4JBZA

Structure of mcm10 coiled-coil region
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
401
structure length
401
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMGVCQEKSKDELEDELRKMQAQMKKLQEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mcm10 self-association is mediated by an N-terminal coiled-coil domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication
molecule keywords MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH XENOPUS LAEVI
total genus 131
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4jbzA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA01
1BIYA 4WEDA 1H45A 1QVSA 3OELA 1LCFA 5L9SA 3S9EA 3SDFA 1LP1A 1H43A 3QK6A 2DWHA 1MXUA 3C4MA 4OETA 4QRZA 2B89A 3KFMA 3PPRA 4HCYA 4G8HA 5KCJA 3PV0E 4EQ9A 3EQ1A 3CIJA 1XC1A 2LXCB 5KDTA 1MY0A 4JWOA 3H6WA 1YTVA 3RTWB 2F5XA 2YLNA 3VLWA 2OJTA 1UIUA 4TLLB 4THIA 5I84A 4YKIA 3RT8A 4F3PA 4QFLA 1OIBA 2B3FA 1EH3A 3N5LA 3TZAA 2B87B 1ELJA 3TTKA 4ASWA 1IXCA 4OHNA 3MHVA 1IXHA 4DXUA 5CBRA 5AA2A 3MP1A 4ESWA 3IOTA 2X26A 2ZXTA 1UQWA 3O6GA 3C9HA 3HHFA 5AE4A 3UORA 1MXYA 4MBPA 5DYHA 4NF8A 4LVQA 4OERA 2DP8A 4YU0A 4MN4C 3B6QA 4ELQA 1XVYA 3K02A 4IO5A 4F19A 5H8HA 4NF6B 3SKPA 4KFQA 2I4BA 3C34A 1N7XA 3S9MC 2QRYA 4M4GA 2DWAA 1YCJA 4MF3A 2Q89A 1B3GA 2HQ0A 3N6TA 2FA7A 3MPKA 1A8FA 3PU5A 4G2ZA 3I3VA 1MG1A 1UTHB 1OLAA 2AYSA 2RINA 4G4PA 1ZIUA 2I49A 1HSLA 1Z7NE 4IO6A 4R2FA 1MXZA 4F3BA 4RPOA 4JSDA 5HM4B 5ITOA 1IITA 3CFZA 3GXAA 1Y3PA 1LAXA 4OFJA 3SESA 1NFTA 1UTHA 1B40A 1JVYA 3C33A 1DMBA 2B87A 2M5AB 2ALUA 1UIVA 4U22A 3SETA 1B3FA 2HEUA 3FGSA 4R75A 3K1PA 3IOVA 3KSXA 3W15C 4OENA 4QSCA 3IOUA 1SYHA 3TCHA 3FVKA 4OFOA 1B9JA 3SEWA 1OVRA 4DZ1A 2Y7WA 3KN8A 3RGYA 2HAUA 3OO8A 1M5BA 3CSGA 2HFBA 5K2XA 2F34A 4NF4B 5ISUA 3FVOA 4ZZEA 4YKPA 2V3QA 3GBBA 3UK4A 3TEPA 4Z0IA 1LGBC 3KJTA 1OVBA 1Q35A 4U21A 4JBZA 2QJEA 3FD3A 3R26A 1IXIA 1KWHA 1QUJA 3H6VA 1JW1A 2VHAA 4PP0A 2REJA 2RCAA 5FHMA 1A99A 3G3IA 1OVVA 2Q2CA 3PD8A 2I3WA 4F2OA 2I3VA 1DPEA 3FXEA 3O29A 1P1OA 1MQIA 4KYEA 1QW0A 4QFNA 5I58A 5CMCA 4MFIA 3H6UA 4G68A 3DM0A 2H5YA 4YMAA 1B32A 1D9YA 2F6PA 4F1UA 4X9TA 3TELA 4ZZAA 2RKMA 1MQDA 1ZMGA 1B1HA 1GTKA 2DVZA 1DEEG 1Z7ME 1IUDA 4F3GA 5H8NB 1PC3A 5CI5A 3OEMA 1QUIA 2B65A 2NWJA 5H8HB 4NF5B 2GHBA 3FVNA 3TTRA 2DXYA 3QUJA 1Y3QA 3G7WA 2ONRA 4CPGA 3O2AA 1OQGA 4GD5A 4LQ5A 3Q27A 1NNKA 2D21A 4ZS9A 2OZZA 4FAJA 1ZU0A 3EN3A 5ICTA 4FORA 3MBPA 5A5XA 3MWBA 1N84A 2VD2A 1N3XA 3GZGA 3ECRA 1VFDA 4QFKA 3ILUB 5DTBA 5H8SA 4H5GA 2Y7RA 1U7JA 3JYRA 2DWJA 5AA4A 4IO2A 3Q28A 3FJGA 4DCXA 2DE3A 1FQEA 2PT2A 4GXAA 4O3BA 4E0WA 4YAHX 4LUBA 1LB9A 1B3HA 3Q26A 4R2BA 2DOJA 4OQOA 2V3TA 4EDPA 1ZW0A 5AA4B 5M2VA 5K5GB 4PE5B 1JEVA 1S3JA 1ANFA 1FQCA 3TYHA 1FTMA 5K2YA 1P1UA 1AMFA 3IO4A 1AOVA 1CB6A 2QS4A 4BDMA 3PUWE 3K4UA 4U2RA 1FW0A 1P1NA 3OO6A 4PFWA 4DLDA 4ZEFA 4GIZA 2G29A 4NWCA 4G8MA 1JW4A 2XXTA 1VSOA 3E3KA 4YB7A 3E9XA 2Y7KA 3USDA 3IX1A 5FHOA 2XD3A 4IY6A 5I57B 4E0XA 2XHDA 3VE1B 2A5SA 4UA8A 3K00A 4Q8RA 5FTIA 1QUKA 2QMXA 4NPEA 2P1SA 2VGQA 3WAFA 4JDFA 1L5TA 1A54A 2H25A 2RC9A 2QVAA 3E4RA 4KI0E 2IA4A 4FEBA 1DOTA 1LT1A 1GGGA 1UTBA 2O84X 1MFTA 3N94A 1O7TA 5ITPA 2LAOA 3TCFA 1NMUA 1IXGA 3ONMA 1EZPA 1SVXB 1WODA 4AQ4A 4LZ5A 3OO7A 4RYAA 3IAZA 1SYIA 2XD2A 3C31A 1MXXA 1Y9UA 3EPEA 4EF2A 2VD3A 1XVXA 2O6AA 4H67A 4KCCA 1LAFE 4Q30B 5JTYB 4F39A 1FC2C 5TU0A 2R9JA 1PB8A 1R9QA 4IB2A 2Y7PA 3HSTA 3L6GA 1FCKA 4F1YA 3M3LA 4KCDA 4ONYA 3O97A 4GOTA 5I2KB 2V3UA 4BDQA 4O3CA 2I48A 1MDP1 2XX9A 1PBQA 1USYE 3U92A 5CBOA 3QAXA 1BP5A 3QYTA 1T0KA 1DTGA 3O28A 4LA9A 4EXLA 3RLFE 4GVOA 3RUMA 2RCBA 4YZZA 3O66A 1NH8A 3MAMA 2P0SA 5F1QA 4JXIA 3IJXB 4LP2B 5AA2B 4YB5A 2F36A 2Y7IA 2QRXA 4LZ8A 2LXBA 1JW5A 4LZ7A 1H76A 2M8CA 4YMBA 5CC2A 4OYVA 2F35A 1TFDA 1SQYA 3QXMA 1MH4A 3MZ9A 2PX1A 5CM6A 3VDFA 2ZNUA 1GV8A 3GBAA 3SEXA 2K3RA 5DJUB 5JTYA 4OEVA 1MY2A 1B4ZA 2HXWA 2Q88A 1M5DA 3O6HA 2O7IA 4KYDA 1R6ZA 1H0TA 1MXWA 1IZ1A 4N13A 4H8JA 3MVXA 4K3AA 3UN6A 5I56A 1FQDA 1NKXA 4H1XA 3CFLA 3O9PA 4OEUA 3K01A 2XXWA 3WAEA 5AA3A 1I6BA 1N3WA 3LBSA 1XS5A 2F97A 1R1NA 4IGTA 4ZNCA 2I4CA 5I59A 3R6UA 1MY4A 2QL3A 4G68B 2GHAA 4ELOA 4TOZA 3ZKKA 2VOZA 1LLSA 3I5OA 1WVJA 1FTOA 3MPLA 4KYSA 4XKNA 5CMBA 2XXIA 3HN0A 5H8QA 1NNFA 3KZGA 1FTJA 3QWOC 1B51A 1BLFA 3RY3A 5CMKA 4ZEKA 3VVDA 3KEIA 3R7XA 2DSFA 3PPOA 4ZMDA 3TPAA 4YKJA 2F6GA 4EQ7A 3T93B 2RC7A 3O6IA 3PH0A 1Y4TA 2Z8DA 1BDDA 1OMPA 3T9UA 1GR2A 4PFYA 4R9GA 3T9HB 4XXUA 1SI1A 4EXKA 2YPNA 4PETA 4RK9A 2O7UA 5KZTA 3K6UA 3K1MA 3FATA 5B70A 3MW0A 3PUXE 1YAEA 1RKMA 2Y84A 3T96B 4WEPA 1PEBA 3IB1A 3PPNA 3K6WA 3DP4A 3ODBA 3ZDMA 4I9DA 4F22A 1EDIA 5I2NB 3TUSA 1Y47A 3FXDA 2NOOA 5B7DA 4F29A 1B46A 2ZYKA 3A3UA 2XXYA 5I56B 4FJPA 4BDOA 3A3CA 1MY1A 1MQHA 1B5HA 2PBWA 3KN7A 1FQBA 5KDTB 2VP1A 2I6EA 3JZJA 2AL5A 3TDJA 2W7YA 3EHTA 5A5XB 3IR1A 1JMBA 1LFGA 3M3KA 4GODA 4JWXA 4ZEIA 1JVXA 4ZEBA 3VVFA 3THIA 4GXSB 3F11A 4IGRA 4YICA 3JV9A 2XX7A 3B7DA 2QS3A 3MZ1A 4NPDA 1FQAA 2Z23A 3PPQA 3MP8A 4WWIA 2O1MA 4JWYA 1LB8A 4RK2A 4U23A 1IIWA 4X1DA 3PPPA 1B5JA 1B6HA 1MQGA 1Y20A 3MVZA 2I58A 4R6KA 4RA1A 2I0CA 5H8NA 5L9MA 2BJJX 3G3JA 5I2NA 3TQLA 1Q1KA 5L9OA 4U4SA 1N04A 4ESXA 2KUBA 1D3KA 2PVUA 1M5EA 1EDJA 1B52A 3LSFB 2HR3A 4RPNA 4R73A 1B58A 4XIGQ 3K1NA 3SEVA 4FECA 4F3SA 2IEEA 1JNFA 1TXFA 1LSTA 1II5A 2P2AA 2QMWA 1BKAA 3VXBA 4IO3A 4ZDMA 4KD5A 4HTGA 4U1OA 4TQUQ 1MH3A 3S9NC 3HO7A 4QFPA 4GRKA 1O64A 1MDQA 4IO4A 1LBBA 3TCGA 3IOWA 4HJGH 3LSWA 1B7ZA 5DVFA 3CRBA 5CMMA 3TKDA 1B7UA 4YB6A 3PGFA 1LFHA 2ANJA 4X1BA 3LSLA 5LOMA 4G77A 4Q5TA 1VE4A 4ZE9A 1B5IA 2DQVA 1R9LA 2ZAEB 2FNCA 1IQ7A 3Q25A 4XKRA 1O63A 4C1TA 2V93A 1ZLQA 3AXFA 4R74A 1AH5A 5H8QB 3K6XA 1XOCA 2NVUB 4M1VA 1I6AA 5HBCA 1ZTYA 2ZNSA 3KN3A 4NF5A 5KCJB 5JK4A 3OD7A 3H4ZA 4POXA 4AB6A 2X7QA 2H4IA 4K3FA 3C32A 4LQ2A 2RF1A 4NF8B 4RXLA 4EUOA 5FTHA 3FIRA 3PMVA 3VV5A 1PB7A 4KQPA 3TFLA 1WDNA 2KI7B 1QKBA 2A5TA 2OBGA 1CE2A 2F78A 1N76A 1USYH 2DE2A 3CVGA 4DCYA 1EDLA 1XT8A 1LAHE 1I69A 3Q29A 4X48A 4GOFA 4PFUA 3U8QA 3KSJA 5ICQA 4BXLA 2Z8FA 4DIGA 2XXHA 3IK6B 4U4XA 4F1VA 3K0VA 3QSLA 3ZKLA 2UVJA 1POTA 2F8DA 3FVGA 3IORA 5I2KA 4GFRA 4DDDA 2XXQA 2ZYOA 1EZ9A 3EHUA 4ELRA 4FIMA 4F2QA 2H99A 3M3FA 3PD9A 1MM7A 4QF9A 4H6DA 1F9BA 2E0SA 1IEJA 5HPQA 4KHZE 3BFUA 3W9WA 3QUFA 1OVUA 2O68A 3K2DA 4OFLA 2UXAA 1US5A 2HZKA 1A55A 2KLFA 4GWOA 4LATA 4L17A 2WMMA 1D4NA 5BUUA 1M5CA 4K35A 4H65A 1ZKBA 3HPIA 1MY3A 1RYXA 3RTFB 4QHQA 4POWA 1ZXGA 4DXBA 3VFJA 2GH9A 4O3AA 3ILTB 3VLVA 3RGUA 5TPAB 3IO6A 2R71A 2OWTA 1I6QA 3VVEA 3H3GA 1A7LA 3MZWB 4TLMB 3PUVE 2CMOA 3RQTA 3HV1A 3OSRA 3KJ7A 1QJMA 2OLBA 3KBRA 4BDRA 3S2VA 2UYEA 2DXRA 1MRPA 1NH7A 2Q2AA 2NUVA 4EQBA 5C39A 3U72A 3MZBA 3VLUA 3FXQA 2XXRA 2KZIA 3BBRA 1AL3A 2UVIA 2UWJE 2QPQA 3D4GA 2H98A 1SBPA 5TP9B 5IKBA 5DEXB 3E13X 1URDA 2G93A 2OTKE 1SW5A 2F7CA 4I62A 1B3EA 2ZYNA 2E1SA 3B6TA 1Y1MA 3G3GA 1BTJA 4C0RA 3SERA 3FZVA 3LSXA 2OWSA 2Z8EA 4NF4A 2OK2A 5I58B 4FE8A 5I59B 3LR1A 3CFXA 2QS1A 2GFEA 5TPAA 3T22A 1B2HA 4NPFX 1J1NA 4KPTA 2Q8JA 4F31B 4XKPA 3UGWA 2HCAA 4R6YA 2I0BA 3V89B 5I57A 3OSQA 5J1DA 3G3HA 1SS1A 1B0HA 1D9VA 2M0BA 3OOAA 3FV2A 3LC8A 2YJPA 5DJTB 3RNNA 1UTBB 3BKIB 1B3LA 4ZEDA 1VFEA 3FJ7A 3U94A 3KOTA 2X7PA 1SI0A 3VXCA 2ONSA 1NVOA 2I8DA 2WKYA 3MUQA 1H44A 1N7WA 3IJOB 3MVYA 4QFOA 4MLVA 4FATA 2XXPA 4P0GA 4XKQA 5TP9A 5CBSA 1B1XA 2HAVA 1FTKA 3W9VA 1RYOA 3D4CA 2PMSA 4ISUA 3PUZE 4EF1A 3KG2A 4ND9A 1PBPA 4MH5A 2V25A 1M5FA 3K6VA 3QIMA 2NXOA 4GOEA 4I8CA 4GF8A 3GLBA 2UVGA 3EF7A 4Q0CA 4R9FA 4ELPA 3IB2A 4FEDA 4QSEA 4ECFA 2F7BA 1XHYA 4G8NA 5H8FB 5EFWB 4H8IA 5AA1A 1QULA 4BDLA 3TTMA 4P11A 5EHSA 1A8EA 2Z22A 1B7HA 3OO9A 4NEDA 2LR2A 1JEUA 3HHGA 3U1OA 3OENA 2PYYA 1BDCA 1GVCA 3OEKA 4NWDA 2XXUA 4OVJA 4UACA 2ZNTA 1MXVA 3DP6A 1ATGA 4OWDA 2D5WA 2CZLA 5FHNA 1MM6A 1A40A 3S9LC 1P1WA 1TFAA 3BFTA 4BLAA 5ELVA 2H9BA 3SEYA 2DVCA 3FJMA 1EZOA 1NNTA 3RT6B 3CG3A 3CR9A 2XXXA 4EYYQ 4HS7A 1FQFA 4YKKA 1HSEA 3KGCA 3MP6A 4I1DA 1SDXA 3PMXA 3HCQA 5IAIA 3PMWA 5EYFA 4HCWA 1NL5A 2RC8A 4NE4A 1SW1A 1MPBA 2QS2A 1SW4A 1HSJA 4Z7EA 1Y1ZA 3B6WA 2JWDA 3C36A 4GQOA 1EU8A 4OMBA 1H0TB 4DXCA 4QSDA 3MVWA 2OCUA 1LP1B 2Q1KA 3MJNA 3FV1A 1TT1A 1MPCA 4OZ9A 3V83A 2KZJA 3S1KA 3TTNA 1OVTA 3H7MA 4N07A 3FASA 3G3KA 2KIKA 5DVJA 3V5AA 4NMYA 3UIFA 3UA8A 4R6HA 2FYIA 3ZS6A 1MPDA 1QKAA 4R72A 3UP9A 1VR5A 2DWIA 3TODA 4N6PA 3TMGA 3KOSA 2D3IA 1FTLA 4LONB 1YPNA 1B4HA 4GL8A 3T9VA 3L6HA 1Q2NA 4H0WA 4WXJA 4JB7A 4IY5A 1URSA 2O69A 1X0TA 3IL1B 4G68C 2B3BA 1LFIA 3TAJA 2PT1A 3LUYA 2DYXA 4ZECA 2O1LA 2B88A 2XXVA 5L8DA 1N0TA 2ONKE 1P99A 5AA2D 1MS7A 1DPPA 1S9TA 1AIVA 1B0LA 4WKMA 3N26A 3OXNA 1PB9A 4MLQA 4GL0A 3I6VA 4ASVA 4NTLA 2O51A 4P0IA 1TWYA 3C35A 2XX8A 4F18A 2A5TB 4BDNA 2DS9A 4XTCQ 3H03A 2KS1B 5DVIA 1JETA 3OMBA 1JM0A 3H6TA 2M5AA 3TQWA 2R6GE 2AL4A 1Y4CA 1DTZA 2P58A 2DE4A 1LCTA 1S50A 5BWJA 1SD3A 4RJZA 4IO7A 1EC5A 4OESA 3TTLA 3FXRA 3T66A 3CG1A 3N6UA 1DSNA 3M8UA 3DLNA 4HB1A 5DT6A 5CRYA 3CI8A 1URGA 1POY1 1OLCA 1LAGE 1US4A 2AIXA 1B05A 2REGA 4OTEA 1U7MA 1NNPA 1H3DA 3DP8A 1S7YA 4OXVA 2GRVA 3RPWA 2ZMBA 4H5FA 4DE8A 1P1QA 3DELB 2ABHA 1LBCA 3P7IA 5CBNA 4C1UA 3H06B 5EHMA 1EDKA 3A09A 1JQFA 3IB0A 2SPZA 3MQ9A 1Y3NA 5JEIA 3PUYE 4RNSA 2V84A 1OQHA 4IOIH 2QSXA 3ZSFA 3RN8A 2THIA 4KJMA 5F7VA 5DEXA 4RY1A 4NF6A 2UYFA 2ZYMA 4U1ZA 4PFTA 4ZE8A 2RKLA 3EHSA 1MQJA 1SW2A 2R44A 2UVHA 3FUZA 3FXUA 2ESNA 3SEUA 3T9XB 5H8FA 4HKZH 2F7AA 3U93A 4AB5A 2Q9TA 3S4UA 4GLIA 4PQJA 4JSOA 3MC2A 3G3FA 1PDAA 2HZLA 1ZJLA 4HW8A 1ZBMA 3CSBA 3V8XB 4KR5A
chains in the Genus database with same CATH superfamily
2NPSB 1BIYA 4WEDA 1FZCC 1H45A 3P8CE 1QVSA 1L4AD 1INPA 3CXHE 3OELA 1LCFA 1T2KD 5L9SA 3S9EA 3SDFA 1LP1A 1H43A 3QK6A 1NUXA 1E5WA 2DWHA 3CCVP 1MXUA 1KILE 4NX1A 3C4MA 3L71D 5EQ9A 4OETA 2GA1A 3EFFK 1KQGB 4HE2A 1NH4A 2B89A 4QRZA 3KFMA 3PPRA 4HCYA 4G8HA 2FFDB 4GWYA 5KCJA 3PV0E 1YJNP 4EQ9A 3CWBG 3EQ1A 3VOPA 3CIJA 1XC1A 2LXCB 5KDTA 1MY0A 4JWOA 3H6WA 1YTVA 3RTWB 1H8AA 2J5UA 2F5XA 4H13D 2YLNA 3VLWA 1L0LG 1NU1K 3GHGB 2OJTA 3CWBD 1UIUA 2NZ2A 4P47A 1AVYA 1LTGC 3H1JD 3CMAP 4THIA 4TLLB 5I84A 2A06G 4YKIA 4PAFA 3RT8A 4F3PA 4QFLA 1CSBA 4H44B 1OIBA 1MZ9A 2B3FA 1EH3A 3N5LA 3TZAA 2B87B 3SZPA 1ELJA 3S4RA 1KYOD 3SWFA 4N8YA 3TTKA 3HFUA 3CX5I 4ASWA 2YKOA 2JEEA 1IXCA 4OHNA 5T3JA 3MHVA 1IXHA 4DXUA 5CBRA 5AA2A 3MP1A 4ESWA 3IOTA 1Q7YQ 4H44D 3USSA 3H1KG 3AEFC 2X26A 2ZXTA 1UQWA 2WYKA 3O6GA 2H43A 3C9HA 2HPCA 3HHFA 5AE4A 3UORA 1MXYA 4UB6E 4D6TD 4MBPA 5DYHA 4NF8A 1EZVD 4LVQA 1Q82Q 4OERA 2DP8A 4YU0A 4MN4C 3B6QA 1LTJC 1G0IA 3VMZA 5KKZB 3CCLP 1XVYA 4HE1A 3K02A 4ELQA 3M0DA 4IO5A 4F19A 4MJOA 5H8HA 4IL6X 4I3YA 4NF6B 3SKPA 4KFQA 2I4BA 3TGUE 1BE3D 3C34A 1YITP 1N8RQ 1N7XA 4GX6A 2FFDC 3S9MC 2QRYA 4M4GA 1K8AQ 2DWAA 3N4XA 1YCJA 3SFEC 2JKVA 4MF3A 2Q89A 1B3GA 2HQ0A 3V4WA 3N6TA 1LNQA 1N7SC 2FA7A 3H1HD 3MPKA 1A8FA 3PU5A 4G2ZA 3I3VA 3H1HG 2P3VA 3CC2P 1VQ7P 1MG1A 2Y0DA 1OMIA 1PP9E 5KLIB 1RH5B 3KPEA 3HUSA 3V2QA 5BVZA 1FBHA 1OLAA 1KQFB 2NPSC 5AVSB 2AYSA 1YHQP 2RINA 5ET8A 3CCSP 4G4PA 1ZIUA 2P7JA 2I49A 3H1HJ 1HSLA 3CC4P 1Z7NE 4IO6A 4R2FA 1MXZA 4F3BA 2Q8MA 1LBXA 4RPOA 4JSDA 5HM4B 5ITOA 1IITA 5AVTB 3CFZA 3CWBE 1PGPA 3GXAA 1Y3PA 3U1CA 4U3FJ 1LAXA 4OFJA 3SESA 1CI6B 1NFTA 1GZLA 1UTHA 3L70G 1B40A 1JVYA 3C33A 1N2DC 1DMBA 2B87A 3AEGC 2M5AB 3HD7D 2ALUA 1UIVA 4U22A 3RYDA 4N91A 3SETA 3VMXA 1B3FA 3VN0A 1KQSO 2HEUA 3BVHA 3FGSA 4R75A 1G1IA 3K1PA 4GWXA 2MJZA 3IOVA 1QVGO 3KSXA 3W15C 1FDOA 4OENA 2FIEA 1BGYD 4QSCA 3IOUA 1SYHA 2YKPA 3TCHA 3FVKA 3NXSA 4OFOA 1B9JA 3L73D 4P1EA 3SEWA 1OVRA 3U1AA 1DBZA 4U7JA 4DZ1A 2Y7WA 3E7KA 4JVDA 3KN8A 4NGUA 3RGYA 1QX8A 2KXPB 4MHFA 2PGDA 2A06D 3IN6A 2HAUA 2MKZA 3B5NC 3MD0A 3OO8A 1M5BA 1G2CA 2ZZVA 1LBZA 1GW3A 3CSGA 2WSCJ 3BCCD 4PCDA 2HFBA 1VQKP 1NTKG 5K2XA 1SP4A 2F34A 2H88C 1IJDB 4NF4B 2FYUD 1SQXJ 1KYOI 4WY4C 4PC9A 5ISUA 2ZYGA 3FVOA 2F3BA 4ZZEA 2GQ1A 2V7QJ 1JB0J 4OVPA 4YKPA 2V3QA 3GBBA 3UK4A 3TEPA 2OYHB 4Z0IA 1DX7A 1EZVG 1LGBC 3KJTA 1OVBA 3KZIE 1Q35A 4P56A 4U21A 4JBZA 3CCRP 1FPEA 2QJEA 3CHGA 3FD3A 3CL3D 3R26A 1IXIA 1KWHA 1QUJA 3H6VA 1JW1A 1HUCA 1GL2D 4YXDC 2VHAA 1VQNP 4PP0A 2REJA 2RCAA 5FHMA 1A99A 2CK3H 3G3IA 1IFNA 1N86A 1OVVA 2YMYA 1CI6A 2Q2CA 2WPRA 3CX5E 1VQ4P 3PD8A 2I3WA 4F2OA 3FX0A 2I3VA 1RF1C 1DPEA 1R8EA 2M3EA 3FXEA 3O29A 1P1OA 1MQIA 4PE3A 4KYEA 1QW0A 4QFNA 4H0LD 4N78E 3B50A 5I58A 2BEZF 5CMCA 1NYHA 4MFIA 1PPJG 1NV6A 3Q5SA 3H6UA 4G68A 1YQ4C 3DM0A 5CCGD 1LT9B 2H5YA 4YMAA 1B32A 3UIAA 1KFMA 1SQBD 3V2RA 1D9YA 2F6PA 4F1UA 4X9TA 3TELA 4ZZAA 1IFMA 4PD4I 1MQDA 2RKMA 1ZMGA 3V2PA 1B1HA 1FPBA 4U3FD 1GTKA 2DVZA 1IFDA 1DEEG 3H25A 1Z7ME 5AW8B 1IUDA 4F3GA 1NHLA 1PC3A 5CI5A 1X9VA 5H8NB 5GTIH 3OEMA 2HODB 1N73C 4DZOA 3T97A 3E78A 1QUIA 2B65A 2A45I 2NWJA 4GX4A 5H8HB 1KB9E 2GHBA 4NF5B 5CCHA 3FVNA 3M91A 3BCCE 4GDOA 5ET5A 2IBZD 3TTRA 2DXYA 3AEAC 3QUJA 1Y3QA 3G7WA 2ONRA 4CPGA 4NN3A 1BGYJ 3O2AA 1OQGA 2QVUA 1S9KD 4DOJA 2FYNB 4GD5A 4LQ5A 2PFZA 2G8YA 1WT6A 2OYHA 3T97B 3Q27A 1NNKA 3WU2E 4XF5A 5GTHH 2D21A 4ZS9A 1IMCA 1SFCD 5AVQB 4MCOA 4PAIA 1VQLP 2OZZA 4FAJA 1ZU0A 3EN3A 5ICTA 2QIWA 4O94A 4GX3A 4FORA 3MBPA 5F24A 5A5XA 2O1JA 3MWBA 2WWWA 4N15A 1N84A 2VD2A 1YI2P 1N3XA 3GZGA 1JMMA 2VRSA 3ECRA 4GWZA 2QJYB 1M8OB 4OANA 4P1LA 2KP8A 3H32B 1VFDA 2V4HA 4QFKA 3ILUB 5DTBA 5ESYA 4PD4E 5H8SA 4H5GA 1KTMA 1LJ2A 1N73B 2Y7RA 1U7JA 3JYRA 1ZMEC 1YYCA 2DWJA 5AA4A 4IO2A 3Q28A 3VMYA 3FJGA 1AVOA 5CJ4A 2Y9ZA 3Q5PA 4DCXA 4I6MC 2KOGA 1T8ZA 4C7NB 2DE3A 1SQQD 1FQEA 2PT2A 4GXAA 4O3BA 4E0WA 4YAHX 4LUBA 2FXOA 1KFNA 5IGAA 1LB9A 1FTAA 1B3HA 1S5LH 3Q26A 4R2BA 3MTUE 1AFOA 2DOJA 4OQOA 2V3TA 1DD3A 4EIJA 2QE7H 4EDPA 1J2JB 1ZW0A 1RDYA 5AA4B 5M2VA 1QGKB 3IF4A 5K5GB 1FPJA 5AVWB 1SFCA 4PE5B 1JEVA 1S3JA 1ANFA 3L75J 1FQCA 3TYHA 1FTMA 5K2YA 1P1UA 1AMFA 3IO4A 5EYGA 2A06E 1AOVA 3MYUA 1NTZG 1Y8AA 1CB6A 2QS4A 4BDMA 2IDBA 2Q74A 1FZEA 3PUWE 3K4UA 1YTZI 1FJPA 2E76C 5I3SA 4U2RA 1PP9G 1FW0A 3LV0A 1P1NA 3OO6A 2C9LY 4PFWA 4DLDA 4ZEFA 4GIZA 1EXIA 1LGHB 1NU1E 4MEVA 2CPSA 4O9BA 1J1DB 1VQ9P 2G29A 2E74D 4NHBA 4NWCA 1SQXE 1JCDA 4G8MA 2E75D 1JW4A 5KLVJ 2XXTA 1HBWA 4O7MA 1RHZB 1VSOA 3E3KA 4YB7A 3L4FA 3E9XA 4BRYB 1H89A 2Y7KA 2W8ZA 3ABVC 4LN5A 5CCGC 2FFDA 1P84H 3D1RA 3USDA 3IX1A 4DI4B 5FHOA 2XD3A 4IY6A 5I57B 5APXA 2O01N 4E0XA 2A5SA 2XHDA 3VE1B 4UA8A 5H2FH 3K00A 4Q8RA 1L0LJ 5FTIA 3CXHD 1QUKA 1JP4A 2QMXA 4NPEA 2P1SA 2VGQA 2QEXP 4PFBA 5APTA 4I2LC 3BIGA 1LEVA 4C7RA 2Q7CA 3WAFA 4Y28J 4JDFA 1SLQA 1L5TA 3V6IA 1A54A 1DD4A 1GTWA 2KK7A 4OVTA 3AE2C 3L70J 2KNCB 2H25A 2RC9A 2QVAA 4QMAA 3E4RA 4KI0E 5CCHD 1KV4A 1VDFA 2IA4A 4PJ0E 1DOTA 4FEBA 1P84D 2K9YA 1LT1A 1IC2A 4GBWA 2E74C 1GGGA 1UTBA 2O84X 4OVSA 1MFTA 3N94A 1O7TA 3KBZA 5ITPA 3CXHH 2LAOA 3TCFA 1NMUA 4P8BA 4I7ZC 1IXGA 3ONMA 1EZPA 1SVXB 1WODA 4UABA 4AQ4A 3KC1A 2W6BA 3EQ2A 4LZ5A 1S4XA 2ZT9B 2K9JA 3OO7A 4RYAA 3IAZA 1SYIA 1SQPG 2XD2A 3M0DC 2WPVB 3A7OA 3L35A 1MXXA 1Y9UA 3C31A 5CCGA 4WBAA 3EPEA 4EF2A 1M1JA 2VD3A 1T2KC 2CZKA 1IMEA 3TYYA 2V4CA 1QVFO 1FJKA 3KYQA 1XVXA 3LIDA 2O6AA 2ZFCA 1X8YA 4H67A 4KCCA 3H6PA 2N1TD 3BRVB 2ZT9D 1LAFE 1YZ0A 4Q30B 1FAVA 3R4YA 4PDHA 5JTYB 1NU1J 4F39A 3CCJP 1FC2C 1NTMJ 4ZKPA 5J16A 1PP9J 5TU0A 2R9JA 1PB8A 2R32A 1GU5A 1HF9A 1R9QA 4IB2A 4LC1A 2Y7PA 3HSTA 3L6GA 3KQGA 3TGUJ 3D6ZA 1FCKA 4F1YA 5IZ3B 2XWIA 2QJPC 1NOHA 3P8MC 3BCCG 4B86A 1ZOYC 2HODA 2YKQA 3M3LA 4KCDA 4ONYA 2WT7A 3O97A 2JR8A 2XXKA 4L75A 4GOTA 5I2KB 4TLFA 1LTJB 2Y9YA 1NWQA 2V3UA 2O01H 4D6TJ 4BDQA 1PGQA 4O3CA 2I48A 3AE7C 1MDP1 2XX9A 2FY8A 2AXTE 1VL2A 1PBQA 3HD7A 5IZ3A 3RL0D 1USYE 1ZRTE 2CEXA 1EYJA 5M1BA 1VQMP 3E1RA 2OARA 3M9BA 3ISPA 1URQB 3U92A 5CBOA 3QAXA 1BP5A 2R3SA 3GLMA 1JO5A 4R4LA 3QYTA 1T0KA 3MUDA 5KAFE 4QBAA 1DTGA 3O28A 4LA9A 4EXLA 3RLFE 4I40A 1USDA 4GVOA 3RUMA 2RCBA 1OIPA 1WMKA 4N17A 4MMPA 2H89C 4DJGA 4YZZA 3O66A 2ZT9C 4R4MA 3ITKA 1NH8A 3FBPA 2P0SA 3MAMA 5F1QA 4JXIA 3HD7B 3IJXB 4LP2B 5AA2B 1YQ3C 4YB5A 2F36A 2Y7IA 1NV7A 2QRXA 4N3YB 3LUZA 2C0XA 4LZ8A 2LXBA 1JW5A 1J1DC 4LZ7A 4Z1MH 1H76A 2M8CA 4YMBA 5CC2A 4OYVA 2F35A 1KILB 1TFDA 1SQYA 1HTLC 1MH4A 3QXMA 3MZ9A 1LTTC 2PX1A 3L74G 5CM6A 3VDFA 1GD2E 1OW8A 2ZNUA 1KN7A 2QVRA 3GBAA 1GV8A 3SEXA 2K3RA 5I5PA 5DJUB 3V2NA 4UB8H 2XWVA 5JTYA 4OEVA 1MY2A 3CC7P 3FXBA 5E79H 2XNXA 1B4ZA 2HXWA 1KILA 2JJLA 1SQXD 3JCUH 2P3NA 2Q88A 1M5DA 3O6HA 2O7IA 4KYDA 4YTPC 1H0TA 4WVZA 1R6ZA 1MXWA 1A02J 1IZ1A 4N13A 2ZVNB 4H8JA 3PJSK 3MVXA 4K3AA 1GK6A 1RQVA 1SFCB 4PV1C 3UN6A 5I56A 1IMAA 1FQDA 1NKXA 3L72D 1M56D 1HWTC 1BE3G 4H1XA 1RE3C 3RK3B 2CZIA 3CFLA 3O9PA 4OEUA 3B5NB 1KD1Q 2XXWA 3K01A 3WAEA 5AA3A 2E75C 5LTCA 1I6BA 2WSFJ 1N3WA 3LBSA 1XS5A 2F97A 3JSVC 1R1NA 3CCEP 4IGTA 4ZNCA 1CW5A 1H88A 2I4CA 3L75G 5I59A 3R6UA 2M3BA 1MY4A 1XTGB 4W80A 2QL3A 2OTJP 1SQVE 3BIHA 4G68B 1M1KQ 2GHAA 4ELOA 2Q5UA 3AE5C 4TOZA 5KJ7D 5CHXA 3ZKKA 2VOZA 1LLSA 3I5OA 5EQ7A 1WVJA 2I1KA 1FTOA 3MPLA 1UIXA 4KYSA 2AXCA 5AW9B 4XKNA 5CMBA 2XXIA 1HJ0A 3HN0A 3CCUP 5H8QA 2KS1A 1NUWA 2NRGA 1NNFA 2AEJA 3AE6C 3KZGA 2YXRB 2P2UA 1FTJA 3QWOC 4H46A 2DDKA 3RK3C 1B51A 1BLFA 3F5HA 3RY3A 2Z5IA 5CMKA 4ZEKA 3KZIH 3VVDA 4X8RA 3H1ID 3KEIA 3R7XA 2DSFA 3QMFA 1GK4A 3PPOA 4ZMDA 1ZR4A 3TPAA 2OX3A 4YKJA 2F6GA 4AUWA 1JY2O 5EYHA 4GWUA 3L70E 4EQ7A 3T93B 1OXZA 4XFJA 2KB7P 2H7HA 3H1JJ 1RF0A 2R3CA 2RC7A 2WSEH 2PRRA 3CX5H 3G4SP 3PH0A 3O6IA 1VPCA 2JO1A 1BDDA 4C7NA 1OMPA 1Y4TA 1YYZA 1ZRTD 2KQZA 2Z8DA 3T9UA 1GR2A 4PFYA 4R9GA 1QL1A 4XXUA 1SI1A 3II6A 3T9HB 3G3ZA 4GWSA 2KNCA 4EXKA 4N81A 3PP5A 2YPNA 1JNMA 4PETA 4DI3D 1YXIA 2HLOA 4RK9A 4EI2A 2O7UA 2Q9IA 2AEFA 1A02F 4JF7A 5KZTA 3K6UA 2ZVOB 3K1MA 1FDIA 3FATA 5B70A 3MW0A 3PUXE 3O8ZA 1YAEA 1DCUA 4DT0A 1Q9DA 1RKMA 4KXPA 1DEBA 3EWKA 2Y84A 3T96B 1NTKD 2WITA 3HTKB 4WEPA 1PEBA 1AWBA 3VMAA 3IB1A 1SQVJ 3PPNA 3K6WA 1RE4A 3RPLA 3DP4A 3ODBA 3ZDMA 4I9DA 4F22A 1SQQK 1EDIA 2F3DA 5I2NB 1L4AA 3TUSA 2Q3EA 1Y47A 2IFNA 2FYNC 5GTIE 1EYKA 2J59M 3FXDA 1FZBA 2NOOA 1SQVD 5B7DA 2OWZA 1JY3N 3NTNA 3L71J 4F29A 1B46A 2ZYKA 3A3UA 2XXYA 1E79H 5I56B 4FJPA 4BDOA 1NO4A 3A3CA 3BRTB 1MY1A 5TISE 1URQC 1UTHB 1MQHA 1VQOP 1B5HA 2PBWA 3CWBJ 3KN7A 2OQQA 3F89A 1FQBA 3B8EB 2W6AA 5KDTB 2VP1A 2I6EA 5IZ1A 3JZJA 2AL5A 3TDJA 2W7YA 1NV5A 5B5EH 1W2BO 3H1HE 1KORA 3WU2H 3EHTA 1ZN5A 2IYPA 2E75B 1IMDA 5A5XB 1FPDA 2Z4EA 3IR1A 1VQPP 1M90Q 1JMBA 5KTBA 1LFGA 3M3KA 2B9BA 3L37A 4GODA 1FPLA 4JWXA 2YIUB 4ZEIA 3C1LA 2KSEA 1JVXA 3VP9A 2ZJSE 4ZEBA 3VVFA 3THIA 1S1CX 2WZ7A 3L70D 1FBPA 4GXSB 3F11A 2YO2A 4OH8B 1GL2B 4IGRA 3FGAD 4YICA 3Q2YA 3CCMP 3JV9A 3L73E 2XX7A 3B7DA 2ZYAA 3Q3DA 1S2EA 2QS3A 2E43A 3D70A 3MZ1A 4PD4H 4NPDA 3H1LJ 4TT3H 1FQAA 1GMJA 2Z23A 3GG2A 3PPQA 3MP8A 1K9ZA 4NAPA 4XEQA 3CI9A 4WWIA 2P67A 1BSHA 2O1MA 4PDDA 4JWYA 1LB8A 4RK2A 4MIJA 4U23A 1L0NJ 1SQBK 1IIWA 4X1DA 2FXMA 3PPPA 1B5JA 1B6HA 1MQGA 1Y20A 3MVZA 2I58A 4R6KA 4RA1A 2I0CA 4OGQC 5AVRB 1YIJP 1S5LE 3G9RA 3KHUA 3G6EP 1RF1A 5H8NA 2FYUE 1URQA 4I7ZB 3E79A 2BJJX 3G3JA 5L9MA 5I2NA 3TQLA 1Q1KA 4RO0A 5L9OA 3V4QA 2KYVA 4U4SA 2B4MA 1N04A 3I5CA 3L74J 2K1AA 4ESXA 1FZGA 2KUBA 1D3KA 2PVUA 2W6JH 3BCCJ 1M5EA 3BASA 1LWUA 3H1LE 1EDJA 4HXVA 3T1BA 1B52A 3LSFB 2N1TB 2HR3A 1RDZA 4RPNA 4R73A 1B58A 4XIGQ 3K1NA 2BEQD 1VF5D 2RMZA 3H1JE 3SEVA 4FECA 2WEFA 1N7LA 5AW5B 4OVQA 4F3SA 2IEEA 1JNFA 1ZP0C 1TXFA 1GL2C 1LSTA 1FPIA 1II5A 2E42A 2P2AA 2QMWA 1WRGA 4N78D 2IPPA 3TK1A 3Q5RA 4WB4A 1BKAA 2JWAA 4Y99C 4O7IA 2YIUC 3VXBA 1L0LD 4IO3A 1EQ7A 1EYIA 4ZDMA 1KA0A 4KD5A 2QJPB 1P84E 1YJWP 3IFMA 4HTGA 4U1OA 3NMDA 4TQUQ 1MH3A 2XKMA 3S9NC 3HO7A 2GUSA 4PD4D 4QFPA 4GRKA 1O64A 1MDQA 1OW7A 4IO4A 1LBBA 3TCGA 5IM2A 1KZUB 3IOWA 2ZZWA 4HJGH 3LSWA 2QG4A 1JY2P 3L71E 3P32A 1B7ZA 2QFLA 4BWNA 5AVYB 1SVFA 2IFMA 2OGUA 3CRBA 5DVFA 1RDXA 5CMMA 3B4SA 3TKDA 3TGUD 1B7UA 4YB6A 1QLED 1FPKA 3PGFA 3K5BA 1LFHA 1NKNA 2E5TA 2ANJA 5KLIC 4X1BA 3LSLA 3M06A 5LOMA 4G77A 4Q5TA 4PJ0H 1VE4A 4H44C 1JOCA 4ZE9A 4LLHA 2HHMA 1VDWA 2HXRA 1BSNA 1JUNA 1PL5A 1B5IA 1KILD 5KAIE 1PIXA 5AVZB 1NKZB 1XTCC 1R9LA 2WTYA 2DQVA 2ZAEB 2FNCA 1IQ7A 4ZKUA 1USEA 3Q25A 4N6KA 2XNDH 4XKRA 1O63A 4C1TA 2V93A 3VYIA 4N6JA 3L72E 2R5BA 1ZLQA 3AXFA 4R74A 1AH5A 3R2PA 3CXHI 5H8QB 3K6XA 2LKMA 1XOCA 2NVUB 1N7SA 4M1VA 1I6AA 1NTMD 2IZ1A 5AW2B 1PGJA 1ZTYA 5HBCA 2ZNSA 2POHA 3RL0g 3KN3A 2JP3A 4EDFA 4NF5A 3TNUB 1NV0A 5KCJB 1L4AC 5JK4A 3OD7A 3H4ZA 4POXA 4AB6A 2X7QA 2H4IA 1HGZA 3L74E 2CEYA 1RE4C 2Y5KA 3C32A 2RF1A 4K3FA 4LQ2A 4NF8B 5AW6B 4RXLA 4EUOA 2QJYC 2Y0EA 5FTHA 3FIRA 3IR9A 4IFMA 3PMVA 3VV5A 3O6QB 1PB7A 2Q6QA 4KQPA 4O8MA 2Y0CA 3TFLA 1WDNA 5APVA 3TNUA 2WYPA 3S9OA 1U57A 1S5LX 4OVNF 5BU5A 4PBQA 4W7YA 2KI7B 1QKBA 3TSIA 2A5TA 2OBGA 1CE2A 1KYOH 2F78A 2AXTH 1N76A 5APUA 1USYH 3H1LG 2DE2A 3CVGA 4DCYA 3L72G 1SQPJ 1EDLA 1XT8A 3L73J 4IL6E 3Q1MA 1LAHE 1I69A 3Q29A 4X48A 4GOFA 1JY2N 4PFUA 3U8QA 4KT0J 1L2PA 3KSJA 3RL0B 5ICQA 4BXLA 2Z8FA 5KAFH 1LBVA 4DIGA 1K9YA 3OA7A 4GIFA 2XXHA 1NU1D 2BCCD 1UIIA 3IK6B 4U4XA 1ZV8A 4F1VA 3K0VA 3QSLA 3ZKLA 2UVJA 1POTA 2F8DA 3KXDA 2N9YB 1SQBG 2OYIB 5BU8B 1GDTA 5TJHA 3AEDC 3FVGA 3MUDC 1LTBC 1CNQA 3IORA 5I2KA 4JQ0D 4GFRA 1K9MQ 4DDDA 2XXQA 2FKWB 2WT7B 1KB9I 3V5BA 4OA4A 3B5ND 2ZYOA 1EZ9A 1LT9C 3KDPB 1GL2A 2KLVA 3EHUA 4ELRA 1BCCG 4FIMA 2RN0A 4F2QA 2H99A 1NTME 3M3FA 3PD9A 1MM7A 1D7MA 1MFZA 4QF9A 2KSJA 4H6DA 1F9BA 1FOSF 2E0SA 1IO4A 1IEJA 5HPQA 5AVUB 3HUSB 4UB8E 4KHZE 1SQQG 3H1KE 4GWWA 2FIXA 3BFUA 3AEEC 3QUFA 5E79E 3W9WA 4C46A 1OVUA 2O68A 3K2DA 2QSIA 1PV3A 1AQ5A 3JCUE 4OFLA 2UXAA 1US5A 2HZKA 1A55A 2KLFA 3GHGA 4GWOA 4LATA 1AQTA 3H1IE 5APWA 1ZR2A 4L17A 2WMMA 1S72P 2XU6A 1D4NA 3WUTA 3RK3E 5BUUA 1M5CA 4K35A 1L0NE 4N4UA 4H65A 1ZKBA 3AE8C 3HPIA 3H1JG 1MY3A 2IBZI 1FPGA 3I56P 1RYXA 3EKIA 4MAGA 4NG7A 4QHQA 4POWA 3RTFB 3HUSC 4XE5B 1ZXGA 4DXBA 3VFJA 2N1TA 2GH9A 4O3AA 3ILTB 3VLVA 5LDZA 3RGUA 5TPAB 1M1JC 1SQBJ 2WX9A 1FRPA 3IO6A 2R71A 2OWTA 1I6QA 3VVEA 4JYBA 3CPWO 3H3GA 2M8RA 1A7LA 3MZWB 2IBZE 1IK7A 4TLMB 3M0AA 4I1LA 3PUVE 1KA1A 3C9IA 1LBWA 2CMOA 3RQTA 3HV1A 3OSRA 2PP6A 3KJ7A 3O6QA 3P7KA 1QJMA 4XFEA 2OLBA 3KBRA 1IFJA 2DW3A 3S2VA 4D6TG 2UYEA 4BDRA 2DXRA 2QJKC 1MRPA 1NH7A 2Q2AA 2NUVA 2Q3IA 3PRJA 4D6TE 2YXQB 4EQBA 5C39A 3L71G 1SQPK 3U72A 3MZBA 3VLUA 3FXQA 2XXRA 2KZIA 3BBRA 1AL3A 2UVIA 2UWJE 2QPQA 2Z5HA 2GUVA 2ITAA 3D4GA 2H98A 1IMFA 1SBPA 5B66H 5TP9B 5IKBA 5DEXB 2BCCJ 2E5YA 3PLNA 1NAFA 3HE5A 1JCCA 2A45G 2K37A 3E13X 1URDA 2G93A 2OTKE 1SW5A 4JPZB 2F7CA 3RBXA 4I62A 1B3EA 3P8CD 2ZYNA 1M7LA 2E1SA 1IFIA 2KR0A 3B6TA 1Y1MA 3G3GA 2IZ0A 3D71A 1BTJA 4C0RA 2C9NY 2FBWC 3SERA 3FZVA 3LSXA 2OWSA 1IK9A 2Z8EA 4MNPA 2XDJA 1G0HA 4NF4A 2OK2A 5I58B 3A29A 3PTZA 1BK4A 1MV8A 1W5CE 4FE8A 1NTZD 3W67A 2D2CD 2L5VA 1LT9A 3A0HH 1MKMA 1G2CB 5I59B 1NI9A 2MKVA 3LR1A 3CFXA 2QS1A 2BCCE 3M9HA 2FXPA 2GFEA 1N7SB 4MX6A 1T3UA 5TPAA 3GF7A 3T22A 4AS5A 1B2HA 1GU4A 4NPFX 1J1NA 4KPTA 2Q8JA 3MGNA 4XKPA 4F31B 2QJKB 4L74A 1JY3O 3UGWA 2HCAA 4R6YA 2I0BA 3V89B 1FS0E 1IZNB 1ZLLA 1FU1A 5I57A 3H1LD 3OSQA 2JJKA 4WY4D 5J1DA 1PGOA 3AE4C 3GMAA 1YTZT 3G3HA 3IFCA 1SS1A 4H0LB 1B0HA 1FZCA 1D9VA 2M0BA 1NV2A 3I55P 1SFCC 3OAKA 3OOAA 3FV2A 3RK2B 3LC8A 1Q81Q 1LWUC 2YJPA 1M1JB 4HE0A 1HH0A 5TISH 5DJTB 3RNNA 1FPFA 5IZZA 2H8PD 1SQXK 1UTBB 2PCRA 4PF6A 3BKIB 3A0BE 3MIWA 2IX7C 2HPCB 1B3LA 5B5EE 4G61A 5EQ8A 1PP9D 1KC8Q 3RL0C 4ZEDA 1L0LE 3HTKA 1Q90D 1VFEA 3FJ7A 1FZFA 4MNIA 3U94A 3KOTA 3M9QA 4OGQD 3TDKA 1HJBA 4JVCA 2X7PA 3H1KJ 1SI0A 3VXCA 3D6YA 2ONSA 1NVOA 4IR8A 2FYUJ 2I8DA 2WKYA 1R5LA 2QM7A 1X22A 3MUQA 1H44A 1N7WA 3CCQP 5CCHC 4H13B 3IJOB 3MVYA 2Y5LA 4QFOA 4OGQB 4MLVA 3MP7B 1L0LK 1LTIC 2XWOA 4FATA 5I7IA 2IBZG 2L5GB 3HE5B 2XXPA 4P0GA 2YMKA 4XKQA 5TP9A 5CBSA 1B1XA 1BCCE 4YXWH 2HAVA 1NTKE 1FTKA 5EQAA 3PHLA 3RPLB 3W9VA 2JDIH 1RYOA 5AW7B 3D4CA 2PMSA 4ISUA 3PUZE 2OYIC 4EF1A 3KG2A 4ND9A 1P84I 1PBPA 4MH5A 3LW5J 2V25A 1RE3A 2XZRA 1M5FA 1PFIA 3K6VA 1BE3J 3QIMA 3HE4B 2NXOA 4PFIA 4GOEA 3TGUG 5KJ7C 1URQD 1LWUB 3QH9A 4I8CA 1FDMA 3RK2C 1NTZJ 2N1TC 4U3FG 4XA4A 3T0JA 4GF8A 3GLBA 2UVGA 1M57D 2NPSA 3EF7A 3N7NA 4Q0CA 4R9FA 1PPJD 5AW4B 1N73A 4ELPA 3IB2A 1NTKK 3CX5D 3GF3A 4FEDA 4QSEA 1KILC 1QL2A 4ECFA 2P1JA 4UB6H 5APSA 2F7BA 3HE4A 3FWNA 1XHYA 4G8NA 5CMZA 4PBHA 5EFWB 4H8IA 5H8FB 5AA1A 2OYIA 1JTHB 3OJAB 2WBBA 5ET7A 4PGNA 1QULA 4BDLA 3TTMA 4P11A 5EHSA 1A8EA 2Z22A 1XI6A 1B7HA 2QVVA 1FSAA 3OO9A 4NEDA 2LR2A 1JEUA 3HHGA 3U1OA 3G71P 3OENA 4JVIA 4BRYA 2PYYA 1BDCA 1GVCA 5APQA 3OEKA 4NWDA 1NTMK 1CZQA 2XXUA 3KC0A 3H1IJ 4OVJA 2E76D 2FBPA 2ZNTA 1FBMA 2J58A 1MXVA 3DP6A 1ATGA 4OWDA 4UACA 2BASA 1KZ8A 2D5WA 1JEKA 2CZLA 5FHNA 3L36A 5KLVK 2BJIA 1MM6A 2K9JB 1VQ6P 1A40A 3S9LC 1P1WA 3L75D 1J1EB 1FBEA 4GT1A 1TFAA 3GHGC 4KHXA 3BFTA 4BLAA 5AVVB 5ELVA 2CZHA 2H9BA 2ZZXA 3SEYA 2FYUG 2FHYA 2WQYC 2WPSA 1IMBA 1FJ9A 2FYZA 2DVCA 1BCCD 3FJMA 1EZOA 1QGXA 4N8GA 3RK3D 5KKZC 1NNTA 3RT6B 3CG3A 3CR9A 2PFXA 3CLQA 4EYYQ 2XXXA 2IYOA 4HS7A 3ROJA 1RY3A 1FQFA 2B4LA 1HSEA 4YKKA 3KGCA 3MP6A 4I1DA 1SDXA 4X04A 5KLVD 3PMXA 2ZYDA 2R8TA 3HCQA 2O3JA 3U65A 1K73Q 5ET6A 5KAIH 2HYNA 2RH0A 2NPSD 3B5NA 1GW4A 3A5TA 5IAIA 1PPJE 3SFDC 3PMWA 4HCWA 1NL5A 5EYFA 2RC8A 2WPQA 1G1JA 4NE4A 1SW1A 3FWLA 2K88A 1MPBA 2QS2A 2W27A 4OWFA 1EXJA 1SW4A 1OW6A 1S9KE 1HSJA 4Z7EA 1Y1ZA 3B6WA 4I3EA 4U3FE 2WBDA 1SQPE 3BATA 4HH2A 2JWDA 3C36A 1L0NG 4GQOA 1EU8A 4OMBA 1H0TB 1LBYA 4DXCA 4QSDA 3MVWA 4HYTB 2OCUA 1LP1B 2Q1KA 4IFFA 3MJNA 3SWYA 3FV1A 2XV5A 1TT1A 2E74B 1SPIA 1MPCA 4PTKA 4OZ9A 3V83A 2KZJA 3EFGA 2WSEJ 2YO3A 2HG5D 2VPOA 2KLUA 4YPCA 1R5SA 1W2EA 3S1KA 2PFYA 2E76B 3TTNA 1L0NK 1OVTA 3H7MA 4N07A 3FASA 3NOHA 2PAJA 1BE3E 3G3KA 2KIKA 1DH3A 1SQXG 2A45H 5DVJA 2OYHC 3V5AA 4NMYA 4DCKA 3UIFA 3C8VA 3SSUA 3UA8A 1NTKJ 3E1IA 4L76A 4R6HA 3W68A 3LIEA 2FYIA 3ZS6A 1MPDA 1TU3F 1FZCB 5AW0B 1SQVG 1QKAA 1KYOE 2WSSH 4R72A 3UP9A 1Y9BA 1DIPA 4H0LC 4FBPA 1VR5A 2DWIA 5KJ7A 3TODA 1K05A 4N6PA 1AA0A 4IL6H 3TMGA 1EZVI 3SWKA 1JY3P 3KOSA 2QM8A 1L0ND 4H45A 2D3IA 1NV3A 1FTLA 4LONB 1NV4A 1PZQA 1FBFA 1YPNA 1B4HA 4GL8A 2G3AA 1EZVE 3T9VA 1FE6A 3HRNA 3JC22 5KLVE 1LTAC 3L6HA 1Q2NA 4H0WA 4WXJA 4JB7A 1N7SD 2N9BA 5AW3B 1NUYA 4IY5A 1URSA 4WY4A 2O69A 1X0TA 2CPBA 3IL1B 4GBVA 2V7QH 4G68C 2B3BA 1K04A 4RJTA 1LFIA 3TAJA 2PT1A 5AW1B 3IFAA 1BGYE 3LUYA 2DYXA 2FVZA 4ZECA 2O1LA 1SQPD 2B88A 1LTSC 2XXVA 4PGPA 4MNCA 1HGVA 2C0WA 1KB9H 3RK2D 5L8DA 1N0TA 2ONKE 4RKUJ 3L75E 1VQ8P 1P99A 2HFED 5AA2D 1MS7A 1DPPA 1S9TA 1AIVA 2AEMA 1B0LA 4WKMA 3TF5A 1NTZE 3N26A 3OXNA 1PB9A 4MLQA 4GL0A 2GM4A 3NFQA 3B8BA 3OW2O 4PV1B 3I6VA 2WVRA 3A3YB 1VQ5P 4ASVA 4NTLA 2O51A 4W7ZA 4P0IA 1TWYA 5GTHE 2D2CB 1YJ9P 2R5DA 2XX8A 3C35A 4F18A 1T6AA 3U59A 2A5TB 2O1KA 3PTYA 4BDNA 1IFPA 3GYYA 2DS9A 4XTCQ 3H03A 2XA5A 3B71A 3L74D 2KS1B 5DVIA 1OX3A 1KB9D 1KMIZ 1VF5C 2D2CC 1JETA 3OMBA 4PF8A 5FBPA 1JM0A 3GW6A 4JYCA 3H6TA 2M5AA 2W90A 3TQWA 4AS4A 1OZHA 2R6GE 2YNYA 3VTPC 2P10A 1BCCJ 2AL4A 1Y4CA 1DTZA 2P58A 2DE4A 1LCTA 1S50A 5BWJA 1SD3A 1J1EC 1RF0C 4RJZA 1Z56A 4IO7A 5CJ0A 1EC5A 2L91A 4OESA 3AE3C 3TTLA 3FXRA 1NUZA 3AEBC 1NGMB 3T66A 1RF1B 2ZXEB 4PFRA 3CG1A 3N6UA 4P3LA 1DSNA 3M8UA 3DLNA 1AV1A 1OFCX 4HB1A 1SQVK 5DT6A 5CRYA 3CI8A 3LW5H 1URGA 1POY1 1SQQJ 1NU1G 1OLCA 3AE1C 1LAGE 1NTZK 1OWAA 5B66E 1US4A 2AIXA 1FJ6A 2O01J 1B05A 2REGA 4OVRA 1RQUA 2FYUK 2QA4P 1JTHA 1DK4A 1U7MA 1NNPA 4OTEA 1VF5B 1X79B 3L73G 1H3DA 3DP8A 1S7YA 4OXVA 2GRVA 1L4AB 1LTJA 2BCCG 3RPWA 1AJYA 2ZMBA 4H5FA 4DE8A 1P1QA 3DELB 2OTLP 4NQ8A 5APYA 2ABHA 1NV1A 4IFDK 1BGYG 1Q86Q 1LBCA 4EOTA 3A2AA 3P7IA 2I1JA 5DW8A 5CBNA 4WY4B 4QXDA 4A7PA 4C1UA 3H06B 5EHMA 1EDKA 3A09A 1D9QA 1JQFA 4RESB 3WMM0 4PV1D 1FBCA 3IB0A 2SPZA 3H32A 3MQ9A 4Y99B 1Y3NA 5JEIA 3PUYE 4RNSA 1SQBE 2V84A 3IAOA 5A5LA 3RBZA 2WSFH 3AECC 3VP8A 1OQHA 3A0HE 4IOIH 2ZXXA 3H1KD 4L73A 2QSXA 4P9KA 3CMEP 1HVVA 4N6DA 3WUVA 3ZSFA 1FBDA 5KLVG 2WSCH 3RN8A 4PAKA 1SQQE 3L72J 2THIA 4KJMA 5AVXB 5F7VA 5DEXA 4RY1A 4NF6A 4M3LA 2UYFA 2ZYMA 4U1ZA 4PFTA 4ZE8A 1KQLA 2RKLA 5L8RJ 3EHSA 5H2FE 1NTMG 1MQJA 3MSTA 1MUUA 1SW2A 2R44A 2UVHA 3CD6P 3FUZA 2XWKA 3FXUA 2ESNA 3SEUA 3T9XB 5H8FA 3H1IG 1NJIQ 4HKZH 2F7AA 2W83C 3U93A 4H13C 4LGDE 3WUUA 4AB5A 1T3JA 3AE9C 2Q9TA 3S4UA 2HPGA 4GLIA 4PQJA 4JSOA 3MC2A 3G3FA 2VPNA 3HD7C 1QEXA 1YBKA 1PDAA 2HZLA 1FBGA 1ZJLA 4AQRD 1NAYA 4HW8A 4AYCA 3A0BH 1FOSE 2VT5A 1ZBMA 3CSBA 3V8XB 1FZAA 2OYOA 4KR5A 4NF0A 4GKGA
chains in the Genus database with same CATH topology
1BIYA 4WEDA 1H45A 1QVSA 3OELA 1LCFA 5L9SA 3S9EA 3SDFA 1LP1A 1H43A 3QK6A 2DWHA 1MXUA 3C4MA 4OETA 4QRZA 2B89A 3KFMA 3PPRA 4HCYA 4G8HA 5KCJA 3PV0E 4EQ9A 3EQ1A 3CIJA 1XC1A 2LXCB 5KDTA 1MY0A 4JWOA 3H6WA 1YTVA 3RTWB 2F5XA 2YLNA 3VLWA 2OJTA 1UIUA 4TLLB 4THIA 5I84A 4YKIA 3RT8A 4F3PA 4QFLA 1OIBA 2B3FA 1EH3A 3N5LA 3TZAA 2B87B 1ELJA 3TTKA 4ASWA 1IXCA 4OHNA 3MHVA 1IXHA 4DXUA 5CBRA 5AA2A 3MP1A 4ESWA 3IOTA 2X26A 2ZXTA 1UQWA 3O6GA 3C9HA 3HHFA 5AE4A 3UORA 1MXYA 4MBPA 5DYHA 4NF8A 4LVQA 4OERA 2DP8A 4YU0A 4MN4C 3B6QA 4ELQA 1XVYA 3K02A 4IO5A 4F19A 5H8HA 4NF6B 3SKPA 4KFQA 2I4BA 3C34A 1N7XA 3S9MC 2QRYA 4M4GA 2DWAA 1YCJA 4MF3A 2Q89A 1B3GA 2HQ0A 3N6TA 2FA7A 3MPKA 1A8FA 3PU5A 4G2ZA 3I3VA 1MG1A 1UTHB 1OLAA 2AYSA 2RINA 4G4PA 1ZIUA 2I49A 1HSLA 1Z7NE 4IO6A 4R2FA 1MXZA 4F3BA 4RPOA 4JSDA 5HM4B 5ITOA 1IITA 3CFZA 3GXAA 1Y3PA 1LAXA 4OFJA 3SESA 1NFTA 1UTHA 1B40A 1JVYA 3C33A 1DMBA 2B87A 2M5AB 2ALUA 1UIVA 4U22A 3SETA 1B3FA 2HEUA 3FGSA 4R75A 3K1PA 3IOVA 3KSXA 3W15C 4OENA 4QSCA 3IOUA 1SYHA 3TCHA 3FVKA 4OFOA 1B9JA 3SEWA 1OVRA 4DZ1A 2Y7WA 3KN8A 3RGYA 2HAUA 3OO8A 1M5BA 3CSGA 2HFBA 5K2XA 2F34A 4NF4B 5ISUA 3FVOA 4ZZEA 4YKPA 2V3QA 3GBBA 3UK4A 3TEPA 4Z0IA 1LGBC 3KJTA 1OVBA 1Q35A 4U21A 4JBZA 2QJEA 3FD3A 3R26A 1IXIA 1KWHA 1QUJA 3H6VA 1JW1A 2VHAA 4PP0A 2REJA 2RCAA 5FHMA 1A99A 3G3IA 1OVVA 2Q2CA 3PD8A 2I3WA 4F2OA 2I3VA 1DPEA 3FXEA 3O29A 1P1OA 1MQIA 4KYEA 1QW0A 4QFNA 5I58A 5CMCA 4MFIA 3H6UA 4G68A 3DM0A 2H5YA 4YMAA 1B32A 1D9YA 2F6PA 4F1UA 4X9TA 3TELA 4ZZAA 2RKMA 1MQDA 1ZMGA 1B1HA 1GTKA 2DVZA 1DEEG 1Z7ME 1IUDA 4F3GA 5H8NB 1PC3A 5CI5A 3OEMA 1QUIA 2B65A 2NWJA 5H8HB 4NF5B 2GHBA 3FVNA 3TTRA 2DXYA 3QUJA 1Y3QA 3G7WA 2ONRA 4CPGA 3O2AA 1OQGA 4GD5A 4LQ5A 3Q27A 1NNKA 2D21A 4ZS9A 2OZZA 4FAJA 1ZU0A 3EN3A 5ICTA 4FORA 3MBPA 5A5XA 3MWBA 1N84A 2VD2A 1N3XA 3GZGA 3ECRA 1VFDA 4QFKA 3ILUB 5DTBA 5H8SA 4H5GA 2Y7RA 1U7JA 3JYRA 2DWJA 5AA4A 4IO2A 3Q28A 3FJGA 4DCXA 2DE3A 1FQEA 2PT2A 4GXAA 4O3BA 4E0WA 4YAHX 4LUBA 1LB9A 1B3HA 3Q26A 4R2BA 2DOJA 4OQOA 2V3TA 4EDPA 1ZW0A 5AA4B 5M2VA 5K5GB 4PE5B 1JEVA 1S3JA 1ANFA 1FQCA 3TYHA 1FTMA 5K2YA 1P1UA 1AMFA 3IO4A 1AOVA 1CB6A 2QS4A 4BDMA 3PUWE 3K4UA 4U2RA 1FW0A 1P1NA 3OO6A 4PFWA 4DLDA 4ZEFA 4GIZA 2G29A 4NWCA 4G8MA 1JW4A 2XXTA 1VSOA 3E3KA 4YB7A 3E9XA 2Y7KA 3USDA 3IX1A 5FHOA 2XD3A 4IY6A 5I57B 4E0XA 2XHDA 3VE1B 2A5SA 4UA8A 3K00A 4Q8RA 5FTIA 1QUKA 2QMXA 4NPEA 2P1SA 2VGQA 3WAFA 4JDFA 1L5TA 1A54A 2H25A 2RC9A 2QVAA 3E4RA 4KI0E 2IA4A 4FEBA 1DOTA 1LT1A 1GGGA 1UTBA 2O84X 1MFTA 3N94A 1O7TA 5ITPA 2LAOA 3TCFA 1NMUA 1IXGA 3ONMA 1EZPA 1SVXB 1WODA 4AQ4A 4LZ5A 3OO7A 4RYAA 3IAZA 1SYIA 2XD2A 3C31A 1MXXA 1Y9UA 3EPEA 4EF2A 2VD3A 1XVXA 2O6AA 4H67A 4KCCA 1LAFE 4Q30B 5JTYB 4F39A 1FC2C 5TU0A 2R9JA 1PB8A 1R9QA 4IB2A 2Y7PA 3HSTA 3L6GA 1FCKA 4F1YA 3M3LA 4KCDA 4ONYA 3O97A 4GOTA 5I2KB 2V3UA 4BDQA 4O3CA 2I48A 1MDP1 2XX9A 1PBQA 1USYE 3U92A 5CBOA 3QAXA 1BP5A 3QYTA 1T0KA 1DTGA 3O28A 4LA9A 4EXLA 3RLFE 4GVOA 3RUMA 2RCBA 4YZZA 3O66A 1NH8A 3MAMA 2P0SA 5F1QA 4JXIA 3IJXB 4LP2B 5AA2B 4YB5A 2F36A 2Y7IA 2QRXA 4LZ8A 2LXBA 1JW5A 4LZ7A 1H76A 2M8CA 4YMBA 5CC2A 4OYVA 2F35A 1TFDA 1SQYA 3QXMA 1MH4A 3MZ9A 2PX1A 5CM6A 3VDFA 2ZNUA 1GV8A 3GBAA 3SEXA 2K3RA 5DJUB 5JTYA 4OEVA 1MY2A 1B4ZA 2HXWA 2Q88A 1M5DA 3O6HA 2O7IA 4KYDA 1R6ZA 1H0TA 1MXWA 1IZ1A 4N13A 4H8JA 3MVXA 4K3AA 3UN6A 5I56A 1FQDA 1NKXA 4H1XA 3CFLA 3O9PA 4OEUA 3K01A 2XXWA 3WAEA 5AA3A 1I6BA 1N3WA 3LBSA 1XS5A 2F97A 1R1NA 4IGTA 4ZNCA 2I4CA 5I59A 3R6UA 1MY4A 2QL3A 4G68B 2GHAA 4ELOA 4TOZA 3ZKKA 2VOZA 1LLSA 3I5OA 1WVJA 1FTOA 3MPLA 4KYSA 4XKNA 5CMBA 2XXIA 3HN0A 5H8QA 1NNFA 3KZGA 1FTJA 3QWOC 1B51A 1BLFA 3RY3A 5CMKA 4ZEKA 3VVDA 3KEIA 3R7XA 2DSFA 3PPOA 4ZMDA 3TPAA 4YKJA 2F6GA 4EQ7A 3T93B 2RC7A 3O6IA 3PH0A 1Y4TA 2Z8DA 1BDDA 1OMPA 3T9UA 1GR2A 4PFYA 4R9GA 3T9HB 4XXUA 1SI1A 4EXKA 2YPNA 4PETA 4RK9A 2O7UA 5KZTA 3K6UA 3K1MA 3FATA 5B70A 3MW0A 3PUXE 1YAEA 1RKMA 2Y84A 3T96B 4WEPA 1PEBA 3IB1A 3PPNA 3K6WA 3DP4A 3ODBA 3ZDMA 4I9DA 4F22A 1EDIA 5I2NB 3TUSA 1Y47A 3FXDA 2NOOA 5B7DA 4F29A 1B46A 2ZYKA 3A3UA 2XXYA 5I56B 4FJPA 4BDOA 3A3CA 1MY1A 1MQHA 1B5HA 2PBWA 3KN7A 1FQBA 5KDTB 2VP1A 2I6EA 3JZJA 2AL5A 3TDJA 2W7YA 3EHTA 5A5XB 3IR1A 1JMBA 1LFGA 3M3KA 4GODA 4JWXA 4ZEIA 1JVXA 4ZEBA 3VVFA 3THIA 4GXSB 3F11A 4IGRA 4YICA 3JV9A 2XX7A 3B7DA 2QS3A 3MZ1A 4NPDA 1FQAA 2Z23A 3PPQA 3MP8A 4WWIA 2O1MA 4JWYA 1LB8A 4RK2A 4U23A 1IIWA 4X1DA 3PPPA 1B5JA 1B6HA 1MQGA 1Y20A 3MVZA 2I58A 4R6KA 4RA1A 2I0CA 5H8NA 5L9MA 2BJJX 3G3JA 5I2NA 3TQLA 1Q1KA 5L9OA 4U4SA 1N04A 4ESXA 2KUBA 1D3KA 2PVUA 1M5EA 1EDJA 1B52A 3LSFB 2HR3A 4RPNA 4R73A 1B58A 4XIGQ 3K1NA 3SEVA 4FECA 4F3SA 2IEEA 1JNFA 1TXFA 1LSTA 1II5A 2P2AA 2QMWA 1BKAA 3VXBA 4IO3A 4ZDMA 4KD5A 4HTGA 4U1OA 4TQUQ 1MH3A 3S9NC 3HO7A 4QFPA 4GRKA 1O64A 1MDQA 4IO4A 1LBBA 3TCGA 3IOWA 4HJGH 3LSWA 1B7ZA 5DVFA 3CRBA 5CMMA 3TKDA 1B7UA 4YB6A 3PGFA 1LFHA 2ANJA 4X1BA 3LSLA 5LOMA 4G77A 4Q5TA 1VE4A 4ZE9A 1B5IA 2DQVA 1R9LA 2ZAEB 2FNCA 1IQ7A 3Q25A 4XKRA 1O63A 4C1TA 2V93A 1ZLQA 3AXFA 4R74A 1AH5A 5H8QB 3K6XA 1XOCA 2NVUB 4M1VA 1I6AA 5HBCA 1ZTYA 2ZNSA 3KN3A 4NF5A 5KCJB 5JK4A 3OD7A 3H4ZA 4POXA 4AB6A 2X7QA 2H4IA 4K3FA 3C32A 4LQ2A 2RF1A 4NF8B 4RXLA 4EUOA 5FTHA 3FIRA 3PMVA 3VV5A 1PB7A 4KQPA 3TFLA 1WDNA 2KI7B 1QKBA 2A5TA 2OBGA 1CE2A 2F78A 1N76A 1USYH 2DE2A 3CVGA 4DCYA 1EDLA 1XT8A 1LAHE 1I69A 3Q29A 4X48A 4GOFA 4PFUA 3U8QA 3KSJA 5ICQA 4BXLA 2Z8FA 4DIGA 2XXHA 3IK6B 4U4XA 4F1VA 3K0VA 3QSLA 3ZKLA 2UVJA 1POTA 2F8DA 3FVGA 3IORA 5I2KA 4GFRA 4DDDA 2XXQA 2ZYOA 1EZ9A 3EHUA 4ELRA 4FIMA 4F2QA 2H99A 3M3FA 3PD9A 1MM7A 4QF9A 4H6DA 1F9BA 2E0SA 1IEJA 5HPQA 4KHZE 3BFUA 3W9WA 3QUFA 1OVUA 2O68A 3K2DA 4OFLA 2UXAA 1US5A 2HZKA 1A55A 2KLFA 4GWOA 4LATA 4L17A 2WMMA 1D4NA 5BUUA 1M5CA 4K35A 4H65A 1ZKBA 3HPIA 1MY3A 1RYXA 3RTFB 4QHQA 4POWA 1ZXGA 4DXBA 3VFJA 2GH9A 4O3AA 3ILTB 3VLVA 3RGUA 5TPAB 3IO6A 2R71A 2OWTA 1I6QA 3VVEA 3H3GA 1A7LA 3MZWB 4TLMB 3PUVE 2CMOA 3RQTA 3HV1A 3OSRA 3KJ7A 1QJMA 2OLBA 3KBRA 4BDRA 3S2VA 2UYEA 2DXRA 1MRPA 1NH7A 2Q2AA 2NUVA 4EQBA 5C39A 3U72A 3MZBA 3VLUA 3FXQA 2XXRA 2KZIA 3BBRA 1AL3A 2UVIA 2UWJE 2QPQA 3D4GA 2H98A 1SBPA 5TP9B 5IKBA 5DEXB 3E13X 1URDA 2G93A 2OTKE 1SW5A 2F7CA 4I62A 1B3EA 2ZYNA 2E1SA 3B6TA 1Y1MA 3G3GA 1BTJA 4C0RA 3SERA 3FZVA 3LSXA 2OWSA 2Z8EA 4NF4A 2OK2A 5I58B 4FE8A 5I59B 3LR1A 3CFXA 2QS1A 2GFEA 5TPAA 3T22A 1B2HA 4NPFX 1J1NA 4KPTA 2Q8JA 4F31B 4XKPA 3UGWA 2HCAA 4R6YA 2I0BA 3V89B 5I57A 3OSQA 5J1DA 3G3HA 1SS1A 1B0HA 1D9VA 2M0BA 3OOAA 3FV2A 3LC8A 2YJPA 5DJTB 3RNNA 1UTBB 3BKIB 1B3LA 4ZEDA 1VFEA 3FJ7A 3U94A 3KOTA 2X7PA 1SI0A 3VXCA 2ONSA 1NVOA 2I8DA 2WKYA 3MUQA 1H44A 1N7WA 3IJOB 3MVYA 4QFOA 4MLVA 4FATA 2XXPA 4P0GA 4XKQA 5TP9A 5CBSA 1B1XA 2HAVA 1FTKA 3W9VA 1RYOA 3D4CA 2PMSA 4ISUA 3PUZE 4EF1A 3KG2A 4ND9A 1PBPA 4MH5A 2V25A 1M5FA 3K6VA 3QIMA 2NXOA 4GOEA 4I8CA 4GF8A 3GLBA 2UVGA 3EF7A 4Q0CA 4R9FA 4ELPA 3IB2A 4FEDA 4QSEA 4ECFA 2F7BA 1XHYA 4G8NA 5H8FB 5EFWB 4H8IA 5AA1A 1QULA 4BDLA 3TTMA 4P11A 5EHSA 1A8EA 2Z22A 1B7HA 3OO9A 4NEDA 2LR2A 1JEUA 3HHGA 3U1OA 3OENA 2PYYA 1BDCA 1GVCA 3OEKA 4NWDA 2XXUA 4OVJA 4UACA 2ZNTA 1MXVA 3DP6A 1ATGA 4OWDA 2D5WA 2CZLA 5FHNA 1MM6A 1A40A 3S9LC 1P1WA 1TFAA 3BFTA 4BLAA 5ELVA 2H9BA 3SEYA 2DVCA 3FJMA 1EZOA 1NNTA 3RT6B 3CG3A 3CR9A 2XXXA 4EYYQ 4HS7A 1FQFA 4YKKA 1HSEA 3KGCA 3MP6A 4I1DA 1SDXA 3PMXA 3HCQA 5IAIA 3PMWA 5EYFA 4HCWA 1NL5A 2RC8A 4NE4A 1SW1A 1MPBA 2QS2A 1SW4A 1HSJA 4Z7EA 1Y1ZA 3B6WA 2JWDA 3C36A 4GQOA 1EU8A 4OMBA 1H0TB 4DXCA 4QSDA 3MVWA 2OCUA 1LP1B 2Q1KA 3MJNA 3FV1A 1TT1A 1MPCA 4OZ9A 3V83A 2KZJA 3S1KA 3TTNA 1OVTA 3H7MA 4N07A 3FASA 3G3KA 2KIKA 5DVJA 3V5AA 4NMYA 3UIFA 3UA8A 4R6HA 2FYIA 3ZS6A 1MPDA 1QKAA 4R72A 3UP9A 1VR5A 2DWIA 3TODA 4N6PA 3TMGA 3KOSA 2D3IA 1FTLA 4LONB 1YPNA 1B4HA 4GL8A 3T9VA 3L6HA 1Q2NA 4H0WA 4WXJA 4JB7A 4IY5A 1URSA 2O69A 1X0TA 3IL1B 4G68C 2B3BA 1LFIA 3TAJA 2PT1A 3LUYA 2DYXA 4ZECA 2O1LA 2B88A 2XXVA 5L8DA 1N0TA 2ONKE 1P99A 5AA2D 1MS7A 1DPPA 1S9TA 1AIVA 1B0LA 4WKMA 3N26A 3OXNA 1PB9A 4MLQA 4GL0A 3I6VA 4ASVA 4NTLA 2O51A 4P0IA 1TWYA 3C35A 2XX8A 4F18A 2A5TB 4BDNA 2DS9A 4XTCQ 3H03A 2KS1B 5DVIA 1JETA 3OMBA 1JM0A 3H6TA 2M5AA 3TQWA 2R6GE 2AL4A 1Y4CA 1DTZA 2P58A 2DE4A 1LCTA 1S50A 5BWJA 1SD3A 4RJZA 4IO7A 1EC5A 4OESA 3TTLA 3FXRA 3T66A 3CG1A 3N6UA 1DSNA 3M8UA 3DLNA 4HB1A 5DT6A 5CRYA 3CI8A 1URGA 1POY1 1OLCA 1LAGE 1US4A 2AIXA 1B05A 2REGA 4OTEA 1U7MA 1NNPA 1H3DA 3DP8A 1S7YA 4OXVA 2GRVA 3RPWA 2ZMBA 4H5FA 4DE8A 1P1QA 3DELB 2ABHA 1LBCA 3P7IA 5CBNA 4C1UA 3H06B 5EHMA 1EDKA 3A09A 1JQFA 3IB0A 2SPZA 3MQ9A 1Y3NA 5JEIA 3PUYE 4RNSA 2V84A 1OQHA 4IOIH 2QSXA 3ZSFA 3RN8A 2THIA 4KJMA 5F7VA 5DEXA 4RY1A 4NF6A 2UYFA 2ZYMA 4U1ZA 4PFTA 4ZE8A 2RKLA 3EHSA 1MQJA 1SW2A 2R44A 2UVHA 3FUZA 3FXUA 2ESNA 3SEUA 3T9XB 5H8FA 4HKZH 2F7AA 3U93A 4AB5A 2Q9TA 3S4UA 4GLIA 4PQJA 4JSOA 3MC2A 3G3FA 1PDAA 2HZLA 1ZJLA 4HW8A 1ZBMA 3CSBA 3V8XB 4KR5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1BIY A;  4WED A;  1H45 A;  1QVS A;  3OEL A;  1LCF A;  5L9S A;  3S9E A;  3SDF A;  1LP1 A;  1H43 A;  3QK6 A;  2DWH A;  1MXU A;  3C4M A;  4OET A;  4QRZ A;  2B89 A;  3KFM A;  3PPR A;  4HCY A;  4G8H A;  5KCJ A;  3PV0 E;  4EQ9 A;  3EQ1 A;  3CIJ A;  1XC1 A;  2LXC B;  5KDT A;  1MY0 A;  4JWO A;  3H6W A;  1YTV A;  3RTW B;  2F5X A;  2YLN A;  3VLW A;  2OJT A;  1UIU A;  4TLL B;  4THI A;  5I84 A;  4YKI A;  3RT8 A;  4F3P A;  4QFL A;  1OIB A;  2B3F A;  1EH3 A;  3N5L A;  3TZA A;  2B87 B;  1ELJ A;  3TTK A;  4ASW A;  1IXC A;  4OHN A;  3MHV A;  1IXH A;  4DXU A;  5CBR A;  5AA2 A;  3MP1 A;  4ESW A;  3IOT A;  2X26 A;  2ZXT A;  1UQW A;  3O6G A;  3C9H A;  3HHF A;  5AE4 A;  3UOR A;  1MXY A;  4MBP A;  5DYH A;  4NF8 A;  4LVQ A;  4OER A;  2DP8 A;  4YU0 A;  4MN4 C;  3B6Q A;  4ELQ A;  1XVY A;  3K02 A;  4IO5 A;  4F19 A;  5H8H A;  4NF6 B;  3SKP A;  4KFQ A;  2I4B A;  3C34 A;  1N7X A;  3S9M C;  2QRY A;  4M4G A;  2DWA A;  1YCJ A;  4MF3 A;  2Q89 A;  1B3G A;  2HQ0 A;  3N6T A;  2FA7 A;  3MPK A;  1A8F A;  3PU5 A;  4G2Z A;  3I3V A;  1MG1 A;  1UTH B;  1OLA A;  2AYS A;  2RIN A;  4G4P A;  1ZIU A;  2I49 A;  1HSL A;  1Z7N E;  4IO6 A;  4R2F A;  1MXZ A;  4F3B A;  4RPO A;  4JSD A;  5HM4 B;  5ITO A;  1IIT A;  3CFZ A;  3GXA A;  1Y3P A;  1LAX A;  4OFJ A;  3SES A;  1NFT A;  1UTH A;  1B40 A;  1JVY A;  3C33 A;  1DMB A;  2B87 A;  2M5A B;  2ALU A;  1UIV A;  4U22 A;  3SET A;  1B3F A;  2HEU A;  3FGS A;  4R75 A;  3K1P A;  3IOV A;  3KSX A;  3W15 C;  4OEN A;  4QSC A;  3IOU A;  1SYH A;  3TCH A;  3FVK A;  4OFO A;  1B9J A;  3SEW A;  1OVR A;  4DZ1 A;  2Y7W A;  3KN8 A;  3RGY A;  2HAU A;  3OO8 A;  1M5B A;  3CSG A;  2HFB A;  5K2X A;  2F34 A;  4NF4 B;  5ISU A;  3FVO A;  4ZZE A;  4YKP A;  2V3Q A;  3GBB A;  3UK4 A;  3TEP A;  4Z0I A;  1LGB C;  3KJT A;  1OVB A;  1Q35 A;  4U21 A;  4JBZ A;  2QJE A;  3FD3 A;  3R26 A;  1IXI A;  1KWH A;  1QUJ A;  3H6V A;  1JW1 A;  2VHA A;  4PP0 A;  2REJ A;  2RCA A;  5FHM A;  1A99 A;  3G3I A;  1OVV A;  2Q2C A;  3PD8 A;  2I3W A;  4F2O A;  2I3V A;  1DPE A;  3FXE A;  3O29 A;  1P1O A;  1MQI A;  4KYE A;  1QW0 A;  4QFN A;  5I58 A;  5CMC A;  4MFI A;  3H6U A;  4G68 A;  3DM0 A;  2H5Y A;  4YMA A;  1B32 A;  1D9Y A;  2F6P A;  4F1U A;  4X9T A;  3TEL A;  4ZZA A;  2RKM A;  1MQD A;  1ZMG A;  1B1H A;  1GTK A;  2DVZ A;  1DEE G;  1Z7M E;  1IUD A;  4F3G A;  5H8N B;  1PC3 A;  5CI5 A;  3OEM A;  1QUI A;  2B65 A;  2NWJ A;  5H8H B;  4NF5 B;  2GHB A;  3FVN A;  3TTR A;  2DXY A;  3QUJ A;  1Y3Q A;  3G7W A;  2ONR A;  4CPG A;  3O2A A;  1OQG A;  4GD5 A;  4LQ5 A;  3Q27 A;  1NNK A;  2D21 A;  4ZS9 A;  2OZZ A;  4FAJ A;  1ZU0 A;  3EN3 A;  5ICT A;  4FOR A;  3MBP A;  5A5X A;  3MWB A;  1N84 A;  2VD2 A;  1N3X A;  3GZG A;  3ECR A;  1VFD A;  4QFK A;  3ILU B;  5DTB A;  5H8S A;  4H5G A;  2Y7R A;  1U7J A;  3JYR A;  2DWJ A;  5AA4 A;  4IO2 A;  3Q28 A;  3FJG A;  4DCX A;  2DE3 A;  1FQE A;  2PT2 A;  4GXA A;  4O3B A;  4E0W A;  4YAH X;  4LUB A;  1LB9 A;  1B3H A;  3Q26 A;  4R2B A;  2DOJ A;  4OQO A;  2V3T A;  4EDP A;  1ZW0 A;  5AA4 B;  5M2V A;  5K5G B;  4PE5 B;  1JEV A;  1S3J A;  1ANF A;  1FQC A;  3TYH A;  1FTM A;  5K2Y A;  1P1U A;  1AMF A;  3IO4 A;  1AOV A;  1CB6 A;  2QS4 A;  4BDM A;  3PUW E;  3K4U A;  4U2R A;  1FW0 A;  1P1N A;  3OO6 A;  4PFW A;  4DLD A;  4ZEF A;  4GIZ A;  2G29 A;  4NWC A;  4G8M A;  1JW4 A;  2XXT A;  1VSO A;  3E3K A;  4YB7 A;  3E9X A;  2Y7K A;  3USD A;  3IX1 A;  5FHO A;  2XD3 A;  4IY6 A;  5I57 B;  4E0X A;  2XHD A;  3VE1 B;  2A5S A;  4UA8 A;  3K00 A;  4Q8R A;  5FTI A;  1QUK A;  2QMX A;  4NPE A;  2P1S A;  2VGQ A;  3WAF A;  4JDF A;  1L5T A;  1A54 A;  2H25 A;  2RC9 A;  2QVA A;  3E4R A;  4KI0 E;  2IA4 A;  4FEB A;  1DOT A;  1LT1 A;  1GGG A;  1UTB A;  2O84 X;  1MFT A;  3N94 A;  1O7T A;  5ITP A;  2LAO A;  3TCF A;  1NMU A;  1IXG A;  3ONM A;  1EZP A;  1SVX B;  1WOD A;  4AQ4 A;  4LZ5 A;  3OO7 A;  4RYA A;  3IAZ A;  1SYI A;  2XD2 A;  3C31 A;  1MXX A;  1Y9U A;  3EPE A;  4EF2 A;  2VD3 A;  1XVX A;  2O6A A;  4H67 A;  4KCC A;  1LAF E;  4Q30 B;  5JTY B;  4F39 A;  1FC2 C;  5TU0 A;  2R9J A;  1PB8 A;  1R9Q A;  4IB2 A;  2Y7P A;  3HST A;  3L6G A;  1FCK A;  4F1Y A;  3M3L A;  4KCD A;  4ONY A;  3O97 A;  4GOT A;  5I2K B;  2V3U A;  4BDQ A;  4O3C A;  2I48 A;  1MDP 1;  2XX9 A;  1PBQ A;  1USY E;  3U92 A;  5CBO A;  3QAX A;  1BP5 A;  3QYT A;  1T0K A;  1DTG A;  3O28 A;  4LA9 A;  4EXL A;  3RLF E;  4GVO A;  3RUM A;  2RCB A;  4YZZ A;  3O66 A;  1NH8 A;  3MAM A;  2P0S A;  5F1Q A;  4JXI A;  3IJX B;  4LP2 B;  5AA2 B;  4YB5 A;  2F36 A;  2Y7I A;  2QRX A;  4LZ8 A;  2LXB A;  1JW5 A;  4LZ7 A;  1H76 A;  2M8C A;  4YMB A;  5CC2 A;  4OYV A;  2F35 A;  1TFD A;  1SQY A;  3QXM A;  1MH4 A;  3MZ9 A;  2PX1 A;  5CM6 A;  3VDF A;  2ZNU A;  1GV8 A;  3GBA A;  3SEX A;  2K3R A;  5DJU B;  5JTY A;  4OEV A;  1MY2 A;  1B4Z A;  2HXW A;  2Q88 A;  1M5D A;  3O6H A;  2O7I A;  4KYD A;  1R6Z A;  1H0T A;  1MXW A;  1IZ1 A;  4N13 A;  4H8J A;  3MVX A;  4K3A A;  3UN6 A;  5I56 A;  1FQD A;  1NKX A;  4H1X A;  3CFL A;  3O9P A;  4OEU A;  3K01 A;  2XXW A;  3WAE A;  5AA3 A;  1I6B A;  1N3W A;  3LBS A;  1XS5 A;  2F97 A;  1R1N A;  4IGT A;  4ZNC A;  2I4C A;  5I59 A;  3R6U A;  1MY4 A;  2QL3 A;  4G68 B;  2GHA A;  4ELO A;  4TOZ A;  3ZKK A;  2VOZ A;  1LLS A;  3I5O A;  1WVJ A;  1FTO A;  3MPL A;  4KYS A;  4XKN A;  5CMB A;  2XXI A;  3HN0 A;  5H8Q A;  1NNF A;  3KZG A;  1FTJ A;  3QWO C;  1B51 A;  1BLF A;  3RY3 A;  5CMK A;  4ZEK A;  3VVD A;  3KEI A;  3R7X A;  2DSF A;  3PPO A;  4ZMD A;  3TPA A;  4YKJ A;  2F6G A;  4EQ7 A;  3T93 B;  2RC7 A;  3O6I A;  3PH0 A;  1Y4T A;  2Z8D A;  1BDD A;  1OMP A;  3T9U A;  1GR2 A;  4PFY A;  4R9G A;  3T9H B;  4XXU A;  1SI1 A;  4EXK A;  2YPN A;  4PET A;  4RK9 A;  2O7U A;  5KZT A;  3K6U A;  3K1M A;  3FAT A;  5B70 A;  3MW0 A;  3PUX E;  1YAE A;  1RKM A;  2Y84 A;  3T96 B;  4WEP A;  1PEB A;  3IB1 A;  3PPN A;  3K6W A;  3DP4 A;  3ODB A;  3ZDM A;  4I9D A;  4F22 A;  1EDI A;  5I2N B;  3TUS A;  1Y47 A;  3FXD A;  2NOO A;  5B7D A;  4F29 A;  1B46 A;  2ZYK A;  3A3U A;  2XXY A;  5I56 B;  4FJP A;  4BDO A;  3A3C A;  1MY1 A;  1MQH A;  1B5H A;  2PBW A;  3KN7 A;  1FQB A;  5KDT B;  2VP1 A;  2I6E A;  3JZJ A;  2AL5 A;  3TDJ A;  2W7Y A;  3EHT A;  5A5X B;  3IR1 A;  1JMB A;  1LFG A;  3M3K A;  4GOD A;  4JWX A;  4ZEI A;  1JVX A;  4ZEB A;  3VVF A;  3THI A;  4GXS B;  3F11 A;  4IGR A;  4YIC A;  3JV9 A;  2XX7 A;  3B7D A;  2QS3 A;  3MZ1 A;  4NPD A;  1FQA A;  2Z23 A;  3PPQ A;  3MP8 A;  4WWI A;  2O1M A;  4JWY A;  1LB8 A;  4RK2 A;  4U23 A;  1IIW A;  4X1D A;  3PPP A;  1B5J A;  1B6H A;  1MQG A;  1Y20 A;  3MVZ A;  2I58 A;  4R6K A;  4RA1 A;  2I0C A;  5H8N A;  5L9M A;  2BJJ X;  3G3J A;  5I2N A;  3TQL A;  1Q1K A;  5L9O A;  4U4S A;  1N04 A;  4ESX A;  2KUB A;  1D3K A;  2PVU A;  1M5E A;  1EDJ A;  1B52 A;  3LSF B;  2HR3 A;  4RPN A;  4R73 A;  1B58 A;  4XIG Q;  3K1N A;  3SEV A;  4FEC A;  4F3S A;  2IEE A;  1JNF A;  1TXF A;  1LST A;  1II5 A;  2P2A A;  2QMW A;  1BKA A;  3VXB A;  4IO3 A;  4ZDM A;  4KD5 A;  4HTG A;  4U1O A;  4TQU Q;  1MH3 A;  3S9N C;  3HO7 A;  4QFP A;  4GRK A;  1O64 A;  1MDQ A;  4IO4 A;  1LBB A;  3TCG A;  3IOW A;  4HJG H;  3LSW A;  1B7Z A;  5DVF A;  3CRB A;  5CMM A;  3TKD A;  1B7U A;  4YB6 A;  3PGF A;  1LFH A;  2ANJ A;  4X1B A;  3LSL A;  5LOM A;  4G77 A;  4Q5T A;  1VE4 A;  4ZE9 A;  1B5I A;  2DQV A;  1R9L A;  2ZAE B;  2FNC A;  1IQ7 A;  3Q25 A;  4XKR A;  1O63 A;  4C1T A;  2V93 A;  1ZLQ A;  3AXF A;  4R74 A;  1AH5 A;  5H8Q B;  3K6X A;  1XOC A;  2NVU B;  4M1V A;  1I6A A;  5HBC A;  1ZTY A;  2ZNS A;  3KN3 A;  4NF5 A;  5KCJ B;  5JK4 A;  3OD7 A;  3H4Z A;  4POX A;  4AB6 A;  2X7Q A;  2H4I A;  4K3F A;  3C32 A;  4LQ2 A;  2RF1 A;  4NF8 B;  4RXL A;  4EUO A;  5FTH A;  3FIR A;  3PMV A;  3VV5 A;  1PB7 A;  4KQP A;  3TFL A;  1WDN A;  2KI7 B;  1QKB A;  2A5T A;  2OBG A;  1CE2 A;  2F78 A;  1N76 A;  1USY H;  2DE2 A;  3CVG A;  4DCY A;  1EDL A;  1XT8 A;  1LAH E;  1I69 A;  3Q29 A;  4X48 A;  4GOF A;  4PFU A;  3U8Q A;  3KSJ A;  5ICQ A;  4BXL A;  2Z8F A;  4DIG A;  2XXH A;  3IK6 B;  4U4X A;  4F1V A;  3K0V A;  3QSL A;  3ZKL A;  2UVJ A;  1POT A;  2F8D A;  3FVG A;  3IOR A;  5I2K A;  4GFR A;  4DDD A;  2XXQ A;  2ZYO A;  1EZ9 A;  3EHU A;  4ELR A;  4FIM A;  4F2Q A;  2H99 A;  3M3F A;  3PD9 A;  1MM7 A;  4QF9 A;  4H6D A;  1F9B A;  2E0S A;  1IEJ A;  5HPQ A;  4KHZ E;  3BFU A;  3W9W A;  3QUF A;  1OVU A;  2O68 A;  3K2D A;  4OFL A;  2UXA A;  1US5 A;  2HZK A;  1A55 A;  2KLF A;  4GWO A;  4LAT A;  4L17 A;  2WMM A;  1D4N A;  5BUU A;  1M5C A;  4K35 A;  4H65 A;  1ZKB A;  3HPI A;  1MY3 A;  1RYX A;  3RTF B;  4QHQ A;  4POW A;  1ZXG A;  4DXB A;  3VFJ A;  2GH9 A;  4O3A A;  3ILT B;  3VLV A;  3RGU A;  5TPA B;  3IO6 A;  2R71 A;  2OWT A;  1I6Q A;  3VVE A;  3H3G A;  1A7L A;  3MZW B;  4TLM B;  3PUV E;  2CMO A;  3RQT A;  3HV1 A;  3OSR A;  3KJ7 A;  1QJM A;  2OLB A;  3KBR A;  4BDR A;  3S2V A;  2UYE A;  2DXR A;  1MRP A;  1NH7 A;  2Q2A A;  2NUV A;  4EQB A;  5C39 A;  3U72 A;  3MZB A;  3VLU A;  3FXQ A;  2XXR A;  2KZI A;  3BBR A;  1AL3 A;  2UVI A;  2UWJ E;  2QPQ A;  3D4G A;  2H98 A;  1SBP A;  5TP9 B;  5IKB A;  5DEX B;  3E13 X;  1URD A;  2G93 A;  2OTK E;  1SW5 A;  2F7C A;  4I62 A;  1B3E A;  2ZYN A;  2E1S A;  3B6T A;  1Y1M A;  3G3G A;  1BTJ A;  4C0R A;  3SER A;  3FZV A;  3LSX A;  2OWS A;  2Z8E A;  4NF4 A;  2OK2 A;  5I58 B;  4FE8 A;  5I59 B;  3LR1 A;  3CFX A;  2QS1 A;  2GFE A;  5TPA A;  3T22 A;  1B2H A;  4NPF X;  1J1N A;  4KPT A;  2Q8J A;  4F31 B;  4XKP A;  3UGW A;  2HCA A;  4R6Y A;  2I0B A;  3V89 B;  5I57 A;  3OSQ A;  5J1D A;  3G3H A;  1SS1 A;  1B0H A;  1D9V A;  2M0B A;  3OOA A;  3FV2 A;  3LC8 A;  2YJP A;  5DJT B;  3RNN A;  1UTB B;  3BKI B;  1B3L A;  4ZED A;  1VFE A;  3FJ7 A;  3U94 A;  3KOT A;  2X7P A;  1SI0 A;  3VXC A;  2ONS A;  1NVO A;  2I8D A;  2WKY A;  3MUQ A;  1H44 A;  1N7W A;  3IJO B;  3MVY A;  4QFO A;  4MLV A;  4FAT A;  2XXP A;  4P0G A;  4XKQ A;  5TP9 A;  5CBS A;  1B1X A;  2HAV A;  1FTK A;  3W9V A;  1RYO A;  3D4C A;  2PMS A;  4ISU A;  3PUZ E;  4EF1 A;  3KG2 A;  4ND9 A;  1PBP A;  4MH5 A;  2V25 A;  1M5F A;  3K6V A;  3QIM A;  2NXO A;  4GOE A;  4I8C A;  4GF8 A;  3GLB A;  2UVG A;  3EF7 A;  4Q0C A;  4R9F A;  4ELP A;  3IB2 A;  4FED A;  4QSE A;  4ECF A;  2F7B A;  1XHY A;  4G8N A;  5H8F B;  5EFW B;  4H8I A;  5AA1 A;  1QUL A;  4BDL A;  3TTM A;  4P11 A;  5EHS A;  1A8E A;  2Z22 A;  1B7H A;  3OO9 A;  4NED A;  2LR2 A;  1JEU A;  3HHG A;  3U1O A;  3OEN A;  2PYY A;  1BDC A;  1GVC A;  3OEK A;  4NWD A;  2XXU A;  4OVJ A;  4UAC A;  2ZNT A;  1MXV A;  3DP6 A;  1ATG A;  4OWD A;  2D5W A;  2CZL A;  5FHN A;  1MM6 A;  1A40 A;  3S9L C;  1P1W A;  1TFA A;  3BFT A;  4BLA A;  5ELV A;  2H9B A;  3SEY A;  2DVC A;  3FJM A;  1EZO A;  1NNT A;  3RT6 B;  3CG3 A;  3CR9 A;  2XXX A;  4EYY Q;  4HS7 A;  1FQF A;  4YKK A;  1HSE A;  3KGC A;  3MP6 A;  4I1D A;  1SDX A;  3PMX A;  3HCQ A;  5IAI A;  3PMW A;  5EYF A;  4HCW A;  1NL5 A;  2RC8 A;  4NE4 A;  1SW1 A;  1MPB A;  2QS2 A;  1SW4 A;  1HSJ A;  4Z7E A;  1Y1Z A;  3B6W A;  2JWD A;  3C36 A;  4GQO A;  1EU8 A;  4OMB A;  1H0T B;  4DXC A;  4QSD A;  3MVW A;  2OCU A;  1LP1 B;  2Q1K A;  3MJN A;  3FV1 A;  1TT1 A;  1MPC A;  4OZ9 A;  3V83 A;  2KZJ A;  3S1K A;  3TTN A;  1OVT A;  3H7M A;  4N07 A;  3FAS A;  3G3K A;  2KIK A;  5DVJ A;  3V5A A;  4NMY A;  3UIF A;  3UA8 A;  4R6H A;  2FYI A;  3ZS6 A;  1MPD A;  1QKA A;  4R72 A;  3UP9 A;  1VR5 A;  2DWI A;  3TOD A;  4N6P A;  3TMG A;  3KOS A;  2D3I A;  1FTL A;  4LON B;  1YPN A;  1B4H A;  4GL8 A;  3T9V A;  3L6H A;  1Q2N A;  4H0W A;  4WXJ A;  4JB7 A;  4IY5 A;  1URS A;  2O69 A;  1X0T A;  3IL1 B;  4G68 C;  2B3B A;  1LFI A;  3TAJ A;  2PT1 A;  3LUY A;  2DYX A;  4ZEC A;  2O1L A;  2B88 A;  2XXV A;  5L8D A;  1N0T A;  2ONK E;  1P99 A;  5AA2 D;  1MS7 A;  1DPP A;  1S9T A;  1AIV A;  1B0L A;  4WKM A;  3N26 A;  3OXN A;  1PB9 A;  4MLQ A;  4GL0 A;  3I6V A;  4ASV A;  4NTL A;  2O51 A;  4P0I A;  1TWY A;  3C35 A;  2XX8 A;  4F18 A;  2A5T B;  4BDN A;  2DS9 A;  4XTC Q;  3H03 A;  2KS1 B;  5DVI A;  1JET A;  3OMB A;  1JM0 A;  3H6T A;  2M5A A;  3TQW A;  2R6G E;  2AL4 A;  1Y4C A;  1DTZ A;  2P58 A;  2DE4 A;  1LCT A;  1S50 A;  5BWJ A;  1SD3 A;  4RJZ A;  4IO7 A;  1EC5 A;  4OES A;  3TTL A;  3FXR A;  3T66 A;  3CG1 A;  3N6U A;  1DSN A;  3M8U A;  3DLN A;  4HB1 A;  5DT6 A;  5CRY A;  3CI8 A;  1URG A;  1POY 1;  1OLC A;  1LAG E;  1US4 A;  2AIX A;  1B05 A;  2REG A;  4OTE A;  1U7M A;  1NNP A;  1H3D A;  3DP8 A;  1S7Y A;  4OXV A;  2GRV A;  3RPW A;  2ZMB A;  4H5F A;  4DE8 A;  1P1Q A;  3DEL B;  2ABH A;  1LBC A;  3P7I A;  5CBN A;  4C1U A;  3H06 B;  5EHM A;  1EDK A;  3A09 A;  1JQF A;  3IB0 A;  2SPZ A;  3MQ9 A;  1Y3N A;  5JEI A;  3PUY E;  4RNS A;  2V84 A;  1OQH A;  4IOI H;  2QSX A;  3ZSF A;  3RN8 A;  2THI A;  4KJM A;  5F7V A;  5DEX A;  4RY1 A;  4NF6 A;  2UYF A;  2ZYM A;  4U1Z A;  4PFT A;  4ZE8 A;  2RKL A;  3EHS A;  1MQJ A;  1SW2 A;  2R44 A;  2UVH A;  3FUZ A;  3FXU A;  2ESN A;  3SEU A;  3T9X B;  5H8F A;  4HKZ H;  2F7A A;  3U93 A;  4AB5 A;  2Q9T A;  3S4U A;  4GLI A;  4PQJ A;  4JSO A;  3MC2 A;  3G3F A;  1PDA A;  2HZL A;  1ZJL A;  4HW8 A;  1ZBM A;  3CSB A;  3V8X B;  4KR5 A; 
#chains in the Genus database with same CATH topology
 2NPS B;  1BIY A;  4WED A;  1FZC C;  1H45 A;  3P8C E;  1QVS A;  1L4A D;  1INP A;  3CXH E;  3OEL A;  1LCF A;  1T2K D;  5L9S A;  3S9E A;  3SDF A;  1LP1 A;  1H43 A;  3QK6 A;  1NUX A;  1E5W A;  2DWH A;  3CCV P;  1MXU A;  1KIL E;  4NX1 A;  3C4M A;  3L71 D;  5EQ9 A;  4OET A;  2GA1 A;  3EFF K;  1KQG B;  4HE2 A;  1NH4 A;  2B89 A;  4QRZ A;  3KFM A;  3PPR A;  4HCY A;  4G8H A;  2FFD B;  4GWY A;  5KCJ A;  3PV0 E;  1YJN P;  4EQ9 A;  3CWB G;  3EQ1 A;  3VOP A;  3CIJ A;  1XC1 A;  2LXC B;  5KDT A;  1MY0 A;  4JWO A;  3H6W A;  1YTV A;  3RTW B;  1H8A A;  2J5U A;  2F5X A;  4H13 D;  2YLN A;  3VLW A;  1L0L G;  1NU1 K;  3GHG B;  2OJT A;  3CWB D;  1UIU A;  2NZ2 A;  4P47 A;  1AVY A;  1LTG C;  3H1J D;  3CMA P;  4THI A;  4TLL B;  5I84 A;  2A06 G;  4YKI A;  4PAF A;  3RT8 A;  4F3P A;  4QFL A;  1CSB A;  4H44 B;  1OIB A;  1MZ9 A;  2B3F A;  1EH3 A;  3N5L A;  3TZA A;  2B87 B;  3SZP A;  1ELJ A;  3S4R A;  1KYO D;  3SWF A;  4N8Y A;  3TTK A;  3HFU A;  3CX5 I;  4ASW A;  2YKO A;  2JEE A;  1IXC A;  4OHN A;  5T3J A;  3MHV A;  1IXH A;  4DXU A;  5CBR A;  5AA2 A;  3MP1 A;  4ESW A;  3IOT A;  1Q7Y Q;  4H44 D;  3USS A;  3H1K G;  3AEF C;  2X26 A;  2ZXT A;  1UQW A;  2WYK A;  3O6G A;  2H43 A;  3C9H A;  2HPC A;  3HHF A;  5AE4 A;  3UOR A;  1MXY A;  4UB6 E;  4D6T D;  4MBP A;  5DYH A;  4NF8 A;  1EZV D;  4LVQ A;  1Q82 Q;  4OER A;  2DP8 A;  4YU0 A;  4MN4 C;  3B6Q A;  1LTJ C;  1G0I A;  3VMZ A;  5KKZ B;  3CCL P;  1XVY A;  4HE1 A;  3K02 A;  4ELQ A;  3M0D A;  4IO5 A;  4F19 A;  4MJO A;  5H8H A;  4IL6 X;  4I3Y A;  4NF6 B;  3SKP A;  4KFQ A;  2I4B A;  3TGU E;  1BE3 D;  3C34 A;  1YIT P;  1N8R Q;  1N7X A;  4GX6 A;  2FFD C;  3S9M C;  2QRY A;  4M4G A;  1K8A Q;  2DWA A;  3N4X A;  1YCJ A;  3SFE C;  2JKV A;  4MF3 A;  2Q89 A;  1B3G A;  2HQ0 A;  3V4W A;  3N6T A;  1LNQ A;  1N7S C;  2FA7 A;  3H1H D;  3MPK A;  1A8F A;  3PU5 A;  4G2Z A;  3I3V A;  3H1H G;  2P3V A;  3CC2 P;  1VQ7 P;  1MG1 A;  2Y0D A;  1OMI A;  1PP9 E;  5KLI B;  1RH5 B;  3KPE A;  3HUS A;  3V2Q A;  5BVZ A;  1FBH A;  1OLA A;  1KQF B;  2NPS C;  5AVS B;  2AYS A;  1YHQ P;  2RIN A;  5ET8 A;  3CCS P;  4G4P A;  1ZIU A;  2P7J A;  2I49 A;  3H1H J;  1HSL A;  3CC4 P;  1Z7N E;  4IO6 A;  4R2F A;  1MXZ A;  4F3B A;  2Q8M A;  1LBX A;  4RPO A;  4JSD A;  5HM4 B;  5ITO A;  1IIT A;  5AVT B;  3CFZ A;  3CWB E;  1PGP A;  3GXA A;  1Y3P A;  3U1C A;  4U3F J;  1LAX A;  4OFJ A;  3SES A;  1CI6 B;  1NFT A;  1GZL A;  1UTH A;  3L70 G;  1B40 A;  1JVY A;  3C33 A;  1N2D C;  1DMB A;  2B87 A;  3AEG C;  2M5A B;  3HD7 D;  2ALU A;  1UIV A;  4U22 A;  3RYD A;  4N91 A;  3SET A;  3VMX A;  1B3F A;  3VN0 A;  1KQS O;  2HEU A;  3BVH A;  3FGS A;  4R75 A;  1G1I A;  3K1P A;  4GWX A;  2MJZ A;  3IOV A;  1QVG O;  3KSX A;  3W15 C;  1FDO A;  4OEN A;  2FIE A;  1BGY D;  4QSC A;  3IOU A;  1SYH A;  2YKP A;  3TCH A;  3FVK A;  3NXS A;  4OFO A;  1B9J A;  3L73 D;  4P1E A;  3SEW A;  1OVR A;  3U1A A;  1DBZ A;  4U7J A;  4DZ1 A;  2Y7W A;  3E7K A;  4JVD A;  3KN8 A;  4NGU A;  3RGY A;  1QX8 A;  2KXP B;  4MHF A;  2PGD A;  2A06 D;  3IN6 A;  2HAU A;  2MKZ A;  3B5N C;  3MD0 A;  3OO8 A;  1M5B A;  1G2C A;  2ZZV A;  1LBZ A;  1GW3 A;  3CSG A;  2WSC J;  3BCC D;  4PCD A;  2HFB A;  1VQK P;  1NTK G;  5K2X A;  1SP4 A;  2F34 A;  2H88 C;  1IJD B;  4NF4 B;  2FYU D;  1SQX J;  1KYO I;  4WY4 C;  4PC9 A;  5ISU A;  2ZYG A;  3FVO A;  2F3B A;  4ZZE A;  2GQ1 A;  2V7Q J;  1JB0 J;  4OVP A;  4YKP A;  2V3Q A;  3GBB A;  3UK4 A;  3TEP A;  2OYH B;  4Z0I A;  1DX7 A;  1EZV G;  1LGB C;  3KJT A;  1OVB A;  3KZI E;  1Q35 A;  4P56 A;  4U21 A;  4JBZ A;  3CCR P;  1FPE A;  2QJE A;  3CHG A;  3FD3 A;  3CL3 D;  3R26 A;  1IXI A;  1KWH A;  1QUJ A;  3H6V A;  1JW1 A;  1HUC A;  1GL2 D;  4YXD C;  2VHA A;  1VQN P;  4PP0 A;  2REJ A;  2RCA A;  5FHM A;  1A99 A;  2CK3 H;  3G3I A;  1IFN A;  1N86 A;  1OVV A;  2YMY A;  1CI6 A;  2Q2C A;  2WPR A;  3CX5 E;  1VQ4 P;  3PD8 A;  2I3W A;  4F2O A;  3FX0 A;  2I3V A;  1RF1 C;  1DPE A;  1R8E A;  2M3E A;  3FXE A;  3O29 A;  1P1O A;  1MQI A;  4PE3 A;  4KYE A;  1QW0 A;  4QFN A;  4H0L D;  4N78 E;  3B50 A;  5I58 A;  2BEZ F;  5CMC A;  1NYH A;  4MFI A;  1PPJ G;  1NV6 A;  3Q5S A;  3H6U A;  4G68 A;  1YQ4 C;  3DM0 A;  5CCG D;  1LT9 B;  2H5Y A;  4YMA A;  1B32 A;  3UIA A;  1KFM A;  1SQB D;  3V2R A;  1D9Y A;  2F6P A;  4F1U A;  4X9T A;  3TEL A;  4ZZA A;  1IFM A;  4PD4 I;  1MQD A;  2RKM A;  1ZMG A;  3V2P A;  1B1H A;  1FPB A;  4U3F D;  1GTK A;  2DVZ A;  1IFD A;  1DEE G;  3H25 A;  1Z7M E;  5AW8 B;  1IUD A;  4F3G A;  1NHL A;  1PC3 A;  5CI5 A;  1X9V A;  5H8N B;  5GTI H;  3OEM A;  2HOD B;  1N73 C;  4DZO A;  3T97 A;  3E78 A;  1QUI A;  2B65 A;  2A45 I;  2NWJ A;  4GX4 A;  5H8H B;  1KB9 E;  2GHB A;  4NF5 B;  5CCH A;  3FVN A;  3M91 A;  3BCC E;  4GDO A;  5ET5 A;  2IBZ D;  3TTR A;  2DXY A;  3AEA C;  3QUJ A;  1Y3Q A;  3G7W A;  2ONR A;  4CPG A;  4NN3 A;  1BGY J;  3O2A A;  1OQG A;  2QVU A;  1S9K D;  4DOJ A;  2FYN B;  4GD5 A;  4LQ5 A;  2PFZ A;  2G8Y A;  1WT6 A;  2OYH A;  3T97 B;  3Q27 A;  1NNK A;  3WU2 E;  4XF5 A;  5GTH H;  2D21 A;  4ZS9 A;  1IMC A;  1SFC D;  5AVQ B;  4MCO A;  4PAI A;  1VQL P;  2OZZ A;  4FAJ A;  1ZU0 A;  3EN3 A;  5ICT A;  2QIW A;  4O94 A;  4GX3 A;  4FOR A;  3MBP A;  5F24 A;  5A5X A;  2O1J A;  3MWB A;  2WWW A;  4N15 A;  1N84 A;  2VD2 A;  1YI2 P;  1N3X A;  3GZG A;  1JMM A;  2VRS A;  3ECR A;  4GWZ A;  2QJY B;  1M8O B;  4OAN A;  4P1L A;  2KP8 A;  3H32 B;  1VFD A;  2V4H A;  4QFK A;  3ILU B;  5DTB A;  5ESY A;  4PD4 E;  5H8S A;  4H5G A;  1KTM A;  1LJ2 A;  1N73 B;  2Y7R A;  1U7J A;  3JYR A;  1ZME C;  1YYC A;  2DWJ A;  5AA4 A;  4IO2 A;  3Q28 A;  3VMY A;  3FJG A;  1AVO A;  5CJ4 A;  2Y9Z A;  3Q5P A;  4DCX A;  4I6M C;  2KOG A;  1T8Z A;  4C7N B;  2DE3 A;  1SQQ D;  1FQE A;  2PT2 A;  4GXA A;  4O3B A;  4E0W A;  4YAH X;  4LUB A;  2FXO A;  1KFN A;  5IGA A;  1LB9 A;  1FTA A;  1B3H A;  1S5L H;  3Q26 A;  4R2B A;  3MTU E;  1AFO A;  2DOJ A;  4OQO A;  2V3T A;  1DD3 A;  4EIJ A;  2QE7 H;  4EDP A;  1J2J B;  1ZW0 A;  1RDY A;  5AA4 B;  5M2V A;  1QGK B;  3IF4 A;  5K5G B;  1FPJ A;  5AVW B;  1SFC A;  4PE5 B;  1JEV A;  1S3J A;  1ANF A;  3L75 J;  1FQC A;  3TYH A;  1FTM A;  5K2Y A;  1P1U A;  1AMF A;  3IO4 A;  5EYG A;  2A06 E;  1AOV A;  3MYU A;  1NTZ G;  1Y8A A;  1CB6 A;  2QS4 A;  4BDM A;  2IDB A;  2Q74 A;  1FZE A;  3PUW E;  3K4U A;  1YTZ I;  1FJP A;  2E76 C;  5I3S A;  4U2R A;  1PP9 G;  1FW0 A;  3LV0 A;  1P1N A;  3OO6 A;  2C9L Y;  4PFW A;  4DLD A;  4ZEF A;  4GIZ A;  1EXI A;  1LGH B;  1NU1 E;  4MEV A;  2CPS A;  4O9B A;  1J1D B;  1VQ9 P;  2G29 A;  2E74 D;  4NHB A;  4NWC A;  1SQX E;  1JCD A;  4G8M A;  2E75 D;  1JW4 A;  5KLV J;  2XXT A;  1HBW A;  4O7M A;  1RHZ B;  1VSO A;  3E3K A;  4YB7 A;  3L4F A;  3E9X A;  4BRY B;  1H89 A;  2Y7K A;  2W8Z A;  3ABV C;  4LN5 A;  5CCG C;  2FFD A;  1P84 H;  3D1R A;  3USD A;  3IX1 A;  4DI4 B;  5FHO A;  2XD3 A;  4IY6 A;  5I57 B;  5APX A;  2O01 N;  4E0X A;  2A5S A;  2XHD A;  3VE1 B;  4UA8 A;  5H2F H;  3K00 A;  4Q8R A;  1L0L J;  5FTI A;  3CXH D;  1QUK A;  1JP4 A;  2QMX A;  4NPE A;  2P1S A;  2VGQ A;  2QEX P;  4PFB A;  5APT A;  4I2L C;  3BIG A;  1LEV A;  4C7R A;  2Q7C A;  3WAF A;  4Y28 J;  4JDF A;  1SLQ A;  1L5T A;  3V6I A;  1A54 A;  1DD4 A;  1GTW A;  2KK7 A;  4OVT A;  3AE2 C;  3L70 J;  2KNC B;  2H25 A;  2RC9 A;  2QVA A;  4QMA A;  3E4R A;  4KI0 E;  5CCH D;  1KV4 A;  1VDF A;  2IA4 A;  4PJ0 E;  1DOT A;  4FEB A;  1P84 D;  2K9Y A;  1LT1 A;  1IC2 A;  4GBW A;  2E74 C;  1GGG A;  1UTB A;  2O84 X;  4OVS A;  1MFT A;  3N94 A;  1O7T A;  3KBZ A;  5ITP A;  3CXH H;  2LAO A;  3TCF A;  1NMU A;  4P8B A;  4I7Z C;  1IXG A;  3ONM A;  1EZP A;  1SVX B;  1WOD A;  4UAB A;  4AQ4 A;  3KC1 A;  2W6B A;  3EQ2 A;  4LZ5 A;  1S4X A;  2ZT9 B;  2K9J A;  3OO7 A;  4RYA A;  3IAZ A;  1SYI A;  1SQP G;  2XD2 A;  3M0D C;  2WPV B;  3A7O A;  3L35 A;  1MXX A;  1Y9U A;  3C31 A;  5CCG A;  4WBA A;  3EPE A;  4EF2 A;  1M1J A;  2VD3 A;  1T2K C;  2CZK A;  1IME A;  3TYY A;  2V4C A;  1QVF O;  1FJK A;  3KYQ A;  1XVX A;  3LID A;  2O6A A;  2ZFC A;  1X8Y A;  4H67 A;  4KCC A;  3H6P A;  2N1T D;  3BRV B;  2ZT9 D;  1LAF E;  1YZ0 A;  4Q30 B;  1FAV A;  3R4Y A;  4PDH A;  5JTY B;  1NU1 J;  4F39 A;  3CCJ P;  1FC2 C;  1NTM J;  4ZKP A;  5J16 A;  1PP9 J;  5TU0 A;  2R9J A;  1PB8 A;  2R32 A;  1GU5 A;  1HF9 A;  1R9Q A;  4IB2 A;  4LC1 A;  2Y7P A;  3HST A;  3L6G A;  3KQG A;  3TGU J;  3D6Z A;  1FCK A;  4F1Y A;  5IZ3 B;  2XWI A;  2QJP C;  1NOH A;  3P8M C;  3BCC G;  4B86 A;  1ZOY C;  2HOD A;  2YKQ A;  3M3L A;  4KCD A;  4ONY A;  2WT7 A;  3O97 A;  2JR8 A;  2XXK A;  4L75 A;  4GOT A;  5I2K B;  4TLF A;  1LTJ B;  2Y9Y A;  1NWQ A;  2V3U A;  2O01 H;  4D6T J;  4BDQ A;  1PGQ A;  4O3C A;  2I48 A;  3AE7 C;  1MDP 1;  2XX9 A;  2FY8 A;  2AXT E;  1VL2 A;  1PBQ A;  3HD7 A;  5IZ3 A;  3RL0 D;  1USY E;  1ZRT E;  2CEX A;  1EYJ A;  5M1B A;  1VQM P;  3E1R A;  2OAR A;  3M9B A;  3ISP A;  1URQ B;  3U92 A;  5CBO A;  3QAX A;  1BP5 A;  2R3S A;  3GLM A;  1JO5 A;  4R4L A;  3QYT A;  1T0K A;  3MUD A;  5KAF E;  4QBA A;  1DTG A;  3O28 A;  4LA9 A;  4EXL A;  3RLF E;  4I40 A;  1USD A;  4GVO A;  3RUM A;  2RCB A;  1OIP A;  1WMK A;  4N17 A;  4MMP A;  2H89 C;  4DJG A;  4YZZ A;  3O66 A;  2ZT9 C;  4R4M A;  3ITK A;  1NH8 A;  3FBP A;  2P0S A;  3MAM A;  5F1Q A;  4JXI A;  3HD7 B;  3IJX B;  4LP2 B;  5AA2 B;  1YQ3 C;  4YB5 A;  2F36 A;  2Y7I A;  1NV7 A;  2QRX A;  4N3Y B;  3LUZ A;  2C0X A;  4LZ8 A;  2LXB A;  1JW5 A;  1J1D C;  4LZ7 A;  4Z1M H;  1H76 A;  2M8C A;  4YMB A;  5CC2 A;  4OYV A;  2F35 A;  1KIL B;  1TFD A;  1SQY A;  1HTL C;  1MH4 A;  3QXM A;  3MZ9 A;  1LTT C;  2PX1 A;  3L74 G;  5CM6 A;  3VDF A;  1GD2 E;  1OW8 A;  2ZNU A;  1KN7 A;  2QVR A;  3GBA A;  1GV8 A;  3SEX A;  2K3R A;  5I5P A;  5DJU B;  3V2N A;  4UB8 H;  2XWV A;  5JTY A;  4OEV A;  1MY2 A;  3CC7 P;  3FXB A;  5E79 H;  2XNX A;  1B4Z A;  2HXW A;  1KIL A;  2JJL A;  1SQX D;  3JCU H;  2P3N A;  2Q88 A;  1M5D A;  3O6H A;  2O7I A;  4KYD A;  4YTP C;  1H0T A;  4WVZ A;  1R6Z A;  1MXW A;  1A02 J;  1IZ1 A;  4N13 A;  2ZVN B;  4H8J A;  3PJS K;  3MVX A;  4K3A A;  1GK6 A;  1RQV A;  1SFC B;  4PV1 C;  3UN6 A;  5I56 A;  1IMA A;  1FQD A;  1NKX A;  3L72 D;  1M56 D;  1HWT C;  1BE3 G;  4H1X A;  1RE3 C;  3RK3 B;  2CZI A;  3CFL A;  3O9P A;  4OEU A;  3B5N B;  1KD1 Q;  2XXW A;  3K01 A;  3WAE A;  5AA3 A;  2E75 C;  5LTC A;  1I6B A;  2WSF J;  1N3W A;  3LBS A;  1XS5 A;  2F97 A;  3JSV C;  1R1N A;  3CCE P;  4IGT A;  4ZNC A;  1CW5 A;  1H88 A;  2I4C A;  3L75 G;  5I59 A;  3R6U A;  2M3B A;  1MY4 A;  1XTG B;  4W80 A;  2QL3 A;  2OTJ P;  1SQV E;  3BIH A;  4G68 B;  1M1K Q;  2GHA A;  4ELO A;  2Q5U A;  3AE5 C;  4TOZ A;  5KJ7 D;  5CHX A;  3ZKK A;  2VOZ A;  1LLS A;  3I5O A;  5EQ7 A;  1WVJ A;  2I1K A;  1FTO A;  3MPL A;  1UIX A;  4KYS A;  2AXC A;  5AW9 B;  4XKN A;  5CMB A;  2XXI A;  1HJ0 A;  3HN0 A;  3CCU P;  5H8Q A;  2KS1 A;  1NUW A;  2NRG A;  1NNF A;  2AEJ A;  3AE6 C;  3KZG A;  2YXR B;  2P2U A;  1FTJ A;  3QWO C;  4H46 A;  2DDK A;  3RK3 C;  1B51 A;  1BLF A;  3F5H A;  3RY3 A;  2Z5I A;  5CMK A;  4ZEK A;  3KZI H;  3VVD A;  4X8R A;  3H1I D;  3KEI A;  3R7X A;  2DSF A;  3QMF A;  1GK4 A;  3PPO A;  4ZMD A;  1ZR4 A;  3TPA A;  2OX3 A;  4YKJ A;  2F6G A;  4AUW A;  1JY2 O;  5EYH A;  4GWU A;  3L70 E;  4EQ7 A;  3T93 B;  1OXZ A;  4XFJ A;  2KB7 P;  2H7H A;  3H1J J;  1RF0 A;  2R3C A;  2RC7 A;  2WSE H;  2PRR A;  3CX5 H;  3G4S P;  3PH0 A;  3O6I A;  1VPC A;  2JO1 A;  1BDD A;  4C7N A;  1OMP A;  1Y4T A;  1YYZ A;  1ZRT D;  2KQZ A;  2Z8D A;  3T9U A;  1GR2 A;  4PFY A;  4R9G A;  1QL1 A;  4XXU A;  1SI1 A;  3II6 A;  3T9H B;  3G3Z A;  4GWS A;  2KNC A;  4EXK A;  4N81 A;  3PP5 A;  2YPN A;  1JNM A;  4PET A;  4DI3 D;  1YXI A;  2HLO A;  4RK9 A;  4EI2 A;  2O7U A;  2Q9I A;  2AEF A;  1A02 F;  4JF7 A;  5KZT A;  3K6U A;  2ZVO B;  3K1M A;  1FDI A;  3FAT A;  5B70 A;  3MW0 A;  3PUX E;  3O8Z A;  1YAE A;  1DCU A;  4DT0 A;  1Q9D A;  1RKM A;  4KXP A;  1DEB A;  3EWK A;  2Y84 A;  3T96 B;  1NTK D;  2WIT A;  3HTK B;  4WEP A;  1PEB A;  1AWB A;  3VMA A;  3IB1 A;  1SQV J;  3PPN A;  3K6W A;  1RE4 A;  3RPL A;  3DP4 A;  3ODB A;  3ZDM A;  4I9D A;  4F22 A;  1SQQ K;  1EDI A;  2F3D A;  5I2N B;  1L4A A;  3TUS A;  2Q3E A;  1Y47 A;  2IFN A;  2FYN C;  5GTI E;  1EYK A;  2J59 M;  3FXD A;  1FZB A;  2NOO A;  1SQV D;  5B7D A;  2OWZ A;  1JY3 N;  3NTN A;  3L71 J;  4F29 A;  1B46 A;  2ZYK A;  3A3U A;  2XXY A;  1E79 H;  5I56 B;  4FJP A;  4BDO A;  1NO4 A;  3A3C A;  3BRT B;  1MY1 A;  5TIS E;  1URQ C;  1UTH B;  1MQH A;  1VQO P;  1B5H A;  2PBW A;  3CWB J;  3KN7 A;  2OQQ A;  3F89 A;  1FQB A;  3B8E B;  2W6A A;  5KDT B;  2VP1 A;  2I6E A;  5IZ1 A;  3JZJ A;  2AL5 A;  3TDJ A;  2W7Y A;  1NV5 A;  5B5E H;  1W2B O;  3H1H E;  1KOR A;  3WU2 H;  3EHT A;  1ZN5 A;  2IYP A;  2E75 B;  1IMD A;  5A5X B;  1FPD A;  2Z4E A;  3IR1 A;  1VQP P;  1M90 Q;  1JMB A;  5KTB A;  1LFG A;  3M3K A;  2B9B A;  3L37 A;  4GOD A;  1FPL A;  4JWX A;  2YIU B;  4ZEI A;  3C1L A;  2KSE A;  1JVX A;  3VP9 A;  2ZJS E;  4ZEB A;  3VVF A;  3THI A;  1S1C X;  2WZ7 A;  3L70 D;  1FBP A;  4GXS B;  3F11 A;  2YO2 A;  4OH8 B;  1GL2 B;  4IGR A;  3FGA D;  4YIC A;  3Q2Y A;  3CCM P;  3JV9 A;  3L73 E;  2XX7 A;  3B7D A;  2ZYA A;  3Q3D A;  1S2E A;  2QS3 A;  2E43 A;  3D70 A;  3MZ1 A;  4PD4 H;  4NPD A;  3H1L J;  4TT3 H;  1FQA A;  1GMJ A;  2Z23 A;  3GG2 A;  3PPQ A;  3MP8 A;  1K9Z A;  4NAP A;  4XEQ A;  3CI9 A;  4WWI A;  2P67 A;  1BSH A;  2O1M A;  4PDD A;  4JWY A;  1LB8 A;  4RK2 A;  4MIJ A;  4U23 A;  1L0N J;  1SQB K;  1IIW A;  4X1D A;  2FXM A;  3PPP A;  1B5J A;  1B6H A;  1MQG A;  1Y20 A;  3MVZ A;  2I58 A;  4R6K A;  4RA1 A;  2I0C A;  4OGQ C;  5AVR B;  1YIJ P;  1S5L E;  3G9R A;  3KHU A;  3G6E P;  1RF1 A;  5H8N A;  2FYU E;  1URQ A;  4I7Z B;  3E79 A;  2BJJ X;  3G3J A;  5L9M A;  5I2N A;  3TQL A;  1Q1K A;  4RO0 A;  5L9O A;  3V4Q A;  2KYV A;  4U4S A;  2B4M A;  1N04 A;  3I5C A;  3L74 J;  2K1A A;  4ESX A;  1FZG A;  2KUB A;  1D3K A;  2PVU A;  2W6J H;  3BCC J;  1M5E A;  3BAS A;  1LWU A;  3H1L E;  1EDJ A;  4HXV A;  3T1B A;  1B52 A;  3LSF B;  2N1T B;  2HR3 A;  1RDZ A;  4RPN A;  4R73 A;  1B58 A;  4XIG Q;  3K1N A;  2BEQ D;  1VF5 D;  2RMZ A;  3H1J E;  3SEV A;  4FEC A;  2WEF A;  1N7L A;  5AW5 B;  4OVQ A;  4F3S A;  2IEE A;  1JNF A;  1ZP0 C;  1TXF A;  1GL2 C;  1LST A;  1FPI A;  1II5 A;  2E42 A;  2P2A A;  2QMW A;  1WRG A;  4N78 D;  2IPP A;  3TK1 A;  3Q5R A;  4WB4 A;  1BKA A;  2JWA A;  4Y99 C;  4O7I A;  2YIU C;  3VXB A;  1L0L D;  4IO3 A;  1EQ7 A;  1EYI A;  4ZDM A;  1KA0 A;  4KD5 A;  2QJP B;  1P84 E;  1YJW P;  3IFM A;  4HTG A;  4U1O A;  3NMD A;  4TQU Q;  1MH3 A;  2XKM A;  3S9N C;  3HO7 A;  2GUS A;  4PD4 D;  4QFP A;  4GRK A;  1O64 A;  1MDQ A;  1OW7 A;  4IO4 A;  1LBB A;  3TCG A;  5IM2 A;  1KZU B;  3IOW A;  2ZZW A;  4HJG H;  3LSW A;  2QG4 A;  1JY2 P;  3L71 E;  3P32 A;  1B7Z A;  2QFL A;  4BWN A;  5AVY B;  1SVF A;  2IFM A;  2OGU A;  3CRB A;  5DVF A;  1RDX A;  5CMM A;  3B4S A;  3TKD A;  3TGU D;  1B7U A;  4YB6 A;  1QLE D;  1FPK A;  3PGF A;  3K5B A;  1LFH A;  1NKN A;  2E5T A;  2ANJ A;  5KLI C;  4X1B A;  3LSL A;  3M06 A;  5LOM A;  4G77 A;  4Q5T A;  4PJ0 H;  1VE4 A;  4H44 C;  1JOC A;  4ZE9 A;  4LLH A;  2HHM A;  1VDW A;  2HXR A;  1BSN A;  1JUN A;  1PL5 A;  1B5I A;  1KIL D;  5KAI E;  1PIX A;  5AVZ B;  1NKZ B;  1XTC C;  1R9L A;  2WTY A;  2DQV A;  2ZAE B;  2FNC A;  1IQ7 A;  4ZKU A;  1USE A;  3Q25 A;  4N6K A;  2XND H;  4XKR A;  1O63 A;  4C1T A;  2V93 A;  3VYI A;  4N6J A;  3L72 E;  2R5B A;  1ZLQ A;  3AXF A;  4R74 A;  1AH5 A;  3R2P A;  3CXH I;  5H8Q B;  3K6X A;  2LKM A;  1XOC A;  2NVU B;  1N7S A;  4M1V A;  1I6A A;  1NTM D;  2IZ1 A;  5AW2 B;  1PGJ A;  1ZTY A;  5HBC A;  2ZNS A;  2POH A;  3RL0 g;  3KN3 A;  2JP3 A;  4EDF A;  4NF5 A;  3TNU B;  1NV0 A;  5KCJ B;  1L4A C;  5JK4 A;  3OD7 A;  3H4Z A;  4POX A;  4AB6 A;  2X7Q A;  2H4I A;  1HGZ A;  3L74 E;  2CEY A;  1RE4 C;  2Y5K A;  3C32 A;  2RF1 A;  4K3F A;  4LQ2 A;  4NF8 B;  5AW6 B;  4RXL A;  4EUO A;  2QJY C;  2Y0E A;  5FTH A;  3FIR A;  3IR9 A;  4IFM A;  3PMV A;  3VV5 A;  3O6Q B;  1PB7 A;  2Q6Q A;  4KQP A;  4O8M A;  2Y0C A;  3TFL A;  1WDN A;  5APV A;  3TNU A;  2WYP A;  3S9O A;  1U57 A;  1S5L X;  4OVN F;  5BU5 A;  4PBQ A;  4W7Y A;  2KI7 B;  1QKB A;  3TSI A;  2A5T A;  2OBG A;  1CE2 A;  1KYO H;  2F78 A;  2AXT H;  1N76 A;  5APU A;  1USY H;  3H1L G;  2DE2 A;  3CVG A;  4DCY A;  3L72 G;  1SQP J;  1EDL A;  1XT8 A;  3L73 J;  4IL6 E;  3Q1M A;  1LAH E;  1I69 A;  3Q29 A;  4X48 A;  4GOF A;  1JY2 N;  4PFU A;  3U8Q A;  4KT0 J;  1L2P A;  3KSJ A;  3RL0 B;  5ICQ A;  4BXL A;  2Z8F A;  5KAF H;  1LBV A;  4DIG A;  1K9Y A;  3OA7 A;  4GIF A;  2XXH A;  1NU1 D;  2BCC D;  1UII A;  3IK6 B;  4U4X A;  1ZV8 A;  4F1V A;  3K0V A;  3QSL A;  3ZKL A;  2UVJ A;  1POT A;  2F8D A;  3KXD A;  2N9Y B;  1SQB G;  2OYI B;  5BU8 B;  1GDT A;  5TJH A;  3AED C;  3FVG A;  3MUD C;  1LTB C;  1CNQ A;  3IOR A;  5I2K A;  4JQ0 D;  4GFR A;  1K9M Q;  4DDD A;  2XXQ A;  2FKW B;  2WT7 B;  1KB9 I;  3V5B A;  4OA4 A;  3B5N D;  2ZYO A;  1EZ9 A;  1LT9 C;  3KDP B;  1GL2 A;  2KLV A;  3EHU A;  4ELR A;  1BCC G;  4FIM A;  2RN0 A;  4F2Q A;  2H99 A;  1NTM E;  3M3F A;  3PD9 A;  1MM7 A;  1D7M A;  1MFZ A;  4QF9 A;  2KSJ A;  4H6D A;  1F9B A;  1FOS F;  2E0S A;  1IO4 A;  1IEJ A;  5HPQ A;  5AVU B;  3HUS B;  4UB8 E;  4KHZ E;  1SQQ G;  3H1K E;  4GWW A;  2FIX A;  3BFU A;  3AEE C;  3QUF A;  5E79 E;  3W9W A;  4C46 A;  1OVU A;  2O68 A;  3K2D A;  2QSI A;  1PV3 A;  1AQ5 A;  3JCU E;  4OFL A;  2UXA A;  1US5 A;  2HZK A;  1A55 A;  2KLF A;  3GHG A;  4GWO A;  4LAT A;  1AQT A;  3H1I E;  5APW A;  1ZR2 A;  4L17 A;  2WMM A;  1S72 P;  2XU6 A;  1D4N A;  3WUT A;  3RK3 E;  5BUU A;  1M5C A;  4K35 A;  1L0N E;  4N4U A;  4H65 A;  1ZKB A;  3AE8 C;  3HPI A;  3H1J G;  1MY3 A;  2IBZ I;  1FPG A;  3I56 P;  1RYX A;  3EKI A;  4MAG A;  4NG7 A;  4QHQ A;  4POW A;  3RTF B;  3HUS C;  4XE5 B;  1ZXG A;  4DXB A;  3VFJ A;  2N1T A;  2GH9 A;  4O3A A;  3ILT B;  3VLV A;  5LDZ A;  3RGU A;  5TPA B;  1M1J C;  1SQB J;  2WX9 A;  1FRP A;  3IO6 A;  2R71 A;  2OWT A;  1I6Q A;  3VVE A;  4JYB A;  3CPW O;  3H3G A;  2M8R A;  1A7L A;  3MZW B;  2IBZ E;  1IK7 A;  4TLM B;  3M0A A;  4I1L A;  3PUV E;  1KA1 A;  3C9I A;  1LBW A;  2CMO A;  3RQT A;  3HV1 A;  3OSR A;  2PP6 A;  3KJ7 A;  3O6Q A;  3P7K A;  1QJM A;  4XFE A;  2OLB A;  3KBR A;  1IFJ A;  2DW3 A;  3S2V A;  4D6T G;  2UYE A;  4BDR A;  2DXR A;  2QJK C;  1MRP A;  1NH7 A;  2Q2A A;  2NUV A;  2Q3I A;  3PRJ A;  4D6T E;  2YXQ B;  4EQB A;  5C39 A;  3L71 G;  1SQP K;  3U72 A;  3MZB A;  3VLU A;  3FXQ A;  2XXR A;  2KZI A;  3BBR A;  1AL3 A;  2UVI A;  2UWJ E;  2QPQ A;  2Z5H A;  2GUV A;  2ITA A;  3D4G A;  2H98 A;  1IMF A;  1SBP A;  5B66 H;  5TP9 B;  5IKB A;  5DEX B;  2BCC J;  2E5Y A;  3PLN A;  1NAF A;  3HE5 A;  1JCC A;  2A45 G;  2K37 A;  3E13 X;  1URD A;  2G93 A;  2OTK E;  1SW5 A;  4JPZ B;  2F7C A;  3RBX A;  4I62 A;  1B3E A;  3P8C D;  2ZYN A;  1M7L A;  2E1S A;  1IFI A;  2KR0 A;  3B6T A;  1Y1M A;  3G3G A;  2IZ0 A;  3D71 A;  1BTJ A;  4C0R A;  2C9N Y;  2FBW C;  3SER A;  3FZV A;  3LSX A;  2OWS A;  1IK9 A;  2Z8E A;  4MNP A;  2XDJ A;  1G0H A;  4NF4 A;  2OK2 A;  5I58 B;  3A29 A;  3PTZ A;  1BK4 A;  1MV8 A;  1W5C E;  4FE8 A;  1NTZ D;  3W67 A;  2D2C D;  2L5V A;  1LT9 A;  3A0H H;  1MKM A;  1G2C B;  5I59 B;  1NI9 A;  2MKV A;  3LR1 A;  3CFX A;  2QS1 A;  2BCC E;  3M9H A;  2FXP A;  2GFE A;  1N7S B;  4MX6 A;  1T3U A;  5TPA A;  3GF7 A;  3T22 A;  4AS5 A;  1B2H A;  1GU4 A;  4NPF X;  1J1N A;  4KPT A;  2Q8J A;  3MGN A;  4XKP A;  4F31 B;  2QJK B;  4L74 A;  1JY3 O;  3UGW A;  2HCA A;  4R6Y A;  2I0B A;  3V89 B;  1FS0 E;  1IZN B;  1ZLL A;  1FU1 A;  5I57 A;  3H1L D;  3OSQ A;  2JJK A;  4WY4 D;  5J1D A;  1PGO A;  3AE4 C;  3GMA A;  1YTZ T;  3G3H A;  3IFC A;  1SS1 A;  4H0L B;  1B0H A;  1FZC A;  1D9V A;  2M0B A;  1NV2 A;  3I55 P;  1SFC C;  3OAK A;  3OOA A;  3FV2 A;  3RK2 B;  3LC8 A;  1Q81 Q;  1LWU C;  2YJP A;  1M1J B;  4HE0 A;  1HH0 A;  5TIS H;  5DJT B;  3RNN A;  1FPF A;  5IZZ A;  2H8P D;  1SQX K;  1UTB B;  2PCR A;  4PF6 A;  3BKI B;  3A0B E;  3MIW A;  2IX7 C;  2HPC B;  1B3L A;  5B5E E;  4G61 A;  5EQ8 A;  1PP9 D;  1KC8 Q;  3RL0 C;  4ZED A;  1L0L E;  3HTK A;  1Q90 D;  1VFE A;  3FJ7 A;  1FZF A;  4MNI A;  3U94 A;  3KOT A;  3M9Q A;  4OGQ D;  3TDK A;  1HJB A;  4JVC A;  2X7P A;  3H1K J;  1SI0 A;  3VXC A;  3D6Y A;  2ONS A;  1NVO A;  4IR8 A;  2FYU J;  2I8D A;  2WKY A;  1R5L A;  2QM7 A;  1X22 A;  3MUQ A;  1H44 A;  1N7W A;  3CCQ P;  5CCH C;  4H13 B;  3IJO B;  3MVY A;  2Y5L A;  4QFO A;  4OGQ B;  4MLV A;  3MP7 B;  1L0L K;  1LTI C;  2XWO A;  4FAT A;  5I7I A;  2IBZ G;  2L5G B;  3HE5 B;  2XXP A;  4P0G A;  2YMK A;  4XKQ A;  5TP9 A;  5CBS A;  1B1X A;  1BCC E;  4YXW H;  2HAV A;  1NTK E;  1FTK A;  5EQA A;  3PHL A;  3RPL B;  3W9V A;  2JDI H;  1RYO A;  5AW7 B;  3D4C A;  2PMS A;  4ISU A;  3PUZ E;  2OYI C;  4EF1 A;  3KG2 A;  4ND9 A;  1P84 I;  1PBP A;  4MH5 A;  3LW5 J;  2V25 A;  1RE3 A;  2XZR A;  1M5F A;  1PFI A;  3K6V A;  1BE3 J;  3QIM A;  3HE4 B;  2NXO A;  4PFI A;  4GOE A;  3TGU G;  5KJ7 C;  1URQ D;  1LWU B;  3QH9 A;  4I8C A;  1FDM A;  3RK2 C;  1NTZ J;  2N1T C;  4U3F G;  4XA4 A;  3T0J A;  4GF8 A;  3GLB A;  2UVG A;  1M57 D;  2NPS A;  3EF7 A;  3N7N A;  4Q0C A;  4R9F A;  1PPJ D;  5AW4 B;  1N73 A;  4ELP A;  3IB2 A;  1NTK K;  3CX5 D;  3GF3 A;  4FED A;  4QSE A;  1KIL C;  1QL2 A;  4ECF A;  2P1J A;  4UB6 H;  5APS A;  2F7B A;  3HE4 A;  3FWN A;  1XHY A;  4G8N A;  5CMZ A;  4PBH A;  5EFW B;  4H8I A;  5H8F B;  5AA1 A;  2OYI A;  1JTH B;  3OJA B;  2WBB A;  5ET7 A;  4PGN A;  1QUL A;  4BDL A;  3TTM A;  4P11 A;  5EHS A;  1A8E A;  2Z22 A;  1XI6 A;  1B7H A;  2QVV A;  1FSA A;  3OO9 A;  4NED A;  2LR2 A;  1JEU A;  3HHG A;  3U1O A;  3G71 P;  3OEN A;  4JVI A;  4BRY A;  2PYY A;  1BDC A;  1GVC A;  5APQ A;  3OEK A;  4NWD A;  1NTM K;  1CZQ A;  2XXU A;  3KC0 A;  3H1I J;  4OVJ A;  2E76 D;  2FBP A;  2ZNT A;  1FBM A;  2J58 A;  1MXV A;  3DP6 A;  1ATG A;  4OWD A;  4UAC A;  2BAS A;  1KZ8 A;  2D5W A;  1JEK A;  2CZL A;  5FHN A;  3L36 A;  5KLV K;  2BJI A;  1MM6 A;  2K9J B;  1VQ6 P;  1A40 A;  3S9L C;  1P1W A;  3L75 D;  1J1E B;  1FBE A;  4GT1 A;  1TFA A;  3GHG C;  4KHX A;  3BFT A;  4BLA A;  5AVV B;  5ELV A;  2CZH A;  2H9B A;  2ZZX A;  3SEY A;  2FYU G;  2FHY A;  2WQY C;  2WPS A;  1IMB A;  1FJ9 A;  2FYZ A;  2DVC A;  1BCC D;  3FJM A;  1EZO A;  1QGX A;  4N8G A;  3RK3 D;  5KKZ C;  1NNT A;  3RT6 B;  3CG3 A;  3CR9 A;  2PFX A;  3CLQ A;  4EYY Q;  2XXX A;  2IYO A;  4HS7 A;  3ROJ A;  1RY3 A;  1FQF A;  2B4L A;  1HSE A;  4YKK A;  3KGC A;  3MP6 A;  4I1D A;  1SDX A;  4X04 A;  5KLV D;  3PMX A;  2ZYD A;  2R8T A;  3HCQ A;  2O3J A;  3U65 A;  1K73 Q;  5ET6 A;  5KAI H;  2HYN A;  2RH0 A;  2NPS D;  3B5N A;  1GW4 A;  3A5T A;  5IAI A;  1PPJ E;  3SFD C;  3PMW A;  4HCW A;  1NL5 A;  5EYF A;  2RC8 A;  2WPQ A;  1G1J A;  4NE4 A;  1SW1 A;  3FWL A;  2K88 A;  1MPB A;  2QS2 A;  2W27 A;  4OWF A;  1EXJ A;  1SW4 A;  1OW6 A;  1S9K E;  1HSJ A;  4Z7E A;  1Y1Z A;  3B6W A;  4I3E A;  4U3F E;  2WBD A;  1SQP E;  3BAT A;  4HH2 A;  2JWD A;  3C36 A;  1L0N G;  4GQO A;  1EU8 A;  4OMB A;  1H0T B;  1LBY A;  4DXC A;  4QSD A;  3MVW A;  4HYT B;  2OCU A;  1LP1 B;  2Q1K A;  4IFF A;  3MJN A;  3SWY A;  3FV1 A;  2XV5 A;  1TT1 A;  2E74 B;  1SPI A;  1MPC A;  4PTK A;  4OZ9 A;  3V83 A;  2KZJ A;  3EFG A;  2WSE J;  2YO3 A;  2HG5 D;  2VPO A;  2KLU A;  4YPC A;  1R5S A;  1W2E A;  3S1K A;  2PFY A;  2E76 B;  3TTN A;  1L0N K;  1OVT A;  3H7M A;  4N07 A;  3FAS A;  3NOH A;  2PAJ A;  1BE3 E;  3G3K A;  2KIK A;  1DH3 A;  1SQX G;  2A45 H;  5DVJ A;  2OYH C;  3V5A A;  4NMY A;  4DCK A;  3UIF A;  3C8V A;  3SSU A;  3UA8 A;  1NTK J;  3E1I A;  4L76 A;  4R6H A;  3W68 A;  3LIE A;  2FYI A;  3ZS6 A;  1MPD A;  1TU3 F;  1FZC B;  5AW0 B;  1SQV G;  1QKA A;  1KYO E;  2WSS H;  4R72 A;  3UP9 A;  1Y9B A;  1DIP A;  4H0L C;  4FBP A;  1VR5 A;  2DWI A;  5KJ7 A;  3TOD A;  1K05 A;  4N6P A;  1AA0 A;  4IL6 H;  3TMG A;  1EZV I;  3SWK A;  1JY3 P;  3KOS A;  2QM8 A;  1L0N D;  4H45 A;  2D3I A;  1NV3 A;  1FTL A;  4LON B;  1NV4 A;  1PZQ A;  1FBF A;  1YPN A;  1B4H A;  4GL8 A;  2G3A A;  1EZV E;  3T9V A;  1FE6 A;  3HRN A;  3JC2 2;  5KLV E;  1LTA C;  3L6H A;  1Q2N A;  4H0W A;  4WXJ A;  4JB7 A;  1N7S D;  2N9B A;  5AW3 B;  1NUY A;  4IY5 A;  1URS A;  4WY4 A;  2O69 A;  1X0T A;  2CPB A;  3IL1 B;  4GBV A;  2V7Q H;  4G68 C;  2B3B A;  1K04 A;  4RJT A;  1LFI A;  3TAJ A;  2PT1 A;  5AW1 B;  3IFA A;  1BGY E;  3LUY A;  2DYX A;  2FVZ A;  4ZEC A;  2O1L A;  1SQP D;  2B88 A;  1LTS C;  2XXV A;  4PGP A;  4MNC A;  1HGV A;  2C0W A;  1KB9 H;  3RK2 D;  5L8D A;  1N0T A;  2ONK E;  4RKU J;  3L75 E;  1VQ8 P;  1P99 A;  2HFE D;  5AA2 D;  1MS7 A;  1DPP A;  1S9T A;  1AIV A;  2AEM A;  1B0L A;  4WKM A;  3TF5 A;  1NTZ E;  3N26 A;  3OXN A;  1PB9 A;  4MLQ A;  4GL0 A;  2GM4 A;  3NFQ A;  3B8B A;  3OW2 O;  4PV1 B;  3I6V A;  2WVR A;  3A3Y B;  1VQ5 P;  4ASV A;  4NTL A;  2O51 A;  4W7Z A;  4P0I A;  1TWY A;  5GTH E;  2D2C B;  1YJ9 P;  2R5D A;  2XX8 A;  3C35 A;  4F18 A;  1T6A A;  3U59 A;  2A5T B;  2O1K A;  3PTY A;  4BDN A;  1IFP A;  3GYY A;  2DS9 A;  4XTC Q;  3H03 A;  2XA5 A;  3B71 A;  3L74 D;  2KS1 B;  5DVI A;  1OX3 A;  1KB9 D;  1KMI Z;  1VF5 C;  2D2C C;  1JET A;  3OMB A;  4PF8 A;  5FBP A;  1JM0 A;  3GW6 A;  4JYC A;  3H6T A;  2M5A A;  2W90 A;  3TQW A;  4AS4 A;  1OZH A;  2R6G E;  2YNY A;  3VTP C;  2P10 A;  1BCC J;  2AL4 A;  1Y4C A;  1DTZ A;  2P58 A;  2DE4 A;  1LCT A;  1S50 A;  5BWJ A;  1SD3 A;  1J1E C;  1RF0 C;  4RJZ A;  1Z56 A;  4IO7 A;  5CJ0 A;  1EC5 A;  2L91 A;  4OES A;  3AE3 C;  3TTL A;  3FXR A;  1NUZ A;  3AEB C;  1NGM B;  3T66 A;  1RF1 B;  2ZXE B;  4PFR A;  3CG1 A;  3N6U A;  4P3L A;  1DSN A;  3M8U A;  3DLN A;  1AV1 A;  1OFC X;  4HB1 A;  1SQV K;  5DT6 A;  5CRY A;  3CI8 A;  3LW5 H;  1URG A;  1POY 1;  1SQQ J;  1NU1 G;  1OLC A;  3AE1 C;  1LAG E;  1NTZ K;  1OWA A;  5B66 E;  1US4 A;  2AIX A;  1FJ6 A;  2O01 J;  1B05 A;  2REG A;  4OVR A;  1RQU A;  2FYU K;  2QA4 P;  1JTH A;  1DK4 A;  1U7M A;  1NNP A;  4OTE A;  1VF5 B;  1X79 B;  3L73 G;  1H3D A;  3DP8 A;  1S7Y A;  4OXV A;  2GRV A;  1L4A B;  1LTJ A;  2BCC G;  3RPW A;  1AJY A;  2ZMB A;  4H5F A;  4DE8 A;  1P1Q A;  3DEL B;  2OTL P;  4NQ8 A;  5APY A;  2ABH A;  1NV1 A;  4IFD K;  1BGY G;  1Q86 Q;  1LBC A;  4EOT A;  3A2A A;  3P7I A;  2I1J A;  5DW8 A;  5CBN A;  4WY4 B;  4QXD A;  4A7P A;  4C1U A;  3H06 B;  5EHM A;  1EDK A;  3A09 A;  1D9Q A;  1JQF A;  4RES B;  3WMM 0;  4PV1 D;  1FBC A;  3IB0 A;  2SPZ A;  3H32 A;  3MQ9 A;  4Y99 B;  1Y3N A;  5JEI A;  3PUY E;  4RNS A;  1SQB E;  2V84 A;  3IAO A;  5A5L A;  3RBZ A;  2WSF H;  3AEC C;  3VP8 A;  1OQH A;  3A0H E;  4IOI H;  2ZXX A;  3H1K D;  4L73 A;  2QSX A;  4P9K A;  3CME P;  1HVV A;  4N6D A;  3WUV A;  3ZSF A;  1FBD A;  5KLV G;  2WSC H;  3RN8 A;  4PAK A;  1SQQ E;  3L72 J;  2THI A;  4KJM A;  5AVX B;  5F7V A;  5DEX A;  4RY1 A;  4NF6 A;  4M3L A;  2UYF A;  2ZYM A;  4U1Z A;  4PFT A;  4ZE8 A;  1KQL A;  2RKL A;  5L8R J;  3EHS A;  5H2F E;  1NTM G;  1MQJ A;  3MST A;  1MUU A;  1SW2 A;  2R44 A;  2UVH A;  3CD6 P;  3FUZ A;  2XWK A;  3FXU A;  2ESN A;  3SEU A;  3T9X B;  5H8F A;  3H1I G;  1NJI Q;  4HKZ H;  2F7A A;  2W83 C;  3U93 A;  4H13 C;  4LGD E;  3WUU A;  4AB5 A;  1T3J A;  3AE9 C;  2Q9T A;  3S4U A;  2HPG A;  4GLI A;  4PQJ A;  4JSO A;  3MC2 A;  3G3F A;  2VPN A;  3HD7 C;  1QEX A;  1YBK A;  1PDA A;  2HZL A;  1FBG A;  1ZJL A;  4AQR D;  1NAY A;  4HW8 A;  4AYC A;  3A0B H;  1FOS E;  2VT5 A;  1ZBM A;  3CSB A;  3V8X B;  1FZA A;  2OYO A;  4KR5 A;  4NF0 A;  4GKG A; 
#chains in the Genus database with same CATH homology
 1BIY A;  4WED A;  1H45 A;  1QVS A;  3OEL A;  1LCF A;  5L9S A;  3S9E A;  3SDF A;  1LP1 A;  1H43 A;  3QK6 A;  2DWH A;  1MXU A;  3C4M A;  4OET A;  4QRZ A;  2B89 A;  3KFM A;  3PPR A;  4HCY A;  4G8H A;  5KCJ A;  3PV0 E;  4EQ9 A;  3EQ1 A;  3CIJ A;  1XC1 A;  2LXC B;  5KDT A;  1MY0 A;  4JWO A;  3H6W A;  1YTV A;  3RTW B;  2F5X A;  2YLN A;  3VLW A;  2OJT A;  1UIU A;  4TLL B;  4THI A;  5I84 A;  4YKI A;  3RT8 A;  4F3P A;  4QFL A;  1OIB A;  2B3F A;  1EH3 A;  3N5L A;  3TZA A;  2B87 B;  1ELJ A;  3TTK A;  4ASW A;  1IXC A;  4OHN A;  3MHV A;  1IXH A;  4DXU A;  5CBR A;  5AA2 A;  3MP1 A;  4ESW A;  3IOT A;  2X26 A;  2ZXT A;  1UQW A;  3O6G A;  3C9H A;  3HHF A;  5AE4 A;  3UOR A;  1MXY A;  4MBP A;  5DYH A;  4NF8 A;  4LVQ A;  4OER A;  2DP8 A;  4YU0 A;  4MN4 C;  3B6Q A;  4ELQ A;  1XVY A;  3K02 A;  4IO5 A;  4F19 A;  5H8H A;  4NF6 B;  3SKP A;  4KFQ A;  2I4B A;  3C34 A;  1N7X A;  3S9M C;  2QRY A;  4M4G A;  2DWA A;  1YCJ A;  4MF3 A;  2Q89 A;  1B3G A;  2HQ0 A;  3N6T A;  2FA7 A;  3MPK A;  1A8F A;  3PU5 A;  4G2Z A;  3I3V A;  1MG1 A;  1UTH B;  1OLA A;  2AYS A;  2RIN A;  4G4P A;  1ZIU A;  2I49 A;  1HSL A;  1Z7N E;  4IO6 A;  4R2F A;  1MXZ A;  4F3B A;  4RPO A;  4JSD A;  5HM4 B;  5ITO A;  1IIT A;  3CFZ A;  3GXA A;  1Y3P A;  1LAX A;  4OFJ A;  3SES A;  1NFT A;  1UTH A;  1B40 A;  1JVY A;  3C33 A;  1DMB A;  2B87 A;  2M5A B;  2ALU A;  1UIV A;  4U22 A;  3SET A;  1B3F A;  2HEU A;  3FGS A;  4R75 A;  3K1P A;  3IOV A;  3KSX A;  3W15 C;  4OEN A;  4QSC A;  3IOU A;  1SYH A;  3TCH A;  3FVK A;  4OFO A;  1B9J A;  3SEW A;  1OVR A;  4DZ1 A;  2Y7W A;  3KN8 A;  3RGY A;  2HAU A;  3OO8 A;  1M5B A;  3CSG A;  2HFB A;  5K2X A;  2F34 A;  4NF4 B;  5ISU A;  3FVO A;  4ZZE A;  4YKP A;  2V3Q A;  3GBB A;  3UK4 A;  3TEP A;  4Z0I A;  1LGB C;  3KJT A;  1OVB A;  1Q35 A;  4U21 A;  4JBZ A;  2QJE A;  3FD3 A;  3R26 A;  1IXI A;  1KWH A;  1QUJ A;  3H6V A;  1JW1 A;  2VHA A;  4PP0 A;  2REJ A;  2RCA A;  5FHM A;  1A99 A;  3G3I A;  1OVV A;  2Q2C A;  3PD8 A;  2I3W A;  4F2O A;  2I3V A;  1DPE A;  3FXE A;  3O29 A;  1P1O A;  1MQI A;  4KYE A;  1QW0 A;  4QFN A;  5I58 A;  5CMC A;  4MFI A;  3H6U A;  4G68 A;  3DM0 A;  2H5Y A;  4YMA A;  1B32 A;  1D9Y A;  2F6P A;  4F1U A;  4X9T A;  3TEL A;  4ZZA A;  2RKM A;  1MQD A;  1ZMG A;  1B1H A;  1GTK A;  2DVZ A;  1DEE G;  1Z7M E;  1IUD A;  4F3G A;  5H8N B;  1PC3 A;  5CI5 A;  3OEM A;  1QUI A;  2B65 A;  2NWJ A;  5H8H B;  4NF5 B;  2GHB A;  3FVN A;  3TTR A;  2DXY A;  3QUJ A;  1Y3Q A;  3G7W A;  2ONR A;  4CPG A;  3O2A A;  1OQG A;  4GD5 A;  4LQ5 A;  3Q27 A;  1NNK A;  2D21 A;  4ZS9 A;  2OZZ A;  4FAJ A;  1ZU0 A;  3EN3 A;  5ICT A;  4FOR A;  3MBP A;  5A5X A;  3MWB A;  1N84 A;  2VD2 A;  1N3X A;  3GZG A;  3ECR A;  1VFD A;  4QFK A;  3ILU B;  5DTB A;  5H8S A;  4H5G A;  2Y7R A;  1U7J A;  3JYR A;  2DWJ A;  5AA4 A;  4IO2 A;  3Q28 A;  3FJG A;  4DCX A;  2DE3 A;  1FQE A;  2PT2 A;  4GXA A;  4O3B A;  4E0W A;  4YAH X;  4LUB A;  1LB9 A;  1B3H A;  3Q26 A;  4R2B A;  2DOJ A;  4OQO A;  2V3T A;  4EDP A;  1ZW0 A;  5AA4 B;  5M2V A;  5K5G B;  4PE5 B;  1JEV A;  1S3J A;  1ANF A;  1FQC A;  3TYH A;  1FTM A;  5K2Y A;  1P1U A;  1AMF A;  3IO4 A;  1AOV A;  1CB6 A;  2QS4 A;  4BDM A;  3PUW E;  3K4U A;  4U2R A;  1FW0 A;  1P1N A;  3OO6 A;  4PFW A;  4DLD A;  4ZEF A;  4GIZ A;  2G29 A;  4NWC A;  4G8M A;  1JW4 A;  2XXT A;  1VSO A;  3E3K A;  4YB7 A;  3E9X A;  2Y7K A;  3USD A;  3IX1 A;  5FHO A;  2XD3 A;  4IY6 A;  5I57 B;  4E0X A;  2XHD A;  3VE1 B;  2A5S A;  4UA8 A;  3K00 A;  4Q8R A;  5FTI A;  1QUK A;  2QMX A;  4NPE A;  2P1S A;  2VGQ A;  3WAF A;  4JDF A;  1L5T A;  1A54 A;  2H25 A;  2RC9 A;  2QVA A;  3E4R A;  4KI0 E;  2IA4 A;  4FEB A;  1DOT A;  1LT1 A;  1GGG A;  1UTB A;  2O84 X;  1MFT A;  3N94 A;  1O7T A;  5ITP A;  2LAO A;  3TCF A;  1NMU A;  1IXG A;  3ONM A;  1EZP A;  1SVX B;  1WOD A;  4AQ4 A;  4LZ5 A;  3OO7 A;  4RYA A;  3IAZ A;  1SYI A;  2XD2 A;  3C31 A;  1MXX A;  1Y9U A;  3EPE A;  4EF2 A;  2VD3 A;  1XVX A;  2O6A A;  4H67 A;  4KCC A;  1LAF E;  4Q30 B;  5JTY B;  4F39 A;  1FC2 C;  5TU0 A;  2R9J A;  1PB8 A;  1R9Q A;  4IB2 A;  2Y7P A;  3HST A;  3L6G A;  1FCK A;  4F1Y A;  3M3L A;  4KCD A;  4ONY A;  3O97 A;  4GOT A;  5I2K B;  2V3U A;  4BDQ A;  4O3C A;  2I48 A;  1MDP 1;  2XX9 A;  1PBQ A;  1USY E;  3U92 A;  5CBO A;  3QAX A;  1BP5 A;  3QYT A;  1T0K A;  1DTG A;  3O28 A;  4LA9 A;  4EXL A;  3RLF E;  4GVO A;  3RUM A;  2RCB A;  4YZZ A;  3O66 A;  1NH8 A;  3MAM A;  2P0S A;  5F1Q A;  4JXI A;  3IJX B;  4LP2 B;  5AA2 B;  4YB5 A;  2F36 A;  2Y7I A;  2QRX A;  4LZ8 A;  2LXB A;  1JW5 A;  4LZ7 A;  1H76 A;  2M8C A;  4YMB A;  5CC2 A;  4OYV A;  2F35 A;  1TFD A;  1SQY A;  3QXM A;  1MH4 A;  3MZ9 A;  2PX1 A;  5CM6 A;  3VDF A;  2ZNU A;  1GV8 A;  3GBA A;  3SEX A;  2K3R A;  5DJU B;  5JTY A;  4OEV A;  1MY2 A;  1B4Z A;  2HXW A;  2Q88 A;  1M5D A;  3O6H A;  2O7I A;  4KYD A;  1R6Z A;  1H0T A;  1MXW A;  1IZ1 A;  4N13 A;  4H8J A;  3MVX A;  4K3A A;  3UN6 A;  5I56 A;  1FQD A;  1NKX A;  4H1X A;  3CFL A;  3O9P A;  4OEU A;  3K01 A;  2XXW A;  3WAE A;  5AA3 A;  1I6B A;  1N3W A;  3LBS A;  1XS5 A;  2F97 A;  1R1N A;  4IGT A;  4ZNC A;  2I4C A;  5I59 A;  3R6U A;  1MY4 A;  2QL3 A;  4G68 B;  2GHA A;  4ELO A;  4TOZ A;  3ZKK A;  2VOZ A;  1LLS A;  3I5O A;  1WVJ A;  1FTO A;  3MPL A;  4KYS A;  4XKN A;  5CMB A;  2XXI A;  3HN0 A;  5H8Q A;  1NNF A;  3KZG A;  1FTJ A;  3QWO C;  1B51 A;  1BLF A;  3RY3 A;  5CMK A;  4ZEK A;  3VVD A;  3KEI A;  3R7X A;  2DSF A;  3PPO A;  4ZMD A;  3TPA A;  4YKJ A;  2F6G A;  4EQ7 A;  3T93 B;  2RC7 A;  3O6I A;  3PH0 A;  1Y4T A;  2Z8D A;  1BDD A;  1OMP A;  3T9U A;  1GR2 A;  4PFY A;  4R9G A;  3T9H B;  4XXU A;  1SI1 A;  4EXK A;  2YPN A;  4PET A;  4RK9 A;  2O7U A;  5KZT A;  3K6U A;  3K1M A;  3FAT A;  5B70 A;  3MW0 A;  3PUX E;  1YAE A;  1RKM A;  2Y84 A;  3T96 B;  4WEP A;  1PEB A;  3IB1 A;  3PPN A;  3K6W A;  3DP4 A;  3ODB A;  3ZDM A;  4I9D A;  4F22 A;  1EDI A;  5I2N B;  3TUS A;  1Y47 A;  3FXD A;  2NOO A;  5B7D A;  4F29 A;  1B46 A;  2ZYK A;  3A3U A;  2XXY A;  5I56 B;  4FJP A;  4BDO A;  3A3C A;  1MY1 A;  1MQH A;  1B5H A;  2PBW A;  3KN7 A;  1FQB A;  5KDT B;  2VP1 A;  2I6E A;  3JZJ A;  2AL5 A;  3TDJ A;  2W7Y A;  3EHT A;  5A5X B;  3IR1 A;  1JMB A;  1LFG A;  3M3K A;  4GOD A;  4JWX A;  4ZEI A;  1JVX A;  4ZEB A;  3VVF A;  3THI A;  4GXS B;  3F11 A;  4IGR A;  4YIC A;  3JV9 A;  2XX7 A;  3B7D A;  2QS3 A;  3MZ1 A;  4NPD A;  1FQA A;  2Z23 A;  3PPQ A;  3MP8 A;  4WWI A;  2O1M A;  4JWY A;  1LB8 A;  4RK2 A;  4U23 A;  1IIW A;  4X1D A;  3PPP A;  1B5J A;  1B6H A;  1MQG A;  1Y20 A;  3MVZ A;  2I58 A;  4R6K A;  4RA1 A;  2I0C A;  5H8N A;  5L9M A;  2BJJ X;  3G3J A;  5I2N A;  3TQL A;  1Q1K A;  5L9O A;  4U4S A;  1N04 A;  4ESX A;  2KUB A;  1D3K A;  2PVU A;  1M5E A;  1EDJ A;  1B52 A;  3LSF B;  2HR3 A;  4RPN A;  4R73 A;  1B58 A;  4XIG Q;  3K1N A;  3SEV A;  4FEC A;  4F3S A;  2IEE A;  1JNF A;  1TXF A;  1LST A;  1II5 A;  2P2A A;  2QMW A;  1BKA A;  3VXB A;  4IO3 A;  4ZDM A;  4KD5 A;  4HTG A;  4U1O A;  4TQU Q;  1MH3 A;  3S9N C;  3HO7 A;  4QFP A;  4GRK A;  1O64 A;  1MDQ A;  4IO4 A;  1LBB A;  3TCG A;  3IOW A;  4HJG H;  3LSW A;  1B7Z A;  5DVF A;  3CRB A;  5CMM A;  3TKD A;  1B7U A;  4YB6 A;  3PGF A;  1LFH A;  2ANJ A;  4X1B A;  3LSL A;  5LOM A;  4G77 A;  4Q5T A;  1VE4 A;  4ZE9 A;  1B5I A;  2DQV A;  1R9L A;  2ZAE B;  2FNC A;  1IQ7 A;  3Q25 A;  4XKR A;  1O63 A;  4C1T A;  2V93 A;  1ZLQ A;  3AXF A;  4R74 A;  1AH5 A;  5H8Q B;  3K6X A;  1XOC A;  2NVU B;  4M1V A;  1I6A A;  5HBC A;  1ZTY A;  2ZNS A;  3KN3 A;  4NF5 A;  5KCJ B;  5JK4 A;  3OD7 A;  3H4Z A;  4POX A;  4AB6 A;  2X7Q A;  2H4I A;  4K3F A;  3C32 A;  4LQ2 A;  2RF1 A;  4NF8 B;  4RXL A;  4EUO A;  5FTH A;  3FIR A;  3PMV A;  3VV5 A;  1PB7 A;  4KQP A;  3TFL A;  1WDN A;  2KI7 B;  1QKB A;  2A5T A;  2OBG A;  1CE2 A;  2F78 A;  1N76 A;  1USY H;  2DE2 A;  3CVG A;  4DCY A;  1EDL A;  1XT8 A;  1LAH E;  1I69 A;  3Q29 A;  4X48 A;  4GOF A;  4PFU A;  3U8Q A;  3KSJ A;  5ICQ A;  4BXL A;  2Z8F A;  4DIG A;  2XXH A;  3IK6 B;  4U4X A;  4F1V A;  3K0V A;  3QSL A;  3ZKL A;  2UVJ A;  1POT A;  2F8D A;  3FVG A;  3IOR A;  5I2K A;  4GFR A;  4DDD A;  2XXQ A;  2ZYO A;  1EZ9 A;  3EHU A;  4ELR A;  4FIM A;  4F2Q A;  2H99 A;  3M3F A;  3PD9 A;  1MM7 A;  4QF9 A;  4H6D A;  1F9B A;  2E0S A;  1IEJ A;  5HPQ A;  4KHZ E;  3BFU A;  3W9W A;  3QUF A;  1OVU A;  2O68 A;  3K2D A;  4OFL A;  2UXA A;  1US5 A;  2HZK A;  1A55 A;  2KLF A;  4GWO A;  4LAT A;  4L17 A;  2WMM A;  1D4N A;  5BUU A;  1M5C A;  4K35 A;  4H65 A;  1ZKB A;  3HPI A;  1MY3 A;  1RYX A;  3RTF B;  4QHQ A;  4POW A;  1ZXG A;  4DXB A;  3VFJ A;  2GH9 A;  4O3A A;  3ILT B;  3VLV A;  3RGU A;  5TPA B;  3IO6 A;  2R71 A;  2OWT A;  1I6Q A;  3VVE A;  3H3G A;  1A7L A;  3MZW B;  4TLM B;  3PUV E;  2CMO A;  3RQT A;  3HV1 A;  3OSR A;  3KJ7 A;  1QJM A;  2OLB A;  3KBR A;  4BDR A;  3S2V A;  2UYE A;  2DXR A;  1MRP A;  1NH7 A;  2Q2A A;  2NUV A;  4EQB A;  5C39 A;  3U72 A;  3MZB A;  3VLU A;  3FXQ A;  2XXR A;  2KZI A;  3BBR A;  1AL3 A;  2UVI A;  2UWJ E;  2QPQ A;  3D4G A;  2H98 A;  1SBP A;  5TP9 B;  5IKB A;  5DEX B;  3E13 X;  1URD A;  2G93 A;  2OTK E;  1SW5 A;  2F7C A;  4I62 A;  1B3E A;  2ZYN A;  2E1S A;  3B6T A;  1Y1M A;  3G3G A;  1BTJ A;  4C0R A;  3SER A;  3FZV A;  3LSX A;  2OWS A;  2Z8E A;  4NF4 A;  2OK2 A;  5I58 B;  4FE8 A;  5I59 B;  3LR1 A;  3CFX A;  2QS1 A;  2GFE A;  5TPA A;  3T22 A;  1B2H A;  4NPF X;  1J1N A;  4KPT A;  2Q8J A;  4F31 B;  4XKP A;  3UGW A;  2HCA A;  4R6Y A;  2I0B A;  3V89 B;  5I57 A;  3OSQ A;  5J1D A;  3G3H A;  1SS1 A;  1B0H A;  1D9V A;  2M0B A;  3OOA A;  3FV2 A;  3LC8 A;  2YJP A;  5DJT B;  3RNN A;  1UTB B;  3BKI B;  1B3L A;  4ZED A;  1VFE A;  3FJ7 A;  3U94 A;  3KOT A;  2X7P A;  1SI0 A;  3VXC A;  2ONS A;  1NVO A;  2I8D A;  2WKY A;  3MUQ A;  1H44 A;  1N7W A;  3IJO B;  3MVY A;  4QFO A;  4MLV A;  4FAT A;  2XXP A;  4P0G A;  4XKQ A;  5TP9 A;  5CBS A;  1B1X A;  2HAV A;  1FTK A;  3W9V A;  1RYO A;  3D4C A;  2PMS A;  4ISU A;  3PUZ E;  4EF1 A;  3KG2 A;  4ND9 A;  1PBP A;  4MH5 A;  2V25 A;  1M5F A;  3K6V A;  3QIM A;  2NXO A;  4GOE A;  4I8C A;  4GF8 A;  3GLB A;  2UVG A;  3EF7 A;  4Q0C A;  4R9F A;  4ELP A;  3IB2 A;  4FED A;  4QSE A;  4ECF A;  2F7B A;  1XHY A;  4G8N A;  5H8F B;  5EFW B;  4H8I A;  5AA1 A;  1QUL A;  4BDL A;  3TTM A;  4P11 A;  5EHS A;  1A8E A;  2Z22 A;  1B7H A;  3OO9 A;  4NED A;  2LR2 A;  1JEU A;  3HHG A;  3U1O A;  3OEN A;  2PYY A;  1BDC A;  1GVC A;  3OEK A;  4NWD A;  2XXU A;  4OVJ A;  4UAC A;  2ZNT A;  1MXV A;  3DP6 A;  1ATG A;  4OWD A;  2D5W A;  2CZL A;  5FHN A;  1MM6 A;  1A40 A;  3S9L C;  1P1W A;  1TFA A;  3BFT A;  4BLA A;  5ELV A;  2H9B A;  3SEY A;  2DVC A;  3FJM A;  1EZO A;  1NNT A;  3RT6 B;  3CG3 A;  3CR9 A;  2XXX A;  4EYY Q;  4HS7 A;  1FQF A;  4YKK A;  1HSE A;  3KGC A;  3MP6 A;  4I1D A;  1SDX A;  3PMX A;  3HCQ A;  5IAI A;  3PMW A;  5EYF A;  4HCW A;  1NL5 A;  2RC8 A;  4NE4 A;  1SW1 A;  1MPB A;  2QS2 A;  1SW4 A;  1HSJ A;  4Z7E A;  1Y1Z A;  3B6W A;  2JWD A;  3C36 A;  4GQO A;  1EU8 A;  4OMB A;  1H0T B;  4DXC A;  4QSD A;  3MVW A;  2OCU A;  1LP1 B;  2Q1K A;  3MJN A;  3FV1 A;  1TT1 A;  1MPC A;  4OZ9 A;  3V83 A;  2KZJ A;  3S1K A;  3TTN A;  1OVT A;  3H7M A;  4N07 A;  3FAS A;  3G3K A;  2KIK A;  5DVJ A;  3V5A A;  4NMY A;  3UIF A;  3UA8 A;  4R6H A;  2FYI A;  3ZS6 A;  1MPD A;  1QKA A;  4R72 A;  3UP9 A;  1VR5 A;  2DWI A;  3TOD A;  4N6P A;  3TMG A;  3KOS A;  2D3I A;  1FTL A;  4LON B;  1YPN A;  1B4H A;  4GL8 A;  3T9V A;  3L6H A;  1Q2N A;  4H0W A;  4WXJ A;  4JB7 A;  4IY5 A;  1URS A;  2O69 A;  1X0T A;  3IL1 B;  4G68 C;  2B3B A;  1LFI A;  3TAJ A;  2PT1 A;  3LUY A;  2DYX A;  4ZEC A;  2O1L A;  2B88 A;  2XXV A;  5L8D A;  1N0T A;  2ONK E;  1P99 A;  5AA2 D;  1MS7 A;  1DPP A;  1S9T A;  1AIV A;  1B0L A;  4WKM A;  3N26 A;  3OXN A;  1PB9 A;  4MLQ A;  4GL0 A;  3I6V A;  4ASV A;  4NTL A;  2O51 A;  4P0I A;  1TWY A;  3C35 A;  2XX8 A;  4F18 A;  2A5T B;  4BDN A;  2DS9 A;  4XTC Q;  3H03 A;  2KS1 B;  5DVI A;  1JET A;  3OMB A;  1JM0 A;  3H6T A;  2M5A A;  3TQW A;  2R6G E;  2AL4 A;  1Y4C A;  1DTZ A;  2P58 A;  2DE4 A;  1LCT A;  1S50 A;  5BWJ A;  1SD3 A;  4RJZ A;  4IO7 A;  1EC5 A;  4OES A;  3TTL A;  3FXR A;  3T66 A;  3CG1 A;  3N6U A;  1DSN A;  3M8U A;  3DLN A;  4HB1 A;  5DT6 A;  5CRY A;  3CI8 A;  1URG A;  1POY 1;  1OLC A;  1LAG E;  1US4 A;  2AIX A;  1B05 A;  2REG A;  4OTE A;  1U7M A;  1NNP A;  1H3D A;  3DP8 A;  1S7Y A;  4OXV A;  2GRV A;  3RPW A;  2ZMB A;  4H5F A;  4DE8 A;  1P1Q A;  3DEL B;  2ABH A;  1LBC A;  3P7I A;  5CBN A;  4C1U A;  3H06 B;  5EHM A;  1EDK A;  3A09 A;  1JQF A;  3IB0 A;  2SPZ A;  3MQ9 A;  1Y3N A;  5JEI A;  3PUY E;  4RNS A;  2V84 A;  1OQH A;  4IOI H;  2QSX A;  3ZSF A;  3RN8 A;  2THI A;  4KJM A;  5F7V A;  5DEX A;  4RY1 A;  4NF6 A;  2UYF A;  2ZYM A;  4U1Z A;  4PFT A;  4ZE8 A;  2RKL A;  3EHS A;  1MQJ A;  1SW2 A;  2R44 A;  2UVH A;  3FUZ A;  3FXU A;  2ESN A;  3SEU A;  3T9X B;  5H8F A;  4HKZ H;  2F7A A;  3U93 A;  4AB5 A;  2Q9T A;  3S4U A;  4GLI A;  4PQJ A;  4JSO A;  3MC2 A;  3G3F A;  1PDA A;  2HZL A;  1ZJL A;  4HW8 A;  1ZBM A;  3CSB A;  3V8X B;  4KR5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...