4JBZA

Structure of mcm10 coiled-coil region
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
401
structure length
401
Chain Sequence
b'MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMGVCQEKSKDELEDELRKMQAQMKKLQEQL'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH XENOPUS LAEVI
publication title Mcm10 self-association is mediated by an N-terminal coiled-coil domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication
total genus 131
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4jbzA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA01
4WWIA 5DEXB 1Z7NE 4R73A 1UIUA 3T66A 2XXWA 3I6VA 1QUKA 3SETA 1U7MA 1WODA 1AMFA 2E1SA 2Q89A 3H6TA 3O28A 2O51A 3PUWE 3G3JA 5C39A 1IXIA 1BDDA 1A54A 3H3GA 1NH8A 5I57B 4FEBA 4F1YA 5LOMA 4H8IA 3PPQA 2PX1A 5AA4A 1S50A 2Q9TA 2LXCB 5H8NB 4KYSA 4H6DA 5DT6A 4ZMDA 3L6GA 1JETA 3O97A 3OO7A 4MFIA 3OO8A 1B0HA 1OIBA 4AQ4A 4IO6A 4IY6A 4GF8A 3SDFA 1PB7A 4GQOA 4ZEBA 4ZZAA 4IGRA 3FZVA 3N6TA 1SI0A 1SYHA 2A5TA 1ZXGA 4IGTA 3DM0A 2XXUA 3S9LC 1OQGA 3FXQA 3OEKA 4BDRA 3IX1A 1ELJA 1LAFE 2HR3A 1B9JA 4N13A 3DP6A 1H43A 1SD3A 2QRXA 1USYH 4C1TA 4G8MA 4RY1A 4GODA 1JMBA 1JEVA 3K4UA 5DVFA 2OCUA 4QFOA 2R44A 3EQ1A 5CRYA 4EF1A 4R9FA 2H4IA 1FTMA 4XIGQ 3W15C 3SEUA 4P0GA 1OMPA 3HSTA 2DVZA 3CRBA 3OEMA 1LAHE 1FTJA 5I59B 1YCJA 3BKIB 2H5YA 1EC5A 4RPNA 3IOTA 3TAJA 3C4MA 1B3HA 1JEUA 2AYSA 5CI5A 4ELQA 4M4GA 1VFEA 4MBPA 4BLAA 2DOJA 3MAMA 4YB6A 4R72A 2ANJA 1MXXA 1Y4TA 1I6BA 4PFUA 2O69A 5ISUA 3SEXA 2F5XA 2Q8JA 4OMBA 2B87B 1DEEG 4ZE8A 5FHMA 3QUFA 3TMGA 2Q88A 2V3QA 4EXKA 4R2BA 2XXXA 3K1PA 3CFLA 2PBWA 5I58A 5F1QA 1DTZA 5EFWB 1DMBA 1M5DA 3U8QA 3A3CA 3H6UA 3L6HA 2Z23A 4ZDMA 4OEVA 4IO7A 1IQ7A 1OLAA 3THIA 3IL1B 4Q30B 2O68A 4YICA 5K2XA 4LZ7A 1D9YA 2XXQA 5F7VA 2ESNA 2P0SA 1NNKA 2VD3A 1MH3A 3Q28A 2I4BA 2I6EA 4F2QA 5M2VA 1MDQA 3MJNA 4I1DA 2V3UA 1B7UA 2QS3A 3VXBA 1MM7A 4IY5A 1SQYA 1PB9A 2DWIA 3VLUA 3N26A 5EYFA 4YKJA 5EHSA 2H99A 3QAXA 4I62A 1P1UA 1PEBA 4QRZA 4FJPA 5L9SA 1JQFA 2RINA 1YPNA 5H8FA 5CBOA 1TFDA 2LR2A 3QIMA 3KOSA 2GHAA 3TODA 4Q8RA 3K6WA 3GXAA 2DE2A 4YMAA 3N5LA 4HCYA 4KI0E 3IO6A 4GWOA 4TLLB 5H8NA 1MDP1 2XX9A 1XC1A 1NFTA 3O2AA 3K02A 3H6WA 1N76A 1TWYA 3FXRA 2F6PA 5I2KB 3RTFB 1BKAA 5AA4B 1UTBA 3SEWA 3TQLA 4POXA 1IXHA 1N3XA 1GTKA 1DOTA 2ZMBA 4EDPA 4BDMA 3MVXA 1LGBC 3IK6B 1QULA 3ZS6A 4YMBA 1LBCA 2ONKE 2RCBA 4NTLA 2PMSA 4NWCA 3LBSA 1MY3A 5H8QA 2H25A 4JB7A 4QF9A 3FVGA 2UYFA 2I3WA 2XXVA 1WVJA 4ELPA 1FQAA 1QUIA 3FXEA 2R6GE 1ZIUA 4O3CA 2Y7IA 2GH9A 4R6KA 2A5TB 1MQGA 3MZ9A 1MPBA 4ZECA 3MHVA 3OMBA 4DXCA 4RA1A 2HEUA 2ONSA 2F7CA 4JWYA 4OHNA 1EDLA 4IO2A 4PETA 3CFXA 3C32A 3RT6B 4DDDA 3RLFE 4OESA 1OVVA 1J1NA 1GV8A 2NUVA 2HCAA 3CSBA 3MWBA 1SDXA 4EF2A 3TELA 3RGYA 5DTBA 4PE5B 4G77A 4LATA 2QRYA 1M5CA 3C36A 2DS9A 3V5AA 2QJEA 1B5IA 3SERA 3G3HA 3K1MA 2F97A 4PFTA 5B7DA 3GBBA 1A55A 1QUJA 4OXVA 5BWJA 1Y9UA 3HHGA 3SEVA 3BFUA 2UWJE 4IO5A 1D9VA 2VGQA 2F78A 2E0SA 1VR5A 3EHSA 3EPEA 4XKNA 4QSEA 1B46A 4F2OA 2O1MA 4IO4A 2V84A 4FECA 1POTA 1R1NA 2OBGA 2DVCA 1FQCA 2REJA 1SVXB 1XT8A 4HS7A 1LP1A 1EDIA 1N7WA 1RKMA 3T96B 1BTJA 2XX8A 1SW1A 3QUJA 3RTWB 3IOUA 5I58B 4FATA 3C35A 2OK2A 3PD8A 2DWJA 3O6HA 3LR1A 3PV0E 5CBNA 2PT2A 3DLNA 4DCXA 3FASA 2VOZA 1QVSA 4LZ5A 2F6GA 3V8XB 3WAFA 4YKIA 1Y3QA 3KG2A 4X48A 3R6UA 4KR5A 1DSNA 1LCFA 1KWHA 5AA3A 1XS5A 4EQBA 3G3IA 3OD7A 4ND9A 2LAOA 1XVXA 3FUZA 2F8DA 3EHTA 4HCWA 5I84A 4KYEA 3QK6A 2UVIA 2PYYA 4ISUA 4F18A 3O9PA 4GOTA 2Y84A 3I5OA 4TOZA 2DWHA 3K6XA 3VLVA 1Y3NA 3LSWA 5KZTA 3VFJA 5BUUA 4H8JA 4UA8A 3B6WA 2QPQA 3DP8A 3H4ZA 3UP9A 3MZ1A 5H8FB 3LSFB 3TZAA 3O6GA 4OETA 4QFPA 4LZ8A 2O7IA 1EZOA 5I2KA 3TQWA 4QFLA 1R9QA 3TCHA 1MQJA 3KSXA 1DTGA 4G2ZA 3H6VA 3KJ7A 3FIRA 1I6QA 5I56B 4NPDA 4OFOA 1I69A 2HAVA 1B5HA 1B7HA 4KD5A 3QWOC 4NF8A 5JK4A 1UTBB 5DVJA 5EHMA 1P1WA 5I2NA 2IA4A 4U22A 3B6TA 1H0TA 3H06B 3Q25A 3JV9A 1FCKA 5H8QB 2DQVA 1LB9A 1MG1A 3ILTB 1SW5A 4HW8A 5FHNA 4ZEDA 1EDJA 1B6HA 1ANFA 3HHFA 3E4RA 4JXIA 2M8CA 4C1UA 1JM0A 2I0CA 5L9OA 1A40A 2XXYA 4H1XA 4NWDA 5IAIA 3PMXA 4LUBA 3S9MC 3PPOA 1ZU0A 4NPEA 4KYDA 3MVYA 4OYVA 5DVIA 2ZNTA 1OLCA 4F1VA 3H7MA 3MVWA 2QS1A 1UTHA 3B7DA 5AA2A 4KPTA 4DXUA 3FGSA 1B51A 3TUSA 2Y7RA 1IITA 4IOIH 3PUYE 1VE4A 1DPPA 4NF4A 3HCQA 1JW1A 2G29A 4LQ2A 4ASWA 2AL4A 3E13X 3IOVA 1RYOA 5K5GB 2ALUA 1MH4A 3CVGA 5CMMA 4IO3A 1TXFA 2B89A 3PD9A 2AL5A 3T9XB 5B70A 2F7AA 5H8SA 3FV1A 3K0VA 2B88A 1NL5A 2D5WA 4F3SA 1QJMA 4EXLA 1MQHA 4F1UA 2D3IA 4X1BA 2GHBA 1B3GA 1SW2A 1TT1A 1H76A 4NPFX 1OVTA 3TTRA 4PFYA 3USDA 1NNFA 4XKQA 1LP1B 1SYIA 1YTVA 2XD2A 2V93A 2F35A 3TKDA 5A5XA 1EZPA 2AIXA 2XXIA 1MQIA 1Y3PA 2PT1A 1LLSA 3RNNA 1O64A 1BLFA 3UIFA 4OVJA 2HAUA 1GR2A 4OERA 4FAJA 1B2HA 4GRKA 2RKMA 2P58A 2X26A 3RGUA 1N0TA 1AH5A 3VVFA 4ZEKA 3UGWA 4G68C 4GL0A 4Z0IA 2THIA 5TPAA 1B32A 2UVGA 4XTCQ 4GIZA 4YZZA 2VP1A 5H8HA 1YAEA 1US5A 2DWAA 4OEUA 1MY1A 3OELA 3S9EA 1US4A 2F7BA 3CG3A 1O7TA 4ZEFA 5FTHA 2OTKE 3FVNA 3HO7A 2DE4A 4EYYQ 1GGGA 2FYIA 3PGFA 4GXAA 1MXZA 4JSOA 4QSCA 3M3KA 3MC2A 3CSGA 3K6UA 1XHYA 4U4XA 1B0LA 1BIYA 2NWJA 5I56A 2F36A 1MXYA 1Q1KA 2Z8DA 4Z7EA 1B05A 2FA7A 4R9GA 4DLDA 5TP9A 2VD2A 3C31A 1NMUA 1A8FA 1MXVA 3E3KA 3SESA 1B40A 4C0RA 5CBSA 3GZGA 2BJJX 1AL3A 3H03A 4MLVA 2KIKA 1CB6A 3G3FA 3OSRA 3UORA 2RF1A 3TFLA 4UACA 1U7JA 1UIVA 4NF8B 4G8NA 4GOFA 4H5FA 2I58A 1L5TA 4KCCA 5ITOA 5I2NB 1JVYA 1IEJA 3MP6A 2OLBA 1H0TB 3TEPA 3OENA 1FTLA 4DXBA 3RY3A 3UA8A 4OFJA 4F31B 1NH7A 2O7UA 3QXMA 3RQTA 1ZMGA 3MPKA 4GXSB 4U1OA 4FE8A 4OWDA 4RXLA 2HXWA 3D4CA 1S7YA 4XXUA 4ELOA 4WXJA 5DYHA 1IZ1A 4OQOA 1MM6A 4QSDA 4ZS9A 3KN7A 2OJTA 2QMWA 2NXOA 1UTHB 4BDQA 1ATGA 3FD3A 1SI1A 5AA2B 1ZTYA 4TLMB 2KZJA 1LAGE 2ZYNA 3RPWA 3GBAA 1JW4A 2M5AA 1II5A 2KS1B 3A09A 1VSOA 2K3RA 4KQPA 3R7XA 4NF4B 1MRPA 4Q5TA 3SEYA 4I9DA 4R2FA 3F11A 3SKPA 1Q2NA 3KN3A 4KHZE 4WEDA 2XHDA 4RK9A 1URSA 3WAEA 3OXNA 4E0WA 1P99A 1LBBA 1MS7A 4DZ1A 4H0WA 4WEPA 2IEEA 3MP1A 3ZDMA 4AB6A 3KOTA 4GLIA 1BP5A 3DP4A 4M1VA 2HFBA 2OWTA 1OVRA 2RC7A 3PUXE 5L9MA 1AOVA 3V89B 3FXDA 3ILUB 4U2RA 3ECRA 5ICTA 4XKPA 4R75A 5CMCA 1FQEA 3CIJA 1ZKBA 4JBZA 3G3KA 3OOAA 4JWXA 2QMXA 3U93A 3Q29A 3PPPA 3PPRA 3N6UA 2I4CA 2NOOA 4BDOA 3C34A 1QW0A 3KN8A 3KGCA 5A5XB 3W9WA 3U92A 1HSEA 3I3VA 5ELVA 1D4NA 4TQUQ 4JDFA 2YPNA 3MZWB 4AB5A 4F39A 2KI7B 1FC2C 4DCYA 3BFTA 1O63A 4ELRA 4H65A 1IXGA 1MPCA 3E9XA 3MW0A 4EUOA 1RYXA 3MBPA 1EZ9A 4NF6A 3C9HA 4CPGA 4LA9A 5TPAB 4BDNA 3PH0A 4MF3A 1B58A 2RKLA 1A8EA 3IB1A 3U72A 3JZJA 3T93B 1GVCA 3V83A 5H8HB 3O66A 4DE8A 1R9LA 2QS4A 3PUVE 1A99A 1PBPA 5CM6A 1Y4CA 5HM4B 3MUQA 1T0KA 1B5JA 3TCGA 2XX7A 4L17A 4Q0CA 3CR9A 2QSXA 3VDFA 4RYAA 2R9JA 1MPDA 3JYRA 2OWSA 3FJGA 3LC8A 3T9HB 2Y7PA 5K2YA 3KJTA 3RT8A 1PC3A 5AE4A 4K35A 3Q27A 2X7QA 3KZGA 1MFTA 4GD5A 1XOCA 2B3BA 2DE3A 2Y7KA 5TP9B 4U4SA 2JWDA 1N04A 4F29A 3FATA 4NE4A 4R74A 3HV1A 2I8DA 2ZYMA 3FVOA 3FXUA 2WKYA 3EN3A 4FEDA 5CMKA 3R26A 4PP0A 5DJUB 1MY4A 1OVBA 4KCDA 3KBRA 2XXHA 3CI8A 4K3AA 3KFMA 1AIVA 4N6PA 3ODBA 1POY1 4G8HA 1B7ZA 5KCJA 1PB8A 2DXRA 4P11A 3VV5A 1Y20A 1DPEA 4U1ZA 2B3FA 1B4ZA 1EDKA 1N84A 1UQWA 4OTEA 1LT1A 2V25A 4YAHX 4P0IA 1EH3A 4WKMA 2XXPA 5CC2A 2ZNUA 1ZBMA 3DELB 4ASVA 3W9VA 1IIWA 1URDA 4G68A 4LVQA 2M5AB 1H44A 2H98A 2GRVA 1LSTA 3C33A 3GLBA 3IORA 4NF5A 4RJZA 5JTYA 3RUMA 1LFHA 1NVOA 4DIGA 1OQHA 1B4HA 2WMMA 3ONMA 4GOEA 4ZE9A 2KLFA 2QL3A 1PBQA 4QHQA 3BBRA 5KDTA 2KZIA 4LONB 3OSQA 4QFNA 3KSJA 3TTLA 3IJOB 3IB0A 5AA2D 1A7LA 1LCTA 3K2DA 3IAZA 3K00A 2P1SA 4OZ9A 5IKBA 1JW5A 1LFGA 4F22A 4OENA 4ECFA 4YB5A 3TDJA 4YKPA 1LAXA 2V3TA 2UYEA 3HN0A 3MVZA 4ONYA 4EQ7A 2XD3A 1N7XA 4BDLA 2CZLA 4ZEIA 3FJ7A 1IXCA 4I8CA 3KEIA 4THIA 3HPIA 1ZJLA 3T9VA 4HKZH 1P1OA 4GVOA 2P2AA 4KJMA 1R6ZA 1CE2A 1N3WA 3MP8A 4R6YA 4XKRA 3TTKA 3M3LA 5HBCA 3FV2A 3OO6A 4ZZEA 2DSFA 2LXBA 3S9NC 1FQFA 1MXWA 2DYXA 5ITPA 1MQDA 2PVUA 3S2VA 3TTNA 4HB1A 2G93A 4X9TA 5TU0A 2I0BA 2SPZA 1NKXA 5FTIA 4NF6B 2DXYA 3PUZE 1IUDA 2OZZA 2M0BA 5DEXA 4MN4C 4O3BA 1MY0A 3MQ9A 1QKAA 2Q2CA 3K1NA 1Z7ME 4K3FA 3IB2A 2RC8A 3IO4A 2I48A 3CFZA 3P7IA 4KFQA 3IJXB 2ZAEB 2ABHA 3K6VA 4F3PA 2ZYOA 4O3AA 3T9UA 1B3LA 5I57A 2I3VA 2DP8A 3QSLA 1PDAA 4FORA 3RN8A 3PU5A 4MH5A 4QFKA 1JNFA 1QKBA 4GFRA 1B1HA 2GFEA 3VE1B 3PPNA 1B3FA 3VLWA 3T22A 4G4PA 5ICQA 4N07A 1H3DA 4HJGH 3PMVA 3K01A 2CMOA 3MZBA 3O29A 4U21A 2H9BA 3M8UA 2I49A 1P1NA 3D4GA 4PFWA 3FJMA 3AXFA 2UXAA 1VFDA 2XXRA 3TPAA 1USYE 1Q35A 4F3BA 2Z8FA 1XVYA 1OVUA 2A5SA 1H45A 1I6AA 2HZKA 3PMWA 2F34A 4RNSA 1P1QA 2QVAA 1ZLQA 3ZKLA 1HSJA 5KCJB 4F3GA 4LQ5A 3EF7A 2Y7WA 4MLQA 4H5GA 3M3FA 4FIMA 3ZSFA 2ZXTA 1B3EA 3TCFA 5I59A 3G3GA 3VVDA 4ESWA 1X0TA 1NNPA 5AA1A 5J1DA 2Q1KA 4YB7A 2B65A 2ZYKA 1SW4A 1Y1ZA 2UVJA 3UN6A 1ZW0A 4GL8A 2KUBA 1JVXA 3G7WA 4X1DA 3Q26A 1URGA 1MY2A 4G68B 1EU8A 1FTKA 4NF5B 1FTOA 2XXTA 4E0XA 1D3KA 3LSXA 5JTYB 5CMBA 1B52A 4ZNCA 2YLNA 4LP2B 2B87A 2VHAA 3N94A 5FHOA 3VVEA 1LFIA 3VXCA 3LUYA 4ESXA 1SS1A 2YJPA 5KDTB 4R6HA 2X7PA 1FQBA 1Y1MA 1M5EA 3IR1A 4EQ9A 2UVHA 1NNTA 3MPLA 3ZKKA 4H67A 4U23A 5CBRA 1TFAA 4HTGA 1F9BA 4PQJA 2FNCA 4RK2A 2O1LA 1MXUA 4RPOA 2ZNSA 2D21A 1M5BA 4JSDA 3U94A 1WDNA 2Z22A 5L8DA 1BDCA 2R71A 3TTMA 3FVKA 4YU0A 1FQDA 3OO9A 2Z8EA 1B1XA 1LB8A 5DJTB 1S3JA 1HSLA 3S1KA 1M5FA 3TYHA 2RC9A 3B6QA 2HZLA 2O84X 2Q2AA 4IB2A 3A3UA 2REGA 4YKKA 2NVUB 4POWA 4OFLA 2W7YA 3IOWA 5HPQA 4JWOA 1S9TA 2O6AA 3EHUA 3CG1A 1Y47A 1FW0A 4NEDA 3S4UA 3O6IA 2RCAA 3U1OA 5JEIA 4NMYA 1SBPA 2ONRA 3QYTA 4BXLA 4F19A 3UK4A 2HQ0A 2QS2A 3LSLA
chains in the Genus database with same CATH superfamily
1U57A 4WWIA 5DEXB 3AEEC 1WRGA 1Z7NE 1LBXA 3PTYA 1N7SD 4R73A 1UIUA 3T66A 2XXWA 1P84H 3I6VA 1QUKA 2E76D 1U7MA 3V4WA 1WODA 3SETA 1AMFA 5AVUB 2E1SA 2Q89A 3H6TA 3O28A 2FHYA 1SQVD 4DI4B 2R32A 3P8CD 2O51A 3PUWE 5ET7A 1LBWA 3G3JA 5C39A 1IXIA 2RN0A 4O8MA 2M8RA 2BCCD 1BDDA 3H32B 1A54A 3SZPA 3H3GA 1NO4A 1NH8A 2IPPA 3LUZA 5I57B 4FEBA 4GWUA 4F1YA 5KJ7A 1YQ3C 4DCKA 5LOMA 4H8IA 2B9BA 1FZAA 1KQFB 3PPQA 2PX1A 2WPRA 4GWWA 5AA4A 1S50A 2H88C 2Q9TA 2LXCB 1DH3A 3V2RA 2ZFCA 5H8NB 4KYSA 4H6DA 1FBDA 5DT6A 4ZMDA 1TU3F 3L37A 3L6GA 2H8PD 4I40A 1FE6A 1JETA 3O97A 3OO7A 2R5BA 4MFIA 1YJNP 3OO8A 1GK4A 1B0HA 1OIBA 3TGUJ 3NTNA 2WT7B 1FOSE 4AQ4A 4IO6A 2XXKA 4IY6A 3H1IJ 1AFOA 4GF8A 3ITKA 1JUNA 1S2EA 3A7OA 3SDFA 2FXOA 5AW7B 1PB7A 4JVDA 1J2JB 4GQOA 4ZEBA 4ZZAA 3KC0A 4IGRA 3FZVA 3HD7A 3N6TA 2WWWA 1SI0A 4BRYB 3G3ZA 1WT6A 1NTZG 5TJHA 1S5LH 2PP6A 4NF0A 1SYHA 1PIXA 4YTPC 1SQXJ 2A5TA 1ZXGA 1G2CA 3L74D 3SWFA 1JOCA 4IGTA 3DM0A 2E43A 3CMEP 2XXUA 5AVTB 3S9LC 1T3JA 5KLVG 4H13C 1NUYA 1K9MQ 2KSJA 1OQGA 3FXQA 5B66E 3OEKA 4GDOA 4BDRA 3IX1A 1CZQA 1ELJA 2Q6QA 1LAFE 2HR3A 1SQPK 3A0HH 1B9JA 4N13A 2FIEA 3JCUE 1M1KQ 3E1RA 3R4YA 3TNUA 3DP6A 1H43A 3WUUA 2QRXA 1SD3A 2MKVA 1USYH 4C1TA 4G8MA 5KJ7D 4RY1A 4QBAA 3HUSA 1PGQA 4GODA 1JMBA 1JEVA 3K4UA 5DVFA 3O6QA 2OCUA 4QFOA 2WITA 4P3LA 1CNQA 3VMXA 2R44A 1HF9A 3EQ1A 2QVRA 5CRYA 4EF1A 4R9FA 2H4IA 1FTMA 4XIGQ 3W15C 3SEUA 4P0GA 1OMPA 4JF7A 1KILE 3HSTA 4N81A 2DVZA 3CRBA 4N6KA 2WSEJ 3OEMA 1LAHE 2N1TB 4PE3A 4O9BA 1FTJA 4MMPA 1NV7A 1ZR4A 5I59B 2BEQD 1YCJA 1IMCA 3BKIB 4D6TD 2H5YA 1EC5A 4RPNA 3HD7D 3IOTA 3TAJA 3GMAA 2HPCB 3H1KG 1IMDA 2VPNA 3L35A 3C4MA 4IFDK 3H1IE 1B3HA 1JEUA 2AYSA 5CI5A 4ELQA 4M4GA 2R8TA 1VFEA 4MBPA 4BLAA 2DOJA 3MAMA 4YB6A 4R72A 5AW5B 3B5NB 2ANJA 1PZQA 1EZVD 1MXXA 4U3FG 1LT9C 1FZGA 2Q3EA 3RK3C 1Y4TA 1I6BA 3L70G 1IC2A 1NTMJ 3KXDA 4OGQB 4DJGA 2W8ZA 1FPIA 5IGAA 4PFBA 4PFUA 2O69A 3H25A 5ISUA 5F24A 1FDIA 3SEXA 2F5XA 2Q8JA 5KTBA 1KQLA 1SQVE 4OMBA 3P8CE 2B87B 1GW4A 1DEEG 4P8BA 1VF5B 4ZE8A 5FHMA 3CXHE 3U1AA 3G71P 3QUFA 1X22A 3TMGA 2ZYAA 4GT1A 3GYYA 3LV0A 4GX6A 2Q88A 5AVVB 2V3QA 1UIXA 4JYBA 3T97A 4EXKA 3GHGA 4R2BA 4H0LB 1KYOD 1OMIA 1L0LJ 1VQLP 2XXXA 1BGYJ 3RK2D 2FY8A 3K1PA 1S9KE 3CFLA 2PBWA 3M91A 5I58A 3HE5A 1X79B 3MUDC 5F1QA 1DTZA 5EFWB 1DMBA 5AVWB 1M5DA 3U8QA 3A3CA 5APTA 2KLVA 2O01N 3H6UA 3L6HA 5I7IA 1PGJA 3IN6A 2Z23A 4OEVA 4IO7A 4ZDMA 1IQ7A 1OLAA 3THIA 2E76B 3IL1B 4Q30B 1T2KC 2O68A 1VQMP 4YICA 2W83C 5K2XA 4LZ7A 1D9YA 2XXQA 5APUA 1QL2A 4NX1A 2ZT9D 4Y99C 4MAGA 4N78D 1GTWA 2ESNA 5F7VA 2P0SA 1NNKA 2VD3A 1LTJC 2R3SA 1MH3A 3Q28A 2I4BA 2I6EA 4F2QA 2FYZA 1N73C 1YHQP 3A5TA 5M2VA 1MDQA 3MJNA 4I1DA 2V3UA 5EYHA 2JR8A 1Q86Q 1B7UA 2XNXA 2KOGA 3MYUA 2QS3A 3Q5PA 3VXBA 3A0BE 2G3AA 1USEA 1MM7A 4PJ0H 4IY5A 3D6YA 4NN3A 3AE1C 1SQYA 1PB9A 2DWIA 4IL6E 4GWZA 3VLUA 5GTIE 3N26A 1JTHA 5EYFA 4YKJA 5EHSA 1NTME 2H99A 3QAXA 4H44C 4I62A 5KKZC 3CCQP 2JP3A 1P1UA 1PEBA 5FBPA 1FS0E 4QRZA 1HWTC 3L73D 3N4XA 4FJPA 5L9SA 3V2NA 1JQFA 2NPSC 2JKVA 1YPNA 2RINA 2CZKA 4O94A 5H8FA 1G1JA 5CBOA 1TFDA 1DBZA 1FPDA 1NTZJ 2LR2A 3QIMA 3E78A 1SQVK 1KMIZ 3KOSA 1L0LE 4UB8E 2GHAA 3TODA 4Q8RA 4OVNF 3K6WA 2Q9IA 5AW0B 3KC1A 1RH5B 1BCCD 5AW8B 3RK3E 3GXAA 2W6JH 2DE2A 3VP8A 4YMAA 1Q90D 3N5LA 4D6TE 4HCYA 4KI0E 3IO6A 2FYNC 4GWOA 4TLLB 5H8NA 1MDP1 2XX9A 4YXWH 2QVVA 1XC1A 1L4AA 1NFTA 3IR9A 4WY4A 1HTLC 3O2AA 3K02A 3AEDC 4OVPA 5I3SA 3H6WA 2H7HA 1L0NG 1LBYA 3AEBC 3BCCG 1N76A 1TWYA 3FXRA 5CCGA 1VL2A 2F6PA 5I2KB 4N8YA 3RTFB 1BKAA 1EZVE 5AA4B 1FPLA 1UTBA 3SEWA 3F5HA 3TQLA 4POXA 2W6AA 1IXHA 4OVQA 4TLFA 1N3XA 1GTKA 1DOTA 2ZMBA 4EDPA 3AE3C 2Y5LA 2KXPB 4C7RA 3TDKA 1SFCC 4BDMA 3MVXA 2KR0A 1LGBC 3IK6B 1QULA 3ZS6A 2Z5IA 4YMBA 1FZCA 3AE9C 1LBCA 1PPJD 2ONKE 2RCBA 4NTLA 2PMSA 4NWCA 3VTPC 2WYKA 3LBSA 1MY3A 5H8QA 2H25A 4JB7A 3AE7C 4QF9A 3FVGA 2UYFA 2I3WA 2XXVA 1WVJA 4ELPA 1FQAA 1QUIA 3FXEA 2Q74A 1KA1A 2R6GE 3HD7B 1ZIUA 3KBZA 4O3CA 2DDKA 1PV3A 2Y7IA 2GH9A 4P47A 1AQTA 5AVYB 1IMAA 2BJIA 2A5TB 4R6KA 1MQGA 4JPZB 3H1KJ 1G2CB 3HTKA 4P9KA 3B4SA 3MZ9A 1MPBA 2J58A 2WSCH 3KHUA 4ZECA 1NTMK 3MHVA 3OMBA 2P2UA 4DXCA 1YI2P 4RA1A 2HEUA 1R5SA 1KB9E 1E79H 2ONSA 1XI6A 2F7CA 2JJKA 4JWYA 4U3FJ 4OHNA 1EDLA 4BWNA 4IO2A 1RDYA 4PETA 3L70J 3CFXA 5B66H 4WY4D 3C32A 3RT6B 4DDDA 3TNUB 3RLFE 4OESA 1OVVA 1J1NA 1KA0A 3BIGA 1GV8A 2NUVA 2HCAA 1VQ4P 1KZUB 1GDTA 1M56D 3CSBA 3MWBA 1SDXA 4EF2A 5EQ7A 3TELA 3HUSB 1OW6A 1EXIA 3RGYA 5DTBA 1L0LK 3O6QB 4PE5B 4G77A 5AW9B 4GX4A 2QJKB 1RE3A 1Y9BA 3CL3D 3H1JD 5GTHE 4LATA 4W7YA 2XV5A 1QVGO 2QRYA 1M5CA 5EYGA 3C36A 4PV1B 2DS9A 4MEVA 2L91A 1XTCC 5L8RJ 3V5AA 1SQVG 2XWOA 1HUCA 2FFDA 2QJEA 4P1EA 1AQ5A 1B5IA 3FBPA 1IFJA 2IX7C 4JQ0D 2YNYA 1QGXA 3SERA 3G3HA 1FBMA 2BCCG 3L75D 1FPEA 3K1MA 5AVZB 2F97A 4PFTA 4RKUJ 3G4SP 4RO0A 4C7NA 2ZT9B 1FZFA 2JWAA 3GBBA 5B7DA 1JY3N 2GUSA 1A55A 1RF0C 1QUJA 3MP7B 1H89A 4OXVA 5BWJA 1Y9UA 3HHGA 3SEVA 3MIWA 3BFUA 2UWJE 4IO5A 1D9VA 4EOTA 2VGQA 2F78A 2CPBA 2E0SA 1JCCA 1VR5A 1UIIA 2E74D 3EHSA 3H1KE 3EPEA 4XKNA 3Q5RA 3SWYA 3CXHI 4QSEA 3M0DC 1B46A 4F2OA 2O1MA 4IO4A 2V84A 1NAFA 4FECA 2POHA 3CWBD 3L72D 1POTA 4I2LC 1R1NA 2OBGA 3AEAC 2DVCA 1FQCA 3U65A 2REJA 4JVCA 3AE5C 2N1TD 4L76A 1N86A 1SVXB 1XT8A 4U3FE 4HS7A 1LP1A 4EI2A 3H1JJ 1EDIA 1N7WA 3L74G 3L70E 1RKMA 3H1HD 1NAYA 3CXHH 3T96B 2KP8A 3T97B 1BTJA 2XX8A 3GHGB 4HYTB 2NRGA 4NHBA 4UB6E 3SFEC 2WZ7A 1SW1A 3QUJA 3RTWB 3IOUA 3ABVC 2Y9ZA 5I58B 4FATA 3HE5B 1IFIA 3C35A 2GQ1A 4R4MA 1LTBC 2OK2A 4IR8A 2V4CA 4PAFA 4I6MC 3PD8A 5EQ9A 1MZ9A 2DWJA 1PPJE 1VDFA 1KZ8A 4MCOA 3O6HA 3LR1A 3PV0E 3B5ND 2XU6A 5CBNA 1HJ0A 2PT2A 3DLNA 4PF8A 4DCXA 3FASA 1YYZA 1NTKD 2VOZA 4N17A 2A06D 4OGQD 1LNQA 1NV0A 1QVSA 4LZ5A 3E7KA 2F6GA 3V8XB 3WAFA 4YKIA 1Y3QA 2WSEH 3KG2A 1KQSO 1FBGA 4XE5B 4X48A 1K05A 2QIWA 3R6UA 4EIJA 4KR5A 1DSNA 1LCFA 2WPVB 4N6DA 1KTMA 1KWHA 1VF5D 5AA3A 1XS5A 4N3YB 4EQBA 3G3IA 3OD7A 4ND9A 1OXZA 3SSUA 4HH2A 2LAOA 1R5LA 1XVXA 1L0NJ 3BCCJ 3FUZA 2F8DA 1EQ7A 3EHTA 4HCWA 5I84A 4KYEA 3QK6A 4D6TG 2UVIA 1Q81Q 4GIFA 2PYYA 3F89A 4ISUA 4F18A 2C0WA 3O9PA 4GOTA 3II6A 2Y84A 3I5OA 3H1HJ 4IL6H 4TOZA 2DWHA 3K6XA 5GTIH 3VLVA 2M3EA 2Q8MA 1Y3NA 2QJPC 2KK7A 3LSWA 5KZTA 3VFJA 1JY2N 4WB4A 5BUUA 4AUWA 4H8JA 1URQC 4UA8A 3B6WA 2JDIH 3VMZA 2QPQA 3L71D 3DP8A 2YXQB 3H4ZA 2IZ1A 1EZVG 2WVRA 3UP9A 3MZ1A 4H0LC 3H1JE 4PTKA 5H8FB 1RF1A 3LSFB 3TZAA 3O6GA 4OETA 1M8OB 4QFPA 2OYOA 4LZ8A 3G6EP 2O7IA 1N7LA 1JB0J 1EZOA 5I2KA 3TQWA 4UB8H 5CMZA 1Q7YQ 3W68A 4QFLA 4KT0J 1R9QA 3TCHA 3I5CA 2WSFJ 3WU2E 3GW6A 1MQJA 1N7SC 3KSXA 2V7QJ 2C0XA 1DTGA 4G2ZA 5IZ1A 3H6VA 1L4AB 3RYDA 2E76C 3KJ7A 3FIRA 4WY4B 1T6AA 2JJLA 3RBXA 4C46A 3CX5E 3MTUE 1I6QA 5I56B 3PLNA 4NPDA 5IZ3A 5CCHD 4OFOA 1I69A 2HAVA 2Q5UA 2HPGA 3K5BA 1B5HA 1B7HA 1VQ6P 2YKPA 4KD5A 5ET6A 3QWOC 2W90A 4NF8A 5JK4A 1BSNA 1YXIA 1UTBB 3CCMP 5DVJA 5EHMA 4I3EA 2D2CB 1P1WA 2H43A 5I2NA 2IA4A 5AW4B 4U22A 2IBZD 4G61A 1GK6A 1ZR2A 3B6TA 3L72E 1H0TA 1L0NE 3H06B 3Q25A 1FZCB 3BCCE 3PJSK 3JV9A 1FCKA 2OYHA 5H8QB 2DQVA 3L71J 1LB9A 2J5UA 4NAPA 1MG1A 3ILTB 1SW5A 4HW8A 5FHNA 3S9OA 1SQVJ 4ZEDA 4Y28J 1EDJA 1W2EA 1ANFA 1B6HA 4GWXA 2W27A 3HHFA 2K9YA 1IFNA 3E4RA 4JXIA 2M8CA 3E79A 3H1HE 4W80A 5H2FE 2ZZXA 4C1UA 1JM0A 2I0CA 4H46A 5L9OA 1NU1D 4N15A 1FBHA 2BCCJ 1A40A 2XXYA 5KLIB 1N2DC 1NYHA 4H1XA 4NWDA 1AJYA 1HBWA 5IAIA 3PMXA 4LUBA 3S9MC 1KB9I 3PPOA 1ZU0A 4NPEA 4KYDA 3HTKB 3MVYA 3CCLP 2NZ2A 4OYVA 2FBPA 5DVIA 2YO3A 1Y8AA 2ZNTA 2E74B 1X9VA 1OLCA 4F1VA 3M9HA 3H7MA 3MVWA 1HH0A 2QS1A 1UTHA 4XA4A 1S5LX 3CMAP 1KB9H 3AEGC 2WTYA 3B7DA 5AA2A 3L73G 1P84D 1KD1Q 2O1KA 4KPTA 4DXUA 1NGMB 2J59M 4PAIA 3FGSA 1B51A 3TUSA 2Y7RA 2AEJA 1IITA 4IOIH 4I7ZB 3PUYE 5KJ7C 4PDHA 4KHXA 2PAJA 3V2QA 1VE4A 1DPPA 3L74J 1BCCG 2OTLP 1OIPA 4NF4A 3HCQA 1JW1A 1FPFA 2G29A 2F3BA 3H1LD 4LQ2A 5GTHH 1HJBA 4N91A 4ASWA 2AL4A 3E13X 2KNCA 2FFDB 1KN7A 3IOVA 2H89C 1RYOA 5K5GB 2YO2A 2K9JA 2ALUA 1MH4A 2ZYDA 3CVGA 1BE3D 4IO3A 1TXFA 5CMMA 2B89A 4NQ8A 3PD9A 2AL5A 3T9XB 5B70A 5AW2B 5BVZA 3TK1A 3M9QA 2QSIA 2A45G 2P67A 3L71E 2F7AA 3HD7C 2P3NA 4C7NB 5H8SA 3FV1A 3K0VA 1IFPA 2B88A 1YIJP 1NL5A 1OWAA 3U59A 2D5WA 2IFNA 3C8VA 5ET8A 4F3SA 1QJMA 3B8EB 5ET5A 4ZKUA 1N8RQ 1FJ6A 3RL0B 2KQZA 1L0NK 3KZIH 2BCCE 5I5PA 1PPJG 2QM7A 4EXLA 3CCUP 1ZV8A 2YXRB 1MQHA 3B50A 4F1UA 2D3IA 4X1BA 2GHBA 1FBCA 4L75A 1B3GA 1SW2A 1TT1A 2KYVA 1H76A 3IFCA 4NPFX 5AVQB 1OVTA 4PV1D 4LGDE 1ZN5A 4D6TJ 3TTRA 3CCRP 1SQBD 4PFYA 3BRVB 1NNFA 4XKQA 1PP9D 3USDA 3P32A 1LP1B 1SYIA 1YTVA 2XD2A 2V93A 2F35A 3TKDA 5A5XA 1EZPA 1JY3P 2AIXA 2XXIA 1MQIA 1Y3PA 2PT1A 2OYIA 1LLSA 1QL1A 3HUSC 3IF4A 3RNNA 1O64A 3FWLA 1BLFA 2YIUC 3UIFA 1X8YA 4OVJA 5IZZA 1FJPA 2A45H 2HAUA 1GR2A 3JC22 4OERA 3GLMA 4PD4I 4HE2A 4UB6H 1RE4A 4FAJA 3RK2C 5APWA 1B2HA 4GRKA 3I55P 4IFFA 1DD3A 3L74E 5APVA 4OH8B 2RKMA 2FKWB 2P58A 4P1LA 2X26A 2FYUD 3AE2C 2CK3H 4R4LA 3RGUA 1N0TA 1AH5A 4OWFA 3PP5A 4ZEKA 3VVFA 1NUZA 3UGWA 4G68C 1QX8A 4GL0A 4Z0IA 2THIA 5TPAA 4PD4H 1NU1E 1B32A 4PF6A 5AW3B 3CC7P 2UVGA 2HHMA 1YTZI 3H1JG 2OARA 2OGUA 2ZT9C 1CW5A 4MNIA 4GIZA 4XTCQ 2VP1A 2XWVA 4YZZA 3I56P 5H8HA 1YAEA 1M1JA 1US5A 3WUTA 2DWAA 4OEUA 2QJYB 1MY1A 3OELA 4OA4A 3S9EA 1US4A 2F7BA 3CG3A 2ITAA 1O7TA 3TF5A 4ZEFA 3CCEP 5FTHA 1SQBJ 4I3YA 1RDXA 1EYJA 2RMZA 3IFMA 1Q9DA 3L75G 1SQQD 2OTKE 3TSIA 4X04A 3FVNA 3MD0A 2DE4A 4H13B 1IFDA 3HO7A 4EYYQ 3JSVC 5B5EH 1P84E 1GGGA 3RPLA 2Y0EA 1M57D 2FYIA 4AS4A 3PGFA 2PGDA 2E75D 4GXAA 1FBEA 2WBDA 2Z4EA 1DCUA 1MXZA 4JSOA 4QSCA 3M3KA 3MC2A 3LW5J 3CSGA 1IMEA 3K6UA 1XHYA 5AVSB 4U4XA 3GHGC 1B0LA 1RF1B 1BIYA 2NWJA 5I56A 5KAFE 3H1LE 3CWBG 3L72G 4LLHA 1NV2A 2OX3A 1FBFA 2F36A 3A2AA 1OW8A 1MXYA 1Q1KA 1R8EA 2Z8DA 3CX5I 4Z7EA 4M3LA 4JVIA 1NI9A 2QE7H 4OVRA 1CSBA 1B05A 2C9LY 2FA7A 4R9GA 4DLDA 5TP9A 2VD2A 1BE3E 1NMUA 3C31A 1A8FA 3H1HG 1MXVA 3EFGA 3E3KA 1PL5A 3FX0A 1B40A 3SESA 4C0RA 1JY2P 2PRRA 5CBSA 3GZGA 3GG2A 2BJJX 3P7KA 1AL3A 3H03A 4MLVA 3L4FA 2AEFA 2KIKA 5IZ3B 4XFJA 1CB6A 3G3FA 3OSRA 1S4XA 3A3YB 1DEBA 3BIHA 3UORA 2RF1A 3L73J 2QA4P 3CX5H 4UACA 3TFLA 1U7JA 3V4QA 1ZRTD 1UIVA 2IYOA 5CJ0A 5APXA 1W2BO 1NJIQ 4NF8B 1XTGB 4GOFA 1D9QA 4G8NA 4H5FA 2I58A 3BATA 4KCCA 1T3UA 4O7MA 2FXMA 5ESYA 1L5TA 1LWUA 3PTZA 5ITOA 2P3VA 2CEXA 4PC9A 1NTKG 5I2NB 1KYOE 1JVYA 1IEJA 4NGUA 3MP6A 2OLBA 1H0TB 1BCCJ 2Y0DA 3TEPA 3OENA 1FTLA 2E5TA 1NU1K 2OYHB 4DXBA 3RY3A 2L5GB 2XDJA 1SQBE 3UA8A 1JNMA 4OFJA 4DZOA 4F31B 3AE6C 5APSA 1NH7A 2B4MA 4EDFA 2O7UA 1SVFA 1IMBA 3QXMA 3RQTA 1ZMGA 4AYCA 1EYIA 2GUVA 1H88A 1HVVA 2P10A 3MPKA 4GXSB 1L4AD 5H2FH 2WPQA 2KSEA 3M0AA 4YXDC 5BU8B 1PGPA 4FE8A 4OWDA 4RXLA 2HXWA 4U1OA 3D4CA 1S7YA 1NV4A 1FSAA 3JCUH 4PGNA 4XXUA 4ELOA 4N78E 2Q7CA 4WXJA 5DYHA 1SQPD 1FJ9A 1GU4A 1JCDA 1IZ1A 4OQOA 5CCGD 1MM6A 4QSDA 3Q1MA 5AVXB 3CLQA 4ZS9A 3KN7A 2OJTA 2QMWA 2XNDH 2FYUE 2NXOA 1UTHB 4BDQA 1LTIC 1ATGA 2D2CD 3FD3A 1SI1A 4PBHA 4DI3D 2AXTE 5AA2B 1ZTYA 3L71G 3BASA 4GBWA 1MFZA 4OVSA 4TLMB 2KZJA 3L36A 1LAGE 1L4AC 1D7MA 2ZYNA 3RPWA 4WY4C 2QM8A 3GBAA 1JW4A 1ZLLA 1VQOP 2M5AA 4OANA 2WSFH 2KS1B 1II5A 1NHLA 3A09A 2VRSA 4XEQA 3KQGA 2V7QH 2K3RA 1VSOA 4KQPA 1PGOA 1EXJA 3R7XA 3CD6P 1GL2A 3L73E 4NF4B 1N73B 1MRPA 4Q5TA 3SEYA 4I9DA 4R2FA 3F11A 3SKPA 1Q2NA 3PHLA 1AVOA 3KN3A 4KHZE 1PFIA 4WEDA 2XHDA 1ZP0C 1SQQE 1JY3O 4RK9A 1URSA 3WAEA 2KNCB 1USDA 3KDPB 1M90Q 3OXNA 4E0WA 1P99A 1A02J 1FZCC 2K9JB 1LBBA 4PCDA 1MS7A 4DZ1A 4H0WA 1BCCE 4MHFA 4WEPA 1KFNA 1RQVA 2IEEA 1KILA 3MP1A 1HGVA 1RHZB 3ZDMA 1W5CE 2KLUA 3EWKA 5KKZB 1YTZT 1DIPA 4AB6A 3KOTA 4GLIA 1QGKB 1A02F 3B71A 3USSA 1BP5A 3DP4A 1JMMA 1URQA 4M1VA 2HFBA 2OWTA 1OVRA 2RC7A 3PUXE 5L9MA 1AOVA 3V89B 1VQNP 2IBZG 3FXDA 3ILUB 4U2RA 2NPSB 1NKNA 1K8AQ 3ECRA 5ICTA 1T8ZA 3N7NA 4XKPA 4R75A 5CMCA 1SQBK 1QEXA 2LKMA 1KFMA 1FQEA 3CIJA 4W7ZA 2ZJSE 1ZKBA 4JBZA 3G3KA 2V4HA 2E74C 3OOAA 4HXVA 5IM2A 4JWXA 2QMXA 3U93A 2K1AA 3Q29A 3PPPA 4N6JA 3AEFC 4ZKPA 1NU1G 2I4CA 2NOOA 3N6UA 3PPRA 3L75J 4BDOA 3C34A 2FYNB 1QW0A 3KN8A 3KGCA 5A5XB 2N1TC 3A29A 3W9WA 2JEEA 1HSEA 3U92A 3I3VA 5ELVA 2E75B 1D4NA 2OYIB 4TQUQ 1OFCX 4JDFA 2QEXP 2YPNA 3MZWB 2XWKA 2WPSA 4AB5A 4F39A 4I7ZC 2R3CA 3HE4A 1GL2D 2KI7B 3MGNA 1RDZA 3QH9A 2FYUK 1RQUA 1RE3C 1FC2C 4DCYA 3BFTA 4P56A 1O63A 2AEMA 1NV3A 1VPCA 3V2PA 4ELRA 1JEKA 1Q82Q 4H65A 4IFMA 2MJZA 4LC1A 1IXGA 3HRNA 2WX9A 3RL0D 4PJ0E 1MPCA 3E9XA 1NOHA 4RJTA 4N8GA 3AE8C 3CWBJ 3L72J 3MW0A 4EUOA 1RYXA 3B5NC 1KILD 3MBPA 1EZ9A 4NF6A 3C9HA 4CPGA 4LA9A 5TPAB 3A0BH 4OGQC 4BDNA 3PH0A 4MF3A 1B58A 2RKLA 1LTSC 1A8EA 3IB1A 5AW6B 3U72A 3JZJA 3T93B 1YJWP 1GVCA 3H1LG 3NFQA 1KC8Q 3V83A 1SQQK 3TGUD 2IZ0A 1M1JB 3RL0g 3D70A 3O66A 2K37A 4U7JA 5H8HB 3VMAA 1VF5C 3H1ID 5LTCA 2Y9YA 4DE8A 1R9LA 2QS4A 3PUVE 1NH4A 1A99A 1PBPA 5CM6A 3OA7A 1BE3G 1Y4CA 5HM4B 3MUQA 1T0KA 3EKIA 1B5JA 3TCGA 2XX7A 4L17A 4Q0CA 2KB7P 3CR9A 1NTKJ 2FXPA 3BRTB 2OQQA 2QSXA 1Z56A 4GX3A 3RPLB 1SQXD 3VDFA 4RYAA 2F3DA 2R9JA 2FIXA 1MPDA 3JYRA 2OWSA 3FJGA 3CCJP 4UABA 3LC8A 4XF5A 1BK4A 3T9HB 3TYYA 2Y7PA 2C9NY 3Q5SA 5K2YA 3L75E 3R2PA 4PAKA 3KJTA 4O7IA 1LBVA 3RT8A 5E79E 1J1DB 1PC3A 2PFXA 1EZVI 5AE4A 2HODA 3CXHD 4K35A 3Q27A 1YBKA 4IL6X 2X7QA 3KZGA 3WMM0 1FU1A 1MFTA 5KAFH 4GD5A 1XOCA 1SQBG 4Z1MH 1FTAA 4I1LA 5TISE 1S9KD 1PP9G 1YYCA 2B3BA 5J16A 2DE3A 3VMYA 3SWKA 2Y7KA 2ZZVA 4U4SA 5TP9B 1ZOYC 2JWDA 1N04A 4F29A 1CI6A 3FATA 4NE4A 2O1JA 2QG4A 3CWBE 4H13D 1LT9A 1H8AA 2Q3IA 4R74A 3HV1A 2I8DA 1VQ5P 2ZYMA 3FVOA 3FXUA 2WKYA 1KYOI 3EN3A 3S4RA 4FEDA 5CMKA 5CCHC 4PFIA 3R26A 4PP0A 1IK7A 2XZRA 5DJUB 1MY4A 1LWUB 2B4LA 1OVBA 3ROJA 2QJYC 4KCDA 3KBRA 1FDMA 2FYUG 2XXHA 3CPWO 5APQA 3CI8A 3KYQA 4K3AA 3KFMA 1AIVA 4N6PA 1KYOH 3M06A 1RY3A 2BASA 3ODBA 1OW7A 1POY1 4G8HA 1GZLA 1B7ZA 5APYA 5KCJA 1GD2E 1PB8A 1QVFO 2DXRA 4P11A 1NTKE 3VV5A 3MUDA 2A06E 2VT5A 1Y20A 1NTMD 2P7JA 1DPEA 3EQ2A 4U1ZA 2B3FA 1E5WA 2Y5KA 3M9BA 1RF1C 1J1EB 1B4ZA 5DW8A 1EDKA 1SQQG 1N84A 1UQWA 4OTEA 5LDZA 1FJKA 2KS1A 4MNPA 1LT1A 2V25A 3LW5H 4YAHX 1FBPA 4GWSA 3QMFA 4P0IA 1EH3A 1NKZB 1LTJA 1ZMEC 2AXCA 1N73A 4WKMA 2XXPA 1L0LD 5CC2A 1NWQA 3O8ZA 2O01J 1BGYD 2ZNUA 4XFEA 4YPCA 3W67A 1ZBMA 2AXTH 3RK3D 3DELB 1K04A 4ASVA 3W9VA 3CCVP 1JP4A 1IIWA 1URDA 4G68A 4LVQA 2M5AB 1H44A 2H98A 1NU1J 2GRVA 1LSTA 3C33A 3TGUE 3GLBA 3IORA 4NF5A 4RJZA 2R5DA 5JTYA 3RUMA 1LFHA 1DX7A 3WUVA 1GL2B 1OZHA 2XA5A 2ZYGA 2FVZA 1NVOA 4DIGA 3E1IA 1OQHA 2HFED 1B4HA 2WMMA 3LIEA 3ONMA 4GOEA 4ZE9A 3OW2O 1MV8A 1NV1A 2KLFA 3D6ZA 1PBQA 2QL3A 4QHQA 1AV1A 1SQXE 3BBRA 5KDTA 2NPSA 2OYHC 3T0JA 1NUWA 2KZIA 1G0IA 4KXPA 4LONB 3BVHA 4HE0A 3OSQA 4QFNA 2HG5D 1KILB 3KSJA 3TTLA 3T1BA 3IJOB 5KAIE 3IB0A 5AA2D 1A7LA 4L73A 1LCTA 4OVTA 2QJPB 2VPOA 1K9YA 3K2DA 2A45I 2RH0A 5EQ8A 3VYIA 3IAZA 3K00A 2P1SA 2WBBA 1URQB 3B8BA 4AS5A 4OZ9A 5IKBA 1JW5A 1LFGA 2OTJP 4F22A 1IK9A 4OENA 1T2KD 1IO4A 4ECFA 2PCRA 4YB5A 2L5VA 3TDJA 3VN0A 2YKOA 1K9ZA 4YKPA 1QLED 1LAXA 3P8MC 4B86A 1FZEA 3H1LJ 2UYEA 2V3TA 3HN0A 3MVZA 1VQ9P 4ONYA 3V5BA 4EQ7A 2WQYC 2XD3A 3OJAB 1N7XA 1HGZA 4BDLA 1NTKK 2QJKC 2CZLA 3FJ7A 1G0HA 4ZEIA 2IFMA 1IXCA 3CHGA 4I8CA 3KEIA 2IBZE 4THIA 3HPIA 1BE3J 1ZJLA 3T9VA 4PV1C 1N7SB 1KB9D 1NTZD 4HKZH 1P1OA 1SLQA 4GVOA 3VOPA 2P2AA 1GU5A 4KJMA 1GMJA 1VQKP 1R6ZA 1CE2A 2DW3A 1N3WA 3MP8A 4R6YA 1SQPG 4XKRA 3TTKA 1SFCA 3M3LA 3FV2A 3OO6A 4QXDA 5HBCA 4ZZEA 2DSFA 1JO5A 1FAVA 3HE4B 2LXBA 2FBWC 3EFFK 5KLVD 4H44D 3S9NC 1FQFA 3AE4C 2WYPA 4WBAA 4PBQA 1MXWA 2DYXA 5ITPA 4MX6A 3PRJA 5M1BA 1MQDA 2XKMA 3C1LA 4RESB 3MSTA 2PVUA 2NPSD 3S2VA 3TTNA 4HB1A 2G93A 4X9TA 1DD4A 3KPEA 5TU0A 2HYNA 2I0BA 4MIJA 1IJDB 2SPZA 1NKXA 5FTIA 2ZVOB 4NF6B 2WEFA 2DXYA 3PUZE 1IUDA 1PP9J 2OZZA 2M0BA 2CEYA 5AW1B 4PGPA 1INPA 5DEXA 4MN4C 2Z5HA 1YQ4C 3RBZA 4O3BA 1MY0A 1VQ7P 3MQ9A 1QKAA 2Q2CA 3K1NA 5T3JA 1Z7ME 4K3FA 3IB2A 2N9YB 2RC8A 3IO4A 2I48A 3CFZA 2IDBA 1FPBA 1SQXK 2O3JA 3P7IA 4KFQA 3Q3DA 3IJXB 2ZAEB 2ABHA 3K6VA 4F3PA 4L74A 2ZYOA 1FPJA 4O3AA 3H32A 5CJ4A 2FYUJ 4WVZA 2HXRA 4PDDA 3T9UA 1FPGA 3G9RA 1B3LA 5I57A 1BGYE 1G1IA 3H1KD 2I3VA 2DP8A 3CC4P 3QSLA 5KLVJ 1PDAA 4FORA 3RN8A 2YMKA 3SFDC 3PU5A 4MH5A 2P1JA 1SFCD 4QFKA 4AQRD 2E75C 2OYIC 1JNFA 1QKBA 4GFRA 4DT0A 3WU2H 1B1HA 2GFEA 4U3FD 2PFYA 2HODB 3VE1B 2WT7A 3PPNA 2W6BA 4PFRA 3L70D 5E79H 1B3FA 1KV4A 3VLWA 1RE4C 1VQ8P 4G4PA 4GBVA 3IFAA 3T22A 1LTGC 1S5LE 5ICQA 2OWZA 3NMDA 1M7LA 4N07A 1GW3A 1SQQJ 4BRYA 1H3DA 2YKQA 4HJGH 1RF0A 3PMVA 3CCSP 3K01A 2CMOA 3VP9A 5TISH 3MZBA 2CPSA 2A06G 3O29A 1CI6B 3Q2YA 4U21A 1LT9B 3CI9A 3RK3B 3CC2P 2H9BA 3M8UA 2I49A 4PD4D 1P1NA 1VDWA 5EQAA 3M0DA 3D4GA 4DOJA 3FWNA 1PP9E 1K73Q 3A0HE 3D1RA 4PFWA 2K88A 3FJMA 3AXFA 1M1JC 1SP4A 2UXAA 1VFDA 4GKGA 2XXRA 1KORA 3TPAA 1USYE 1Q35A 2WSSH 4F3BA 1AWBA 2Z8FA 1XVYA 1OVUA 2A5SA 1H45A 1MKMA 2JO1A 1I6AA 2HZKA 4NG7A 3PMWA 2F34A 2ZZWA 4RNSA 1P1QA 2QVAA 5BU5A 1NTZE 3UIAA 2IYPA 1ZLQA 1EYKA 1HSJA 3ZKLA 1IMFA 3FXBA 5KCJB 4F3GA 4LQ5A 1AVYA 5AVRB 3EF7A 4N4UA 2Y7WA 4MLQA 3TGUG 4H5GA 1BSHA 3H1IG 1FRPA 3M3FA 2I1KA 4FIMA 3ZSFA 1YJ9P 2ZXTA 1LTAC 3C9IA 2N1TA 5KLVE 1B3EA 1J1DC 3TCFA 5I59A 3G3GA 4H45A 3VVDA 1S72P 3IAOA 4ESWA 2HLOA 1AA0A 1IZNB 2YIUB 3ISPA 1LGHB 1X0TA 1YITP 1NNPA 5AA1A 5J1DA 1NV5A 2Q1KA 1SQXG 4Y99B 5CCGC 2HPCA 4YB7A 3RK2B 1LTJB 1L2PA 1VQPP 2XWIA 2GM4A 2B65A 2ZYKA 1NV6A 1SW4A 2N9BA 2D2CC 1Y1ZA 2UVJA 1FZBA 1ZW0A 3UN6A 4GL8A 2KUBA 1JVXA 3G7WA 2M3BA 3B5NA 4X1DA 3Q26A 1URGA 1MY2A 4X8RA 4G68B 2E42A 1EU8A 1FTKA 4NF5B 1FTOA 2XXTA 4E0XA 1D3KA 3LSXA 5JTYB 5CMBA 2ZXXA 3CX5D 3AECC 1S1CX 1B52A 3U1CA 4ZNCA 1LWUC 1SQPJ 4H44B 2YLNA 2B87A 1DK4A 2VHAA 3N94A 4LN5A 4LP2B 5FHOA 3VVEA 3KZIE 4MNCA 1NUXA 1LBZA 1LFIA 4MJOA 5KLIC 1IFMA 1OX3A 2G8YA 3VXCA 3LUYA 4ESXA 1SS1A 1YZ0A 1FDOA 2Y0CA 3D71A 2YJPA 5KDTB 4R6HA 2YMYA 2GA1A 2X7PA 3GF3A 1FQBA 1Y1MA 1M5EA 3OAKA 3IR1A 4EQ9A 2UVHA 4TT3H 1NNTA 3MPLA 2E5YA 3ZKKA 1MUUA 1L0ND 1KQGB 4H67A 3BCCD 4U23A 5CBRA 4GWYA 1TFAA 2ZVNB 4HTGA 3NXSA 1F9BA 4PQJA 2QFLA 5KAIH 2FNCA 4RK2A 2O1LA 1MXUA 2I1JA 4RPOA 2ZNSA 1N7SA 2D21A 1M5BA 2PFZA 4JSDA 3U94A 1WDNA 1J1EC 2Z22A 4FBPA 2IBZI 5L8DA 1ZRTE 2CZHA 1BDCA 3LIDA 2R71A 3TTMA 1NTZK 3FVKA 3NOHA 1SPIA 4YU0A 1FQDA 3OO9A 3HFUA 2Z8EA 4JYCA 2QVUA 1B1XA 1LB8A 5DJTB 4QMAA 1S3JA 1HSLA 1NTMG 3S1KA 1M5FA 3TYHA 1FPKA 5KLVK 2RC9A 3B6QA 2HZLA 2O84X 2Q2AA 2FFDC 4PD4E 3GF7A 5A5LA 4IB2A 3A3UA 2REGA 4A7PA 1SFCB 4YKKA 2NVUB 4HE1A 2O01H 1LEVA 4POWA 5CHXA 1LTTC 4OFLA 5CCHA 2W7YA 3IOWA 1GL2C 3V6IA 1LJ2A 1URQD 5HPQA 1WMKA 4JWOA 1S9TA 2O6AA 1FOSF 1L0LG 3EHUA 2BEZF 3CG1A 1BGYG 2CZIA 1Y47A 2WSCJ 1FW0A 1SQPE 2MKZA 4NEDA 3S4UA 3O6IA 3H6PA 3RL0C 4H0LD 1P84I 2RCAA 1JY2O 3U1OA 3FGAD 4NMYA 5JEIA 1SBPA 2ONRA 5B5EE 3QYTA 1JTHB 4BXLA 4F19A 3UK4A 1KILC 2HQ0A 2QS2A 3LSLA 2ZXEB
chains in the Genus database with same CATH topology
4WWIA 5DEXB 1Z7NE 4R73A 1UIUA 3T66A 2XXWA 3I6VA 1QUKA 3SETA 1U7MA 1WODA 1AMFA 2E1SA 2Q89A 3H6TA 3O28A 2O51A 3PUWE 3G3JA 5C39A 1IXIA 1BDDA 1A54A 3H3GA 1NH8A 5I57B 4FEBA 4F1YA 5LOMA 4H8IA 3PPQA 2PX1A 5AA4A 1S50A 2Q9TA 2LXCB 5H8NB 4KYSA 4H6DA 5DT6A 4ZMDA 3L6GA 1JETA 3O97A 3OO7A 4MFIA 3OO8A 1B0HA 1OIBA 4AQ4A 4IO6A 4IY6A 4GF8A 3SDFA 1PB7A 4GQOA 4ZEBA 4ZZAA 4IGRA 3FZVA 3N6TA 1SI0A 1SYHA 2A5TA 1ZXGA 4IGTA 3DM0A 2XXUA 3S9LC 1OQGA 3FXQA 3OEKA 4BDRA 3IX1A 1ELJA 1LAFE 2HR3A 1B9JA 4N13A 3DP6A 1H43A 1SD3A 2QRXA 1USYH 4C1TA 4G8MA 4RY1A 4GODA 1JMBA 1JEVA 3K4UA 5DVFA 2OCUA 4QFOA 2R44A 3EQ1A 5CRYA 4EF1A 4R9FA 2H4IA 1FTMA 4XIGQ 3W15C 3SEUA 4P0GA 1OMPA 3HSTA 2DVZA 3CRBA 3OEMA 1LAHE 1FTJA 5I59B 1YCJA 3BKIB 2H5YA 1EC5A 4RPNA 3IOTA 3TAJA 3C4MA 1B3HA 1JEUA 2AYSA 5CI5A 4ELQA 4M4GA 1VFEA 4MBPA 4BLAA 2DOJA 3MAMA 4YB6A 4R72A 2ANJA 1MXXA 1Y4TA 1I6BA 4PFUA 2O69A 5ISUA 3SEXA 2F5XA 2Q8JA 4OMBA 2B87B 1DEEG 4ZE8A 5FHMA 3QUFA 3TMGA 2Q88A 2V3QA 4EXKA 4R2BA 2XXXA 3K1PA 3CFLA 2PBWA 5I58A 5F1QA 1DTZA 5EFWB 1DMBA 1M5DA 3U8QA 3A3CA 3H6UA 3L6HA 2Z23A 4ZDMA 4OEVA 4IO7A 1IQ7A 1OLAA 3THIA 3IL1B 4Q30B 2O68A 4YICA 5K2XA 4LZ7A 1D9YA 2XXQA 5F7VA 2ESNA 2P0SA 1NNKA 2VD3A 1MH3A 3Q28A 2I4BA 2I6EA 4F2QA 5M2VA 1MDQA 3MJNA 4I1DA 2V3UA 1B7UA 2QS3A 3VXBA 1MM7A 4IY5A 1SQYA 1PB9A 2DWIA 3VLUA 3N26A 5EYFA 4YKJA 5EHSA 2H99A 3QAXA 4I62A 1P1UA 1PEBA 4QRZA 4FJPA 5L9SA 1JQFA 2RINA 1YPNA 5H8FA 5CBOA 1TFDA 2LR2A 3QIMA 3KOSA 2GHAA 3TODA 4Q8RA 3K6WA 3GXAA 2DE2A 4YMAA 3N5LA 4HCYA 4KI0E 3IO6A 4GWOA 4TLLB 5H8NA 1MDP1 2XX9A 1XC1A 1NFTA 3O2AA 3K02A 3H6WA 1N76A 1TWYA 3FXRA 2F6PA 5I2KB 3RTFB 1BKAA 5AA4B 1UTBA 3SEWA 3TQLA 4POXA 1IXHA 1N3XA 1GTKA 1DOTA 2ZMBA 4EDPA 4BDMA 3MVXA 1LGBC 3IK6B 1QULA 3ZS6A 4YMBA 1LBCA 2ONKE 2RCBA 4NTLA 2PMSA 4NWCA 3LBSA 1MY3A 5H8QA 2H25A 4JB7A 4QF9A 3FVGA 2UYFA 2I3WA 2XXVA 1WVJA 4ELPA 1FQAA 1QUIA 3FXEA 2R6GE 1ZIUA 4O3CA 2Y7IA 2GH9A 4R6KA 2A5TB 1MQGA 3MZ9A 1MPBA 4ZECA 3MHVA 3OMBA 4DXCA 4RA1A 2HEUA 2ONSA 2F7CA 4JWYA 4OHNA 1EDLA 4IO2A 4PETA 3CFXA 3C32A 3RT6B 4DDDA 3RLFE 4OESA 1OVVA 1J1NA 1GV8A 2NUVA 2HCAA 3CSBA 3MWBA 1SDXA 4EF2A 3TELA 3RGYA 5DTBA 4PE5B 4G77A 4LATA 2QRYA 1M5CA 3C36A 2DS9A 3V5AA 2QJEA 1B5IA 3SERA 3G3HA 3K1MA 2F97A 4PFTA 5B7DA 3GBBA 1A55A 1QUJA 4OXVA 5BWJA 1Y9UA 3HHGA 3SEVA 3BFUA 2UWJE 4IO5A 1D9VA 2VGQA 2F78A 2E0SA 1VR5A 3EHSA 3EPEA 4XKNA 4QSEA 1B46A 4F2OA 2O1MA 4IO4A 2V84A 4FECA 1POTA 1R1NA 2OBGA 2DVCA 1FQCA 2REJA 1SVXB 1XT8A 4HS7A 1LP1A 1EDIA 1N7WA 1RKMA 3T96B 1BTJA 2XX8A 1SW1A 3QUJA 3RTWB 3IOUA 5I58B 4FATA 3C35A 2OK2A 3PD8A 2DWJA 3O6HA 3LR1A 3PV0E 5CBNA 2PT2A 3DLNA 4DCXA 3FASA 2VOZA 1QVSA 4LZ5A 2F6GA 3V8XB 3WAFA 4YKIA 1Y3QA 3KG2A 4X48A 3R6UA 4KR5A 1DSNA 1LCFA 1KWHA 5AA3A 1XS5A 4EQBA 3G3IA 3OD7A 4ND9A 2LAOA 1XVXA 3FUZA 2F8DA 3EHTA 4HCWA 5I84A 4KYEA 3QK6A 2UVIA 2PYYA 4ISUA 4F18A 3O9PA 4GOTA 2Y84A 3I5OA 4TOZA 2DWHA 3K6XA 3VLVA 1Y3NA 3LSWA 5KZTA 3VFJA 5BUUA 4H8JA 4UA8A 3B6WA 2QPQA 3DP8A 3H4ZA 3UP9A 3MZ1A 5H8FB 3LSFB 3TZAA 3O6GA 4OETA 4QFPA 4LZ8A 2O7IA 1EZOA 5I2KA 3TQWA 4QFLA 1R9QA 3TCHA 1MQJA 3KSXA 1DTGA 4G2ZA 3H6VA 3KJ7A 3FIRA 1I6QA 5I56B 4NPDA 4OFOA 1I69A 2HAVA 1B5HA 1B7HA 4KD5A 3QWOC 4NF8A 5JK4A 1UTBB 5DVJA 5EHMA 1P1WA 5I2NA 2IA4A 4U22A 3B6TA 1H0TA 3H06B 3Q25A 3JV9A 1FCKA 5H8QB 2DQVA 1LB9A 1MG1A 3ILTB 1SW5A 4HW8A 5FHNA 4ZEDA 1EDJA 1B6HA 1ANFA 3HHFA 3E4RA 4JXIA 2M8CA 4C1UA 1JM0A 2I0CA 5L9OA 1A40A 2XXYA 4H1XA 4NWDA 5IAIA 3PMXA 4LUBA 3S9MC 3PPOA 1ZU0A 4NPEA 4KYDA 3MVYA 4OYVA 5DVIA 2ZNTA 1OLCA 4F1VA 3H7MA 3MVWA 2QS1A 1UTHA 3B7DA 5AA2A 4KPTA 4DXUA 3FGSA 1B51A 3TUSA 2Y7RA 1IITA 4IOIH 3PUYE 1VE4A 1DPPA 4NF4A 3HCQA 1JW1A 2G29A 4LQ2A 4ASWA 2AL4A 3E13X 3IOVA 1RYOA 5K5GB 2ALUA 1MH4A 3CVGA 5CMMA 4IO3A 1TXFA 2B89A 3PD9A 2AL5A 3T9XB 5B70A 2F7AA 5H8SA 3FV1A 3K0VA 2B88A 1NL5A 2D5WA 4F3SA 1QJMA 4EXLA 1MQHA 4F1UA 2D3IA 4X1BA 2GHBA 1B3GA 1SW2A 1TT1A 1H76A 4NPFX 1OVTA 3TTRA 4PFYA 3USDA 1NNFA 4XKQA 1LP1B 1SYIA 1YTVA 2XD2A 2V93A 2F35A 3TKDA 5A5XA 1EZPA 2AIXA 2XXIA 1MQIA 1Y3PA 2PT1A 1LLSA 3RNNA 1O64A 1BLFA 3UIFA 4OVJA 2HAUA 1GR2A 4OERA 4FAJA 1B2HA 4GRKA 2RKMA 2P58A 2X26A 3RGUA 1N0TA 1AH5A 3VVFA 4ZEKA 3UGWA 4G68C 4GL0A 4Z0IA 2THIA 5TPAA 1B32A 2UVGA 4XTCQ 4GIZA 4YZZA 2VP1A 5H8HA 1YAEA 1US5A 2DWAA 4OEUA 1MY1A 3OELA 3S9EA 1US4A 2F7BA 3CG3A 1O7TA 4ZEFA 5FTHA 2OTKE 3FVNA 3HO7A 2DE4A 4EYYQ 1GGGA 2FYIA 3PGFA 4GXAA 1MXZA 4JSOA 4QSCA 3M3KA 3MC2A 3CSGA 3K6UA 1XHYA 4U4XA 1B0LA 1BIYA 2NWJA 5I56A 2F36A 1MXYA 1Q1KA 2Z8DA 4Z7EA 1B05A 2FA7A 4R9GA 4DLDA 5TP9A 2VD2A 3C31A 1NMUA 1A8FA 1MXVA 3E3KA 3SESA 1B40A 4C0RA 5CBSA 3GZGA 2BJJX 1AL3A 3H03A 4MLVA 2KIKA 1CB6A 3G3FA 3OSRA 3UORA 2RF1A 3TFLA 4UACA 1U7JA 1UIVA 4NF8B 4G8NA 4GOFA 4H5FA 2I58A 1L5TA 4KCCA 5ITOA 5I2NB 1JVYA 1IEJA 3MP6A 2OLBA 1H0TB 3TEPA 3OENA 1FTLA 4DXBA 3RY3A 3UA8A 4OFJA 4F31B 1NH7A 2O7UA 3QXMA 3RQTA 1ZMGA 3MPKA 4GXSB 4U1OA 4FE8A 4OWDA 4RXLA 2HXWA 3D4CA 1S7YA 4XXUA 4ELOA 4WXJA 5DYHA 1IZ1A 4OQOA 1MM6A 4QSDA 4ZS9A 3KN7A 2OJTA 2QMWA 2NXOA 1UTHB 4BDQA 1ATGA 3FD3A 1SI1A 5AA2B 1ZTYA 4TLMB 2KZJA 1LAGE 2ZYNA 3RPWA 3GBAA 1JW4A 2M5AA 1II5A 2KS1B 3A09A 1VSOA 2K3RA 4KQPA 3R7XA 4NF4B 1MRPA 4Q5TA 3SEYA 4I9DA 4R2FA 3F11A 3SKPA 1Q2NA 3KN3A 4KHZE 4WEDA 2XHDA 4RK9A 1URSA 3WAEA 3OXNA 4E0WA 1P99A 1LBBA 1MS7A 4DZ1A 4H0WA 4WEPA 2IEEA 3MP1A 3ZDMA 4AB6A 3KOTA 4GLIA 1BP5A 3DP4A 4M1VA 2HFBA 2OWTA 1OVRA 2RC7A 3PUXE 5L9MA 1AOVA 3V89B 3FXDA 3ILUB 4U2RA 3ECRA 5ICTA 4XKPA 4R75A 5CMCA 1FQEA 3CIJA 1ZKBA 4JBZA 3G3KA 3OOAA 4JWXA 2QMXA 3U93A 3Q29A 3PPPA 3PPRA 3N6UA 2I4CA 2NOOA 4BDOA 3C34A 1QW0A 3KN8A 3KGCA 5A5XB 3W9WA 3U92A 1HSEA 3I3VA 5ELVA 1D4NA 4TQUQ 4JDFA 2YPNA 3MZWB 4AB5A 4F39A 2KI7B 1FC2C 4DCYA 3BFTA 1O63A 4ELRA 4H65A 1IXGA 1MPCA 3E9XA 3MW0A 4EUOA 1RYXA 3MBPA 1EZ9A 4NF6A 3C9HA 4CPGA 4LA9A 5TPAB 4BDNA 3PH0A 4MF3A 1B58A 2RKLA 1A8EA 3IB1A 3U72A 3JZJA 3T93B 1GVCA 3V83A 5H8HB 3O66A 4DE8A 1R9LA 2QS4A 3PUVE 1A99A 1PBPA 5CM6A 1Y4CA 5HM4B 3MUQA 1T0KA 1B5JA 3TCGA 2XX7A 4L17A 4Q0CA 3CR9A 2QSXA 3VDFA 4RYAA 2R9JA 1MPDA 3JYRA 2OWSA 3FJGA 3LC8A 3T9HB 2Y7PA 5K2YA 3KJTA 3RT8A 1PC3A 5AE4A 4K35A 3Q27A 2X7QA 3KZGA 1MFTA 4GD5A 1XOCA 2B3BA 2DE3A 2Y7KA 5TP9B 4U4SA 2JWDA 1N04A 4F29A 3FATA 4NE4A 4R74A 3HV1A 2I8DA 2ZYMA 3FVOA 3FXUA 2WKYA 3EN3A 4FEDA 5CMKA 3R26A 4PP0A 5DJUB 1MY4A 1OVBA 4KCDA 3KBRA 2XXHA 3CI8A 4K3AA 3KFMA 1AIVA 4N6PA 3ODBA 1POY1 4G8HA 1B7ZA 5KCJA 1PB8A 2DXRA 4P11A 3VV5A 1Y20A 1DPEA 4U1ZA 2B3FA 1B4ZA 1EDKA 1N84A 1UQWA 4OTEA 1LT1A 2V25A 4YAHX 4P0IA 1EH3A 4WKMA 2XXPA 5CC2A 2ZNUA 1ZBMA 3DELB 4ASVA 3W9VA 1IIWA 1URDA 4G68A 4LVQA 2M5AB 1H44A 2H98A 2GRVA 1LSTA 3C33A 3GLBA 3IORA 4NF5A 4RJZA 5JTYA 3RUMA 1LFHA 1NVOA 4DIGA 1OQHA 1B4HA 2WMMA 3ONMA 4GOEA 4ZE9A 2KLFA 2QL3A 1PBQA 4QHQA 3BBRA 5KDTA 2KZIA 4LONB 3OSQA 4QFNA 3KSJA 3TTLA 3IJOB 3IB0A 5AA2D 1A7LA 1LCTA 3K2DA 3IAZA 3K00A 2P1SA 4OZ9A 5IKBA 1JW5A 1LFGA 4F22A 4OENA 4ECFA 4YB5A 3TDJA 4YKPA 1LAXA 2V3TA 2UYEA 3HN0A 3MVZA 4ONYA 4EQ7A 2XD3A 1N7XA 4BDLA 2CZLA 4ZEIA 3FJ7A 1IXCA 4I8CA 3KEIA 4THIA 3HPIA 1ZJLA 3T9VA 4HKZH 1P1OA 4GVOA 2P2AA 4KJMA 1R6ZA 1CE2A 1N3WA 3MP8A 4R6YA 4XKRA 3TTKA 3M3LA 5HBCA 3FV2A 3OO6A 4ZZEA 2DSFA 2LXBA 3S9NC 1FQFA 1MXWA 2DYXA 5ITPA 1MQDA 2PVUA 3S2VA 3TTNA 4HB1A 2G93A 4X9TA 5TU0A 2I0BA 2SPZA 1NKXA 5FTIA 4NF6B 2DXYA 3PUZE 1IUDA 2OZZA 2M0BA 5DEXA 4MN4C 4O3BA 1MY0A 3MQ9A 1QKAA 2Q2CA 3K1NA 1Z7ME 4K3FA 3IB2A 2RC8A 3IO4A 2I48A 3CFZA 3P7IA 4KFQA 3IJXB 2ZAEB 2ABHA 3K6VA 4F3PA 2ZYOA 4O3AA 3T9UA 1B3LA 5I57A 2I3VA 2DP8A 3QSLA 1PDAA 4FORA 3RN8A 3PU5A 4MH5A 4QFKA 1JNFA 1QKBA 4GFRA 1B1HA 2GFEA 3VE1B 3PPNA 1B3FA 3VLWA 3T22A 4G4PA 5ICQA 4N07A 1H3DA 4HJGH 3PMVA 3K01A 2CMOA 3MZBA 3O29A 4U21A 2H9BA 3M8UA 2I49A 1P1NA 3D4GA 4PFWA 3FJMA 3AXFA 2UXAA 1VFDA 2XXRA 3TPAA 1USYE 1Q35A 4F3BA 2Z8FA 1XVYA 1OVUA 2A5SA 1H45A 1I6AA 2HZKA 3PMWA 2F34A 4RNSA 1P1QA 2QVAA 1ZLQA 3ZKLA 1HSJA 5KCJB 4F3GA 4LQ5A 3EF7A 2Y7WA 4MLQA 4H5GA 3M3FA 4FIMA 3ZSFA 2ZXTA 1B3EA 3TCFA 5I59A 3G3GA 3VVDA 4ESWA 1X0TA 1NNPA 5AA1A 5J1DA 2Q1KA 4YB7A 2B65A 2ZYKA 1SW4A 1Y1ZA 2UVJA 3UN6A 1ZW0A 4GL8A 2KUBA 1JVXA 3G7WA 4X1DA 3Q26A 1URGA 1MY2A 4G68B 1EU8A 1FTKA 4NF5B 1FTOA 2XXTA 4E0XA 1D3KA 3LSXA 5JTYB 5CMBA 1B52A 4ZNCA 2YLNA 4LP2B 2B87A 2VHAA 3N94A 5FHOA 3VVEA 1LFIA 3VXCA 3LUYA 4ESXA 1SS1A 2YJPA 5KDTB 4R6HA 2X7PA 1FQBA 1Y1MA 1M5EA 3IR1A 4EQ9A 2UVHA 1NNTA 3MPLA 3ZKKA 4H67A 4U23A 5CBRA 1TFAA 4HTGA 1F9BA 4PQJA 2FNCA 4RK2A 2O1LA 1MXUA 4RPOA 2ZNSA 2D21A 1M5BA 4JSDA 3U94A 1WDNA 2Z22A 5L8DA 1BDCA 2R71A 3TTMA 3FVKA 4YU0A 1FQDA 3OO9A 2Z8EA 1B1XA 1LB8A 5DJTB 1S3JA 1HSLA 3S1KA 1M5FA 3TYHA 2RC9A 3B6QA 2HZLA 2O84X 2Q2AA 4IB2A 3A3UA 2REGA 4YKKA 2NVUB 4POWA 4OFLA 2W7YA 3IOWA 5HPQA 4JWOA 1S9TA 2O6AA 3EHUA 3CG1A 1Y47A 1FW0A 4NEDA 3S4UA 3O6IA 2RCAA 3U1OA 5JEIA 4NMYA 1SBPA 2ONRA 3QYTA 4BXLA 4F19A 3UK4A 2HQ0A 2QS2A 3LSLA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4WWI A;  5DEX B;  1Z7N E;  4R73 A;  1UIU A;  3T66 A;  2XXW A;  3I6V A;  1QUK A;  3SET A;  1U7M A;  1WOD A;  1AMF A;  2E1S A;  2Q89 A;  3H6T A;  3O28 A;  2O51 A;  3PUW E;  3G3J A;  5C39 A;  1IXI A;  1BDD A;  1A54 A;  3H3G A;  1NH8 A;  5I57 B;  4FEB A;  4F1Y A;  5LOM A;  4H8I A;  3PPQ A;  2PX1 A;  5AA4 A;  1S50 A;  2Q9T A;  2LXC B;  5H8N B;  4KYS A;  4H6D A;  5DT6 A;  4ZMD A;  3L6G A;  1JET A;  3O97 A;  3OO7 A;  4MFI A;  3OO8 A;  1B0H A;  1OIB A;  4AQ4 A;  4IO6 A;  4IY6 A;  4GF8 A;  3SDF A;  1PB7 A;  4GQO A;  4ZEB A;  4ZZA A;  4IGR A;  3FZV A;  3N6T A;  1SI0 A;  1SYH A;  2A5T A;  1ZXG A;  4IGT A;  3DM0 A;  2XXU A;  3S9L C;  1OQG A;  3FXQ A;  3OEK A;  4BDR A;  3IX1 A;  1ELJ A;  1LAF E;  2HR3 A;  1B9J A;  4N13 A;  3DP6 A;  1H43 A;  1SD3 A;  2QRX A;  1USY H;  4C1T A;  4G8M A;  4RY1 A;  4GOD A;  1JMB A;  1JEV A;  3K4U A;  5DVF A;  2OCU A;  4QFO A;  2R44 A;  3EQ1 A;  5CRY A;  4EF1 A;  4R9F A;  2H4I A;  1FTM A;  4XIG Q;  3W15 C;  3SEU A;  4P0G A;  1OMP A;  3HST A;  2DVZ A;  3CRB A;  3OEM A;  1LAH E;  1FTJ A;  5I59 B;  1YCJ A;  3BKI B;  2H5Y A;  1EC5 A;  4RPN A;  3IOT A;  3TAJ A;  3C4M A;  1B3H A;  1JEU A;  2AYS A;  5CI5 A;  4ELQ A;  4M4G A;  1VFE A;  4MBP A;  4BLA A;  2DOJ A;  3MAM A;  4YB6 A;  4R72 A;  2ANJ A;  1MXX A;  1Y4T A;  1I6B A;  4PFU A;  2O69 A;  5ISU A;  3SEX A;  2F5X A;  2Q8J A;  4OMB A;  2B87 B;  1DEE G;  4ZE8 A;  5FHM A;  3QUF A;  3TMG A;  2Q88 A;  2V3Q A;  4EXK A;  4R2B A;  2XXX A;  3K1P A;  3CFL A;  2PBW A;  5I58 A;  5F1Q A;  1DTZ A;  5EFW B;  1DMB A;  1M5D A;  3U8Q A;  3A3C A;  3H6U A;  3L6H A;  2Z23 A;  4ZDM A;  4OEV A;  4IO7 A;  1IQ7 A;  1OLA A;  3THI A;  3IL1 B;  4Q30 B;  2O68 A;  4YIC A;  5K2X A;  4LZ7 A;  1D9Y A;  2XXQ A;  5F7V A;  2ESN A;  2P0S A;  1NNK A;  2VD3 A;  1MH3 A;  3Q28 A;  2I4B A;  2I6E A;  4F2Q A;  5M2V A;  1MDQ A;  3MJN A;  4I1D A;  2V3U A;  1B7U A;  2QS3 A;  3VXB A;  1MM7 A;  4IY5 A;  1SQY A;  1PB9 A;  2DWI A;  3VLU A;  3N26 A;  5EYF A;  4YKJ A;  5EHS A;  2H99 A;  3QAX A;  4I62 A;  1P1U A;  1PEB A;  4QRZ A;  4FJP A;  5L9S A;  1JQF A;  2RIN A;  1YPN A;  5H8F A;  5CBO A;  1TFD A;  2LR2 A;  3QIM A;  3KOS A;  2GHA A;  3TOD A;  4Q8R A;  3K6W A;  3GXA A;  2DE2 A;  4YMA A;  3N5L A;  4HCY A;  4KI0 E;  3IO6 A;  4GWO A;  4TLL B;  5H8N A;  1MDP 1;  2XX9 A;  1XC1 A;  1NFT A;  3O2A A;  3K02 A;  3H6W A;  1N76 A;  1TWY A;  3FXR A;  2F6P A;  5I2K B;  3RTF B;  1BKA A;  5AA4 B;  1UTB A;  3SEW A;  3TQL A;  4POX A;  1IXH A;  1N3X A;  1GTK A;  1DOT A;  2ZMB A;  4EDP A;  4BDM A;  3MVX A;  1LGB C;  3IK6 B;  1QUL A;  3ZS6 A;  4YMB A;  1LBC A;  2ONK E;  2RCB A;  4NTL A;  2PMS A;  4NWC A;  3LBS A;  1MY3 A;  5H8Q A;  2H25 A;  4JB7 A;  4QF9 A;  3FVG A;  2UYF A;  2I3W A;  2XXV A;  1WVJ A;  4ELP A;  1FQA A;  1QUI A;  3FXE A;  2R6G E;  1ZIU A;  4O3C A;  2Y7I A;  2GH9 A;  4R6K A;  2A5T B;  1MQG A;  3MZ9 A;  1MPB A;  4ZEC A;  3MHV A;  3OMB A;  4DXC A;  4RA1 A;  2HEU A;  2ONS A;  2F7C A;  4JWY A;  4OHN A;  1EDL A;  4IO2 A;  4PET A;  3CFX A;  3C32 A;  3RT6 B;  4DDD A;  3RLF E;  4OES A;  1OVV A;  1J1N A;  1GV8 A;  2NUV A;  2HCA A;  3CSB A;  3MWB A;  1SDX A;  4EF2 A;  3TEL A;  3RGY A;  5DTB A;  4PE5 B;  4G77 A;  4LAT A;  2QRY A;  1M5C A;  3C36 A;  2DS9 A;  3V5A A;  2QJE A;  1B5I A;  3SER A;  3G3H A;  3K1M A;  2F97 A;  4PFT A;  5B7D A;  3GBB A;  1A55 A;  1QUJ A;  4OXV A;  5BWJ A;  1Y9U A;  3HHG A;  3SEV A;  3BFU A;  2UWJ E;  4IO5 A;  1D9V A;  2VGQ A;  2F78 A;  2E0S A;  1VR5 A;  3EHS A;  3EPE A;  4XKN A;  4QSE A;  1B46 A;  4F2O A;  2O1M A;  4IO4 A;  2V84 A;  4FEC A;  1POT A;  1R1N A;  2OBG A;  2DVC A;  1FQC A;  2REJ A;  1SVX B;  1XT8 A;  4HS7 A;  1LP1 A;  1EDI A;  1N7W A;  1RKM A;  3T96 B;  1BTJ A;  2XX8 A;  1SW1 A;  3QUJ A;  3RTW B;  3IOU A;  5I58 B;  4FAT A;  3C35 A;  2OK2 A;  3PD8 A;  2DWJ A;  3O6H A;  3LR1 A;  3PV0 E;  5CBN A;  2PT2 A;  3DLN A;  4DCX A;  3FAS A;  2VOZ A;  1QVS A;  4LZ5 A;  2F6G A;  3V8X B;  3WAF A;  4YKI A;  1Y3Q A;  3KG2 A;  4X48 A;  3R6U A;  4KR5 A;  1DSN A;  1LCF A;  1KWH A;  5AA3 A;  1XS5 A;  4EQB A;  3G3I A;  3OD7 A;  4ND9 A;  2LAO A;  1XVX A;  3FUZ A;  2F8D A;  3EHT A;  4HCW A;  5I84 A;  4KYE A;  3QK6 A;  2UVI A;  2PYY A;  4ISU A;  4F18 A;  3O9P A;  4GOT A;  2Y84 A;  3I5O A;  4TOZ A;  2DWH A;  3K6X A;  3VLV A;  1Y3N A;  3LSW A;  5KZT A;  3VFJ A;  5BUU A;  4H8J A;  4UA8 A;  3B6W A;  2QPQ A;  3DP8 A;  3H4Z A;  3UP9 A;  3MZ1 A;  5H8F B;  3LSF B;  3TZA A;  3O6G A;  4OET A;  4QFP A;  4LZ8 A;  2O7I A;  1EZO A;  5I2K A;  3TQW A;  4QFL A;  1R9Q A;  3TCH A;  1MQJ A;  3KSX A;  1DTG A;  4G2Z A;  3H6V A;  3KJ7 A;  3FIR A;  1I6Q A;  5I56 B;  4NPD A;  4OFO A;  1I69 A;  2HAV A;  1B5H A;  1B7H A;  4KD5 A;  3QWO C;  4NF8 A;  5JK4 A;  1UTB B;  5DVJ A;  5EHM A;  1P1W A;  5I2N A;  2IA4 A;  4U22 A;  3B6T A;  1H0T A;  3H06 B;  3Q25 A;  3JV9 A;  1FCK A;  5H8Q B;  2DQV A;  1LB9 A;  1MG1 A;  3ILT B;  1SW5 A;  4HW8 A;  5FHN A;  4ZED A;  1EDJ A;  1B6H A;  1ANF A;  3HHF A;  3E4R A;  4JXI A;  2M8C A;  4C1U A;  1JM0 A;  2I0C A;  5L9O A;  1A40 A;  2XXY A;  4H1X A;  4NWD A;  5IAI A;  3PMX A;  4LUB A;  3S9M C;  3PPO A;  1ZU0 A;  4NPE A;  4KYD A;  3MVY A;  4OYV A;  5DVI A;  2ZNT A;  1OLC A;  4F1V A;  3H7M A;  3MVW A;  2QS1 A;  1UTH A;  3B7D A;  5AA2 A;  4KPT A;  4DXU A;  3FGS A;  1B51 A;  3TUS A;  2Y7R A;  1IIT A;  4IOI H;  3PUY E;  1VE4 A;  1DPP A;  4NF4 A;  3HCQ A;  1JW1 A;  2G29 A;  4LQ2 A;  4ASW A;  2AL4 A;  3E13 X;  3IOV A;  1RYO A;  5K5G B;  2ALU A;  1MH4 A;  3CVG A;  5CMM A;  4IO3 A;  1TXF A;  2B89 A;  3PD9 A;  2AL5 A;  3T9X B;  5B70 A;  2F7A A;  5H8S A;  3FV1 A;  3K0V A;  2B88 A;  1NL5 A;  2D5W A;  4F3S A;  1QJM A;  4EXL A;  1MQH A;  4F1U A;  2D3I A;  4X1B A;  2GHB A;  1B3G A;  1SW2 A;  1TT1 A;  1H76 A;  4NPF X;  1OVT A;  3TTR A;  4PFY A;  3USD A;  1NNF A;  4XKQ A;  1LP1 B;  1SYI A;  1YTV A;  2XD2 A;  2V93 A;  2F35 A;  3TKD A;  5A5X A;  1EZP A;  2AIX A;  2XXI A;  1MQI A;  1Y3P A;  2PT1 A;  1LLS A;  3RNN A;  1O64 A;  1BLF A;  3UIF A;  4OVJ A;  2HAU A;  1GR2 A;  4OER A;  4FAJ A;  1B2H A;  4GRK A;  2RKM A;  2P58 A;  2X26 A;  3RGU A;  1N0T A;  1AH5 A;  3VVF A;  4ZEK A;  3UGW A;  4G68 C;  4GL0 A;  4Z0I A;  2THI A;  5TPA A;  1B32 A;  2UVG A;  4XTC Q;  4GIZ A;  4YZZ A;  2VP1 A;  5H8H A;  1YAE A;  1US5 A;  2DWA A;  4OEU A;  1MY1 A;  3OEL A;  3S9E A;  1US4 A;  2F7B A;  3CG3 A;  1O7T A;  4ZEF A;  5FTH A;  2OTK E;  3FVN A;  3HO7 A;  2DE4 A;  4EYY Q;  1GGG A;  2FYI A;  3PGF A;  4GXA A;  1MXZ A;  4JSO A;  4QSC A;  3M3K A;  3MC2 A;  3CSG A;  3K6U A;  1XHY A;  4U4X A;  1B0L A;  1BIY A;  2NWJ A;  5I56 A;  2F36 A;  1MXY A;  1Q1K A;  2Z8D A;  4Z7E A;  1B05 A;  2FA7 A;  4R9G A;  4DLD A;  5TP9 A;  2VD2 A;  3C31 A;  1NMU A;  1A8F A;  1MXV A;  3E3K A;  3SES A;  1B40 A;  4C0R A;  5CBS A;  3GZG A;  2BJJ X;  1AL3 A;  3H03 A;  4MLV A;  2KIK A;  1CB6 A;  3G3F A;  3OSR A;  3UOR A;  2RF1 A;  3TFL A;  4UAC A;  1U7J A;  1UIV A;  4NF8 B;  4G8N A;  4GOF A;  4H5F A;  2I58 A;  1L5T A;  4KCC A;  5ITO A;  5I2N B;  1JVY A;  1IEJ A;  3MP6 A;  2OLB A;  1H0T B;  3TEP A;  3OEN A;  1FTL A;  4DXB A;  3RY3 A;  3UA8 A;  4OFJ A;  4F31 B;  1NH7 A;  2O7U A;  3QXM A;  3RQT A;  1ZMG A;  3MPK A;  4GXS B;  4U1O A;  4FE8 A;  4OWD A;  4RXL A;  2HXW A;  3D4C A;  1S7Y A;  4XXU A;  4ELO A;  4WXJ A;  5DYH A;  1IZ1 A;  4OQO A;  1MM6 A;  4QSD A;  4ZS9 A;  3KN7 A;  2OJT A;  2QMW A;  2NXO A;  1UTH B;  4BDQ A;  1ATG A;  3FD3 A;  1SI1 A;  5AA2 B;  1ZTY A;  4TLM B;  2KZJ A;  1LAG E;  2ZYN A;  3RPW A;  3GBA A;  1JW4 A;  2M5A A;  1II5 A;  2KS1 B;  3A09 A;  1VSO A;  2K3R A;  4KQP A;  3R7X A;  4NF4 B;  1MRP A;  4Q5T A;  3SEY A;  4I9D A;  4R2F A;  3F11 A;  3SKP A;  1Q2N A;  3KN3 A;  4KHZ E;  4WED A;  2XHD A;  4RK9 A;  1URS A;  3WAE A;  3OXN A;  4E0W A;  1P99 A;  1LBB A;  1MS7 A;  4DZ1 A;  4H0W A;  4WEP A;  2IEE A;  3MP1 A;  3ZDM A;  4AB6 A;  3KOT A;  4GLI A;  1BP5 A;  3DP4 A;  4M1V A;  2HFB A;  2OWT A;  1OVR A;  2RC7 A;  3PUX E;  5L9M A;  1AOV A;  3V89 B;  3FXD A;  3ILU B;  4U2R A;  3ECR A;  5ICT A;  4XKP A;  4R75 A;  5CMC A;  1FQE A;  3CIJ A;  1ZKB A;  4JBZ A;  3G3K A;  3OOA A;  4JWX A;  2QMX A;  3U93 A;  3Q29 A;  3PPP A;  3PPR A;  3N6U A;  2I4C A;  2NOO A;  4BDO A;  3C34 A;  1QW0 A;  3KN8 A;  3KGC A;  5A5X B;  3W9W A;  3U92 A;  1HSE A;  3I3V A;  5ELV A;  1D4N A;  4TQU Q;  4JDF A;  2YPN A;  3MZW B;  4AB5 A;  4F39 A;  2KI7 B;  1FC2 C;  4DCY A;  3BFT A;  1O63 A;  4ELR A;  4H65 A;  1IXG A;  1MPC A;  3E9X A;  3MW0 A;  4EUO A;  1RYX A;  3MBP A;  1EZ9 A;  4NF6 A;  3C9H A;  4CPG A;  4LA9 A;  5TPA B;  4BDN A;  3PH0 A;  4MF3 A;  1B58 A;  2RKL A;  1A8E A;  3IB1 A;  3U72 A;  3JZJ A;  3T93 B;  1GVC A;  3V83 A;  5H8H B;  3O66 A;  4DE8 A;  1R9L A;  2QS4 A;  3PUV E;  1A99 A;  1PBP A;  5CM6 A;  1Y4C A;  5HM4 B;  3MUQ A;  1T0K A;  1B5J A;  3TCG A;  2XX7 A;  4L17 A;  4Q0C A;  3CR9 A;  2QSX A;  3VDF A;  4RYA A;  2R9J A;  1MPD A;  3JYR A;  2OWS A;  3FJG A;  3LC8 A;  3T9H B;  2Y7P A;  5K2Y A;  3KJT A;  3RT8 A;  1PC3 A;  5AE4 A;  4K35 A;  3Q27 A;  2X7Q A;  3KZG A;  1MFT A;  4GD5 A;  1XOC A;  2B3B A;  2DE3 A;  2Y7K A;  5TP9 B;  4U4S A;  2JWD A;  1N04 A;  4F29 A;  3FAT A;  4NE4 A;  4R74 A;  3HV1 A;  2I8D A;  2ZYM A;  3FVO A;  3FXU A;  2WKY A;  3EN3 A;  4FED A;  5CMK A;  3R26 A;  4PP0 A;  5DJU B;  1MY4 A;  1OVB A;  4KCD A;  3KBR A;  2XXH A;  3CI8 A;  4K3A A;  3KFM A;  1AIV A;  4N6P A;  3ODB A;  1POY 1;  4G8H A;  1B7Z A;  5KCJ A;  1PB8 A;  2DXR A;  4P11 A;  3VV5 A;  1Y20 A;  1DPE A;  4U1Z A;  2B3F A;  1B4Z A;  1EDK A;  1N84 A;  1UQW A;  4OTE A;  1LT1 A;  2V25 A;  4YAH X;  4P0I A;  1EH3 A;  4WKM A;  2XXP A;  5CC2 A;  2ZNU A;  1ZBM A;  3DEL B;  4ASV A;  3W9V A;  1IIW A;  1URD A;  4G68 A;  4LVQ A;  2M5A B;  1H44 A;  2H98 A;  2GRV A;  1LST A;  3C33 A;  3GLB A;  3IOR A;  4NF5 A;  4RJZ A;  5JTY A;  3RUM A;  1LFH A;  1NVO A;  4DIG A;  1OQH A;  1B4H A;  2WMM A;  3ONM A;  4GOE A;  4ZE9 A;  2KLF A;  2QL3 A;  1PBQ A;  4QHQ A;  3BBR A;  5KDT A;  2KZI A;  4LON B;  3OSQ A;  4QFN A;  3KSJ A;  3TTL A;  3IJO B;  3IB0 A;  5AA2 D;  1A7L A;  1LCT A;  3K2D A;  3IAZ A;  3K00 A;  2P1S A;  4OZ9 A;  5IKB A;  1JW5 A;  1LFG A;  4F22 A;  4OEN A;  4ECF A;  4YB5 A;  3TDJ A;  4YKP A;  1LAX A;  2V3T A;  2UYE A;  3HN0 A;  3MVZ A;  4ONY A;  4EQ7 A;  2XD3 A;  1N7X A;  4BDL A;  2CZL A;  4ZEI A;  3FJ7 A;  1IXC A;  4I8C A;  3KEI A;  4THI A;  3HPI A;  1ZJL A;  3T9V A;  4HKZ H;  1P1O A;  4GVO A;  2P2A A;  4KJM A;  1R6Z A;  1CE2 A;  1N3W A;  3MP8 A;  4R6Y A;  4XKR A;  3TTK A;  3M3L A;  5HBC A;  3FV2 A;  3OO6 A;  4ZZE A;  2DSF A;  2LXB A;  3S9N C;  1FQF A;  1MXW A;  2DYX A;  5ITP A;  1MQD A;  2PVU A;  3S2V A;  3TTN A;  4HB1 A;  2G93 A;  4X9T A;  5TU0 A;  2I0B A;  2SPZ A;  1NKX A;  5FTI A;  4NF6 B;  2DXY A;  3PUZ E;  1IUD A;  2OZZ A;  2M0B A;  5DEX A;  4MN4 C;  4O3B A;  1MY0 A;  3MQ9 A;  1QKA A;  2Q2C A;  3K1N A;  1Z7M E;  4K3F A;  3IB2 A;  2RC8 A;  3IO4 A;  2I48 A;  3CFZ A;  3P7I A;  4KFQ A;  3IJX B;  2ZAE B;  2ABH A;  3K6V A;  4F3P A;  2ZYO A;  4O3A A;  3T9U A;  1B3L A;  5I57 A;  2I3V A;  2DP8 A;  3QSL A;  1PDA A;  4FOR A;  3RN8 A;  3PU5 A;  4MH5 A;  4QFK A;  1JNF A;  1QKB A;  4GFR A;  1B1H A;  2GFE A;  3VE1 B;  3PPN A;  1B3F A;  3VLW A;  3T22 A;  4G4P A;  5ICQ A;  4N07 A;  1H3D A;  4HJG H;  3PMV A;  3K01 A;  2CMO A;  3MZB A;  3O29 A;  4U21 A;  2H9B A;  3M8U A;  2I49 A;  1P1N A;  3D4G A;  4PFW A;  3FJM A;  3AXF A;  2UXA A;  1VFD A;  2XXR A;  3TPA A;  1USY E;  1Q35 A;  4F3B A;  2Z8F A;  1XVY A;  1OVU A;  2A5S A;  1H45 A;  1I6A A;  2HZK A;  3PMW A;  2F34 A;  4RNS A;  1P1Q A;  2QVA A;  1ZLQ A;  3ZKL A;  1HSJ A;  5KCJ B;  4F3G A;  4LQ5 A;  3EF7 A;  2Y7W A;  4MLQ A;  4H5G A;  3M3F A;  4FIM A;  3ZSF A;  2ZXT A;  1B3E A;  3TCF A;  5I59 A;  3G3G A;  3VVD A;  4ESW A;  1X0T A;  1NNP A;  5AA1 A;  5J1D A;  2Q1K A;  4YB7 A;  2B65 A;  2ZYK A;  1SW4 A;  1Y1Z A;  2UVJ A;  3UN6 A;  1ZW0 A;  4GL8 A;  2KUB A;  1JVX A;  3G7W A;  4X1D A;  3Q26 A;  1URG A;  1MY2 A;  4G68 B;  1EU8 A;  1FTK A;  4NF5 B;  1FTO A;  2XXT A;  4E0X A;  1D3K A;  3LSX A;  5JTY B;  5CMB A;  1B52 A;  4ZNC A;  2YLN A;  4LP2 B;  2B87 A;  2VHA A;  3N94 A;  5FHO A;  3VVE A;  1LFI A;  3VXC A;  3LUY A;  4ESX A;  1SS1 A;  2YJP A;  5KDT B;  4R6H A;  2X7P A;  1FQB A;  1Y1M A;  1M5E A;  3IR1 A;  4EQ9 A;  2UVH A;  1NNT A;  3MPL A;  3ZKK A;  4H67 A;  4U23 A;  5CBR A;  1TFA A;  4HTG A;  1F9B A;  4PQJ A;  2FNC A;  4RK2 A;  2O1L A;  1MXU A;  4RPO A;  2ZNS A;  2D21 A;  1M5B A;  4JSD A;  3U94 A;  1WDN A;  2Z22 A;  5L8D A;  1BDC A;  2R71 A;  3TTM A;  3FVK A;  4YU0 A;  1FQD A;  3OO9 A;  2Z8E A;  1B1X A;  1LB8 A;  5DJT B;  1S3J A;  1HSL A;  3S1K A;  1M5F A;  3TYH A;  2RC9 A;  3B6Q A;  2HZL A;  2O84 X;  2Q2A A;  4IB2 A;  3A3U A;  2REG A;  4YKK A;  2NVU B;  4POW A;  4OFL A;  2W7Y A;  3IOW A;  5HPQ A;  4JWO A;  1S9T A;  2O6A A;  3EHU A;  3CG1 A;  1Y47 A;  1FW0 A;  4NED A;  3S4U A;  3O6I A;  2RCA A;  3U1O A;  5JEI A;  4NMY A;  1SBP A;  2ONR A;  3QYT A;  4BXL A;  4F19 A;  3UK4 A;  2HQ0 A;  2QS2 A;  3LSL A; 
#chains in the Genus database with same CATH topology
 1U57 A;  4WWI A;  5DEX B;  3AEE C;  1WRG A;  1Z7N E;  1LBX A;  3PTY A;  1N7S D;  4R73 A;  1UIU A;  3T66 A;  2XXW A;  1P84 H;  3I6V A;  1QUK A;  2E76 D;  1U7M A;  3V4W A;  1WOD A;  3SET A;  1AMF A;  5AVU B;  2E1S A;  2Q89 A;  3H6T A;  3O28 A;  2FHY A;  1SQV D;  4DI4 B;  2R32 A;  3P8C D;  2O51 A;  3PUW E;  5ET7 A;  1LBW A;  3G3J A;  5C39 A;  1IXI A;  2RN0 A;  4O8M A;  2M8R A;  2BCC D;  1BDD A;  3H32 B;  1A54 A;  3SZP A;  3H3G A;  1NO4 A;  1NH8 A;  2IPP A;  3LUZ A;  5I57 B;  4FEB A;  4GWU A;  4F1Y A;  5KJ7 A;  1YQ3 C;  4DCK A;  5LOM A;  4H8I A;  2B9B A;  1FZA A;  1KQF B;  3PPQ A;  2PX1 A;  2WPR A;  4GWW A;  5AA4 A;  1S50 A;  2H88 C;  2Q9T A;  2LXC B;  1DH3 A;  3V2R A;  2ZFC A;  5H8N B;  4KYS A;  4H6D A;  1FBD A;  5DT6 A;  4ZMD A;  1TU3 F;  3L37 A;  3L6G A;  2H8P D;  4I40 A;  1FE6 A;  1JET A;  3O97 A;  3OO7 A;  2R5B A;  4MFI A;  1YJN P;  3OO8 A;  1GK4 A;  1B0H A;  1OIB A;  3TGU J;  3NTN A;  2WT7 B;  1FOS E;  4AQ4 A;  4IO6 A;  2XXK A;  4IY6 A;  3H1I J;  1AFO A;  4GF8 A;  3ITK A;  1JUN A;  1S2E A;  3A7O A;  3SDF A;  2FXO A;  5AW7 B;  1PB7 A;  4JVD A;  1J2J B;  4GQO A;  4ZEB A;  4ZZA A;  3KC0 A;  4IGR A;  3FZV A;  3HD7 A;  3N6T A;  2WWW A;  1SI0 A;  4BRY B;  3G3Z A;  1WT6 A;  1NTZ G;  5TJH A;  1S5L H;  2PP6 A;  4NF0 A;  1SYH A;  1PIX A;  4YTP C;  1SQX J;  2A5T A;  1ZXG A;  1G2C A;  3L74 D;  3SWF A;  1JOC A;  4IGT A;  3DM0 A;  2E43 A;  3CME P;  2XXU A;  5AVT B;  3S9L C;  1T3J A;  5KLV G;  4H13 C;  1NUY A;  1K9M Q;  2KSJ A;  1OQG A;  3FXQ A;  5B66 E;  3OEK A;  4GDO A;  4BDR A;  3IX1 A;  1CZQ A;  1ELJ A;  2Q6Q A;  1LAF E;  2HR3 A;  1SQP K;  3A0H H;  1B9J A;  4N13 A;  2FIE A;  3JCU E;  1M1K Q;  3E1R A;  3R4Y A;  3TNU A;  3DP6 A;  1H43 A;  3WUU A;  2QRX A;  1SD3 A;  2MKV A;  1USY H;  4C1T A;  4G8M A;  5KJ7 D;  4RY1 A;  4QBA A;  3HUS A;  1PGQ A;  4GOD A;  1JMB A;  1JEV A;  3K4U A;  5DVF A;  3O6Q A;  2OCU A;  4QFO A;  2WIT A;  4P3L A;  1CNQ A;  3VMX A;  2R44 A;  1HF9 A;  3EQ1 A;  2QVR A;  5CRY A;  4EF1 A;  4R9F A;  2H4I A;  1FTM A;  4XIG Q;  3W15 C;  3SEU A;  4P0G A;  1OMP A;  4JF7 A;  1KIL E;  3HST A;  4N81 A;  2DVZ A;  3CRB A;  4N6K A;  2WSE J;  3OEM A;  1LAH E;  2N1T B;  4PE3 A;  4O9B A;  1FTJ A;  4MMP A;  1NV7 A;  1ZR4 A;  5I59 B;  2BEQ D;  1YCJ A;  1IMC A;  3BKI B;  4D6T D;  2H5Y A;  1EC5 A;  4RPN A;  3HD7 D;  3IOT A;  3TAJ A;  3GMA A;  2HPC B;  3H1K G;  1IMD A;  2VPN A;  3L35 A;  3C4M A;  4IFD K;  3H1I E;  1B3H A;  1JEU A;  2AYS A;  5CI5 A;  4ELQ A;  4M4G A;  2R8T A;  1VFE A;  4MBP A;  4BLA A;  2DOJ A;  3MAM A;  4YB6 A;  4R72 A;  5AW5 B;  3B5N B;  2ANJ A;  1PZQ A;  1EZV D;  1MXX A;  4U3F G;  1LT9 C;  1FZG A;  2Q3E A;  3RK3 C;  1Y4T A;  1I6B A;  3L70 G;  1IC2 A;  1NTM J;  3KXD A;  4OGQ B;  4DJG A;  2W8Z A;  1FPI A;  5IGA A;  4PFB A;  4PFU A;  2O69 A;  3H25 A;  5ISU A;  5F24 A;  1FDI A;  3SEX A;  2F5X A;  2Q8J A;  5KTB A;  1KQL A;  1SQV E;  4OMB A;  3P8C E;  2B87 B;  1GW4 A;  1DEE G;  4P8B A;  1VF5 B;  4ZE8 A;  5FHM A;  3CXH E;  3U1A A;  3G71 P;  3QUF A;  1X22 A;  3TMG A;  2ZYA A;  4GT1 A;  3GYY A;  3LV0 A;  4GX6 A;  2Q88 A;  5AVV B;  2V3Q A;  1UIX A;  4JYB A;  3T97 A;  4EXK A;  3GHG A;  4R2B A;  4H0L B;  1KYO D;  1OMI A;  1L0L J;  1VQL P;  2XXX A;  1BGY J;  3RK2 D;  2FY8 A;  3K1P A;  1S9K E;  3CFL A;  2PBW A;  3M91 A;  5I58 A;  3HE5 A;  1X79 B;  3MUD C;  5F1Q A;  1DTZ A;  5EFW B;  1DMB A;  5AVW B;  1M5D A;  3U8Q A;  3A3C A;  5APT A;  2KLV A;  2O01 N;  3H6U A;  3L6H A;  5I7I A;  1PGJ A;  3IN6 A;  2Z23 A;  4OEV A;  4IO7 A;  4ZDM A;  1IQ7 A;  1OLA A;  3THI A;  2E76 B;  3IL1 B;  4Q30 B;  1T2K C;  2O68 A;  1VQM P;  4YIC A;  2W83 C;  5K2X A;  4LZ7 A;  1D9Y A;  2XXQ A;  5APU A;  1QL2 A;  4NX1 A;  2ZT9 D;  4Y99 C;  4MAG A;  4N78 D;  1GTW A;  2ESN A;  5F7V A;  2P0S A;  1NNK A;  2VD3 A;  1LTJ C;  2R3S A;  1MH3 A;  3Q28 A;  2I4B A;  2I6E A;  4F2Q A;  2FYZ A;  1N73 C;  1YHQ P;  3A5T A;  5M2V A;  1MDQ A;  3MJN A;  4I1D A;  2V3U A;  5EYH A;  2JR8 A;  1Q86 Q;  1B7U A;  2XNX A;  2KOG A;  3MYU A;  2QS3 A;  3Q5P A;  3VXB A;  3A0B E;  2G3A A;  1USE A;  1MM7 A;  4PJ0 H;  4IY5 A;  3D6Y A;  4NN3 A;  3AE1 C;  1SQY A;  1PB9 A;  2DWI A;  4IL6 E;  4GWZ A;  3VLU A;  5GTI E;  3N26 A;  1JTH A;  5EYF A;  4YKJ A;  5EHS A;  1NTM E;  2H99 A;  3QAX A;  4H44 C;  4I62 A;  5KKZ C;  3CCQ P;  2JP3 A;  1P1U A;  1PEB A;  5FBP A;  1FS0 E;  4QRZ A;  1HWT C;  3L73 D;  3N4X A;  4FJP A;  5L9S A;  3V2N A;  1JQF A;  2NPS C;  2JKV A;  1YPN A;  2RIN A;  2CZK A;  4O94 A;  5H8F A;  1G1J A;  5CBO A;  1TFD A;  1DBZ A;  1FPD A;  1NTZ J;  2LR2 A;  3QIM A;  3E78 A;  1SQV K;  1KMI Z;  3KOS A;  1L0L E;  4UB8 E;  2GHA A;  3TOD A;  4Q8R A;  4OVN F;  3K6W A;  2Q9I A;  5AW0 B;  3KC1 A;  1RH5 B;  1BCC D;  5AW8 B;  3RK3 E;  3GXA A;  2W6J H;  2DE2 A;  3VP8 A;  4YMA A;  1Q90 D;  3N5L A;  4D6T E;  4HCY A;  4KI0 E;  3IO6 A;  2FYN C;  4GWO A;  4TLL B;  5H8N A;  1MDP 1;  2XX9 A;  4YXW H;  2QVV A;  1XC1 A;  1L4A A;  1NFT A;  3IR9 A;  4WY4 A;  1HTL C;  3O2A A;  3K02 A;  3AED C;  4OVP A;  5I3S A;  3H6W A;  2H7H A;  1L0N G;  1LBY A;  3AEB C;  3BCC G;  1N76 A;  1TWY A;  3FXR A;  5CCG A;  1VL2 A;  2F6P A;  5I2K B;  4N8Y A;  3RTF B;  1BKA A;  1EZV E;  5AA4 B;  1FPL A;  1UTB A;  3SEW A;  3F5H A;  3TQL A;  4POX A;  2W6A A;  1IXH A;  4OVQ A;  4TLF A;  1N3X A;  1GTK A;  1DOT A;  2ZMB A;  4EDP A;  3AE3 C;  2Y5L A;  2KXP B;  4C7R A;  3TDK A;  1SFC C;  4BDM A;  3MVX A;  2KR0 A;  1LGB C;  3IK6 B;  1QUL A;  3ZS6 A;  2Z5I A;  4YMB A;  1FZC A;  3AE9 C;  1LBC A;  1PPJ D;  2ONK E;  2RCB A;  4NTL A;  2PMS A;  4NWC A;  3VTP C;  2WYK A;  3LBS A;  1MY3 A;  5H8Q A;  2H25 A;  4JB7 A;  3AE7 C;  4QF9 A;  3FVG A;  2UYF A;  2I3W A;  2XXV A;  1WVJ A;  4ELP A;  1FQA A;  1QUI A;  3FXE A;  2Q74 A;  1KA1 A;  2R6G E;  3HD7 B;  1ZIU A;  3KBZ A;  4O3C A;  2DDK A;  1PV3 A;  2Y7I A;  2GH9 A;  4P47 A;  1AQT A;  5AVY B;  1IMA A;  2BJI A;  2A5T B;  4R6K A;  1MQG A;  4JPZ B;  3H1K J;  1G2C B;  3HTK A;  4P9K A;  3B4S A;  3MZ9 A;  1MPB A;  2J58 A;  2WSC H;  3KHU A;  4ZEC A;  1NTM K;  3MHV A;  3OMB A;  2P2U A;  4DXC A;  1YI2 P;  4RA1 A;  2HEU A;  1R5S A;  1KB9 E;  1E79 H;  2ONS A;  1XI6 A;  2F7C A;  2JJK A;  4JWY A;  4U3F J;  4OHN A;  1EDL A;  4BWN A;  4IO2 A;  1RDY A;  4PET A;  3L70 J;  3CFX A;  5B66 H;  4WY4 D;  3C32 A;  3RT6 B;  4DDD A;  3TNU B;  3RLF E;  4OES A;  1OVV A;  1J1N A;  1KA0 A;  3BIG A;  1GV8 A;  2NUV A;  2HCA A;  1VQ4 P;  1KZU B;  1GDT A;  1M56 D;  3CSB A;  3MWB A;  1SDX A;  4EF2 A;  5EQ7 A;  3TEL A;  3HUS B;  1OW6 A;  1EXI A;  3RGY A;  5DTB A;  1L0L K;  3O6Q B;  4PE5 B;  4G77 A;  5AW9 B;  4GX4 A;  2QJK B;  1RE3 A;  1Y9B A;  3CL3 D;  3H1J D;  5GTH E;  4LAT A;  4W7Y A;  2XV5 A;  1QVG O;  2QRY A;  1M5C A;  5EYG A;  3C36 A;  4PV1 B;  2DS9 A;  4MEV A;  2L91 A;  1XTC C;  5L8R J;  3V5A A;  1SQV G;  2XWO A;  1HUC A;  2FFD A;  2QJE A;  4P1E A;  1AQ5 A;  1B5I A;  3FBP A;  1IFJ A;  2IX7 C;  4JQ0 D;  2YNY A;  1QGX A;  3SER A;  3G3H A;  1FBM A;  2BCC G;  3L75 D;  1FPE A;  3K1M A;  5AVZ B;  2F97 A;  4PFT A;  4RKU J;  3G4S P;  4RO0 A;  4C7N A;  2ZT9 B;  1FZF A;  2JWA A;  3GBB A;  5B7D A;  1JY3 N;  2GUS A;  1A55 A;  1RF0 C;  1QUJ A;  3MP7 B;  1H89 A;  4OXV A;  5BWJ A;  1Y9U A;  3HHG A;  3SEV A;  3MIW A;  3BFU A;  2UWJ E;  4IO5 A;  1D9V A;  4EOT A;  2VGQ A;  2F78 A;  2CPB A;  2E0S A;  1JCC A;  1VR5 A;  1UII A;  2E74 D;  3EHS A;  3H1K E;  3EPE A;  4XKN A;  3Q5R A;  3SWY A;  3CXH I;  4QSE A;  3M0D C;  1B46 A;  4F2O A;  2O1M A;  4IO4 A;  2V84 A;  1NAF A;  4FEC A;  2POH A;  3CWB D;  3L72 D;  1POT A;  4I2L C;  1R1N A;  2OBG A;  3AEA C;  2DVC A;  1FQC A;  3U65 A;  2REJ A;  4JVC A;  3AE5 C;  2N1T D;  4L76 A;  1N86 A;  1SVX B;  1XT8 A;  4U3F E;  4HS7 A;  1LP1 A;  4EI2 A;  3H1J J;  1EDI A;  1N7W A;  3L74 G;  3L70 E;  1RKM A;  3H1H D;  1NAY A;  3CXH H;  3T96 B;  2KP8 A;  3T97 B;  1BTJ A;  2XX8 A;  3GHG B;  4HYT B;  2NRG A;  4NHB A;  4UB6 E;  3SFE C;  2WZ7 A;  1SW1 A;  3QUJ A;  3RTW B;  3IOU A;  3ABV C;  2Y9Z A;  5I58 B;  4FAT A;  3HE5 B;  1IFI A;  3C35 A;  2GQ1 A;  4R4M A;  1LTB C;  2OK2 A;  4IR8 A;  2V4C A;  4PAF A;  4I6M C;  3PD8 A;  5EQ9 A;  1MZ9 A;  2DWJ A;  1PPJ E;  1VDF A;  1KZ8 A;  4MCO A;  3O6H A;  3LR1 A;  3PV0 E;  3B5N D;  2XU6 A;  5CBN A;  1HJ0 A;  2PT2 A;  3DLN A;  4PF8 A;  4DCX A;  3FAS A;  1YYZ A;  1NTK D;  2VOZ A;  4N17 A;  2A06 D;  4OGQ D;  1LNQ A;  1NV0 A;  1QVS A;  4LZ5 A;  3E7K A;  2F6G A;  3V8X B;  3WAF A;  4YKI A;  1Y3Q A;  2WSE H;  3KG2 A;  1KQS O;  1FBG A;  4XE5 B;  4X48 A;  1K05 A;  2QIW A;  3R6U A;  4EIJ A;  4KR5 A;  1DSN A;  1LCF A;  2WPV B;  4N6D A;  1KTM A;  1KWH A;  1VF5 D;  5AA3 A;  1XS5 A;  4N3Y B;  4EQB A;  3G3I A;  3OD7 A;  4ND9 A;  1OXZ A;  3SSU A;  4HH2 A;  2LAO A;  1R5L A;  1XVX A;  1L0N J;  3BCC J;  3FUZ A;  2F8D A;  1EQ7 A;  3EHT A;  4HCW A;  5I84 A;  4KYE A;  3QK6 A;  4D6T G;  2UVI A;  1Q81 Q;  4GIF A;  2PYY A;  3F89 A;  4ISU A;  4F18 A;  2C0W A;  3O9P A;  4GOT A;  3II6 A;  2Y84 A;  3I5O A;  3H1H J;  4IL6 H;  4TOZ A;  2DWH A;  3K6X A;  5GTI H;  3VLV A;  2M3E A;  2Q8M A;  1Y3N A;  2QJP C;  2KK7 A;  3LSW A;  5KZT A;  3VFJ A;  1JY2 N;  4WB4 A;  5BUU A;  4AUW A;  4H8J A;  1URQ C;  4UA8 A;  3B6W A;  2JDI H;  3VMZ A;  2QPQ A;  3L71 D;  3DP8 A;  2YXQ B;  3H4Z A;  2IZ1 A;  1EZV G;  2WVR A;  3UP9 A;  3MZ1 A;  4H0L C;  3H1J E;  4PTK A;  5H8F B;  1RF1 A;  3LSF B;  3TZA A;  3O6G A;  4OET A;  1M8O B;  4QFP A;  2OYO A;  4LZ8 A;  3G6E P;  2O7I A;  1N7L A;  1JB0 J;  1EZO A;  5I2K A;  3TQW A;  4UB8 H;  5CMZ A;  1Q7Y Q;  3W68 A;  4QFL A;  4KT0 J;  1R9Q A;  3TCH A;  3I5C A;  2WSF J;  3WU2 E;  3GW6 A;  1MQJ A;  1N7S C;  3KSX A;  2V7Q J;  2C0X A;  1DTG A;  4G2Z A;  5IZ1 A;  3H6V A;  1L4A B;  3RYD A;  2E76 C;  3KJ7 A;  3FIR A;  4WY4 B;  1T6A A;  2JJL A;  3RBX A;  4C46 A;  3CX5 E;  3MTU E;  1I6Q A;  5I56 B;  3PLN A;  4NPD A;  5IZ3 A;  5CCH D;  4OFO A;  1I69 A;  2HAV A;  2Q5U A;  2HPG A;  3K5B A;  1B5H A;  1B7H A;  1VQ6 P;  2YKP A;  4KD5 A;  5ET6 A;  3QWO C;  2W90 A;  4NF8 A;  5JK4 A;  1BSN A;  1YXI A;  1UTB B;  3CCM P;  5DVJ A;  5EHM A;  4I3E A;  2D2C B;  1P1W A;  2H43 A;  5I2N A;  2IA4 A;  5AW4 B;  4U22 A;  2IBZ D;  4G61 A;  1GK6 A;  1ZR2 A;  3B6T A;  3L72 E;  1H0T A;  1L0N E;  3H06 B;  3Q25 A;  1FZC B;  3BCC E;  3PJS K;  3JV9 A;  1FCK A;  2OYH A;  5H8Q B;  2DQV A;  3L71 J;  1LB9 A;  2J5U A;  4NAP A;  1MG1 A;  3ILT B;  1SW5 A;  4HW8 A;  5FHN A;  3S9O A;  1SQV J;  4ZED A;  4Y28 J;  1EDJ A;  1W2E A;  1ANF A;  1B6H A;  4GWX A;  2W27 A;  3HHF A;  2K9Y A;  1IFN A;  3E4R A;  4JXI A;  2M8C A;  3E79 A;  3H1H E;  4W80 A;  5H2F E;  2ZZX A;  4C1U A;  1JM0 A;  2I0C A;  4H46 A;  5L9O A;  1NU1 D;  4N15 A;  1FBH A;  2BCC J;  1A40 A;  2XXY A;  5KLI B;  1N2D C;  1NYH A;  4H1X A;  4NWD A;  1AJY A;  1HBW A;  5IAI A;  3PMX A;  4LUB A;  3S9M C;  1KB9 I;  3PPO A;  1ZU0 A;  4NPE A;  4KYD A;  3HTK B;  3MVY A;  3CCL P;  2NZ2 A;  4OYV A;  2FBP A;  5DVI A;  2YO3 A;  1Y8A A;  2ZNT A;  2E74 B;  1X9V A;  1OLC A;  4F1V A;  3M9H A;  3H7M A;  3MVW A;  1HH0 A;  2QS1 A;  1UTH A;  4XA4 A;  1S5L X;  3CMA P;  1KB9 H;  3AEG C;  2WTY A;  3B7D A;  5AA2 A;  3L73 G;  1P84 D;  1KD1 Q;  2O1K A;  4KPT A;  4DXU A;  1NGM B;  2J59 M;  4PAI A;  3FGS A;  1B51 A;  3TUS A;  2Y7R A;  2AEJ A;  1IIT A;  4IOI H;  4I7Z B;  3PUY E;  5KJ7 C;  4PDH A;  4KHX A;  2PAJ A;  3V2Q A;  1VE4 A;  1DPP A;  3L74 J;  1BCC G;  2OTL P;  1OIP A;  4NF4 A;  3HCQ A;  1JW1 A;  1FPF A;  2G29 A;  2F3B A;  3H1L D;  4LQ2 A;  5GTH H;  1HJB A;  4N91 A;  4ASW A;  2AL4 A;  3E13 X;  2KNC A;  2FFD B;  1KN7 A;  3IOV A;  2H89 C;  1RYO A;  5K5G B;  2YO2 A;  2K9J A;  2ALU A;  1MH4 A;  2ZYD A;  3CVG A;  1BE3 D;  4IO3 A;  1TXF A;  5CMM A;  2B89 A;  4NQ8 A;  3PD9 A;  2AL5 A;  3T9X B;  5B70 A;  5AW2 B;  5BVZ A;  3TK1 A;  3M9Q A;  2QSI A;  2A45 G;  2P67 A;  3L71 E;  2F7A A;  3HD7 C;  2P3N A;  4C7N B;  5H8S A;  3FV1 A;  3K0V A;  1IFP A;  2B88 A;  1YIJ P;  1NL5 A;  1OWA A;  3U59 A;  2D5W A;  2IFN A;  3C8V A;  5ET8 A;  4F3S A;  1QJM A;  3B8E B;  5ET5 A;  4ZKU A;  1N8R Q;  1FJ6 A;  3RL0 B;  2KQZ A;  1L0N K;  3KZI H;  2BCC E;  5I5P A;  1PPJ G;  2QM7 A;  4EXL A;  3CCU P;  1ZV8 A;  2YXR B;  1MQH A;  3B50 A;  4F1U A;  2D3I A;  4X1B A;  2GHB A;  1FBC A;  4L75 A;  1B3G A;  1SW2 A;  1TT1 A;  2KYV A;  1H76 A;  3IFC A;  4NPF X;  5AVQ B;  1OVT A;  4PV1 D;  4LGD E;  1ZN5 A;  4D6T J;  3TTR A;  3CCR P;  1SQB D;  4PFY A;  3BRV B;  1NNF A;  4XKQ A;  1PP9 D;  3USD A;  3P32 A;  1LP1 B;  1SYI A;  1YTV A;  2XD2 A;  2V93 A;  2F35 A;  3TKD A;  5A5X A;  1EZP A;  1JY3 P;  2AIX A;  2XXI A;  1MQI A;  1Y3P A;  2PT1 A;  2OYI A;  1LLS A;  1QL1 A;  3HUS C;  3IF4 A;  3RNN A;  1O64 A;  3FWL A;  1BLF A;  2YIU C;  3UIF A;  1X8Y A;  4OVJ A;  5IZZ A;  1FJP A;  2A45 H;  2HAU A;  1GR2 A;  3JC2 2;  4OER A;  3GLM A;  4PD4 I;  4HE2 A;  4UB6 H;  1RE4 A;  4FAJ A;  3RK2 C;  5APW A;  1B2H A;  4GRK A;  3I55 P;  4IFF A;  1DD3 A;  3L74 E;  5APV A;  4OH8 B;  2RKM A;  2FKW B;  2P58 A;  4P1L A;  2X26 A;  2FYU D;  3AE2 C;  2CK3 H;  4R4L A;  3RGU A;  1N0T A;  1AH5 A;  4OWF A;  3PP5 A;  4ZEK A;  3VVF A;  1NUZ A;  3UGW A;  4G68 C;  1QX8 A;  4GL0 A;  4Z0I A;  2THI A;  5TPA A;  4PD4 H;  1NU1 E;  1B32 A;  4PF6 A;  5AW3 B;  3CC7 P;  2UVG A;  2HHM A;  1YTZ I;  3H1J G;  2OAR A;  2OGU A;  2ZT9 C;  1CW5 A;  4MNI A;  4GIZ A;  4XTC Q;  2VP1 A;  2XWV A;  4YZZ A;  3I56 P;  5H8H A;  1YAE A;  1M1J A;  1US5 A;  3WUT A;  2DWA A;  4OEU A;  2QJY B;  1MY1 A;  3OEL A;  4OA4 A;  3S9E A;  1US4 A;  2F7B A;  3CG3 A;  2ITA A;  1O7T A;  3TF5 A;  4ZEF A;  3CCE P;  5FTH A;  1SQB J;  4I3Y A;  1RDX A;  1EYJ A;  2RMZ A;  3IFM A;  1Q9D A;  3L75 G;  1SQQ D;  2OTK E;  3TSI A;  4X04 A;  3FVN A;  3MD0 A;  2DE4 A;  4H13 B;  1IFD A;  3HO7 A;  4EYY Q;  3JSV C;  5B5E H;  1P84 E;  1GGG A;  3RPL A;  2Y0E A;  1M57 D;  2FYI A;  4AS4 A;  3PGF A;  2PGD A;  2E75 D;  4GXA A;  1FBE A;  2WBD A;  2Z4E A;  1DCU A;  1MXZ A;  4JSO A;  4QSC A;  3M3K A;  3MC2 A;  3LW5 J;  3CSG A;  1IME A;  3K6U A;  1XHY A;  5AVS B;  4U4X A;  3GHG C;  1B0L A;  1RF1 B;  1BIY A;  2NWJ A;  5I56 A;  5KAF E;  3H1L E;  3CWB G;  3L72 G;  4LLH A;  1NV2 A;  2OX3 A;  1FBF A;  2F36 A;  3A2A A;  1OW8 A;  1MXY A;  1Q1K A;  1R8E A;  2Z8D A;  3CX5 I;  4Z7E A;  4M3L A;  4JVI A;  1NI9 A;  2QE7 H;  4OVR A;  1CSB A;  1B05 A;  2C9L Y;  2FA7 A;  4R9G A;  4DLD A;  5TP9 A;  2VD2 A;  1BE3 E;  1NMU A;  3C31 A;  1A8F A;  3H1H G;  1MXV A;  3EFG A;  3E3K A;  1PL5 A;  3FX0 A;  1B40 A;  3SES A;  4C0R A;  1JY2 P;  2PRR A;  5CBS A;  3GZG A;  3GG2 A;  2BJJ X;  3P7K A;  1AL3 A;  3H03 A;  4MLV A;  3L4F A;  2AEF A;  2KIK A;  5IZ3 B;  4XFJ A;  1CB6 A;  3G3F A;  3OSR A;  1S4X A;  3A3Y B;  1DEB A;  3BIH A;  3UOR A;  2RF1 A;  3L73 J;  2QA4 P;  3CX5 H;  4UAC A;  3TFL A;  1U7J A;  3V4Q A;  1ZRT D;  1UIV A;  2IYO A;  5CJ0 A;  5APX A;  1W2B O;  1NJI Q;  4NF8 B;  1XTG B;  4GOF A;  1D9Q A;  4G8N A;  4H5F A;  2I58 A;  3BAT A;  4KCC A;  1T3U A;  4O7M A;  2FXM A;  5ESY A;  1L5T A;  1LWU A;  3PTZ A;  5ITO A;  2P3V A;  2CEX A;  4PC9 A;  1NTK G;  5I2N B;  1KYO E;  1JVY A;  1IEJ A;  4NGU A;  3MP6 A;  2OLB A;  1H0T B;  1BCC J;  2Y0D A;  3TEP A;  3OEN A;  1FTL A;  2E5T A;  1NU1 K;  2OYH B;  4DXB A;  3RY3 A;  2L5G B;  2XDJ A;  1SQB E;  3UA8 A;  1JNM A;  4OFJ A;  4DZO A;  4F31 B;  3AE6 C;  5APS A;  1NH7 A;  2B4M A;  4EDF A;  2O7U A;  1SVF A;  1IMB A;  3QXM A;  3RQT A;  1ZMG A;  4AYC A;  1EYI A;  2GUV A;  1H88 A;  1HVV A;  2P10 A;  3MPK A;  4GXS B;  1L4A D;  5H2F H;  2WPQ A;  2KSE A;  3M0A A;  4YXD C;  5BU8 B;  1PGP A;  4FE8 A;  4OWD A;  4RXL A;  2HXW A;  4U1O A;  3D4C A;  1S7Y A;  1NV4 A;  1FSA A;  3JCU H;  4PGN A;  4XXU A;  4ELO A;  4N78 E;  2Q7C A;  4WXJ A;  5DYH A;  1SQP D;  1FJ9 A;  1GU4 A;  1JCD A;  1IZ1 A;  4OQO A;  5CCG D;  1MM6 A;  4QSD A;  3Q1M A;  5AVX B;  3CLQ A;  4ZS9 A;  3KN7 A;  2OJT A;  2QMW A;  2XND H;  2FYU E;  2NXO A;  1UTH B;  4BDQ A;  1LTI C;  1ATG A;  2D2C D;  3FD3 A;  1SI1 A;  4PBH A;  4DI3 D;  2AXT E;  5AA2 B;  1ZTY A;  3L71 G;  3BAS A;  4GBW A;  1MFZ A;  4OVS A;  4TLM B;  2KZJ A;  3L36 A;  1LAG E;  1L4A C;  1D7M A;  2ZYN A;  3RPW A;  4WY4 C;  2QM8 A;  3GBA A;  1JW4 A;  1ZLL A;  1VQO P;  2M5A A;  4OAN A;  2WSF H;  2KS1 B;  1II5 A;  1NHL A;  3A09 A;  2VRS A;  4XEQ A;  3KQG A;  2V7Q H;  2K3R A;  1VSO A;  4KQP A;  1PGO A;  1EXJ A;  3R7X A;  3CD6 P;  1GL2 A;  3L73 E;  4NF4 B;  1N73 B;  1MRP A;  4Q5T A;  3SEY A;  4I9D A;  4R2F A;  3F11 A;  3SKP A;  1Q2N A;  3PHL A;  1AVO A;  3KN3 A;  4KHZ E;  1PFI A;  4WED A;  2XHD A;  1ZP0 C;  1SQQ E;  1JY3 O;  4RK9 A;  1URS A;  3WAE A;  2KNC B;  1USD A;  3KDP B;  1M90 Q;  3OXN A;  4E0W A;  1P99 A;  1A02 J;  1FZC C;  2K9J B;  1LBB A;  4PCD A;  1MS7 A;  4DZ1 A;  4H0W A;  1BCC E;  4MHF A;  4WEP A;  1KFN A;  1RQV A;  2IEE A;  1KIL A;  3MP1 A;  1HGV A;  1RHZ B;  3ZDM A;  1W5C E;  2KLU A;  3EWK A;  5KKZ B;  1YTZ T;  1DIP A;  4AB6 A;  3KOT A;  4GLI A;  1QGK B;  1A02 F;  3B71 A;  3USS A;  1BP5 A;  3DP4 A;  1JMM A;  1URQ A;  4M1V A;  2HFB A;  2OWT A;  1OVR A;  2RC7 A;  3PUX E;  5L9M A;  1AOV A;  3V89 B;  1VQN P;  2IBZ G;  3FXD A;  3ILU B;  4U2R A;  2NPS B;  1NKN A;  1K8A Q;  3ECR A;  5ICT A;  1T8Z A;  3N7N A;  4XKP A;  4R75 A;  5CMC A;  1SQB K;  1QEX A;  2LKM A;  1KFM A;  1FQE A;  3CIJ A;  4W7Z A;  2ZJS E;  1ZKB A;  4JBZ A;  3G3K A;  2V4H A;  2E74 C;  3OOA A;  4HXV A;  5IM2 A;  4JWX A;  2QMX A;  3U93 A;  2K1A A;  3Q29 A;  3PPP A;  4N6J A;  3AEF C;  4ZKP A;  1NU1 G;  2I4C A;  2NOO A;  3N6U A;  3PPR A;  3L75 J;  4BDO A;  3C34 A;  2FYN B;  1QW0 A;  3KN8 A;  3KGC A;  5A5X B;  2N1T C;  3A29 A;  3W9W A;  2JEE A;  1HSE A;  3U92 A;  3I3V A;  5ELV A;  2E75 B;  1D4N A;  2OYI B;  4TQU Q;  1OFC X;  4JDF A;  2QEX P;  2YPN A;  3MZW B;  2XWK A;  2WPS A;  4AB5 A;  4F39 A;  4I7Z C;  2R3C A;  3HE4 A;  1GL2 D;  2KI7 B;  3MGN A;  1RDZ A;  3QH9 A;  2FYU K;  1RQU A;  1RE3 C;  1FC2 C;  4DCY A;  3BFT A;  4P56 A;  1O63 A;  2AEM A;  1NV3 A;  1VPC A;  3V2P A;  4ELR A;  1JEK A;  1Q82 Q;  4H65 A;  4IFM A;  2MJZ A;  4LC1 A;  1IXG A;  3HRN A;  2WX9 A;  3RL0 D;  4PJ0 E;  1MPC A;  3E9X A;  1NOH A;  4RJT A;  4N8G A;  3AE8 C;  3CWB J;  3L72 J;  3MW0 A;  4EUO A;  1RYX A;  3B5N C;  1KIL D;  3MBP A;  1EZ9 A;  4NF6 A;  3C9H A;  4CPG A;  4LA9 A;  5TPA B;  3A0B H;  4OGQ C;  4BDN A;  3PH0 A;  4MF3 A;  1B58 A;  2RKL A;  1LTS C;  1A8E A;  3IB1 A;  5AW6 B;  3U72 A;  3JZJ A;  3T93 B;  1YJW P;  1GVC A;  3H1L G;  3NFQ A;  1KC8 Q;  3V83 A;  1SQQ K;  3TGU D;  2IZ0 A;  1M1J B;  3RL0 g;  3D70 A;  3O66 A;  2K37 A;  4U7J A;  5H8H B;  3VMA A;  1VF5 C;  3H1I D;  5LTC A;  2Y9Y A;  4DE8 A;  1R9L A;  2QS4 A;  3PUV E;  1NH4 A;  1A99 A;  1PBP A;  5CM6 A;  3OA7 A;  1BE3 G;  1Y4C A;  5HM4 B;  3MUQ A;  1T0K A;  3EKI A;  1B5J A;  3TCG A;  2XX7 A;  4L17 A;  4Q0C A;  2KB7 P;  3CR9 A;  1NTK J;  2FXP A;  3BRT B;  2OQQ A;  2QSX A;  1Z56 A;  4GX3 A;  3RPL B;  1SQX D;  3VDF A;  4RYA A;  2F3D A;  2R9J A;  2FIX A;  1MPD A;  3JYR A;  2OWS A;  3FJG A;  3CCJ P;  4UAB A;  3LC8 A;  4XF5 A;  1BK4 A;  3T9H B;  3TYY A;  2Y7P A;  2C9N Y;  3Q5S A;  5K2Y A;  3L75 E;  3R2P A;  4PAK A;  3KJT A;  4O7I A;  1LBV A;  3RT8 A;  5E79 E;  1J1D B;  1PC3 A;  2PFX A;  1EZV I;  5AE4 A;  2HOD A;  3CXH D;  4K35 A;  3Q27 A;  1YBK A;  4IL6 X;  2X7Q A;  3KZG A;  3WMM 0;  1FU1 A;  1MFT A;  5KAF H;  4GD5 A;  1XOC A;  1SQB G;  4Z1M H;  1FTA A;  4I1L A;  5TIS E;  1S9K D;  1PP9 G;  1YYC A;  2B3B A;  5J16 A;  2DE3 A;  3VMY A;  3SWK A;  2Y7K A;  2ZZV A;  4U4S A;  5TP9 B;  1ZOY C;  2JWD A;  1N04 A;  4F29 A;  1CI6 A;  3FAT A;  4NE4 A;  2O1J A;  2QG4 A;  3CWB E;  4H13 D;  1LT9 A;  1H8A A;  2Q3I A;  4R74 A;  3HV1 A;  2I8D A;  1VQ5 P;  2ZYM A;  3FVO A;  3FXU A;  2WKY A;  1KYO I;  3EN3 A;  3S4R A;  4FED A;  5CMK A;  5CCH C;  4PFI A;  3R26 A;  4PP0 A;  1IK7 A;  2XZR A;  5DJU B;  1MY4 A;  1LWU B;  2B4L A;  1OVB A;  3ROJ A;  2QJY C;  4KCD A;  3KBR A;  1FDM A;  2FYU G;  2XXH A;  3CPW O;  5APQ A;  3CI8 A;  3KYQ A;  4K3A A;  3KFM A;  1AIV A;  4N6P A;  1KYO H;  3M06 A;  1RY3 A;  2BAS A;  3ODB A;  1OW7 A;  1POY 1;  4G8H A;  1GZL A;  1B7Z A;  5APY A;  5KCJ A;  1GD2 E;  1PB8 A;  1QVF O;  2DXR A;  4P11 A;  1NTK E;  3VV5 A;  3MUD A;  2A06 E;  2VT5 A;  1Y20 A;  1NTM D;  2P7J A;  1DPE A;  3EQ2 A;  4U1Z A;  2B3F A;  1E5W A;  2Y5K A;  3M9B A;  1RF1 C;  1J1E B;  1B4Z A;  5DW8 A;  1EDK A;  1SQQ G;  1N84 A;  1UQW A;  4OTE A;  5LDZ A;  1FJK A;  2KS1 A;  4MNP A;  1LT1 A;  2V25 A;  3LW5 H;  4YAH X;  1FBP A;  4GWS A;  3QMF A;  4P0I A;  1EH3 A;  1NKZ B;  1LTJ A;  1ZME C;  2AXC A;  1N73 A;  4WKM A;  2XXP A;  1L0L D;  5CC2 A;  1NWQ A;  3O8Z A;  2O01 J;  1BGY D;  2ZNU A;  4XFE A;  4YPC A;  3W67 A;  1ZBM A;  2AXT H;  3RK3 D;  3DEL B;  1K04 A;  4ASV A;  3W9V A;  3CCV P;  1JP4 A;  1IIW A;  1URD A;  4G68 A;  4LVQ A;  2M5A B;  1H44 A;  2H98 A;  1NU1 J;  2GRV A;  1LST A;  3C33 A;  3TGU E;  3GLB A;  3IOR A;  4NF5 A;  4RJZ A;  2R5D A;  5JTY A;  3RUM A;  1LFH A;  1DX7 A;  3WUV A;  1GL2 B;  1OZH A;  2XA5 A;  2ZYG A;  2FVZ A;  1NVO A;  4DIG A;  3E1I A;  1OQH A;  2HFE D;  1B4H A;  2WMM A;  3LIE A;  3ONM A;  4GOE A;  4ZE9 A;  3OW2 O;  1MV8 A;  1NV1 A;  2KLF A;  3D6Z A;  1PBQ A;  2QL3 A;  4QHQ A;  1AV1 A;  1SQX E;  3BBR A;  5KDT A;  2NPS A;  2OYH C;  3T0J A;  1NUW A;  2KZI A;  1G0I A;  4KXP A;  4LON B;  3BVH A;  4HE0 A;  3OSQ A;  4QFN A;  2HG5 D;  1KIL B;  3KSJ A;  3TTL A;  3T1B A;  3IJO B;  5KAI E;  3IB0 A;  5AA2 D;  1A7L A;  4L73 A;  1LCT A;  4OVT A;  2QJP B;  2VPO A;  1K9Y A;  3K2D A;  2A45 I;  2RH0 A;  5EQ8 A;  3VYI A;  3IAZ A;  3K00 A;  2P1S A;  2WBB A;  1URQ B;  3B8B A;  4AS5 A;  4OZ9 A;  5IKB A;  1JW5 A;  1LFG A;  2OTJ P;  4F22 A;  1IK9 A;  4OEN A;  1T2K D;  1IO4 A;  4ECF A;  2PCR A;  4YB5 A;  2L5V A;  3TDJ A;  3VN0 A;  2YKO A;  1K9Z A;  4YKP A;  1QLE D;  1LAX A;  3P8M C;  4B86 A;  1FZE A;  3H1L J;  2UYE A;  2V3T A;  3HN0 A;  3MVZ A;  1VQ9 P;  4ONY A;  3V5B A;  4EQ7 A;  2WQY C;  2XD3 A;  3OJA B;  1N7X A;  1HGZ A;  4BDL A;  1NTK K;  2QJK C;  2CZL A;  3FJ7 A;  1G0H A;  4ZEI A;  2IFM A;  1IXC A;  3CHG A;  4I8C A;  3KEI A;  2IBZ E;  4THI A;  3HPI A;  1BE3 J;  1ZJL A;  3T9V A;  4PV1 C;  1N7S B;  1KB9 D;  1NTZ D;  4HKZ H;  1P1O A;  1SLQ A;  4GVO A;  3VOP A;  2P2A A;  1GU5 A;  4KJM A;  1GMJ A;  1VQK P;  1R6Z A;  1CE2 A;  2DW3 A;  1N3W A;  3MP8 A;  4R6Y A;  1SQP G;  4XKR A;  3TTK A;  1SFC A;  3M3L A;  3FV2 A;  3OO6 A;  4QXD A;  5HBC A;  4ZZE A;  2DSF A;  1JO5 A;  1FAV A;  3HE4 B;  2LXB A;  2FBW C;  3EFF K;  5KLV D;  4H44 D;  3S9N C;  1FQF A;  3AE4 C;  2WYP A;  4WBA A;  4PBQ A;  1MXW A;  2DYX A;  5ITP A;  4MX6 A;  3PRJ A;  5M1B A;  1MQD A;  2XKM A;  3C1L A;  4RES B;  3MST A;  2PVU A;  2NPS D;  3S2V A;  3TTN A;  4HB1 A;  2G93 A;  4X9T A;  1DD4 A;  3KPE A;  5TU0 A;  2HYN A;  2I0B A;  4MIJ A;  1IJD B;  2SPZ A;  1NKX A;  5FTI A;  2ZVO B;  4NF6 B;  2WEF A;  2DXY A;  3PUZ E;  1IUD A;  1PP9 J;  2OZZ A;  2M0B A;  2CEY A;  5AW1 B;  4PGP A;  1INP A;  5DEX A;  4MN4 C;  2Z5H A;  1YQ4 C;  3RBZ A;  4O3B A;  1MY0 A;  1VQ7 P;  3MQ9 A;  1QKA A;  2Q2C A;  3K1N A;  5T3J A;  1Z7M E;  4K3F A;  3IB2 A;  2N9Y B;  2RC8 A;  3IO4 A;  2I48 A;  3CFZ A;  2IDB A;  1FPB A;  1SQX K;  2O3J A;  3P7I A;  4KFQ A;  3Q3D A;  3IJX B;  2ZAE B;  2ABH A;  3K6V A;  4F3P A;  4L74 A;  2ZYO A;  1FPJ A;  4O3A A;  3H32 A;  5CJ4 A;  2FYU J;  4WVZ A;  2HXR A;  4PDD A;  3T9U A;  1FPG A;  3G9R A;  1B3L A;  5I57 A;  1BGY E;  1G1I A;  3H1K D;  2I3V A;  2DP8 A;  3CC4 P;  3QSL A;  5KLV J;  1PDA A;  4FOR A;  3RN8 A;  2YMK A;  3SFD C;  3PU5 A;  4MH5 A;  2P1J A;  1SFC D;  4QFK A;  4AQR D;  2E75 C;  2OYI C;  1JNF A;  1QKB A;  4GFR A;  4DT0 A;  3WU2 H;  1B1H A;  2GFE A;  4U3F D;  2PFY A;  2HOD B;  3VE1 B;  2WT7 A;  3PPN A;  2W6B A;  4PFR A;  3L70 D;  5E79 H;  1B3F A;  1KV4 A;  3VLW A;  1RE4 C;  1VQ8 P;  4G4P A;  4GBV A;  3IFA A;  3T22 A;  1LTG C;  1S5L E;  5ICQ A;  2OWZ A;  3NMD A;  1M7L A;  4N07 A;  1GW3 A;  1SQQ J;  4BRY A;  1H3D A;  2YKQ A;  4HJG H;  1RF0 A;  3PMV A;  3CCS P;  3K01 A;  2CMO A;  3VP9 A;  5TIS H;  3MZB A;  2CPS A;  2A06 G;  3O29 A;  1CI6 B;  3Q2Y A;  4U21 A;  1LT9 B;  3CI9 A;  3RK3 B;  3CC2 P;  2H9B A;  3M8U A;  2I49 A;  4PD4 D;  1P1N A;  1VDW A;  5EQA A;  3M0D A;  3D4G A;  4DOJ A;  3FWN A;  1PP9 E;  1K73 Q;  3A0H E;  3D1R A;  4PFW A;  2K88 A;  3FJM A;  3AXF A;  1M1J C;  1SP4 A;  2UXA A;  1VFD A;  4GKG A;  2XXR A;  1KOR A;  3TPA A;  1USY E;  1Q35 A;  2WSS H;  4F3B A;  1AWB A;  2Z8F A;  1XVY A;  1OVU A;  2A5S A;  1H45 A;  1MKM A;  2JO1 A;  1I6A A;  2HZK A;  4NG7 A;  3PMW A;  2F34 A;  2ZZW A;  4RNS A;  1P1Q A;  2QVA A;  5BU5 A;  1NTZ E;  3UIA A;  2IYP A;  1ZLQ A;  1EYK A;  1HSJ A;  3ZKL A;  1IMF A;  3FXB A;  5KCJ B;  4F3G A;  4LQ5 A;  1AVY A;  5AVR B;  3EF7 A;  4N4U A;  2Y7W A;  4MLQ A;  3TGU G;  4H5G A;  1BSH A;  3H1I G;  1FRP A;  3M3F A;  2I1K A;  4FIM A;  3ZSF A;  1YJ9 P;  2ZXT A;  1LTA C;  3C9I A;  2N1T A;  5KLV E;  1B3E A;  1J1D C;  3TCF A;  5I59 A;  3G3G A;  4H45 A;  3VVD A;  1S72 P;  3IAO A;  4ESW A;  2HLO A;  1AA0 A;  1IZN B;  2YIU B;  3ISP A;  1LGH B;  1X0T A;  1YIT P;  1NNP A;  5AA1 A;  5J1D A;  1NV5 A;  2Q1K A;  1SQX G;  4Y99 B;  5CCG C;  2HPC A;  4YB7 A;  3RK2 B;  1LTJ B;  1L2P A;  1VQP P;  2XWI A;  2GM4 A;  2B65 A;  2ZYK A;  1NV6 A;  1SW4 A;  2N9B A;  2D2C C;  1Y1Z A;  2UVJ A;  1FZB A;  1ZW0 A;  3UN6 A;  4GL8 A;  2KUB A;  1JVX A;  3G7W A;  2M3B A;  3B5N A;  4X1D A;  3Q26 A;  1URG A;  1MY2 A;  4X8R A;  4G68 B;  2E42 A;  1EU8 A;  1FTK A;  4NF5 B;  1FTO A;  2XXT A;  4E0X A;  1D3K A;  3LSX A;  5JTY B;  5CMB A;  2ZXX A;  3CX5 D;  3AEC C;  1S1C X;  1B52 A;  3U1C A;  4ZNC A;  1LWU C;  1SQP J;  4H44 B;  2YLN A;  2B87 A;  1DK4 A;  2VHA A;  3N94 A;  4LN5 A;  4LP2 B;  5FHO A;  3VVE A;  3KZI E;  4MNC A;  1NUX A;  1LBZ A;  1LFI A;  4MJO A;  5KLI C;  1IFM A;  1OX3 A;  2G8Y A;  3VXC A;  3LUY A;  4ESX A;  1SS1 A;  1YZ0 A;  1FDO A;  2Y0C A;  3D71 A;  2YJP A;  5KDT B;  4R6H A;  2YMY A;  2GA1 A;  2X7P A;  3GF3 A;  1FQB A;  1Y1M A;  1M5E A;  3OAK A;  3IR1 A;  4EQ9 A;  2UVH A;  4TT3 H;  1NNT A;  3MPL A;  2E5Y A;  3ZKK A;  1MUU A;  1L0N D;  1KQG B;  4H67 A;  3BCC D;  4U23 A;  5CBR A;  4GWY A;  1TFA A;  2ZVN B;  4HTG A;  3NXS A;  1F9B A;  4PQJ A;  2QFL A;  5KAI H;  2FNC A;  4RK2 A;  2O1L A;  1MXU A;  2I1J A;  4RPO A;  2ZNS A;  1N7S A;  2D21 A;  1M5B A;  2PFZ A;  4JSD A;  3U94 A;  1WDN A;  1J1E C;  2Z22 A;  4FBP A;  2IBZ I;  5L8D A;  1ZRT E;  2CZH A;  1BDC A;  3LID A;  2R71 A;  3TTM A;  1NTZ K;  3FVK A;  3NOH A;  1SPI A;  4YU0 A;  1FQD A;  3OO9 A;  3HFU A;  2Z8E A;  4JYC A;  2QVU A;  1B1X A;  1LB8 A;  5DJT B;  4QMA A;  1S3J A;  1HSL A;  1NTM G;  3S1K A;  1M5F A;  3TYH A;  1FPK A;  5KLV K;  2RC9 A;  3B6Q A;  2HZL A;  2O84 X;  2Q2A A;  2FFD C;  4PD4 E;  3GF7 A;  5A5L A;  4IB2 A;  3A3U A;  2REG A;  4A7P A;  1SFC B;  4YKK A;  2NVU B;  4HE1 A;  2O01 H;  1LEV A;  4POW A;  5CHX A;  1LTT C;  4OFL A;  5CCH A;  2W7Y A;  3IOW A;  1GL2 C;  3V6I A;  1LJ2 A;  1URQ D;  5HPQ A;  1WMK A;  4JWO A;  1S9T A;  2O6A A;  1FOS F;  1L0L G;  3EHU A;  2BEZ F;  3CG1 A;  1BGY G;  2CZI A;  1Y47 A;  2WSC J;  1FW0 A;  1SQP E;  2MKZ A;  4NED A;  3S4U A;  3O6I A;  3H6P A;  3RL0 C;  4H0L D;  1P84 I;  2RCA A;  1JY2 O;  3U1O A;  3FGA D;  4NMY A;  5JEI A;  1SBP A;  2ONR A;  5B5E E;  3QYT A;  1JTH B;  4BXL A;  4F19 A;  3UK4 A;  1KIL C;  2HQ0 A;  2QS2 A;  3LSL A;  2ZXE B; 
#chains in the Genus database with same CATH homology
 4WWI A;  5DEX B;  1Z7N E;  4R73 A;  1UIU A;  3T66 A;  2XXW A;  3I6V A;  1QUK A;  3SET A;  1U7M A;  1WOD A;  1AMF A;  2E1S A;  2Q89 A;  3H6T A;  3O28 A;  2O51 A;  3PUW E;  3G3J A;  5C39 A;  1IXI A;  1BDD A;  1A54 A;  3H3G A;  1NH8 A;  5I57 B;  4FEB A;  4F1Y A;  5LOM A;  4H8I A;  3PPQ A;  2PX1 A;  5AA4 A;  1S50 A;  2Q9T A;  2LXC B;  5H8N B;  4KYS A;  4H6D A;  5DT6 A;  4ZMD A;  3L6G A;  1JET A;  3O97 A;  3OO7 A;  4MFI A;  3OO8 A;  1B0H A;  1OIB A;  4AQ4 A;  4IO6 A;  4IY6 A;  4GF8 A;  3SDF A;  1PB7 A;  4GQO A;  4ZEB A;  4ZZA A;  4IGR A;  3FZV A;  3N6T A;  1SI0 A;  1SYH A;  2A5T A;  1ZXG A;  4IGT A;  3DM0 A;  2XXU A;  3S9L C;  1OQG A;  3FXQ A;  3OEK A;  4BDR A;  3IX1 A;  1ELJ A;  1LAF E;  2HR3 A;  1B9J A;  4N13 A;  3DP6 A;  1H43 A;  1SD3 A;  2QRX A;  1USY H;  4C1T A;  4G8M A;  4RY1 A;  4GOD A;  1JMB A;  1JEV A;  3K4U A;  5DVF A;  2OCU A;  4QFO A;  2R44 A;  3EQ1 A;  5CRY A;  4EF1 A;  4R9F A;  2H4I A;  1FTM A;  4XIG Q;  3W15 C;  3SEU A;  4P0G A;  1OMP A;  3HST A;  2DVZ A;  3CRB A;  3OEM A;  1LAH E;  1FTJ A;  5I59 B;  1YCJ A;  3BKI B;  2H5Y A;  1EC5 A;  4RPN A;  3IOT A;  3TAJ A;  3C4M A;  1B3H A;  1JEU A;  2AYS A;  5CI5 A;  4ELQ A;  4M4G A;  1VFE A;  4MBP A;  4BLA A;  2DOJ A;  3MAM A;  4YB6 A;  4R72 A;  2ANJ A;  1MXX A;  1Y4T A;  1I6B A;  4PFU A;  2O69 A;  5ISU A;  3SEX A;  2F5X A;  2Q8J A;  4OMB A;  2B87 B;  1DEE G;  4ZE8 A;  5FHM A;  3QUF A;  3TMG A;  2Q88 A;  2V3Q A;  4EXK A;  4R2B A;  2XXX A;  3K1P A;  3CFL A;  2PBW A;  5I58 A;  5F1Q A;  1DTZ A;  5EFW B;  1DMB A;  1M5D A;  3U8Q A;  3A3C A;  3H6U A;  3L6H A;  2Z23 A;  4ZDM A;  4OEV A;  4IO7 A;  1IQ7 A;  1OLA A;  3THI A;  3IL1 B;  4Q30 B;  2O68 A;  4YIC A;  5K2X A;  4LZ7 A;  1D9Y A;  2XXQ A;  5F7V A;  2ESN A;  2P0S A;  1NNK A;  2VD3 A;  1MH3 A;  3Q28 A;  2I4B A;  2I6E A;  4F2Q A;  5M2V A;  1MDQ A;  3MJN A;  4I1D A;  2V3U A;  1B7U A;  2QS3 A;  3VXB A;  1MM7 A;  4IY5 A;  1SQY A;  1PB9 A;  2DWI A;  3VLU A;  3N26 A;  5EYF A;  4YKJ A;  5EHS A;  2H99 A;  3QAX A;  4I62 A;  1P1U A;  1PEB A;  4QRZ A;  4FJP A;  5L9S A;  1JQF A;  2RIN A;  1YPN A;  5H8F A;  5CBO A;  1TFD A;  2LR2 A;  3QIM A;  3KOS A;  2GHA A;  3TOD A;  4Q8R A;  3K6W A;  3GXA A;  2DE2 A;  4YMA A;  3N5L A;  4HCY A;  4KI0 E;  3IO6 A;  4GWO A;  4TLL B;  5H8N A;  1MDP 1;  2XX9 A;  1XC1 A;  1NFT A;  3O2A A;  3K02 A;  3H6W A;  1N76 A;  1TWY A;  3FXR A;  2F6P A;  5I2K B;  3RTF B;  1BKA A;  5AA4 B;  1UTB A;  3SEW A;  3TQL A;  4POX A;  1IXH A;  1N3X A;  1GTK A;  1DOT A;  2ZMB A;  4EDP A;  4BDM A;  3MVX A;  1LGB C;  3IK6 B;  1QUL A;  3ZS6 A;  4YMB A;  1LBC A;  2ONK E;  2RCB A;  4NTL A;  2PMS A;  4NWC A;  3LBS A;  1MY3 A;  5H8Q A;  2H25 A;  4JB7 A;  4QF9 A;  3FVG A;  2UYF A;  2I3W A;  2XXV A;  1WVJ A;  4ELP A;  1FQA A;  1QUI A;  3FXE A;  2R6G E;  1ZIU A;  4O3C A;  2Y7I A;  2GH9 A;  4R6K A;  2A5T B;  1MQG A;  3MZ9 A;  1MPB A;  4ZEC A;  3MHV A;  3OMB A;  4DXC A;  4RA1 A;  2HEU A;  2ONS A;  2F7C A;  4JWY A;  4OHN A;  1EDL A;  4IO2 A;  4PET A;  3CFX A;  3C32 A;  3RT6 B;  4DDD A;  3RLF E;  4OES A;  1OVV A;  1J1N A;  1GV8 A;  2NUV A;  2HCA A;  3CSB A;  3MWB A;  1SDX A;  4EF2 A;  3TEL A;  3RGY A;  5DTB A;  4PE5 B;  4G77 A;  4LAT A;  2QRY A;  1M5C A;  3C36 A;  2DS9 A;  3V5A A;  2QJE A;  1B5I A;  3SER A;  3G3H A;  3K1M A;  2F97 A;  4PFT A;  5B7D A;  3GBB A;  1A55 A;  1QUJ A;  4OXV A;  5BWJ A;  1Y9U A;  3HHG A;  3SEV A;  3BFU A;  2UWJ E;  4IO5 A;  1D9V A;  2VGQ A;  2F78 A;  2E0S A;  1VR5 A;  3EHS A;  3EPE A;  4XKN A;  4QSE A;  1B46 A;  4F2O A;  2O1M A;  4IO4 A;  2V84 A;  4FEC A;  1POT A;  1R1N A;  2OBG A;  2DVC A;  1FQC A;  2REJ A;  1SVX B;  1XT8 A;  4HS7 A;  1LP1 A;  1EDI A;  1N7W A;  1RKM A;  3T96 B;  1BTJ A;  2XX8 A;  1SW1 A;  3QUJ A;  3RTW B;  3IOU A;  5I58 B;  4FAT A;  3C35 A;  2OK2 A;  3PD8 A;  2DWJ A;  3O6H A;  3LR1 A;  3PV0 E;  5CBN A;  2PT2 A;  3DLN A;  4DCX A;  3FAS A;  2VOZ A;  1QVS A;  4LZ5 A;  2F6G A;  3V8X B;  3WAF A;  4YKI A;  1Y3Q A;  3KG2 A;  4X48 A;  3R6U A;  4KR5 A;  1DSN A;  1LCF A;  1KWH A;  5AA3 A;  1XS5 A;  4EQB A;  3G3I A;  3OD7 A;  4ND9 A;  2LAO A;  1XVX A;  3FUZ A;  2F8D A;  3EHT A;  4HCW A;  5I84 A;  4KYE A;  3QK6 A;  2UVI A;  2PYY A;  4ISU A;  4F18 A;  3O9P A;  4GOT A;  2Y84 A;  3I5O A;  4TOZ A;  2DWH A;  3K6X A;  3VLV A;  1Y3N A;  3LSW A;  5KZT A;  3VFJ A;  5BUU A;  4H8J A;  4UA8 A;  3B6W A;  2QPQ A;  3DP8 A;  3H4Z A;  3UP9 A;  3MZ1 A;  5H8F B;  3LSF B;  3TZA A;  3O6G A;  4OET A;  4QFP A;  4LZ8 A;  2O7I A;  1EZO A;  5I2K A;  3TQW A;  4QFL A;  1R9Q A;  3TCH A;  1MQJ A;  3KSX A;  1DTG A;  4G2Z A;  3H6V A;  3KJ7 A;  3FIR A;  1I6Q A;  5I56 B;  4NPD A;  4OFO A;  1I69 A;  2HAV A;  1B5H A;  1B7H A;  4KD5 A;  3QWO C;  4NF8 A;  5JK4 A;  1UTB B;  5DVJ A;  5EHM A;  1P1W A;  5I2N A;  2IA4 A;  4U22 A;  3B6T A;  1H0T A;  3H06 B;  3Q25 A;  3JV9 A;  1FCK A;  5H8Q B;  2DQV A;  1LB9 A;  1MG1 A;  3ILT B;  1SW5 A;  4HW8 A;  5FHN A;  4ZED A;  1EDJ A;  1B6H A;  1ANF A;  3HHF A;  3E4R A;  4JXI A;  2M8C A;  4C1U A;  1JM0 A;  2I0C A;  5L9O A;  1A40 A;  2XXY A;  4H1X A;  4NWD A;  5IAI A;  3PMX A;  4LUB A;  3S9M C;  3PPO A;  1ZU0 A;  4NPE A;  4KYD A;  3MVY A;  4OYV A;  5DVI A;  2ZNT A;  1OLC A;  4F1V A;  3H7M A;  3MVW A;  2QS1 A;  1UTH A;  3B7D A;  5AA2 A;  4KPT A;  4DXU A;  3FGS A;  1B51 A;  3TUS A;  2Y7R A;  1IIT A;  4IOI H;  3PUY E;  1VE4 A;  1DPP A;  4NF4 A;  3HCQ A;  1JW1 A;  2G29 A;  4LQ2 A;  4ASW A;  2AL4 A;  3E13 X;  3IOV A;  1RYO A;  5K5G B;  2ALU A;  1MH4 A;  3CVG A;  5CMM A;  4IO3 A;  1TXF A;  2B89 A;  3PD9 A;  2AL5 A;  3T9X B;  5B70 A;  2F7A A;  5H8S A;  3FV1 A;  3K0V A;  2B88 A;  1NL5 A;  2D5W A;  4F3S A;  1QJM A;  4EXL A;  1MQH A;  4F1U A;  2D3I A;  4X1B A;  2GHB A;  1B3G A;  1SW2 A;  1TT1 A;  1H76 A;  4NPF X;  1OVT A;  3TTR A;  4PFY A;  3USD A;  1NNF A;  4XKQ A;  1LP1 B;  1SYI A;  1YTV A;  2XD2 A;  2V93 A;  2F35 A;  3TKD A;  5A5X A;  1EZP A;  2AIX A;  2XXI A;  1MQI A;  1Y3P A;  2PT1 A;  1LLS A;  3RNN A;  1O64 A;  1BLF A;  3UIF A;  4OVJ A;  2HAU A;  1GR2 A;  4OER A;  4FAJ A;  1B2H A;  4GRK A;  2RKM A;  2P58 A;  2X26 A;  3RGU A;  1N0T A;  1AH5 A;  3VVF A;  4ZEK A;  3UGW A;  4G68 C;  4GL0 A;  4Z0I A;  2THI A;  5TPA A;  1B32 A;  2UVG A;  4XTC Q;  4GIZ A;  4YZZ A;  2VP1 A;  5H8H A;  1YAE A;  1US5 A;  2DWA A;  4OEU A;  1MY1 A;  3OEL A;  3S9E A;  1US4 A;  2F7B A;  3CG3 A;  1O7T A;  4ZEF A;  5FTH A;  2OTK E;  3FVN A;  3HO7 A;  2DE4 A;  4EYY Q;  1GGG A;  2FYI A;  3PGF A;  4GXA A;  1MXZ A;  4JSO A;  4QSC A;  3M3K A;  3MC2 A;  3CSG A;  3K6U A;  1XHY A;  4U4X A;  1B0L A;  1BIY A;  2NWJ A;  5I56 A;  2F36 A;  1MXY A;  1Q1K A;  2Z8D A;  4Z7E A;  1B05 A;  2FA7 A;  4R9G A;  4DLD A;  5TP9 A;  2VD2 A;  3C31 A;  1NMU A;  1A8F A;  1MXV A;  3E3K A;  3SES A;  1B40 A;  4C0R A;  5CBS A;  3GZG A;  2BJJ X;  1AL3 A;  3H03 A;  4MLV A;  2KIK A;  1CB6 A;  3G3F A;  3OSR A;  3UOR A;  2RF1 A;  3TFL A;  4UAC A;  1U7J A;  1UIV A;  4NF8 B;  4G8N A;  4GOF A;  4H5F A;  2I58 A;  1L5T A;  4KCC A;  5ITO A;  5I2N B;  1JVY A;  1IEJ A;  3MP6 A;  2OLB A;  1H0T B;  3TEP A;  3OEN A;  1FTL A;  4DXB A;  3RY3 A;  3UA8 A;  4OFJ A;  4F31 B;  1NH7 A;  2O7U A;  3QXM A;  3RQT A;  1ZMG A;  3MPK A;  4GXS B;  4U1O A;  4FE8 A;  4OWD A;  4RXL A;  2HXW A;  3D4C A;  1S7Y A;  4XXU A;  4ELO A;  4WXJ A;  5DYH A;  1IZ1 A;  4OQO A;  1MM6 A;  4QSD A;  4ZS9 A;  3KN7 A;  2OJT A;  2QMW A;  2NXO A;  1UTH B;  4BDQ A;  1ATG A;  3FD3 A;  1SI1 A;  5AA2 B;  1ZTY A;  4TLM B;  2KZJ A;  1LAG E;  2ZYN A;  3RPW A;  3GBA A;  1JW4 A;  2M5A A;  1II5 A;  2KS1 B;  3A09 A;  1VSO A;  2K3R A;  4KQP A;  3R7X A;  4NF4 B;  1MRP A;  4Q5T A;  3SEY A;  4I9D A;  4R2F A;  3F11 A;  3SKP A;  1Q2N A;  3KN3 A;  4KHZ E;  4WED A;  2XHD A;  4RK9 A;  1URS A;  3WAE A;  3OXN A;  4E0W A;  1P99 A;  1LBB A;  1MS7 A;  4DZ1 A;  4H0W A;  4WEP A;  2IEE A;  3MP1 A;  3ZDM A;  4AB6 A;  3KOT A;  4GLI A;  1BP5 A;  3DP4 A;  4M1V A;  2HFB A;  2OWT A;  1OVR A;  2RC7 A;  3PUX E;  5L9M A;  1AOV A;  3V89 B;  3FXD A;  3ILU B;  4U2R A;  3ECR A;  5ICT A;  4XKP A;  4R75 A;  5CMC A;  1FQE A;  3CIJ A;  1ZKB A;  4JBZ A;  3G3K A;  3OOA A;  4JWX A;  2QMX A;  3U93 A;  3Q29 A;  3PPP A;  3PPR A;  3N6U A;  2I4C A;  2NOO A;  4BDO A;  3C34 A;  1QW0 A;  3KN8 A;  3KGC A;  5A5X B;  3W9W A;  3U92 A;  1HSE A;  3I3V A;  5ELV A;  1D4N A;  4TQU Q;  4JDF A;  2YPN A;  3MZW B;  4AB5 A;  4F39 A;  2KI7 B;  1FC2 C;  4DCY A;  3BFT A;  1O63 A;  4ELR A;  4H65 A;  1IXG A;  1MPC A;  3E9X A;  3MW0 A;  4EUO A;  1RYX A;  3MBP A;  1EZ9 A;  4NF6 A;  3C9H A;  4CPG A;  4LA9 A;  5TPA B;  4BDN A;  3PH0 A;  4MF3 A;  1B58 A;  2RKL A;  1A8E A;  3IB1 A;  3U72 A;  3JZJ A;  3T93 B;  1GVC A;  3V83 A;  5H8H B;  3O66 A;  4DE8 A;  1R9L A;  2QS4 A;  3PUV E;  1A99 A;  1PBP A;  5CM6 A;  1Y4C A;  5HM4 B;  3MUQ A;  1T0K A;  1B5J A;  3TCG A;  2XX7 A;  4L17 A;  4Q0C A;  3CR9 A;  2QSX A;  3VDF A;  4RYA A;  2R9J A;  1MPD A;  3JYR A;  2OWS A;  3FJG A;  3LC8 A;  3T9H B;  2Y7P A;  5K2Y A;  3KJT A;  3RT8 A;  1PC3 A;  5AE4 A;  4K35 A;  3Q27 A;  2X7Q A;  3KZG A;  1MFT A;  4GD5 A;  1XOC A;  2B3B A;  2DE3 A;  2Y7K A;  5TP9 B;  4U4S A;  2JWD A;  1N04 A;  4F29 A;  3FAT A;  4NE4 A;  4R74 A;  3HV1 A;  2I8D A;  2ZYM A;  3FVO A;  3FXU A;  2WKY A;  3EN3 A;  4FED A;  5CMK A;  3R26 A;  4PP0 A;  5DJU B;  1MY4 A;  1OVB A;  4KCD A;  3KBR A;  2XXH A;  3CI8 A;  4K3A A;  3KFM A;  1AIV A;  4N6P A;  3ODB A;  1POY 1;  4G8H A;  1B7Z A;  5KCJ A;  1PB8 A;  2DXR A;  4P11 A;  3VV5 A;  1Y20 A;  1DPE A;  4U1Z A;  2B3F A;  1B4Z A;  1EDK A;  1N84 A;  1UQW A;  4OTE A;  1LT1 A;  2V25 A;  4YAH X;  4P0I A;  1EH3 A;  4WKM A;  2XXP A;  5CC2 A;  2ZNU A;  1ZBM A;  3DEL B;  4ASV A;  3W9V A;  1IIW A;  1URD A;  4G68 A;  4LVQ A;  2M5A B;  1H44 A;  2H98 A;  2GRV A;  1LST A;  3C33 A;  3GLB A;  3IOR A;  4NF5 A;  4RJZ A;  5JTY A;  3RUM A;  1LFH A;  1NVO A;  4DIG A;  1OQH A;  1B4H A;  2WMM A;  3ONM A;  4GOE A;  4ZE9 A;  2KLF A;  2QL3 A;  1PBQ A;  4QHQ A;  3BBR A;  5KDT A;  2KZI A;  4LON B;  3OSQ A;  4QFN A;  3KSJ A;  3TTL A;  3IJO B;  3IB0 A;  5AA2 D;  1A7L A;  1LCT A;  3K2D A;  3IAZ A;  3K00 A;  2P1S A;  4OZ9 A;  5IKB A;  1JW5 A;  1LFG A;  4F22 A;  4OEN A;  4ECF A;  4YB5 A;  3TDJ A;  4YKP A;  1LAX A;  2V3T A;  2UYE A;  3HN0 A;  3MVZ A;  4ONY A;  4EQ7 A;  2XD3 A;  1N7X A;  4BDL A;  2CZL A;  4ZEI A;  3FJ7 A;  1IXC A;  4I8C A;  3KEI A;  4THI A;  3HPI A;  1ZJL A;  3T9V A;  4HKZ H;  1P1O A;  4GVO A;  2P2A A;  4KJM A;  1R6Z A;  1CE2 A;  1N3W A;  3MP8 A;  4R6Y A;  4XKR A;  3TTK A;  3M3L A;  5HBC A;  3FV2 A;  3OO6 A;  4ZZE A;  2DSF A;  2LXB A;  3S9N C;  1FQF A;  1MXW A;  2DYX A;  5ITP A;  1MQD A;  2PVU A;  3S2V A;  3TTN A;  4HB1 A;  2G93 A;  4X9T A;  5TU0 A;  2I0B A;  2SPZ A;  1NKX A;  5FTI A;  4NF6 B;  2DXY A;  3PUZ E;  1IUD A;  2OZZ A;  2M0B A;  5DEX A;  4MN4 C;  4O3B A;  1MY0 A;  3MQ9 A;  1QKA A;  2Q2C A;  3K1N A;  1Z7M E;  4K3F A;  3IB2 A;  2RC8 A;  3IO4 A;  2I48 A;  3CFZ A;  3P7I A;  4KFQ A;  3IJX B;  2ZAE B;  2ABH A;  3K6V A;  4F3P A;  2ZYO A;  4O3A A;  3T9U A;  1B3L A;  5I57 A;  2I3V A;  2DP8 A;  3QSL A;  1PDA A;  4FOR A;  3RN8 A;  3PU5 A;  4MH5 A;  4QFK A;  1JNF A;  1QKB A;  4GFR A;  1B1H A;  2GFE A;  3VE1 B;  3PPN A;  1B3F A;  3VLW A;  3T22 A;  4G4P A;  5ICQ A;  4N07 A;  1H3D A;  4HJG H;  3PMV A;  3K01 A;  2CMO A;  3MZB A;  3O29 A;  4U21 A;  2H9B A;  3M8U A;  2I49 A;  1P1N A;  3D4G A;  4PFW A;  3FJM A;  3AXF A;  2UXA A;  1VFD A;  2XXR A;  3TPA A;  1USY E;  1Q35 A;  4F3B A;  2Z8F A;  1XVY A;  1OVU A;  2A5S A;  1H45 A;  1I6A A;  2HZK A;  3PMW A;  2F34 A;  4RNS A;  1P1Q A;  2QVA A;  1ZLQ A;  3ZKL A;  1HSJ A;  5KCJ B;  4F3G A;  4LQ5 A;  3EF7 A;  2Y7W A;  4MLQ A;  4H5G A;  3M3F A;  4FIM A;  3ZSF A;  2ZXT A;  1B3E A;  3TCF A;  5I59 A;  3G3G A;  3VVD A;  4ESW A;  1X0T A;  1NNP A;  5AA1 A;  5J1D A;  2Q1K A;  4YB7 A;  2B65 A;  2ZYK A;  1SW4 A;  1Y1Z A;  2UVJ A;  3UN6 A;  1ZW0 A;  4GL8 A;  2KUB A;  1JVX A;  3G7W A;  4X1D A;  3Q26 A;  1URG A;  1MY2 A;  4G68 B;  1EU8 A;  1FTK A;  4NF5 B;  1FTO A;  2XXT A;  4E0X A;  1D3K A;  3LSX A;  5JTY B;  5CMB A;  1B52 A;  4ZNC A;  2YLN A;  4LP2 B;  2B87 A;  2VHA A;  3N94 A;  5FHO A;  3VVE A;  1LFI A;  3VXC A;  3LUY A;  4ESX A;  1SS1 A;  2YJP A;  5KDT B;  4R6H A;  2X7P A;  1FQB A;  1Y1M A;  1M5E A;  3IR1 A;  4EQ9 A;  2UVH A;  1NNT A;  3MPL A;  3ZKK A;  4H67 A;  4U23 A;  5CBR A;  1TFA A;  4HTG A;  1F9B A;  4PQJ A;  2FNC A;  4RK2 A;  2O1L A;  1MXU A;  4RPO A;  2ZNS A;  2D21 A;  1M5B A;  4JSD A;  3U94 A;  1WDN A;  2Z22 A;  5L8D A;  1BDC A;  2R71 A;  3TTM A;  3FVK A;  4YU0 A;  1FQD A;  3OO9 A;  2Z8E A;  1B1X A;  1LB8 A;  5DJT B;  1S3J A;  1HSL A;  3S1K A;  1M5F A;  3TYH A;  2RC9 A;  3B6Q A;  2HZL A;  2O84 X;  2Q2A A;  4IB2 A;  3A3U A;  2REG A;  4YKK A;  2NVU B;  4POW A;  4OFL A;  2W7Y A;  3IOW A;  5HPQ A;  4JWO A;  1S9T A;  2O6A A;  3EHU A;  3CG1 A;  1Y47 A;  1FW0 A;  4NED A;  3S4U A;  3O6I A;  2RCA A;  3U1O A;  5JEI A;  4NMY A;  1SBP A;  2ONR A;  3QYT A;  4BXL A;  4F19 A;  3UK4 A;  2HQ0 A;  2QS2 A;  3LSL A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...