4JBZA

Structure of mcm10 coiled-coil region
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
401
structure length
401
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMGVCQEKSKDELEDELRKMQAQMKKLQEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Replication
molecule keywords MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH XENOPUS LAEVI
publication title Mcm10 self-association is mediated by an N-terminal coiled-coil domain.
pubmed doi rcsb
source organism Escherichia coli
total genus 131
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4jbzA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA01
2F7BA 4LZ7A 5A5XA 1QKAA 3SDFA 3O6GA 3E3KA 1H0TB 1H45A 4ZS9A 3PU5A 4NPEA 3TELA 5H8NB 1BKAA 2FA7A 1QKBA 4F3SA 2QS4A 4DZ1A 4IOIH 3KBRA 4DE8A 3P7IA 5K2YA 1LAXA 2RF1A 2RCBA 4G68C 4RNSA 2P58A 4RY1A 2Y84A 3CG1A 4AQ4A 1JW5A 4ONYA 5EFWB 3MHVA 4GF8A 4NF8B 1FTMA 1POY1 2B65A 2RKMA 3PUWE 1FQCA 3IO4A 1LFIA 3M3KA 2I4CA 1SBPA 5CMCA 1D9VA 4XKRA 4U4SA 3T66A 2VOZA 4U4XA 1XC1A 3LC8A 4WEPA 2V3QA 2HEUA 3KOSA 4YKJA 4F2QA 1ZBMA 1ZMGA 1Y3QA 4Z0IA 3ILUB 1B6HA 4N13A 3FGSA 3HV1A 3ONMA 4PFUA 1LB8A 4KI0E 4JB7A 3EPEA 3FVNA 1BP5A 4H67A 2O1LA 3G3HA 4UA8A 1SW4A 4QF9A 4YB6A 1B0LA 1JMBA 1SQYA 1VFEA 1QUJA 3CSBA 2ONRA 2ZYMA 2I58A 2XXWA 2KLFA 4R6HA 2XXVA 3CFXA 5TPAA 3MVWA 5DEXB 4HCYA 3WAFA 2NXOA 1X0TA 1Y20A 2HAUA 2DP8A 1AIVA 4XKQA 3KSXA 3UK4A 3H3GA 2QSXA 1GR2A 3LSWA 4M1VA 3N6UA 3FIRA 3U94A 4M4GA 3PV0E 3TTRA 2VD3A 4OMBA 2HQ0A 1JQFA 2XXYA 2XXRA 3S9EA 4QFNA 4GQOA 3E4RA 1DEEG 1Y9UA 3Q29A 3C31A 3CSGA 2E1SA 2V3UA 2O51A 3FJGA 5H8QB 5L9SA 3QXMA 3H4ZA 4JDFA 2O68A 2ZYOA 3DP4A 3JV9A 4NE4A 2QRXA 2QMXA 3BFTA 2ONKE 2P1SA 3MZ9A 1OVTA 3PPPA 1Y47A 1U7JA 3MQ9A 2YJPA 2I0BA 2PX1A 3CI8A 3N5LA 2IA4A 4C0RA 2YLNA 3V89B 4U23A 4PETA 4QSEA 2GH9A 1P1UA 4QFLA 4LVQA 5CC2A 1MXYA 3MVZA 2V84A 1SD3A 1JW1A 3TFLA 3OO6A 2UVGA 3FUZA 3O66A 3IB0A 3IB1A 2UWJE 4QFOA 3IB2A 4H5FA 5DTBA 5J1DA 2OLBA 3LSXA 1H0TA 2UYEA 3HN0A 3T9UA 1N0TA 1ZJLA 4PFWA 3S9LC 5H8NA 3PPQA 3OSRA 1N04A 2GHBA 1WVJA 4MBPA 3EN3A 4YB5A 1FQBA 1FCKA 2XXTA 4ZMDA 2PBWA 2XX8A 2PYYA 4G68B 3PPNA 1XS5A 4RK2A 4I9DA 2DOJA 1TFAA 3W9VA 3TTMA 1Y4TA 4U21A 3KN8A 4NWDA 3PUXE 1B5HA 4U22A 3MPKA 1B40A 1EZ9A 2M8CA 1Y3NA 1HSEA 2DWIA 2O7UA 1OQGA 4GVOA 2LR2A 2H98A 5JK4A 1P1OA 3TAJA 2ZNSA 5I2KB 1AOVA 4F18A 3OO9A 3RY3A 1KWHA 4ND9A 2D21A 1T0KA 4ELQA 3EHSA 4DDDA 2REGA 3RNNA 4F39A 3K1MA 3ODBA 3DP6A 4HKZH 3K01A 3D4GA 5JTYB 1MY3A 2Z8EA 5DT6A 4OHNA 4KHZE 1OVRA 5HM4B 1ZKBA 3K6XA 3N26A 1IUDA 1B51A 2GHAA 2G29A 1H43A 1JVXA 5H8SA 4GFRA 1Q2NA 3PGFA 3U8QA 4TLLB 4TLMB 3QAXA 3L6GA 1A40A 2DYXA 4RJZA 4RK9A 3T9HB 4H8IA 3TMGA 3TCGA 5I56A 1USYE 1B5IA 3LR1A 4DXBA 1RYXA 3U72A 3MWBA 3S9NC 5DYHA 2V93A 3PD9A 3MZ1A 4EQ7A 1FTJA 2I4BA 4R73A 3LUYA 5DEXA 4WXJA 5KDTB 3UA8A 2Q8JA 4YKPA 4EF2A 4ZZAA 4E0WA 1SVXB 2XHDA 1MH3A 1FQAA 2PT1A 3T96B 3EF7A 2QS3A 1B1HA 2I48A 1IEJA 1UIVA 3VVDA 2YPNA 1JEVA 1B58A 1MQJA 1SYIA 4R2FA 3T9XB 1JNFA 3V83A 1NNFA 2ESNA 4IGRA 3IOUA 2ABHA 1OIBA 4JXIA 2RCAA 3O2AA 5H8QA 3U93A 4R72A 1LP1B 3TTNA 4YKKA 1IIWA 2I8DA 1B0HA 5CBRA 3UGWA 1B3FA 4X1DA 1Y4CA 3OSQA 3TQLA 3TPAA 3TEPA 2DQVA 3IORA 2NWJA 1MXWA 3VVEA 1URGA 1MG1A 2Q2AA 1B05A 4KFQA 5DVIA 4KR5A 2OTKE 3IR1A 2OJTA 5TU0A 4EUOA 2G93A 3H6VA 4GRKA 1B52A 1PB8A 4WWIA 3RTWB 4NF4B 4H65A 2QMWA 2REJA 4YZZA 3PMWA 3UP9A 3KG2A 2QL3A 4I8CA 1UTHB 1B32A 4IY5A 4HJGH 4IGTA 3G3FA 4OESA 1I6QA 2AYSA 4ESXA 3OENA 2ZNUA 4Q5TA 2SPZA 2RC8A 4XKNA 2KS1B 4LONB 4GD5A 3S1KA 3C32A 4QFPA 1ATGA 2H4IA 3H6WA 1LFGA 1TWYA 1M5BA 2HR3A 3VLWA 2O69A 2E0SA 3ZDMA 4ZZEA 3CG3A 1M5FA 3ZSFA 1EC5A 4ZE9A 4G68A 4OENA 4EQBA 4BDQA 3OMBA 4FECA 3OD7A 4FORA 1MS7A 3KZGA 5L9OA 3I6VA 3BKIB 1P1WA 2XXHA 1FW0A 4NEDA 2NOOA 2I0CA 3CR9A 1H44A 5LOMA 1M5DA 1D9YA 1MY1A 1LCTA 5ICQA 3PPRA 2DXRA 4MFIA 3R26A 1BLFA 4YMBA 3OO7A 3SEVA 2DWHA 3PPOA 1MM6A 2CMOA 4N6PA 1A7LA 2XD2A 3MP8A 1YTVA 3VXBA 1B3EA 5JTYA 2Y7RA 4KPTA 2OWSA 4NPDA 3VXCA 2F78A 4OXVA 2HZKA 2PT2A 2LAOA 1L5TA 1OVVA 2CZLA 1UIUA 3LSLA 4IO7A 4P11A 1DTGA 3TODA 1AH5A 1MFTA 3RQTA 1BDDA 5L9MA 5C39A 1XVXA 2JWDA 2OBGA 2VGQA 3GBBA 2F35A 3V8XB 5KCJB 3HHGA 3KSJA 4EF1A 1MY2A 3DELB 4NPFX 2AIXA 4XKPA 1UTBA 2I6EA 1NVOA 4GL8A 3KFMA 2AL5A 5DVFA 3M3FA 4WKMA 5B7DA 1XVYA 1R9QA 4OWDA 2P0SA 3SESA 1B5JA 4RPOA 3GBAA 4THIA 3G3KA 5KDTA 1MXZA 5AE4A 3MZBA 4RXLA 4KJMA 4F29A 4DXCA 3OXNA 3BBRA 4P0GA 5CMMA 1O63A 3M3LA 3HPIA 3QUJA 1QUKA 4OEVA 4F22A 4NF5A 3F11A 1JEUA 1VE4A 3RTFB 1LAFE 2VP1A 3K2DA 5HPQA 1OVUA 4ELPA 3EQ1A 4NMYA 3H6UA 2H99A 1I69A 3FXQA 4X1BA 1D3KA 4R9GA 3RLFE 1TT1A 1SI1A 2XXXA 3EHTA 2Y7WA 1B3GA 3W9WA 5BWJA 1MPDA 1LBCA 1LP1A 4O3AA 4PFYA 3RGYA 3QK6A 3MP6A 5TP9B 2XXIA 4Q30B 2B3FA 4F1YA 5KZTA 3IK6B 1PBPA 3E13X 3CFLA 5H8FB 1MQGA 2IEEA 2ZYNA 3TYHA 4MLVA 3TZAA 3K0VA 3FXDA 2RINA 5L8DA 3G3JA 4YICA 3MZWB 3QUFA 5CM6A 1QJMA 1JETA 4ESWA 1XHYA 2D5WA 2XD3A 3TQWA 1SW2A 4TOZA 4GOTA 4JWXA 3GZGA 2XX7A 3UORA 5I59B 1B3HA 3B6WA 3C9HA 3K6WA 1VSOA 2PMSA 1UTHA 3PUZE 3UN6A 1GVCA 3IAZA 2XX9A 1DMBA 4F3PA 2F6GA 5FHOA 1P99A 5M2VA 5DJTB 5I2NB 4BDLA 5FTIA 4LQ2A 4IO6A 4ASWA 2Y7KA 3DP8A 4PP0A 2QJEA 4KQPA 2M5AB 4LZ8A 4ZEIA 1FTLA 3KEIA 2QS2A 3TUSA 4YB7A 1R9LA 1HSJA 4XIGQ 3I5OA 4HB1A 3S4UA 4OERA 3EHUA 1JM0A 3C33A 3FJ7A 2QPQA 3OOAA 3QSLA 1IITA 4IB2A 3U1OA 3MBPA 4QFKA 1GGGA 4DLDA 5F7VA 3LSFB 3B7DA 3VLVA 1HSLA 3R7XA 5CBNA 5I84A 3A3CA 4H0WA 1LBBA 1Y1MA 1N3XA 4NF8A 3G3GA 1FC2C 4NF6B 4X48A 1MY4A 2O84X 1H3DA 4KYDA 4G2ZA 3H6TA 4BLAA 3THIA 4ZEBA 1AL3A 1PBQA 3GXAA 3Q25A 1N76A 4DXUA 3ZKKA 3FXUA 5ITPA 1XOCA 1PC3A 4ZNCA 3IOWA 1IXIA 2I3WA 1U7MA 4R74A 4C1UA 3K02A 1SDXA 5K2XA 3G3IA 5BUUA 1S9TA 3ZS6A 4RPNA 1B1XA 4EDPA 3A09A 4OEUA 4GLIA 1MPCA 1Z7NE 3H7MA 2A5TB 2X7PA 3PUYE 4ZEFA 3C34A 4GXAA 1NFTA 3CRBA 5KCJA 3O29A 3PD8A 1IXHA 1B4HA 3FVOA 2X7QA 2V3TA 4KYSA 4UACA 3MVXA 1FTKA 2X26A 3IJXB 1BTJA 4H8JA 3TTKA 4HTGA 1NNTA 4LATA 4OFJA 4JWYA 4F3BA 3UIFA 2R6GE 3FZVA 3JZJA 2HXWA 5K5GB 2I3VA 1O7TA 4POXA 3O97A 3R6UA 1AMFA 2I49A 2ANJA 1UQWA 3SETA 2HAVA 2O7IA 5ELVA 4RYAA 4G77A 4ZEKA 2KUBA 1N7WA 2ALUA 3Q26A 4F1VA 1N7XA 3VLUA 4EXKA 1IQ7A 2W7YA 1B7HA 1FQDA 5AA4B 2O6AA 4ELRA 2RC9A 5TP9A 1VR5A 4E0XA 5F1QA 1YPNA 1ZLQA 5EYFA 2O1MA 3CVGA 1Z7ME 5EHMA 3KJTA 3C35A 1LB9A 1A55A 2DSFA 3K6UA 3W15C 1QVSA 3MJNA 3Q28A 1IZ1A 4HW8A 1ZTYA 3FASA 4H5GA 4OYVA 4FEDA 1NNKA 2UVJA 3ZKLA 1NL5A 4NTLA 3MW0A 1NMUA 1N84A 1OLAA 3FXEA 4YKIA 2Q2CA 1MQIA 2XXPA 2OK2A 4ISUA 5FTHA 4BDMA 1S50A 4MF3A 2KI7B 1VFDA 5I2NA 1CE2A 1JW4A 4QRZA 1MQDA 2F6PA 3BFUA 4HS7A 5I57B 2FYIA 3IJOB 3SEYA 2Q88A 1B3LA 1YCJA 4POWA 4LZ5A 3T9VA 4R6KA 5CMBA 3O6HA 1F9BA 2KZIA 4P0IA 2Y7IA 2ZNTA 2Q1KA 3IL1B 4FATA 4R75A 5I58B 2F5XA 4TQUQ 3RT8A 3TTLA 4GOEA 3FATA 4WEDA 4L17A 3HCQA 3SEXA 4AB5A 1D4NA 1WDNA 5FHNA 3FD3A 5JEIA 1S3JA 4NF6A 1MY0A 4FIMA 1SS1A 3DLNA 2ZMBA 3O28A 1POTA 2PVUA 1I6AA 4XXUA 3K6VA 5I2KA 1BIYA 4F31B 1SYHA 4H1XA 1LSTA 4QSCA 4MH5A 4G4PA 5FHMA 3H06B 1FQEA 2F7CA 2DE3A 3KJ7A 4U1ZA 1B46A 2A5TA 2HZLA 2F34A 4FAJA 2LXCB 4GOFA 4GODA 3FVKA 4NWCA 1NH7A 4BDRA 4R9FA 3TCFA 3QWOC 1PB9A 4Z7EA 3RT6B 4JWOA 5CMKA 2H25A 4DCXA 3SERA 5AA2D 4IY6A 2ONSA 4DCYA 3VDFA 3G7WA 2B87B 4LP2B 4O3BA 2UYFA 1FQFA 2OWTA 4IO2A 3SEUA 3PUVE 1OVBA 3CFZA 3QYTA 3ECRA 1LLSA 3VE1B 2R44A 3FXRA 3PMXA 4H6DA 4BXLA 2QRYA 1MQHA 3GLBA 1LGBC 3OEMA 2HFBA 5IKBA 2Q9TA 3T22A 1TFDA 1OMPA 1PDAA 3VVFA 4I62A 1R6ZA 1P1QA 3N6TA 1H76A 1ZW0A 2M0BA 5I56B 4KYEA 4F1UA 4KCDA 1EZOA 1B4ZA 2B88A 1NH8A 1II5A 3MPLA 4MLQA 5H8HB 3PMVA 3D4CA 4FEBA 4G8NA 1DOTA 3K1PA 2H9BA 5AA4A 3H03A 1MPBA 3ILTB 1MDQA 4K35A 4OETA 3B6QA 3HSTA 2BJJX 2ZYKA 2XXQA 2LXBA 2R71A 4FJPA 1MM7A 2R9JA 4YU0A 2GRVA 2H5YA 2QVAA 3MUQA 3RUMA 1QULA 5AA3A 4CPGA 1Q1KA 4Q0CA 2DWJA 3SEWA 1GV8A 2UVIA 4JSOA 4KD5A 4ZEDA 1QUIA 1N3WA 1B9JA 1US4A 4OFLA 2KIKA 3TDJA 2Y7PA 4U2RA 4MN4C 1FTOA 4NF4A 3SKPA 1A54A 3FV2A 3FJMA 1Q35A 5EHSA 1URSA 4LQ5A 5ISUA 4OTEA 2DVZA 4AB6A 2VHAA 1EU8A 4IO3A 5I57A 3B6TA 3S9MC 1OLCA 3FV1A 3VV5A 3WAEA 3O9PA 1J1NA 2OZZA 1EDLA 1A8FA 1LFHA 1PB7A 2Z23A 1ANFA 4GXSB 4R6YA 5AA2B 1B2HA 1M5CA 1LAHE 4F2OA 3K1NA 2F8DA 5I58A 1SI0A 2UVHA 1P1NA 2UXAA 3C4MA 1LT1A 2DE4A 4IO5A 3OO8A 4EXLA 5A5XB 1MH4A 3PH0A 3S2VA 1YAEA 1LAGE 3IOTA 1EH3A 3O6IA 4YMAA 2KZJA 4U1OA 3MP1A 4GIZA 2ZXTA 4HCWA 3K00A 3HHFA 2DWAA 1IXCA 1RKMA 3IX1A 4RA1A 3RGUA 1MRPA 1SW1A 3JYRA 2F97A 4PE5B 2A5SA 4JBZA 1GTKA 1PEBA 2RC7A 4F19A 4JSDA 3TCHA 3VFJA 4IO4A 1MXXA 1MXUA 4Q8RA 3N94A 4XTCQ 3Q27A 1Y3PA 1DPPA 5ICTA 4K3AA 4GWOA 4PFTA 5CRYA 2VD2A 5ITOA 3KGCA 2THIA 4QHQA 4LA9A 1RYOA 5AA1A 2B87A 1Y1ZA 2Z8DA 1ZIUA 3CIJA 2B89A 1XT8A 4O3CA 4BDNA 4OQOA 5CBOA 1DPEA 1WODA 4OVJA 2V25A 3HO7A 2DS9A 5HBCA 2DVCA 4LUBA 1NNPA 2DXYA 1UTBB 1O64A 1ZXGA 1SW5A 1R1NA 3I3VA 1TXFA 2NVUB 3K4UA 4K3FA 1S7YA 1MDP1 1EZPA 3OEKA 1MXVA 4GL0A 4QSDA 3C36A 1EDIA 2FNCA 2XXUA 2QS1A 3FVGA 5H8HA 2ZAEB 3T93B 2HCAA 5IAIA 1USYH 1CB6A 2K3RA 2GFEA 5TPAB 4ELOA 1EDJA 5DVJA 1A99A 4PQJA 1EDKA 2Q89A 4NF5B 1ELJA 1QW0A 4EQ9A 1NKXA 5H8FA 2AL4A 3L6HA 5CBSA 2OCUA 4ZECA 4ECFA 3RPWA 3U92A 3KN3A 2RKLA 1OQHA 1A8EA 1DSNA 1ZU0A 4OZ9A 3V5AA 3E9XA 2Z8FA 3DM0A 1BDCA 3QIMA 3MVYA 3KOTA 1URDA 3MAMA 5DJUB 4F3GA 1M5EA 4BDOA 4DIGA 5I59A 2WMMA 3RN8A 1DTZA 4EYYQ 1B7UA 1LCFA 3AXFA 4R2BA 4FE8A 2Z22A 2WKYA 5CI5A 1I6BA 2F7AA 4G8MA 3A3UA 4ZE8A 4OFOA 4C1TA 2B3BA 3MC2A 4YAHX 2D3IA 1JVYA 3LBSA 2M5AA 3M8UA 4ZDMA 4I1DA 3IOVA 3IO6A 2DE2A 1IXGA 3KN7A 3TKDA 1US5A 4KCCA 5AA2A 4ASVA 5B70A 2NUVA 2P2AA 4G8HA 1B7ZA 2F36A 4N07A 3OELA 4X9TA 3USDA
chains in the Genus database with same CATH superfamily
2F7BA 4LZ7A 5A5XA 2KNCB 1QKAA 3SDFA 4H13B 3MUDA 4H44C 3O6GA 3E3KA 1H0TB 1H45A 2FY8A 4ZS9A 1HVVA 4ZKPA 3PU5A 1FDIA 5B5EE 4NPEA 3TELA 5H8NB 1BKAA 3Q1MA 2FA7A 2FXPA 2WT7B 1QKBA 3L71E 4F3SA 2WVRA 2QS4A 4HH2A 2GUSA 2QIWA 3B5NA 4IOIH 2FIXA 4NHBA 4DZ1A 1NUZA 1NTKD 2KYVA 3KBRA 4DE8A 1YBKA 3P7IA 5K2YA 1P84E 1LAXA 2RF1A 2RCBA 4G68C 4UB8E 1NUYA 5ET7A 1NU1J 4RNSA 1KB9I 2P58A 1QL2A 1K04A 4RY1A 2Y84A 3CG1A 5CCGC 4AQ4A 1JW5A 2WPQA 4XA4A 4ONYA 3AE6C 3LW5H 4GWXA 2YMKA 1HUCA 5EFWB 3MHVA 3E7KA 4GF8A 4NF8B 5CCHA 2OYIC 1FTMA 2L91A 1POY1 2B65A 2RKMA 3PUWE 5EYGA 1FQCA 3IO4A 1LFIA 4PFBA 3M3KA 4GWZA 1VQPP 3G71P 2I4CA 1SBPA 3H1IJ 2Q74A 2NPSD 5CMCA 1L4AB 1D9VA 1NU1E 4MX6A 4XKRA 4N81A 4U4SA 3L74J 3T66A 5AW2B 2VOZA 4U4XA 1XC1A 3LC8A 4XFJA 1IMCA 3V2QA 1G2CB 4WEPA 2V3QA 2I1JA 3H25A 2HEUA 3KOSA 4YKJA 4F2QA 5BU5A 4PD4D 2HODB 4OVPA 1ZBMA 5APVA 3C9IA 4C7NB 1ZMGA 1Y3QA 4Z0IA 3P32A 1FBDA 3ILUB 1B6HA 4N13A 3H1IE 4PE3A 3FGSA 3HV1A 3ONMA 4PFUA 5AVWB 4JVIA 2YIUC 1LB8A 3L74E 4KI0E 1K05A 2IFNA 3H1HJ 4JB7A 1RH5B 5EQ9A 2QJYC 3EPEA 1YXIA 3BCCG 2K37A 3FVNA 1BP5A 3E1IA 3CD6P 5I5PA 1NV7A 4H67A 3L75J 2O1LA 3G3HA 3CCSP 5GTIE 1N73A 3AEBC 5KKZC 5KLVK 3B8BA 4I2LC 4UA8A 1SW4A 2Y9YA 4QF9A 1H89A 4YB6A 4I7ZB 3GHGB 3VMZA 1B0LA 1JMBA 1Y9BA 1SQYA 3G4SP 5EQ7A 2KLVA 3H1HE 1VFEA 1QUJA 2ZT9C 1IZNB 4TT3H 3HE5A 3CSBA 1SQPG 2ONRA 2ZYMA 2XNXA 3K5BA 2I58A 2XXWA 2KLFA 4R6HA 3L75E 1FPKA 1JB0J 1CI6A 4WY4C 3CX5D 2XXVA 4W7ZA 1YTZI 3CFXA 2XDJA 5TPAA 3MVWA 1BGYG 5DEXB 3BCCD 4AUWA 1RF0C 4HCYA 2CEXA 3U65A 1GL2B 4M3LA 3WAFA 1FDMA 2NXOA 1X0TA 1YHQP 1Y20A 2HAUA 3PRJA 3A0BE 1URQB 2DP8A 2WSFJ 1AIVA 4XKQA 3V4WA 3KSXA 4EIJA 1EYKA 3UK4A 2W6AA 3H3GA 2QSXA 2H8PD 3EFFK 1GR2A 2L5VA 1KORA 3U59A 3LSWA 1VQ6P 4M1VA 3HTKB 3N6UA 2C9LY 1LGHB 3L71G 3FIRA 4PDHA 3AE4C 3U94A 4M4GA 3PV0E 3TTRA 2VD3A 4OMBA 2HQ0A 1JQFA 2XXYA 1SQPD 2XXRA 3S9EA 4QFNA 4GQOA 3E4RA 1HBWA 3T0JA 1DEEG 1Y9UA 3Q29A 3C31A 1ZV8A 3V6IA 1FZFA 3W67A 1PGQA 3CSGA 5TISE 1LTJC 2E1SA 2V3UA 2O51A 1SQXK 1S72P 3FJGA 4X8RA 5H8QB 1VQ8P 1G1JA 4B86A 1BGYD 5L9SA 2IYPA 2JDIH 2Y9ZA 3QXMA 2IBZI 1YZ0A 3H4ZA 4JDFA 2O68A 2ZYOA 3DP4A 3JV9A 4NE4A 4XFEA 2BCCJ 2QRXA 1S2EA 3O8ZA 2QMXA 3HE4A 3BFTA 1NWQA 4DJGA 2ONKE 2P1SA 3MZ9A 1OVTA 5LTCA 1PFIA 4QXDA 1NOHA 3PPPA 1SQBD 4IL6E 1NYHA 1Y47A 1YJWP 1U7JA 3L71D 2VRSA 3MQ9A 1GW4A 2FFDA 1QLED 2J59M 2YJPA 1FZCA 2W8ZA 2I0BA 1NU1G 4PF8A 2PX1A 1KFMA 1MKMA 1PIXA 1GDTA 1LBWA 3CI8A 4HXVA 3N5LA 5APXA 2IA4A 4P3LA 1SQVJ 2OARA 5AW1B 2YLNA 4C0RA 2BCCE 3V89B 4U23A 3T97B 2O01J 2Q8MA 4PETA 4QSEA 2GH9A 4HE1A 1P1UA 4QFLA 4LVQA 1AFOA 4LN5A 4PAIA 3CMAP 2NPSB 5CC2A 5ET6A 2VPOA 2PAJA 1MXYA 4OVQA 3MVZA 2V84A 3H1IG 1SD3A 1JW1A 2JEEA 2BASA 3RPLA 3TFLA 3OO6A 3L74G 2UVGA 3FUZA 1SQVE 3O66A 1JP4A 3IB0A 2KQZA 3IB1A 2UWJE 2O01N 1KA0A 4QFOA 2W27A 3TGUJ 3IB2A 1FBEA 3HD7A 4H5FA 5DTBA 5J1DA 1USEA 1NU1D 2OLBA 3LSXA 1H0TA 2UYEA 3HN0A 3T9UA 3CXHI 1SFCD 1N0TA 1ZJLA 2Q9IA 1SQQJ 4PFWA 3S9LC 5H8NA 3PPQA 3OSRA 1IK7A 1N04A 4GX3A 3H1HG 2GHBA 3E1RA 1WVJA 2A45I 2AXCA 4MBPA 3EN3A 4YB5A 2KK7A 1FQBA 1FCKA 2XXTA 4GWYA 2AEFA 3KXDA 1LWUC 2WPVB 3L75G 3H1ID 4ZMDA 2PBWA 2XX8A 2W83C 2PYYA 5KJ7C 1N2DC 2E5YA 4G68B 4PFIA 3PPNA 3OW2O 4PFRA 3I5CA 3WUVA 2Y5KA 1KB9D 1XS5A 4RK2A 1PGJA 4I9DA 2DOJA 1TFAA 1SQQE 3W9VA 3TTMA 1MFZA 4OVRA 2B4MA 1Y4TA 3M91A 4U21A 5KTBA 3KN8A 1HWTC 1OW8A 3U1AA 4NWDA 2MJZA 3PUXE 1B5HA 4U22A 3MPKA 5KAIE 1B40A 2OYIB 4I3YA 3KHUA 1EZ9A 3VYIA 1UIIA 3MIWA 2YO2A 2H7HA 2M8CA 1Y3NA 2FYNB 1NKNA 4HYTB 4MIJA 4N78E 2JJKA 1HSEA 1T6AA 1NTZJ 2DWIA 2O7UA 4U7JA 2E75C 1OQGA 2LR2A 3H1HD 2H98A 4GVOA 5JK4A 2M8RA 1P1OA 3TAJA 2ZNSA 3LIEA 1J1EB 2NRGA 1NJIQ 5I2KB 4F18A 1AOVA 2ZXEB 4BWNA 3P8CE 1L4AA 1JOCA 3OO9A 3RY3A 1KWHA 4ND9A 3L75D 2D21A 1T0KA 4ELQA 4KXPA 3F89A 3O6QB 3EHSA 4DDDA 2REGA 3RNNA 2C0XA 1VQ4P 3S9OA 4F39A 2Q6QA 3K1MA 3DP6A 3ODBA 2HODA 2AXTH 4HKZH 1NTZE 4NGUA 1E79H 4C7NA 3D4GA 3JC22 3K01A 2K9YA 5JTYB 5AW3B 1MY3A 2Z8EA 5DT6A 1M1JA 4OHNA 4IFMA 1JTHA 1QEXA 4KHZE 1OVRA 5HM4B 1ZKBA 2QJYB 2KLUA 4OANA 3K6XA 3N26A 3EQ2A 3M9BA 1QX8A 1IUDA 1B51A 1NTKK 1SPIA 2GHAA 2G29A 1H43A 1JVXA 5EYHA 1M1KQ 5H8SA 3WU2E 1GMJA 1D7MA 1LBVA 1Q2NA 4GFRA 4H45A 3A7OA 1IK9A 3PGFA 3U8QA 4TLLB 4TLMB 3QAXA 4D6TJ 4DZOA 5KKZB 1S4XA 1A02F 2K9JB 1Q9DA 2YKOA 4JF7A 3CXHH 3L6GA 4P9KA 1YI2P 1A40A 2DYXA 2BCCG 4RJZA 1VQ9P 4RK9A 5KJ7D 1IFJA 3GHGA 2WSCH 2FBPA 4Z1MH 3T9HB 4KHXA 4H8IA 2A45H 4DI3D 4L75A 1IMBA 5GTHE 2FXMA 2QVUA 3TCGA 2WITA 3TMGA 4NAPA 5I56A 1VQKP 2WTYA 4BRYB 1FE6A 1USYE 4P47A 2POHA 3BRTB 1FBHA 3AE9C 1B5IA 2MKVA 3LR1A 4DXBA 1RYXA 3U72A 3MWBA 2V7QH 3S9NC 4D6TE 2GA1A 1KA1A 5DYHA 2V93A 3PD9A 3MZ1A 4EQ7A 1FTJA 2I4BA 1SQVG 1FDOA 1LTIC 1R5SA 4R73A 1VQ7P 3LUYA 1YITP 4WXJA 5DEXA 3UA8A 5KDTB 2E75D 1ZRTE 2Q8JA 1GL2A 2VT5A 4YKPA 3GLMA 1WT6A 1OW6A 4EF2A 1URQA 4ZZAA 3CX5I 1SVXB 1QGXA 2XHDA 1DCUA 1FQAA 1MH3A 4E0WA 3GMAA 4DCKA 2PT1A 3BIGA 3T96B 4I1LA 3PJSK 3EF7A 2QS3A 2A06G 1B1HA 4MCOA 2I48A 1IEJA 1Q7YQ 1UIVA 3VVDA 1GL2C 2YPNA 2B9BA 1HJBA 3HTKA 5KAFH 3RYDA 1JEVA 1B58A 1MQJA 3TK1A 1SYIA 4R2FA 3T9XB 1JNFA 1X8YA 3V83A 1NNFA 3AEDC 1NV6A 3TGUG 2ESNA 1RF1C 4IGRA 3ROJA 3IOUA 3L70J 5L8RJ 1SFCB 2ABHA 1G0IA 1IFMA 4QBAA 1OIBA 2ITAA 4JXIA 1SQVD 3I56P 5APQA 2RCAA 1PP9D 3O2AA 5H8QA 3U93A 4R72A 4PV1C 4NX1A 1LP1B 2W6BA 3TTNA 1RE4A 4YKKA 1IIWA 4IL6X 3GBBA 3IN6A 2I8DA 2O3JA 1B0HA 3UGWA 3KZIH 5CBRA 1B3FA 1BSHA 3A5TA 3EKIA 5AW6B 4X1DA 1IFNA 1Y4CA 5AW4B 4O7MA 3OSQA 4PD4H 3TQLA 4GWSA 3TPAA 1K9YA 3L70E 4N4UA 2A06D 4N91A 3VOPA 3TEPA 2DQVA 3IORA 2NWJA 2ZXXA 2ZZWA 1MXWA 3VVEA 1URGA 1MG1A 2Q2AA 1B05A 4KFQA 4X04A 1GU5A 4KR5A 5DVIA 2OTKE 3IR1A 3M0DA 3TGUD 2OJTA 1IO4A 5TU0A 1GTWA 4EUOA 3H1LJ 2G93A 3H6VA 2QJPC 3QMFA 4GRKA 4U3FD 4PJ0E 1B52A 1PB8A 4WWIA 1FPEA 1FJ9A 3T97A 3RTWB 4NF4B 4H65A 2QMWA 2REJA 1BSNA 4L73A 3BATA 2NPSA 3S4RA 1NTZG 4YZZA 3PMWA 1FBFA 1FS0E 3UP9A 3KG2A 1KC8Q 1P84I 5IZZA 2QL3A 1OIPA 4I8CA 1UTHB 1B32A 5AVTB 3H1LE 4Y28J 1FOSE 1SQPK 4N78D 4ZKUA 4HJGH 4IGTA 4IY5A 3G3FA 4OESA 4JYBA 1I6QA 3CLQA 2AYSA 3MP7B 3TF5A 1EYIA 4ESXA 3AE8C 3OENA 5I7IA 3CX5H 2ZNUA 4Q5TA 2SPZA 2RC8A 4XKNA 3P8CD 2KS1B 4LONB 4GD5A 1NH4A 3S1KA 1DK4A 3C32A 4QFPA 1ATGA 2H4IA 2N1TC 3RK2D 3H6WA 1VDWA 4GBVA 3LW5J 2Z4EA 1LFGA 1TWYA 1M5BA 3M0AA 2HR3A 2FYUD 3LUZA 1LTBC 3VLWA 1H8AA 4W80A 2O69A 4PV1D 1LWUB 2E0SA 1NTZD 3ZDMA 1JMMA 4ZZEA 3CG3A 2BEZF 4PCDA 1M5FA 4D6TG 2CPSA 3ZSFA 1SQBK 5BU8B 1XI6A 1EC5A 3USDA 4O7IA 4ZE9A 4G68A 4OENA 4EQBA 2IZ1A 2Z5HA 4BDQA 3OMBA 4XE5B 2PFXA 3VMAA 2V4HA 1PL5A 5AW0B 5CCGA 3A0HE 1PV3A 4FECA 3OD7A 1W2EA 4FORA 1MS7A 3KZGA 5L9OA 3I6VA 3BKIB 1P1WA 3NFQA 1FBCA 2XXHA 2OYIA 1AQ5A 1FPLA 2OWZA 5APYA 1FW0A 4NEDA 2NOOA 2I0CA 3CR9A 2E75B 1H44A 2Q5UA 5LOMA 1YQ4C 1M5DA 1J1DB 1D9YA 1MY1A 2IDBA 1LCTA 5B66E 2H89C 5ICQA 1N86A 2B4LA 3PPRA 3GYYA 2DXRA 2HLOA 4MFIA 2P3VA 3R26A 4N6JA 1FRPA 1BLFA 1XTGB 4D6TD 4YMBA 2FYNC 2Z5IA 3OO7A 3SEVA 2DWHA 3PPOA 5AW8B 1MM6A 3MTUE 1NU1K 3O6QA 3RK3C 2CMOA 4N6PA 1J1EC 1A7LA 5FBPA 1ZRTD 2XD2A 3HUSC 3MP8A 1S9KE 1YTVA 3VXBA 1B3EA 5JTYA 2Y7RA 3V8XB 4KPTA 4UB8H 4NPDA 2OWSA 3VXCA 2F78A 4OXVA 1NAFA 4OWFA 2FKWB 1N8RQ 2HZKA 2PT2A 2LAOA 3L70G 2N1TD 2OX3A 1VPCA 1OVVA 5AVVB 1L5TA 2CZLA 1UIUA 3FX0A 3LSLA 4IO7A 4P11A 3B71A 4H46A 1DTGA 3ITKA 1QGKB 3TODA 5E79E 1MFTA 1AH5A 3RQTA 1DX7A 1IFPA 1BDDA 5L9MA 5C39A 1XVXA 1LTAC 2JWDA 2K9JA 3TDKA 3VTPC 1BK4A 1LBYA 2F35A 2OBGA 2VGQA 3G6EP 4PGNA 5KCJB 1GW3A 3HHGA 3KSJA 1LEVA 3A3YB 4EF1A 1MY2A 4PF6A 3DELB 4NPFX 4WVZA 2AIXA 4XKPA 1UTBA 2I6EA 5CHXA 4PDDA 1AA0A 4BRYA 3LV0A 1IFDA 1NVOA 1VQMP 4GL8A 3USSA 2AL5A 3KFMA 1VQOP 3M3FA 4MNIA 4WKMA 5DVFA 4WY4A 5B7DA 1XVYA 4N6DA 1R9QA 3SFEC 4OWDA 2P0SA 3SESA 3H1LG 3BRVB 1B5JA 3FWNA 3L70D 3GBAA 4RPOA 4THIA 2GUVA 2WSEJ 1RF0A 3G3KA 5AVXB 5KDTA 1MXZA 5AE4A 4L76A 3MZBA 1U57A 4RXLA 1IC2A 5AVZB 4N8GA 4KJMA 4F29A 2O1JA 4DXCA 4A7PA 3OXNA 4I3EA 3BBRA 4P0GA 5CMMA 1O63A 1FZBA 3HPIA 3M3LA 3B5ND 1KB9H 3QUJA 2L5GB 1E5WA 2XU6A 2YKQA 1QUKA 5A5LA 3H6PA 4OEVA 1NAYA 4L74A 1NTMJ 5GTIH 4F22A 4NF5A 3RK3D 3F11A 1JEUA 1VE4A 2CZHA 3RTFB 1LAFE 1RF1B 2VP1A 3K2DA 5HPQA 1OVUA 4ELPA 2PP6A 5IZ3B 3RK2B 1KFNA 3EQ1A 4NMYA 3H6UA 1N7LA 3MYUA 2H99A 1LTJA 1I69A 3FXQA 3C1LA 3H1LD 4X1BA 1D3KA 4R9GA 3RLFE 1TT1A 5AVUB 1SI1A 2R3SA 2XXXA 4PV1B 3EHTA 3M06A 2Y7WA 1B3GA 3W9WA 5BWJA 4P1EA 1MPDA 3B8EB 1LBCA 1BE3J 1LP1A 4O3AA 1NTME 4PFYA 3RGYA 3QK6A 3MP6A 4PTKA 5CMZA 5TP9B 1SFCC 2XXIA 4Q30B 2C0WA 2B3FA 4F1YA 5KZTA 3IK6B 1PBPA 1JO5A 5AW5B 4P1LA 3E13X 3CFLA 5H8FB 1MQGA 2IEEA 2ZYNA 3TYHA 1NV5A 3A0BH 4H0LC 4MLVA 2DDKA 3TZAA 1XTCC 3K0VA 3FXDA 3GF7A 2RINA 5L8DA 3G3JA 4YICA 3MZWB 2QJPB 3QUFA 1BE3E 3JCUE 3KYQA 2JKVA 1QJMA 5CM6A 3IAOA 1JETA 1NUWA 4RESB 4ESWA 1XHYA 2D5WA 2XD3A 3TQWA 1AVOA 3L4FA 3BVHA 1SW2A 3CL3D 4TOZA 1KYOE 2GM4A 4GOTA 5I3SA 2QE7H 1EZVE 4JVDA 4MMPA 4JWXA 2WSFH 3MGNA 2HPCB 1P84D 1YIJP 3GZGA 4YXDC 2KSJA 2XX7A 3UORA 1JY3O 5I59B 1B3HA 4OGQD 3B6WA 3C9HA 3KC1A 3K6WA 1VSOA 2XA5A 1W2BO 2PMSA 1UTHA 1NKZB 3PUZE 3UN6A 1GVCA 3IR9A 3IAZA 2XX9A 1DMBA 4F3PA 2F6GA 5FHOA 2QJKC 1P99A 5M2VA 4G61A 5DJTB 5I2NB 4BDLA 4NQ8A 5AVSB 1HJ0A 2PCRA 5FTIA 1SQVK 2KS1A 4LQ2A 2N1TB 4IO6A 4ASWA 2Y7KA 3DP8A 4GX4A 4PP0A 2QJEA 4IL6H 1CSBA 2DW3A 2XWKA 4KQPA 2M5AB 3R4YA 1PGOA 3VN0A 4LZ8A 2KNCA 4N6KA 4ZEIA 1JY2N 2PFYA 3P7KA 1FTLA 3KEIA 4NN3A 3LIDA 2QS2A 4NG7A 1NV0A 1LWUA 1S9KD 3TUSA 2QA4P 4YB7A 1R9LA 1HSJA 4XIGQ 3I5OA 1N7SC 4HB1A 3S4UA 4OERA 5KJ7A 3EHUA 1JM0A 2WT7A 3C33A 3FJ7A 2QPQA 4C46A 3OOAA 3QSLA 1X79B 1IITA 3AE2C 4IB2A 3U1OA 4H0LD 2XWVA 4TLFA 3MBPA 4QFKA 4IR8A 2WEFA 3ISPA 1GGGA 4DLDA 3WUTA 3H32B 5F7VA 1PGPA 3L74D 3LSFB 3B7DA 1KILE 1HSLA 4HE0A 3VLVA 3D70A 4PGPA 3R7XA 2YXQB 5CBNA 5I84A 2O01H 2OYHC 2WX9A 3A3CA 5BVZA 1MZ9A 1L0NJ 4H0WA 2FIEA 3CWBJ 1Q82Q 1LBBA 1Y1MA 4PAFA 1QVGO 1N3XA 4NF8A 3G3GA 1FC2C 2ZJSE 5EQ8A 4NF6B 4X48A 1FPDA 1EYJA 3N7NA 1MY4A 2O84X 1H3DA 1JY2P 4MAGA 4PC9A 3U1CA 3CCQP 4KYDA 3A2AA 5AVQB 4G2ZA 3H6TA 1J1DC 3GF3A 3RK3B 2V4CA 3THIA 4BLAA 2HPGA 4ZEBA 1AL3A 1G0HA 1PBQA 1JY2O 3M9HA 2E74C 3GXAA 3Q25A 1N76A 3HUSB 2WBBA 4DXUA 3ZKKA 1L0NE 1NTMG 4DT0A 3FXUA 5ITPA 1XOCA 1HGZA 1PC3A 4ZNCA 3CWBE 1G2CA 3IOWA 1IXIA 2I3WA 3AE1C 1U7MA 1OW7A 5CJ0A 2QSIA 4R74A 4C1UA 3K02A 1S5LE 2FYUK 2XV5A 1SDXA 4MEVA 5K2XA 3G3IA 5BUUA 1S9TA 1NTZK 1RY3A 4RPNA 1B1XA 3ZS6A 1RQUA 3SZPA 4EDPA 3HRNA 3A09A 3D6YA 1NV3A 4OEUA 4GLIA 2CK3H 1GK4A 2G3AA 1MPCA 1Z7NE 3H7MA 2A5TB 2X7PA 1JNMA 3PUYE 4ZEFA 1BE3G 1NHLA 3C34A 3CCEP 4GXAA 4IFFA 1A02J 1N7SD 1FU1A 1NFTA 3CRBA 5KCJA 3FWLA 1M8OB 1YJ9P 3O29A 3PD8A 1IXHA 1B4HA 3FVOA 2X7QA 2V3TA 4KYSA 4UACA 3MVXA 1FTKA 2X26A 3D1RA 3E78A 3IJXB 1NO4A 3H1KJ 1EZVG 1BTJA 2Q3IA 1NTMD 4H8JA 3II6A 3TTKA 4HTGA 1KTMA 1NNTA 4LATA 4I40A 4OFJA 3HD7D 4JWYA 4F3BA 3V2PA 3VMXA 2WSSH 3UIFA 2R6GE 3JSVC 1DBZA 3FZVA 3JZJA 4H13D 3D71A 5LDZA 3CI9A 2HXWA 5K5GB 1S1CX 1O7TA 2I3VA 3CHGA 3FBPA 3PLNA 4EDFA 4POXA 4XEQA 1ZP0C 4OGQB 1KILC 3H1KE 3O97A 3R6UA 1BE3D 1AMFA 2GQ1A 2I49A 4R4LA 5KAFE 2FXOA 2ANJA 1SVFA 1Q86Q 1AWBA 3KPEA 5AVRB 1UQWA 2WPRA 1KYOD 2ZVOB 2E74D 2HAVA 3SETA 2O7IA 1W5CE 3AE5C 5ELVA 1T8ZA 1FBPA 1EZVD 1RF1A 4RYAA 1WRGA 2BCCD 2KB7P 4UB6E 5DW8A 4G77A 4ZEKA 5IZ3A 2KUBA 1INPA 1N7WA 2ALUA 3Q26A 3KDPB 1FJPA 1N7XA 3VLUA 4F1VA 5GTHH 1QL1A 1LT9C 4EXKA 2P67A 1IQ7A 1VF5D 1ZMEC 2W7YA 2QG4A 1B7HA 1FQDA 3CC4P 4HE2A 4OVTA 5AA4B 2O6AA 3RK2C 4ELRA 2M3BA 2Y0CA 5TJHA 4PD4E 2RC9A 2OTLP 5TP9A 3HFUA 3G3ZA 1JCCA 1VR5A 4E0XA 3AE7C 1SQQG 1NGMB 1YPNA 5F1QA 1ZLQA 1K9MQ 3IF4A 4H0LB 5EYFA 1RDXA 3SWYA 2O1MA 1NI9A 3ABVC 1RQVA 5ET5A 3CVGA 1Z7ME 5EHMA 1DEBA 3KJTA 1M90Q 1OZHA 3C35A 1LB9A 1VDFA 1A55A 2DSFA 1KQLA 3K6UA 3W15C 3BIHA 2D2CC 1QVSA 2J5UA 3R2PA 3MJNA 3Q28A 1IZ1A 1DD4A 3RL0C 1VQNP 1ZTYA 1EXIA 4HW8A 5IZ1A 1YJNP 3FASA 2M3EA 4H5GA 4OYVA 4FEDA 1L0NG 1R8EA 1DD3A 1NNKA 3CWBG 2UVJA 3ZKLA 1NL5A 2VPNA 1KILD 1PZQA 4LGDE 4NTLA 3MW0A 4OVNF 1NMUA 1N84A 1SQQD 3HE4B 3RL0g 3FXEA 1OLAA 4YKIA 2Q2CA 1EXJA 1MQIA 3SSUA 2XXPA 1ZLLA 2QJKB 2OK2A 4ISUA 2K88A 5FTHA 1FZGA 1FPIA 4BDMA 3GG2A 1S50A 4MF3A 2KI7B 3AEEC 1VFDA 5I2NA 2FFDB 3CC7P 1CE2A 3V5BA 1JW4A 4QRZA 2N9BA 1MQDA 2AEMA 2N1TA 2F6PA 3BFUA 1YYCA 3L37A 1L0LJ 3Q2YA 4HS7A 5I57B 4YTPC 2R5DA 2FYIA 2FYZA 3IJOB 3SEYA 2Q88A 3SWKA 1M57D 1B3LA 1YCJA 4POWA 1L0ND 2F3DA 4LZ5A 1N7SB 3T9VA 3CWBD 5AW7B 1X22A 1VL2A 4R6KA 2IZ0A 2XKMA 3AE3C 5CMBA 3L73J 3MD0A 3O6HA 1F9BA 2KZIA 4P0IA 2Y7IA 2ZNTA 1SQBJ 1X9VA 1L0LE 1RE3C 3KC0A 2W6JH 2Q1KA 3IFCA 1BGYE 1AJYA 3CCMP 5H2FH 3HD7B 3H32A 3H1KG 2WQYC 3IL1B 4FATA 4R75A 5I58B 2F5XA 1HH0A 1WMKA 2OYHB 1HF9A 4TQUQ 3RT8A 2IFMA 3TTLA 4GOEA 2D2CD 3T1BA 3FATA 3CMEP 3L73E 3NTNA 4WEDA 1AQTA 4JQ0D 4AS5A 3RL0D 4L17A 4MHFA 1K9ZA 3MSTA 1T2KC 1ZR2A 4O94A 3HCQA 3SEXA 2WYKA 1SQBE 1LTSC 4AB5A 1D4NA 1WDNA 5FHNA 3MUDC 1FJ6A 3FD3A 5JEIA 2QVRA 1USDA 2G8YA 1S3JA 2E5TA 4MJOA 4NF6A 1MY0A 1FPBA 1SS1A 3EWKA 3DLNA 4FIMA 2ZMBA 4R4MA 3O28A 1POTA 2PVUA 2E74B 1I6AA 1S5LX 4XXUA 2E76C 3K6VA 5B5EH 5I2KA 1BIYA 3HUSA 3B5NC 4F31B 2FVZA 1SYHA 4P8BA 3B4SA 3H1KD 4H1XA 3V2NA 2AEJA 1FSAA 1LSTA 4QSCA 2YNYA 2P7JA 1Y8AA 3F5HA 4MH5A 3OA7A 4G4PA 3RBXA 4JPZB 1VF5B 5FHMA 3H06B 3VP8A 1FQEA 2CZKA 1LNQA 1FBMA 2F7CA 3A0HH 2DE3A 1P84H 4W7YA 4EI2A 3KJ7A 4U1ZA 1B46A 2CEYA 4Y99C 2A5TA 2HZLA 2F34A 1Z56A 1K73Q 1LBXA 4FAJA 2LXCB 5CCHC 4GOFA 4GODA 3FVKA 5B66H 4NWCA 1NH7A 4BDRA 4R9FA 3TCFA 1OFCX 5AW9B 1JCDA 3QWOC 1PB9A 4JVCA 5ESYA 3RT6B 4Z7EA 4JWOA 5APUA 2XZRA 5CMKA 2PGDA 2H25A 1FZAA 4DCXA 3SERA 2HYNA 3W68A 5AA2D 4IY6A 4XF5A 2ONSA 5KLVJ 4DCYA 1M1JB 2KXPB 1RHZB 3VDFA 4H44D 3G7WA 2B87B 1JTHB 1LBZA 4LP2B 4O3BA 2UYFA 2N9YB 1FQFA 1T2KD 1UIXA 2OWTA 1KB9E 4IO2A 1H88A 4MNCA 1KILB 3SEUA 3CC2P 3PUVE 3TNUB 1OVBA 1IMAA 3CFZA 3QYTA 3ECRA 1LLSA 3VE1B 5IM2A 1CZQA 2R44A 3FXRA 3PMXA 4H6DA 5APWA 4BXLA 2P2UA 1MQHA 2QRYA 5J16A 3SWFA 3GLBA 1LGBC 3OEMA 5KLVE 2HFBA 5E79H 5IKBA 2OGUA 2Q9TA 3T22A 2E76D 1TFDA 1OMPA 1PDAA 3VVFA 4OGQC 4I62A 3KQGA 1P1QA 3P8MC 1YQ3C 1R6ZA 1L2PA 3N6TA 1H76A 2I1KA 1ZW0A 2M0BA 1N73C 5I56B 1YTZT 1LTGC 4KYEA 4F1UA 4KCDA 1EZOA 3QH9A 1B4ZA 2QVVA 2B88A 1NH8A 1LT9B 5CCGD 4NF0A 3CCJP 1II5A 1RDYA 2QFLA 4LC1A 1KYOI 3MPLA 4MLQA 5AVYB 5H8HB 2OYOA 1Q81Q 1L0LG 3PMVA 3D4CA 1EZVI 4FEBA 4G8NA 4PBHA 2NZ2A 1DOTA 1IFIA 3K1PA 2H9BA 1SFCA 5KLIC 5AA4A 3H03A 1JY3N 1MPBA 3ILTB 1MDQA 4K35A 2HXRA 4YPCA 4OETA 3B6QA 3HSTA 1LJ2A 2BJJX 5CCHD 2P3NA 3L73G 2ZYKA 2JWAA 1NTMK 1SQXJ 2XXQA 2LXBA 2R71A 4FJPA 2WWWA 1MM7A 2R9JA 4YU0A 1CW5A 1SQBG 4DOJA 2GRVA 3AEFC 5M1BA 2H5YA 1KV4A 2QVAA 3H1JJ 3MUQA 4N8YA 3RUMA 1QULA 4I6MC 5AA3A 2D2CB 3Q3DA 4JYCA 4CPGA 3CPWO 1Q1KA 4Q0CA 4AS4A 2DWJA 3SEWA 1BCCJ 3RL0B 1GV8A 2WSEH 3VMYA 2UVIA 4JSOA 4KD5A 2IPPA 2PFZA 1QUIA 4ZEDA 1K8AQ 1N3WA 1L0LD 1SQXE 5EQAA 2E43A 1T3UA 1B9JA 1US4A 4OFLA 2KIKA 2K1AA 4FBPA 3TDJA 2YXRB 2Y7PA 2E42A 3NOHA 4U2RA 4MN4C 1FTOA 4NF4A 3H1JE 3SKPA 1A54A 2HG5D 3FV2A 3B50A 1JY3P 3L73D 1VQ5P 1BCCE 3FJMA 5TISH 1Q35A 5EHSA 1URSA 2JJLA 2XXKA 4LQ5A 1OXZA 2H88C 2R8TA 5ISUA 4OTEA 2ZT9D 1M56D 2YMYA 1HTLC 4OVSA 2DVZA 2QEXP 4AB6A 4GKGA 2VHAA 1EU8A 4IO3A 1Q90D 5I57A 4WY4D 2KR0A 2XWIA 1PP9J 5CJ4A 4RKUJ 4KT0J 4P56A 1HGVA 3B6TA 1OWAA 3S9MC 4WBAA 3JCUH 2FFDC 2P1JA 1OLCA 3FV1A 5ET8A 1GU4A 3VV5A 3WAEA 1FZCC 3O9PA 1J1NA 3VP9A 3IFMA 1N7SA 2OZZA 3PTZA 1NV4A 1FJKA 4IFDK 1RDZA 1KYOH 1EDLA 1TU3F 2W90A 1JEKA 3L35A 3CCRP 1A8FA 1LFHA 1PB7A 2Z23A 1ANFA 4GXSB 2WPSA 1EQ7A 1PP9E 3L72J 4R6YA 5AA2B 2IBZE 2O1KA 1B2HA 1M5CA 1KQFB 2KSEA 4GDOA 1LAHE 4F2OA 3K1NA 4H44B 2F8DA 4GWUA 5I58A 4U3FJ 2OYHA 1SI0A 2UVHA 3AEGC 1P1NA 5KLVG 2UXAA 3C4MA 1KMIZ 1LT1A 2A06E 2DE4A 1NV1A 2MKZA 4IO5A 3OO8A 4EXLA 5A5XB 1MH4A 3HD7C 3PH0A 1YYZA 3S2VA 1YAEA 2ZZXA 1SQQK 1LAGE 3FXBA 3PP5A 3IOTA 4H13C 1EH3A 3O6IA 4YMAA 3KBZA 3L72E 2KZJA 4U1OA 1MUUA 3MP1A 3TGUE 4GIZA 4C7RA 2ZXTA 4HCWA 2CZIA 2ZYGA 3K00A 1PPJE 3HHFA 2E76B 1IXCA 2DWAA 2HHMA 3Q5PA 4PBQA 4U3FE 1RKMA 2F3BA 3B5NB 3M9QA 3IX1A 4RA1A 3RGUA 1MRPA 4GT1A 1SW1A 2LKMA 4GIFA 3JYRA 1AV1A 2AXTE 2F97A 4PE5B 2A5SA 2QM7A 4JBZA 1GTKA 1PEBA 2WSCJ 1FTAA 2RC7A 1L0NK 2ZFCA 5KLVD 4F19A 4JSDA 3TCHA 2HFED 2FYUJ 3VFJA 4IO4A 1MXXA 1IMEA 4Y99B 3NMDA 1MXUA 1GZLA 1ZN5A 4Q8RA 3N94A 1VF5C 2V7QJ 4XTCQ 3Q27A 1Y3PA 2YO3A 4N17A 3CCLP 3CXHE 2R32A 1IMDA 1DPPA 5KAIH 4DI4B 1NTKJ 5ICTA 2QM8A 3PTYA 4K3AA 4GWOA 3G9RA 3Q5SA 2R3CA 1SQXG 4PFTA 3WUUA 5CRYA 2VD2A 5ITOA 1KQGB 3KGCA 2FYUE 2RN0A 1IJDB 1L4AC 2THIA 4GWWA 2R5BA 3IFAA 4QHQA 3H1JG 1FZEA 4LLHA 4LA9A 2YIUB 1RYOA 2B87A 5AA1A 1Y1ZA 4MNPA 2Z8DA 1ZIUA 1BCCG 3CIJA 2B89A 2WYPA 4O8MA 1NTKE 4PD4I 1XT8A 1M7LA 4O3CA 5F24A 1S5LH 1KILA 4OA4A 4BDNA 3CCUP 3NXSA 1M1JC 3TNUA 4OQOA 4GBWA 5CBOA 1OMIA 2Q7CA 1DPEA 1WODA 1FPGA 4RO0A 4OVJA 2V25A 2JO1A 3HO7A 2DS9A 5HBCA 1D9QA 2DVCA 4LUBA 1NNPA 2Y0EA 3EFGA 5APSA 2P10A 3AECC 1NUXA 1SQXD 1N73B 2Q3EA 2DXYA 2ZT9B 1FPJA 1UTBB 2KP8A 1O64A 3WU2H 2IX7C 1ZXGA 1SW5A 1R1NA 4AYCA 3I3VA 1TXFA 2NVUB 3K4UA 3V2RA 4K3FA 1S7YA 1MDP1 1EZPA 3OEKA 1MXVA 1FBGA 4GL0A 3H1JD 1OX3A 4QSDA 2BJIA 4WY4B 1LT9A 2PRRA 4I7ZC 3GHGC 3C36A 1KZ8A 3N4XA 1JUNA 1EDIA 2FNCA 2C9NY 2XXUA 2QS1A 1MV8A 3FVGA 1KD1Q 3HE5B 2ZZVA 1BCCD 5H8HA 2ZAEB 5KLIB 4N3YB 3UIAA 1NV2A 3T93B 1PP9G 3RBZA 2IBZG 2J58A 3OAKA 2HCAA 5IAIA 1CI6B 1USYH 2ZYAA 1CB6A 3WMM0 1SLQA 2K3RA 3KZIE 2GFEA 3E79A 5TPAB 3OJAB 2RMZA 2H43A 1GK6A 4OH8B 2FBWC 4ELOA 1EDJA 5DVJA 1A99A 4PQJA 1EDKA 4QMAA 2Q89A 1ELJA 4NF5B 1J2JB 4N15A 2CPBA 1URQC 1QW0A 2ZYDA 1L4AD 3PHLA 3L72G 4EQ9A 2IYOA 2RH0A 1NKXA 3CCVP 5H8FA 2AL4A 3L6HA 5CBSA 2OCUA 1KZUB 4ZECA 4ECFA 1PPJG 3RPWA 4U3FG 3U92A 1LTJB 4UB6H 1FPFA 5T3JA 3KN3A 1KQSO 2RKLA 1OQHA 2JP3A 2IBZD 5APTA 1A8EA 1DSNA 1ZU0A 4OZ9A 3V5AA 3E9XA 2BEQD 1G1IA 2Z8FA 2XNDH 3Q5RA 3BCCJ 4YXWH 2OQQA 3DM0A 1BDCA 3QIMA 4WB4A 3KOTA 3MVYA 1URDA 3MAMA 2HPCA 5DJUB 4F3GA 3D6ZA 2ZVNB 1M5EA 4BDOA 4DIGA 1RE4C 3I55P 5I59A 2WMMA 3AEAC 1DTZA 3RN8A 4EYYQ 1B7UA 3CX5E 3L72D 1LCFA 3C8VA 2WBDA 3AXFA 3SFDC 4R2BA 1PPJD 4FE8A 3BCCE 2Z22A 3A29A 2WKYA 1SQPJ 5CI5A 1I6BA 2F7AA 2WZ7A 3BASA 3TSIA 3A3UA 4G8MA 1FZCB 4GX6A 4OFOA 2JR8A 2A45G 4ZE8A 2B3BA 4C1TA 4PAKA 3MC2A 4YAHX 2FYUG 3FGAD 3RK3E 1ZR4A 3M0DC 1FOSF 1SP4A 2D3IA 4UABA 1JVYA 1CNQA 1QVFO 3LBSA 2M5AA 4O9BA 1BGYJ 3M8UA 4ZDMA 4I1DA 4EOTA 2Y0DA 3IOVA 3IO6A 2DE2A 2YKPA 3TYYA 5H2FE 1GD2E 1FAVA 1RE3A 4PJ0H 3V4QA 1IXGA 5IGAA 3KN7A 1IMFA 1NTKG 3TKDA 1US5A 2NPSC 1SQPE 4KCCA 2OTJP 2FHYA 1GL2D 5AA2A 2KOGA 4ASVA 1DH3A 1T3JA 2Y5LA 5B70A 1AVYA 2NUVA 1URQD 3RPLB 2P2AA 1KN7A 4AQRD 1VQLP 4G8HA 1B7ZA 1ZOYC 1L0LK 3L71J 2F36A 1R5LA 4RJTA 3CXHD 3GW6A 2XWOA 1DIPA 3OELA 4N07A 4X9TA 1LTTC 3L36A
chains in the Genus database with same CATH topology
2F7BA 4LZ7A 5A5XA 1QKAA 3SDFA 3O6GA 3E3KA 1H0TB 1H45A 4ZS9A 3PU5A 4NPEA 3TELA 5H8NB 1BKAA 2FA7A 1QKBA 4F3SA 2QS4A 4DZ1A 4IOIH 3KBRA 4DE8A 3P7IA 5K2YA 1LAXA 2RF1A 2RCBA 4G68C 4RNSA 2P58A 4RY1A 2Y84A 3CG1A 4AQ4A 1JW5A 4ONYA 5EFWB 3MHVA 4GF8A 4NF8B 1FTMA 1POY1 2B65A 2RKMA 3PUWE 1FQCA 3IO4A 1LFIA 3M3KA 2I4CA 1SBPA 5CMCA 1D9VA 4XKRA 4U4SA 3T66A 2VOZA 4U4XA 1XC1A 3LC8A 4WEPA 2V3QA 2HEUA 3KOSA 4YKJA 4F2QA 1ZBMA 1ZMGA 1Y3QA 4Z0IA 3ILUB 1B6HA 4N13A 3FGSA 3HV1A 3ONMA 4PFUA 1LB8A 4KI0E 4JB7A 3EPEA 3FVNA 1BP5A 4H67A 2O1LA 3G3HA 4UA8A 1SW4A 4QF9A 4YB6A 1B0LA 1JMBA 1SQYA 1VFEA 1QUJA 3CSBA 2ONRA 2ZYMA 2I58A 2XXWA 2KLFA 4R6HA 2XXVA 3CFXA 5TPAA 3MVWA 5DEXB 4HCYA 3WAFA 2NXOA 1X0TA 1Y20A 2HAUA 2DP8A 1AIVA 4XKQA 3KSXA 3UK4A 3H3GA 2QSXA 1GR2A 3LSWA 4M1VA 3N6UA 3FIRA 3U94A 4M4GA 3PV0E 3TTRA 2VD3A 4OMBA 2HQ0A 1JQFA 2XXYA 2XXRA 3S9EA 4QFNA 4GQOA 3E4RA 1DEEG 1Y9UA 3Q29A 3C31A 3CSGA 2E1SA 2V3UA 2O51A 3FJGA 5H8QB 5L9SA 3QXMA 3H4ZA 4JDFA 2O68A 2ZYOA 3DP4A 3JV9A 4NE4A 2QRXA 2QMXA 3BFTA 2ONKE 2P1SA 3MZ9A 1OVTA 3PPPA 1Y47A 1U7JA 3MQ9A 2YJPA 2I0BA 2PX1A 3CI8A 3N5LA 2IA4A 4C0RA 2YLNA 3V89B 4U23A 4PETA 4QSEA 2GH9A 1P1UA 4QFLA 4LVQA 5CC2A 1MXYA 3MVZA 2V84A 1SD3A 1JW1A 3TFLA 3OO6A 2UVGA 3FUZA 3O66A 3IB0A 3IB1A 2UWJE 4QFOA 3IB2A 4H5FA 5DTBA 5J1DA 2OLBA 3LSXA 1H0TA 2UYEA 3HN0A 3T9UA 1N0TA 1ZJLA 4PFWA 3S9LC 5H8NA 3PPQA 3OSRA 1N04A 2GHBA 1WVJA 4MBPA 3EN3A 4YB5A 1FQBA 1FCKA 2XXTA 4ZMDA 2PBWA 2XX8A 2PYYA 4G68B 3PPNA 1XS5A 4RK2A 4I9DA 2DOJA 1TFAA 3W9VA 3TTMA 1Y4TA 4U21A 3KN8A 4NWDA 3PUXE 1B5HA 4U22A 3MPKA 1B40A 1EZ9A 2M8CA 1Y3NA 1HSEA 2DWIA 2O7UA 1OQGA 4GVOA 2LR2A 2H98A 5JK4A 1P1OA 3TAJA 2ZNSA 5I2KB 1AOVA 4F18A 3OO9A 3RY3A 1KWHA 4ND9A 2D21A 1T0KA 4ELQA 3EHSA 4DDDA 2REGA 3RNNA 4F39A 3K1MA 3ODBA 3DP6A 4HKZH 3K01A 3D4GA 5JTYB 1MY3A 2Z8EA 5DT6A 4OHNA 4KHZE 1OVRA 5HM4B 1ZKBA 3K6XA 3N26A 1IUDA 1B51A 2GHAA 2G29A 1H43A 1JVXA 5H8SA 4GFRA 1Q2NA 3PGFA 3U8QA 4TLLB 4TLMB 3QAXA 3L6GA 1A40A 2DYXA 4RJZA 4RK9A 3T9HB 4H8IA 3TMGA 3TCGA 5I56A 1USYE 1B5IA 3LR1A 4DXBA 1RYXA 3U72A 3MWBA 3S9NC 5DYHA 2V93A 3PD9A 3MZ1A 4EQ7A 1FTJA 2I4BA 4R73A 3LUYA 5DEXA 4WXJA 5KDTB 3UA8A 2Q8JA 4YKPA 4EF2A 4ZZAA 4E0WA 1SVXB 2XHDA 1MH3A 1FQAA 2PT1A 3T96B 3EF7A 2QS3A 1B1HA 2I48A 1IEJA 1UIVA 3VVDA 2YPNA 1JEVA 1B58A 1MQJA 1SYIA 4R2FA 3T9XB 1JNFA 3V83A 1NNFA 2ESNA 4IGRA 3IOUA 2ABHA 1OIBA 4JXIA 2RCAA 3O2AA 5H8QA 3U93A 4R72A 1LP1B 3TTNA 4YKKA 1IIWA 2I8DA 1B0HA 5CBRA 3UGWA 1B3FA 4X1DA 1Y4CA 3OSQA 3TQLA 3TPAA 3TEPA 2DQVA 3IORA 2NWJA 1MXWA 3VVEA 1URGA 1MG1A 2Q2AA 1B05A 4KFQA 5DVIA 4KR5A 2OTKE 3IR1A 2OJTA 5TU0A 4EUOA 2G93A 3H6VA 4GRKA 1B52A 1PB8A 4WWIA 3RTWB 4NF4B 4H65A 2QMWA 2REJA 4YZZA 3PMWA 3UP9A 3KG2A 2QL3A 4I8CA 1UTHB 1B32A 4IY5A 4HJGH 4IGTA 3G3FA 4OESA 1I6QA 2AYSA 4ESXA 3OENA 2ZNUA 4Q5TA 2SPZA 2RC8A 4XKNA 2KS1B 4LONB 4GD5A 3S1KA 3C32A 4QFPA 1ATGA 2H4IA 3H6WA 1LFGA 1TWYA 1M5BA 2HR3A 3VLWA 2O69A 2E0SA 3ZDMA 4ZZEA 3CG3A 1M5FA 3ZSFA 1EC5A 4ZE9A 4G68A 4OENA 4EQBA 4BDQA 3OMBA 4FECA 3OD7A 4FORA 1MS7A 3KZGA 5L9OA 3I6VA 3BKIB 1P1WA 2XXHA 1FW0A 4NEDA 2NOOA 2I0CA 3CR9A 1H44A 5LOMA 1M5DA 1D9YA 1MY1A 1LCTA 5ICQA 3PPRA 2DXRA 4MFIA 3R26A 1BLFA 4YMBA 3OO7A 3SEVA 2DWHA 3PPOA 1MM6A 2CMOA 4N6PA 1A7LA 2XD2A 3MP8A 1YTVA 3VXBA 1B3EA 5JTYA 2Y7RA 4KPTA 2OWSA 4NPDA 3VXCA 2F78A 4OXVA 2HZKA 2PT2A 2LAOA 1L5TA 1OVVA 2CZLA 1UIUA 3LSLA 4IO7A 4P11A 1DTGA 3TODA 1AH5A 1MFTA 3RQTA 1BDDA 5L9MA 5C39A 1XVXA 2JWDA 2OBGA 2VGQA 3GBBA 2F35A 3V8XB 5KCJB 3HHGA 3KSJA 4EF1A 1MY2A 3DELB 4NPFX 2AIXA 4XKPA 1UTBA 2I6EA 1NVOA 4GL8A 3KFMA 2AL5A 5DVFA 3M3FA 4WKMA 5B7DA 1XVYA 1R9QA 4OWDA 2P0SA 3SESA 1B5JA 4RPOA 3GBAA 4THIA 3G3KA 5KDTA 1MXZA 5AE4A 3MZBA 4RXLA 4KJMA 4F29A 4DXCA 3OXNA 3BBRA 4P0GA 5CMMA 1O63A 3M3LA 3HPIA 3QUJA 1QUKA 4OEVA 4F22A 4NF5A 3F11A 1JEUA 1VE4A 3RTFB 1LAFE 2VP1A 3K2DA 5HPQA 1OVUA 4ELPA 3EQ1A 4NMYA 3H6UA 2H99A 1I69A 3FXQA 4X1BA 1D3KA 4R9GA 3RLFE 1TT1A 1SI1A 2XXXA 3EHTA 2Y7WA 1B3GA 3W9WA 5BWJA 1MPDA 1LBCA 1LP1A 4O3AA 4PFYA 3RGYA 3QK6A 3MP6A 5TP9B 2XXIA 4Q30B 2B3FA 4F1YA 5KZTA 3IK6B 1PBPA 3E13X 3CFLA 5H8FB 1MQGA 2IEEA 2ZYNA 3TYHA 4MLVA 3TZAA 3K0VA 3FXDA 2RINA 5L8DA 3G3JA 4YICA 3MZWB 3QUFA 5CM6A 1QJMA 1JETA 4ESWA 1XHYA 2D5WA 2XD3A 3TQWA 1SW2A 4TOZA 4GOTA 4JWXA 3GZGA 2XX7A 3UORA 5I59B 1B3HA 3B6WA 3C9HA 3K6WA 1VSOA 2PMSA 1UTHA 3PUZE 3UN6A 1GVCA 3IAZA 2XX9A 1DMBA 4F3PA 2F6GA 5FHOA 1P99A 5M2VA 5DJTB 5I2NB 4BDLA 5FTIA 4LQ2A 4IO6A 4ASWA 2Y7KA 3DP8A 4PP0A 2QJEA 4KQPA 2M5AB 4LZ8A 4ZEIA 1FTLA 3KEIA 2QS2A 3TUSA 4YB7A 1R9LA 1HSJA 4XIGQ 3I5OA 4HB1A 3S4UA 4OERA 3EHUA 1JM0A 3C33A 3FJ7A 2QPQA 3OOAA 3QSLA 1IITA 4IB2A 3U1OA 3MBPA 4QFKA 1GGGA 4DLDA 5F7VA 3LSFB 3B7DA 3VLVA 1HSLA 3R7XA 5CBNA 5I84A 3A3CA 4H0WA 1LBBA 1Y1MA 1N3XA 4NF8A 3G3GA 1FC2C 4NF6B 4X48A 1MY4A 2O84X 1H3DA 4KYDA 4G2ZA 3H6TA 4BLAA 3THIA 4ZEBA 1AL3A 1PBQA 3GXAA 3Q25A 1N76A 4DXUA 3ZKKA 3FXUA 5ITPA 1XOCA 1PC3A 4ZNCA 3IOWA 1IXIA 2I3WA 1U7MA 4R74A 4C1UA 3K02A 1SDXA 5K2XA 3G3IA 5BUUA 1S9TA 3ZS6A 4RPNA 1B1XA 4EDPA 3A09A 4OEUA 4GLIA 1MPCA 1Z7NE 3H7MA 2A5TB 2X7PA 3PUYE 4ZEFA 3C34A 4GXAA 1NFTA 3CRBA 5KCJA 3O29A 3PD8A 1IXHA 1B4HA 3FVOA 2X7QA 2V3TA 4KYSA 4UACA 3MVXA 1FTKA 2X26A 3IJXB 1BTJA 4H8JA 3TTKA 4HTGA 1NNTA 4LATA 4OFJA 4JWYA 4F3BA 3UIFA 2R6GE 3FZVA 3JZJA 2HXWA 5K5GB 2I3VA 1O7TA 4POXA 3O97A 3R6UA 1AMFA 2I49A 2ANJA 1UQWA 3SETA 2HAVA 2O7IA 5ELVA 4RYAA 4G77A 4ZEKA 2KUBA 1N7WA 2ALUA 3Q26A 4F1VA 1N7XA 3VLUA 4EXKA 1IQ7A 2W7YA 1B7HA 1FQDA 5AA4B 2O6AA 4ELRA 2RC9A 5TP9A 1VR5A 4E0XA 5F1QA 1YPNA 1ZLQA 5EYFA 2O1MA 3CVGA 1Z7ME 5EHMA 3KJTA 3C35A 1LB9A 1A55A 2DSFA 3K6UA 3W15C 1QVSA 3MJNA 3Q28A 1IZ1A 4HW8A 1ZTYA 3FASA 4H5GA 4OYVA 4FEDA 1NNKA 2UVJA 3ZKLA 1NL5A 4NTLA 3MW0A 1NMUA 1N84A 1OLAA 3FXEA 4YKIA 2Q2CA 1MQIA 2XXPA 2OK2A 4ISUA 5FTHA 4BDMA 1S50A 4MF3A 2KI7B 1VFDA 5I2NA 1CE2A 1JW4A 4QRZA 1MQDA 2F6PA 3BFUA 4HS7A 5I57B 2FYIA 3IJOB 3SEYA 2Q88A 1B3LA 1YCJA 4POWA 4LZ5A 3T9VA 4R6KA 5CMBA 3O6HA 1F9BA 2KZIA 4P0IA 2Y7IA 2ZNTA 2Q1KA 3IL1B 4FATA 4R75A 5I58B 2F5XA 4TQUQ 3RT8A 3TTLA 4GOEA 3FATA 4WEDA 4L17A 3HCQA 3SEXA 4AB5A 1D4NA 1WDNA 5FHNA 3FD3A 5JEIA 1S3JA 4NF6A 1MY0A 4FIMA 1SS1A 3DLNA 2ZMBA 3O28A 1POTA 2PVUA 1I6AA 4XXUA 3K6VA 5I2KA 1BIYA 4F31B 1SYHA 4H1XA 1LSTA 4QSCA 4MH5A 4G4PA 5FHMA 3H06B 1FQEA 2F7CA 2DE3A 3KJ7A 4U1ZA 1B46A 2A5TA 2HZLA 2F34A 4FAJA 2LXCB 4GOFA 4GODA 3FVKA 4NWCA 1NH7A 4BDRA 4R9FA 3TCFA 3QWOC 1PB9A 4Z7EA 3RT6B 4JWOA 5CMKA 2H25A 4DCXA 3SERA 5AA2D 4IY6A 2ONSA 4DCYA 3VDFA 3G7WA 2B87B 4LP2B 4O3BA 2UYFA 1FQFA 2OWTA 4IO2A 3SEUA 3PUVE 1OVBA 3CFZA 3QYTA 3ECRA 1LLSA 3VE1B 2R44A 3FXRA 3PMXA 4H6DA 4BXLA 2QRYA 1MQHA 3GLBA 1LGBC 3OEMA 2HFBA 5IKBA 2Q9TA 3T22A 1TFDA 1OMPA 1PDAA 3VVFA 4I62A 1R6ZA 1P1QA 3N6TA 1H76A 1ZW0A 2M0BA 5I56B 4KYEA 4F1UA 4KCDA 1EZOA 1B4ZA 2B88A 1NH8A 1II5A 3MPLA 4MLQA 5H8HB 3PMVA 3D4CA 4FEBA 4G8NA 1DOTA 3K1PA 2H9BA 5AA4A 3H03A 1MPBA 3ILTB 1MDQA 4K35A 4OETA 3B6QA 3HSTA 2BJJX 2ZYKA 2XXQA 2LXBA 2R71A 4FJPA 1MM7A 2R9JA 4YU0A 2GRVA 2H5YA 2QVAA 3MUQA 3RUMA 1QULA 5AA3A 4CPGA 1Q1KA 4Q0CA 2DWJA 3SEWA 1GV8A 2UVIA 4JSOA 4KD5A 4ZEDA 1QUIA 1N3WA 1B9JA 1US4A 4OFLA 2KIKA 3TDJA 2Y7PA 4U2RA 4MN4C 1FTOA 4NF4A 3SKPA 1A54A 3FV2A 3FJMA 1Q35A 5EHSA 1URSA 4LQ5A 5ISUA 4OTEA 2DVZA 4AB6A 2VHAA 1EU8A 4IO3A 5I57A 3B6TA 3S9MC 1OLCA 3FV1A 3VV5A 3WAEA 3O9PA 1J1NA 2OZZA 1EDLA 1A8FA 1LFHA 1PB7A 2Z23A 1ANFA 4GXSB 4R6YA 5AA2B 1B2HA 1M5CA 1LAHE 4F2OA 3K1NA 2F8DA 5I58A 1SI0A 2UVHA 1P1NA 2UXAA 3C4MA 1LT1A 2DE4A 4IO5A 3OO8A 4EXLA 5A5XB 1MH4A 3PH0A 3S2VA 1YAEA 1LAGE 3IOTA 1EH3A 3O6IA 4YMAA 2KZJA 4U1OA 3MP1A 4GIZA 2ZXTA 4HCWA 3K00A 3HHFA 2DWAA 1IXCA 1RKMA 3IX1A 4RA1A 3RGUA 1MRPA 1SW1A 3JYRA 2F97A 4PE5B 2A5SA 4JBZA 1GTKA 1PEBA 2RC7A 4F19A 4JSDA 3TCHA 3VFJA 4IO4A 1MXXA 1MXUA 4Q8RA 3N94A 4XTCQ 3Q27A 1Y3PA 1DPPA 5ICTA 4K3AA 4GWOA 4PFTA 5CRYA 2VD2A 5ITOA 3KGCA 2THIA 4QHQA 4LA9A 1RYOA 5AA1A 2B87A 1Y1ZA 2Z8DA 1ZIUA 3CIJA 2B89A 1XT8A 4O3CA 4BDNA 4OQOA 5CBOA 1DPEA 1WODA 4OVJA 2V25A 3HO7A 2DS9A 5HBCA 2DVCA 4LUBA 1NNPA 2DXYA 1UTBB 1O64A 1ZXGA 1SW5A 1R1NA 3I3VA 1TXFA 2NVUB 3K4UA 4K3FA 1S7YA 1MDP1 1EZPA 3OEKA 1MXVA 4GL0A 4QSDA 3C36A 1EDIA 2FNCA 2XXUA 2QS1A 3FVGA 5H8HA 2ZAEB 3T93B 2HCAA 5IAIA 1USYH 1CB6A 2K3RA 2GFEA 5TPAB 4ELOA 1EDJA 5DVJA 1A99A 4PQJA 1EDKA 2Q89A 4NF5B 1ELJA 1QW0A 4EQ9A 1NKXA 5H8FA 2AL4A 3L6HA 5CBSA 2OCUA 4ZECA 4ECFA 3RPWA 3U92A 3KN3A 2RKLA 1OQHA 1A8EA 1DSNA 1ZU0A 4OZ9A 3V5AA 3E9XA 2Z8FA 3DM0A 1BDCA 3QIMA 3MVYA 3KOTA 1URDA 3MAMA 5DJUB 4F3GA 1M5EA 4BDOA 4DIGA 5I59A 2WMMA 3RN8A 1DTZA 4EYYQ 1B7UA 1LCFA 3AXFA 4R2BA 4FE8A 2Z22A 2WKYA 5CI5A 1I6BA 2F7AA 4G8MA 3A3UA 4ZE8A 4OFOA 4C1TA 2B3BA 3MC2A 4YAHX 2D3IA 1JVYA 3LBSA 2M5AA 3M8UA 4ZDMA 4I1DA 3IOVA 3IO6A 2DE2A 1IXGA 3KN7A 3TKDA 1US5A 4KCCA 5AA2A 4ASVA 5B70A 2NUVA 2P2AA 4G8HA 1B7ZA 2F36A 4N07A 3OELA 4X9TA 3USDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2F7B A;  4LZ7 A;  5A5X A;  1QKA A;  3SDF A;  3O6G A;  3E3K A;  1H0T B;  1H45 A;  4ZS9 A;  3PU5 A;  4NPE A;  3TEL A;  5H8N B;  1BKA A;  2FA7 A;  1QKB A;  4F3S A;  2QS4 A;  4DZ1 A;  4IOI H;  3KBR A;  4DE8 A;  3P7I A;  5K2Y A;  1LAX A;  2RF1 A;  2RCB A;  4G68 C;  4RNS A;  2P58 A;  4RY1 A;  2Y84 A;  3CG1 A;  4AQ4 A;  1JW5 A;  4ONY A;  5EFW B;  3MHV A;  4GF8 A;  4NF8 B;  1FTM A;  1POY 1;  2B65 A;  2RKM A;  3PUW E;  1FQC A;  3IO4 A;  1LFI A;  3M3K A;  2I4C A;  1SBP A;  5CMC A;  1D9V A;  4XKR A;  4U4S A;  3T66 A;  2VOZ A;  4U4X A;  1XC1 A;  3LC8 A;  4WEP A;  2V3Q A;  2HEU A;  3KOS A;  4YKJ A;  4F2Q A;  1ZBM A;  1ZMG A;  1Y3Q A;  4Z0I A;  3ILU B;  1B6H A;  4N13 A;  3FGS A;  3HV1 A;  3ONM A;  4PFU A;  1LB8 A;  4KI0 E;  4JB7 A;  3EPE A;  3FVN A;  1BP5 A;  4H67 A;  2O1L A;  3G3H A;  4UA8 A;  1SW4 A;  4QF9 A;  4YB6 A;  1B0L A;  1JMB A;  1SQY A;  1VFE A;  1QUJ A;  3CSB A;  2ONR A;  2ZYM A;  2I58 A;  2XXW A;  2KLF A;  4R6H A;  2XXV A;  3CFX A;  5TPA A;  3MVW A;  5DEX B;  4HCY A;  3WAF A;  2NXO A;  1X0T A;  1Y20 A;  2HAU A;  2DP8 A;  1AIV A;  4XKQ A;  3KSX A;  3UK4 A;  3H3G A;  2QSX A;  1GR2 A;  3LSW A;  4M1V A;  3N6U A;  3FIR A;  3U94 A;  4M4G A;  3PV0 E;  3TTR A;  2VD3 A;  4OMB A;  2HQ0 A;  1JQF A;  2XXY A;  2XXR A;  3S9E A;  4QFN A;  4GQO A;  3E4R A;  1DEE G;  1Y9U A;  3Q29 A;  3C31 A;  3CSG A;  2E1S A;  2V3U A;  2O51 A;  3FJG A;  5H8Q B;  5L9S A;  3QXM A;  3H4Z A;  4JDF A;  2O68 A;  2ZYO A;  3DP4 A;  3JV9 A;  4NE4 A;  2QRX A;  2QMX A;  3BFT A;  2ONK E;  2P1S A;  3MZ9 A;  1OVT A;  3PPP A;  1Y47 A;  1U7J A;  3MQ9 A;  2YJP A;  2I0B A;  2PX1 A;  3CI8 A;  3N5L A;  2IA4 A;  4C0R A;  2YLN A;  3V89 B;  4U23 A;  4PET A;  4QSE A;  2GH9 A;  1P1U A;  4QFL A;  4LVQ A;  5CC2 A;  1MXY A;  3MVZ A;  2V84 A;  1SD3 A;  1JW1 A;  3TFL A;  3OO6 A;  2UVG A;  3FUZ A;  3O66 A;  3IB0 A;  3IB1 A;  2UWJ E;  4QFO A;  3IB2 A;  4H5F A;  5DTB A;  5J1D A;  2OLB A;  3LSX A;  1H0T A;  2UYE A;  3HN0 A;  3T9U A;  1N0T A;  1ZJL A;  4PFW A;  3S9L C;  5H8N A;  3PPQ A;  3OSR A;  1N04 A;  2GHB A;  1WVJ A;  4MBP A;  3EN3 A;  4YB5 A;  1FQB A;  1FCK A;  2XXT A;  4ZMD A;  2PBW A;  2XX8 A;  2PYY A;  4G68 B;  3PPN A;  1XS5 A;  4RK2 A;  4I9D A;  2DOJ A;  1TFA A;  3W9V A;  3TTM A;  1Y4T A;  4U21 A;  3KN8 A;  4NWD A;  3PUX E;  1B5H A;  4U22 A;  3MPK A;  1B40 A;  1EZ9 A;  2M8C A;  1Y3N A;  1HSE A;  2DWI A;  2O7U A;  1OQG A;  4GVO A;  2LR2 A;  2H98 A;  5JK4 A;  1P1O A;  3TAJ A;  2ZNS A;  5I2K B;  1AOV A;  4F18 A;  3OO9 A;  3RY3 A;  1KWH A;  4ND9 A;  2D21 A;  1T0K A;  4ELQ A;  3EHS A;  4DDD A;  2REG A;  3RNN A;  4F39 A;  3K1M A;  3ODB A;  3DP6 A;  4HKZ H;  3K01 A;  3D4G A;  5JTY B;  1MY3 A;  2Z8E A;  5DT6 A;  4OHN A;  4KHZ E;  1OVR A;  5HM4 B;  1ZKB A;  3K6X A;  3N26 A;  1IUD A;  1B51 A;  2GHA A;  2G29 A;  1H43 A;  1JVX A;  5H8S A;  4GFR A;  1Q2N A;  3PGF A;  3U8Q A;  4TLL B;  4TLM B;  3QAX A;  3L6G A;  1A40 A;  2DYX A;  4RJZ A;  4RK9 A;  3T9H B;  4H8I A;  3TMG A;  3TCG A;  5I56 A;  1USY E;  1B5I A;  3LR1 A;  4DXB A;  1RYX A;  3U72 A;  3MWB A;  3S9N C;  5DYH A;  2V93 A;  3PD9 A;  3MZ1 A;  4EQ7 A;  1FTJ A;  2I4B A;  4R73 A;  3LUY A;  5DEX A;  4WXJ A;  5KDT B;  3UA8 A;  2Q8J A;  4YKP A;  4EF2 A;  4ZZA A;  4E0W A;  1SVX B;  2XHD A;  1MH3 A;  1FQA A;  2PT1 A;  3T96 B;  3EF7 A;  2QS3 A;  1B1H A;  2I48 A;  1IEJ A;  1UIV A;  3VVD A;  2YPN A;  1JEV A;  1B58 A;  1MQJ A;  1SYI A;  4R2F A;  3T9X B;  1JNF A;  3V83 A;  1NNF A;  2ESN A;  4IGR A;  3IOU A;  2ABH A;  1OIB A;  4JXI A;  2RCA A;  3O2A A;  5H8Q A;  3U93 A;  4R72 A;  1LP1 B;  3TTN A;  4YKK A;  1IIW A;  2I8D A;  1B0H A;  5CBR A;  3UGW A;  1B3F A;  4X1D A;  1Y4C A;  3OSQ A;  3TQL A;  3TPA A;  3TEP A;  2DQV A;  3IOR A;  2NWJ A;  1MXW A;  3VVE A;  1URG A;  1MG1 A;  2Q2A A;  1B05 A;  4KFQ A;  5DVI A;  4KR5 A;  2OTK E;  3IR1 A;  2OJT A;  5TU0 A;  4EUO A;  2G93 A;  3H6V A;  4GRK A;  1B52 A;  1PB8 A;  4WWI A;  3RTW B;  4NF4 B;  4H65 A;  2QMW A;  2REJ A;  4YZZ A;  3PMW A;  3UP9 A;  3KG2 A;  2QL3 A;  4I8C A;  1UTH B;  1B32 A;  4IY5 A;  4HJG H;  4IGT A;  3G3F A;  4OES A;  1I6Q A;  2AYS A;  4ESX A;  3OEN A;  2ZNU A;  4Q5T A;  2SPZ A;  2RC8 A;  4XKN A;  2KS1 B;  4LON B;  4GD5 A;  3S1K A;  3C32 A;  4QFP A;  1ATG A;  2H4I A;  3H6W A;  1LFG A;  1TWY A;  1M5B A;  2HR3 A;  3VLW A;  2O69 A;  2E0S A;  3ZDM A;  4ZZE A;  3CG3 A;  1M5F A;  3ZSF A;  1EC5 A;  4ZE9 A;  4G68 A;  4OEN A;  4EQB A;  4BDQ A;  3OMB A;  4FEC A;  3OD7 A;  4FOR A;  1MS7 A;  3KZG A;  5L9O A;  3I6V A;  3BKI B;  1P1W A;  2XXH A;  1FW0 A;  4NED A;  2NOO A;  2I0C A;  3CR9 A;  1H44 A;  5LOM A;  1M5D A;  1D9Y A;  1MY1 A;  1LCT A;  5ICQ A;  3PPR A;  2DXR A;  4MFI A;  3R26 A;  1BLF A;  4YMB A;  3OO7 A;  3SEV A;  2DWH A;  3PPO A;  1MM6 A;  2CMO A;  4N6P A;  1A7L A;  2XD2 A;  3MP8 A;  1YTV A;  3VXB A;  1B3E A;  5JTY A;  2Y7R A;  4KPT A;  2OWS A;  4NPD A;  3VXC A;  2F78 A;  4OXV A;  2HZK A;  2PT2 A;  2LAO A;  1L5T A;  1OVV A;  2CZL A;  1UIU A;  3LSL A;  4IO7 A;  4P11 A;  1DTG A;  3TOD A;  1AH5 A;  1MFT A;  3RQT A;  1BDD A;  5L9M A;  5C39 A;  1XVX A;  2JWD A;  2OBG A;  2VGQ A;  3GBB A;  2F35 A;  3V8X B;  5KCJ B;  3HHG A;  3KSJ A;  4EF1 A;  1MY2 A;  3DEL B;  4NPF X;  2AIX A;  4XKP A;  1UTB A;  2I6E A;  1NVO A;  4GL8 A;  3KFM A;  2AL5 A;  5DVF A;  3M3F A;  4WKM A;  5B7D A;  1XVY A;  1R9Q A;  4OWD A;  2P0S A;  3SES A;  1B5J A;  4RPO A;  3GBA A;  4THI A;  3G3K A;  5KDT A;  1MXZ A;  5AE4 A;  3MZB A;  4RXL A;  4KJM A;  4F29 A;  4DXC A;  3OXN A;  3BBR A;  4P0G A;  5CMM A;  1O63 A;  3M3L A;  3HPI A;  3QUJ A;  1QUK A;  4OEV A;  4F22 A;  4NF5 A;  3F11 A;  1JEU A;  1VE4 A;  3RTF B;  1LAF E;  2VP1 A;  3K2D A;  5HPQ A;  1OVU A;  4ELP A;  3EQ1 A;  4NMY A;  3H6U A;  2H99 A;  1I69 A;  3FXQ A;  4X1B A;  1D3K A;  4R9G A;  3RLF E;  1TT1 A;  1SI1 A;  2XXX A;  3EHT A;  2Y7W A;  1B3G A;  3W9W A;  5BWJ A;  1MPD A;  1LBC A;  1LP1 A;  4O3A A;  4PFY A;  3RGY A;  3QK6 A;  3MP6 A;  5TP9 B;  2XXI A;  4Q30 B;  2B3F A;  4F1Y A;  5KZT A;  3IK6 B;  1PBP A;  3E13 X;  3CFL A;  5H8F B;  1MQG A;  2IEE A;  2ZYN A;  3TYH A;  4MLV A;  3TZA A;  3K0V A;  3FXD A;  2RIN A;  5L8D A;  3G3J A;  4YIC A;  3MZW B;  3QUF A;  5CM6 A;  1QJM A;  1JET A;  4ESW A;  1XHY A;  2D5W A;  2XD3 A;  3TQW A;  1SW2 A;  4TOZ A;  4GOT A;  4JWX A;  3GZG A;  2XX7 A;  3UOR A;  5I59 B;  1B3H A;  3B6W A;  3C9H A;  3K6W A;  1VSO A;  2PMS A;  1UTH A;  3PUZ E;  3UN6 A;  1GVC A;  3IAZ A;  2XX9 A;  1DMB A;  4F3P A;  2F6G A;  5FHO A;  1P99 A;  5M2V A;  5DJT B;  5I2N B;  4BDL A;  5FTI A;  4LQ2 A;  4IO6 A;  4ASW A;  2Y7K A;  3DP8 A;  4PP0 A;  2QJE A;  4KQP A;  2M5A B;  4LZ8 A;  4ZEI A;  1FTL A;  3KEI A;  2QS2 A;  3TUS A;  4YB7 A;  1R9L A;  1HSJ A;  4XIG Q;  3I5O A;  4HB1 A;  3S4U A;  4OER A;  3EHU A;  1JM0 A;  3C33 A;  3FJ7 A;  2QPQ A;  3OOA A;  3QSL A;  1IIT A;  4IB2 A;  3U1O A;  3MBP A;  4QFK A;  1GGG A;  4DLD A;  5F7V A;  3LSF B;  3B7D A;  3VLV A;  1HSL A;  3R7X A;  5CBN A;  5I84 A;  3A3C A;  4H0W A;  1LBB A;  1Y1M A;  1N3X A;  4NF8 A;  3G3G A;  1FC2 C;  4NF6 B;  4X48 A;  1MY4 A;  2O84 X;  1H3D A;  4KYD A;  4G2Z A;  3H6T A;  4BLA A;  3THI A;  4ZEB A;  1AL3 A;  1PBQ A;  3GXA A;  3Q25 A;  1N76 A;  4DXU A;  3ZKK A;  3FXU A;  5ITP A;  1XOC A;  1PC3 A;  4ZNC A;  3IOW A;  1IXI A;  2I3W A;  1U7M A;  4R74 A;  4C1U A;  3K02 A;  1SDX A;  5K2X A;  3G3I A;  5BUU A;  1S9T A;  3ZS6 A;  4RPN A;  1B1X A;  4EDP A;  3A09 A;  4OEU A;  4GLI A;  1MPC A;  1Z7N E;  3H7M A;  2A5T B;  2X7P A;  3PUY E;  4ZEF A;  3C34 A;  4GXA A;  1NFT A;  3CRB A;  5KCJ A;  3O29 A;  3PD8 A;  1IXH A;  1B4H A;  3FVO A;  2X7Q A;  2V3T A;  4KYS A;  4UAC A;  3MVX A;  1FTK A;  2X26 A;  3IJX B;  1BTJ A;  4H8J A;  3TTK A;  4HTG A;  1NNT A;  4LAT A;  4OFJ A;  4JWY A;  4F3B A;  3UIF A;  2R6G E;  3FZV A;  3JZJ A;  2HXW A;  5K5G B;  2I3V A;  1O7T A;  4POX A;  3O97 A;  3R6U A;  1AMF A;  2I49 A;  2ANJ A;  1UQW A;  3SET A;  2HAV A;  2O7I A;  5ELV A;  4RYA A;  4G77 A;  4ZEK A;  2KUB A;  1N7W A;  2ALU A;  3Q26 A;  4F1V A;  1N7X A;  3VLU A;  4EXK A;  1IQ7 A;  2W7Y A;  1B7H A;  1FQD A;  5AA4 B;  2O6A A;  4ELR A;  2RC9 A;  5TP9 A;  1VR5 A;  4E0X A;  5F1Q A;  1YPN A;  1ZLQ A;  5EYF A;  2O1M A;  3CVG A;  1Z7M E;  5EHM A;  3KJT A;  3C35 A;  1LB9 A;  1A55 A;  2DSF A;  3K6U A;  3W15 C;  1QVS A;  3MJN A;  3Q28 A;  1IZ1 A;  4HW8 A;  1ZTY A;  3FAS A;  4H5G A;  4OYV A;  4FED A;  1NNK A;  2UVJ A;  3ZKL A;  1NL5 A;  4NTL A;  3MW0 A;  1NMU A;  1N84 A;  1OLA A;  3FXE A;  4YKI A;  2Q2C A;  1MQI A;  2XXP A;  2OK2 A;  4ISU A;  5FTH A;  4BDM A;  1S50 A;  4MF3 A;  2KI7 B;  1VFD A;  5I2N A;  1CE2 A;  1JW4 A;  4QRZ A;  1MQD A;  2F6P A;  3BFU A;  4HS7 A;  5I57 B;  2FYI A;  3IJO B;  3SEY A;  2Q88 A;  1B3L A;  1YCJ A;  4POW A;  4LZ5 A;  3T9V A;  4R6K A;  5CMB A;  3O6H A;  1F9B A;  2KZI A;  4P0I A;  2Y7I A;  2ZNT A;  2Q1K A;  3IL1 B;  4FAT A;  4R75 A;  5I58 B;  2F5X A;  4TQU Q;  3RT8 A;  3TTL A;  4GOE A;  3FAT A;  4WED A;  4L17 A;  3HCQ A;  3SEX A;  4AB5 A;  1D4N A;  1WDN A;  5FHN A;  3FD3 A;  5JEI A;  1S3J A;  4NF6 A;  1MY0 A;  4FIM A;  1SS1 A;  3DLN A;  2ZMB A;  3O28 A;  1POT A;  2PVU A;  1I6A A;  4XXU A;  3K6V A;  5I2K A;  1BIY A;  4F31 B;  1SYH A;  4H1X A;  1LST A;  4QSC A;  4MH5 A;  4G4P A;  5FHM A;  3H06 B;  1FQE A;  2F7C A;  2DE3 A;  3KJ7 A;  4U1Z A;  1B46 A;  2A5T A;  2HZL A;  2F34 A;  4FAJ A;  2LXC B;  4GOF A;  4GOD A;  3FVK A;  4NWC A;  1NH7 A;  4BDR A;  4R9F A;  3TCF A;  3QWO C;  1PB9 A;  4Z7E A;  3RT6 B;  4JWO A;  5CMK A;  2H25 A;  4DCX A;  3SER A;  5AA2 D;  4IY6 A;  2ONS A;  4DCY A;  3VDF A;  3G7W A;  2B87 B;  4LP2 B;  4O3B A;  2UYF A;  1FQF A;  2OWT A;  4IO2 A;  3SEU A;  3PUV E;  1OVB A;  3CFZ A;  3QYT A;  3ECR A;  1LLS A;  3VE1 B;  2R44 A;  3FXR A;  3PMX A;  4H6D A;  4BXL A;  2QRY A;  1MQH A;  3GLB A;  1LGB C;  3OEM A;  2HFB A;  5IKB A;  2Q9T A;  3T22 A;  1TFD A;  1OMP A;  1PDA A;  3VVF A;  4I62 A;  1R6Z A;  1P1Q A;  3N6T A;  1H76 A;  1ZW0 A;  2M0B A;  5I56 B;  4KYE A;  4F1U A;  4KCD A;  1EZO A;  1B4Z A;  2B88 A;  1NH8 A;  1II5 A;  3MPL A;  4MLQ A;  5H8H B;  3PMV A;  3D4C A;  4FEB A;  4G8N A;  1DOT A;  3K1P A;  2H9B A;  5AA4 A;  3H03 A;  1MPB A;  3ILT B;  1MDQ A;  4K35 A;  4OET A;  3B6Q A;  3HST A;  2BJJ X;  2ZYK A;  2XXQ A;  2LXB A;  2R71 A;  4FJP A;  1MM7 A;  2R9J A;  4YU0 A;  2GRV A;  2H5Y A;  2QVA A;  3MUQ A;  3RUM A;  1QUL A;  5AA3 A;  4CPG A;  1Q1K A;  4Q0C A;  2DWJ A;  3SEW A;  1GV8 A;  2UVI A;  4JSO A;  4KD5 A;  4ZED A;  1QUI A;  1N3W A;  1B9J A;  1US4 A;  4OFL A;  2KIK A;  3TDJ A;  2Y7P A;  4U2R A;  4MN4 C;  1FTO A;  4NF4 A;  3SKP A;  1A54 A;  3FV2 A;  3FJM A;  1Q35 A;  5EHS A;  1URS A;  4LQ5 A;  5ISU A;  4OTE A;  2DVZ A;  4AB6 A;  2VHA A;  1EU8 A;  4IO3 A;  5I57 A;  3B6T A;  3S9M C;  1OLC A;  3FV1 A;  3VV5 A;  3WAE A;  3O9P A;  1J1N A;  2OZZ A;  1EDL A;  1A8F A;  1LFH A;  1PB7 A;  2Z23 A;  1ANF A;  4GXS B;  4R6Y A;  5AA2 B;  1B2H A;  1M5C A;  1LAH E;  4F2O A;  3K1N A;  2F8D A;  5I58 A;  1SI0 A;  2UVH A;  1P1N A;  2UXA A;  3C4M A;  1LT1 A;  2DE4 A;  4IO5 A;  3OO8 A;  4EXL A;  5A5X B;  1MH4 A;  3PH0 A;  3S2V A;  1YAE A;  1LAG E;  3IOT A;  1EH3 A;  3O6I A;  4YMA A;  2KZJ A;  4U1O A;  3MP1 A;  4GIZ A;  2ZXT A;  4HCW A;  3K00 A;  3HHF A;  2DWA A;  1IXC A;  1RKM A;  3IX1 A;  4RA1 A;  3RGU A;  1MRP A;  1SW1 A;  3JYR A;  2F97 A;  4PE5 B;  2A5S A;  4JBZ A;  1GTK A;  1PEB A;  2RC7 A;  4F19 A;  4JSD A;  3TCH A;  3VFJ A;  4IO4 A;  1MXX A;  1MXU A;  4Q8R A;  3N94 A;  4XTC Q;  3Q27 A;  1Y3P A;  1DPP A;  5ICT A;  4K3A A;  4GWO A;  4PFT A;  5CRY A;  2VD2 A;  5ITO A;  3KGC A;  2THI A;  4QHQ A;  4LA9 A;  1RYO A;  5AA1 A;  2B87 A;  1Y1Z A;  2Z8D A;  1ZIU A;  3CIJ A;  2B89 A;  1XT8 A;  4O3C A;  4BDN A;  4OQO A;  5CBO A;  1DPE A;  1WOD A;  4OVJ A;  2V25 A;  3HO7 A;  2DS9 A;  5HBC A;  2DVC A;  4LUB A;  1NNP A;  2DXY A;  1UTB B;  1O64 A;  1ZXG A;  1SW5 A;  1R1N A;  3I3V A;  1TXF A;  2NVU B;  3K4U A;  4K3F A;  1S7Y A;  1MDP 1;  1EZP A;  3OEK A;  1MXV A;  4GL0 A;  4QSD A;  3C36 A;  1EDI A;  2FNC A;  2XXU A;  2QS1 A;  3FVG A;  5H8H A;  2ZAE B;  3T93 B;  2HCA A;  5IAI A;  1USY H;  1CB6 A;  2K3R A;  2GFE A;  5TPA B;  4ELO A;  1EDJ A;  5DVJ A;  1A99 A;  4PQJ A;  1EDK A;  2Q89 A;  4NF5 B;  1ELJ A;  1QW0 A;  4EQ9 A;  1NKX A;  5H8F A;  2AL4 A;  3L6H A;  5CBS A;  2OCU A;  4ZEC A;  4ECF A;  3RPW A;  3U92 A;  3KN3 A;  2RKL A;  1OQH A;  1A8E A;  1DSN A;  1ZU0 A;  4OZ9 A;  3V5A A;  3E9X A;  2Z8F A;  3DM0 A;  1BDC A;  3QIM A;  3MVY A;  3KOT A;  1URD A;  3MAM A;  5DJU B;  4F3G A;  1M5E A;  4BDO A;  4DIG A;  5I59 A;  2WMM A;  3RN8 A;  1DTZ A;  4EYY Q;  1B7U A;  1LCF A;  3AXF A;  4R2B A;  4FE8 A;  2Z22 A;  2WKY A;  5CI5 A;  1I6B A;  2F7A A;  4G8M A;  3A3U A;  4ZE8 A;  4OFO A;  4C1T A;  2B3B A;  3MC2 A;  4YAH X;  2D3I A;  1JVY A;  3LBS A;  2M5A A;  3M8U A;  4ZDM A;  4I1D A;  3IOV A;  3IO6 A;  2DE2 A;  1IXG A;  3KN7 A;  3TKD A;  1US5 A;  4KCC A;  5AA2 A;  4ASV A;  5B70 A;  2NUV A;  2P2A A;  4G8H A;  1B7Z A;  2F36 A;  4N07 A;  3OEL A;  4X9T A;  3USD A; 
#chains in the Genus database with same CATH topology
 2F7B A;  4LZ7 A;  5A5X A;  2KNC B;  1QKA A;  3SDF A;  4H13 B;  3MUD A;  4H44 C;  3O6G A;  3E3K A;  1H0T B;  1H45 A;  2FY8 A;  4ZS9 A;  1HVV A;  4ZKP A;  3PU5 A;  1FDI A;  5B5E E;  4NPE A;  3TEL A;  5H8N B;  1BKA A;  3Q1M A;  2FA7 A;  2FXP A;  2WT7 B;  1QKB A;  3L71 E;  4F3S A;  2WVR A;  2QS4 A;  4HH2 A;  2GUS A;  2QIW A;  3B5N A;  4IOI H;  2FIX A;  4NHB A;  4DZ1 A;  1NUZ A;  1NTK D;  2KYV A;  3KBR A;  4DE8 A;  1YBK A;  3P7I A;  5K2Y A;  1P84 E;  1LAX A;  2RF1 A;  2RCB A;  4G68 C;  4UB8 E;  1NUY A;  5ET7 A;  1NU1 J;  4RNS A;  1KB9 I;  2P58 A;  1QL2 A;  1K04 A;  4RY1 A;  2Y84 A;  3CG1 A;  5CCG C;  4AQ4 A;  1JW5 A;  2WPQ A;  4XA4 A;  4ONY A;  3AE6 C;  3LW5 H;  4GWX A;  2YMK A;  1HUC A;  5EFW B;  3MHV A;  3E7K A;  4GF8 A;  4NF8 B;  5CCH A;  2OYI C;  1FTM A;  2L91 A;  1POY 1;  2B65 A;  2RKM A;  3PUW E;  5EYG A;  1FQC A;  3IO4 A;  1LFI A;  4PFB A;  3M3K A;  4GWZ A;  1VQP P;  3G71 P;  2I4C A;  1SBP A;  3H1I J;  2Q74 A;  2NPS D;  5CMC A;  1L4A B;  1D9V A;  1NU1 E;  4MX6 A;  4XKR A;  4N81 A;  4U4S A;  3L74 J;  3T66 A;  5AW2 B;  2VOZ A;  4U4X A;  1XC1 A;  3LC8 A;  4XFJ A;  1IMC A;  3V2Q A;  1G2C B;  4WEP A;  2V3Q A;  2I1J A;  3H25 A;  2HEU A;  3KOS A;  4YKJ A;  4F2Q A;  5BU5 A;  4PD4 D;  2HOD B;  4OVP A;  1ZBM A;  5APV A;  3C9I A;  4C7N B;  1ZMG A;  1Y3Q A;  4Z0I A;  3P32 A;  1FBD A;  3ILU B;  1B6H A;  4N13 A;  3H1I E;  4PE3 A;  3FGS A;  3HV1 A;  3ONM A;  4PFU A;  5AVW B;  4JVI A;  2YIU C;  1LB8 A;  3L74 E;  4KI0 E;  1K05 A;  2IFN A;  3H1H J;  4JB7 A;  1RH5 B;  5EQ9 A;  2QJY C;  3EPE A;  1YXI A;  3BCC G;  2K37 A;  3FVN A;  1BP5 A;  3E1I A;  3CD6 P;  5I5P A;  1NV7 A;  4H67 A;  3L75 J;  2O1L A;  3G3H A;  3CCS P;  5GTI E;  1N73 A;  3AEB C;  5KKZ C;  5KLV K;  3B8B A;  4I2L C;  4UA8 A;  1SW4 A;  2Y9Y A;  4QF9 A;  1H89 A;  4YB6 A;  4I7Z B;  3GHG B;  3VMZ A;  1B0L A;  1JMB A;  1Y9B A;  1SQY A;  3G4S P;  5EQ7 A;  2KLV A;  3H1H E;  1VFE A;  1QUJ A;  2ZT9 C;  1IZN B;  4TT3 H;  3HE5 A;  3CSB A;  1SQP G;  2ONR A;  2ZYM A;  2XNX A;  3K5B A;  2I58 A;  2XXW A;  2KLF A;  4R6H A;  3L75 E;  1FPK A;  1JB0 J;  1CI6 A;  4WY4 C;  3CX5 D;  2XXV A;  4W7Z A;  1YTZ I;  3CFX A;  2XDJ A;  5TPA A;  3MVW A;  1BGY G;  5DEX B;  3BCC D;  4AUW A;  1RF0 C;  4HCY A;  2CEX A;  3U65 A;  1GL2 B;  4M3L A;  3WAF A;  1FDM A;  2NXO A;  1X0T A;  1YHQ P;  1Y20 A;  2HAU A;  3PRJ A;  3A0B E;  1URQ B;  2DP8 A;  2WSF J;  1AIV A;  4XKQ A;  3V4W A;  3KSX A;  4EIJ A;  1EYK A;  3UK4 A;  2W6A A;  3H3G A;  2QSX A;  2H8P D;  3EFF K;  1GR2 A;  2L5V A;  1KOR A;  3U59 A;  3LSW A;  1VQ6 P;  4M1V A;  3HTK B;  3N6U A;  2C9L Y;  1LGH B;  3L71 G;  3FIR A;  4PDH A;  3AE4 C;  3U94 A;  4M4G A;  3PV0 E;  3TTR A;  2VD3 A;  4OMB A;  2HQ0 A;  1JQF A;  2XXY A;  1SQP D;  2XXR A;  3S9E A;  4QFN A;  4GQO A;  3E4R A;  1HBW A;  3T0J A;  1DEE G;  1Y9U A;  3Q29 A;  3C31 A;  1ZV8 A;  3V6I A;  1FZF A;  3W67 A;  1PGQ A;  3CSG A;  5TIS E;  1LTJ C;  2E1S A;  2V3U A;  2O51 A;  1SQX K;  1S72 P;  3FJG A;  4X8R A;  5H8Q B;  1VQ8 P;  1G1J A;  4B86 A;  1BGY D;  5L9S A;  2IYP A;  2JDI H;  2Y9Z A;  3QXM A;  2IBZ I;  1YZ0 A;  3H4Z A;  4JDF A;  2O68 A;  2ZYO A;  3DP4 A;  3JV9 A;  4NE4 A;  4XFE A;  2BCC J;  2QRX A;  1S2E A;  3O8Z A;  2QMX A;  3HE4 A;  3BFT A;  1NWQ A;  4DJG A;  2ONK E;  2P1S A;  3MZ9 A;  1OVT A;  5LTC A;  1PFI A;  4QXD A;  1NOH A;  3PPP A;  1SQB D;  4IL6 E;  1NYH A;  1Y47 A;  1YJW P;  1U7J A;  3L71 D;  2VRS A;  3MQ9 A;  1GW4 A;  2FFD A;  1QLE D;  2J59 M;  2YJP A;  1FZC A;  2W8Z A;  2I0B A;  1NU1 G;  4PF8 A;  2PX1 A;  1KFM A;  1MKM A;  1PIX A;  1GDT A;  1LBW A;  3CI8 A;  4HXV A;  3N5L A;  5APX A;  2IA4 A;  4P3L A;  1SQV J;  2OAR A;  5AW1 B;  2YLN A;  4C0R A;  2BCC E;  3V89 B;  4U23 A;  3T97 B;  2O01 J;  2Q8M A;  4PET A;  4QSE A;  2GH9 A;  4HE1 A;  1P1U A;  4QFL A;  4LVQ A;  1AFO A;  4LN5 A;  4PAI A;  3CMA P;  2NPS B;  5CC2 A;  5ET6 A;  2VPO A;  2PAJ A;  1MXY A;  4OVQ A;  3MVZ A;  2V84 A;  3H1I G;  1SD3 A;  1JW1 A;  2JEE A;  2BAS A;  3RPL A;  3TFL A;  3OO6 A;  3L74 G;  2UVG A;  3FUZ A;  1SQV E;  3O66 A;  1JP4 A;  3IB0 A;  2KQZ A;  3IB1 A;  2UWJ E;  2O01 N;  1KA0 A;  4QFO A;  2W27 A;  3TGU J;  3IB2 A;  1FBE A;  3HD7 A;  4H5F A;  5DTB A;  5J1D A;  1USE A;  1NU1 D;  2OLB A;  3LSX A;  1H0T A;  2UYE A;  3HN0 A;  3T9U A;  3CXH I;  1SFC D;  1N0T A;  1ZJL A;  2Q9I A;  1SQQ J;  4PFW A;  3S9L C;  5H8N A;  3PPQ A;  3OSR A;  1IK7 A;  1N04 A;  4GX3 A;  3H1H G;  2GHB A;  3E1R A;  1WVJ A;  2A45 I;  2AXC A;  4MBP A;  3EN3 A;  4YB5 A;  2KK7 A;  1FQB A;  1FCK A;  2XXT A;  4GWY A;  2AEF A;  3KXD A;  1LWU C;  2WPV B;  3L75 G;  3H1I D;  4ZMD A;  2PBW A;  2XX8 A;  2W83 C;  2PYY A;  5KJ7 C;  1N2D C;  2E5Y A;  4G68 B;  4PFI A;  3PPN A;  3OW2 O;  4PFR A;  3I5C A;  3WUV A;  2Y5K A;  1KB9 D;  1XS5 A;  4RK2 A;  1PGJ A;  4I9D A;  2DOJ A;  1TFA A;  1SQQ E;  3W9V A;  3TTM A;  1MFZ A;  4OVR A;  2B4M A;  1Y4T A;  3M91 A;  4U21 A;  5KTB A;  3KN8 A;  1HWT C;  1OW8 A;  3U1A A;  4NWD A;  2MJZ A;  3PUX E;  1B5H A;  4U22 A;  3MPK A;  5KAI E;  1B40 A;  2OYI B;  4I3Y A;  3KHU A;  1EZ9 A;  3VYI A;  1UII A;  3MIW A;  2YO2 A;  2H7H A;  2M8C A;  1Y3N A;  2FYN B;  1NKN A;  4HYT B;  4MIJ A;  4N78 E;  2JJK A;  1HSE A;  1T6A A;  1NTZ J;  2DWI A;  2O7U A;  4U7J A;  2E75 C;  1OQG A;  2LR2 A;  3H1H D;  2H98 A;  4GVO A;  5JK4 A;  2M8R A;  1P1O A;  3TAJ A;  2ZNS A;  3LIE A;  1J1E B;  2NRG A;  1NJI Q;  5I2K B;  4F18 A;  1AOV A;  2ZXE B;  4BWN A;  3P8C E;  1L4A A;  1JOC A;  3OO9 A;  3RY3 A;  1KWH A;  4ND9 A;  3L75 D;  2D21 A;  1T0K A;  4ELQ A;  4KXP A;  3F89 A;  3O6Q B;  3EHS A;  4DDD A;  2REG A;  3RNN A;  2C0X A;  1VQ4 P;  3S9O A;  4F39 A;  2Q6Q A;  3K1M A;  3DP6 A;  3ODB A;  2HOD A;  2AXT H;  4HKZ H;  1NTZ E;  4NGU A;  1E79 H;  4C7N A;  3D4G A;  3JC2 2;  3K01 A;  2K9Y A;  5JTY B;  5AW3 B;  1MY3 A;  2Z8E A;  5DT6 A;  1M1J A;  4OHN A;  4IFM A;  1JTH A;  1QEX A;  4KHZ E;  1OVR A;  5HM4 B;  1ZKB A;  2QJY B;  2KLU A;  4OAN A;  3K6X A;  3N26 A;  3EQ2 A;  3M9B A;  1QX8 A;  1IUD A;  1B51 A;  1NTK K;  1SPI A;  2GHA A;  2G29 A;  1H43 A;  1JVX A;  5EYH A;  1M1K Q;  5H8S A;  3WU2 E;  1GMJ A;  1D7M A;  1LBV A;  1Q2N A;  4GFR A;  4H45 A;  3A7O A;  1IK9 A;  3PGF A;  3U8Q A;  4TLL B;  4TLM B;  3QAX A;  4D6T J;  4DZO A;  5KKZ B;  1S4X A;  1A02 F;  2K9J B;  1Q9D A;  2YKO A;  4JF7 A;  3CXH H;  3L6G A;  4P9K A;  1YI2 P;  1A40 A;  2DYX A;  2BCC G;  4RJZ A;  1VQ9 P;  4RK9 A;  5KJ7 D;  1IFJ A;  3GHG A;  2WSC H;  2FBP A;  4Z1M H;  3T9H B;  4KHX A;  4H8I A;  2A45 H;  4DI3 D;  4L75 A;  1IMB A;  5GTH E;  2FXM A;  2QVU A;  3TCG A;  2WIT A;  3TMG A;  4NAP A;  5I56 A;  1VQK P;  2WTY A;  4BRY B;  1FE6 A;  1USY E;  4P47 A;  2POH A;  3BRT B;  1FBH A;  3AE9 C;  1B5I A;  2MKV A;  3LR1 A;  4DXB A;  1RYX A;  3U72 A;  3MWB A;  2V7Q H;  3S9N C;  4D6T E;  2GA1 A;  1KA1 A;  5DYH A;  2V93 A;  3PD9 A;  3MZ1 A;  4EQ7 A;  1FTJ A;  2I4B A;  1SQV G;  1FDO A;  1LTI C;  1R5S A;  4R73 A;  1VQ7 P;  3LUY A;  1YIT P;  4WXJ A;  5DEX A;  3UA8 A;  5KDT B;  2E75 D;  1ZRT E;  2Q8J A;  1GL2 A;  2VT5 A;  4YKP A;  3GLM A;  1WT6 A;  1OW6 A;  4EF2 A;  1URQ A;  4ZZA A;  3CX5 I;  1SVX B;  1QGX A;  2XHD A;  1DCU A;  1FQA A;  1MH3 A;  4E0W A;  3GMA A;  4DCK A;  2PT1 A;  3BIG A;  3T96 B;  4I1L A;  3PJS K;  3EF7 A;  2QS3 A;  2A06 G;  1B1H A;  4MCO A;  2I48 A;  1IEJ A;  1Q7Y Q;  1UIV A;  3VVD A;  1GL2 C;  2YPN A;  2B9B A;  1HJB A;  3HTK A;  5KAF H;  3RYD A;  1JEV A;  1B58 A;  1MQJ A;  3TK1 A;  1SYI A;  4R2F A;  3T9X B;  1JNF A;  1X8Y A;  3V83 A;  1NNF A;  3AED C;  1NV6 A;  3TGU G;  2ESN A;  1RF1 C;  4IGR A;  3ROJ A;  3IOU A;  3L70 J;  5L8R J;  1SFC B;  2ABH A;  1G0I A;  1IFM A;  4QBA A;  1OIB A;  2ITA A;  4JXI A;  1SQV D;  3I56 P;  5APQ A;  2RCA A;  1PP9 D;  3O2A A;  5H8Q A;  3U93 A;  4R72 A;  4PV1 C;  4NX1 A;  1LP1 B;  2W6B A;  3TTN A;  1RE4 A;  4YKK A;  1IIW A;  4IL6 X;  3GBB A;  3IN6 A;  2I8D A;  2O3J A;  1B0H A;  3UGW A;  3KZI H;  5CBR A;  1B3F A;  1BSH A;  3A5T A;  3EKI A;  5AW6 B;  4X1D A;  1IFN A;  1Y4C A;  5AW4 B;  4O7M A;  3OSQ A;  4PD4 H;  3TQL A;  4GWS A;  3TPA A;  1K9Y A;  3L70 E;  4N4U A;  2A06 D;  4N91 A;  3VOP A;  3TEP A;  2DQV A;  3IOR A;  2NWJ A;  2ZXX A;  2ZZW A;  1MXW A;  3VVE A;  1URG A;  1MG1 A;  2Q2A A;  1B05 A;  4KFQ A;  4X04 A;  1GU5 A;  4KR5 A;  5DVI A;  2OTK E;  3IR1 A;  3M0D A;  3TGU D;  2OJT A;  1IO4 A;  5TU0 A;  1GTW A;  4EUO A;  3H1L J;  2G93 A;  3H6V A;  2QJP C;  3QMF A;  4GRK A;  4U3F D;  4PJ0 E;  1B52 A;  1PB8 A;  4WWI A;  1FPE A;  1FJ9 A;  3T97 A;  3RTW B;  4NF4 B;  4H65 A;  2QMW A;  2REJ A;  1BSN A;  4L73 A;  3BAT A;  2NPS A;  3S4R A;  1NTZ G;  4YZZ A;  3PMW A;  1FBF A;  1FS0 E;  3UP9 A;  3KG2 A;  1KC8 Q;  1P84 I;  5IZZ A;  2QL3 A;  1OIP A;  4I8C A;  1UTH B;  1B32 A;  5AVT B;  3H1L E;  4Y28 J;  1FOS E;  1SQP K;  4N78 D;  4ZKU A;  4HJG H;  4IGT A;  4IY5 A;  3G3F A;  4OES A;  4JYB A;  1I6Q A;  3CLQ A;  2AYS A;  3MP7 B;  3TF5 A;  1EYI A;  4ESX A;  3AE8 C;  3OEN A;  5I7I A;  3CX5 H;  2ZNU A;  4Q5T A;  2SPZ A;  2RC8 A;  4XKN A;  3P8C D;  2KS1 B;  4LON B;  4GD5 A;  1NH4 A;  3S1K A;  1DK4 A;  3C32 A;  4QFP A;  1ATG A;  2H4I A;  2N1T C;  3RK2 D;  3H6W A;  1VDW A;  4GBV A;  3LW5 J;  2Z4E A;  1LFG A;  1TWY A;  1M5B A;  3M0A A;  2HR3 A;  2FYU D;  3LUZ A;  1LTB C;  3VLW A;  1H8A A;  4W80 A;  2O69 A;  4PV1 D;  1LWU B;  2E0S A;  1NTZ D;  3ZDM A;  1JMM A;  4ZZE A;  3CG3 A;  2BEZ F;  4PCD A;  1M5F A;  4D6T G;  2CPS A;  3ZSF A;  1SQB K;  5BU8 B;  1XI6 A;  1EC5 A;  3USD A;  4O7I A;  4ZE9 A;  4G68 A;  4OEN A;  4EQB A;  2IZ1 A;  2Z5H A;  4BDQ A;  3OMB A;  4XE5 B;  2PFX A;  3VMA A;  2V4H A;  1PL5 A;  5AW0 B;  5CCG A;  3A0H E;  1PV3 A;  4FEC A;  3OD7 A;  1W2E A;  4FOR A;  1MS7 A;  3KZG A;  5L9O A;  3I6V A;  3BKI B;  1P1W A;  3NFQ A;  1FBC A;  2XXH A;  2OYI A;  1AQ5 A;  1FPL A;  2OWZ A;  5APY A;  1FW0 A;  4NED A;  2NOO A;  2I0C A;  3CR9 A;  2E75 B;  1H44 A;  2Q5U A;  5LOM A;  1YQ4 C;  1M5D A;  1J1D B;  1D9Y A;  1MY1 A;  2IDB A;  1LCT A;  5B66 E;  2H89 C;  5ICQ A;  1N86 A;  2B4L A;  3PPR A;  3GYY A;  2DXR A;  2HLO A;  4MFI A;  2P3V A;  3R26 A;  4N6J A;  1FRP A;  1BLF A;  1XTG B;  4D6T D;  4YMB A;  2FYN C;  2Z5I A;  3OO7 A;  3SEV A;  2DWH A;  3PPO A;  5AW8 B;  1MM6 A;  3MTU E;  1NU1 K;  3O6Q A;  3RK3 C;  2CMO A;  4N6P A;  1J1E C;  1A7L A;  5FBP A;  1ZRT D;  2XD2 A;  3HUS C;  3MP8 A;  1S9K E;  1YTV A;  3VXB A;  1B3E A;  5JTY A;  2Y7R A;  3V8X B;  4KPT A;  4UB8 H;  4NPD A;  2OWS A;  3VXC A;  2F78 A;  4OXV A;  1NAF A;  4OWF A;  2FKW B;  1N8R Q;  2HZK A;  2PT2 A;  2LAO A;  3L70 G;  2N1T D;  2OX3 A;  1VPC A;  1OVV A;  5AVV B;  1L5T A;  2CZL A;  1UIU A;  3FX0 A;  3LSL A;  4IO7 A;  4P11 A;  3B71 A;  4H46 A;  1DTG A;  3ITK A;  1QGK B;  3TOD A;  5E79 E;  1MFT A;  1AH5 A;  3RQT A;  1DX7 A;  1IFP A;  1BDD A;  5L9M A;  5C39 A;  1XVX A;  1LTA C;  2JWD A;  2K9J A;  3TDK A;  3VTP C;  1BK4 A;  1LBY A;  2F35 A;  2OBG A;  2VGQ A;  3G6E P;  4PGN A;  5KCJ B;  1GW3 A;  3HHG A;  3KSJ A;  1LEV A;  3A3Y B;  4EF1 A;  1MY2 A;  4PF6 A;  3DEL B;  4NPF X;  4WVZ A;  2AIX A;  4XKP A;  1UTB A;  2I6E A;  5CHX A;  4PDD A;  1AA0 A;  4BRY A;  3LV0 A;  1IFD A;  1NVO A;  1VQM P;  4GL8 A;  3USS A;  2AL5 A;  3KFM A;  1VQO P;  3M3F A;  4MNI A;  4WKM A;  5DVF A;  4WY4 A;  5B7D A;  1XVY A;  4N6D A;  1R9Q A;  3SFE C;  4OWD A;  2P0S A;  3SES A;  3H1L G;  3BRV B;  1B5J A;  3FWN A;  3L70 D;  3GBA A;  4RPO A;  4THI A;  2GUV A;  2WSE J;  1RF0 A;  3G3K A;  5AVX B;  5KDT A;  1MXZ A;  5AE4 A;  4L76 A;  3MZB A;  1U57 A;  4RXL A;  1IC2 A;  5AVZ B;  4N8G A;  4KJM A;  4F29 A;  2O1J A;  4DXC A;  4A7P A;  3OXN A;  4I3E A;  3BBR A;  4P0G A;  5CMM A;  1O63 A;  1FZB A;  3HPI A;  3M3L A;  3B5N D;  1KB9 H;  3QUJ A;  2L5G B;  1E5W A;  2XU6 A;  2YKQ A;  1QUK A;  5A5L A;  3H6P A;  4OEV A;  1NAY A;  4L74 A;  1NTM J;  5GTI H;  4F22 A;  4NF5 A;  3RK3 D;  3F11 A;  1JEU A;  1VE4 A;  2CZH A;  3RTF B;  1LAF E;  1RF1 B;  2VP1 A;  3K2D A;  5HPQ A;  1OVU A;  4ELP A;  2PP6 A;  5IZ3 B;  3RK2 B;  1KFN A;  3EQ1 A;  4NMY A;  3H6U A;  1N7L A;  3MYU A;  2H99 A;  1LTJ A;  1I69 A;  3FXQ A;  3C1L A;  3H1L D;  4X1B A;  1D3K A;  4R9G A;  3RLF E;  1TT1 A;  5AVU B;  1SI1 A;  2R3S A;  2XXX A;  4PV1 B;  3EHT A;  3M06 A;  2Y7W A;  1B3G A;  3W9W A;  5BWJ A;  4P1E A;  1MPD A;  3B8E B;  1LBC A;  1BE3 J;  1LP1 A;  4O3A A;  1NTM E;  4PFY A;  3RGY A;  3QK6 A;  3MP6 A;  4PTK A;  5CMZ A;  5TP9 B;  1SFC C;  2XXI A;  4Q30 B;  2C0W A;  2B3F A;  4F1Y A;  5KZT A;  3IK6 B;  1PBP A;  1JO5 A;  5AW5 B;  4P1L A;  3E13 X;  3CFL A;  5H8F B;  1MQG A;  2IEE A;  2ZYN A;  3TYH A;  1NV5 A;  3A0B H;  4H0L C;  4MLV A;  2DDK A;  3TZA A;  1XTC C;  3K0V A;  3FXD A;  3GF7 A;  2RIN A;  5L8D A;  3G3J A;  4YIC A;  3MZW B;  2QJP B;  3QUF A;  1BE3 E;  3JCU E;  3KYQ A;  2JKV A;  1QJM A;  5CM6 A;  3IAO A;  1JET A;  1NUW A;  4RES B;  4ESW A;  1XHY A;  2D5W A;  2XD3 A;  3TQW A;  1AVO A;  3L4F A;  3BVH A;  1SW2 A;  3CL3 D;  4TOZ A;  1KYO E;  2GM4 A;  4GOT A;  5I3S A;  2QE7 H;  1EZV E;  4JVD A;  4MMP A;  4JWX A;  2WSF H;  3MGN A;  2HPC B;  1P84 D;  1YIJ P;  3GZG A;  4YXD C;  2KSJ A;  2XX7 A;  3UOR A;  1JY3 O;  5I59 B;  1B3H A;  4OGQ D;  3B6W A;  3C9H A;  3KC1 A;  3K6W A;  1VSO A;  2XA5 A;  1W2B O;  2PMS A;  1UTH A;  1NKZ B;  3PUZ E;  3UN6 A;  1GVC A;  3IR9 A;  3IAZ A;  2XX9 A;  1DMB A;  4F3P A;  2F6G A;  5FHO A;  2QJK C;  1P99 A;  5M2V A;  4G61 A;  5DJT B;  5I2N B;  4BDL A;  4NQ8 A;  5AVS B;  1HJ0 A;  2PCR A;  5FTI A;  1SQV K;  2KS1 A;  4LQ2 A;  2N1T B;  4IO6 A;  4ASW A;  2Y7K A;  3DP8 A;  4GX4 A;  4PP0 A;  2QJE A;  4IL6 H;  1CSB A;  2DW3 A;  2XWK A;  4KQP A;  2M5A B;  3R4Y A;  1PGO A;  3VN0 A;  4LZ8 A;  2KNC A;  4N6K A;  4ZEI A;  1JY2 N;  2PFY A;  3P7K A;  1FTL A;  3KEI A;  4NN3 A;  3LID A;  2QS2 A;  4NG7 A;  1NV0 A;  1LWU A;  1S9K D;  3TUS A;  2QA4 P;  4YB7 A;  1R9L A;  1HSJ A;  4XIG Q;  3I5O A;  1N7S C;  4HB1 A;  3S4U A;  4OER A;  5KJ7 A;  3EHU A;  1JM0 A;  2WT7 A;  3C33 A;  3FJ7 A;  2QPQ A;  4C46 A;  3OOA A;  3QSL A;  1X79 B;  1IIT A;  3AE2 C;  4IB2 A;  3U1O A;  4H0L D;  2XWV A;  4TLF A;  3MBP A;  4QFK A;  4IR8 A;  2WEF A;  3ISP A;  1GGG A;  4DLD A;  3WUT A;  3H32 B;  5F7V A;  1PGP A;  3L74 D;  3LSF B;  3B7D A;  1KIL E;  1HSL A;  4HE0 A;  3VLV A;  3D70 A;  4PGP A;  3R7X A;  2YXQ B;  5CBN A;  5I84 A;  2O01 H;  2OYH C;  2WX9 A;  3A3C A;  5BVZ A;  1MZ9 A;  1L0N J;  4H0W A;  2FIE A;  3CWB J;  1Q82 Q;  1LBB A;  1Y1M A;  4PAF A;  1QVG O;  1N3X A;  4NF8 A;  3G3G A;  1FC2 C;  2ZJS E;  5EQ8 A;  4NF6 B;  4X48 A;  1FPD A;  1EYJ A;  3N7N A;  1MY4 A;  2O84 X;  1H3D A;  1JY2 P;  4MAG A;  4PC9 A;  3U1C A;  3CCQ P;  4KYD A;  3A2A A;  5AVQ B;  4G2Z A;  3H6T A;  1J1D C;  3GF3 A;  3RK3 B;  2V4C A;  3THI A;  4BLA A;  2HPG A;  4ZEB A;  1AL3 A;  1G0H A;  1PBQ A;  1JY2 O;  3M9H A;  2E74 C;  3GXA A;  3Q25 A;  1N76 A;  3HUS B;  2WBB A;  4DXU A;  3ZKK A;  1L0N E;  1NTM G;  4DT0 A;  3FXU A;  5ITP A;  1XOC A;  1HGZ A;  1PC3 A;  4ZNC A;  3CWB E;  1G2C A;  3IOW A;  1IXI A;  2I3W A;  3AE1 C;  1U7M A;  1OW7 A;  5CJ0 A;  2QSI A;  4R74 A;  4C1U A;  3K02 A;  1S5L E;  2FYU K;  2XV5 A;  1SDX A;  4MEV A;  5K2X A;  3G3I A;  5BUU A;  1S9T A;  1NTZ K;  1RY3 A;  4RPN A;  1B1X A;  3ZS6 A;  1RQU A;  3SZP A;  4EDP A;  3HRN A;  3A09 A;  3D6Y A;  1NV3 A;  4OEU A;  4GLI A;  2CK3 H;  1GK4 A;  2G3A A;  1MPC A;  1Z7N E;  3H7M A;  2A5T B;  2X7P A;  1JNM A;  3PUY E;  4ZEF A;  1BE3 G;  1NHL A;  3C34 A;  3CCE P;  4GXA A;  4IFF A;  1A02 J;  1N7S D;  1FU1 A;  1NFT A;  3CRB A;  5KCJ A;  3FWL A;  1M8O B;  1YJ9 P;  3O29 A;  3PD8 A;  1IXH A;  1B4H A;  3FVO A;  2X7Q A;  2V3T A;  4KYS A;  4UAC A;  3MVX A;  1FTK A;  2X26 A;  3D1R A;  3E78 A;  3IJX B;  1NO4 A;  3H1K J;  1EZV G;  1BTJ A;  2Q3I A;  1NTM D;  4H8J A;  3II6 A;  3TTK A;  4HTG A;  1KTM A;  1NNT A;  4LAT A;  4I40 A;  4OFJ A;  3HD7 D;  4JWY A;  4F3B A;  3V2P A;  3VMX A;  2WSS H;  3UIF A;  2R6G E;  3JSV C;  1DBZ A;  3FZV A;  3JZJ A;  4H13 D;  3D71 A;  5LDZ A;  3CI9 A;  2HXW A;  5K5G B;  1S1C X;  1O7T A;  2I3V A;  3CHG A;  3FBP A;  3PLN A;  4EDF A;  4POX A;  4XEQ A;  1ZP0 C;  4OGQ B;  1KIL C;  3H1K E;  3O97 A;  3R6U A;  1BE3 D;  1AMF A;  2GQ1 A;  2I49 A;  4R4L A;  5KAF E;  2FXO A;  2ANJ A;  1SVF A;  1Q86 Q;  1AWB A;  3KPE A;  5AVR B;  1UQW A;  2WPR A;  1KYO D;  2ZVO B;  2E74 D;  2HAV A;  3SET A;  2O7I A;  1W5C E;  3AE5 C;  5ELV A;  1T8Z A;  1FBP A;  1EZV D;  1RF1 A;  4RYA A;  1WRG A;  2BCC D;  2KB7 P;  4UB6 E;  5DW8 A;  4G77 A;  4ZEK A;  5IZ3 A;  2KUB A;  1INP A;  1N7W A;  2ALU A;  3Q26 A;  3KDP B;  1FJP A;  1N7X A;  3VLU A;  4F1V A;  5GTH H;  1QL1 A;  1LT9 C;  4EXK A;  2P67 A;  1IQ7 A;  1VF5 D;  1ZME C;  2W7Y A;  2QG4 A;  1B7H A;  1FQD A;  3CC4 P;  4HE2 A;  4OVT A;  5AA4 B;  2O6A A;  3RK2 C;  4ELR A;  2M3B A;  2Y0C A;  5TJH A;  4PD4 E;  2RC9 A;  2OTL P;  5TP9 A;  3HFU A;  3G3Z A;  1JCC A;  1VR5 A;  4E0X A;  3AE7 C;  1SQQ G;  1NGM B;  1YPN A;  5F1Q A;  1ZLQ A;  1K9M Q;  3IF4 A;  4H0L B;  5EYF A;  1RDX A;  3SWY A;  2O1M A;  1NI9 A;  3ABV C;  1RQV A;  5ET5 A;  3CVG A;  1Z7M E;  5EHM A;  1DEB A;  3KJT A;  1M90 Q;  1OZH A;  3C35 A;  1LB9 A;  1VDF A;  1A55 A;  2DSF A;  1KQL A;  3K6U A;  3W15 C;  3BIH A;  2D2C C;  1QVS A;  2J5U A;  3R2P A;  3MJN A;  3Q28 A;  1IZ1 A;  1DD4 A;  3RL0 C;  1VQN P;  1ZTY A;  1EXI A;  4HW8 A;  5IZ1 A;  1YJN P;  3FAS A;  2M3E A;  4H5G A;  4OYV A;  4FED A;  1L0N G;  1R8E A;  1DD3 A;  1NNK A;  3CWB G;  2UVJ A;  3ZKL A;  1NL5 A;  2VPN A;  1KIL D;  1PZQ A;  4LGD E;  4NTL A;  3MW0 A;  4OVN F;  1NMU A;  1N84 A;  1SQQ D;  3HE4 B;  3RL0 g;  3FXE A;  1OLA A;  4YKI A;  2Q2C A;  1EXJ A;  1MQI A;  3SSU A;  2XXP A;  1ZLL A;  2QJK B;  2OK2 A;  4ISU A;  2K88 A;  5FTH A;  1FZG A;  1FPI A;  4BDM A;  3GG2 A;  1S50 A;  4MF3 A;  2KI7 B;  3AEE C;  1VFD A;  5I2N A;  2FFD B;  3CC7 P;  1CE2 A;  3V5B A;  1JW4 A;  4QRZ A;  2N9B A;  1MQD A;  2AEM A;  2N1T A;  2F6P A;  3BFU A;  1YYC A;  3L37 A;  1L0L J;  3Q2Y A;  4HS7 A;  5I57 B;  4YTP C;  2R5D A;  2FYI A;  2FYZ A;  3IJO B;  3SEY A;  2Q88 A;  3SWK A;  1M57 D;  1B3L A;  1YCJ A;  4POW A;  1L0N D;  2F3D A;  4LZ5 A;  1N7S B;  3T9V A;  3CWB D;  5AW7 B;  1X22 A;  1VL2 A;  4R6K A;  2IZ0 A;  2XKM A;  3AE3 C;  5CMB A;  3L73 J;  3MD0 A;  3O6H A;  1F9B A;  2KZI A;  4P0I A;  2Y7I A;  2ZNT A;  1SQB J;  1X9V A;  1L0L E;  1RE3 C;  3KC0 A;  2W6J H;  2Q1K A;  3IFC A;  1BGY E;  1AJY A;  3CCM P;  5H2F H;  3HD7 B;  3H32 A;  3H1K G;  2WQY C;  3IL1 B;  4FAT A;  4R75 A;  5I58 B;  2F5X A;  1HH0 A;  1WMK A;  2OYH B;  1HF9 A;  4TQU Q;  3RT8 A;  2IFM A;  3TTL A;  4GOE A;  2D2C D;  3T1B A;  3FAT A;  3CME P;  3L73 E;  3NTN A;  4WED A;  1AQT A;  4JQ0 D;  4AS5 A;  3RL0 D;  4L17 A;  4MHF A;  1K9Z A;  3MST A;  1T2K C;  1ZR2 A;  4O94 A;  3HCQ A;  3SEX A;  2WYK A;  1SQB E;  1LTS C;  4AB5 A;  1D4N A;  1WDN A;  5FHN A;  3MUD C;  1FJ6 A;  3FD3 A;  5JEI A;  2QVR A;  1USD A;  2G8Y A;  1S3J A;  2E5T A;  4MJO A;  4NF6 A;  1MY0 A;  1FPB A;  1SS1 A;  3EWK A;  3DLN A;  4FIM A;  2ZMB A;  4R4M A;  3O28 A;  1POT A;  2PVU A;  2E74 B;  1I6A A;  1S5L X;  4XXU A;  2E76 C;  3K6V A;  5B5E H;  5I2K A;  1BIY A;  3HUS A;  3B5N C;  4F31 B;  2FVZ A;  1SYH A;  4P8B A;  3B4S A;  3H1K D;  4H1X A;  3V2N A;  2AEJ A;  1FSA A;  1LST A;  4QSC A;  2YNY A;  2P7J A;  1Y8A A;  3F5H A;  4MH5 A;  3OA7 A;  4G4P A;  3RBX A;  4JPZ B;  1VF5 B;  5FHM A;  3H06 B;  3VP8 A;  1FQE A;  2CZK A;  1LNQ A;  1FBM A;  2F7C A;  3A0H H;  2DE3 A;  1P84 H;  4W7Y A;  4EI2 A;  3KJ7 A;  4U1Z A;  1B46 A;  2CEY A;  4Y99 C;  2A5T A;  2HZL A;  2F34 A;  1Z56 A;  1K73 Q;  1LBX A;  4FAJ A;  2LXC B;  5CCH C;  4GOF A;  4GOD A;  3FVK A;  5B66 H;  4NWC A;  1NH7 A;  4BDR A;  4R9F A;  3TCF A;  1OFC X;  5AW9 B;  1JCD A;  3QWO C;  1PB9 A;  4JVC A;  5ESY A;  3RT6 B;  4Z7E A;  4JWO A;  5APU A;  2XZR A;  5CMK A;  2PGD A;  2H25 A;  1FZA A;  4DCX A;  3SER A;  2HYN A;  3W68 A;  5AA2 D;  4IY6 A;  4XF5 A;  2ONS A;  5KLV J;  4DCY A;  1M1J B;  2KXP B;  1RHZ B;  3VDF A;  4H44 D;  3G7W A;  2B87 B;  1JTH B;  1LBZ A;  4LP2 B;  4O3B A;  2UYF A;  2N9Y B;  1FQF A;  1T2K D;  1UIX A;  2OWT A;  1KB9 E;  4IO2 A;  1H88 A;  4MNC A;  1KIL B;  3SEU A;  3CC2 P;  3PUV E;  3TNU B;  1OVB A;  1IMA A;  3CFZ A;  3QYT A;  3ECR A;  1LLS A;  3VE1 B;  5IM2 A;  1CZQ A;  2R44 A;  3FXR A;  3PMX A;  4H6D A;  5APW A;  4BXL A;  2P2U A;  1MQH A;  2QRY A;  5J16 A;  3SWF A;  3GLB A;  1LGB C;  3OEM A;  5KLV E;  2HFB A;  5E79 H;  5IKB A;  2OGU A;  2Q9T A;  3T22 A;  2E76 D;  1TFD A;  1OMP A;  1PDA A;  3VVF A;  4OGQ C;  4I62 A;  3KQG A;  1P1Q A;  3P8M C;  1YQ3 C;  1R6Z A;  1L2P A;  3N6T A;  1H76 A;  2I1K A;  1ZW0 A;  2M0B A;  1N73 C;  5I56 B;  1YTZ T;  1LTG C;  4KYE A;  4F1U A;  4KCD A;  1EZO A;  3QH9 A;  1B4Z A;  2QVV A;  2B88 A;  1NH8 A;  1LT9 B;  5CCG D;  4NF0 A;  3CCJ P;  1II5 A;  1RDY A;  2QFL A;  4LC1 A;  1KYO I;  3MPL A;  4MLQ A;  5AVY B;  5H8H B;  2OYO A;  1Q81 Q;  1L0L G;  3PMV A;  3D4C A;  1EZV I;  4FEB A;  4G8N A;  4PBH A;  2NZ2 A;  1DOT A;  1IFI A;  3K1P A;  2H9B A;  1SFC A;  5KLI C;  5AA4 A;  3H03 A;  1JY3 N;  1MPB A;  3ILT B;  1MDQ A;  4K35 A;  2HXR A;  4YPC A;  4OET A;  3B6Q A;  3HST A;  1LJ2 A;  2BJJ X;  5CCH D;  2P3N A;  3L73 G;  2ZYK A;  2JWA A;  1NTM K;  1SQX J;  2XXQ A;  2LXB A;  2R71 A;  4FJP A;  2WWW A;  1MM7 A;  2R9J A;  4YU0 A;  1CW5 A;  1SQB G;  4DOJ A;  2GRV A;  3AEF C;  5M1B A;  2H5Y A;  1KV4 A;  2QVA A;  3H1J J;  3MUQ A;  4N8Y A;  3RUM A;  1QUL A;  4I6M C;  5AA3 A;  2D2C B;  3Q3D A;  4JYC A;  4CPG A;  3CPW O;  1Q1K A;  4Q0C A;  4AS4 A;  2DWJ A;  3SEW A;  1BCC J;  3RL0 B;  1GV8 A;  2WSE H;  3VMY A;  2UVI A;  4JSO A;  4KD5 A;  2IPP A;  2PFZ A;  1QUI A;  4ZED A;  1K8A Q;  1N3W A;  1L0L D;  1SQX E;  5EQA A;  2E43 A;  1T3U A;  1B9J A;  1US4 A;  4OFL A;  2KIK A;  2K1A A;  4FBP A;  3TDJ A;  2YXR B;  2Y7P A;  2E42 A;  3NOH A;  4U2R A;  4MN4 C;  1FTO A;  4NF4 A;  3H1J E;  3SKP A;  1A54 A;  2HG5 D;  3FV2 A;  3B50 A;  1JY3 P;  3L73 D;  1VQ5 P;  1BCC E;  3FJM A;  5TIS H;  1Q35 A;  5EHS A;  1URS A;  2JJL A;  2XXK A;  4LQ5 A;  1OXZ A;  2H88 C;  2R8T A;  5ISU A;  4OTE A;  2ZT9 D;  1M56 D;  2YMY A;  1HTL C;  4OVS A;  2DVZ A;  2QEX P;  4AB6 A;  4GKG A;  2VHA A;  1EU8 A;  4IO3 A;  1Q90 D;  5I57 A;  4WY4 D;  2KR0 A;  2XWI A;  1PP9 J;  5CJ4 A;  4RKU J;  4KT0 J;  4P56 A;  1HGV A;  3B6T A;  1OWA A;  3S9M C;  4WBA A;  3JCU H;  2FFD C;  2P1J A;  1OLC A;  3FV1 A;  5ET8 A;  1GU4 A;  3VV5 A;  3WAE A;  1FZC C;  3O9P A;  1J1N A;  3VP9 A;  3IFM A;  1N7S A;  2OZZ A;  3PTZ A;  1NV4 A;  1FJK A;  4IFD K;  1RDZ A;  1KYO H;  1EDL A;  1TU3 F;  2W90 A;  1JEK A;  3L35 A;  3CCR P;  1A8F A;  1LFH A;  1PB7 A;  2Z23 A;  1ANF A;  4GXS B;  2WPS A;  1EQ7 A;  1PP9 E;  3L72 J;  4R6Y A;  5AA2 B;  2IBZ E;  2O1K A;  1B2H A;  1M5C A;  1KQF B;  2KSE A;  4GDO A;  1LAH E;  4F2O A;  3K1N A;  4H44 B;  2F8D A;  4GWU A;  5I58 A;  4U3F J;  2OYH A;  1SI0 A;  2UVH A;  3AEG C;  1P1N A;  5KLV G;  2UXA A;  3C4M A;  1KMI Z;  1LT1 A;  2A06 E;  2DE4 A;  1NV1 A;  2MKZ A;  4IO5 A;  3OO8 A;  4EXL A;  5A5X B;  1MH4 A;  3HD7 C;  3PH0 A;  1YYZ A;  3S2V A;  1YAE A;  2ZZX A;  1SQQ K;  1LAG E;  3FXB A;  3PP5 A;  3IOT A;  4H13 C;  1EH3 A;  3O6I A;  4YMA A;  3KBZ A;  3L72 E;  2KZJ A;  4U1O A;  1MUU A;  3MP1 A;  3TGU E;  4GIZ A;  4C7R A;  2ZXT A;  4HCW A;  2CZI A;  2ZYG A;  3K00 A;  1PPJ E;  3HHF A;  2E76 B;  1IXC A;  2DWA A;  2HHM A;  3Q5P A;  4PBQ A;  4U3F E;  1RKM A;  2F3B A;  3B5N B;  3M9Q A;  3IX1 A;  4RA1 A;  3RGU A;  1MRP A;  4GT1 A;  1SW1 A;  2LKM A;  4GIF A;  3JYR A;  1AV1 A;  2AXT E;  2F97 A;  4PE5 B;  2A5S A;  2QM7 A;  4JBZ A;  1GTK A;  1PEB A;  2WSC J;  1FTA A;  2RC7 A;  1L0N K;  2ZFC A;  5KLV D;  4F19 A;  4JSD A;  3TCH A;  2HFE D;  2FYU J;  3VFJ A;  4IO4 A;  1MXX A;  1IME A;  4Y99 B;  3NMD A;  1MXU A;  1GZL A;  1ZN5 A;  4Q8R A;  3N94 A;  1VF5 C;  2V7Q J;  4XTC Q;  3Q27 A;  1Y3P A;  2YO3 A;  4N17 A;  3CCL P;  3CXH E;  2R32 A;  1IMD A;  1DPP A;  5KAI H;  4DI4 B;  1NTK J;  5ICT A;  2QM8 A;  3PTY A;  4K3A A;  4GWO A;  3G9R A;  3Q5S A;  2R3C A;  1SQX G;  4PFT A;  3WUU A;  5CRY A;  2VD2 A;  5ITO A;  1KQG B;  3KGC A;  2FYU E;  2RN0 A;  1IJD B;  1L4A C;  2THI A;  4GWW A;  2R5B A;  3IFA A;  4QHQ A;  3H1J G;  1FZE A;  4LLH A;  4LA9 A;  2YIU B;  1RYO A;  2B87 A;  5AA1 A;  1Y1Z A;  4MNP A;  2Z8D A;  1ZIU A;  1BCC G;  3CIJ A;  2B89 A;  2WYP A;  4O8M A;  1NTK E;  4PD4 I;  1XT8 A;  1M7L A;  4O3C A;  5F24 A;  1S5L H;  1KIL A;  4OA4 A;  4BDN A;  3CCU P;  3NXS A;  1M1J C;  3TNU A;  4OQO A;  4GBW A;  5CBO A;  1OMI A;  2Q7C A;  1DPE A;  1WOD A;  1FPG A;  4RO0 A;  4OVJ A;  2V25 A;  2JO1 A;  3HO7 A;  2DS9 A;  5HBC A;  1D9Q A;  2DVC A;  4LUB A;  1NNP A;  2Y0E A;  3EFG A;  5APS A;  2P10 A;  3AEC C;  1NUX A;  1SQX D;  1N73 B;  2Q3E A;  2DXY A;  2ZT9 B;  1FPJ A;  1UTB B;  2KP8 A;  1O64 A;  3WU2 H;  2IX7 C;  1ZXG A;  1SW5 A;  1R1N A;  4AYC A;  3I3V A;  1TXF A;  2NVU B;  3K4U A;  3V2R A;  4K3F A;  1S7Y A;  1MDP 1;  1EZP A;  3OEK A;  1MXV A;  1FBG A;  4GL0 A;  3H1J D;  1OX3 A;  4QSD A;  2BJI A;  4WY4 B;  1LT9 A;  2PRR A;  4I7Z C;  3GHG C;  3C36 A;  1KZ8 A;  3N4X A;  1JUN A;  1EDI A;  2FNC A;  2C9N Y;  2XXU A;  2QS1 A;  1MV8 A;  3FVG A;  1KD1 Q;  3HE5 B;  2ZZV A;  1BCC D;  5H8H A;  2ZAE B;  5KLI B;  4N3Y B;  3UIA A;  1NV2 A;  3T93 B;  1PP9 G;  3RBZ A;  2IBZ G;  2J58 A;  3OAK A;  2HCA A;  5IAI A;  1CI6 B;  1USY H;  2ZYA A;  1CB6 A;  3WMM 0;  1SLQ A;  2K3R A;  3KZI E;  2GFE A;  3E79 A;  5TPA B;  3OJA B;  2RMZ A;  2H43 A;  1GK6 A;  4OH8 B;  2FBW C;  4ELO A;  1EDJ A;  5DVJ A;  1A99 A;  4PQJ A;  1EDK A;  4QMA A;  2Q89 A;  1ELJ A;  4NF5 B;  1J2J B;  4N15 A;  2CPB A;  1URQ C;  1QW0 A;  2ZYD A;  1L4A D;  3PHL A;  3L72 G;  4EQ9 A;  2IYO A;  2RH0 A;  1NKX A;  3CCV P;  5H8F A;  2AL4 A;  3L6H A;  5CBS A;  2OCU A;  1KZU B;  4ZEC A;  4ECF A;  1PPJ G;  3RPW A;  4U3F G;  3U92 A;  1LTJ B;  4UB6 H;  1FPF A;  5T3J A;  3KN3 A;  1KQS O;  2RKL A;  1OQH A;  2JP3 A;  2IBZ D;  5APT A;  1A8E A;  1DSN A;  1ZU0 A;  4OZ9 A;  3V5A A;  3E9X A;  2BEQ D;  1G1I A;  2Z8F A;  2XND H;  3Q5R A;  3BCC J;  4YXW H;  2OQQ A;  3DM0 A;  1BDC A;  3QIM A;  4WB4 A;  3KOT A;  3MVY A;  1URD A;  3MAM A;  2HPC A;  5DJU B;  4F3G A;  3D6Z A;  2ZVN B;  1M5E A;  4BDO A;  4DIG A;  1RE4 C;  3I55 P;  5I59 A;  2WMM A;  3AEA C;  1DTZ A;  3RN8 A;  4EYY Q;  1B7U A;  3CX5 E;  3L72 D;  1LCF A;  3C8V A;  2WBD A;  3AXF A;  3SFD C;  4R2B A;  1PPJ D;  4FE8 A;  3BCC E;  2Z22 A;  3A29 A;  2WKY A;  1SQP J;  5CI5 A;  1I6B A;  2F7A A;  2WZ7 A;  3BAS A;  3TSI A;  3A3U A;  4G8M A;  1FZC B;  4GX6 A;  4OFO A;  2JR8 A;  2A45 G;  4ZE8 A;  2B3B A;  4C1T A;  4PAK A;  3MC2 A;  4YAH X;  2FYU G;  3FGA D;  3RK3 E;  1ZR4 A;  3M0D C;  1FOS F;  1SP4 A;  2D3I A;  4UAB A;  1JVY A;  1CNQ A;  1QVF O;  3LBS A;  2M5A A;  4O9B A;  1BGY J;  3M8U A;  4ZDM A;  4I1D A;  4EOT A;  2Y0D A;  3IOV A;  3IO6 A;  2DE2 A;  2YKP A;  3TYY A;  5H2F E;  1GD2 E;  1FAV A;  1RE3 A;  4PJ0 H;  3V4Q A;  1IXG A;  5IGA A;  3KN7 A;  1IMF A;  1NTK G;  3TKD A;  1US5 A;  2NPS C;  1SQP E;  4KCC A;  2OTJ P;  2FHY A;  1GL2 D;  5AA2 A;  2KOG A;  4ASV A;  1DH3 A;  1T3J A;  2Y5L A;  5B70 A;  1AVY A;  2NUV A;  1URQ D;  3RPL B;  2P2A A;  1KN7 A;  4AQR D;  1VQL P;  4G8H A;  1B7Z A;  1ZOY C;  1L0L K;  3L71 J;  2F36 A;  1R5L A;  4RJT A;  3CXH D;  3GW6 A;  2XWO A;  1DIP A;  3OEL A;  4N07 A;  4X9T A;  1LTT C;  3L36 A; 
#chains in the Genus database with same CATH homology
 2F7B A;  4LZ7 A;  5A5X A;  1QKA A;  3SDF A;  3O6G A;  3E3K A;  1H0T B;  1H45 A;  4ZS9 A;  3PU5 A;  4NPE A;  3TEL A;  5H8N B;  1BKA A;  2FA7 A;  1QKB A;  4F3S A;  2QS4 A;  4DZ1 A;  4IOI H;  3KBR A;  4DE8 A;  3P7I A;  5K2Y A;  1LAX A;  2RF1 A;  2RCB A;  4G68 C;  4RNS A;  2P58 A;  4RY1 A;  2Y84 A;  3CG1 A;  4AQ4 A;  1JW5 A;  4ONY A;  5EFW B;  3MHV A;  4GF8 A;  4NF8 B;  1FTM A;  1POY 1;  2B65 A;  2RKM A;  3PUW E;  1FQC A;  3IO4 A;  1LFI A;  3M3K A;  2I4C A;  1SBP A;  5CMC A;  1D9V A;  4XKR A;  4U4S A;  3T66 A;  2VOZ A;  4U4X A;  1XC1 A;  3LC8 A;  4WEP A;  2V3Q A;  2HEU A;  3KOS A;  4YKJ A;  4F2Q A;  1ZBM A;  1ZMG A;  1Y3Q A;  4Z0I A;  3ILU B;  1B6H A;  4N13 A;  3FGS A;  3HV1 A;  3ONM A;  4PFU A;  1LB8 A;  4KI0 E;  4JB7 A;  3EPE A;  3FVN A;  1BP5 A;  4H67 A;  2O1L A;  3G3H A;  4UA8 A;  1SW4 A;  4QF9 A;  4YB6 A;  1B0L A;  1JMB A;  1SQY A;  1VFE A;  1QUJ A;  3CSB A;  2ONR A;  2ZYM A;  2I58 A;  2XXW A;  2KLF A;  4R6H A;  2XXV A;  3CFX A;  5TPA A;  3MVW A;  5DEX B;  4HCY A;  3WAF A;  2NXO A;  1X0T A;  1Y20 A;  2HAU A;  2DP8 A;  1AIV A;  4XKQ A;  3KSX A;  3UK4 A;  3H3G A;  2QSX A;  1GR2 A;  3LSW A;  4M1V A;  3N6U A;  3FIR A;  3U94 A;  4M4G A;  3PV0 E;  3TTR A;  2VD3 A;  4OMB A;  2HQ0 A;  1JQF A;  2XXY A;  2XXR A;  3S9E A;  4QFN A;  4GQO A;  3E4R A;  1DEE G;  1Y9U A;  3Q29 A;  3C31 A;  3CSG A;  2E1S A;  2V3U A;  2O51 A;  3FJG A;  5H8Q B;  5L9S A;  3QXM A;  3H4Z A;  4JDF A;  2O68 A;  2ZYO A;  3DP4 A;  3JV9 A;  4NE4 A;  2QRX A;  2QMX A;  3BFT A;  2ONK E;  2P1S A;  3MZ9 A;  1OVT A;  3PPP A;  1Y47 A;  1U7J A;  3MQ9 A;  2YJP A;  2I0B A;  2PX1 A;  3CI8 A;  3N5L A;  2IA4 A;  4C0R A;  2YLN A;  3V89 B;  4U23 A;  4PET A;  4QSE A;  2GH9 A;  1P1U A;  4QFL A;  4LVQ A;  5CC2 A;  1MXY A;  3MVZ A;  2V84 A;  1SD3 A;  1JW1 A;  3TFL A;  3OO6 A;  2UVG A;  3FUZ A;  3O66 A;  3IB0 A;  3IB1 A;  2UWJ E;  4QFO A;  3IB2 A;  4H5F A;  5DTB A;  5J1D A;  2OLB A;  3LSX A;  1H0T A;  2UYE A;  3HN0 A;  3T9U A;  1N0T A;  1ZJL A;  4PFW A;  3S9L C;  5H8N A;  3PPQ A;  3OSR A;  1N04 A;  2GHB A;  1WVJ A;  4MBP A;  3EN3 A;  4YB5 A;  1FQB A;  1FCK A;  2XXT A;  4ZMD A;  2PBW A;  2XX8 A;  2PYY A;  4G68 B;  3PPN A;  1XS5 A;  4RK2 A;  4I9D A;  2DOJ A;  1TFA A;  3W9V A;  3TTM A;  1Y4T A;  4U21 A;  3KN8 A;  4NWD A;  3PUX E;  1B5H A;  4U22 A;  3MPK A;  1B40 A;  1EZ9 A;  2M8C A;  1Y3N A;  1HSE A;  2DWI A;  2O7U A;  1OQG A;  4GVO A;  2LR2 A;  2H98 A;  5JK4 A;  1P1O A;  3TAJ A;  2ZNS A;  5I2K B;  1AOV A;  4F18 A;  3OO9 A;  3RY3 A;  1KWH A;  4ND9 A;  2D21 A;  1T0K A;  4ELQ A;  3EHS A;  4DDD A;  2REG A;  3RNN A;  4F39 A;  3K1M A;  3ODB A;  3DP6 A;  4HKZ H;  3K01 A;  3D4G A;  5JTY B;  1MY3 A;  2Z8E A;  5DT6 A;  4OHN A;  4KHZ E;  1OVR A;  5HM4 B;  1ZKB A;  3K6X A;  3N26 A;  1IUD A;  1B51 A;  2GHA A;  2G29 A;  1H43 A;  1JVX A;  5H8S A;  4GFR A;  1Q2N A;  3PGF A;  3U8Q A;  4TLL B;  4TLM B;  3QAX A;  3L6G A;  1A40 A;  2DYX A;  4RJZ A;  4RK9 A;  3T9H B;  4H8I A;  3TMG A;  3TCG A;  5I56 A;  1USY E;  1B5I A;  3LR1 A;  4DXB A;  1RYX A;  3U72 A;  3MWB A;  3S9N C;  5DYH A;  2V93 A;  3PD9 A;  3MZ1 A;  4EQ7 A;  1FTJ A;  2I4B A;  4R73 A;  3LUY A;  5DEX A;  4WXJ A;  5KDT B;  3UA8 A;  2Q8J A;  4YKP A;  4EF2 A;  4ZZA A;  4E0W A;  1SVX B;  2XHD A;  1MH3 A;  1FQA A;  2PT1 A;  3T96 B;  3EF7 A;  2QS3 A;  1B1H A;  2I48 A;  1IEJ A;  1UIV A;  3VVD A;  2YPN A;  1JEV A;  1B58 A;  1MQJ A;  1SYI A;  4R2F A;  3T9X B;  1JNF A;  3V83 A;  1NNF A;  2ESN A;  4IGR A;  3IOU A;  2ABH A;  1OIB A;  4JXI A;  2RCA A;  3O2A A;  5H8Q A;  3U93 A;  4R72 A;  1LP1 B;  3TTN A;  4YKK A;  1IIW A;  2I8D A;  1B0H A;  5CBR A;  3UGW A;  1B3F A;  4X1D A;  1Y4C A;  3OSQ A;  3TQL A;  3TPA A;  3TEP A;  2DQV A;  3IOR A;  2NWJ A;  1MXW A;  3VVE A;  1URG A;  1MG1 A;  2Q2A A;  1B05 A;  4KFQ A;  5DVI A;  4KR5 A;  2OTK E;  3IR1 A;  2OJT A;  5TU0 A;  4EUO A;  2G93 A;  3H6V A;  4GRK A;  1B52 A;  1PB8 A;  4WWI A;  3RTW B;  4NF4 B;  4H65 A;  2QMW A;  2REJ A;  4YZZ A;  3PMW A;  3UP9 A;  3KG2 A;  2QL3 A;  4I8C A;  1UTH B;  1B32 A;  4IY5 A;  4HJG H;  4IGT A;  3G3F A;  4OES A;  1I6Q A;  2AYS A;  4ESX A;  3OEN A;  2ZNU A;  4Q5T A;  2SPZ A;  2RC8 A;  4XKN A;  2KS1 B;  4LON B;  4GD5 A;  3S1K A;  3C32 A;  4QFP A;  1ATG A;  2H4I A;  3H6W A;  1LFG A;  1TWY A;  1M5B A;  2HR3 A;  3VLW A;  2O69 A;  2E0S A;  3ZDM A;  4ZZE A;  3CG3 A;  1M5F A;  3ZSF A;  1EC5 A;  4ZE9 A;  4G68 A;  4OEN A;  4EQB A;  4BDQ A;  3OMB A;  4FEC A;  3OD7 A;  4FOR A;  1MS7 A;  3KZG A;  5L9O A;  3I6V A;  3BKI B;  1P1W A;  2XXH A;  1FW0 A;  4NED A;  2NOO A;  2I0C A;  3CR9 A;  1H44 A;  5LOM A;  1M5D A;  1D9Y A;  1MY1 A;  1LCT A;  5ICQ A;  3PPR A;  2DXR A;  4MFI A;  3R26 A;  1BLF A;  4YMB A;  3OO7 A;  3SEV A;  2DWH A;  3PPO A;  1MM6 A;  2CMO A;  4N6P A;  1A7L A;  2XD2 A;  3MP8 A;  1YTV A;  3VXB A;  1B3E A;  5JTY A;  2Y7R A;  4KPT A;  2OWS A;  4NPD A;  3VXC A;  2F78 A;  4OXV A;  2HZK A;  2PT2 A;  2LAO A;  1L5T A;  1OVV A;  2CZL A;  1UIU A;  3LSL A;  4IO7 A;  4P11 A;  1DTG A;  3TOD A;  1AH5 A;  1MFT A;  3RQT A;  1BDD A;  5L9M A;  5C39 A;  1XVX A;  2JWD A;  2OBG A;  2VGQ A;  3GBB A;  2F35 A;  3V8X B;  5KCJ B;  3HHG A;  3KSJ A;  4EF1 A;  1MY2 A;  3DEL B;  4NPF X;  2AIX A;  4XKP A;  1UTB A;  2I6E A;  1NVO A;  4GL8 A;  3KFM A;  2AL5 A;  5DVF A;  3M3F A;  4WKM A;  5B7D A;  1XVY A;  1R9Q A;  4OWD A;  2P0S A;  3SES A;  1B5J A;  4RPO A;  3GBA A;  4THI A;  3G3K A;  5KDT A;  1MXZ A;  5AE4 A;  3MZB A;  4RXL A;  4KJM A;  4F29 A;  4DXC A;  3OXN A;  3BBR A;  4P0G A;  5CMM A;  1O63 A;  3M3L A;  3HPI A;  3QUJ A;  1QUK A;  4OEV A;  4F22 A;  4NF5 A;  3F11 A;  1JEU A;  1VE4 A;  3RTF B;  1LAF E;  2VP1 A;  3K2D A;  5HPQ A;  1OVU A;  4ELP A;  3EQ1 A;  4NMY A;  3H6U A;  2H99 A;  1I69 A;  3FXQ A;  4X1B A;  1D3K A;  4R9G A;  3RLF E;  1TT1 A;  1SI1 A;  2XXX A;  3EHT A;  2Y7W A;  1B3G A;  3W9W A;  5BWJ A;  1MPD A;  1LBC A;  1LP1 A;  4O3A A;  4PFY A;  3RGY A;  3QK6 A;  3MP6 A;  5TP9 B;  2XXI A;  4Q30 B;  2B3F A;  4F1Y A;  5KZT A;  3IK6 B;  1PBP A;  3E13 X;  3CFL A;  5H8F B;  1MQG A;  2IEE A;  2ZYN A;  3TYH A;  4MLV A;  3TZA A;  3K0V A;  3FXD A;  2RIN A;  5L8D A;  3G3J A;  4YIC A;  3MZW B;  3QUF A;  5CM6 A;  1QJM A;  1JET A;  4ESW A;  1XHY A;  2D5W A;  2XD3 A;  3TQW A;  1SW2 A;  4TOZ A;  4GOT A;  4JWX A;  3GZG A;  2XX7 A;  3UOR A;  5I59 B;  1B3H A;  3B6W A;  3C9H A;  3K6W A;  1VSO A;  2PMS A;  1UTH A;  3PUZ E;  3UN6 A;  1GVC A;  3IAZ A;  2XX9 A;  1DMB A;  4F3P A;  2F6G A;  5FHO A;  1P99 A;  5M2V A;  5DJT B;  5I2N B;  4BDL A;  5FTI A;  4LQ2 A;  4IO6 A;  4ASW A;  2Y7K A;  3DP8 A;  4PP0 A;  2QJE A;  4KQP A;  2M5A B;  4LZ8 A;  4ZEI A;  1FTL A;  3KEI A;  2QS2 A;  3TUS A;  4YB7 A;  1R9L A;  1HSJ A;  4XIG Q;  3I5O A;  4HB1 A;  3S4U A;  4OER A;  3EHU A;  1JM0 A;  3C33 A;  3FJ7 A;  2QPQ A;  3OOA A;  3QSL A;  1IIT A;  4IB2 A;  3U1O A;  3MBP A;  4QFK A;  1GGG A;  4DLD A;  5F7V A;  3LSF B;  3B7D A;  3VLV A;  1HSL A;  3R7X A;  5CBN A;  5I84 A;  3A3C A;  4H0W A;  1LBB A;  1Y1M A;  1N3X A;  4NF8 A;  3G3G A;  1FC2 C;  4NF6 B;  4X48 A;  1MY4 A;  2O84 X;  1H3D A;  4KYD A;  4G2Z A;  3H6T A;  4BLA A;  3THI A;  4ZEB A;  1AL3 A;  1PBQ A;  3GXA A;  3Q25 A;  1N76 A;  4DXU A;  3ZKK A;  3FXU A;  5ITP A;  1XOC A;  1PC3 A;  4ZNC A;  3IOW A;  1IXI A;  2I3W A;  1U7M A;  4R74 A;  4C1U A;  3K02 A;  1SDX A;  5K2X A;  3G3I A;  5BUU A;  1S9T A;  3ZS6 A;  4RPN A;  1B1X A;  4EDP A;  3A09 A;  4OEU A;  4GLI A;  1MPC A;  1Z7N E;  3H7M A;  2A5T B;  2X7P A;  3PUY E;  4ZEF A;  3C34 A;  4GXA A;  1NFT A;  3CRB A;  5KCJ A;  3O29 A;  3PD8 A;  1IXH A;  1B4H A;  3FVO A;  2X7Q A;  2V3T A;  4KYS A;  4UAC A;  3MVX A;  1FTK A;  2X26 A;  3IJX B;  1BTJ A;  4H8J A;  3TTK A;  4HTG A;  1NNT A;  4LAT A;  4OFJ A;  4JWY A;  4F3B A;  3UIF A;  2R6G E;  3FZV A;  3JZJ A;  2HXW A;  5K5G B;  2I3V A;  1O7T A;  4POX A;  3O97 A;  3R6U A;  1AMF A;  2I49 A;  2ANJ A;  1UQW A;  3SET A;  2HAV A;  2O7I A;  5ELV A;  4RYA A;  4G77 A;  4ZEK A;  2KUB A;  1N7W A;  2ALU A;  3Q26 A;  4F1V A;  1N7X A;  3VLU A;  4EXK A;  1IQ7 A;  2W7Y A;  1B7H A;  1FQD A;  5AA4 B;  2O6A A;  4ELR A;  2RC9 A;  5TP9 A;  1VR5 A;  4E0X A;  5F1Q A;  1YPN A;  1ZLQ A;  5EYF A;  2O1M A;  3CVG A;  1Z7M E;  5EHM A;  3KJT A;  3C35 A;  1LB9 A;  1A55 A;  2DSF A;  3K6U A;  3W15 C;  1QVS A;  3MJN A;  3Q28 A;  1IZ1 A;  4HW8 A;  1ZTY A;  3FAS A;  4H5G A;  4OYV A;  4FED A;  1NNK A;  2UVJ A;  3ZKL A;  1NL5 A;  4NTL A;  3MW0 A;  1NMU A;  1N84 A;  1OLA A;  3FXE A;  4YKI A;  2Q2C A;  1MQI A;  2XXP A;  2OK2 A;  4ISU A;  5FTH A;  4BDM A;  1S50 A;  4MF3 A;  2KI7 B;  1VFD A;  5I2N A;  1CE2 A;  1JW4 A;  4QRZ A;  1MQD A;  2F6P A;  3BFU A;  4HS7 A;  5I57 B;  2FYI A;  3IJO B;  3SEY A;  2Q88 A;  1B3L A;  1YCJ A;  4POW A;  4LZ5 A;  3T9V A;  4R6K A;  5CMB A;  3O6H A;  1F9B A;  2KZI A;  4P0I A;  2Y7I A;  2ZNT A;  2Q1K A;  3IL1 B;  4FAT A;  4R75 A;  5I58 B;  2F5X A;  4TQU Q;  3RT8 A;  3TTL A;  4GOE A;  3FAT A;  4WED A;  4L17 A;  3HCQ A;  3SEX A;  4AB5 A;  1D4N A;  1WDN A;  5FHN A;  3FD3 A;  5JEI A;  1S3J A;  4NF6 A;  1MY0 A;  4FIM A;  1SS1 A;  3DLN A;  2ZMB A;  3O28 A;  1POT A;  2PVU A;  1I6A A;  4XXU A;  3K6V A;  5I2K A;  1BIY A;  4F31 B;  1SYH A;  4H1X A;  1LST A;  4QSC A;  4MH5 A;  4G4P A;  5FHM A;  3H06 B;  1FQE A;  2F7C A;  2DE3 A;  3KJ7 A;  4U1Z A;  1B46 A;  2A5T A;  2HZL A;  2F34 A;  4FAJ A;  2LXC B;  4GOF A;  4GOD A;  3FVK A;  4NWC A;  1NH7 A;  4BDR A;  4R9F A;  3TCF A;  3QWO C;  1PB9 A;  4Z7E A;  3RT6 B;  4JWO A;  5CMK A;  2H25 A;  4DCX A;  3SER A;  5AA2 D;  4IY6 A;  2ONS A;  4DCY A;  3VDF A;  3G7W A;  2B87 B;  4LP2 B;  4O3B A;  2UYF A;  1FQF A;  2OWT A;  4IO2 A;  3SEU A;  3PUV E;  1OVB A;  3CFZ A;  3QYT A;  3ECR A;  1LLS A;  3VE1 B;  2R44 A;  3FXR A;  3PMX A;  4H6D A;  4BXL A;  2QRY A;  1MQH A;  3GLB A;  1LGB C;  3OEM A;  2HFB A;  5IKB A;  2Q9T A;  3T22 A;  1TFD A;  1OMP A;  1PDA A;  3VVF A;  4I62 A;  1R6Z A;  1P1Q A;  3N6T A;  1H76 A;  1ZW0 A;  2M0B A;  5I56 B;  4KYE A;  4F1U A;  4KCD A;  1EZO A;  1B4Z A;  2B88 A;  1NH8 A;  1II5 A;  3MPL A;  4MLQ A;  5H8H B;  3PMV A;  3D4C A;  4FEB A;  4G8N A;  1DOT A;  3K1P A;  2H9B A;  5AA4 A;  3H03 A;  1MPB A;  3ILT B;  1MDQ A;  4K35 A;  4OET A;  3B6Q A;  3HST A;  2BJJ X;  2ZYK A;  2XXQ A;  2LXB A;  2R71 A;  4FJP A;  1MM7 A;  2R9J A;  4YU0 A;  2GRV A;  2H5Y A;  2QVA A;  3MUQ A;  3RUM A;  1QUL A;  5AA3 A;  4CPG A;  1Q1K A;  4Q0C A;  2DWJ A;  3SEW A;  1GV8 A;  2UVI A;  4JSO A;  4KD5 A;  4ZED A;  1QUI A;  1N3W A;  1B9J A;  1US4 A;  4OFL A;  2KIK A;  3TDJ A;  2Y7P A;  4U2R A;  4MN4 C;  1FTO A;  4NF4 A;  3SKP A;  1A54 A;  3FV2 A;  3FJM A;  1Q35 A;  5EHS A;  1URS A;  4LQ5 A;  5ISU A;  4OTE A;  2DVZ A;  4AB6 A;  2VHA A;  1EU8 A;  4IO3 A;  5I57 A;  3B6T A;  3S9M C;  1OLC A;  3FV1 A;  3VV5 A;  3WAE A;  3O9P A;  1J1N A;  2OZZ A;  1EDL A;  1A8F A;  1LFH A;  1PB7 A;  2Z23 A;  1ANF A;  4GXS B;  4R6Y A;  5AA2 B;  1B2H A;  1M5C A;  1LAH E;  4F2O A;  3K1N A;  2F8D A;  5I58 A;  1SI0 A;  2UVH A;  1P1N A;  2UXA A;  3C4M A;  1LT1 A;  2DE4 A;  4IO5 A;  3OO8 A;  4EXL A;  5A5X B;  1MH4 A;  3PH0 A;  3S2V A;  1YAE A;  1LAG E;  3IOT A;  1EH3 A;  3O6I A;  4YMA A;  2KZJ A;  4U1O A;  3MP1 A;  4GIZ A;  2ZXT A;  4HCW A;  3K00 A;  3HHF A;  2DWA A;  1IXC A;  1RKM A;  3IX1 A;  4RA1 A;  3RGU A;  1MRP A;  1SW1 A;  3JYR A;  2F97 A;  4PE5 B;  2A5S A;  4JBZ A;  1GTK A;  1PEB A;  2RC7 A;  4F19 A;  4JSD A;  3TCH A;  3VFJ A;  4IO4 A;  1MXX A;  1MXU A;  4Q8R A;  3N94 A;  4XTC Q;  3Q27 A;  1Y3P A;  1DPP A;  5ICT A;  4K3A A;  4GWO A;  4PFT A;  5CRY A;  2VD2 A;  5ITO A;  3KGC A;  2THI A;  4QHQ A;  4LA9 A;  1RYO A;  5AA1 A;  2B87 A;  1Y1Z A;  2Z8D A;  1ZIU A;  3CIJ A;  2B89 A;  1XT8 A;  4O3C A;  4BDN A;  4OQO A;  5CBO A;  1DPE A;  1WOD A;  4OVJ A;  2V25 A;  3HO7 A;  2DS9 A;  5HBC A;  2DVC A;  4LUB A;  1NNP A;  2DXY A;  1UTB B;  1O64 A;  1ZXG A;  1SW5 A;  1R1N A;  3I3V A;  1TXF A;  2NVU B;  3K4U A;  4K3F A;  1S7Y A;  1MDP 1;  1EZP A;  3OEK A;  1MXV A;  4GL0 A;  4QSD A;  3C36 A;  1EDI A;  2FNC A;  2XXU A;  2QS1 A;  3FVG A;  5H8H A;  2ZAE B;  3T93 B;  2HCA A;  5IAI A;  1USY H;  1CB6 A;  2K3R A;  2GFE A;  5TPA B;  4ELO A;  1EDJ A;  5DVJ A;  1A99 A;  4PQJ A;  1EDK A;  2Q89 A;  4NF5 B;  1ELJ A;  1QW0 A;  4EQ9 A;  1NKX A;  5H8F A;  2AL4 A;  3L6H A;  5CBS A;  2OCU A;  4ZEC A;  4ECF A;  3RPW A;  3U92 A;  3KN3 A;  2RKL A;  1OQH A;  1A8E A;  1DSN A;  1ZU0 A;  4OZ9 A;  3V5A A;  3E9X A;  2Z8F A;  3DM0 A;  1BDC A;  3QIM A;  3MVY A;  3KOT A;  1URD A;  3MAM A;  5DJU B;  4F3G A;  1M5E A;  4BDO A;  4DIG A;  5I59 A;  2WMM A;  3RN8 A;  1DTZ A;  4EYY Q;  1B7U A;  1LCF A;  3AXF A;  4R2B A;  4FE8 A;  2Z22 A;  2WKY A;  5CI5 A;  1I6B A;  2F7A A;  4G8M A;  3A3U A;  4ZE8 A;  4OFO A;  4C1T A;  2B3B A;  3MC2 A;  4YAH X;  2D3I A;  1JVY A;  3LBS A;  2M5A A;  3M8U A;  4ZDM A;  4I1D A;  3IOV A;  3IO6 A;  2DE2 A;  1IXG A;  3KN7 A;  3TKD A;  1US5 A;  4KCC A;  5AA2 A;  4ASV A;  5B70 A;  2NUV A;  2P2A A;  4G8H A;  1B7Z A;  2F36 A;  4N07 A;  3OEL A;  4X9T A;  3USD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...