4A 2PRRA 3RK3E 2KLVA 1X0TA 3UIAA 1T6AA 1L4AB 4H44C 2YKOA 4XE5B 2AIXA 3FUZA 3M8UA 5J1DA 1D9QA 4GOEA 2CK3H 3HO7A 1YZ0A 2FFDC 1FBCA 5B70A 1YCJA 5JEIA 4NX1A 5HPQA 5AVYB 2UVHA 1B32A 1FTKA 2KZIA 4JWOA 4NF8B 1WMKA 3BRVB 2OTLP 4LN5A 2IYOA 3B71A 2PMSA 1IMBA 4EF1A 2ZXXA 4D6TJ 1BGYG 1KILA 1B5IA 2N1TC 3K6XA 4M4GA 3H1IG 5LTCA 2H89C 1JNMA 1LSTA 1PB8A 2E42A 2XD2A 4P11A 1PP9G 2YIUB 3CVGA 3MYUA 5TP9A 5JTYA 1AVOA 3O6GA 1EXJA 1GK6A 1LT9B 1NV4A 1BE3J 1A8FA 1BTJA 1MQDA 1Y9BA 1XI6A 3UP9A 1HSJA 2I48A 1BCCE 4IO7A 1PP9D 3PPQA 1EU8A 3MZWB 2P58A 4I62A 3W9VA 1KB9D 2F7AA 2WBBA 3U93A 3O66A 4C7RA 2XWOA 1LBWA 3N26A 4IR8A 3K0VA 4OEUA 4JBZA 1QVFO 1L0NJ 2WT7B 1YJ9P 2VD3A 1EQ7A 5AVSB 1L0NG 4MCOA 1BSNA 3G4SP 2YNYA 3CFXA 2ALUA 2FYUJ 3CC7P 3V8XB 4K3AA 1KQSO 2MKZA 2QPQA 1USEA 4XKNA 1X9VA 3FGSA 2G93A 1LT9A 3AEDC 1G2CA 3H6TA 4N78E 1B46A 1QULA 1IZNB 1CNQA 4OVRA 4C7NB 3CL3D 4OQOA 1ZR2A 5KDTA 4U1OA 4UACA 1N7XA 4EOTA 5BU5A 1TFAA 3G6EP 4G77A 5L9SA 2KNCA 4NWCA 2ZXEB 3L74E 3L73D 1NU1J 3U65A 3C1LA 3CG1A 5EYGA 1SDXA 2FYUK 2XXIA 1QUKA 3G3HA 5TISE 4GIZA 3Q3DA 4ZKUA 1EZVI 4DLDA 2UWJE 3FGAD 4IFFA 1DH3A 1N86A 1FBDA 2L5GB 1URQC 1ZTYA 2HODA 4MAGA 2DS9A 2B87A 1B0HA 3G71P 4PF8A 1FZEA 1FTAA 2FFDB 5KLIC 3VVEA 1VF5D 3TAJA 1U7JA 3CSGA 3RQTA 3RL0C 1L4AC 5TISH 1INPA 4R6YA 3VFJA 4QSDA 3KDPB 1AIVA 2F3DA 2Y0CA 1OVBA 5LDZA 4GBWA 4R72A 2BCCG 2Z22A 3B6TA 1HUCA 2QE7H 4G68C 1B9JA 2QJKC 4ZMDA 3II6A 5IM2A 1H8AA 3IJXB 3KQGA 1SFCC 1I6AA 1PEBA 2XWIA 3CMAP 3IORA 3VP9A 3VVDA 3K6VA 5I59B 4OGQB 1L0LE 1VQKP 2WSCJ 2ZZWA 4GQOA 3T66A 1HVVA 1FZAA 2E1SA 2KR0A 3FXBA 2K9YA 2XXKA 4N6DA 5CMKA 1FPJA 2V25A 3H6UA 4N4UA 2P1JA 2HHMA 4RJZA 5CCGA 1IFIA 1L0LJ 4MLVA 3VXBA 2PAJA 2PFZA 5C39A 1OVVA 4XKRA 2KI7B 4UB6H 4XKPA 2O01N 3H03A 4F29A 5LOMA 2OCUA 3K4UA 3C4MA 4JDFA 1NKNA 3T97A 2QG4A 1B7UA 3GXAA 4PTKA 1NAFA 3BRTB 3EWKA 2P0SA 3MP8A 1OQGA 1FQFA 3CFLA 1H3DA 1NHLA 1EC5A 2NRGA 2Y7IA 5EQ8A 3TNUA 4PFRA 3TCGA 1NTZD 1NTKK 4TOZA 3TUSA 1EZOA 4PC9A 3MVXA 2XX9A 2ONSA 3PGFA 3H1KG 3D70A 1KV4A 4JYCA 1Q86Q 4OVTA 2HCAA 3TKDA 2H43A 3LSXA 1SQBD 1SQXG 5CCGD 1Q35A 3SEXA 5KLVD 3ONMA 3I5CA 1VQ4P 4OVNF 1ZKBA 1U57A 1NGMB 3M0AA 2OYIB 1DCUA 2NXOA 2O1JA 1OFCX 2QFLA 2IYPA 4G8NA 1RF1C 1FDOA 5CMMA 3F5HA 4PE3A 4G2ZA 2IFMA 1WVJA 3T1BA 2ZNTA 4ZS9A 1NYHA 1RE3A 4QMAA 4R4MA 3VTPC 1NH7A 2YMKA 4NHBA 4IY6A 3QMFA 2Q88A 3K01A 3LV0A 3D6ZA 1MM7A 1ZOYC 4P0GA 1QL2A 4MNPA 1M1JA 3EFGA 2FXOA 3MJNA 4AQRD 4WY4B 1LAHE 1FJPA 3Q27A 2QJYC 1EXIA 2PYYA 1LWUB 4I9DA 2IBZE 3PTZA 4ESWA 4EXKA 3PU5A 2F3BA 1JUNA 4GL0A 1JY3P 1KORA 3L71D 4GOFA 3FATA 1N7SB 1GL2C 2MJZA 3AEGC 4PJ0E 2KLFA 4F3BA 1UTBA 2P67A 4EYYQ 3GMAA 1SQVK 4YZZA 1NUZA 5AW4B 2QS4A 3U94A 5CBOA 3T9UA 1MY1A 3N7NA 1S5LE 3BBRA 3RTWB 2E74D 5FBPA 1KB9I 5H8QA 1HH0A 5BU8B 5IZ3B 4L76A 4QRZA 1YXIA 1AJYA 2F36A 1CB6A 1MXYA 3MUDC 1NKZB 3V5BA 1K9YA 1NV2A 4BDQA 3V6IA 4H46A 4Q5TA 2NWJA 3NXSA 4DZOA 1Q1KA 3Q26A 1MY0A 2P2UA 1CI6B 2IDBA 1VDWA 2R5DA 2CZKA 1RF1A 3HE4B 2YMYA 3PPPA 1OIPA 1KD1Q 2PBWA 3G7WA 4R6HA 2WYPA 1EZVD 1B5HA 4HE1A 1NNKA 4MH5A 4JWXA 3KEIA 3TQWA 3UORA 1KYOI 1NV3A 1NTZE 5GTHE 4R75A 3T9VA 1R5LA 2R6GE 2W6BA 3E4RA 3HUSC 1N73B 2B88A 1ZP0C 2O3JA 4EQ9A 2PP6A 5CMZA 3CCVP 2XWVA 1GD2E 3EPEA 5AW2B 3H32B 4WKMA 3UIFA 1IEJA 3L72J 2FYIA 3GHGB 3FJMA 1L5TA 3P8CD 1OVRA 2QJEA 2B3BA 2C9NY 1S9KD 1T0KA 3H1LG 1QUJA 3E13X 1SQXJ 4IO4A 2QJYB 3PHLA 5DEXB 3AE7C 3L72E 4NWDA 4U3FG 1BE3E 3OEMA 5B5EE 2HFBA 1Q2NA 4M1VA 4NF8A 3G9RA 5KAIH 1P1UA 2LKMA 3AXFA 4HCYA 3WU2H 2ZVNB 3OD7A 4L75A 1JTHA 2OGUA 2R5BA 4GLIA 1YQ3C 1CE2A 4WXJA 4BLAA 1NH4A 4ZEDA 1EZ9A 4LP2B 2Q8JA 1MQIA 2E75B 2QJKB 4O9BA 1GU4A 2Z23A 4WEDA 3C33A 4LA9A 2QS2A 4R2FA 4P8BA 1AWBA 2V3QA 3L37A 1VQLP 2WKYA 2K37A 2E74C 3TPAA 2FYNC 3I3VA 5APUA 3FX0A 2XZRA 3A7OA 1VF5C 3L74D 1FZCC 3AEAC 2Q6QA 1NL5A 3BFUA 1POTA 3Q5PA 5IZ3A 1DSNA 5B66E 1Q7YQ 3CR9A 4X04A 1MQJA 2N9YB 1XHYA 3PD8A 1PL5A 2J59M 2ITAA 4KQPA 5CJ4A 3KG2A 4IO5A 1FCKA 2ZNUA 1L0LD 2OBGA 4FIMA 3SFDC 4R9GA 3MZ9A 2AEMA 1KB9E 3K1PA 1KILE 1JP4A 2Y84A 1QJMA 4POWA 5CBNA 2I58A 1K8AQ 4K3FA 4Y99B 3RK2D 3TYYA 3H1HE 1S3JA 1URQD 3E1IA 3N94A 1XVXA 4F3SA 3GLBA 3V2RA 3OA7A 2M3EA 1P1QA 4H13B 4N3YB 1W2EA 1UTHA 1K9MQ 2KP8A 2RN0A 1S7YA 5ISUA 5APTA 1FTLA 1FBGA 3KOTA 1ZV8A 5AW3B 2IBZD 2A06D 2V4CA 2Y0DA 4ZZEA 5I2NB 2BEQD 5B7DA 1DTGA 3F11A 4OTEA 1JQFA 4AB5A 2XD3A 1B6HA 1GMJA 1GDTA 2B87B 4X8RA 1FW0A 4RJTA 3LW5J 3IB0A 3QAXA 3ZS6A 4LC1A 5H8HA 4ZNCA 3MZBA 1JY2N 4FAJA 5CJ0A 2E43A 4H45A 1D9YA 3M3KA 1PPJD 5APQA 4ZE9A 2XXUA 2C9LY 2L91A 4YB5A 3H1KE 1SQBE 1P1NA 2HEUA 3AEBC 3D4CA 1BIYA 4GXSB 1FQAA 2M8RA 1LJ2A 1P84H 2KLUA 3L35A 3S1KA 1GV8A 1BCCD 4O3AA 4PFIA 2DOJA 1Y3PA 2NZ2A 1DD3A 1L0NE 3AE4C 4YXDC 3H1HJ 4FEDA 4O3CA 2DW3A 2FYUG 2OARA 1FQEA 2PCRA 1QLED 1FQCA 1YPNA 3ZKKA 1LT1A 3KC1A 3CIJA 5KJ7A 1OVUA 1UIIA 2VP1A 4X9TA 2D2CD 4U3FJ 3H7MA 3TFLA 1Y4TA 1QVSA 2ZYGA 2WSCH 4PV1D 3CSBA 1KZUB 4E0WA 1DEBA 5I56B 3LUZA 2ZZVA 5E79H 2B65A 3V2QA 1LAXA 1JVYA 3MUQA 3VMZA 1PP9E 1NFTA 3I6VA 4RXLA 1KQFB 4DI4B 1IXHA 4PD4H 1EYIA 1YITP 2NPSB 3M0DC 1H45A 4NGUA 4OERA 1RYOA 1LGHB 2AXTH 4LONB 3VXCA 2HG5D 4R9FA 2OYOA 1FPBA 4HW8A 3SEVA 2Y0EA 2OTJP 1GL2D 1OIBA 4KR5A 3FWNA 1MDP1 3A2AA 1NTME 5KJ7D 1SD3A 1IFMA 2QVUA 4YICA 2ZT9B 3WUTA 5ESYA 3CCJP 3EQ2A 3JC22 3OAKA 3KGCA 3B8EB 1FTMA 5I58A 4QFOA 4MX6A 4BDLA 2P10A 2H98A 4DIGA 5AA2B 5HM4B 2B89A 4O8MA 2Q89A 1S2EA 5B66H 2YO3A 4O7IA 3S9LC 2CEYA 3VP8A 4OANA 1B3FA 5AW6B 2XXXA 4G8MA 1SQQD 5DW8A 1RQVA 4N8GA 3L72G 2YO2A 1R1NA 2YIUC 3HD7D 1SQVD 3L70D 4C7NA 1NNFA 2VT5A 5I5PA 2NUVA 5ELVA 1GW4A 2E5TA 2N1TB 2F6PA 2WSFJ 3IO6A 4HCWA 3HHFA 5BWJA 1B3GA 1AOVA 4F31B 1GZLA 1AQTA 2ZNSA 4P0IA 1LBVA 3O8ZA 3H6VA 2FBPA 4MMPA 1KQGB 1LWUC 4OZ9A 2WPSA 1SQBJ 3OO8A 1E79H 2R8TA 3MWBA 5DVIA 1JMBA 1M5CA 2D2CC 1IFJA 1A7LA 1B58A 2BJIA 1IMFA 1LFGA 1NTMJ 3A3UA 4I2LC 3USSA 4UABA 1RY3A 3CX5I 1JCDA 1QGKB 1JEKA 3O28A 3DLNA 2FYZA 1J2JB 2M3BA 4PCDA 2LXCB 1IK7A 4PAIA 1Q9DA 5I2KB 4DI3D 4EQ7A 1PGQA 3GYYA 4G68B 3CX5E 2B4MA 5ET6A 2A06E 1US4A 3MQ9A 3PV0E 1EDIA 5CCHC 3AE1C 3IX1A 3RT8A 1SVFA 3GW6A 3RL0B 1BDDA 4YU0A 3CX5H 2HAUA 4NF0A 1VQ5P 3GZGA 3TYHA 1H0TA 4OETA 3SEWA 1OW7A 1SFCA 4YAHX 1RDZA 3T9XB 3RK3C 3FXRA 1KMIZ 1WRGA 2ZYNA 1S1CX 1SYHA 1KFNA 3C34A 3EFFK 3TTRA 3R2PA 5KAIE 1DIPA 2PT1A 4Q30B 2ZZXA 1Y8AA 1NTKE 4WBAA 3UGWA 2H8PD 1GR2A 1LWUA 3CXHD 1AL3A 2WEFA 4NF6B 3B5ND 3O97A 1KA1A 3PMXA 4ZECA 3Q1MA 2RF1A 3EF7A 3DM0A 3H1IJ 1MQGA 4KCDA 1H89A 2WYKA 4YB6A 4ASWA 2KIKA 3LSWA 1X79B 3M9QA 3HFUA 2XHDA 2KXPB 4LGDE 5KZTA 2DSFA 2Q9IA 4GWOA 2W90A 3V4QA 3R7XA 4DXUA 5F24A 4FEBA 5AW0B 4QFLA 1SFCD 4U7JA 2Q7CA 1B51A 1YTVA 5HBCA 4GX4A 3G3FA 4ZEBA 3FVGA 4GRKA 2LXBA 1UTHB 4QFKA 1NJIQ 2OJTA 1SQVE 1NO4A 1TWYA 1KILC 5AVXB 2B4LA 3C8VA 1JMMA 1AFOA 4OVJA 3TTMA 4BDMA 2VPNA 2QIWA 3P8CE 2OYIA 2XXWA 4FORA 4YMAA 1VQMP 3S2VA 3CI9A 2DWHA 3BIHA 1NV6A 1SQXE 3DP8A 3GF7A 4PAKA 3B5NA 2QMWA 2QVVA 2UVGA 1FPFA 1I69A 1QUIA 2OWTA 2GUVA 3RN8A 1BE3D 2QMXA 1USDA 2OYHB 1FTJA 4NPEA 4GWSA 5B5EH 1FBPA 3MBPA 1R5SA 4D6TG 1IITA 3O2AA 4QXDA 1SW2A 5APVA 3CD6P 1DPPA 4XIGQ 1FAVA 1WT6A 4ZE8A 4PFBA 3ITKA 4OA4A 4XFEA 1NTMG 3K6UA 1ZN5A 1LGBC 4MIJA 4ASVA 2AXCA 1LCTA 1EYKA 5CCHA 2I6EA 1IQ7A 1FRPA 3FVKA 3D1RA 3TODA 3BCCD 4N81A 5K5GB 3GBBA 3E7KA 3A0BE 3OO9A 5EQ9A 3SZPA 5CBRA 2FYUE 1N0TA 1IC2A 5GTIH 3FXQA 4DT0A 5AVQB 1XS5A 2XXPA 4KCCA 4PDHA 2Y5KA 3H25A 1LTIC 1G1JA 2REJA 2J5UA 2F97A 2KYVA 3B6QA 4H5GA 1VQ7P 4OWDA 3B8BA 5I84A 2OYIC 3IOWA 3TQLA 4UB6E 3TTLA 4QSEA 4EDPA 1LTJA 2Z4EA 1HJBA 3I56P 1Z7NE 1NTKD 4DCYA 1DMBA 3PUVE 1BSHA 4H0WA 3BCCG 4YKJA 2ZMBA 1D7MA 3IR9A 2GM4A 4PGPA 5CCHD 2VHAA 3C35A 4X1BA 4MNIA 4MBPA 2Q1KA 4H0LC 2Y9ZA 4Y28J 3K2DA 2WSSH 5L9MA 1P99A 1POY1 3AEEC 4WB4A 1RF0A 3CFZA 3MIWA 3DP6A 1N84A 2YKQA 3PLNA 1SI0A 3GLMA 1FPIA 1VSOA 4NN3A 3D6YA 4OMBA 3KYQA 2O84X 4G68A 3L4FA 2XA5A 1D4NA 4F39A 4OVQA 1X22A 3AE5C 1T2KD 1JY3N 2CZHA 4BWNA 4OENA 1F9BA 1N04A 4NAPA 3U8QA 1P1WA 3W15C 1B7HA 3FD3A 4GWZA 1VDFA 2KUBA 3CWBG 3RUMA 3R26A 3IOTA 1LFHA 1SW1A 2CEXA 4RK9A 4KD5A 1J1EC 4FJPA 2Z5IA 3IOUA 3L75E 3IOVA 4BXLA 2K9JA 4BRYA 1IMCA 1URSA 1T3UA 4DXCA 2ZAEB 4A7PA 3O6IA 5CMCA 4AUWA 4H44B 1FZCB 3H1HG 1SW4A 3A0HH 3LW5H 3IO4A 5KAFH 1K73Q 4N6JA 4KXPA 2OYHC 2E5YA 1B3HA 1M90Q 2E75C 3SWKA 4AS4A 1NUWA 5DT6A 2ZYOA 1RF0C 2XU6A 2A5TA 2F8DA 2I1KA 1MZ9A 2FNCA 5I2KA 1L2PA 3L6GA 1S5LX 4EDFA 2WTYA 2HXWA 5KCJA 4X1DA 1B0LA 3EN3A 2WITA 2DVCA 5FTIA 3TDJA 4MHFA 5KLVJ 2Y7RA 1PZQA 3S4UA 5DYHA 1L0NK 1UIUA 1G0IA 4JPZB 3S4RA 1FBEA 2OWSA 3CG3A 1GTWA 1N73A 1LB8A 1USYE 2KB7P 1P84E 3O6QA 2R44A 4E0XA 4F2QA 1S4XA 3B7DA 4QSCA 5H8NA 4XTCQ 3ZSFA 2V93A 4OFOA 1USYH 2AYSA 2VOZA 3PPNA 3FXUA 3FJ7A 3RY3A 1QVGO 4TQUQ 5DVFA 2IFNA 2B3FA 4JWYA 2QJPC 5AA4B 1LTGC 1PGPA 4U3FE 2FVZA 1MH4A 3IL1B 5K2YA 3JV9A 3FXDA 2X7PA 4EQBA 3M9HA 3H1LE 1R8EA 3H3GA 3N5LA 3M3LA 4GDOA 3JSVC 1NU1D 2O1KA 5E79E 2LAOA 3SSUA 3T96B 2O1LA 2Q3EA 3E9XA 3L71J 2Q5UA 3TGUG 4DZ1A 2I4CA 1ZLQA 1YTZT 2ZT9C 2HPGA 1JETA 4KHZE 2A45H 3M9BA 1SQPD 1G2CB 2R32A 1KFMA 4Z0IA 2WVRA 3FIRA 3LBSA 2W7YA 4MNCA 4WWIA 2HYNA 1SQVG 3TGUE 4OH8B 2E0SA 1MDQA 1PC3A 2M8CA 1B1XA 1LNQA 2NPSC 4YXWH 5H8FA 3L75D 4CPGA 2OX3A 2ONKE 1M5FA 1PV3A 1NNTA 4OESA 2E75D 3CCUP 4UA8A 1KWHA 4DE8A 3PJSK 3CC2P 3G3ZA 1HSEA 4RPNA 1GW3A 1Y1MA 1CSBA 3FJGA 1GVCA 1SVXB 4HKZH 1N7SA 2P3NA 3IK6B 4IO6A 3MP1A 3Q5SA 1JW4A 4F3PA 3H1JD 5EFWB 2P1SA 4RA1A 5M1BA 2RC9A 1ZMGA 5GTIE 1R9LA 2P2AA 4DXBA 4YTPC 1ZRTD 3VOPA 5BVZA 1N7WA 2QS3A 3VLVA 2Q2AA 2A45I 5APWA 3RL0g 3VLUA 4EIJA 2GRVA 2OLBA 3TMGA 1LFIA 4HH2A 1A99A 4AB6A 5A5LA 3CWBE 2RC7A 3MPKA 1IFNA 1YYCA 1B4ZA 1NV7A 4H1XA 1SQQE 2V7QJ 3CXHI 3HUSB 1RH5B 1N73C 4PFTA 2FA7A 1SQXK 2RCBA 1MY4A 1KYOE 3M0DA 1IMDA 3Q29A 1NTKJ 3HHGA 1LTAC 1EDJA 1MXUA 2G3AA 2CPSA 1PP9J 2H5YA 4YKPA 3MZ1A 2O01J 3QSLA 2BEZF 4LZ5A 5EYFA 5TU0A 3EKIA 3E78A 3QUFA 4IO2A 3PPOA 2NVUB 1FDIA 1SQBK 4EF2A 1OMIA 3H1JG 1MG1A 2O01H 3TEPA 4NF4B 5KLVK 3EHSA 1YHQP 2GHAA 4QFPA 1GU5A 3RNNA 4X48A 1VL2A 1ZLLA 1MXXA 4R73A 4ZDMA 3WAFA 2Q9TA 3QUJA 4N15A 2FYUD 2RCAA 3OMBA 2OTKE 3AEFC 3T0JA 4B86A 1XT8A 4L17A 4I6MC 1BCCG 2GHBA 3RT6B 2RMZA 3L75G 1MM6A 5I57A 1LBZA 4NG7A 4NMYA 4IY5A 2XXRA 1ZR4A 1JW1A 5DJUB 3IFMA 1FPLA 1JY2P 1HBWA 1LCFA 3AE8C 1YBKA 3CHGA 1RDXA 1LTBC 3V83A 1W5CE 2QVRA 3THIA 5EYHA 1SQPG 3MPLA 1LTJC 5CMBA 1D9VA 3L73J 1II5A 2DYXA 1N3XA 4K35A 3MC2A 4PF6A 3KHUA 1LAFE 4JF7A 3TGUD 1SPIA 2VGQA 3CCEP 3P8MC 2KQZA 3GG2A 2F7BA 3BATA 1HGZA 2FBWC 1NU1G 5ITOA 1S9KE 4UB8H 2A06G 3KPEA 5AA2D 1CI6A 1TT1A 1SS1A 4ELRA 4H8IA 1MS7A 2FXPA 4RO0A 1IXCA 1RE3C 1YI2P 1MXWA 4XEQA 1VQPP 1S72P 3SFEC 3PUWE 1Y1ZA 2FIXA 3K1MA 3IAOA 4IO3A 4HE2A 1N8RQ 3PUYE 2D3IA 5M2VA 2I4BA 2X26A 1NNPA 5DJTB 4H13D 4I7ZC 1MPCA 4W7ZA 3VDFA 3FZVA 2O68A 1PGJA 1B3LA 2WMMA 2R9JA 1H0TB 2QL3A 1UQWA 4XFJA 1HSLA 3OJAB 4LUBA 4DCXA 1LB9A 1L0LG 1YJNP 5AW5B 5KLVE 1K9ZA 3BKIB 2Z5HA 3D71A 1XTGB 1IZ1A 4KHXA 5A5XA 4R4LA 3KFMA 1QX8A 5KTBA 4P47A 3PTYA 2QM7A 5DEXA 4NPDA 4IFMA 4H5FA 4I8CA 1JTHB 3NTNA 3L74G 3VMAA 4IFDK 2HZKA 3E3KA 1JB0J 3MUDA 3G3KA 4F22A 4LATA 1VFEA 4P1LA 1FZGA 1P84D 4ND9A 3ZDMA 1M1KQ 4P1EA 4P9KA 1XC1A 1MUUA 5H8SA 4JYBA 1FQDA 4JVIA 2JWAA 3L6HA 3H1HD 3V89B 5ET7A 2FIEA 2ZXTA 2ONRA 1DK4A 3KN3A 2YJPA 3USDA 4MN4C 4RKUJ 1QKBA 1IFDA 1O7TA 2K88A 4U3FD 2OWZA 3H06B 4GVOA 4ESXA 2J58A 4YKKA 1MXVA 3CWBD 3VYIA 4KYDA 3H1LD 4H6DA 1JCCA 2ZYAA 5JTYB 2R3CA 2KOGA 3B6WA 4MLQA 3U92A 2WPRA 3B5NC 3PMWA 1MRPA 4PAFA 3VV5A 1AA0A 2WX9A 4PE5B 3IN6A 2ZYDA 3CCSP 1URQA 3BFTA 3TTKA 1SYIA 1KN7A 3WUVA 3PD9A 2O6AA 5FHOA 3OELA 3C32A 2HR3A 1P84I 3VE1B 3H1IE 1EZVG 2YKPA 1AV1A 2V3UA 4EI2A 1LAGE 4TLFA 1TU3F 1OX3A 1JVXA 2BJJX 2A45G 4KJMA 1M57D 2D2CB 1JY3O 3H1JJ 2HAVA 4P3LA 1URQB 1A54A 2JWDA 4NPFX 3T22A 1FOSF 1MQHA 4I1LA 4TT3H 1Q81Q 4HB1A 4WY4C 3JZJA 1MV8A 4H44D 1M5EA 4QFNA 2XX8A 3RLFE 3AE6C 2XWKA 3ILUB 1NTKG 3CWBJ 4Z1MH 3OEKA 2WPQA 3L70J 2Y5LA 3RPLA 3H1LJ 1NMUA 4JSDA 1QGXA 4GXAA 2N1TD 1MPBA 1SQQJ 3IFCA 4PETA 3KZIE 1A40A 2REGA 2K1AA 2DDKA 1KTMA 5IKBA 3FWLA 4PD4I 3FASA 5AW7B 4ZKPA 1K04A 4ISUA 1G1IA 1EZPA 3L71G 4NE4A 2PT2A 2IX7C 4N6KA 5IGAA 1E5WA 5DVJA 2ABHA 3RTFB 3H1KJ 4N6PA 2FFDA 1BGYJ 1Q82Q 1VQ6P 1Q90D 1S5LH 1YQ4C 1FJ6A 1RHZB 2QA4P 2OQQA 3HRNA 3CCLP 2WSEJ 1OWAA 3KN7A 4U2RA 3HPIA 2ANJA 1NTMD 2C0XA 4N07A 3KJTA 5CBSA 3S9EA 2XXQA 2DE4A 5AVUB 4H67A 2H25A 1H44A 3SEYA 4IOIH 3TCHA 2K3RA 1OQHA 1KZ8A 3RK2C 2IEEA 1NWQA 2N1TA 4D6TD 2QJPB 4ELOA 1IXGA 1BE3G 3QYTA 4W7YA 5KDTB 3FVOA 1M5DA 1FSAA 1GL2A 4HYTB 2PFYA 1I6QA 3IAZA 5AA3A 4PFYA 2YXQB 3LSFB 5EHMA 5T3JA 3AE2C 5KLVG 3W68A 1A8EA 1SQXD 4IL6X 3PMVA 2W6JH 3G3IA 3TGUJ 4DOJA 5H2FE 3KOSA 5AA4A 2DQVA 3ILTB 5H8HB 4DCKA 1FBHA 3LR1A 5L8RJ 5I58B 3HD7B 5IAIA 4YB7A 4C46A 1NTZG 3TF5A 1B2HA 1VQOP 1LBYA 1NI9A 3GHGA 1M1JC 1IMAA 1T3JA 1HTLC 1FC2C 2BCCJ 2O69A 1SFCB 3IB1A 3OOAA 3V2NA 2XXYA 2OYHA 5EHSA 1Y47A 1VF5B 1BKAA 1XTCC 4WY4A 3L75J 3AECC 1FE6A 2WQYC 1P1OA 1OLAA 3CC4P 1YYZA 3MVYA 3LUYA 4N91A 1JW5A 1JOCA 3P7KA 2WT7A 3T93B 3TSIA 5KCJB 3B5NB 1QW0A 3ROJA 2RH0A 1EDLA 1I6BA 1Y3NA 4F3GA 3M91A 1A55A 1WODA 2AEJA 2W6AA 4JSOA 1SQPE 3OSQA 1KC8Q 2XXVA 2X7QA 4IL6E 3HSTA 3R4YA 3U1CA 1J1EB 4O7MA 2Z8DA 2Q2CA 1J1DB 1M56D 3HCQA 3V2PA 5KAFE 4GWWA 5I57B 3MGNA 3NFQA 2I1JA 4YPCA 1JNFA 2DP8A 4GF8A 4H8JA 2BASA 2QSIA 5I7IA 1N3WA 4WY4D 3K02A 2ZYKA 4PDDA 2M5AB 2KS1A 3T97B 2VRSA 3CRBA 2KK7A 1NKXA 4LVQA 2UYFA 3AE3C 2BCCD 4GKGA 2F35A 1FOSE 4BDRA 5L8DA 5L9OA 3UA8A 3R6UA 2XX7A 2F6GA 3MHVA 4OXVA 3RK2B 1AQ5A 4FBPA 3O6HA 4RPOA 3PUXE 4OVPA 3HUSA 2M0BA 2XXHA 3IF4A 3BVHA 1PBQA 1ZRTE 3BCCJ 5DTBA 4QBAA 1DEEG 5JK4A 1GGGA 2POHA 2KS1B 3KJ7A 3H1JE 4JQ0D 3V4WA 2RKMA 2E76C 2PFXA 2QSXA 5ET8A 3JCUH 1EDKA 5EQ7A 4U21A 1OW8A 2AEFA 4FATA 3L73E 4GD5A 3L73G 2THIA 3E1RA 3CXHE 3Q5RA 3TCFA 3D4GA 3A3YB 1VQ9P 2IBZI 3U72A 2NPSA 3L70G 1NAYA 3WU2E 1SI1A 2Y7KA 3SEUA 3L72D 3RBXA 2O7UA 3QWOC 2RC8A 1SQQG 1DD4A 4F2OA 3LIDA 2HFED 1PB7A 5APYA 4NF6A 3SKPA 3VMYA 1AVYA 3W9WA 2H4IA 1FS0E 4R6KA 1N7SC 2Q3IA 1M5BA 3MVZA 3SETA 3OXNA 3L36A 1ZMEC 5ICTA 1NTZJ 2I3VA 2QVAA 5K2XA 1L0ND 3A09A 2IZ1A 3PUZE 3CCRP 3ABVC 1N2DC 1SP4A 2H88C 4PJ0H 4W80A 1IUDA 4Q0CA 4ZZAA 2OK2A 2XDJA 2GUSA 3FV2A 1PB9A 4ONYA 3KXDA 3B4SA 1AH5A 1PIXA 1ZXGA 3MP7B 1OZHA 1PPJE 4EUOA 3N6TA 3CCQP 2NPSD 2DE2A 3MD0A 4MEVA 1K05A 5AW9B 4C1UA 2DXYA 4H65A 2WWWA 2A5SA 2D21A 3MW0A 4QHQA 2HODB 3TNUB 4Z7EA 3QXMA 4G61A 5AE4A 3H6PA 3H1ID 1NVOA 3VMXA 3CLQA 4YMBA 1BGYD 2ZJSE 2RINA 4ZEIA 4LLHA 2HQ0A 2E76B 4L74A 4RYAA 2VPOA 1B3EA 5TJHA 3G3JA 3O6QB 4R74A 2P7JA 4NTLA 1Y20A 1YAEA 3DP4A 3ISPA 3OSRA 4U4XA 2WBDA 1O64A 4O94A 5KKZC 2O51A 3MP6A 4I3EA 2DXRA 5I56A 4MJOA 1RE4A 3M06A 1L0LK 3TELA 3WAEA 1JEVA 5H8FB 1FPGA 3JYRA 4RK2A 1UIXA 2HLOA 3ODBA 2YLNA 4GL8A 2GQ1A 1GK4A 5AVRB 3P32A 1LBXA 1LT9C 1BDCA 1L4AD 2XNXA 2Z8FA 1FJKA 1M7LA 4OFJA 3CX5D 1J1NA 2Z8EA 1VFDA 4Y99C 1PFIA 2FHYA 1PPJG 1X8YA 4XA4A 4P56A 1GL2B 1O63A 3KC0A 4PBHA 4I1DA 2F7CA 4AS5A 3PRJA 3HTKA 1RDYA 3DELB 5CC2A 4TLLB 5FTHA 3HE5A 1R6ZA 1N76A 1MXZA 1RKMA 3G3GA 3OENA 4OGQD 1KQLA 1URDA 1SQQK 2V3TA 2YPNA 1RQUA 1VR5A 1H43A 1FPKA 2G29A 3RGUA 2JEEA 2M5AA 4GX3A 3CMEP 2IBZG 4JVCA 4NF5A 4PQJA 3RBZA 2R3SA 2V7QH 1LLSA 5KJ7C 1Z7ME 4GWYA 1BK4A 1FZBA 5H2FH 3HV1A 4RNSA 3UK4A 1KB9H 3MAMA 1FPEA 3A5TA 1NTMK 4BDNA 2Y7WA 2HZLA 2FYNB 4YKIA 2E76D 3HE5B 5AVZB 1L4AA 4ZEFA 4I7ZB 5IZ1A 3I5OA 1D3KA 4PD4D 5H8QB 5ITPA 2LR2A 4HS7A 1G0HA 1B7ZA 4F18A 4N17A 1IO4A 2QRXA 3Q25A 1NUXA 3TTNA 4M3LA 4NF5B 1OXZA 1ANFA 5I59A 5H8NB 2QM8A 3S9MC 4THIA 5KLIB 4OWFA 3SDFA 1FU1A 3IB2A 2HPCB 1SQPJ 4G4PA 1XOCA 5APSA 1LTTC 3F89A 3N4XA 5CCGC 1EH3A 4POXA 3IFAA 4GWXA 1BLFA 1IIWA 3FV1A 2QRYA 3B50A 3V5AA 2WSEH 3TZAA 2ZYMA 3UN6A 3VLWA 5F1QA 1T2KC 1OMPA 3CI8A 3GHGC 2FXMA 2OZZA 2CZLA 3LC8A 4H13C 4UB8E 1B40A 1MFTA 2N9BA 1GTKA 5TP9B 3KBZA 1ZBMA 1U7MA 4GX6A 1US5A 2IPPA 3QK6A 1RE4C 1H88A 3BASA 2W27A 2UYEA 1A02J 1CW5A 2RKLA 3A0BH 2I49A 1EZVE 4C1TA 3KBRA 4U4SA 4NF4A 4DDDA 2JO1A 2XNDH 3BIGA 5ICQA 3BCCE 1LP1B 3CPWO 1J1DC 3VN0A 4NQ8A 1NV0A 1ZJLA 4AYCA 3H4ZA 2ZT9D 1JEUA 1NUYA 2WPVB 4RESB 2F34A 5BUUA 1NH8A 1YTZI 3A29A 1MY2A 3U59A 4IB2A 4IGTA 1VPCA 5I2NA 3HE4A 2IZ0A 1OW6A 3MTUE 1DOTA 2G8YA 2I8DA 2DWAA 3RK3D 2UXAA 3P7IA 3FBPA 4ZEKA 2JP3A 4H0LD 3VVFA 2AL5A 4PFUA 3SERA 2KNCB 2L5VA 1SW5A 1SQYA 1B4HA 1YJWP 2PVUA 2ZVOB 2B9BA 5AVWB 1MH3A 4GOTA 1TXFA 5EQAA 1FDMA 3Q28A 1DX7A 3KZGA 1EYJA 2Q74A
chains in the Genus database with same CATH topology
1MY3A 1B05A 4KFQA 4GODA 1OLCA 3QIMA 2DWIA 1FQBA 3H6WA 1MPDA 1Y3QA 4KYSA 4JB7A 5F7VA 4F19A 4IGRA 3FVNA 2H99A 4GFRA 1R9QA 4XXUA 4MF3A 1LBCA 4U1ZA 2GFEA 4FECA 3C9HA 4BDOA 2CMOA 4U23A 3RPWA 2F5XA 4R2BA 2IA4A 2O1MA 3EQ1A 4EXLA 3SESA 2ESNA 4WEPA 5TPAA 1B52A 1AMFA 3M3FA 4OEVA 2UVJA 3KN8A 1PDAA 5FHNA 4F1UA 3ECRA 1QKAA 2DE3A 1B5JA 3EHTA 3S9NC 1WDNA 4HJGH 5CRYA 3LSLA 2D5WA 2Y7PA 4LZ7A 1LP1A 4C0RA 1SBPA 3GBAA 4F1YA 2VD2A 3PPRA 3K6WA 5CI5A 4PFWA 1Y4CA 4LQ2A 1XVYA 2QS1A 4OFLA 2DVZA 1S9TA 3U1OA 1ELJA 2A5TB 1ZW0A 2DWJA 3K00A 1PBPA 2XXTA 1B1HA 1UIVA 4KYEA 4LQ5A 2V84A 2O7IA 3A3CA 4NEDA 3KSXA 3OO6A 2KZJA 1ZU0A 2SPZA 5AA1A 5A5XB 2GH9A 2PX1A 2R71A 2UVIA 4G8HA 1URGA 2I3WA 4N13A 2F78A 3N6UA 3C31A 1ZIUA 3PH0A 4Q8RA 3IJOB 1ATGA 4O3BA 5CM6A 1JM0A 5TPAB 1S50A 3EHUA 4F1VA 4OHNA 5AA2A 4OYVA 1DTZA 5FHMA 4PP0A 3K1NA 3KSJA 2NOOA 1DPEA 3RGYA 1Y9UA 4HTGA 4FE8A 3OO7A 4KPTA 4RY1A 4XKQA 1UTBB 1IXIA 4MFIA 2H9BA 4ELPA 2I0CA 3O9PA 3ZKLA 4TLMB 2I0BA 4KI0E 3MVWA 1H76A 2AL4A 3IR1A 1BP5A 3FXEA 1OVTA 1FTOA 4QF9A 1LBBA 4LZ8A 1RYXA 3O29A 4ECFA 4AQ4A 3C36A 3T9HB 4U22A 4JXIA 3HN0A 1TFDA 1VE4A 1X0TA 2AIXA 3M8UA 3FUZA 5J1DA 4GOEA 3HO7A 5B70A 1YCJA 5JEIA 5HPQA 2UVHA 1B32A 1FTKA 2KZIA 4JWOA 4NF8B 2PMSA 4EF1A 1B5IA 3K6XA 4M4GA 1LSTA 1PB8A 2XD2A 4P11A 3CVGA 5TP9A 5JTYA 3O6GA 1A8FA 1BTJA 1MQDA 3UP9A 1HSJA 2I48A 4IO7A 3PPQA 1EU8A 3MZWB 2P58A 4I62A 3W9VA 2F7AA 3U93A 3O66A 3N26A 3K0VA 4OEUA 4JBZA 2VD3A 3CFXA 2ALUA 3V8XB 4K3AA 2QPQA 4XKNA 3FGSA 2G93A 3H6TA 1B46A 1QULA 4OQOA 5KDTA 4U1OA 4UACA 1N7XA 1TFAA 4G77A 5L9SA 4NWCA 3CG1A 1SDXA 2XXIA 1QUKA 3G3HA 4GIZA 4DLDA 2UWJE 1ZTYA 2DS9A 2B87A 1B0HA 3VVEA 3TAJA 1U7JA 3CSGA 3RQTA 4R6YA 3VFJA 4QSDA 1AIVA 1OVBA 4R72A 3B6TA 2Z22A 4G68C 1B9JA 4ZMDA 3IJXB 1I6AA 1PEBA 3IORA 3VVDA 3K6VA 5I59B 4GQOA 3T66A 2E1SA 5CMKA 3H6UA 2V25A 4RJZA 4MLVA 3VXBA 5C39A 1OVVA 4XKRA 2KI7B 4XKPA 3H03A 4F29A 5LOMA 2OCUA 3K4UA 3C4MA 4JDFA 1B7UA 3GXAA 3MP8A 2P0SA 1OQGA 1FQFA 3CFLA 1H3DA 1EC5A 2Y7IA 3TCGA 4TOZA 3TUSA 1EZOA 3MVXA 2XX9A 2ONSA 3PGFA 2HCAA 3TKDA 3LSXA 1Q35A 3SEXA 3ONMA 1ZKBA 2NXOA 4G8NA 5CMMA 4G2ZA 1WVJA 4ZS9A 2ZNTA 1NH7A 4IY6A 2Q88A 3K01A 1MM7A 4P0GA 3MJNA 1LAHE 3Q27A 2PYYA 4I9DA 4ESWA 4EXKA 3PU5A 4GL0A 4GOFA 4ELQA 3FATA 2KLFA 4F3BA 1UTBA 4EYYQ 4YZZA 3U94A 2QS4A 5CBOA 3T9UA 1MY1A 3BBRA 3RTWB 5H8QA 4QRZA 2F36A 1CB6A 1MXYA 4BDQA 4Q5TA 2NWJA 1Q1KA 3Q26A 1MY0A 3PPPA 2PBWA 3G7WA 4R6HA 1B5HA 1NNKA 4MH5A 4JWXA 3KEIA 3TQWA 3UORA 4R75A 3T9VA 2R6GE 3E4RA 2B88A 4EQ9A 3EPEA 4WKMA 3UIFA 1IEJA 2FYIA 3FJMA 1L5TA 1OVRA 2QJEA 2B3BA 1T0KA 1QUJA 3E13X 4IO4A 5DEXB 4NWDA 3OEMA 2HFBA 1Q2NA 4M1VA 4NF8A 1P1UA 3AXFA 4HCYA 3OD7A 4GLIA 1CE2A 4WXJA 4BLAA 4ZEDA 1EZ9A 4LP2B 2Q8JA 1MQIA 2Z23A 4WEDA 3C33A 4LA9A 2QS2A 4R2FA 2V3QA 2WKYA 3TPAA 3I3VA 1NL5A 3BFUA 1POTA 1DSNA 3CR9A 1MQJA 1XHYA 3PD8A 4KQPA 3KG2A 4IO5A 1FCKA 2ZNUA 2OBGA 4FIMA 4R9GA 3MZ9A 3K1PA 2Y84A 1QJMA 4POWA 5CBNA 2I58A 4K3FA 1S3JA 3N94A 1XVXA 4F3SA 3GLBA 1P1QA 1UTHA 1S7YA 5ISUA 1FTLA 3KOTA 4ZZEA 5I2NB 5B7DA 1DTGA 3F11A 4OTEA 1JQFA 4AB5A 2XD3A 1B6HA 2B87B 1FW0A 3IB0A 3QAXA 3ZS6A 5H8HA 4ZNCA 3MZBA 4FAJA 1D9YA 3M3KA 4ZE9A 2XXUA 4YB5A 1P1NA 2HEUA 3D4CA 1BIYA 4GXSB 1FQAA 3S1KA 1GV8A 4O3AA 2DOJA 1Y3PA 4FEDA 4O3CA 1FQEA 1FQCA 1YPNA 3ZKKA 1LT1A 3CIJA 1OVUA 2VP1A 4X9TA 3H7MA 3TFLA 1Y4TA 1QVSA 3CSBA 4E0WA 5I56B 2B65A 1LAXA 1JVYA 3MUQA 1NFTA 3I6VA 4RXLA 1IXHA 1H45A 4OERA 1RYOA 4LONB 3VXCA 4R9FA 4HW8A 3SEVA 1OIBA 4KR5A 1MDP1 1SD3A 4YICA 3KGCA 1FTMA 5I58A 4QFOA 4BDLA 2H98A 4DIGA 5AA2B 5HM4B 2B89A 2Q89A 3S9LC 1B3FA 2XXXA 4G8MA 1R1NA 1NNFA 2NUVA 5ELVA 2F6PA 3IO6A 4HCWA 3HHFA 5BWJA 1B3GA 1AOVA 4F31B 4P0IA 2ZNSA 3H6VA 4OZ9A 3OO8A 3MWBA 5DVIA 1JMBA 1M5CA 1A7LA 1B58A 1LFGA 3A3UA 3O28A 3DLNA 2LXCB 5I2KB 4EQ7A 4G68B 3MQ9A 1US4A 3PV0E 1EDIA 3IX1A 3RT8A 1BDDA 4YU0A 2HAUA 3GZGA 3TYHA 1H0TA 4OETA 3SEWA 4YAHX 3T9XB 3FXRA 2ZYNA 1SYHA 3C34A 3TTRA 2PT1A 4Q30B 3UGWA 1GR2A 1AL3A 4NF6B 3O97A 3PMXA 4ZECA 2RF1A 3EF7A 3DM0A 1MQGA 4KCDA 4YB6A 4ASWA 2KIKA 3LSWA 2XHDA 5KZTA 2DSFA 4GWOA 3R7XA 4DXUA 4FEBA 4QFLA 1B51A 1YTVA 5HBCA 3G3FA 4ZEBA 3FVGA 4GRKA 2LXBA 1UTHB 4QFKA 2OJTA 1TWYA 4OVJA 3TTMA 4BDMA 4FORA 4YMAA 2XXWA 3S2VA 2DWHA 3DP8A 2QMWA 2UVGA 1I69A 1QUIA 2OWTA 3RN8A 2QMXA 1FTJA 4NPEA 3MBPA 1IITA 3O2AA 1SW2A 1DPPA 4XIGQ 4ZE8A 3K6UA 1LGBC 4ASVA 1LCTA 2I6EA 1IQ7A 3FVKA 3TODA 5K5GB 3GBBA 3OO9A 5CBRA 1N0TA 3FXQA 1XS5A 2XXPA 4KCCA 2REJA 2F97A 3B6QA 4H5GA 4OWDA 5I84A 3IOWA 3TQLA 3TTLA 4QSEA 4EDPA 1Z7NE 4DCYA 1DMBA 3PUVE 4H0WA 4YKJA 2ZMBA 2VHAA 3C35A 4X1BA 4MBPA 2Q1KA 3K2DA 5L9MA 1P99A 1POY1 3CFZA 3DP6A 1N84A 1SI0A 1VSOA 4OMBA 2O84X 4G68A 1D4NA 4F39A 4OENA 1F9BA 1N04A 3U8QA 1P1WA 3W15C 1B7HA 3FD3A 2KUBA 3RUMA 3R26A 3IOTA 1LFHA 1SW1A 4RK9A 4KD5A 4FJPA 3IOUA 3IOVA 4BXLA 1URSA 4DXCA 2ZAEB 3O6IA 5CMCA 1SW4A 3IO4A 1B3HA 5DT6A 2ZYOA 2A5TA 2F8DA 2FNCA 5I2KA 3L6GA 2HXWA 5KCJA 4X1DA 1B0LA 3EN3A 2DVCA 5FTIA 3TDJA 2Y7RA 3S4UA 5DYHA 1UIUA 2OWSA 3CG3A 1LB8A 1USYE 2R44A 4E0XA 4F2QA 3B7DA 4QSCA 5H8NA 4XTCQ 3ZSFA 4OFOA 2V93A 1USYH 2AYSA 2VOZA 3PPNA 3FXUA 3FJ7A 3RY3A 5DVFA 4TQUQ 2B3FA 4JWYA 5AA4B 1MH4A 3IL1B 5K2YA 3JV9A 3FXDA 2X7PA 4EQBA 3H3GA 3N5LA 3M3LA 2LAOA 3T96B 2O1LA 3E9XA 4DZ1A 2I4CA 1ZLQA 1JETA 4KHZE 4Z0IA 3FIRA 3LBSA 2W7YA 4WWIA 2E0SA 1MDQA 1PC3A 2M8CA 1B1XA 5H8FA 4CPGA 2ONKE 1M5FA 1NNTA 4OESA 4UA8A 1KWHA 4DE8A 1HSEA 4RPNA 1Y1MA 3FJGA 1GVCA 1SVXB 4HKZH 3IK6B 4IO6A 3MP1A 1JW4A 4F3PA 5EFWB 2P1SA 4RA1A 2RC9A 1ZMGA 1R9LA 2P2AA 4DXBA 3VLVA 1N7WA 2QS3A 2Q2AA 3VLUA 2OLBA 2GRVA 3TMGA 1LFIA 1A99A 4AB6A 2RC7A 3MPKA 1B4ZA 4H1XA 4PFTA 2FA7A 2RCBA 1MY4A 3Q29A 3HHGA 1EDJA 1MXUA 2H5YA 4YKPA 3MZ1A 3QSLA 4LZ5A 5EYFA 5TU0A 3QUFA 4IO2A 3PPOA 2NVUB 4EF2A 1MG1A 3TEPA 4NF4B 3EHSA 2GHAA 4QFPA 3RNNA 4X48A 1MXXA 4ZDMA 3WAFA 4R73A 2Q9TA 3QUJA 2RCAA 3OMBA 2OTKE 1XT8A 4L17A 2GHBA 3RT6B 1MM6A 5I57A 4NMYA 4IY5A 2XXRA 1JW1A 5DJUB 1LCFA 3V83A 3THIA 5CMBA 3MPLA 1D9VA 1II5A 2DYXA 1N3XA 4K35A 3MC2A 1LAFE 2VGQA 2F7BA 5ITOA 5AA2D 1TT1A 1SS1A 4ELRA 4H8IA 1MS7A 1IXCA 1MXWA 3PUWE 1Y1ZA 3K1MA 4IO3A 3PUYE 2D3IA 5M2VA 2I4BA 2X26A 1NNPA 5DJTB 1MPCA 3VDFA 3FZVA 2O68A 1B3LA 2WMMA 2R9JA 1H0TB 2QL3A 1UQWA 1HSLA 4LUBA 4DCXA 1LB9A 3BKIB 1IZ1A 5A5XA 3KFMA 5DEXA 4NPDA 4H5FA 4I8CA 2HZKA 3E3KA 3G3KA 4F22A 4LATA 1VFEA 4ND9A 3ZDMA 1XC1A 5H8SA 1FQDA 3L6HA 3V89B 2ZXTA 2ONRA 3KN3A 2YJPA 3USDA 4MN4C 1QKBA 1O7TA 4GVOA 3H06B 4ESXA 4YKKA 1MXVA 4KYDA 4H6DA 5JTYB 3B6WA 4MLQA 3U92A 3PMWA 1MRPA 3VV5A 4PE5B 3BFTA 3TTKA 1SYIA 3PD9A 2O6AA 5FHOA 3OELA 3C32A 2HR3A 3VE1B 2V3UA 1LAGE 1JVXA 2BJJX 4KJMA 2HAVA 1A54A 2JWDA 4NPFX 3T22A 1MQHA 4HB1A 3JZJA 1M5EA 4QFNA 2XX8A 3RLFE 3ILUB 3OEKA 1NMUA 4JSDA 4GXAA 1MPBA 4PETA 1A40A 2REGA 5IKBA 3FASA 4ISUA 1EZPA 4NE4A 2PT2A 5DVJA 2ABHA 3RTFB 4N6PA 3KN7A 4U2RA 3HPIA 2ANJA 4N07A 5CBSA 3KJTA 3S9EA 2XXQA 2DE4A 4H67A 2H25A 1H44A 3SEYA 4IOIH 3TCHA 2K3RA 1OQHA 2IEEA 4ELOA 1IXGA 3QYTA 5KDTB 3FVOA 1M5DA 1I6QA 3IAZA 5AA3A 4PFYA 3LSFB 5EHMA 1A8EA 3PMVA 3G3IA 3KOSA 5AA4A 2DQVA 3ILTB 5H8HB 3LR1A 5I58B 5IAIA 4YB7A 1B2HA 2O69A 1FC2C 3OOAA 3IB1A 5EHSA 2XXYA 1Y47A 1BKAA 1P1OA 1OLAA 3MVYA 3LUYA 1JW5A 3T93B 5KCJB 1QW0A 1EDLA 1I6BA 1Y3NA 4F3GA 1A55A 1WODA 4JSOA 3OSQA 2XXVA 2X7QA 3HSTA 2Z8DA 2Q2CA 3HCQA 5I57B 1JNFA 2DP8A 4GF8A 4H8JA 1N3WA 3K02A 2ZYKA 2M5AB 3CRBA 1NKXA 4LVQA 2UYFA 2F35A 4BDRA 5L8DA 5L9OA 3UA8A 3R6UA 2XX7A 2F6GA 3MHVA 4OXVA 3O6HA 4RPOA 3PUXE 2M0BA 2XXHA 1PBQA 5DTBA 5JK4A 1DEEG 1GGGA 2KS1B 3KJ7A 2RKMA 2QSXA 1EDKA 4U21A 4FATA 4GD5A 2THIA 3TCFA 3D4GA 3U72A 1SI1A 2Y7KA 3SEUA 2O7UA 3QWOC 2RC8A 4F2OA 1PB7A 4NF6A 3SKPA 3W9WA 2H4IA 4R6KA 3MVZA 1M5BA 3SETA 3OXNA 5ICTA 2I3VA 2QVAA 5K2XA 3A09A 3PUZE 1IUDA 4Q0CA 4ZZAA 2OK2A 3FV2A 1PB9A 4ONYA 1AH5A 1ZXGA 4EUOA 3N6TA 2DE2A 4C1UA 2DXYA 4H65A 2A5SA 2D21A 3MW0A 4QHQA 4Z7EA 3QXMA 5AE4A 1NVOA 4YMBA 2RINA 4ZEIA 2HQ0A 4RYAA 1B3EA 3G3JA 4R74A 4NTLA 1Y20A 1YAEA 3DP4A 3OSRA 4U4XA 1O64A 2O51A 3MP6A 2DXRA 5I56A 3WAEA 3TELA 1JEVA 5H8FB 3JYRA 4RK2A 3ODBA 2YLNA 4GL8A 1BDCA 2Z8FA 4OFJA 1J1NA 2Z8EA 1VFDA 1O63A 4I1DA 2F7CA 3DELB 5CC2A 4TLLB 5FTHA 1R6ZA 1N76A 1MXZA 1RKMA 3G3GA 3OENA 1URDA 2V3TA 2YPNA 1VR5A 2G29A 1H43A 3RGUA 2M5AA 4PQJA 4NF5A 1LLSA 1Z7ME 3HV1A 4RNSA 3UK4A 3MAMA 4BDNA 2Y7WA 2HZLA 4YKIA 4ZEFA 3I5OA 1D3KA 5H8QB 5ITPA 2LR2A 4HS7A 1B7ZA 4F18A 3Q25A 2QRXA 3TTNA 4NF5B 1ANFA 5I59A 5H8NB 3S9MC 4THIA 3SDFA 3IB2A 4G4PA 1XOCA 1EH3A 4POXA 1BLFA 1IIWA 3FV1A 2QRYA 3V5AA 3TZAA 3VLWA 3UN6A 2ZYMA 5F1QA 1OMPA 3CI8A 2OZZA 2CZLA 3LC8A 1B40A 1MFTA 1GTKA 5TP9B 1ZBMA 1U7MA 1US5A 3QK6A 2UYEA 2RKLA 2I49A 4C1TA 3KBRA 4U4SA 4NF4A 4DDDA 5ICQA 1LP1B 1ZJLA 3H4ZA 1JEUA 2F34A 5BUUA 1NH8A 1MY2A 4IB2A 4IGTA 5I2NA 1DOTA 2I8DA 2DWAA 3P7IA 2UXAA 4ZEKA 3VVFA 2AL5A 4PFUA 3SERA 1SW5A 1SQYA 1B4HA 2PVUA 4GOTA 1MH3A 1TXFA 3Q28A 3KZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MY3 A;  1B05 A;  4KFQ A;  4GOD A;  1OLC A;  3QIM A;  2DWI A;  1FQB A;  3H6W A;  1MPD A;  1Y3Q A;  4KYS A;  4JB7 A;  5F7V A;  4F19 A;  4IGR A;  3FVN A;  2H99 A;  4GFR A;  1R9Q A;  4XXU A;  4MF3 A;  1LBC A;  4U1Z A;  2GFE A;  4FEC A;  3C9H A;  4BDO A;  2CMO A;  4U23 A;  3RPW A;  2F5X A;  4R2B A;  2IA4 A;  2O1M A;  3EQ1 A;  4EXL A;  3SES A;  2ESN A;  4WEP A;  5TPA A;  1B52 A;  1AMF A;  3M3F A;  4OEV A;  2UVJ A;  3KN8 A;  1PDA A;  5FHN A;  4F1U A;  3ECR A;  1QKA A;  2DE3 A;  1B5J A;  3EHT A;  3S9N C;  1WDN A;  4HJG H;  5CRY A;  3LSL A;  2D5W A;  2Y7P A;  4LZ7 A;  1LP1 A;  4C0R A;  1SBP A;  3GBA A;  4F1Y A;  2VD2 A;  3PPR A;  3K6W A;  5CI5 A;  4PFW A;  1Y4C A;  4LQ2 A;  1XVY A;  2QS1 A;  4OFL A;  2DVZ A;  1S9T A;  3U1O A;  1ELJ A;  2A5T B;  1ZW0 A;  2DWJ A;  3K00 A;  1PBP A;  2XXT A;  1B1H A;  1UIV A;  4KYE A;  4LQ5 A;  2V84 A;  2O7I A;  3A3C A;  4NED A;  3KSX A;  3OO6 A;  2KZJ A;  1ZU0 A;  2SPZ A;  5AA1 A;  5A5X B;  2GH9 A;  2PX1 A;  2R71 A;  2UVI A;  4G8H A;  1URG A;  2I3W A;  4N13 A;  2F78 A;  3N6U A;  3C31 A;  1ZIU A;  3PH0 A;  4Q8R A;  3IJO B;  1ATG A;  4O3B A;  5CM6 A;  1JM0 A;  5TPA B;  1S50 A;  3EHU A;  4F1V A;  4OHN A;  5AA2 A;  4OYV A;  1DTZ A;  5FHM A;  4PP0 A;  3K1N A;  3KSJ A;  2NOO A;  1DPE A;  3RGY A;  1Y9U A;  4HTG A;  4FE8 A;  3OO7 A;  4KPT A;  4RY1 A;  4XKQ A;  1UTB B;  1IXI A;  4MFI A;  2H9B A;  4ELP A;  2I0C A;  3O9P A;  3ZKL A;  4TLM B;  2I0B A;  4KI0 E;  3MVW A;  1H76 A;  2AL4 A;  3IR1 A;  1BP5 A;  3FXE A;  1OVT A;  1FTO A;  4QF9 A;  1LBB A;  4LZ8 A;  1RYX A;  3O29 A;  4ECF A;  4AQ4 A;  3C36 A;  3T9H B;  4U22 A;  4JXI A;  3HN0 A;  1TFD A;  1VE4 A;  1X0T A;  2AIX A;  3M8U A;  3FUZ A;  5J1D A;  4GOE A;  3HO7 A;  5B70 A;  1YCJ A;  5JEI A;  5HPQ A;  2UVH A;  1B32 A;  1FTK A;  2KZI A;  4JWO A;  4NF8 B;  2PMS A;  4EF1 A;  1B5I A;  3K6X A;  4M4G A;  1LST A;  1PB8 A;  2XD2 A;  4P11 A;  3CVG A;  5TP9 A;  5JTY A;  3O6G A;  1A8F A;  1BTJ A;  1MQD A;  3UP9 A;  1HSJ A;  2I48 A;  4IO7 A;  3PPQ A;  1EU8 A;  3MZW B;  2P58 A;  4I62 A;  3W9V A;  2F7A A;  3U93 A;  3O66 A;  3N26 A;  3K0V A;  4OEU A;  4JBZ A;  2VD3 A;  3CFX A;  2ALU A;  3V8X B;  4K3A A;  2QPQ A;  4XKN A;  3FGS A;  2G93 A;  3H6T A;  1B46 A;  1QUL A;  4OQO A;  5KDT A;  4U1O A;  4UAC A;  1N7X A;  1TFA A;  4G77 A;  5L9S A;  4NWC A;  3CG1 A;  1SDX A;  2XXI A;  1QUK A;  3G3H A;  4GIZ A;  4DLD A;  2UWJ E;  1ZTY A;  2DS9 A;  2B87 A;  1B0H A;  3VVE A;  3TAJ A;  1U7J A;  3CSG A;  3RQT A;  4R6Y A;  3VFJ A;  4QSD A;  1AIV A;  1OVB A;  4R72 A;  3B6T A;  2Z22 A;  4G68 C;  1B9J A;  4ZMD A;  3IJX B;  1I6A A;  1PEB A;  3IOR A;  3VVD A;  3K6V A;  5I59 B;  4GQO A;  3T66 A;  2E1S A;  5CMK A;  3H6U A;  2V25 A;  4RJZ A;  4MLV A;  3VXB A;  5C39 A;  1OVV A;  4XKR A;  2KI7 B;  4XKP A;  3H03 A;  4F29 A;  5LOM A;  2OCU A;  3K4U A;  3C4M A;  4JDF A;  1B7U A;  3GXA A;  3MP8 A;  2P0S A;  1OQG A;  1FQF A;  3CFL A;  1H3D A;  1EC5 A;  2Y7I A;  3TCG A;  4TOZ A;  3TUS A;  1EZO A;  3MVX A;  2XX9 A;  2ONS A;  3PGF A;  2HCA A;  3TKD A;  3LSX A;  1Q35 A;  3SEX A;  3ONM A;  1ZKB A;  2NXO A;  4G8N A;  5CMM A;  4G2Z A;  1WVJ A;  4ZS9 A;  2ZNT A;  1NH7 A;  4IY6 A;  2Q88 A;  3K01 A;  1MM7 A;  4P0G A;  3MJN A;  1LAH E;  3Q27 A;  2PYY A;  4I9D A;  4ESW A;  4EXK A;  3PU5 A;  4GL0 A;  4GOF A;  4ELQ A;  3FAT A;  2KLF A;  4F3B A;  1UTB A;  4EYY Q;  4YZZ A;  3U94 A;  2QS4 A;  5CBO A;  3T9U A;  1MY1 A;  3BBR A;  3RTW B;  5H8Q A;  4QRZ A;  2F36 A;  1CB6 A;  1MXY A;  4BDQ A;  4Q5T A;  2NWJ A;  1Q1K A;  3Q26 A;  1MY0 A;  3PPP A;  2PBW A;  3G7W A;  4R6H A;  1B5H A;  1NNK A;  4MH5 A;  4JWX A;  3KEI A;  3TQW A;  3UOR A;  4R75 A;  3T9V A;  2R6G E;  3E4R A;  2B88 A;  4EQ9 A;  3EPE A;  4WKM A;  3UIF A;  1IEJ A;  2FYI A;  3FJM A;  1L5T A;  1OVR A;  2QJE A;  2B3B A;  1T0K A;  1QUJ A;  3E13 X;  4IO4 A;  5DEX B;  4NWD A;  3OEM A;  2HFB A;  1Q2N A;  4M1V A;  4NF8 A;  1P1U A;  3AXF A;  4HCY A;  3OD7 A;  4GLI A;  1CE2 A;  4WXJ A;  4BLA A;  4ZED A;  1EZ9 A;  4LP2 B;  2Q8J A;  1MQI A;  2Z23 A;  4WED A;  3C33 A;  4LA9 A;  2QS2 A;  4R2F A;  2V3Q A;  2WKY A;  3TPA A;  3I3V A;  1NL5 A;  3BFU A;  1POT A;  1DSN A;  3CR9 A;  1MQJ A;  1XHY A;  3PD8 A;  4KQP A;  3KG2 A;  4IO5 A;  1FCK A;  2ZNU A;  2OBG A;  4FIM A;  4R9G A;  3MZ9 A;  3K1P A;  2Y84 A;  1QJM A;  4POW A;  5CBN A;  2I58 A;  4K3F A;  1S3J A;  3N94 A;  1XVX A;  4F3S A;  3GLB A;  1P1Q A;  1UTH A;  1S7Y A;  5ISU A;  1FTL A;  3KOT A;  4ZZE A;  5I2N B;  5B7D A;  1DTG A;  3F11 A;  4OTE A;  1JQF A;  4AB5 A;  2XD3 A;  1B6H A;  2B87 B;  1FW0 A;  3IB0 A;  3QAX A;  3ZS6 A;  5H8H A;  4ZNC A;  3MZB A;  4FAJ A;  1D9Y A;  3M3K A;  4ZE9 A;  2XXU A;  4YB5 A;  1P1N A;  2HEU A;  3D4C A;  1BIY A;  4GXS B;  1FQA A;  3S1K A;  1GV8 A;  4O3A A;  2DOJ A;  1Y3P A;  4FED A;  4O3C A;  1FQE A;  1FQC A;  1YPN A;  3ZKK A;  1LT1 A;  3CIJ A;  1OVU A;  2VP1 A;  4X9T A;  3H7M A;  3TFL A;  1Y4T A;  1QVS A;  3CSB A;  4E0W A;  5I56 B;  2B65 A;  1LAX A;  1JVY A;  3MUQ A;  1NFT A;  3I6V A;  4RXL A;  1IXH A;  1H45 A;  4OER A;  1RYO A;  4LON B;  3VXC A;  4R9F A;  4HW8 A;  3SEV A;  1OIB A;  4KR5 A;  1MDP 1;  1SD3 A;  4YIC A;  3KGC A;  1FTM A;  5I58 A;  4QFO A;  4BDL A;  2H98 A;  4DIG A;  5AA2 B;  5HM4 B;  2B89 A;  2Q89 A;  3S9L C;  1B3F A;  2XXX A;  4G8M A;  1R1N A;  1NNF A;  2NUV A;  5ELV A;  2F6P A;  3IO6 A;  4HCW A;  3HHF A;  5BWJ A;  1B3G A;  1AOV A;  4F31 B;  4P0I A;  2ZNS A;  3H6V A;  4OZ9 A;  3OO8 A;  3MWB A;  5DVI A;  1JMB A;  1M5C A;  1A7L A;  1B58 A;  1LFG A;  3A3U A;  3O28 A;  3DLN A;  2LXC B;  5I2K B;  4EQ7 A;  4G68 B;  3MQ9 A;  1US4 A;  3PV0 E;  1EDI A;  3IX1 A;  3RT8 A;  1BDD A;  4YU0 A;  2HAU A;  3GZG A;  3TYH A;  1H0T A;  4OET A;  3SEW A;  4YAH X;  3T9X B;  3FXR A;  2ZYN A;  1SYH A;  3C34 A;  3TTR A;  2PT1 A;  4Q30 B;  3UGW A;  1GR2 A;  1AL3 A;  4NF6 B;  3O97 A;  3PMX A;  4ZEC A;  2RF1 A;  3EF7 A;  3DM0 A;  1MQG A;  4KCD A;  4YB6 A;  4ASW A;  2KIK A;  3LSW A;  2XHD A;  5KZT A;  2DSF A;  4GWO A;  3R7X A;  4DXU A;  4FEB A;  4QFL A;  1B51 A;  1YTV A;  5HBC A;  3G3F A;  4ZEB A;  3FVG A;  4GRK A;  2LXB A;  1UTH B;  4QFK A;  2OJT A;  1TWY A;  4OVJ A;  3TTM A;  4BDM A;  4FOR A;  4YMA A;  2XXW A;  3S2V A;  2DWH A;  3DP8 A;  2QMW A;  2UVG A;  1I69 A;  1QUI A;  2OWT A;  3RN8 A;  2QMX A;  1FTJ A;  4NPE A;  3MBP A;  1IIT A;  3O2A A;  1SW2 A;  1DPP A;  4XIG Q;  4ZE8 A;  3K6U A;  1LGB C;  4ASV A;  1LCT A;  2I6E A;  1IQ7 A;  3FVK A;  3TOD A;  5K5G B;  3GBB A;  3OO9 A;  5CBR A;  1N0T A;  3FXQ A;  1XS5 A;  2XXP A;  4KCC A;  2REJ A;  2F97 A;  3B6Q A;  4H5G A;  4OWD A;  5I84 A;  3IOW A;  3TQL A;  3TTL A;  4QSE A;  4EDP A;  1Z7N E;  4DCY A;  1DMB A;  3PUV E;  4H0W A;  4YKJ A;  2ZMB A;  2VHA A;  3C35 A;  4X1B A;  4MBP A;  2Q1K A;  3K2D A;  5L9M A;  1P99 A;  1POY 1;  3CFZ A;  3DP6 A;  1N84 A;  1SI0 A;  1VSO A;  4OMB A;  2O84 X;  4G68 A;  1D4N A;  4F39 A;  4OEN A;  1F9B A;  1N04 A;  3U8Q A;  1P1W A;  3W15 C;  1B7H A;  3FD3 A;  2KUB A;  3RUM A;  3R26 A;  3IOT A;  1LFH A;  1SW1 A;  4RK9 A;  4KD5 A;  4FJP A;  3IOU A;  3IOV A;  4BXL A;  1URS A;  4DXC A;  2ZAE B;  3O6I A;  5CMC A;  1SW4 A;  3IO4 A;  1B3H A;  5DT6 A;  2ZYO A;  2A5T A;  2F8D A;  2FNC A;  5I2K A;  3L6G A;  2HXW A;  5KCJ A;  4X1D A;  1B0L A;  3EN3 A;  2DVC A;  5FTI A;  3TDJ A;  2Y7R A;  3S4U A;  5DYH A;  1UIU A;  2OWS A;  3CG3 A;  1LB8 A;  1USY E;  2R44 A;  4E0X A;  4F2Q A;  3B7D A;  4QSC A;  5H8N A;  4XTC Q;  3ZSF A;  4OFO A;  2V93 A;  1USY H;  2AYS A;  2VOZ A;  3PPN A;  3FXU A;  3FJ7 A;  3RY3 A;  5DVF A;  4TQU Q;  2B3F A;  4JWY A;  5AA4 B;  1MH4 A;  3IL1 B;  5K2Y A;  3JV9 A;  3FXD A;  2X7P A;  4EQB A;  3H3G A;  3N5L A;  3M3L A;  2LAO A;  3T96 B;  2O1L A;  3E9X A;  4DZ1 A;  2I4C A;  1ZLQ A;  1JET A;  4KHZ E;  4Z0I A;  3FIR A;  3LBS A;  2W7Y A;  4WWI A;  2E0S A;  1MDQ A;  1PC3 A;  2M8C A;  1B1X A;  5H8F A;  4CPG A;  2ONK E;  1M5F A;  1NNT A;  4OES A;  4UA8 A;  1KWH A;  4DE8 A;  1HSE A;  4RPN A;  1Y1M A;  3FJG A;  1GVC A;  1SVX B;  4HKZ H;  3IK6 B;  4IO6 A;  3MP1 A;  1JW4 A;  4F3P A;  5EFW B;  2P1S A;  4RA1 A;  2RC9 A;  1ZMG A;  1R9L A;  2P2A A;  4DXB A;  3VLV A;  1N7W A;  2QS3 A;  2Q2A A;  3VLU A;  2OLB A;  2GRV A;  3TMG A;  1LFI A;  1A99 A;  4AB6 A;  2RC7 A;  3MPK A;  1B4Z A;  4H1X A;  4PFT A;  2FA7 A;  2RCB A;  1MY4 A;  3Q29 A;  3HHG A;  1EDJ A;  1MXU A;  2H5Y A;  4YKP A;  3MZ1 A;  3QSL A;  4LZ5 A;  5EYF A;  5TU0 A;  3QUF A;  4IO2 A;  3PPO A;  2NVU B;  4EF2 A;  1MG1 A;  3TEP A;  4NF4 B;  3EHS A;  2GHA A;  4QFP A;  3RNN A;  4X48 A;  1MXX A;  4ZDM A;  3WAF A;  4R73 A;  2Q9T A;  3QUJ A;  2RCA A;  3OMB A;  2OTK E;  1XT8 A;  4L17 A;  2GHB A;  3RT6 B;  1MM6 A;  5I57 A;  4NMY A;  4IY5 A;  2XXR A;  1JW1 A;  5DJU B;  1LCF A;  3V83 A;  3THI A;  5CMB A;  3MPL A;  1D9V A;  1II5 A;  2DYX A;  1N3X A;  4K35 A;  3MC2 A;  1LAF E;  2VGQ A;  2F7B A;  5ITO A;  5AA2 D;  1TT1 A;  1SS1 A;  4ELR A;  4H8I A;  1MS7 A;  1IXC A;  1MXW A;  3PUW E;  1Y1Z A;  3K1M A;  4IO3 A;  3PUY E;  2D3I A;  5M2V A;  2I4B A;  2X26 A;  1NNP A;  5DJT B;  1MPC A;  3VDF A;  3FZV A;  2O68 A;  1B3L A;  2WMM A;  2R9J A;  1H0T B;  2QL3 A;  1UQW A;  1HSL A;  4LUB A;  4DCX A;  1LB9 A;  3BKI B;  1IZ1 A;  5A5X A;  3KFM A;  5DEX A;  4NPD A;  4H5F A;  4I8C A;  2HZK A;  3E3K A;  3G3K A;  4F22 A;  4LAT A;  1VFE A;  4ND9 A;  3ZDM A;  1XC1 A;  5H8S A;  1FQD A;  3L6H A;  3V89 B;  2ZXT A;  2ONR A;  3KN3 A;  2YJP A;  3USD A;  4MN4 C;  1QKB A;  1O7T A;  4GVO A;  3H06 B;  4ESX A;  4YKK A;  1MXV A;  4KYD A;  4H6D A;  5JTY B;  3B6W A;  4MLQ A;  3U92 A;  3PMW A;  1MRP A;  3VV5 A;  4PE5 B;  3BFT A;  3TTK A;  1SYI A;  3PD9 A;  2O6A A;  5FHO A;  3OEL A;  3C32 A;  2HR3 A;  3VE1 B;  2V3U A;  1LAG E;  1JVX A;  2BJJ X;  4KJM A;  2HAV A;  1A54 A;  2JWD A;  4NPF X;  3T22 A;  1MQH A;  4HB1 A;  3JZJ A;  1M5E A;  4QFN A;  2XX8 A;  3RLF E;  3ILU B;  3OEK A;  1NMU A;  4JSD A;  4GXA A;  1MPB A;  4PET A;  1A40 A;  2REG A;  5IKB A;  3FAS A;  4ISU A;  1EZP A;  4NE4 A;  2PT2 A;  5DVJ A;  2ABH A;  3RTF B;  4N6P A;  3KN7 A;  4U2R A;  3HPI A;  2ANJ A;  4N07 A;  5CBS A;  3KJT A;  3S9E A;  2XXQ A;  2DE4 A;  4H67 A;  2H25 A;  1H44 A;  3SEY A;  4IOI H;  3TCH A;  2K3R A;  1OQH A;  2IEE A;  4ELO A;  1IXG A;  3QYT A;  5KDT B;  3FVO A;  1M5D A;  1I6Q A;  3IAZ A;  5AA3 A;  4PFY A;  3LSF B;  5EHM A;  1A8E A;  3PMV A;  3G3I A;  3KOS A;  5AA4 A;  2DQV A;  3ILT B;  5H8H B;  3LR1 A;  5I58 B;  5IAI A;  4YB7 A;  1B2H A;  2O69 A;  1FC2 C;  3OOA A;  3IB1 A;  5EHS A;  2XXY A;  1Y47 A;  1BKA A;  1P1O A;  1OLA A;  3MVY A;  3LUY A;  1JW5 A;  3T93 B;  5KCJ B;  1QW0 A;  1EDL A;  1I6B A;  1Y3N A;  4F3G A;  1A55 A;  1WOD A;  4JSO A;  3OSQ A;  2XXV A;  2X7Q A;  3HST A;  2Z8D A;  2Q2C A;  3HCQ A;  5I57 B;  1JNF A;  2DP8 A;  4GF8 A;  4H8J A;  1N3W A;  3K02 A;  2ZYK A;  2M5A B;  3CRB A;  1NKX A;  4LVQ A;  2UYF A;  2F35 A;  4BDR A;  5L8D A;  5L9O A;  3UA8 A;  3R6U A;  2XX7 A;  2F6G A;  3MHV A;  4OXV A;  3O6H A;  4RPO A;  3PUX E;  2M0B A;  2XXH A;  1PBQ A;  5DTB A;  5JK4 A;  1DEE G;  1GGG A;  2KS1 B;  3KJ7 A;  2RKM A;  2QSX A;  1EDK A;  4U21 A;  4FAT A;  4GD5 A;  2THI A;  3TCF A;  3D4G A;  3U72 A;  1SI1 A;  2Y7K A;  3SEU A;  2O7U A;  3QWO C;  2RC8 A;  4F2O A;  1PB7 A;  4NF6 A;  3SKP A;  3W9W A;  2H4I A;  4R6K A;  3MVZ A;  1M5B A;  3SET A;  3OXN A;  5ICT A;  2I3V A;  2QVA A;  5K2X A;  3A09 A;  3PUZ E;  1IUD A;  4Q0C A;  4ZZA A;  2OK2 A;  3FV2 A;  1PB9 A;  4ONY A;  1AH5 A;  1ZXG A;  4EUO A;  3N6T A;  2DE2 A;  4C1U A;  2DXY A;  4H65 A;  2A5S A;  2D21 A;  3MW0 A;  4QHQ A;  4Z7E A;  3QXM A;  5AE4 A;  1NVO A;  4YMB A;  2RIN A;  4ZEI A;  2HQ0 A;  4RYA A;  1B3E A;  3G3J A;  4R74 A;  4NTL A;  1Y20 A;  1YAE A;  3DP4 A;  3OSR A;  4U4X A;  1O64 A;  2O51 A;  3MP6 A;  2DXR A;  5I56 A;  3WAE A;  3TEL A;  1JEV A;  5H8F B;  3JYR A;  4RK2 A;  3ODB A;  2YLN A;  4GL8 A;  1BDC A;  2Z8F A;  4OFJ A;  1J1N A;  2Z8E A;  1VFD A;  1O63 A;  4I1D A;  2F7C A;  3DEL B;  5CC2 A;  4TLL B;  5FTH A;  1R6Z A;  1N76 A;  1MXZ A;  1RKM A;  3G3G A;  3OEN A;  1URD A;  2V3T A;  2YPN A;  1VR5 A;  2G29 A;  1H43 A;  3RGU A;  2M5A A;  4PQJ A;  4NF5 A;  1LLS A;  1Z7M E;  3HV1 A;  4RNS A;  3UK4 A;  3MAM A;  4BDN A;  2Y7W A;  2HZL A;  4YKI A;  4ZEF A;  3I5O A;  1D3K A;  5H8Q B;  5ITP A;  2LR2 A;  4HS7 A;  1B7Z A;  4F18 A;  3Q25 A;  2QRX A;  3TTN A;  4NF5 B;  1ANF A;  5I59 A;  5H8N B;  3S9M C;  4THI A;  3SDF A;  3IB2 A;  4G4P A;  1XOC A;  1EH3 A;  4POX A;  1BLF A;  1IIW A;  3FV1 A;  2QRY A;  3V5A A;  3TZA A;  3VLW A;  3UN6 A;  2ZYM A;  5F1Q A;  1OMP A;  3CI8 A;  2OZZ A;  2CZL A;  3LC8 A;  1B40 A;  1MFT A;  1GTK A;  5TP9 B;  1ZBM A;  1U7M A;  1US5 A;  3QK6 A;  2UYE A;  2RKL A;  2I49 A;  4C1T A;  3KBR A;  4U4S A;  4NF4 A;  4DDD A;  5ICQ A;  1LP1 B;  1ZJL A;  3H4Z A;  1JEU A;  2F34 A;  5BUU A;  1NH8 A;  1MY2 A;  4IB2 A;  4IGT A;  5I2N A;  1DOT A;  2I8D A;  2DWA A;  3P7I A;  2UXA A;  4ZEK A;  3VVF A;  2AL5 A;  4PFU A;  3SER A;  1SW5 A;  1SQY A;  1B4H A;  2PVU A;  4GOT A;  1MH3 A;  1TXF A;  3Q28 A;  3KZG A; 
#chains in the Genus database with same CATH topology
 1MY3 A;  1T8Z A;  3SWY A;  1B05 A;  4KFQ A;  1M1J B;  4GOD A;  1OLC A;  4PV1 B;  3KZI H;  4L73 A;  3H32 A;  3QH9 A;  3QIM A;  2DWI A;  1FQB A;  3H6W A;  1MPD A;  1Y3Q A;  1HGV A;  2FY8 A;  4HE0 A;  4KYS A;  4JB7 A;  5F7V A;  1LTS C;  3TDK A;  3NOH A;  1JY2 O;  2V4H A;  1YIJ P;  4IGR A;  4F19 A;  3FVN A;  2H99 A;  4GFR A;  2WSF H;  1R9Q A;  2JJL A;  3W67 A;  4XXU A;  5GTH H;  4MF3 A;  4N78 D;  2HPC A;  1LBC A;  4D6T E;  1CZQ A;  1LTJ B;  4U1Z A;  3C9I A;  2GFE A;  4FEC A;  3C9H A;  4N8Y A;  4BDO A;  2CMO A;  1MFZ A;  4U23 A;  2JDI H;  2JJK A;  3RPW A;  5AVT B;  2F5X A;  4R2B A;  3CCM P;  1PGO A;  4JVD A;  2IA4 A;  2KSJ A;  3L70 E;  3SWF A;  3HD7 A;  1BCC J;  4GIF A;  2O1M A;  3K5B A;  4GT1 A;  1NU1 K;  5KKZ B;  1IME A;  1IK9 A;  3EQ1 A;  4GBV A;  4GWU A;  3SES A;  2ESN A;  4EXL A;  2HXR A;  1KYO H;  1NV5 A;  4WEP A;  1FZF A;  1N7S D;  5TPA A;  3RL0 D;  2BCC E;  2QEX P;  1B52 A;  1AMF A;  1SQP K;  3M3F A;  2UVJ A;  3KN8 A;  4OEV A;  1PDA A;  2JR8 A;  5FHN A;  4F1U A;  4HXV A;  3ECR A;  1QKA A;  2DE3 A;  1B5J A;  3EHT A;  3S9N C;  1HF9 A;  1WDN A;  4HJG H;  4PGN A;  3LSL A;  5CRY A;  5IZZ A;  2D5W A;  2Y7P A;  4KT0 J;  4LZ7 A;  2K9J B;  4BRY B;  1LP1 A;  4C0R A;  1SBP A;  3GBA A;  3RYD A;  4F1Y A;  5AW1 B;  1SLQ A;  2VD2 A;  2JKV A;  2H7H A;  2P3V A;  3PPR A;  3K6W A;  5CI5 A;  2CPB A;  4PFW A;  1Y4C A;  4LQ2 A;  1MKM A;  5AW8 B;  3L74 J;  1XVY A;  2QS1 A;  4OFL A;  5I3S A;  2DVZ A;  1S9T A;  3U1O A;  3HTK B;  1SQB G;  1ELJ A;  4OVS A;  2A5T B;  1ZW0 A;  3H1K D;  2DWJ A;  4DJG A;  3K00 A;  1PBP A;  3AE9 C;  1NV1 A;  3RPL B;  2XXT A;  1B1H A;  1UIV A;  3PP5 A;  4KYE A;  1BGY E;  4LQ5 A;  1VQN P;  3CXH H;  1FBM A;  4PV1 C;  2V84 A;  1M8O B;  2CZI A;  2KSE A;  2O7I A;  3A3C A;  4NED A;  3KSX A;  1RF1 B;  3OO6 A;  2KZJ A;  1QL1 A;  2SPZ A;  1ZU0 A;  2AXT E;  5AA1 A;  5A5X B;  3WUU A;  2GH9 A;  3OW2 O;  2PX1 A;  2R71 A;  2UVI A;  4G8H A;  2WZ7 A;  1SQV J;  3GF3 A;  1NTZ K;  1FPD A;  1URG A;  2I3W A;  4N13 A;  2F78 A;  5APX A;  3N6U A;  3C31 A;  1KIL B;  1ZIU A;  1FZC A;  3PH0 A;  4ELQ A;  2Y9Y A;  4Q8R A;  2Q8M A;  3IJO B;  2MKV A;  1ATG A;  3HD7 C;  4O3B A;  2W8Z A;  5CM6 A;  1JM0 A;  2ZFC A;  5TPA B;  1IJD B;  2GA1 A;  1HWT C;  1S50 A;  1N7L A;  3EHU A;  4F1V A;  5ET5 A;  4OHN A;  2XV5 A;  5AA2 A;  1QEX A;  1NOH A;  1IFP A;  2C0W A;  4OYV A;  3A0H E;  1DTZ A;  5FHM A;  4PP0 A;  3K1N A;  3KSJ A;  3I55 P;  1DBZ A;  2NOO A;  1DPE A;  3RGY A;  1Y9U A;  4PBQ A;  4HTG A;  4IL6 H;  1A02 F;  4PD4 E;  4FE8 A;  3OO7 A;  4KPT A;  4RY1 A;  4XKQ A;  1UTB B;  3Q2Y A;  1IXI A;  3JCU E;  4MFI A;  3NMD A;  2XKM A;  1JO5 A;  2H9B A;  1VQ8 P;  4ELP A;  2I0C A;  2PGD A;  3U1A A;  1FJ9 A;  4I40 A;  3O9P A;  3ZKL A;  4TLM B;  2I0B A;  3MST A;  4H0L B;  3MVW A;  4KI0 E;  4WVZ A;  2W83 C;  4I3Y A;  1Z56 A;  3RK3 B;  1H76 A;  3S9O A;  2AL4 A;  3IR1 A;  1BP5 A;  4OGQ C;  5J16 A;  3FXE A;  1NU1 E;  1OVT A;  1FTO A;  4QF9 A;  1W2B O;  1LBB A;  2YXR B;  4LZ8 A;  5AVV B;  3L71 E;  1RYX A;  1LEV A;  1KIL D;  3O29 A;  3TK1 A;  4ECF A;  3LIE A;  2FKW B;  1KYO D;  4AQ4 A;  2E74 B;  4XF5 A;  5CHX A;  3WMM 0;  3C36 A;  3T9H B;  4U22 A;  4JXI A;  1HJ0 A;  3HN0 A;  1KA0 A;  3E79 A;  1FBF A;  1TFD A;  1VE4 A;  2PRR A;  3RK3 E;  2KLV A;  1X0T A;  3UIA A;  1T6A A;  1L4A B;  4H44 C;  2YKO A;  4XE5 B;  2AIX A;  3FUZ A;  3M8U A;  5J1D A;  1D9Q A;  4GOE A;  2CK3 H;  3HO7 A;  1YZ0 A;  2FFD C;  1FBC A;  5B70 A;  1YCJ A;  5JEI A;  4NX1 A;  5HPQ A;  5AVY B;  2UVH A;  1B32 A;  1FTK A;  2KZI A;  4JWO A;  4NF8 B;  1WMK A;  3BRV B;  2OTL P;  4LN5 A;  2IYO A;  3B71 A;  2PMS A;  1IMB A;  4EF1 A;  2ZXX A;  4D6T J;  1BGY G;  1KIL A;  1B5I A;  2N1T C;  3K6X A;  4M4G A;  3H1I G;  5LTC A;  2H89 C;  1JNM A;  1LST A;  1PB8 A;  2E42 A;  2XD2 A;  4P11 A;  1PP9 G;  2YIU B;  3CVG A;  3MYU A;  5TP9 A;  5JTY A;  1AVO A;  3O6G A;  1EXJ A;  1GK6 A;  1LT9 B;  1NV4 A;  1BE3 J;  1A8F A;  1BTJ A;  1MQD A;  1Y9B A;  1XI6 A;  3UP9 A;  1HSJ A;  2I48 A;  1BCC E;  4IO7 A;  1PP9 D;  3PPQ A;  1EU8 A;  3MZW B;  2P58 A;  4I62 A;  3W9V A;  1KB9 D;  2F7A A;  2WBB A;  3U93 A;  3O66 A;  4C7R A;  2XWO A;  1LBW A;  3N26 A;  4IR8 A;  3K0V A;  4OEU A;  4JBZ A;  1QVF O;  1L0N J;  2WT7 B;  1YJ9 P;  2VD3 A;  1EQ7 A;  5AVS B;  1L0N G;  4MCO A;  1BSN A;  3G4S P;  2YNY A;  3CFX A;  2ALU A;  2FYU J;  3CC7 P;  3V8X B;  4K3A A;  1KQS O;  2MKZ A;  2QPQ A;  1USE A;  4XKN A;  1X9V A;  3FGS A;  2G93 A;  1LT9 A;  3AED C;  1G2C A;  3H6T A;  4N78 E;  1B46 A;  1QUL A;  1IZN B;  1CNQ A;  4OVR A;  4C7N B;  3CL3 D;  4OQO A;  1ZR2 A;  5KDT A;  4U1O A;  4UAC A;  1N7X A;  4EOT A;  5BU5 A;  1TFA A;  3G6E P;  4G77 A;  5L9S A;  2KNC A;  4NWC A;  2ZXE B;  3L74 E;  3L73 D;  1NU1 J;  3U65 A;  3C1L A;  3CG1 A;  5EYG A;  1SDX A;  2FYU K;  2XXI A;  1QUK A;  3G3H A;  5TIS E;  4GIZ A;  3Q3D A;  4ZKU A;  1EZV I;  4DLD A;  2UWJ E;  3FGA D;  4IFF A;  1DH3 A;  1N86 A;  1FBD A;  2L5G B;  1URQ C;  1ZTY A;  2HOD A;  4MAG A;  2DS9 A;  2B87 A;  1B0H A;  3G71 P;  4PF8 A;  1FZE A;  1FTA A;  2FFD B;  5KLI C;  3VVE A;  1VF5 D;  3TAJ A;  1U7J A;  3CSG A;  3RQT A;  3RL0 C;  1L4A C;  5TIS H;  1INP A;  4R6Y A;  3VFJ A;  4QSD A;  3KDP B;  1AIV A;  2F3D A;  2Y0C A;  1OVB A;  5LDZ A;  4GBW A;  4R72 A;  2BCC G;  2Z22 A;  3B6T A;  1HUC A;  2QE7 H;  4G68 C;  1B9J A;  2QJK C;  4ZMD A;  3II6 A;  5IM2 A;  1H8A A;  3IJX B;  3KQG A;  1SFC C;  1I6A A;  1PEB A;  2XWI A;  3CMA P;  3IOR A;  3VP9 A;  3VVD A;  3K6V A;  5I59 B;  4OGQ B;  1L0L E;  1VQK P;  2WSC J;  2ZZW A;  4GQO A;  3T66 A;  1HVV A;  1FZA A;  2E1S A;  2KR0 A;  3FXB A;  2K9Y A;  2XXK A;  4N6D A;  5CMK A;  1FPJ A;  2V25 A;  3H6U A;  4N4U A;  2P1J A;  2HHM A;  4RJZ A;  5CCG A;  1IFI A;  1L0L J;  4MLV A;  3VXB A;  2PAJ A;  2PFZ A;  5C39 A;  1OVV A;  4XKR A;  2KI7 B;  4UB6 H;  4XKP A;  2O01 N;  3H03 A;  4F29 A;  5LOM A;  2OCU A;  3K4U A;  3C4M A;  4JDF A;  1NKN A;  3T97 A;  2QG4 A;  1B7U A;  3GXA A;  4PTK A;  1NAF A;  3BRT B;  3EWK A;  2P0S A;  3MP8 A;  1OQG A;  1FQF A;  3CFL A;  1H3D A;  1NHL A;  1EC5 A;  2NRG A;  2Y7I A;  5EQ8 A;  3TNU A;  4PFR A;  3TCG A;  1NTZ D;  1NTK K;  4TOZ A;  3TUS A;  1EZO A;  4PC9 A;  3MVX A;  2XX9 A;  2ONS A;  3PGF A;  3H1K G;  3D70 A;  1KV4 A;  4JYC A;  1Q86 Q;  4OVT A;  2HCA A;  3TKD A;  2H43 A;  3LSX A;  1SQB D;  1SQX G;  5CCG D;  1Q35 A;  3SEX A;  5KLV D;  3ONM A;  3I5C A;  1VQ4 P;  4OVN F;  1ZKB A;  1U57 A;  1NGM B;  3M0A A;  2OYI B;  1DCU A;  2NXO A;  2O1J A;  1OFC X;  2QFL A;  2IYP A;  4G8N A;  1RF1 C;  1FDO A;  5CMM A;  3F5H A;  4PE3 A;  4G2Z A;  2IFM A;  1WVJ A;  3T1B A;  2ZNT A;  4ZS9 A;  1NYH A;  1RE3 A;  4QMA A;  4R4M A;  3VTP C;  1NH7 A;  2YMK A;  4NHB A;  4IY6 A;  3QMF A;  2Q88 A;  3K01 A;  3LV0 A;  3D6Z A;  1MM7 A;  1ZOY C;  4P0G A;  1QL2 A;  4MNP A;  1M1J A;  3EFG A;  2FXO A;  3MJN A;  4AQR D;  4WY4 B;  1LAH E;  1FJP A;  3Q27 A;  2QJY C;  1EXI A;  2PYY A;  1LWU B;  4I9D A;  2IBZ E;  3PTZ A;  4ESW A;  4EXK A;  3PU5 A;  2F3B A;  1JUN A;  4GL0 A;  1JY3 P;  1KOR A;  3L71 D;  4GOF A;  3FAT A;  1N7S B;  1GL2 C;  2MJZ A;  3AEG C;  4PJ0 E;  2KLF A;  4F3B A;  1UTB A;  2P67 A;  4EYY Q;  3GMA A;  1SQV K;  4YZZ A;  1NUZ A;  5AW4 B;  2QS4 A;  3U94 A;  5CBO A;  3T9U A;  1MY1 A;  3N7N A;  1S5L E;  3BBR A;  3RTW B;  2E74 D;  5FBP A;  1KB9 I;  5H8Q A;  1HH0 A;  5BU8 B;  5IZ3 B;  4L76 A;  4QRZ A;  1YXI A;  1AJY A;  2F36 A;  1CB6 A;  1MXY A;  3MUD C;  1NKZ B;  3V5B A;  1K9Y A;  1NV2 A;  4BDQ A;  3V6I A;  4H46 A;  4Q5T A;  2NWJ A;  3NXS A;  4DZO A;  1Q1K A;  3Q26 A;  1MY0 A;  2P2U A;  1CI6 B;  2IDB A;  1VDW A;  2R5D A;  2CZK A;  1RF1 A;  3HE4 B;  2YMY A;  3PPP A;  1OIP A;  1KD1 Q;  2PBW A;  3G7W A;  4R6H A;  2WYP A;  1EZV D;  1B5H A;  4HE1 A;  1NNK A;  4MH5 A;  4JWX A;  3KEI A;  3TQW A;  3UOR A;  1KYO I;  1NV3 A;  1NTZ E;  5GTH E;  4R75 A;  3T9V A;  1R5L A;  2R6G E;  2W6B A;  3E4R A;  3HUS C;  1N73 B;  2B88 A;  1ZP0 C;  2O3J A;  4EQ9 A;  2PP6 A;  5CMZ A;  3CCV P;  2XWV A;  1GD2 E;  3EPE A;  5AW2 B;  3H32 B;  4WKM A;  3UIF A;  1IEJ A;  3L72 J;  2FYI A;  3GHG B;  3FJM A;  1L5T A;  3P8C D;  1OVR A;  2QJE A;  2B3B A;  2C9N Y;  1S9K D;  1T0K A;  3H1L G;  1QUJ A;  3E13 X;  1SQX J;  4IO4 A;  2QJY B;  3PHL A;  5DEX B;  3AE7 C;  3L72 E;  4NWD A;  4U3F G;  1BE3 E;  3OEM A;  5B5E E;  2HFB A;  1Q2N A;  4M1V A;  4NF8 A;  3G9R A;  5KAI H;  1P1U A;  2LKM A;  3AXF A;  4HCY A;  3WU2 H;  2ZVN B;  3OD7 A;  4L75 A;  1JTH A;  2OGU A;  2R5B A;  4GLI A;  1YQ3 C;  1CE2 A;  4WXJ A;  4BLA A;  1NH4 A;  4ZED A;  1EZ9 A;  4LP2 B;  2Q8J A;  1MQI A;  2E75 B;  2QJK B;  4O9B A;  1GU4 A;  2Z23 A;  4WED A;  3C33 A;  4LA9 A;  2QS2 A;  4R2F A;  4P8B A;  1AWB A;  2V3Q A;  3L37 A;  1VQL P;  2WKY A;  2K37 A;  2E74 C;  3TPA A;  2FYN C;  3I3V A;  5APU A;  3FX0 A;  2XZR A;  3A7O A;  1VF5 C;  3L74 D;  1FZC C;  3AEA C;  2Q6Q A;  1NL5 A;  3BFU A;  1POT A;  3Q5P A;  5IZ3 A;  1DSN A;  5B66 E;  1Q7Y Q;  3CR9 A;  4X04 A;  1MQJ A;  2N9Y B;  1XHY A;  3PD8 A;  1PL5 A;  2J59 M;  2ITA A;  4KQP A;  5CJ4 A;  3KG2 A;  4IO5 A;  1FCK A;  2ZNU A;  1L0L D;  2OBG A;  4FIM A;  3SFD C;  4R9G A;  3MZ9 A;  2AEM A;  1KB9 E;  3K1P A;  1KIL E;  1JP4 A;  2Y84 A;  1QJM A;  4POW A;  5CBN A;  2I58 A;  1K8A Q;  4K3F A;  4Y99 B;  3RK2 D;  3TYY A;  3H1H E;  1S3J A;  1URQ D;  3E1I A;  3N94 A;  1XVX A;  4F3S A;  3GLB A;  3V2R A;  3OA7 A;  2M3E A;  1P1Q A;  4H13 B;  4N3Y B;  1W2E A;  1UTH A;  1K9M Q;  2KP8 A;  2RN0 A;  1S7Y A;  5ISU A;  5APT A;  1FTL A;  1FBG A;  3KOT A;  1ZV8 A;  5AW3 B;  2IBZ D;  2A06 D;  2V4C A;  2Y0D A;  4ZZE A;  5I2N B;  2BEQ D;  5B7D A;  1DTG A;  3F11 A;  4OTE A;  1JQF A;  4AB5 A;  2XD3 A;  1B6H A;  1GMJ A;  1GDT A;  2B87 B;  4X8R A;  1FW0 A;  4RJT A;  3LW5 J;  3IB0 A;  3QAX A;  3ZS6 A;  4LC1 A;  5H8H A;  4ZNC A;  3MZB A;  1JY2 N;  4FAJ A;  5CJ0 A;  2E43 A;  4H45 A;  1D9Y A;  3M3K A;  1PPJ D;  5APQ A;  4ZE9 A;  2XXU A;  2C9L Y;  2L91 A;  4YB5 A;  3H1K E;  1SQB E;  1P1N A;  2HEU A;  3AEB C;  3D4C A;  1BIY A;  4GXS B;  1FQA A;  2M8R A;  1LJ2 A;  1P84 H;  2KLU A;  3L35 A;  3S1K A;  1GV8 A;  1BCC D;  4O3A A;  4PFI A;  2DOJ A;  1Y3P A;  2NZ2 A;  1DD3 A;  1L0N E;  3AE4 C;  4YXD C;  3H1H J;  4FED A;  4O3C A;  2DW3 A;  2FYU G;  2OAR A;  1FQE A;  2PCR A;  1QLE D;  1FQC A;  1YPN A;  3ZKK A;  1LT1 A;  3KC1 A;  3CIJ A;  5KJ7 A;  1OVU A;  1UII A;  2VP1 A;  4X9T A;  2D2C D;  4U3F J;  3H7M A;  3TFL A;  1Y4T A;  1QVS A;  2ZYG A;  2WSC H;  4PV1 D;  3CSB A;  1KZU B;  4E0W A;  1DEB A;  5I56 B;  3LUZ A;  2ZZV A;  5E79 H;  2B65 A;  3V2Q A;  1LAX A;  1JVY A;  3MUQ A;  3VMZ A;  1PP9 E;  1NFT A;  3I6V A;  4RXL A;  1KQF B;  4DI4 B;  1IXH A;  4PD4 H;  1EYI A;  1YIT P;  2NPS B;  3M0D C;  1H45 A;  4NGU A;  4OER A;  1RYO A;  1LGH B;  2AXT H;  4LON B;  3VXC A;  2HG5 D;  4R9F A;  2OYO A;  1FPB A;  4HW8 A;  3SEV A;  2Y0E A;  2OTJ P;  1GL2 D;  1OIB A;  4KR5 A;  3FWN A;  1MDP 1;  3A2A A;  1NTM E;  5KJ7 D;  1SD3 A;  1IFM A;  2QVU A;  4YIC A;  2ZT9 B;  3WUT A;  5ESY A;  3CCJ P;  3EQ2 A;  3JC2 2;  3OAK A;  3KGC A;  3B8E B;  1FTM A;  5I58 A;  4QFO A;  4MX6 A;  4BDL A;  2P10 A;  2H98 A;  4DIG A;  5AA2 B;  5HM4 B;  2B89 A;  4O8M A;  2Q89 A;  1S2E A;  5B66 H;  2YO3 A;  4O7I A;  3S9L C;  2CEY A;  3VP8 A;  4OAN A;  1B3F A;  5AW6 B;  2XXX A;  4G8M A;  1SQQ D;  5DW8 A;  1RQV A;  4N8G A;  3L72 G;  2YO2 A;  1R1N A;  2YIU C;  3HD7 D;  1SQV D;  3L70 D;  4C7N A;  1NNF A;  2VT5 A;  5I5P A;  2NUV A;  5ELV A;  1GW4 A;  2E5T A;  2N1T B;  2F6P A;  2WSF J;  3IO6 A;  4HCW A;  3HHF A;  5BWJ A;  1B3G A;  1AOV A;  4F31 B;  1GZL A;  1AQT A;  2ZNS A;  4P0I A;  1LBV A;  3O8Z A;  3H6V A;  2FBP A;  4MMP A;  1KQG B;  1LWU C;  4OZ9 A;  2WPS A;  1SQB J;  3OO8 A;  1E79 H;  2R8T A;  3MWB A;  5DVI A;  1JMB A;  1M5C A;  2D2C C;  1IFJ A;  1A7L A;  1B58 A;  2BJI A;  1IMF A;  1LFG A;  1NTM J;  3A3U A;  4I2L C;  3USS A;  4UAB A;  1RY3 A;  3CX5 I;  1JCD A;  1QGK B;  1JEK A;  3O28 A;  3DLN A;  2FYZ A;  1J2J B;  2M3B A;  4PCD A;  2LXC B;  1IK7 A;  4PAI A;  1Q9D A;  5I2K B;  4DI3 D;  4EQ7 A;  1PGQ A;  3GYY A;  4G68 B;  3CX5 E;  2B4M A;  5ET6 A;  2A06 E;  1US4 A;  3MQ9 A;  3PV0 E;  1EDI A;  5CCH C;  3AE1 C;  3IX1 A;  3RT8 A;  1SVF A;  3GW6 A;  3RL0 B;  1BDD A;  4YU0 A;  3CX5 H;  2HAU A;  4NF0 A;  1VQ5 P;  3GZG A;  3TYH A;  1H0T A;  4OET A;  3SEW A;  1OW7 A;  1SFC A;  4YAH X;  1RDZ A;  3T9X B;  3RK3 C;  3FXR A;  1KMI Z;  1WRG A;  2ZYN A;  1S1C X;  1SYH A;  1KFN A;  3C34 A;  3EFF K;  3TTR A;  3R2P A;  5KAI E;  1DIP A;  2PT1 A;  4Q30 B;  2ZZX A;  1Y8A A;  1NTK E;  4WBA A;  3UGW A;  2H8P D;  1GR2 A;  1LWU A;  3CXH D;  1AL3 A;  2WEF A;  4NF6 B;  3B5N D;  3O97 A;  1KA1 A;  3PMX A;  4ZEC A;  3Q1M A;  2RF1 A;  3EF7 A;  3DM0 A;  3H1I J;  1MQG A;  4KCD A;  1H89 A;  2WYK A;  4YB6 A;  4ASW A;  2KIK A;  3LSW A;  1X79 B;  3M9Q A;  3HFU A;  2XHD A;  2KXP B;  4LGD E;  5KZT A;  2DSF A;  2Q9I A;  4GWO A;  2W90 A;  3V4Q A;  3R7X A;  4DXU A;  5F24 A;  4FEB A;  5AW0 B;  4QFL A;  1SFC D;  4U7J A;  2Q7C A;  1B51 A;  1YTV A;  5HBC A;  4GX4 A;  3G3F A;  4ZEB A;  3FVG A;  4GRK A;  2LXB A;  1UTH B;  4QFK A;  1NJI Q;  2OJT A;  1SQV E;  1NO4 A;  1TWY A;  1KIL C;  5AVX B;  2B4L A;  3C8V A;  1JMM A;  1AFO A;  4OVJ A;  3TTM A;  4BDM A;  2VPN A;  2QIW A;  3P8C E;  2OYI A;  2XXW A;  4FOR A;  4YMA A;  1VQM P;  3S2V A;  3CI9 A;  2DWH A;  3BIH A;  1NV6 A;  1SQX E;  3DP8 A;  3GF7 A;  4PAK A;  3B5N A;  2QMW A;  2QVV A;  2UVG A;  1FPF A;  1I69 A;  1QUI A;  2OWT A;  2GUV A;  3RN8 A;  1BE3 D;  2QMX A;  1USD A;  2OYH B;  1FTJ A;  4NPE A;  4GWS A;  5B5E H;  1FBP A;  3MBP A;  1R5S A;  4D6T G;  1IIT A;  3O2A A;  4QXD A;  1SW2 A;  5APV A;  3CD6 P;  1DPP A;  4XIG Q;  1FAV A;  1WT6 A;  4ZE8 A;  4PFB A;  3ITK A;  4OA4 A;  4XFE A;  1NTM G;  3K6U A;  1ZN5 A;  1LGB C;  4MIJ A;  4ASV A;  2AXC A;  1LCT A;  1EYK A;  5CCH A;  2I6E A;  1IQ7 A;  1FRP A;  3FVK A;  3D1R A;  3TOD A;  3BCC D;  4N81 A;  5K5G B;  3GBB A;  3E7K A;  3A0B E;  3OO9 A;  5EQ9 A;  3SZP A;  5CBR A;  2FYU E;  1N0T A;  1IC2 A;  5GTI H;  3FXQ A;  4DT0 A;  5AVQ B;  1XS5 A;  2XXP A;  4KCC A;  4PDH A;  2Y5K A;  3H25 A;  1LTI C;  1G1J A;  2REJ A;  2J5U A;  2F97 A;  2KYV A;  3B6Q A;  4H5G A;  1VQ7 P;  4OWD A;  3B8B A;  5I84 A;  2OYI C;  3IOW A;  3TQL A;  4UB6 E;  3TTL A;  4QSE A;  4EDP A;  1LTJ A;  2Z4E A;  1HJB A;  3I56 P;  1Z7N E;  1NTK D;  4DCY A;  1DMB A;  3PUV E;  1BSH A;  4H0W A;  3BCC G;  4YKJ A;  2ZMB A;  1D7M A;  3IR9 A;  2GM4 A;  4PGP A;  5CCH D;  2VHA A;  3C35 A;  4X1B A;  4MNI A;  4MBP A;  2Q1K A;  4H0L C;  2Y9Z A;  4Y28 J;  3K2D A;  2WSS H;  5L9M A;  1P99 A;  1POY 1;  3AEE C;  4WB4 A;  1RF0 A;  3CFZ A;  3MIW A;  3DP6 A;  1N84 A;  2YKQ A;  3PLN A;  1SI0 A;  3GLM A;  1FPI A;  1VSO A;  4NN3 A;  3D6Y A;  4OMB A;  3KYQ A;  2O84 X;  4G68 A;  3L4F A;  2XA5 A;  1D4N A;  4F39 A;  4OVQ A;  1X22 A;  3AE5 C;  1T2K D;  1JY3 N;  2CZH A;  4BWN A;  4OEN A;  1F9B A;  1N04 A;  4NAP A;  3U8Q A;  1P1W A;  3W15 C;  1B7H A;  3FD3 A;  4GWZ A;  1VDF A;  2KUB A;  3CWB G;  3RUM A;  3R26 A;  3IOT A;  1LFH A;  1SW1 A;  2CEX A;  4RK9 A;  4KD5 A;  1J1E C;  4FJP A;  2Z5I A;  3IOU A;  3L75 E;  3IOV A;  4BXL A;  2K9J A;  4BRY A;  1IMC A;  1URS A;  1T3U A;  4DXC A;  2ZAE B;  4A7P A;  3O6I A;  5CMC A;  4AUW A;  4H44 B;  1FZC B;  3H1H G;  1SW4 A;  3A0H H;  3LW5 H;  3IO4 A;  5KAF H;  1K73 Q;  4N6J A;  4KXP A;  2OYH C;  2E5Y A;  1B3H A;  1M90 Q;  2E75 C;  3SWK A;  4AS4 A;  1NUW A;  5DT6 A;  2ZYO A;  1RF0 C;  2XU6 A;  2A5T A;  2F8D A;  2I1K A;  1MZ9 A;  2FNC A;  5I2K A;  1L2P A;  3L6G A;  1S5L X;  4EDF A;  2WTY A;  2HXW A;  5KCJ A;  4X1D A;  1B0L A;  3EN3 A;  2WIT A;  2DVC A;  5FTI A;  3TDJ A;  4MHF A;  5KLV J;  2Y7R A;  1PZQ A;  3S4U A;  5DYH A;  1L0N K;  1UIU A;  1G0I A;  4JPZ B;  3S4R A;  1FBE A;  2OWS A;  3CG3 A;  1GTW A;  1N73 A;  1LB8 A;  1USY E;  2KB7 P;  1P84 E;  3O6Q A;  2R44 A;  4E0X A;  4F2Q A;  1S4X A;  3B7D A;  4QSC A;  5H8N A;  4XTC Q;  3ZSF A;  2V93 A;  4OFO A;  1USY H;  2AYS A;  2VOZ A;  3PPN A;  3FXU A;  3FJ7 A;  3RY3 A;  1QVG O;  4TQU Q;  5DVF A;  2IFN A;  2B3F A;  4JWY A;  2QJP C;  5AA4 B;  1LTG C;  1PGP A;  4U3F E;  2FVZ A;  1MH4 A;  3IL1 B;  5K2Y A;  3JV9 A;  3FXD A;  2X7P A;  4EQB A;  3M9H A;  3H1L E;  1R8E A;  3H3G A;  3N5L A;  3M3L A;  4GDO A;  3JSV C;  1NU1 D;  2O1K A;  5E79 E;  2LAO A;  3SSU A;  3T96 B;  2O1L A;  2Q3E A;  3E9X A;  3L71 J;  2Q5U A;  3TGU G;  4DZ1 A;  2I4C A;  1ZLQ A;  1YTZ T;  2ZT9 C;  2HPG A;  1JET A;  4KHZ E;  2A45 H;  3M9B A;  1SQP D;  1G2C B;  2R32 A;  1KFM A;  4Z0I A;  2WVR A;  3FIR A;  3LBS A;  2W7Y A;  4MNC A;  4WWI A;  2HYN A;  1SQV G;  3TGU E;  4OH8 B;  2E0S A;  1MDQ A;  1PC3 A;  2M8C A;  1B1X A;  1LNQ A;  2NPS C;  4YXW H;  5H8F A;  3L75 D;  4CPG A;  2OX3 A;  2ONK E;  1M5F A;  1PV3 A;  1NNT A;  4OES A;  2E75 D;  3CCU P;  4UA8 A;  1KWH A;  4DE8 A;  3PJS K;  3CC2 P;  3G3Z A;  1HSE A;  4RPN A;  1GW3 A;  1Y1M A;  1CSB A;  3FJG A;  1GVC A;  1SVX B;  4HKZ H;  1N7S A;  2P3N A;  3IK6 B;  4IO6 A;  3MP1 A;  3Q5S A;  1JW4 A;  4F3P A;  3H1J D;  5EFW B;  2P1S A;  4RA1 A;  5M1B A;  2RC9 A;  1ZMG A;  5GTI E;  1R9L A;  2P2A A;  4DXB A;  4YTP C;  1ZRT D;  3VOP A;  5BVZ A;  1N7W A;  2QS3 A;  3VLV A;  2Q2A A;  2A45 I;  5APW A;  3RL0 g;  3VLU A;  4EIJ A;  2GRV A;  2OLB A;  3TMG A;  1LFI A;  4HH2 A;  1A99 A;  4AB6 A;  5A5L A;  3CWB E;  2RC7 A;  3MPK A;  1IFN A;  1YYC A;  1B4Z A;  1NV7 A;  4H1X A;  1SQQ E;  2V7Q J;  3CXH I;  3HUS B;  1RH5 B;  1N73 C;  4PFT A;  2FA7 A;  1SQX K;  2RCB A;  1MY4 A;  1KYO E;  3M0D A;  1IMD A;  3Q29 A;  1NTK J;  3HHG A;  1LTA C;  1EDJ A;  1MXU A;  2G3A A;  2CPS A;  1PP9 J;  2H5Y A;  4YKP A;  3MZ1 A;  2O01 J;  3QSL A;  2BEZ F;  4LZ5 A;  5EYF A;  5TU0 A;  3EKI A;  3E78 A;  3QUF A;  4IO2 A;  3PPO A;  2NVU B;  1FDI A;  1SQB K;  4EF2 A;  1OMI A;  3H1J G;  1MG1 A;  2O01 H;  3TEP A;  4NF4 B;  5KLV K;  3EHS A;  1YHQ P;  2GHA A;  4QFP A;  1GU5 A;  3RNN A;  4X48 A;  1VL2 A;  1ZLL A;  1MXX A;  4R73 A;  4ZDM A;  3WAF A;  2Q9T A;  3QUJ A;  4N15 A;  2FYU D;  2RCA A;  3OMB A;  2OTK E;  3AEF C;  3T0J A;  4B86 A;  1XT8 A;  4L17 A;  4I6M C;  1BCC G;  2GHB A;  3RT6 B;  2RMZ A;  3L75 G;  1MM6 A;  5I57 A;  1LBZ A;  4NG7 A;  4NMY A;  4IY5 A;  2XXR A;  1ZR4 A;  1JW1 A;  5DJU B;  3IFM A;  1FPL A;  1JY2 P;  1HBW A;  1LCF A;  3AE8 C;  1YBK A;  3CHG A;  1RDX A;  1LTB C;  3V83 A;  1W5C E;  2QVR A;  3THI A;  5EYH A;  1SQP G;  3MPL A;  1LTJ C;  5CMB A;  1D9V A;  3L73 J;  1II5 A;  2DYX A;  1N3X A;  4K35 A;  3MC2 A;  4PF6 A;  3KHU A;  1LAF E;  4JF7 A;  3TGU D;  1SPI A;  2VGQ A;  3CCE P;  3P8M C;  2KQZ A;  3GG2 A;  2F7B A;  3BAT A;  1HGZ A;  2FBW C;  1NU1 G;  5ITO A;  1S9K E;  4UB8 H;  2A06 G;  3KPE A;  5AA2 D;  1CI6 A;  1TT1 A;  1SS1 A;  4ELR A;  4H8I A;  1MS7 A;  2FXP A;  4RO0 A;  1IXC A;  1RE3 C;  1YI2 P;  1MXW A;  4XEQ A;  1VQP P;  1S72 P;  3SFE C;  3PUW E;  1Y1Z A;  2FIX A;  3K1M A;  3IAO A;  4IO3 A;  4HE2 A;  1N8R Q;  3PUY E;  2D3I A;  5M2V A;  2I4B A;  2X26 A;  1NNP A;  5DJT B;  4H13 D;  4I7Z C;  1MPC A;  4W7Z A;  3VDF A;  3FZV A;  2O68 A;  1PGJ A;  1B3L A;  2WMM A;  2R9J A;  1H0T B;  2QL3 A;  1UQW A;  4XFJ A;  1HSL A;  3OJA B;  4LUB A;  4DCX A;  1LB9 A;  1L0L G;  1YJN P;  5AW5 B;  5KLV E;  1K9Z A;  3BKI B;  2Z5H A;  3D71 A;  1XTG B;  1IZ1 A;  4KHX A;  5A5X A;  4R4L A;  3KFM A;  1QX8 A;  5KTB A;  4P47 A;  3PTY A;  2QM7 A;  5DEX A;  4NPD A;  4IFM A;  4H5F A;  4I8C A;  1JTH B;  3NTN A;  3L74 G;  3VMA A;  4IFD K;  2HZK A;  3E3K A;  1JB0 J;  3MUD A;  3G3K A;  4F22 A;  4LAT A;  1VFE A;  4P1L A;  1FZG A;  1P84 D;  4ND9 A;  3ZDM A;  1M1K Q;  4P1E A;  4P9K A;  1XC1 A;  1MUU A;  5H8S A;  4JYB A;  1FQD A;  4JVI A;  2JWA A;  3L6H A;  3H1H D;  3V89 B;  5ET7 A;  2FIE A;  2ZXT A;  2ONR A;  1DK4 A;  3KN3 A;  2YJP A;  3USD A;  4MN4 C;  4RKU J;  1QKB A;  1IFD A;  1O7T A;  2K88 A;  4U3F D;  2OWZ A;  3H06 B;  4GVO A;  4ESX A;  2J58 A;  4YKK A;  1MXV A;  3CWB D;  3VYI A;  4KYD A;  3H1L D;  4H6D A;  1JCC A;  2ZYA A;  5JTY B;  2R3C A;  2KOG A;  3B6W A;  4MLQ A;  3U92 A;  2WPR A;  3B5N C;  3PMW A;  1MRP A;  4PAF A;  3VV5 A;  1AA0 A;  2WX9 A;  4PE5 B;  3IN6 A;  2ZYD A;  3CCS P;  1URQ A;  3BFT A;  3TTK A;  1SYI A;  1KN7 A;  3WUV A;  3PD9 A;  2O6A A;  5FHO A;  3OEL A;  3C32 A;  2HR3 A;  1P84 I;  3VE1 B;  3H1I E;  1EZV G;  2YKP A;  1AV1 A;  2V3U A;  4EI2 A;  1LAG E;  4TLF A;  1TU3 F;  1OX3 A;  1JVX A;  2BJJ X;  2A45 G;  4KJM A;  1M57 D;  2D2C B;  1JY3 O;  3H1J J;  2HAV A;  4P3L A;  1URQ B;  1A54 A;  2JWD A;  4NPF X;  3T22 A;  1FOS F;  1MQH A;  4I1L A;  4TT3 H;  1Q81 Q;  4HB1 A;  4WY4 C;  3JZJ A;  1MV8 A;  4H44 D;  1M5E A;  4QFN A;  2XX8 A;  3RLF E;  3AE6 C;  2XWK A;  3ILU B;  1NTK G;  3CWB J;  4Z1M H;  3OEK A;  2WPQ A;  3L70 J;  2Y5L A;  3RPL A;  3H1L J;  1NMU A;  4JSD A;  1QGX A;  4GXA A;  2N1T D;  1MPB A;  1SQQ J;  3IFC A;  4PET A;  3KZI E;  1A40 A;  2REG A;  2K1A A;  2DDK A;  1KTM A;  5IKB A;  3FWL A;  4PD4 I;  3FAS A;  5AW7 B;  4ZKP A;  1K04 A;  4ISU A;  1G1I A;  1EZP A;  3L71 G;  4NE4 A;  2PT2 A;  2IX7 C;  4N6K A;  5IGA A;  1E5W A;  5DVJ A;  2ABH A;  3RTF B;  3H1K J;  4N6P A;  2FFD A;  1BGY J;  1Q82 Q;  1VQ6 P;  1Q90 D;  1S5L H;  1YQ4 C;  1FJ6 A;  1RHZ B;  2QA4 P;  2OQQ A;  3HRN A;  3CCL P;  2WSE J;  1OWA A;  3KN7 A;  4U2R A;  3HPI A;  2ANJ A;  1NTM D;  2C0X A;  4N07 A;  3KJT A;  5CBS A;  3S9E A;  2XXQ A;  2DE4 A;  5AVU B;  4H67 A;  2H25 A;  1H44 A;  3SEY A;  4IOI H;  3TCH A;  2K3R A;  1OQH A;  1KZ8 A;  3RK2 C;  2IEE A;  1NWQ A;  2N1T A;  4D6T D;  2QJP B;  4ELO A;  1IXG A;  1BE3 G;  3QYT A;  4W7Y A;  5KDT B;  3FVO A;  1M5D A;  1FSA A;  1GL2 A;  4HYT B;  2PFY A;  1I6Q A;  3IAZ A;  5AA3 A;  4PFY A;  2YXQ B;  3LSF B;  5EHM A;  5T3J A;  3AE2 C;  5KLV G;  3W68 A;  1A8E A;  1SQX D;  4IL6 X;  3PMV A;  2W6J H;  3G3I A;  3TGU J;  4DOJ A;  5H2F E;  3KOS A;  5AA4 A;  2DQV A;  3ILT B;  5H8H B;  4DCK A;  1FBH A;  3LR1 A;  5L8R J;  5I58 B;  3HD7 B;  5IAI A;  4YB7 A;  4C46 A;  1NTZ G;  3TF5 A;  1B2H A;  1VQO P;  1LBY A;  1NI9 A;  3GHG A;  1M1J C;  1IMA A;  1T3J A;  1HTL C;  1FC2 C;  2BCC J;  2O69 A;  1SFC B;  3IB1 A;  3OOA A;  3V2N A;  2XXY A;  2OYH A;  5EHS A;  1Y47 A;  1VF5 B;  1BKA A;  1XTC C;  4WY4 A;  3L75 J;  3AEC C;  1FE6 A;  2WQY C;  1P1O A;  1OLA A;  3CC4 P;  1YYZ A;  3MVY A;  3LUY A;  4N91 A;  1JW5 A;  1JOC A;  3P7K A;  2WT7 A;  3T93 B;  3TSI A;  5KCJ B;  3B5N B;  1QW0 A;  3ROJ A;  2RH0 A;  1EDL A;  1I6B A;  1Y3N A;  4F3G A;  3M91 A;  1A55 A;  1WOD A;  2AEJ A;  2W6A A;  4JSO A;  1SQP E;  3OSQ A;  1KC8 Q;  2XXV A;  2X7Q A;  4IL6 E;  3HST A;  3R4Y A;  3U1C A;  1J1E B;  4O7M A;  2Z8D A;  2Q2C A;  1J1D B;  1M56 D;  3HCQ A;  3V2P A;  5KAF E;  4GWW A;  5I57 B;  3MGN A;  3NFQ A;  2I1J A;  4YPC A;  1JNF A;  2DP8 A;  4GF8 A;  4H8J A;  2BAS A;  2QSI A;  5I7I A;  1N3W A;  4WY4 D;  3K02 A;  2ZYK A;  4PDD A;  2M5A B;  2KS1 A;  3T97 B;  2VRS A;  3CRB A;  2KK7 A;  1NKX A;  4LVQ A;  2UYF A;  3AE3 C;  2BCC D;  4GKG A;  2F35 A;  1FOS E;  4BDR A;  5L8D A;  5L9O A;  3UA8 A;  3R6U A;  2XX7 A;  2F6G A;  3MHV A;  4OXV A;  3RK2 B;  1AQ5 A;  4FBP A;  3O6H A;  4RPO A;  3PUX E;  4OVP A;  3HUS A;  2M0B A;  2XXH A;  3IF4 A;  3BVH A;  1PBQ A;  1ZRT E;  3BCC J;  5DTB A;  4QBA A;  1DEE G;  5JK4 A;  1GGG A;  2POH A;  2KS1 B;  3KJ7 A;  3H1J E;  4JQ0 D;  3V4W A;  2RKM A;  2E76 C;  2PFX A;  2QSX A;  5ET8 A;  3JCU H;  1EDK A;  5EQ7 A;  4U21 A;  1OW8 A;  2AEF A;  4FAT A;  3L73 E;  4GD5 A;  3L73 G;  2THI A;  3E1R A;  3CXH E;  3Q5R A;  3TCF A;  3D4G A;  3A3Y B;  1VQ9 P;  2IBZ I;  3U72 A;  2NPS A;  3L70 G;  1NAY A;  3WU2 E;  1SI1 A;  2Y7K A;  3SEU A;  3L72 D;  3RBX A;  2O7U A;  3QWO C;  2RC8 A;  1SQQ G;  1DD4 A;  4F2O A;  3LID A;  2HFE D;  1PB7 A;  5APY A;  4NF6 A;  3SKP A;  3VMY A;  1AVY A;  3W9W A;  2H4I A;  1FS0 E;  4R6K A;  1N7S C;  2Q3I A;  1M5B A;  3MVZ A;  3SET A;  3OXN A;  3L36 A;  1ZME C;  5ICT A;  1NTZ J;  2I3V A;  2QVA A;  5K2X A;  1L0N D;  3A09 A;  2IZ1 A;  3PUZ E;  3CCR P;  3ABV C;  1N2D C;  1SP4 A;  2H88 C;  4PJ0 H;  4W80 A;  1IUD A;  4Q0C A;  4ZZA A;  2OK2 A;  2XDJ A;  2GUS A;  3FV2 A;  1PB9 A;  4ONY A;  3KXD A;  3B4S A;  1AH5 A;  1PIX A;  1ZXG A;  3MP7 B;  1OZH A;  1PPJ E;  4EUO A;  3N6T A;  3CCQ P;  2NPS D;  2DE2 A;  3MD0 A;  4MEV A;  1K05 A;  5AW9 B;  4C1U A;  2DXY A;  4H65 A;  2WWW A;  2A5S A;  2D21 A;  3MW0 A;  4QHQ A;  2HOD B;  3TNU B;  4Z7E A;  3QXM A;  4G61 A;  5AE4 A;  3H6P A;  3H1I D;  1NVO A;  3VMX A;  3CLQ A;  4YMB A;  1BGY D;  2ZJS E;  2RIN A;  4ZEI A;  4LLH A;  2HQ0 A;  2E76 B;  4L74 A;  4RYA A;  2VPO A;  1B3E A;  5TJH A;  3G3J A;  3O6Q B;  4R74 A;  2P7J A;  4NTL A;  1Y20 A;  1YAE A;  3DP4 A;  3ISP A;  3OSR A;  4U4X A;  2WBD A;  1O64 A;  4O94 A;  5KKZ C;  2O51 A;  3MP6 A;  4I3E A;  2DXR A;  5I56 A;  4MJO A;  1RE4 A;  3M06 A;  1L0L K;  3TEL A;  3WAE A;  1JEV A;  5H8F B;  1FPG A;  3JYR A;  4RK2 A;  1UIX A;  2HLO A;  3ODB A;  2YLN A;  4GL8 A;  2GQ1 A;  1GK4 A;  5AVR B;  3P32 A;  1LBX A;  1LT9 C;  1BDC A;  1L4A D;  2XNX A;  2Z8F A;  1FJK A;  1M7L A;  4OFJ A;  3CX5 D;  1J1N A;  2Z8E A;  1VFD A;  4Y99 C;  1PFI A;  2FHY A;  1PPJ G;  1X8Y A;  4XA4 A;  4P56 A;  1GL2 B;  1O63 A;  3KC0 A;  4PBH A;  4I1D A;  2F7C A;  4AS5 A;  3PRJ A;  3HTK A;  1RDY A;  3DEL B;  5CC2 A;  4TLL B;  5FTH A;  3HE5 A;  1R6Z A;  1N76 A;  1MXZ A;  1RKM A;  3G3G A;  3OEN A;  4OGQ D;  1KQL A;  1URD A;  1SQQ K;  2V3T A;  2YPN A;  1RQU A;  1VR5 A;  1H43 A;  1FPK A;  2G29 A;  3RGU A;  2JEE A;  2M5A A;  4GX3 A;  3CME P;  2IBZ G;  4JVC A;  4NF5 A;  4PQJ A;  3RBZ A;  2R3S A;  2V7Q H;  1LLS A;  5KJ7 C;  1Z7M E;  4GWY A;  1BK4 A;  1FZB A;  5H2F H;  3HV1 A;  4RNS A;  3UK4 A;  1KB9 H;  3MAM A;  1FPE A;  3A5T A;  1NTM K;  4BDN A;  2Y7W A;  2HZL A;  2FYN B;  4YKI A;  2E76 D;  3HE5 B;  5AVZ B;  1L4A A;  4ZEF A;  4I7Z B;  5IZ1 A;  3I5O A;  1D3K A;  4PD4 D;  5H8Q B;  5ITP A;  2LR2 A;  4HS7 A;  1G0H A;  1B7Z A;  4F18 A;  4N17 A;  1IO4 A;  2QRX A;  3Q25 A;  1NUX A;  3TTN A;  4M3L A;  4NF5 B;  1OXZ A;  1ANF A;  5I59 A;  5H8N B;  2QM8 A;  3S9M C;  4THI A;  5KLI B;  4OWF A;  3SDF A;  1FU1 A;  3IB2 A;  2HPC B;  1SQP J;  4G4P A;  1XOC A;  5APS A;  1LTT C;  3F89 A;  3N4X A;  5CCG C;  1EH3 A;  4POX A;  3IFA A;  4GWX A;  1BLF A;  1IIW A;  3FV1 A;  2QRY A;  3B50 A;  3V5A A;  2WSE H;  3TZA A;  2ZYM A;  3UN6 A;  3VLW A;  5F1Q A;  1T2K C;  1OMP A;  3CI8 A;  3GHG C;  2FXM A;  2OZZ A;  2CZL A;  3LC8 A;  4H13 C;  4UB8 E;  1B40 A;  1MFT A;  2N9B A;  1GTK A;  5TP9 B;  3KBZ A;  1ZBM A;  1U7M A;  4GX6 A;  1US5 A;  2IPP A;  3QK6 A;  1RE4 C;  1H88 A;  3BAS A;  2W27 A;  2UYE A;  1A02 J;  1CW5 A;  2RKL A;  3A0B H;  2I49 A;  1EZV E;  4C1T A;  3KBR A;  4U4S A;  4NF4 A;  4DDD A;  2JO1 A;  2XND H;  3BIG A;  5ICQ A;  3BCC E;  1LP1 B;  3CPW O;  1J1D C;  3VN0 A;  4NQ8 A;  1NV0 A;  1ZJL A;  4AYC A;  3H4Z A;  2ZT9 D;  1JEU A;  1NUY A;  2WPV B;  4RES B;  2F34 A;  5BUU A;  1NH8 A;  1YTZ I;  3A29 A;  1MY2 A;  3U59 A;  4IB2 A;  4IGT A;  1VPC A;  5I2N A;  3HE4 A;  2IZ0 A;  1OW6 A;  3MTU E;  1DOT A;  2G8Y A;  2I8D A;  2DWA A;  3RK3 D;  2UXA A;  3P7I A;  3FBP A;  4ZEK A;  2JP3 A;  4H0L D;  3VVF A;  2AL5 A;  4PFU A;  3SER A;  2KNC B;  2L5V A;  1SW5 A;  1SQY A;  1B4H A;  1YJW P;  2PVU A;  2ZVO B;  2B9B A;  5AVW B;  1MH3 A;  4GOT A;  1TXF A;  5EQA A;  1FDM A;  3Q28 A;  1DX7 A;  3KZG A;  1EYJ A;  2Q74 A; 
#chains in the Genus database with same CATH homology
 1MY3 A;  1B05 A;  4KFQ A;  4GOD A;  1OLC A;  3QIM A;  2DWI A;  1FQB A;  3H6W A;  1MPD A;  1Y3Q A;  4KYS A;  4JB7 A;  5F7V A;  4F19 A;  4IGR A;  3FVN A;  2H99 A;  4GFR A;  1R9Q A;  4XXU A;  4MF3 A;  1LBC A;  4U1Z A;  2GFE A;  4FEC A;  3C9H A;  4BDO A;  2CMO A;  4U23 A;  3RPW A;  2F5X A;  4R2B A;  2IA4 A;  2O1M A;  3EQ1 A;  4EXL A;  3SES A;  2ESN A;  4WEP A;  5TPA A;  1B52 A;  1AMF A;  3M3F A;  4OEV A;  2UVJ A;  3KN8 A;  1PDA A;  5FHN A;  4F1U A;  3ECR A;  1QKA A;  2DE3 A;  1B5J A;  3EHT A;  3S9N C;  1WDN A;  4HJG H;  5CRY A;  3LSL A;  2D5W A;  2Y7P A;  4LZ7 A;  1LP1 A;  4C0R A;  1SBP A;  3GBA A;  4F1Y A;  2VD2 A;  3PPR A;  3K6W A;  5CI5 A;  4PFW A;  1Y4C A;  4LQ2 A;  1XVY A;  2QS1 A;  4OFL A;  2DVZ A;  1S9T A;  3U1O A;  1ELJ A;  2A5T B;  1ZW0 A;  2DWJ A;  3K00 A;  1PBP A;  2XXT A;  1B1H A;  1UIV A;  4KYE A;  4LQ5 A;  2V84 A;  2O7I A;  3A3C A;  4NED A;  3KSX A;  3OO6 A;  2KZJ A;  1ZU0 A;  2SPZ A;  5AA1 A;  5A5X B;  2GH9 A;  2PX1 A;  2R71 A;  2UVI A;  4G8H A;  1URG A;  2I3W A;  4N13 A;  2F78 A;  3N6U A;  3C31 A;  1ZIU A;  3PH0 A;  4Q8R A;  3IJO B;  1ATG A;  4O3B A;  5CM6 A;  1JM0 A;  5TPA B;  1S50 A;  3EHU A;  4F1V A;  4OHN A;  5AA2 A;  4OYV A;  1DTZ A;  5FHM A;  4PP0 A;  3K1N A;  3KSJ A;  2NOO A;  1DPE A;  3RGY A;  1Y9U A;  4HTG A;  4FE8 A;  3OO7 A;  4KPT A;  4RY1 A;  4XKQ A;  1UTB B;  1IXI A;  4MFI A;  2H9B A;  4ELP A;  2I0C A;  3O9P A;  3ZKL A;  4TLM B;  2I0B A;  4KI0 E;  3MVW A;  1H76 A;  2AL4 A;  3IR1 A;  1BP5 A;  3FXE A;  1OVT A;  1FTO A;  4QF9 A;  1LBB A;  4LZ8 A;  1RYX A;  3O29 A;  4ECF A;  4AQ4 A;  3C36 A;  3T9H B;  4U22 A;  4JXI A;  3HN0 A;  1TFD A;  1VE4 A;  1X0T A;  2AIX A;  3M8U A;  3FUZ A;  5J1D A;  4GOE A;  3HO7 A;  5B70 A;  1YCJ A;  5JEI A;  5HPQ A;  2UVH A;  1B32 A;  1FTK A;  2KZI A;  4JWO A;  4NF8 B;  2PMS A;  4EF1 A;  1B5I A;  3K6X A;  4M4G A;  1LST A;  1PB8 A;  2XD2 A;  4P11 A;  3CVG A;  5TP9 A;  5JTY A;  3O6G A;  1A8F A;  1BTJ A;  1MQD A;  3UP9 A;  1HSJ A;  2I48 A;  4IO7 A;  3PPQ A;  1EU8 A;  3MZW B;  2P58 A;  4I62 A;  3W9V A;  2F7A A;  3U93 A;  3O66 A;  3N26 A;  3K0V A;  4OEU A;  4JBZ A;  2VD3 A;  3CFX A;  2ALU A;  3V8X B;  4K3A A;  2QPQ A;  4XKN A;  3FGS A;  2G93 A;  3H6T A;  1B46 A;  1QUL A;  4OQO A;  5KDT A;  4U1O A;  4UAC A;  1N7X A;  1TFA A;  4G77 A;  5L9S A;  4NWC A;  3CG1 A;  1SDX A;  2XXI A;  1QUK A;  3G3H A;  4GIZ A;  4DLD A;  2UWJ E;  1ZTY A;  2DS9 A;  2B87 A;  1B0H A;  3VVE A;  3TAJ A;  1U7J A;  3CSG A;  3RQT A;  4R6Y A;  3VFJ A;  4QSD A;  1AIV A;  1OVB A;  4R72 A;  3B6T A;  2Z22 A;  4G68 C;  1B9J A;  4ZMD A;  3IJX B;  1I6A A;  1PEB A;  3IOR A;  3VVD A;  3K6V A;  5I59 B;  4GQO A;  3T66 A;  2E1S A;  5CMK A;  3H6U A;  2V25 A;  4RJZ A;  4MLV A;  3VXB A;  5C39 A;  1OVV A;  4XKR A;  2KI7 B;  4XKP A;  3H03 A;  4F29 A;  5LOM A;  2OCU A;  3K4U A;  3C4M A;  4JDF A;  1B7U A;  3GXA A;  3MP8 A;  2P0S A;  1OQG A;  1FQF A;  3CFL A;  1H3D A;  1EC5 A;  2Y7I A;  3TCG A;  4TOZ A;  3TUS A;  1EZO A;  3MVX A;  2XX9 A;  2ONS A;  3PGF A;  2HCA A;  3TKD A;  3LSX A;  1Q35 A;  3SEX A;  3ONM A;  1ZKB A;  2NXO A;  4G8N A;  5CMM A;  4G2Z A;  1WVJ A;  4ZS9 A;  2ZNT A;  1NH7 A;  4IY6 A;  2Q88 A;  3K01 A;  1MM7 A;  4P0G A;  3MJN A;  1LAH E;  3Q27 A;  2PYY A;  4I9D A;  4ESW A;  4EXK A;  3PU5 A;  4GL0 A;  4GOF A;  4ELQ A;  3FAT A;  2KLF A;  4F3B A;  1UTB A;  4EYY Q;  4YZZ A;  3U94 A;  2QS4 A;  5CBO A;  3T9U A;  1MY1 A;  3BBR A;  3RTW B;  5H8Q A;  4QRZ A;  2F36 A;  1CB6 A;  1MXY A;  4BDQ A;  4Q5T A;  2NWJ A;  1Q1K A;  3Q26 A;  1MY0 A;  3PPP A;  2PBW A;  3G7W A;  4R6H A;  1B5H A;  1NNK A;  4MH5 A;  4JWX A;  3KEI A;  3TQW A;  3UOR A;  4R75 A;  3T9V A;  2R6G E;  3E4R A;  2B88 A;  4EQ9 A;  3EPE A;  4WKM A;  3UIF A;  1IEJ A;  2FYI A;  3FJM A;  1L5T A;  1OVR A;  2QJE A;  2B3B A;  1T0K A;  1QUJ A;  3E13 X;  4IO4 A;  5DEX B;  4NWD A;  3OEM A;  2HFB A;  1Q2N A;  4M1V A;  4NF8 A;  1P1U A;  3AXF A;  4HCY A;  3OD7 A;  4GLI A;  1CE2 A;  4WXJ A;  4BLA A;  4ZED A;  1EZ9 A;  4LP2 B;  2Q8J A;  1MQI A;  2Z23 A;  4WED A;  3C33 A;  4LA9 A;  2QS2 A;  4R2F A;  2V3Q A;  2WKY A;  3TPA A;  3I3V A;  1NL5 A;  3BFU A;  1POT A;  1DSN A;  3CR9 A;  1MQJ A;  1XHY A;  3PD8 A;  4KQP A;  3KG2 A;  4IO5 A;  1FCK A;  2ZNU A;  2OBG A;  4FIM A;  4R9G A;  3MZ9 A;  3K1P A;  2Y84 A;  1QJM A;  4POW A;  5CBN A;  2I58 A;  4K3F A;  1S3J A;  3N94 A;  1XVX A;  4F3S A;  3GLB A;  1P1Q A;  1UTH A;  1S7Y A;  5ISU A;  1FTL A;  3KOT A;  4ZZE A;  5I2N B;  5B7D A;  1DTG A;  3F11 A;  4OTE A;  1JQF A;  4AB5 A;  2XD3 A;  1B6H A;  2B87 B;  1FW0 A;  3IB0 A;  3QAX A;  3ZS6 A;  5H8H A;  4ZNC A;  3MZB A;  4FAJ A;  1D9Y A;  3M3K A;  4ZE9 A;  2XXU A;  4YB5 A;  1P1N A;  2HEU A;  3D4C A;  1BIY A;  4GXS B;  1FQA A;  3S1K A;  1GV8 A;  4O3A A;  2DOJ A;  1Y3P A;  4FED A;  4O3C A;  1FQE A;  1FQC A;  1YPN A;  3ZKK A;  1LT1 A;  3CIJ A;  1OVU A;  2VP1 A;  4X9T A;  3H7M A;  3TFL A;  1Y4T A;  1QVS A;  3CSB A;  4E0W A;  5I56 B;  2B65 A;  1LAX A;  1JVY A;  3MUQ A;  1NFT A;  3I6V A;  4RXL A;  1IXH A;  1H45 A;  4OER A;  1RYO A;  4LON B;  3VXC A;  4R9F A;  4HW8 A;  3SEV A;  1OIB A;  4KR5 A;  1MDP 1;  1SD3 A;  4YIC A;  3KGC A;  1FTM A;  5I58 A;  4QFO A;  4BDL A;  2H98 A;  4DIG A;  5AA2 B;  5HM4 B;  2B89 A;  2Q89 A;  3S9L C;  1B3F A;  2XXX A;  4G8M A;  1R1N A;  1NNF A;  2NUV A;  5ELV A;  2F6P A;  3IO6 A;  4HCW A;  3HHF A;  5BWJ A;  1B3G A;  1AOV A;  4F31 B;  4P0I A;  2ZNS A;  3H6V A;  4OZ9 A;  3OO8 A;  3MWB A;  5DVI A;  1JMB A;  1M5C A;  1A7L A;  1B58 A;  1LFG A;  3A3U A;  3O28 A;  3DLN A;  2LXC B;  5I2K B;  4EQ7 A;  4G68 B;  3MQ9 A;  1US4 A;  3PV0 E;  1EDI A;  3IX1 A;  3RT8 A;  1BDD A;  4YU0 A;  2HAU A;  3GZG A;  3TYH A;  1H0T A;  4OET A;  3SEW A;  4YAH X;  3T9X B;  3FXR A;  2ZYN A;  1SYH A;  3C34 A;  3TTR A;  2PT1 A;  4Q30 B;  3UGW A;  1GR2 A;  1AL3 A;  4NF6 B;  3O97 A;  3PMX A;  4ZEC A;  2RF1 A;  3EF7 A;  3DM0 A;  1MQG A;  4KCD A;  4YB6 A;  4ASW A;  2KIK A;  3LSW A;  2XHD A;  5KZT A;  2DSF A;  4GWO A;  3R7X A;  4DXU A;  4FEB A;  4QFL A;  1B51 A;  1YTV A;  5HBC A;  3G3F A;  4ZEB A;  3FVG A;  4GRK A;  2LXB A;  1UTH B;  4QFK A;  2OJT A;  1TWY A;  4OVJ A;  3TTM A;  4BDM A;  4FOR A;  4YMA A;  2XXW A;  3S2V A;  2DWH A;  3DP8 A;  2QMW A;  2UVG A;  1I69 A;  1QUI A;  2OWT A;  3RN8 A;  2QMX A;  1FTJ A;  4NPE A;  3MBP A;  1IIT A;  3O2A A;  1SW2 A;  1DPP A;  4XIG Q;  4ZE8 A;  3K6U A;  1LGB C;  4ASV A;  1LCT A;  2I6E A;  1IQ7 A;  3FVK A;  3TOD A;  5K5G B;  3GBB A;  3OO9 A;  5CBR A;  1N0T A;  3FXQ A;  1XS5 A;  2XXP A;  4KCC A;  2REJ A;  2F97 A;  3B6Q A;  4H5G A;  4OWD A;  5I84 A;  3IOW A;  3TQL A;  3TTL A;  4QSE A;  4EDP A;  1Z7N E;  4DCY A;  1DMB A;  3PUV E;  4H0W A;  4YKJ A;  2ZMB A;  2VHA A;  3C35 A;  4X1B A;  4MBP A;  2Q1K A;  3K2D A;  5L9M A;  1P99 A;  1POY 1;  3CFZ A;  3DP6 A;  1N84 A;  1SI0 A;  1VSO A;  4OMB A;  2O84 X;  4G68 A;  1D4N A;  4F39 A;  4OEN A;  1F9B A;  1N04 A;  3U8Q A;  1P1W A;  3W15 C;  1B7H A;  3FD3 A;  2KUB A;  3RUM A;  3R26 A;  3IOT A;  1LFH A;  1SW1 A;  4RK9 A;  4KD5 A;  4FJP A;  3IOU A;  3IOV A;  4BXL A;  1URS A;  4DXC A;  2ZAE B;  3O6I A;  5CMC A;  1SW4 A;  3IO4 A;  1B3H A;  5DT6 A;  2ZYO A;  2A5T A;  2F8D A;  2FNC A;  5I2K A;  3L6G A;  2HXW A;  5KCJ A;  4X1D A;  1B0L A;  3EN3 A;  2DVC A;  5FTI A;  3TDJ A;  2Y7R A;  3S4U A;  5DYH A;  1UIU A;  2OWS A;  3CG3 A;  1LB8 A;  1USY E;  2R44 A;  4E0X A;  4F2Q A;  3B7D A;  4QSC A;  5H8N A;  4XTC Q;  3ZSF A;  4OFO A;  2V93 A;  1USY H;  2AYS A;  2VOZ A;  3PPN A;  3FXU A;  3FJ7 A;  3RY3 A;  5DVF A;  4TQU Q;  2B3F A;  4JWY A;  5AA4 B;  1MH4 A;  3IL1 B;  5K2Y A;  3JV9 A;  3FXD A;  2X7P A;  4EQB A;  3H3G A;  3N5L A;  3M3L A;  2LAO A;  3T96 B;  2O1L A;  3E9X A;  4DZ1 A;  2I4C A;  1ZLQ A;  1JET A;  4KHZ E;  4Z0I A;  3FIR A;  3LBS A;  2W7Y A;  4WWI A;  2E0S A;  1MDQ A;  1PC3 A;  2M8C A;  1B1X A;  5H8F A;  4CPG A;  2ONK E;  1M5F A;  1NNT A;  4OES A;  4UA8 A;  1KWH A;  4DE8 A;  1HSE A;  4RPN A;  1Y1M A;  3FJG A;  1GVC A;  1SVX B;  4HKZ H;  3IK6 B;  4IO6 A;  3MP1 A;  1JW4 A;  4F3P A;  5EFW B;  2P1S A;  4RA1 A;  2RC9 A;  1ZMG A;  1R9L A;  2P2A A;  4DXB A;  3VLV A;  1N7W A;  2QS3 A;  2Q2A A;  3VLU A;  2OLB A;  2GRV A;  3TMG A;  1LFI A;  1A99 A;  4AB6 A;  2RC7 A;  3MPK A;  1B4Z A;  4H1X A;  4PFT A;  2FA7 A;  2RCB A;  1MY4 A;  3Q29 A;  3HHG A;  1EDJ A;  1MXU A;  2H5Y A;  4YKP A;  3MZ1 A;  3QSL A;  4LZ5 A;  5EYF A;  5TU0 A;  3QUF A;  4IO2 A;  3PPO A;  2NVU B;  4EF2 A;  1MG1 A;  3TEP A;  4NF4 B;  3EHS A;  2GHA A;  4QFP A;  3RNN A;  4X48 A;  1MXX A;  4ZDM A;  3WAF A;  4R73 A;  2Q9T A;  3QUJ A;  2RCA A;  3OMB A;  2OTK E;  1XT8 A;  4L17 A;  2GHB A;  3RT6 B;  1MM6 A;  5I57 A;  4NMY A;  4IY5 A;  2XXR A;  1JW1 A;  5DJU B;  1LCF A;  3V83 A;  3THI A;  5CMB A;  3MPL A;  1D9V A;  1II5 A;  2DYX A;  1N3X A;  4K35 A;  3MC2 A;  1LAF E;  2VGQ A;  2F7B A;  5ITO A;  5AA2 D;  1TT1 A;  1SS1 A;  4ELR A;  4H8I A;  1MS7 A;  1IXC A;  1MXW A;  3PUW E;  1Y1Z A;  3K1M A;  4IO3 A;  3PUY E;  2D3I A;  5M2V A;  2I4B A;  2X26 A;  1NNP A;  5DJT B;  1MPC A;  3VDF A;  3FZV A;  2O68 A;  1B3L A;  2WMM A;  2R9J A;  1H0T B;  2QL3 A;  1UQW A;  1HSL A;  4LUB A;  4DCX A;  1LB9 A;  3BKI B;  1IZ1 A;  5A5X A;  3KFM A;  5DEX A;  4NPD A;  4H5F A;  4I8C A;  2HZK A;  3E3K A;  3G3K A;  4F22 A;  4LAT A;  1VFE A;  4ND9 A;  3ZDM A;  1XC1 A;  5H8S A;  1FQD A;  3L6H A;  3V89 B;  2ZXT A;  2ONR A;  3KN3 A;  2YJP A;  3USD A;  4MN4 C;  1QKB A;  1O7T A;  4GVO A;  3H06 B;  4ESX A;  4YKK A;  1MXV A;  4KYD A;  4H6D A;  5JTY B;  3B6W A;  4MLQ A;  3U92 A;  3PMW A;  1MRP A;  3VV5 A;  4PE5 B;  3BFT A;  3TTK A;  1SYI A;  3PD9 A;  2O6A A;  5FHO A;  3OEL A;  3C32 A;  2HR3 A;  3VE1 B;  2V3U A;  1LAG E;  1JVX A;  2BJJ X;  4KJM A;  2HAV A;  1A54 A;  2JWD A;  4NPF X;  3T22 A;  1MQH A;  4HB1 A;  3JZJ A;  1M5E A;  4QFN A;  2XX8 A;  3RLF E;  3ILU B;  3OEK A;  1NMU A;  4JSD A;  4GXA A;  1MPB A;  4PET A;  1A40 A;  2REG A;  5IKB A;  3FAS A;  4ISU A;  1EZP A;  4NE4 A;  2PT2 A;  5DVJ A;  2ABH A;  3RTF B;  4N6P A;  3KN7 A;  4U2R A;  3HPI A;  2ANJ A;  4N07 A;  5CBS A;  3KJT A;  3S9E A;  2XXQ A;  2DE4 A;  4H67 A;  2H25 A;  1H44 A;  3SEY A;  4IOI H;  3TCH A;  2K3R A;  1OQH A;  2IEE A;  4ELO A;  1IXG A;  3QYT A;  5KDT B;  3FVO A;  1M5D A;  1I6Q A;  3IAZ A;  5AA3 A;  4PFY A;  3LSF B;  5EHM A;  1A8E A;  3PMV A;  3G3I A;  3KOS A;  5AA4 A;  2DQV A;  3ILT B;  5H8H B;  3LR1 A;  5I58 B;  5IAI A;  4YB7 A;  1B2H A;  2O69 A;  1FC2 C;  3OOA A;  3IB1 A;  5EHS A;  2XXY A;  1Y47 A;  1BKA A;  1P1O A;  1OLA A;  3MVY A;  3LUY A;  1JW5 A;  3T93 B;  5KCJ B;  1QW0 A;  1EDL A;  1I6B A;  1Y3N A;  4F3G A;  1A55 A;  1WOD A;  4JSO A;  3OSQ A;  2XXV A;  2X7Q A;  3HST A;  2Z8D A;  2Q2C A;  3HCQ A;  5I57 B;  1JNF A;  2DP8 A;  4GF8 A;  4H8J A;  1N3W A;  3K02 A;  2ZYK A;  2M5A B;  3CRB A;  1NKX A;  4LVQ A;  2UYF A;  2F35 A;  4BDR A;  5L8D A;  5L9O A;  3UA8 A;  3R6U A;  2XX7 A;  2F6G A;  3MHV A;  4OXV A;  3O6H A;  4RPO A;  3PUX E;  2M0B A;  2XXH A;  1PBQ A;  5DTB A;  5JK4 A;  1DEE G;  1GGG A;  2KS1 B;  3KJ7 A;  2RKM A;  2QSX A;  1EDK A;  4U21 A;  4FAT A;  4GD5 A;  2THI A;  3TCF A;  3D4G A;  3U72 A;  1SI1 A;  2Y7K A;  3SEU A;  2O7U A;  3QWO C;  2RC8 A;  4F2O A;  1PB7 A;  4NF6 A;  3SKP A;  3W9W A;  2H4I A;  4R6K A;  3MVZ A;  1M5B A;  3SET A;  3OXN A;  5ICT A;  2I3V A;  2QVA A;  5K2X A;  3A09 A;  3PUZ E;  1IUD A;  4Q0C A;  4ZZA A;  2OK2 A;  3FV2 A;  1PB9 A;  4ONY A;  1AH5 A;  1ZXG A;  4EUO A;  3N6T A;  2DE2 A;  4C1U A;  2DXY A;  4H65 A;  2A5S A;  2D21 A;  3MW0 A;  4QHQ A;  4Z7E A;  3QXM A;  5AE4 A;  1NVO A;  4YMB A;  2RIN A;  4ZEI A;  2HQ0 A;  4RYA A;  1B3E A;  3G3J A;  4R74 A;  4NTL A;  1Y20 A;  1YAE A;  3DP4 A;  3OSR A;  4U4X A;  1O64 A;  2O51 A;  3MP6 A;  2DXR A;  5I56 A;  3WAE A;  3TEL A;  1JEV A;  5H8F B;  3JYR A;  4RK2 A;  3ODB A;  2YLN A;  4GL8 A;  1BDC A;  2Z8F A;  4OFJ A;  1J1N A;  2Z8E A;  1VFD A;  1O63 A;  4I1D A;  2F7C A;  3DEL B;  5CC2 A;  4TLL B;  5FTH A;  1R6Z A;  1N76 A;  1MXZ A;  1RKM A;  3G3G A;  3OEN A;  1URD A;  2V3T A;  2YPN A;  1VR5 A;  2G29 A;  1H43 A;  3RGU A;  2M5A A;  4PQJ A;  4NF5 A;  1LLS A;  1Z7M E;  3HV1 A;  4RNS A;  3UK4 A;  3MAM A;  4BDN A;  2Y7W A;  2HZL A;  4YKI A;  4ZEF A;  3I5O A;  1D3K A;  5H8Q B;  5ITP A;  2LR2 A;  4HS7 A;  1B7Z A;  4F18 A;  3Q25 A;  2QRX A;  3TTN A;  4NF5 B;  1ANF A;  5I59 A;  5H8N B;  3S9M C;  4THI A;  3SDF A;  3IB2 A;  4G4P A;  1XOC A;  1EH3 A;  4POX A;  1BLF A;  1IIW A;  3FV1 A;  2QRY A;  3V5A A;  3TZA A;  3VLW A;  3UN6 A;  2ZYM A;  5F1Q A;  1OMP A;  3CI8 A;  2OZZ A;  2CZL A;  3LC8 A;  1B40 A;  1MFT A;  1GTK A;  5TP9 B;  1ZBM A;  1U7M A;  1US5 A;  3QK6 A;  2UYE A;  2RKL A;  2I49 A;  4C1T A;  3KBR A;  4U4S A;  4NF4 A;  4DDD A;  5ICQ A;  1LP1 B;  1ZJL A;  3H4Z A;  1JEU A;  2F34 A;  5BUU A;  1NH8 A;  1MY2 A;  4IB2 A;  4IGT A;  5I2N A;  1DOT A;  2I8D A;  2DWA A;  3P7I A;  2UXA A;  4ZEK A;  3VVF A;  2AL5 A;  4PFU A;  3SER A;  1SW5 A;  1SQY A;  1B4H A;  2PVU A;  4GOT A;  1MH3 A;  1TXF A;  3Q28 A;  3KZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...