4JBZA

Structure of mcm10 coiled-coil region
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
401
structure length
401
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMGVCQEKSKDELEDELRKMQAQMKKLQEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Mcm10 self-association is mediated by an N-terminal coiled-coil domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication
molecule keywords MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH XENOPUS LAEVI
total genus 131
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4jbzA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA01
1SS1A 1J1NA 3CG1A 3PUYE 2I58A 4PFYA 4QFOA 4G4PA 4ECFA 1LP1B 4E0WA 1B7UA 3TODA 4BDLA 2D3IA 1AIVA 2HZKA 2DWHA 3MVXA 5HBCA 1TFDA 4KYDA 4G8NA 4HW8A 3RGYA 4NF8A 3IR1A 1EH3A 5FTHA 3QAXA 4EXKA 5H8QB 4F3SA 3O29A 3MW0A 4PFWA 4PQJA 4XKQA 2F36A 4DXBA 1DOTA 4QSEA 1JNFA 2F7AA 1XHYA 2QSXA 4BLAA 4ELPA 3MJNA 3W9VA 1MY1A 3S2VA 2ZYMA 4KR5A 4DXCA 3CIJA 1GTKA 3SEUA 1ATGA 3ZS6A 4BDRA 3O28A 3K00A 2Z8DA 4KYSA 2I6EA 3PH0A 3IORA 3CSBA 3G3IA 5CI5A 1FQDA 1T0KA 3A3UA 2ZNTA 2Q89A 2P0SA 3FIRA 3ZSFA 3D4GA 4NF8B 4OTEA 3IK6B 2Q1KA 3FATA 4GD5A 4DXUA 4NPDA 2YPNA 4F3PA 2O7IA 4YMBA 4MFIA 3MP1A 5FHNA 2UVIA 1VSOA 4DCXA 3G3KA 1TT1A 3CRBA 5A5XA 1IZ1A 3MZ1A 3C31A 3HPIA 5DT6A 1A40A 3PGFA 1LBCA 2CZLA 1PB9A 5A5XB 4I62A 4MN4C 4R2FA 2B87B 3VLVA 1MXYA 1HSJA 3OO7A 2IA4A 4EF2A 2QRXA 3FJGA 3HCQA 2XXVA 4PFUA 4F22A 3T96B 2XXHA 4AB6A 1B2HA 1PBPA 3MP8A 1FC2C 3C36A 1QUKA 1MPBA 3FXDA 1Y4TA 1OLAA 3RT6B 3T22A 1NVOA 4OETA 4OFJA 3RTWB 5DYHA 3SEWA 1IEJA 3PUVE 3OMBA 1JEVA 3RQTA 2K3RA 4PP0A 3QK6A 1PB8A 4H5GA 3O97A 1A99A 2PX1A 2F35A 3QIMA 3R26A 1B4ZA 2B88A 4G2ZA 5HM4B 2DE2A 3O9PA 2RC9A 1X0TA 3M3KA 1ZXGA 3EQ1A 2F6GA 3LBSA 2M0BA 1LCFA 4POWA 3DM0A 4I9DA 2V84A 4XKRA 3EF7A 4LUBA 1Q35A 4ESWA 3G7WA 1SDXA 3RUMA 1B05A 1MH3A 1BTJA 1NL5A 2OWTA 1SYIA 4IO6A 4U22A 5B7DA 2OZZA 1VFDA 1XT8A 3HHFA 3RY3A 1BKAA 1SW5A 4GXAA 2V25A 4M1VA 2GRVA 5DJTB 1JVYA 3FGSA 4OFOA 4G68C 4KYEA 1FQEA 3QUJA 1DPEA 4K3AA 1FTMA 2R6GE 2A5SA 3TFLA 5H8SA 2O84X 3S9MC 5AA2D 2QPQA 1JW5A 3IJXB 4RPNA 2OJTA 4P0IA 5DEXA 2VGQA 4GIZA 1PB7A 2HEUA 3T9HB 3VDFA 1H0TB 2F97A 3TTMA 1EDIA 2B89A 5EYFA 2ZXTA 4ZEFA 4F3GA 2E0SA 5KCJA 4PFTA 1POY1 4RNSA 3IOVA 1ELJA 2DE3A 4TLLB 2OCUA 1EDKA 4X48A 3U92A 3MPLA 2RF1A 1YPNA 3OEKA 2Z8EA 5KZTA 1FTLA 2ZYKA 4LVQA 1NH7A 4GQOA 2X7PA 1N84A 4AB5A 2FNCA 5IAIA 3IB2A 4G68A 3MZBA 3HHGA 1B1HA 2LAOA 2V93A 1RKMA 2KZJA 4YZZA 1ZMGA 1Y3NA 1NNKA 1UTBA 2M8CA 2O51A 5K2YA 3TCHA 5DEXB 4YKKA 3VVFA 1EZOA 1IXCA 3THIA 4F1UA 2NVUB 5H8HA 5ITPA 3F11A 2F7CA 1MQDA 3BBRA 3D4CA 1AL3A 3CR9A 3N26A 4LATA 5K5GB 3IO4A 2ZNSA 3K6VA 1LCTA 2Q8JA 1FQFA 2O69A 1D4NA 1SI1A 1FTOA 1BDDA 3KN3A 1UTBB 3KG2A 1WVJA 1JW4A 3RPWA 4KD5A 5H8NB 3S4UA 2RKMA 3FJMA 1YAEA 1S7YA 5CMCA 2HAUA 3IOWA 4O3CA 3K02A 4ONYA 4JSDA 2RCAA 4F2OA 4IO4A 3OD7A 3PPPA 5JTYA 1MRPA 3A3CA 3C34A 4QHQA 2Y7PA 1Y20A 1II5A 4R9GA 4EF1A 2IEEA 1M5BA 4YAHX 4U4SA 1MXVA 2THIA 1F9BA 3OELA 3LSLA 5J1DA 4XKNA 3VLWA 1MQJA 1OVUA 1IITA 1MDP1 3QUFA 4Q8RA 3PV0E 1B5IA 5AA2A 3S9NC 4LZ5A 1FQCA 3QYTA 1OIBA 3Q25A 3DLNA 3TKDA 4IOIH 5I57B 3C35A 1FTJA 3QXMA 3PU5A 1M5DA 1YTVA 3SKPA 4CPGA 4EQBA 2M5AB 3DP8A 2ALUA 1QW0A 4QRZA 1LAGE 4NPFX 5I2NB 3M8UA 1IXIA 3Q29A 3HO7A 4OFLA 4BDMA 1B7ZA 5EHMA 4KI0E 4NF5A 3B6TA 3DP4A 5L9MA 1MXWA 2RC8A 4LQ5A 5I59B 5K2XA 3IO6A 3O2AA 4H65A 3KOSA 2XD2A 3K6WA 5I58B 4H6DA 4EXLA 3M3FA 4Z0IA 1P1UA 2ESNA 2RINA 3KFMA 5DTBA 3PPRA 3TTNA 5FTIA 3U94A 5I58A 5BWJA 4NEDA 2F78A 4WXJA 4XXUA 4YMAA 3U72A 4EQ7A 5I2KA 2ZYOA 4M4GA 2HFBA 1S50A 4QFPA 2DWIA 3CVGA 3K2DA 2VP1A 2Y7WA 2I0CA 1QUIA 4OEVA 2VD3A 2VHAA 4QFNA 1B9JA 2REGA 5CMMA 3TQLA 3B6QA 4G68B 3KZGA 3MVYA 4YKJA 1MQHA 5ISUA 1OMPA 4I1DA 2ABHA 4C1UA 2P1SA 4KCCA 2KLFA 4Q0CA 4F3BA 1UIVA 1B3GA 3H06B 4NF6B 2XXXA 4JB7A 3H4ZA 3OEMA 1N04A 4ZEKA 2P58A 2UYFA 2HAVA 4FEBA 4YB7A 3MC2A 4MF3A 4IY5A 1H0TA 1LFGA 1Y3QA 3N6TA 1MS7A 1S3JA 4HS7A 2YLNA 3WAEA 3FV2A 2OK2A 1IXHA 4KHZE 1VFEA 2XXPA 1B7HA 1MQIA 1MY0A 3EHTA 3O66A 4P11A 3CFXA 2G93A 3FXQA 1SBPA 5F7VA 1A8FA 2Q2CA 1POTA 4THIA 5CBSA 5I56B 3KSJA 2CMOA 1H43A 1B3HA 2F7BA 4ISUA 2B3BA 2H4IA 4LA9A 1B4HA 4BDNA 1Y3PA 4U4XA 1R9LA 3MVWA 3K01A 2DVCA 3MWBA 3RT8A 4PE5B 1I6QA 2PYYA 2XD3A 1IIWA 3UA8A 1Y4CA 3ILTB 4UACA 1IXGA 1UIUA 4G8MA 1O63A 5CBNA 3V5AA 4FJPA 3RNNA 4O3BA 3Q28A 3OO6A 3ECRA 2RC7A 3BFUA 4NF4A 1YCJA 1ZU0A 1QVSA 1OVVA 1SW1A 3KOTA 3VVEA 4ZEDA 3K0VA 3PUXE 4R9FA 1MXXA 4NE4A 1JMBA 2DOJA 4RYAA 2NOOA 1N7XA 1ZBMA 3LC8A 1FCKA 3VFJA 1MH4A 1URSA 1LFHA 3K1NA 3R6UA 1MG1A 2LR2A 2PT2A 3LR1A 2V3QA 5JTYB 3E9XA 4LONB 1Y1MA 2JWDA 2DVZA 3IOUA 2XXYA 2Y7RA 1XVYA 1LAHE 1CB6A 4ND9A 1H76A 3E3KA 4IO5A 2BJJX 3CFLA 1B46A 2QRYA 4LP2B 1I69A 2Y7KA 4K35A 3IB0A 1M5CA 2O7UA 3KJTA 4HJGH 1NKXA 4OQOA 4U1OA 3I5OA 5H8HB 3K1MA 2DXRA 2UXAA 4ZNCA 1NNFA 4X9TA 4GODA 4EYYQ 5DVFA 3UN6A 3ILUB 4U1ZA 5I59A 1DTZA 2QL3A 4RY1A 1URGA 4NWDA 3VXBA 2Z22A 2UYEA 4QF9A 2XHDA 1BDCA 2GH9A 3FUZA 5IKBA 1LAXA 4R6YA 5I2NA 4R6KA 5DVJA 1NH8A 1KWHA 2P2AA 3MHVA 3WAFA 2Z8FA 1IUDA 4X1DA 4RJZA 1LGBC 3OOAA 3PMVA 4H8IA 5CRYA 4F1YA 4HCYA 4JSOA 5AA2B 5CMKA 2ZNUA 3V8XB 2A5TB 3KSXA 3GZGA 1AH5A 3TTRA 2NWJA 3MVZA 5JEIA 3MUQA 1NNPA 3T66A 2XX8A 2RCBA 2V3UA 4U2RA 1Z7NE 5AA3A 2R71A 1B51A 5AA4A 2PBWA 2XXRA 1P1OA 3TCFA 1Q2NA 3TDJA 3SEVA 2KI7B 5KDTA 2ZMBA 3Q27A 3OO8A 3CFZA 1OVRA 1Y1ZA 3FV1A 3OENA 1H44A 4GWOA 4GOFA 3ZDMA 2Q9TA 1EU8A 3E13X 2O68A 3KBRA 2I48A 1OVBA 4GF8A 4KQPA 1VE4A 2XXQA 3H3GA 1M5EA 1Y9UA 1XS5A 5B70A 1H45A 1B3FA 1JETA 1A8EA 4QSCA 1D9YA 4NF5B 5AA4B 1NMUA 1LFIA 2LXCB 5EFWB 4FATA 1LB8A 1TXFA 2Q2AA 4R6HA 4FORA 2XXWA 4GXSB 2PT1A 1LAFE 2A5TA 3B6WA 1ZTYA 4DCYA 1BLFA 3O6IA 2HCAA 4OEUA 3CSGA 2YJPA 1URDA 4GFRA 3MPKA 4ZE8A 4JBZA 3QWOC 1A55A 2OBGA 3TTKA 3JZJA 3GLBA 1GR2A 2KIKA 5C39A 1AMFA 3MQ9A 4I8CA 3V83A 3LSWA 3H6UA 4F31B 4ZMDA 4RA1A 1U7MA 3TTLA 3PPQA 5ICTA 3FASA 2QMXA 2ONSA 1UTHA 3MAMA 2Y7IA 1R6ZA 5CM6A 3H6WA 5I2KB 1A54A 1PEBA 2Z23A 4U23A 4OENA 1USYE 3ZKLA 2QS1A 2G29A 4N6PA 4N07A 2E1SA 3TUSA 3BKIB 3SETA 4YKPA 1RYOA 2X26A 3N94A 1B3LA 4NTLA 3KJ7A 4IY6A 2B87A 2B3FA 4MLQA 4RPOA 5EHSA 3TZAA 5L8DA 2F5XA 5CBOA 4GL8A 1MY3A 2XXTA 3K4UA 3DELB 5JK4A 2UWJE 1SVXB 4R72A 1XOCA 5DVIA 5L9SA 3O6HA 1D9VA 4OERA 3E4RA 1N76A 3U8QA 1JQFA 1ZLQA 3FZVA 1JM0A 2XXIA 4ZEIA 1XVXA 2AIXA 4GRKA 4LQ2A 3T9UA 1UTHB 3T93B 4KFQA 1P1NA 3TMGA 2H25A 3GBBA 3A09A 1VR5A 4WKMA 1MDQA 4O3AA 4GOEA 4FECA 1MPCA 2XXUA 1OVTA 1JVXA 4ZZEA 5HPQA 2WKYA 3FVKA 5AA1A 3UGWA 4DLDA 1TFAA 5CMBA 2KS1B 5FHMA 4FE8A 2OLBA 2OTKE 5TP9B 2ANJA 3GBAA 3JV9A 3L6GA 4WWIA 1ANFA 2LXBA 4H0WA 3KEIA 3FVOA 3LSXA 4OZ9A 4JWXA 5H8FB 3MZWB 4G8HA 2DYXA 1B1XA 4DIGA 2KZIA 2GHBA 1SW4A 2O6AA 1GGGA 4WEPA 1B6HA 2QS4A 4JWYA 2I0BA 2AYSA 4YICA 2I8DA 4MLVA 3UK4A 3S1KA 4R2BA 5KDTB 3CI8A 1U7JA 2I3VA 1N3XA 2DSFA 3G3JA 1DPPA 3M3LA 3USDA 4ASVA 4F19A 1LP1A 2ZAEB 4GL0A 2UVGA 1P1QA 2F8DA 4XKPA 1TWYA 3H7MA 4ZS9A 1DTGA 1LBBA 3FVGA 3K6UA 3N5LA 1B0HA 2UVHA 4P0GA 2I4CA 3ONMA 1WODA 1B5JA 1EZPA 1NFTA 4JXIA 3KN8A 1OQGA 4ELOA 2QJEA 1US5A 3ZKKA 3C4MA 3UP9A 4IO3A 4ZDMA 4IB2A 2HXWA 1EDJA 1H3DA 1MFTA 3H6VA 1SI0A 3O6GA 1WDNA 4L17A 4R74A 1USYH 3B7DA 2I4BA 3RGUA 1FW0A 1LB9A 3RN8A 1EDLA 4G77A 5ITOA 4QFKA 4YB5A 3SERA 4OHNA 4NF4B 1Q1KA 3OXNA 4Q30B 3SEXA 4F39A 3PMXA 2VD2A 3RLFE 1I6BA 1AOVA 2KUBA 1Z7ME 4JWOA 3FXRA 1QJMA 3MP6A 3JYRA 2O1MA 1RYXA 5LOMA 4HCWA 1SD3A 1Y47A 4OMBA 4ZE9A 4HTGA 4POXA 4DE8A 2FYIA 1A7LA 3H6TA 1S9TA 3HN0A 1DSNA 4ELQA 4LZ8A 1MY4A 4OESA 2D5WA 1M5FA 3UORA 3PUWE 3TELA 3EPEA 4OWDA 1US4A 3C33A 3G3HA 2H98A 2H9BA 2GHAA 1P99A 2OWSA 3KGCA 3OO9A 2DP8A 3T9XB 4BDQA 1PC3A 3FXEA 2HR3A 3L6HA 5TU0A 3PPOA 4TOZA 3QSLA 1B5HA 3EHUA 3I6VA 4GVOA 1P1WA 2V3TA 4ZZAA 2H99A 5ELVA 4NWCA 3G3FA 2QMWA 1FTKA 2GFEA 4OVJA 1PBQA 4IGTA 2REJA 4BDOA 3IJOB 4UA8A 4NF6A 1LT1A 2WMMA 3TQWA 2UVJA 2H5YA 4GLIA 3W15C 3SEYA 4GOTA 4QSDA 3IB1A 5I57A 3K6XA 5DJUB 1N0TA 4NMYA 3EN3A 2XX9A 4YU0A 4HB1A 1MM6A 3AXFA 2O1LA 4X1BA 4MH5A 2F34A 1B32A 2D21A 1CE2A 3P7IA 1R9QA 3LUYA 1D3KA 5FHOA 1MPDA 3K1PA 2DE4A 1MY2A 2DS9A 3VV5A 4R73A 1I6AA 4EUOA 4ESXA 4N13A 1FQAA 4DDDA 5L9OA 1O7TA 4IGRA 2DQVA 1EZ9A 1MM7A 5I56A 3S9LC 3FXUA 4Q5TA 1JW1A 4JDFA 2DXYA 5CC2A 4C1TA 4K3FA 4F29A 4E0XA 1GVCA 1SQYA 3PMWA 1MXUA 2HZLA 2FA7A 4F1VA 1LLSA 4U21A 3RTFB 1IQ7A 3GXAA 1LSTA 2W7YA 4RXLA 4IO7A 3HV1A 4XIGQ 1B40A 4NPEA 3FJ7A 2VOZA 4F18A 2XX7A 5H8FA 3FVNA 2QS3A 3H03A 1BIYA 4KCDA 1N3WA 1N7WA 1OQHA 2M5AA 4IO2A 3LSFB 3PPNA 2ZYNA 1HSEA 4Z7EA 4TQUQ 1FQBA 3EHSA 4YB6A 4LZ7A 3ODBA 3Q26A 1OLCA 4RK2A 3DP6A 2I3WA 3V89B 3U1OA 3CG3A 4DZ1A 4ZEBA 1O64A 1B52A 3G3GA 4FEDA 1QULA 5KCJB 2QS2A 5H8QA 3OSRA 1GV8A 3TAJA 3MBPA 5M2VA 1QKBA 2F6PA 2Q88A 1BP5A 1DMBA 3HSTA 4FAJA 4KJMA 3I3VA 3TYHA 4FIMA 2Y84A 4BXLA 3C32A 2I49A 2NXOA 1HSLA 2ONKE 3S9EA 4XTCQ 3KN7A 4MBPA 3FD3A 4PETA 4AQ4A 1QUJA 2DWJA 1ZJLA 3VLUA 3IAZA 4WEDA 4H8JA 1B3EA 2PMSA 5CBRA 3VVDA 5TPAA 5BUUA 1ZKBA 4QFLA 2AL5A 2AL4A 2B65A 4H5FA 2R44A 1SW2A 3C9HA 4HKZH 2X7QA 1QKAA 3IL1B 3R7XA 5TP9A 3OSQA 1PDAA 4TLMB 2HQ0A 4H1XA 2PVUA 4ZECA 2NUVA 5F1QA 1UQWA 3MZ9A 3VE1B 3U93A 3IX1A 1ZIUA 3N6UA 1B58A 3UIFA 5I84A 3SDFA 3PD9A 3W9WA 2DWAA 3TEPA 3T9VA 3SESA 4C0RA 4RK9A 4OYVA 3VXCA 2ONRA 1ZW0A 1R1NA 1L5TA 1MXZA 1NNTA 2R9JA 4OXVA 4R75A 1SYHA 5ICQA 5H8NA 3BFTA 3PUZE 2RKLA 4ELRA 4H67A 1XC1A 4EQ9A 1MQGA 4F2QA 4EDPA 2QVAA 1JEUA 3TPAA 2SPZA 3PD8A 5AE4A 1DEEG 3TCGA 1B0LA 1EC5A 4YKIA 3IOTA 4ASWA 5TPAB 4KPTA
chains in the Genus database with same CATH superfamily
1SS1A 1J1NA 3E78A 4WY4C 3P8CD 4GBWA 1FBEA 1FRPA 3IAOA 3CG1A 3PUYE 2NPSD 2I58A 4PFYA 4QFOA 4G4PA 2XU6A 1BSHA 4ECFA 1EZVG 1LP1B 3UIAA 3G6EP 2B4MA 4E0WA 1B7UA 4JYBA 1JO5A 2CZIA 3TODA 4BDLA 2YO2A 2D3IA 1GW3A 1AIVA 3SWYA 1M1JC 4UB6E 3GF3A 2HZKA 1GD2E 2DWHA 3MVXA 5HBCA 1MZ9A 4GWUA 1TFDA 1SQXD 1NTMK 3RL0B 4KYDA 1CW5A 4G8NA 3CCRP 5GTIE 4B86A 1G1IA 4HW8A 4P56A 3RGYA 2FBPA 4NF8A 1Y9BA 2O01J 3IR1A 3RBZA 1EH3A 1S5LH 4PTKA 5AVVB 2W27A 5ET6A 5FTHA 3QAXA 4H13D 3VMYA 3TSIA 4EXKA 5H8QB 4F3SA 3O29A 5CCHC 2QVVA 1JUNA 3MW0A 2JJKA 2GA1A 4PFWA 1N73C 2N1TC 1G0HA 1GU4A 4PQJA 1PIXA 4I3EA 5ET7A 2D2CC 5ET5A 4XKQA 5J16A 1SQVD 2F36A 4DXBA 1DOTA 4QSEA 1JNFA 4MNCA 2F7AA 1XHYA 2QSXA 1HJBA 4JQ0D 4BLAA 3L71G 3E79A 4ELPA 3MJNA 3W9VA 1MY1A 3B5NA 1X9VA 3Q1MA 3S2VA 2ZYMA 5AVQB 2Z5IA 4KR5A 4DXCA 3CIJA 1FJPA 1GTKA 3IF4A 1SQQJ 3SEUA 1ATGA 4IL6X 3TK1A 3ZS6A 4BDRA 3O28A 1H8AA 3F89A 3K00A 4DI3D 5GTIH 3O8ZA 4XEQA 2E74D 2Z8DA 5KJ7D 2IFMA 4KYSA 2I6EA 4IL6H 3E7KA 4GT1A 2FYNC 3PH0A 1FZEA 3WUVA 3IORA 4WY4D 2ZFCA 3CSBA 3G3IA 4OVQA 5CI5A 4YPCA 1BCCE 1JY3O 1FQDA 1T0KA 3A3UA 2A45H 2RN0A 2ZNTA 3RK3C 3SSUA 1YBKA 2Q89A 2KP8A 1SPIA 1QL2A 2PFXA 2P0SA 3FIRA 3ZSFA 2BCCD 3H1HG 3D4GA 1KZ8A 4NF8B 1HGZA 4OTEA 3IK6B 2Q1KA 1NAYA 1L4AB 3FATA 4GD5A 4GWSA 4DXUA 4NPDA 4EDFA 2KSJA 2VPNA 2YPNA 4F3PA 2O7IA 4YMBA 5EYGA 1PGJA 1BE3E 4MFIA 3MP1A 5FHNA 5AW1B 1SQQG 2K9JA 2UVIA 1VSOA 4N91A 3L72J 4DCXA 2FYUD 5AW3B 1RF1A 3G3KA 4C46A 1XTGB 1TT1A 1ZR4A 3CRBA 5A5XA 3OW2O 5EQ7A 4U3FG 3Q5RA 1IZ1A 2M3EA 1M7LA 5APSA 3MZ1A 3C31A 3HPIA 5LDZA 1IFMA 5DT6A 1A40A 5AVUB 1KQFB 2FBWC 2ZT9D 3PGFA 3H1KE 3V5BA 1A02F 1LBCA 2CZLA 1PB9A 3JCUH 5A5XB 5DW8A 4I62A 4MN4C 2CPBA 4R2FA 4N8YA 1AVYA 1IFPA 2B9BA 4JVDA 3M0DA 3HD7A 2FFDB 2B87B 1NWQA 3VLVA 4KHXA 1MXYA 1HSJA 3H1IE 3OO7A 1KQGB 4X8RA 2IA4A 1T3JA 3HD7D 1L0NJ 4EF2A 2QRXA 1WT6A 3FJGA 3HCQA 3RYDA 2XXVA 4PFUA 4F22A 3KPEA 3RPLA 3T96B 2XXHA 2A06G 3C9IA 3LW5J 4AB6A 1B2HA 1PBPA 1LTTC 2BASA 2W6BA 1H89A 3MP8A 1FC2C 2E76B 3FBPA 1ZP0C 1SQVJ 4LC1A 1NV0A 3C36A 1QUKA 1MPBA 3FXDA 1VL2A 1Y4TA 1OLAA 1LTJC 5M1BA 3LV0A 3RT6B 3T22A 1NVOA 1NTKJ 4LN5A 4OETA 1PGPA 4H44B 4OFJA 5F24A 3RTWB 5DYHA 3SEWA 1IEJA 2Y0EA 4MNIA 2ZZWA 5AVWB 3PUVE 3OMBA 1KYOD 3RK3D 1FZCB 1EQ7A 1JEVA 2Q3EA 1N73A 3RQTA 2K3RA 3GF7A 3CCMP 4PF8A 1D9QA 2IBZG 3NMDA 4PP0A 3QK6A 1PB8A 4H5GA 3O97A 1A99A 4OVNF 2PX1A 2F35A 3QIMA 1YJNP 3R26A 2Y0CA 1B4ZA 1M57D 2Q5UA 2B88A 3CXHI 2ITAA 3BCCJ 2ZT9B 2QJKC 4G2ZA 1HBWA 5HM4B 3CC2P 4N78E 2DE2A 1RY3A 3H1HD 3O9PA 2RC9A 1URQA 1X0TA 3M3KA 1ZXGA 3EQ1A 2F6GA 3LBSA 4P8BA 3L72G 2M0BA 3MYUA 1LCFA 4POWA 2W6AA 3DM0A 1LTSC 1YITP 5AW7B 4I9DA 5AW8B 1NTME 4N17A 2V84A 2C9NY 4XKRA 1SQQD 1OX3A 3EF7A 4LUBA 1Q35A 3HD7B 4ESWA 1NTKK 1L0LD 3G7WA 2E5YA 1SDXA 2GQ1A 3RUMA 5KAIE 1B05A 2NPSB 1NJIQ 1MH3A 3RPLB 2WBBA 1FOSE 1BTJA 1HH0A 1NL5A 1L0NG 2OWTA 2FYUE 1SQXE 3TF5A 1SYIA 4IO6A 2WZ7A 2R8TA 1YQ4C 2OTLP 4U22A 2H7HA 1YTZI 2OYOA 5B7DA 4I7ZC 3HTKB 2OZZA 1VFDA 1J1EB 5KKZC 3CI9A 1XT8A 3HHFA 3RY3A 2K9JB 3PTYA 1BKAA 4BWNA 1SW5A 4GXAA 2V25A 3L74D 4M1VA 4MMPA 2GRVA 5DJTB 3RBXA 1JVYA 5CMZA 2P10A 3FGSA 4OFOA 3TYYA 4G68C 1GL2A 4KYEA 3L73E 3L35A 1VDFA 1FQEA 3KHUA 3QUJA 1AVOA 1DPEA 1U57A 1GK4A 3CXHE 3IFMA 4K3AA 3G3ZA 1FTMA 4C7RA 2R6GE 2A5SA 5AVSB 4H0LD 3JC22 2JP3A 1KILC 3TFLA 5H8SA 1T3UA 2O84X 1P84D 4WVZA 3S9MC 1P84E 1MKMA 5AVRB 2YMYA 4PV1B 2QPQA 5AA2D 1X22A 1JW5A 3IJXB 4RPNA 2OJTA 4P0IA 4GKGA 5DEXA 3E1RA 2VGQA 3V4WA 2KQZA 4GIZA 1PB7A 2HEUA 3T9HB 3VDFA 2J5UA 2RMZA 2OYIA 1M1JB 3H6PA 1H0TB 2A06D 2F97A 3TTMA 3O6QA 2P7JA 4I3YA 1IMCA 1EDIA 2B89A 1RQVA 1H88A 1XTCC 5EYFA 2ZXTA 2G8YA 4ZEFA 4F3GA 1G1JA 1BGYD 2IBZD 2E0SA 5KCJA 4H13B 3CWBE 2I1JA 1POY1 4PFTA 2AXTE 2ZXXA 2HHMA 4RNSA 1GZLA 3IOVA 4L75A 1HGVA 3JCUE 4D6TE 1ELJA 2DE3A 2OCUA 1QEXA 4TLLB 4JPZB 1EDKA 4X48A 3U92A 1KQSO 2P67A 5KAFE 3FWNA 3MPLA 2RF1A 1EZVI 5LTCA 1YPNA 4PAIA 2PRRA 1KV4A 1LEVA 2QJYC 3OEKA 2HLOA 2D2CB 2NRGA 2Z8EA 5KZTA 1FTLA 3L75D 3TGUE 2ZYKA 3C8VA 3L75E 1RE3A 1VDWA 4LVQA 3T1BA 3IR9A 3KZIH 1FAVA 1NH7A 2X7PA 2VT5A 4GQOA 1IMBA 1N84A 1S9KD 4AB5A 2FNCA 4HYTB 2CEXA 4MCOA 5IAIA 4H46A 1FU1A 1TU3F 3IB2A 4G68A 3MZBA 3HHGA 1B1HA 2LAOA 2V93A 1RKMA 2KZJA 3TDKA 3EQ2A 3H1JG 4YZZA 1ZMGA 1Y3NA 1NNKA 1IMAA 1FOSF 1UTBA 3CCVP 2M8CA 2O51A 5K2YA 1NV6A 1JTHA 3TCHA 3GW6A 5DEXB 4YKKA 2ZXEB 2ZYDA 3M9BA 1L0NK 3VVFA 1EZOA 1KILA 5CJ0A 1KFMA 2FKWB 1IXCA 5IGAA 5APTA 2OQQA 4G61A 3THIA 4F1UA 2NVUB 5H8HA 5ITPA 3F11A 3CWBD 2F7CA 1MQDA 1GL2C 2K88A 3BBRA 2Q3IA 3D4CA 1AL3A 3CR9A 3N26A 4LATA 5K5GB 3IO4A 2ZNSA 1SFCC 2QJPC 2WBDA 1GL2D 2MKVA 1K9ZA 3K6VA 1LCTA 1NUYA 1IJDB 1KILD 2Q8JA 1YI2P 1FQFA 2O69A 4UB6H 2WSFJ 1D4NA 3MIWA 1FTOA 1SI1A 1BDDA 1OW8A 3KN3A 1M90Q 3L70E 4HE0A 1UTBB 1J2JB 3KG2A 4GWWA 1NYHA 1WVJA 1JW4A 3RPWA 4P1EA 4KD5A 5H8NB 3B4SA 3S4UA 2RKMA 1JCCA 2KS1A 3FJMA 5B66H 1JY3N 1YAEA 1S7YA 1ZV8A 5CMCA 2I1KA 2HAUA 4YTPC 3IOWA 4O3CA 3K02A 4ONYA 4JSDA 2RCAA 4F2OA 1SQPG 2M8RA 4IO4A 3OD7A 3PPPA 5JTYA 1HTLC 1MRPA 3A3CA 1USEA 3C34A 4QHQA 2Y7PA 1Y20A 1II5A 4OGQB 4R9GA 2MKZA 2HODA 5AW5B 1NKZB 3Q3DA 3KC0A 4EF1A 2IEEA 1M5BA 3H32B 4NG7A 3HE4A 4YAHX 1URQC 4U4SA 1E5WA 1MXVA 2THIA 1F9BA 1JY2O 3LSLA 3OELA 5J1DA 2MJZA 4XKNA 3VLWA 5T3JA 2FYUK 1SQXK 1MQJA 4AUWA 2HODB 1OVUA 1IITA 2W83C 1MUUA 1MDP1 3QUFA 1FBMA 4N6KA 4Q8RA 3PV0E 1FZCC 1B5IA 5AA2A 2ZT9C 4LZ5A 3S9NC 1FQCA 5KLIB 1BCCG 2CPSA 2OYHA 3QYTA 1OIBA 1VQLP 3Q25A 3DLNA 3H32A 4H44C 4IOIH 3TKDA 5I57B 1YZ0A 3C35A 3I56P 1FTJA 3QXMA 4IL6E 2HYNA 2QM7A 3PU5A 1M5DA 1YTVA 1Q7YQ 4KT0J 4CPGA 3SKPA 4EQBA 2M5AB 3DP8A 2ALUA 1QW0A 3U1CA 4QRZA 3L70D 3CL3D 4NPFX 1LAGE 5I2NB 2V7QH 1BE3G 3V4QA 3M8UA 1IXIA 4RESB 4ZKPA 1L4AC 3Q29A 3B8EB 5EQ8A 3HO7A 3BASA 3NFQA 4OFLA 3CX5H 2P3VA 4BDMA 2XNXA 4PC9A 3HUSB 1B7ZA 5EHMA 4KI0E 4RO0A 4NF5A 3B6TA 3DP4A 2O01N 4PAFA 2R5BA 4PD4E 2IZ1A 1M56D 5L9MA 1MXWA 2RC8A 1SQBE 2PP6A 4LQ5A 5I59B 5K2XA 3IO6A 3O2AA 1RE4C 3KOSA 2XD2A 3K6WA 4H65A 4NF0A 5I58B 4H6DA 2POHA 4EXLA 2E5TA 3H1IJ 3M3FA 4Z0IA 1P1UA 2ESNA 2RINA 3KFMA 5DTBA 3PPRA 3TTNA 5FTIA 3U94A 4R4LA 5I58A 3V2RA 1NAFA 3S4RA 4I7ZB 3L74E 3V2NA 1IO4A 1YHQP 4H0LB 1JTHB 1VQ4P 5BWJA 1AV1A 2BEZF 3AEDC 1FDIA 1JCDA 2WPSA 3RL0g 4NEDA 2F78A 4WXJA 1Z56A 1NTKG 4U7JA 4XXUA 1T8ZA 3CWBG 4YMAA 2W8ZA 3U72A 1RQUA 4EQ7A 5I2KA 4NX1A 4UABA 3KBZA 3CXHH 2QM8A 2ZYOA 2NPSA 2HFBA 4M4GA 1S50A 1S4XA 4PFBA 2KLUA 4QFPA 2DWIA 3CVGA 3K2DA 1QVFO 2QVUA 2VP1A 2Y7WA 2G3AA 2I0CA 1QUIA 2WITA 4DI4B 4OEVA 2VD3A 2VHAA 4QFNA 1B9JA 2REGA 5CMMA 1NTMJ 3TQLA 3B6QA 3K5BA 3ISPA 4G68B 3KZGA 3MVYA 4YKJA 1MQHA 5ISUA 2QJYB 4YXDC 1PPJE 1OMPA 3GMAA 1UIXA 2PFZA 1S9KE 4I1DA 3RK3E 3KQGA 2ABHA 5IZ1A 4C1UA 1NTZD 3CHGA 2P1SA 4KCCA 2KLFA 5APWA 5I3SA 4PV1C 4Q0CA 4F3BA 1UIVA 3II6A 3ITKA 1B3GA 4PGPA 2WX9A 4GX6A 2WSEH 1KN7A 3H06B 4NF6B 1UIIA 3H25A 2XXXA 4JB7A 3A7OA 3H4ZA 2C0WA 3OEMA 3B5NC 1N04A 4N78D 3BIGA 4ZEKA 1KMIZ 1L0LG 2P58A 2UYFA 2R5DA 2XDJA 2HAVA 3PLNA 4FEBA 4MJOA 4YB7A 1URQD 3MC2A 4MF3A 4IY5A 1M1JA 1H0TA 1LFGA 1YXIA 1Y3QA 3N6TA 1MS7A 1S3JA 4HS7A 5ESYA 2YLNA 3WAEA 1VQ6P 3G9RA 1PGQA 4W7ZA 3FV2A 1LT9B 2OK2A 1IXHA 1FZGA 4PDHA 4KHZE 1VFEA 2XXPA 3KC1A 3L70G 4ZKUA 1B7HA 2H8PD 4P47A 1MQIA 1MY0A 3EHTA 3O66A 3Q5PA 2Y5LA 4P11A 1S5LX 1VQ5P 3CFXA 1PPJD 1GL2B 2G93A 3FXQA 4JYCA 4PE3A 1VQ7P 2KNCB 2KK7A 3EFFK 1VF5B 2N9YB 1YQ3C 1SFCA 1SBPA 1QL1A 5F7VA 3CWBJ 1A8FA 2Q2CA 1N7SD 1POTA 4THIA 5CBSA 5I56B 5BU5A 3KSJA 2FXMA 2CMOA 2HG5D 1H43A 1B3HA 2Y0DA 1PZQA 4OA4A 2F7BA 1RE4A 2FHYA 1YYZA 4ISUA 3AEAC 2HFED 4DOJA 5CCHD 2B3BA 1L0LK 2YIUB 2H4IA 4LA9A 1B4HA 4BDNA 4OANA 2JR8A 1L4AD 2XV5A 1Y3PA 1KTMA 4U4XA 1FDOA 1R9LA 3PHLA 1NV1A 4N15A 1L4AA 3M91A 3MVWA 3K01A 1R5SA 2DVCA 3MWBA 3RT8A 4PE5B 1I6QA 1FS0E 2PYYA 2XD3A 1IIWA 3CCJP 3UA8A 1BGYG 3CCUP 4OGQD 2FXOA 2HPCA 1ZMEC 1Y4CA 3ILTB 3E1IA 4UACA 1IXGA 2H88C 4R4MA 1UIUA 4G8MA 1X8YA 3L71D 1O63A 5CBNA 1LT9A 1N73B 1JY2P 3V5AA 4RJTA 4FJPA 3RNNA 1VQMP 1FJ9A 4O3BA 3Q28A 4PFIA 3OO6A 3A3YB 3ECRA 2PGDA 2RC7A 3BFUA 3CX5E 1YCJA 4NF4A 1ZU0A 1QVSA 1OVVA 1SW1A 2KB7P 3B5ND 1NUXA 3KOTA 3VVEA 4ZEDA 3K0VA 1LWUB 4PF6A 2AXCA 1VPCA 1FPEA 1NTZG 4A7PA 3PUXE 4R9FA 2QEXP 1MXXA 4NE4A 1JMBA 4TT3H 1QX8A 4GWXA 4PGNA 1SQBD 2DOJA 3L37A 4RYAA 2NOOA 1N7XA 2BCCG 1WMKA 1ZBMA 3CPWO 3LC8A 1FCKA 3VFJA 1MH4A 1URSA 2A45I 1IZNB 1LFHA 3K1NA 2Z4EA 2XA5A 2HPCB 3R6UA 1P84I 1MG1A 2OYIC 2LR2A 2PT2A 2Y9YA 3LR1A 5H2FH 1IFDA 2V3QA 4RKUJ 2B4LA 5JTYB 3BIHA 3LUZA 3E9XA 1LBZA 1FBHA 2AEMA 4U3FD 1S2EA 1S72P 1IFIA 1OWAA 4LONB 1Y1MA 4HH2A 2JWDA 1Q90D 3KZIE 2DVZA 3D1RA 1KB9D 4QBAA 3IOUA 2XXYA 2ZVOB 2M3BA 3F5HA 2DW3A 1XVYA 2Y7RA 1LAHE 5CCGD 1CB6A 3M9QA 3AEEC 4ND9A 1ZOYC 1H76A 4O9BA 1NTZJ 3E3KA 1CSBA 3AEBC 4IO5A 5AW9B 3AE2C 2IX7C 2BJJX 3CFLA 1JNMA 1B46A 3TNUA 2AEJA 1OIPA 2QRYA 4LP2B 1I69A 2Y7KA 1PPJG 3M0AA 4K35A 3IB0A 2QG4A 1M5CA 4IFDK 2O7UA 3KJTA 1R5LA 4PDDA 5EYHA 4HJGH 3L4FA 1NKXA 4OQOA 4U1OA 3I5OA 1GK6A 5H8HB 5TISE 3K1MA 2DXRA 2KLVA 2CK3H 1PP9E 2UXAA 4ZNCA 3M06A 1NNFA 4MIJA 4X9TA 4GODA 1FZBA 4EYYQ 3VN0A 1SFCD 5DVFA 3UN6A 3ILUB 4U1ZA 4IR8A 5I59A 1DTZA 4N81A 3RK2B 2GUVA 2L5GB 2QL3A 4RY1A 1DCUA 2WPQA 1KZUB 1URGA 4NWDA 3VXBA 4OGQC 1FPIA 2Z22A 3H1HJ 2UYEA 4QF9A 2V4HA 2XHDA 3BCCD 3IN6A 3KDPB 1BDCA 2GH9A 3FUZA 5IKBA 1LAXA 3A0HH 4R6YA 1HF9A 5I2NA 2OYHB 1KYOE 4R6KA 5DVJA 1G2CA 2W6JH 3PP5A 1KWHA 2P2UA 3SWFA 1NH8A 4DCKA 2PFYA 2P2AA 3JSVC 3MHVA 4I2LC 2FIXA 1SQVE 1IUDA 2Z8FA 3WAFA 3CD6P 1RDZA 5B5EE 3CLQA 1LBVA 5B66E 4X1DA 4RJZA 1J1DB 1LGBC 4OVSA 3OOAA 3PMVA 1VQKP 1S1CX 4H8IA 4N6JA 5CRYA 4F1YA 4HCYA 4JSOA 3SWKA 1IMEA 1A02J 3AE6C 3P32A 5AA2B 5CMKA 2ZNUA 1QGXA 3V8XB 2KSEA 1FZFA 4GWZA 2A5TB 2OX3A 3KSXA 2FYNB 3GZGA 1AH5A 3TTRA 2NWJA 3MVZA 5JEIA 2E74C 3SFEC 1L2PA 1YJ9P 3MUQA 1NNPA 3T66A 2XX8A 2RCBA 5TJHA 2V3UA 4U2RA 1Z7NE 5AA3A 2R71A 1B51A 5AA4A 1NU1E 2PBWA 4QMAA 1K73Q 3MUDC 2XXRA 1P1OA 3KXDA 1KYOH 4PV1D 3TCFA 1Q2NA 1EYKA 3TDJA 4N3YB 3FGAD 3KYQA 2NZ2A 1R8EA 1EXJA 3SEVA 2GM4A 1W2EA 1JMMA 2QIWA 2CZHA 3L74G 1FSAA 5KAIH 2KI7B 3VTPC 2ZZVA 5KDTA 1VQPP 2ZMBA 3Q27A 3HD7C 3OO8A 5APQA 5KLVJ 3CFZA 2D2CD 1OVRA 1Y1ZA 3FV1A 3OENA 4FBPA 1H44A 3G4SP 4GWOA 4GOFA 4LGDE 4I1LA 3ZDMA 1EU8A 2Q9TA 2JDIH 3CCEP 1FPJA 2FFDC 4XFJA 3E13X 4XFEA 2O68A 3KBRA 3W68A 2I48A 1OVBA 4GF8A 4KQPA 1VE4A 1T2KC 2XXQA 3AEGC 2K1AA 3H3GA 1M5EA 4KXPA 3B8BA 1Y9UA 3PTZA 1XS5A 5B70A 1H45A 1B3FA 1JETA 1A8EA 4QSCA 2Z5HA 1D9YA 4XF5A 1NHLA 4HE2A 2KXPB 4NF5B 5CJ4A 3HUSA 1EZVE 5AA4B 1NMUA 1LFIA 2LXCB 5EFWB 4FATA 2WT7B 1LB8A 1TXFA 2VRSA 1RHZB 1Q86Q 2Q2AA 2XWIA 5IM2A 4R6HA 4X04A 5E79E 3PRJA 3V2PA 4FORA 2XXWA 4GXSB 3D70A 2PT1A 2C0XA 4H44D 1LAFE 2A5TA 3B6WA 1NUZA 1GTWA 1ZTYA 4DCYA 1BLFA 4IFFA 1INPA 5I5PA 1G0IA 3O6IA 3ABVC 2HCAA 4OEUA 2F3DA 2WYKA 3H1JE 3CSGA 5FBPA 3B5NB 2YJPA 2YO3A 1LTJB 1URDA 4GFRA 2JKVA 3MPKA 3L71J 4ZE8A 4JBZA 3BCCG 2Q7CA 3QWOC 3T97B 1A55A 1IMFA 2OBGA 1AFOA 3TTKA 3JZJA 1L0LE 3GLBA 1IK7A 5A5LA 1GR2A 2KIKA 4N8GA 5C39A 1AMFA 3MQ9A 4I8CA 4OVRA 1NU1D 3V83A 3HE4B 3LSWA 3H6UA 1LTJA 4F31B 4ZMDA 1QVGO 2WSSH 4RA1A 4MNPA 5EQ9A 3O6QB 1U7MA 3TTLA 3PPQA 5ICTA 1FPGA 2RH0A 3FASA 2QMXA 4PJ0E 1FJ6A 2ONSA 1OMIA 1W5CE 2N1TA 1UTHA 1L0NE 3MAMA 2Y7IA 1RDYA 1R6ZA 2NPSC 5CM6A 2N1TD 2N9BA 3IFAA 1DH3A 1IC2A 1FJKA 2E75C 3H6WA 4PBHA 5I2KB 1A54A 1VF5C 5H2FE 1PEBA 2Z23A 3WU2H 4U23A 4OENA 1N7SC 1USYE 3ZKLA 4NHBA 3M0DC 2QS1A 1RF0A 2E43A 1KA1A 2G29A 3OA7A 3U59A 2KYVA 2E75B 4N6PA 4N07A 1EXIA 2E1SA 2JEEA 2PCRA 3BKIB 3SETA 3TUSA 4YKPA 3L73G 1RYOA 2X26A 4Y99B 3N94A 1B3LA 3CC7P 4TLFA 4NTLA 3KJ7A 4IY6A 3VMAA 2B87A 4O94A 2B3FA 4MLQA 4RPOA 5EHSA 3R4YA 1N2DC 5L8DA 3TZAA 1N8RQ 2F5XA 3I55P 5CBOA 1RF1C 1USDA 4YXWH 4GL8A 3CCSP 3HTKA 1MY3A 2XXTA 1FDMA 3A0BH 1NV2A 2YIUC 1SVFA 2WVRA 1NV3A 3DELB 3K4UA 4WY4A 4AYCA 5JK4A 1DD4A 1ZN5A 2UWJE 1SVXB 5GTHH 2BJIA 3OAKA 4R72A 5CCGA 1XOCA 1PP9D 4IFMA 2L5VA 2XXKA 1LBWA 5DVIA 5L9SA 3O6HA 1D9VA 4OERA 2YKPA 3E4RA 1N76A 3U8QA 1JQFA 1ZLQA 3FZVA 1JM0A 2XXIA 4ZEIA 1XVXA 1JY3P 1FE6A 2AIXA 4GRKA 1GDTA 1DX7A 3AE1C 4LQ2A 5KJ7A 3BVHA 3T9UA 2N1TB 1UTHB 3T93B 1OXZA 4KFQA 1P1NA 5KLVD 2WPRA 2WYPA 2O1KA 3TMGA 3T97A 3NXSA 2H25A 3GBBA 3P8CE 3A09A 1VR5A 4WKMA 1MDQA 4O3AA 4GOEA 3CMAP 3HE5B 1Q9DA 1NU1G 2FVZA 2CEYA 4FECA 1MPCA 2XXUA 1SQBG 1OVTA 1Y8AA 4I6MC 4L74A 2BCCE 2J59M 3BRTB 3W67A 1JVXA 1IFJA 4ZZEA 5HPQA 1G2CB 1NO4A 3AE8C 1KB9I 2WKYA 3CC4P 3RK3B 3FVKA 5AA1A 3AE9C 3UGWA 4DLDA 1JY2N 1TFAA 2OYHC 5CMBA 2K9YA 4H13C 2KS1B 5FHMA 4FE8A 1ZLLA 2OLBA 5CCHA 2OTKE 2IYOA 1FZCA 5TP9B 2ANJA 3GBAA 3L74J 3P7KA 3JV9A 2IBZE 3L6GA 5APUA 4WWIA 4C7NA 3U65A 1GW4A 1ANFA 2LXBA 5APXA 1NV5A 4H0WA 3KEIA 3FVOA 3LSXA 4OZ9A 2WT7A 2AEFA 4JWXA 5H8FB 3MZWB 4G8HA 3L73D 2DYXA 3HFUA 1B1XA 3A29A 4DIGA 2KZIA 2GHBA 1KFNA 1SW4A 1FPFA 2O6AA 1D7MA 1GGGA 3L71E 4MEVA 1DD3A 4WEPA 1B6HA 2QS4A 4AS4A 4JWYA 2I0BA 2E74B 2AYSA 4YICA 4MAGA 2I8DA 3M9HA 4MLVA 3UK4A 1NTKD 1L0LJ 3S1KA 1PP9J 3CI8A 4P9KA 4PBQA 4R2BA 1U7JA 2I3VA 5KDTB 1N3XA 4OVPA 2ZZXA 2DSFA 3G3JA 1DPPA 3M3LA 3USDA 1KILB 5AVYB 5AW0B 1PV3A 4ASVA 4P3LA 5AVZB 4F19A 2FYUG 1PGOA 3ROJA 1K05A 3T0JA 1PP9G 2O01H 1RF1B 2YKQA 1LP1A 1GU5A 4PAKA 2WSFH 2ZJSE 1CZQA 2ZAEB 4GL0A 2UVGA 1P1QA 2F8DA 4XKPA 1Q81Q 1TWYA 1BGYJ 3H7MA 4ZS9A 3AE4C 1DTGA 1LBBA 3FVGA 3FXBA 3K6UA 1NU1K 3N5LA 1KC8Q 1B0HA 4HE1A 5KAFH 2UVHA 4P0GA 2I4CA 2LKMA 3ONMA 1WODA 1OFCX 1FZAA 1PL5A 1B5JA 4PCDA 1EZPA 5E79H 4WBAA 4JF7A 1NFTA 4JXIA 1SQPK 1OQGA 3KN8A 3RL0C 2QJEA 4NGUA 4ELOA 1CNQA 4PJ0H 1VF5D 1URQB 2IZ0A 1KB9H 1US5A 3ZKKA 1CI6B 2K37A 2QSIA 3C4MA 3SZPA 1QLED 3UP9A 3H1LE 1FPDA 4HXVA 4IO3A 4U3FE 2R3CA 4ZDMA 1FBDA 2L91A 3RK2C 3GHGA 4IB2A 2HXWA 1SQQK 1EDJA 1H3DA 1MFTA 1SP4A 3H6VA 1SI0A 1NGMB 3O6GA 1WDNA 3B50A 4L17A 4R74A 1USYH 3B7DA 5KJ7C 5KLVG 2I4BA 1LWUA 3RGUA 1YJWP 1FW0A 1LB9A 3HRNA 3RN8A 1EDLA 1E79H 4G77A 5ITOA 1AQ5A 4QFKA 3SFDC 4YB5A 3SERA 1ZRTD 4OHNA 4NF4B 1NU1J 4BRYA 4QXDA 2IFNA 1Q1KA 1N7SB 3OXNA 4Q30B 2A06E 2E76D 3SEXA 1KD1Q 1KILE 4F39A 3PMXA 4AQRD 2E42A 4D6TG 2YXQB 2VD2A 3RLFE 1BSNA 2DDKA 2FY8A 3Q2YA 3H1KJ 1I6BA 2CZKA 2KUBA 1Z7ME 1AOVA 4WB4A 3LIEA 4JWOA 3FXRA 1QJMA 3MP6A 2QVRA 4GIFA 3JYRA 2O1MA 1RYXA 5LOMA 4HCWA 1LT9C 1NTZK 1DIPA 1SD3A 1M8OB 1Y47A 4OMBA 3L72D 4ZE9A 4HTGA 4POXA 4DE8A 2FYIA 3TNUB 5CHXA 1A7LA 5BVZA 1NH4A 3WMM0 3H6TA 2V4CA 3H1LD 4GBVA 1S9TA 3HN0A 1DSNA 3CCQP 4EOTA 4ELQA 1NTKE 4LZ8A 1HVVA 2KOGA 1RF0C 1MY4A 3MSTA 2BCCJ 4OESA 4O7MA 1AWBA 1M5FA 2C9LY 2D5WA 3CCLP 3UORA 2P1JA 1LGHB 3PUWE 1S5LE 3TELA 3EPEA 2KNCA 4XA4A 4P1LA 1KYOI 4OWDA 1DK4A 3FWLA 1US4A 3C33A 1MV8A 1FPLA 3G3HA 3L72E 3CX5I 2H98A 3V6IA 1T2KD 5APYA 2WQYC 2H9BA 2WEFA 1NTMG 1WRGA 1MFZA 2P3NA 2GHAA 1NKNA 2QA4P 3A2AA 1P99A 3G71P 2OWSA 3KGCA 4Y99C 3OO9A 2DP8A 3T9XB 3IFCA 3TGUJ 1SQXJ 2XWVA 4BDQA 4H45A 2J58A 1PC3A 3FXEA 2HR3A 3L6HA 4NAPA 5TU0A 4H0LC 3PPOA 4TOZA 1VQNP 3QSLA 1SLQA 1B5HA 1SQXG 3D6ZA 3EHUA 4W80A 1N7SA 3I6VA 4GVOA 1P1WA 2V3TA 4ZZAA 2H99A 2WSEJ 4MX6A 3AECC 5ELVA 4I40A 4NWCA 3G3FA 2QMWA 2AXTH 1FTKA 2GFEA 4OVJA 1PBQA 4IGTA 1BCCJ 2REJA 4BDOA 1AA0A 3IJOB 3P8MC 2A45G 4M3LA 4UA8A 4NF6A 1LT1A 5IZZA 2WMMA 4DT0A 2UVJA 2H5YA 4GLIA 3TQWA 4MHFA 3W15C 3MGNA 1K04A 3SEYA 3GHGB 1JP4A 4GOTA 2O1JA 4QSDA 5AW6B 3IB1A 3MTUE 5I57A 3K6XA 5DJUB 1N0TA 2OWZA 4NMYA 1CI6A 3EN3A 3B71A 3L73J 2XX9A 4YU0A 4HB1A 1MM6A 3AXFA 2O1LA 3HE5A 1K9MQ 4PFRA 4X1BA 2FIEA 4MH5A 2XZRA 2YKOA 2F34A 3GLMA 1B32A 2D21A 1CE2A 3P7IA 5L8RJ 1R9QA 2H43A 3N4XA 3PJSK 4Y28J 1LBYA 4W7YA 3LUYA 2XWKA 1D3KA 5FHOA 3WUUA 1MPDA 3K1PA 1JB0J 2DE4A 1MY2A 1LNQA 2BEQD 2DS9A 3VV5A 3L70J 4R73A 1I6AA 4EUOA 2FFDA 4ESXA 5KLVK 1VQ9P 4N13A 1P84H 1FQAA 2HPGA 4AS5A 1HJ0A 2Q6QA 4DDDA 4D6TJ 5L9OA 1O7TA 4GX4A 4IGRA 2DQVA 3VMXA 1EZ9A 1MM7A 5I56A 3S9LC 1LJ2A 3FXUA 4OWFA 4Q5TA 1PFIA 3H1HE 1JW1A 4JDFA 2DXYA 1SFCB 2QJPB 2GUSA 3H1JD 4O8MA 5CC2A 4C1TA 3R2PA 3HUSC 5AVTB 3A0BE 3L36A 4K3FA 4F29A 3RK2D 4E0XA 1GVCA 2IPPA 1RH5B 1T6AA 4DJGA 1SQYA 5I7IA 1SQQE 3MUDA 3PMWA 1EYJA 2WWWA 1MXUA 1NTMD 3RL0D 3H1LG 2HZLA 3C1LA 3D6YA 2WTYA 2FA7A 4F1VA 1LLSA 4U21A 3RTFB 2FYUJ 2OARA 2R3SA 3VP8A 1HWTC 4UB8E 1IQ7A 3Q5SA 3GXAA 3LIDA 1LSTA 2W7YA 1YTZT 1FBPA 4OH8B 1AJYA 4RXLA 4IO7A 3HV1A 4XIGQ 4EI2A 2WPVB 1B40A 4NPEA 3FJ7A 2VOZA 2IYPA 2Q74A 4F18A 2XX7A 2OTJP 3H1JJ 1OZHA 4GDOA 5H8FA 3FVNA 5BU8B 1RDXA 1OW6A 3OJAB 2QS3A 2ZVNB 3H03A 4NQ8A 3GYYA 5EQAA 1BIYA 3EFGA 3WUTA 1Q82Q 4XE5B 1N3WA 4KCDA 5IZ3A 1N7WA 1OQHA 5AW2B 2M5AA 4IO2A 1NV7A 3LSFB 3PPNA 2ZYNA 1SQVK 1HSEA 4Z7EA 4TQUQ 1VQ8P 2OGUA 4JVIA 1FBCA 1FQBA 3EHSA 4YB6A 3V2QA 1DEBA 1NTZE 4LZ7A 5KLIC 3ODBA 3Q26A 1OLCA 4RK2A 2V7QJ 1JEKA 1SQPD 5AW4B 3DP6A 2E76C 1N7LA 2I3WA 2XNDH 3V89B 3NTNA 3U1OA 3CG3A 3H1KD 4DZ1A 2IDBA 2FXPA 1FPKA 4ZEBA 1X79B 1O64A 1B52A 1DBZA 2YNYA 3G3GA 4FEDA 1QULA 5KCJB 4N6DA 1LTIC 4OVTA 2QS2A 1NV4A 5TISH 1LTGC 3H1ID 3OSRA 5H8QA 3TGUD 3A5TA 3LW5H 1GV8A 3TAJA 1NOHA 4JVCA 1IFNA 2WSCJ 3VOPA 3MBPA 2Y9ZA 3GHGC 5M2VA 1QKBA 2R32A 2F6PA 1SQPE 1BCCD 1BP5A 1DMBA 1K8AQ 2Q88A 3HSTA 4FAJA 4KJMA 3N7NA 3I3VA 3TYHA 4EIJA 5KTBA 4FIMA 1GMJA 4WY4B 2Y84A 4BXLA 3C32A 1AQTA 1K9YA 2I49A 3L75J 2NXOA 4DZOA 3AEFC 1HSLA 4L76A 2ONKE 3S9EA 3GG2A 4XTCQ 3KN7A 2PAJA 1VQOP 1J1EC 5KKZB 3A0HE 4MBPA 5IZ3B 3FD3A 4PETA 1FBGA 4AQ4A 1BE3D 4LLHA 3H1LJ 1KQLA 1EZVD 1QUJA 2DWJA 1YYCA 1ZJLA 3VLUA 1FBFA 3IAZA 4WEDA 4H8JA 1ZR2A 2O3JA 1B3EA 2PMSA 5CBRA 3CX5D 3VVDA 1NUWA 1EYIA 1L0ND 1FPBA 1W2BO 5TPAA 5BUUA 1ZKBA 3NOHA 2ZYGA 4QFLA 1YIJP 2QFLA 2IBZI 2WSCH 1SQBK 2AL5A 2AL4A 4NN3A 3S9OA 2B65A 1N86A 3BCCE 3MD0A 3VP9A 2R44A 2YMKA 4H5FA 1SW2A 1ZRTE 2ZYAA 2YXRB 4PD4D 1LBXA 3BRVB 3C9HA 4HKZH 4GX3A 4C7NB 1KB9E 2X7QA 1QKAA 2HXRA 2JWAA 3EKIA 4Z1MH 1NI9A 3IL1B 3R7XA 5TP9A 3OSQA 2JJLA 1PDAA 3WU2E 2W90A 4TLMB 2HQ0A 4H1XA 2PVUA 1M1KQ 1SQPJ 4ZECA 3I5CA 2NUVA 5F1QA 1UQWA 3MZ9A 3VE1B 2FYZA 1SQVG 2Q8MA 3IX1A 3U93A 3AE3C 1IMDA 1ZIUA 3N6UA 1B58A 5KLVE 4PD4I 2JO1A 3UIFA 5I84A 3H1KG 3SDFA 4PD4H 3PD9A 3W9WA 2QJKB 2DWAA 1J1DC 3TEPA 3T9VA 1SQBJ 3SESA 1BGYE 3QMFA 4C0RA 4RK9A 3AE7C 1LTBC 3H1IG 1LWUC 4OYVA 1KORA 5AVXB 3FX0A 3VXCA 2ONRA 1ZW0A 1R1NA 4GWYA 4BRYB 1RE3C 4D6TD 1L5TA 1MXZA 1KA0A 2E75D 4N4UA 5APVA 1NNTA 3EWKA 2R9JA 1HUCA 3VMZA 4OXVA 3CMEP 1JOCA 4R75A 5GTHE 1BK4A 1SYHA 2H89C 4U3FJ 5ICQA 5H8NA 3BFTA 4O7IA 2VPOA 2Y5KA 1BE3J 3PUZE 2OYIB 2RKLA 4ELRA 1LTAC 2F3BA 4UB8H 4H67A 1FTAA 3VYIA 3TGUG 3L75G 5ET8A 1IK9A 1XC1A 4EQ9A 1MQGA 4F2QA 3QH9A 4EDPA 3D71A 2QVAA 2Q9IA 1OW7A 3MP7B 1JEUA 3TPAA 2SPZA 3PD8A 5B5EH 5AE4A 3U1AA 1DEEG 3TCGA 1B0LA 2QE7H 3USSA 2XKMA 3CXHD 2XWOA 3BATA 3AE5C 1EC5A 4YKIA 4L73A 5CCGC 3IOTA 2KR0A 4ASWA 1XI6A 1QGKB 5TPAB 4KPTA
chains in the Genus database with same CATH topology
1SS1A 1J1NA 3CG1A 3PUYE 2I58A 4PFYA 4QFOA 4G4PA 4ECFA 1LP1B 4E0WA 1B7UA 3TODA 4BDLA 2D3IA 1AIVA 2HZKA 2DWHA 3MVXA 5HBCA 1TFDA 4KYDA 4G8NA 4HW8A 3RGYA 4NF8A 3IR1A 1EH3A 5FTHA 3QAXA 4EXKA 5H8QB 4F3SA 3O29A 3MW0A 4PFWA 4PQJA 4XKQA 2F36A 4DXBA 1DOTA 4QSEA 1JNFA 2F7AA 1XHYA 2QSXA 4BLAA 4ELPA 3MJNA 3W9VA 1MY1A 3S2VA 2ZYMA 4KR5A 4DXCA 3CIJA 1GTKA 3SEUA 1ATGA 3ZS6A 4BDRA 3O28A 3K00A 2Z8DA 4KYSA 2I6EA 3PH0A 3IORA 3CSBA 3G3IA 5CI5A 1FQDA 1T0KA 3A3UA 2ZNTA 2Q89A 2P0SA 3FIRA 3ZSFA 3D4GA 4NF8B 4OTEA 3IK6B 2Q1KA 3FATA 4GD5A 4DXUA 4NPDA 2YPNA 4F3PA 2O7IA 4YMBA 4MFIA 3MP1A 5FHNA 2UVIA 1VSOA 4DCXA 3G3KA 1TT1A 3CRBA 5A5XA 1IZ1A 3MZ1A 3C31A 3HPIA 5DT6A 1A40A 3PGFA 1LBCA 2CZLA 1PB9A 5A5XB 4I62A 4MN4C 4R2FA 2B87B 3VLVA 1MXYA 1HSJA 3OO7A 2IA4A 4EF2A 2QRXA 3FJGA 3HCQA 2XXVA 4PFUA 4F22A 3T96B 2XXHA 4AB6A 1B2HA 1PBPA 3MP8A 1FC2C 3C36A 1QUKA 1MPBA 3FXDA 1Y4TA 1OLAA 3RT6B 3T22A 1NVOA 4OETA 4OFJA 3RTWB 5DYHA 3SEWA 1IEJA 3PUVE 3OMBA 1JEVA 3RQTA 2K3RA 4PP0A 3QK6A 1PB8A 4H5GA 3O97A 1A99A 2PX1A 2F35A 3QIMA 3R26A 1B4ZA 2B88A 4G2ZA 5HM4B 2DE2A 3O9PA 2RC9A 1X0TA 3M3KA 1ZXGA 3EQ1A 2F6GA 3LBSA 2M0BA 1LCFA 4POWA 3DM0A 4I9DA 2V84A 4XKRA 3EF7A 4LUBA 1Q35A 4ESWA 3G7WA 1SDXA 3RUMA 1B05A 1MH3A 1BTJA 1NL5A 2OWTA 1SYIA 4IO6A 4U22A 5B7DA 2OZZA 1VFDA 1XT8A 3HHFA 3RY3A 1BKAA 1SW5A 4GXAA 2V25A 4M1VA 2GRVA 5DJTB 1JVYA 3FGSA 4OFOA 4G68C 4KYEA 1FQEA 3QUJA 1DPEA 4K3AA 1FTMA 2R6GE 2A5SA 3TFLA 5H8SA 2O84X 3S9MC 5AA2D 2QPQA 1JW5A 3IJXB 4RPNA 2OJTA 4P0IA 5DEXA 2VGQA 4GIZA 1PB7A 2HEUA 3T9HB 3VDFA 1H0TB 2F97A 3TTMA 1EDIA 2B89A 5EYFA 2ZXTA 4ZEFA 4F3GA 2E0SA 5KCJA 4PFTA 1POY1 4RNSA 3IOVA 1ELJA 2DE3A 4TLLB 2OCUA 1EDKA 4X48A 3U92A 3MPLA 2RF1A 1YPNA 3OEKA 2Z8EA 5KZTA 1FTLA 2ZYKA 4LVQA 1NH7A 4GQOA 2X7PA 1N84A 4AB5A 2FNCA 5IAIA 3IB2A 4G68A 3MZBA 3HHGA 1B1HA 2LAOA 2V93A 1RKMA 2KZJA 4YZZA 1ZMGA 1Y3NA 1NNKA 1UTBA 2M8CA 2O51A 5K2YA 3TCHA 5DEXB 4YKKA 3VVFA 1EZOA 1IXCA 3THIA 4F1UA 2NVUB 5H8HA 5ITPA 3F11A 2F7CA 1MQDA 3BBRA 3D4CA 1AL3A 3CR9A 3N26A 4LATA 5K5GB 3IO4A 2ZNSA 3K6VA 1LCTA 2Q8JA 1FQFA 2O69A 1D4NA 1SI1A 1FTOA 1BDDA 3KN3A 1UTBB 3KG2A 1WVJA 1JW4A 3RPWA 4KD5A 5H8NB 3S4UA 2RKMA 3FJMA 1YAEA 1S7YA 5CMCA 2HAUA 3IOWA 4O3CA 3K02A 4ONYA 4JSDA 2RCAA 4F2OA 4IO4A 3OD7A 3PPPA 5JTYA 1MRPA 3A3CA 3C34A 4QHQA 2Y7PA 1Y20A 1II5A 4R9GA 4EF1A 2IEEA 1M5BA 4YAHX 4U4SA 1MXVA 2THIA 1F9BA 3OELA 3LSLA 5J1DA 4XKNA 3VLWA 1MQJA 1OVUA 1IITA 1MDP1 3QUFA 4Q8RA 3PV0E 1B5IA 5AA2A 3S9NC 4LZ5A 1FQCA 3QYTA 1OIBA 3Q25A 3DLNA 3TKDA 4IOIH 5I57B 3C35A 1FTJA 3QXMA 3PU5A 1M5DA 1YTVA 3SKPA 4CPGA 4EQBA 2M5AB 3DP8A 2ALUA 1QW0A 4QRZA 1LAGE 4NPFX 5I2NB 3M8UA 1IXIA 3Q29A 3HO7A 4OFLA 4BDMA 1B7ZA 5EHMA 4KI0E 4NF5A 3B6TA 3DP4A 5L9MA 1MXWA 2RC8A 4LQ5A 5I59B 5K2XA 3IO6A 3O2AA 4H65A 3KOSA 2XD2A 3K6WA 5I58B 4H6DA 4EXLA 3M3FA 4Z0IA 1P1UA 2ESNA 2RINA 3KFMA 5DTBA 3PPRA 3TTNA 5FTIA 3U94A 5I58A 5BWJA 4NEDA 2F78A 4WXJA 4XXUA 4YMAA 3U72A 4EQ7A 5I2KA 2ZYOA 4M4GA 2HFBA 1S50A 4QFPA 2DWIA 3CVGA 3K2DA 2VP1A 2Y7WA 2I0CA 1QUIA 4OEVA 2VD3A 2VHAA 4QFNA 1B9JA 2REGA 5CMMA 3TQLA 3B6QA 4G68B 3KZGA 3MVYA 4YKJA 1MQHA 5ISUA 1OMPA 4I1DA 2ABHA 4C1UA 2P1SA 4KCCA 2KLFA 4Q0CA 4F3BA 1UIVA 1B3GA 3H06B 4NF6B 2XXXA 4JB7A 3H4ZA 3OEMA 1N04A 4ZEKA 2P58A 2UYFA 2HAVA 4FEBA 4YB7A 3MC2A 4MF3A 4IY5A 1H0TA 1LFGA 1Y3QA 3N6TA 1MS7A 1S3JA 4HS7A 2YLNA 3WAEA 3FV2A 2OK2A 1IXHA 4KHZE 1VFEA 2XXPA 1B7HA 1MQIA 1MY0A 3EHTA 3O66A 4P11A 3CFXA 2G93A 3FXQA 1SBPA 5F7VA 1A8FA 2Q2CA 1POTA 4THIA 5CBSA 5I56B 3KSJA 2CMOA 1H43A 1B3HA 2F7BA 4ISUA 2B3BA 2H4IA 4LA9A 1B4HA 4BDNA 1Y3PA 4U4XA 1R9LA 3MVWA 3K01A 2DVCA 3MWBA 3RT8A 4PE5B 1I6QA 2PYYA 2XD3A 1IIWA 3UA8A 1Y4CA 3ILTB 4UACA 1IXGA 1UIUA 4G8MA 1O63A 5CBNA 3V5AA 4FJPA 3RNNA 4O3BA 3Q28A 3OO6A 3ECRA 2RC7A 3BFUA 4NF4A 1YCJA 1ZU0A 1QVSA 1OVVA 1SW1A 3KOTA 3VVEA 4ZEDA 3K0VA 3PUXE 4R9FA 1MXXA 4NE4A 1JMBA 2DOJA 4RYAA 2NOOA 1N7XA 1ZBMA 3LC8A 1FCKA 3VFJA 1MH4A 1URSA 1LFHA 3K1NA 3R6UA 1MG1A 2LR2A 2PT2A 3LR1A 2V3QA 5JTYB 3E9XA 4LONB 1Y1MA 2JWDA 2DVZA 3IOUA 2XXYA 2Y7RA 1XVYA 1LAHE 1CB6A 4ND9A 1H76A 3E3KA 4IO5A 2BJJX 3CFLA 1B46A 2QRYA 4LP2B 1I69A 2Y7KA 4K35A 3IB0A 1M5CA 2O7UA 3KJTA 4HJGH 1NKXA 4OQOA 4U1OA 3I5OA 5H8HB 3K1MA 2DXRA 2UXAA 4ZNCA 1NNFA 4X9TA 4GODA 4EYYQ 5DVFA 3UN6A 3ILUB 4U1ZA 5I59A 1DTZA 2QL3A 4RY1A 1URGA 4NWDA 3VXBA 2Z22A 2UYEA 4QF9A 2XHDA 1BDCA 2GH9A 3FUZA 5IKBA 1LAXA 4R6YA 5I2NA 4R6KA 5DVJA 1NH8A 1KWHA 2P2AA 3MHVA 3WAFA 2Z8FA 1IUDA 4X1DA 4RJZA 1LGBC 3OOAA 3PMVA 4H8IA 5CRYA 4F1YA 4HCYA 4JSOA 5AA2B 5CMKA 2ZNUA 3V8XB 2A5TB 3KSXA 3GZGA 1AH5A 3TTRA 2NWJA 3MVZA 5JEIA 3MUQA 1NNPA 3T66A 2XX8A 2RCBA 2V3UA 4U2RA 1Z7NE 5AA3A 2R71A 1B51A 5AA4A 2PBWA 2XXRA 1P1OA 3TCFA 1Q2NA 3TDJA 3SEVA 2KI7B 5KDTA 2ZMBA 3Q27A 3OO8A 3CFZA 1OVRA 1Y1ZA 3FV1A 3OENA 1H44A 4GWOA 4GOFA 3ZDMA 2Q9TA 1EU8A 3E13X 2O68A 3KBRA 2I48A 1OVBA 4GF8A 4KQPA 1VE4A 2XXQA 3H3GA 1M5EA 1Y9UA 1XS5A 5B70A 1H45A 1B3FA 1JETA 1A8EA 4QSCA 1D9YA 4NF5B 5AA4B 1NMUA 1LFIA 2LXCB 5EFWB 4FATA 1LB8A 1TXFA 2Q2AA 4R6HA 4FORA 2XXWA 4GXSB 2PT1A 1LAFE 2A5TA 3B6WA 1ZTYA 4DCYA 1BLFA 3O6IA 2HCAA 4OEUA 3CSGA 2YJPA 1URDA 4GFRA 3MPKA 4ZE8A 4JBZA 3QWOC 1A55A 2OBGA 3TTKA 3JZJA 3GLBA 1GR2A 2KIKA 5C39A 1AMFA 3MQ9A 4I8CA 3V83A 3LSWA 3H6UA 4F31B 4ZMDA 4RA1A 1U7MA 3TTLA 3PPQA 5ICTA 3FASA 2QMXA 2ONSA 1UTHA 3MAMA 2Y7IA 1R6ZA 5CM6A 3H6WA 5I2KB 1A54A 1PEBA 2Z23A 4U23A 4OENA 1USYE 3ZKLA 2QS1A 2G29A 4N6PA 4N07A 2E1SA 3TUSA 3BKIB 3SETA 4YKPA 1RYOA 2X26A 3N94A 1B3LA 4NTLA 3KJ7A 4IY6A 2B87A 2B3FA 4MLQA 4RPOA 5EHSA 3TZAA 5L8DA 2F5XA 5CBOA 4GL8A 1MY3A 2XXTA 3K4UA 3DELB 5JK4A 2UWJE 1SVXB 4R72A 1XOCA 5DVIA 5L9SA 3O6HA 1D9VA 4OERA 3E4RA 1N76A 3U8QA 1JQFA 1ZLQA 3FZVA 1JM0A 2XXIA 4ZEIA 1XVXA 2AIXA 4GRKA 4LQ2A 3T9UA 1UTHB 3T93B 4KFQA 1P1NA 3TMGA 2H25A 3GBBA 3A09A 1VR5A 4WKMA 1MDQA 4O3AA 4GOEA 4FECA 1MPCA 2XXUA 1OVTA 1JVXA 4ZZEA 5HPQA 2WKYA 3FVKA 5AA1A 3UGWA 4DLDA 1TFAA 5CMBA 2KS1B 5FHMA 4FE8A 2OLBA 2OTKE 5TP9B 2ANJA 3GBAA 3JV9A 3L6GA 4WWIA 1ANFA 2LXBA 4H0WA 3KEIA 3FVOA 3LSXA 4OZ9A 4JWXA 5H8FB 3MZWB 4G8HA 2DYXA 1B1XA 4DIGA 2KZIA 2GHBA 1SW4A 2O6AA 1GGGA 4WEPA 1B6HA 2QS4A 4JWYA 2I0BA 2AYSA 4YICA 2I8DA 4MLVA 3UK4A 3S1KA 4R2BA 5KDTB 3CI8A 1U7JA 2I3VA 1N3XA 2DSFA 3G3JA 1DPPA 3M3LA 3USDA 4ASVA 4F19A 1LP1A 2ZAEB 4GL0A 2UVGA 1P1QA 2F8DA 4XKPA 1TWYA 3H7MA 4ZS9A 1DTGA 1LBBA 3FVGA 3K6UA 3N5LA 1B0HA 2UVHA 4P0GA 2I4CA 3ONMA 1WODA 1B5JA 1EZPA 1NFTA 4JXIA 3KN8A 1OQGA 4ELOA 2QJEA 1US5A 3ZKKA 3C4MA 3UP9A 4IO3A 4ZDMA 4IB2A 2HXWA 1EDJA 1H3DA 1MFTA 3H6VA 1SI0A 3O6GA 1WDNA 4L17A 4R74A 1USYH 3B7DA 2I4BA 3RGUA 1FW0A 1LB9A 3RN8A 1EDLA 4G77A 5ITOA 4QFKA 4YB5A 3SERA 4OHNA 4NF4B 1Q1KA 3OXNA 4Q30B 3SEXA 4F39A 3PMXA 2VD2A 3RLFE 1I6BA 1AOVA 2KUBA 1Z7ME 4JWOA 3FXRA 1QJMA 3MP6A 3JYRA 2O1MA 1RYXA 5LOMA 4HCWA 1SD3A 1Y47A 4OMBA 4ZE9A 4HTGA 4POXA 4DE8A 2FYIA 1A7LA 3H6TA 1S9TA 3HN0A 1DSNA 4ELQA 4LZ8A 1MY4A 4OESA 2D5WA 1M5FA 3UORA 3PUWE 3TELA 3EPEA 4OWDA 1US4A 3C33A 3G3HA 2H98A 2H9BA 2GHAA 1P99A 2OWSA 3KGCA 3OO9A 2DP8A 3T9XB 4BDQA 1PC3A 3FXEA 2HR3A 3L6HA 5TU0A 3PPOA 4TOZA 3QSLA 1B5HA 3EHUA 3I6VA 4GVOA 1P1WA 2V3TA 4ZZAA 2H99A 5ELVA 4NWCA 3G3FA 2QMWA 1FTKA 2GFEA 4OVJA 1PBQA 4IGTA 2REJA 4BDOA 3IJOB 4UA8A 4NF6A 1LT1A 2WMMA 3TQWA 2UVJA 2H5YA 4GLIA 3W15C 3SEYA 4GOTA 4QSDA 3IB1A 5I57A 3K6XA 5DJUB 1N0TA 4NMYA 3EN3A 2XX9A 4YU0A 4HB1A 1MM6A 3AXFA 2O1LA 4X1BA 4MH5A 2F34A 1B32A 2D21A 1CE2A 3P7IA 1R9QA 3LUYA 1D3KA 5FHOA 1MPDA 3K1PA 2DE4A 1MY2A 2DS9A 3VV5A 4R73A 1I6AA 4EUOA 4ESXA 4N13A 1FQAA 4DDDA 5L9OA 1O7TA 4IGRA 2DQVA 1EZ9A 1MM7A 5I56A 3S9LC 3FXUA 4Q5TA 1JW1A 4JDFA 2DXYA 5CC2A 4C1TA 4K3FA 4F29A 4E0XA 1GVCA 1SQYA 3PMWA 1MXUA 2HZLA 2FA7A 4F1VA 1LLSA 4U21A 3RTFB 1IQ7A 3GXAA 1LSTA 2W7YA 4RXLA 4IO7A 3HV1A 4XIGQ 1B40A 4NPEA 3FJ7A 2VOZA 4F18A 2XX7A 5H8FA 3FVNA 2QS3A 3H03A 1BIYA 4KCDA 1N3WA 1N7WA 1OQHA 2M5AA 4IO2A 3LSFB 3PPNA 2ZYNA 1HSEA 4Z7EA 4TQUQ 1FQBA 3EHSA 4YB6A 4LZ7A 3ODBA 3Q26A 1OLCA 4RK2A 3DP6A 2I3WA 3V89B 3U1OA 3CG3A 4DZ1A 4ZEBA 1O64A 1B52A 3G3GA 4FEDA 1QULA 5KCJB 2QS2A 5H8QA 3OSRA 1GV8A 3TAJA 3MBPA 5M2VA 1QKBA 2F6PA 2Q88A 1BP5A 1DMBA 3HSTA 4FAJA 4KJMA 3I3VA 3TYHA 4FIMA 2Y84A 4BXLA 3C32A 2I49A 2NXOA 1HSLA 2ONKE 3S9EA 4XTCQ 3KN7A 4MBPA 3FD3A 4PETA 4AQ4A 1QUJA 2DWJA 1ZJLA 3VLUA 3IAZA 4WEDA 4H8JA 1B3EA 2PMSA 5CBRA 3VVDA 5TPAA 5BUUA 1ZKBA 4QFLA 2AL5A 2AL4A 2B65A 4H5FA 2R44A 1SW2A 3C9HA 4HKZH 2X7QA 1QKAA 3IL1B 3R7XA 5TP9A 3OSQA 1PDAA 4TLMB 2HQ0A 4H1XA 2PVUA 4ZECA 2NUVA 5F1QA 1UQWA 3MZ9A 3VE1B 3U93A 3IX1A 1ZIUA 3N6UA 1B58A 3UIFA 5I84A 3SDFA 3PD9A 3W9WA 2DWAA 3TEPA 3T9VA 3SESA 4C0RA 4RK9A 4OYVA 3VXCA 2ONRA 1ZW0A 1R1NA 1L5TA 1MXZA 1NNTA 2R9JA 4OXVA 4R75A 1SYHA 5ICQA 5H8NA 3BFTA 3PUZE 2RKLA 4ELRA 4H67A 1XC1A 4EQ9A 1MQGA 4F2QA 4EDPA 2QVAA 1JEUA 3TPAA 2SPZA 3PD8A 5AE4A 1DEEG 3TCGA 1B0LA 1EC5A 4YKIA 3IOTA 4ASWA 5TPAB 4KPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SS1 A;  1J1N A;  3CG1 A;  3PUY E;  2I58 A;  4PFY A;  4QFO A;  4G4P A;  4ECF A;  1LP1 B;  4E0W A;  1B7U A;  3TOD A;  4BDL A;  2D3I A;  1AIV A;  2HZK A;  2DWH A;  3MVX A;  5HBC A;  1TFD A;  4KYD A;  4G8N A;  4HW8 A;  3RGY A;  4NF8 A;  3IR1 A;  1EH3 A;  5FTH A;  3QAX A;  4EXK A;  5H8Q B;  4F3S A;  3O29 A;  3MW0 A;  4PFW A;  4PQJ A;  4XKQ A;  2F36 A;  4DXB A;  1DOT A;  4QSE A;  1JNF A;  2F7A A;  1XHY A;  2QSX A;  4BLA A;  4ELP A;  3MJN A;  3W9V A;  1MY1 A;  3S2V A;  2ZYM A;  4KR5 A;  4DXC A;  3CIJ A;  1GTK A;  3SEU A;  1ATG A;  3ZS6 A;  4BDR A;  3O28 A;  3K00 A;  2Z8D A;  4KYS A;  2I6E A;  3PH0 A;  3IOR A;  3CSB A;  3G3I A;  5CI5 A;  1FQD A;  1T0K A;  3A3U A;  2ZNT A;  2Q89 A;  2P0S A;  3FIR A;  3ZSF A;  3D4G A;  4NF8 B;  4OTE A;  3IK6 B;  2Q1K A;  3FAT A;  4GD5 A;  4DXU A;  4NPD A;  2YPN A;  4F3P A;  2O7I A;  4YMB A;  4MFI A;  3MP1 A;  5FHN A;  2UVI A;  1VSO A;  4DCX A;  3G3K A;  1TT1 A;  3CRB A;  5A5X A;  1IZ1 A;  3MZ1 A;  3C31 A;  3HPI A;  5DT6 A;  1A40 A;  3PGF A;  1LBC A;  2CZL A;  1PB9 A;  5A5X B;  4I62 A;  4MN4 C;  4R2F A;  2B87 B;  3VLV A;  1MXY A;  1HSJ A;  3OO7 A;  2IA4 A;  4EF2 A;  2QRX A;  3FJG A;  3HCQ A;  2XXV A;  4PFU A;  4F22 A;  3T96 B;  2XXH A;  4AB6 A;  1B2H A;  1PBP A;  3MP8 A;  1FC2 C;  3C36 A;  1QUK A;  1MPB A;  3FXD A;  1Y4T A;  1OLA A;  3RT6 B;  3T22 A;  1NVO A;  4OET A;  4OFJ A;  3RTW B;  5DYH A;  3SEW A;  1IEJ A;  3PUV E;  3OMB A;  1JEV A;  3RQT A;  2K3R A;  4PP0 A;  3QK6 A;  1PB8 A;  4H5G A;  3O97 A;  1A99 A;  2PX1 A;  2F35 A;  3QIM A;  3R26 A;  1B4Z A;  2B88 A;  4G2Z A;  5HM4 B;  2DE2 A;  3O9P A;  2RC9 A;  1X0T A;  3M3K A;  1ZXG A;  3EQ1 A;  2F6G A;  3LBS A;  2M0B A;  1LCF A;  4POW A;  3DM0 A;  4I9D A;  2V84 A;  4XKR A;  3EF7 A;  4LUB A;  1Q35 A;  4ESW A;  3G7W A;  1SDX A;  3RUM A;  1B05 A;  1MH3 A;  1BTJ A;  1NL5 A;  2OWT A;  1SYI A;  4IO6 A;  4U22 A;  5B7D A;  2OZZ A;  1VFD A;  1XT8 A;  3HHF A;  3RY3 A;  1BKA A;  1SW5 A;  4GXA A;  2V25 A;  4M1V A;  2GRV A;  5DJT B;  1JVY A;  3FGS A;  4OFO A;  4G68 C;  4KYE A;  1FQE A;  3QUJ A;  1DPE A;  4K3A A;  1FTM A;  2R6G E;  2A5S A;  3TFL A;  5H8S A;  2O84 X;  3S9M C;  5AA2 D;  2QPQ A;  1JW5 A;  3IJX B;  4RPN A;  2OJT A;  4P0I A;  5DEX A;  2VGQ A;  4GIZ A;  1PB7 A;  2HEU A;  3T9H B;  3VDF A;  1H0T B;  2F97 A;  3TTM A;  1EDI A;  2B89 A;  5EYF A;  2ZXT A;  4ZEF A;  4F3G A;  2E0S A;  5KCJ A;  4PFT A;  1POY 1;  4RNS A;  3IOV A;  1ELJ A;  2DE3 A;  4TLL B;  2OCU A;  1EDK A;  4X48 A;  3U92 A;  3MPL A;  2RF1 A;  1YPN A;  3OEK A;  2Z8E A;  5KZT A;  1FTL A;  2ZYK A;  4LVQ A;  1NH7 A;  4GQO A;  2X7P A;  1N84 A;  4AB5 A;  2FNC A;  5IAI A;  3IB2 A;  4G68 A;  3MZB A;  3HHG A;  1B1H A;  2LAO A;  2V93 A;  1RKM A;  2KZJ A;  4YZZ A;  1ZMG A;  1Y3N A;  1NNK A;  1UTB A;  2M8C A;  2O51 A;  5K2Y A;  3TCH A;  5DEX B;  4YKK A;  3VVF A;  1EZO A;  1IXC A;  3THI A;  4F1U A;  2NVU B;  5H8H A;  5ITP A;  3F11 A;  2F7C A;  1MQD A;  3BBR A;  3D4C A;  1AL3 A;  3CR9 A;  3N26 A;  4LAT A;  5K5G B;  3IO4 A;  2ZNS A;  3K6V A;  1LCT A;  2Q8J A;  1FQF A;  2O69 A;  1D4N A;  1SI1 A;  1FTO A;  1BDD A;  3KN3 A;  1UTB B;  3KG2 A;  1WVJ A;  1JW4 A;  3RPW A;  4KD5 A;  5H8N B;  3S4U A;  2RKM A;  3FJM A;  1YAE A;  1S7Y A;  5CMC A;  2HAU A;  3IOW A;  4O3C A;  3K02 A;  4ONY A;  4JSD A;  2RCA A;  4F2O A;  4IO4 A;  3OD7 A;  3PPP A;  5JTY A;  1MRP A;  3A3C A;  3C34 A;  4QHQ A;  2Y7P A;  1Y20 A;  1II5 A;  4R9G A;  4EF1 A;  2IEE A;  1M5B A;  4YAH X;  4U4S A;  1MXV A;  2THI A;  1F9B A;  3OEL A;  3LSL A;  5J1D A;  4XKN A;  3VLW A;  1MQJ A;  1OVU A;  1IIT A;  1MDP 1;  3QUF A;  4Q8R A;  3PV0 E;  1B5I A;  5AA2 A;  3S9N C;  4LZ5 A;  1FQC A;  3QYT A;  1OIB A;  3Q25 A;  3DLN A;  3TKD A;  4IOI H;  5I57 B;  3C35 A;  1FTJ A;  3QXM A;  3PU5 A;  1M5D A;  1YTV A;  3SKP A;  4CPG A;  4EQB A;  2M5A B;  3DP8 A;  2ALU A;  1QW0 A;  4QRZ A;  1LAG E;  4NPF X;  5I2N B;  3M8U A;  1IXI A;  3Q29 A;  3HO7 A;  4OFL A;  4BDM A;  1B7Z A;  5EHM A;  4KI0 E;  4NF5 A;  3B6T A;  3DP4 A;  5L9M A;  1MXW A;  2RC8 A;  4LQ5 A;  5I59 B;  5K2X A;  3IO6 A;  3O2A A;  4H65 A;  3KOS A;  2XD2 A;  3K6W A;  5I58 B;  4H6D A;  4EXL A;  3M3F A;  4Z0I A;  1P1U A;  2ESN A;  2RIN A;  3KFM A;  5DTB A;  3PPR A;  3TTN A;  5FTI A;  3U94 A;  5I58 A;  5BWJ A;  4NED A;  2F78 A;  4WXJ A;  4XXU A;  4YMA A;  3U72 A;  4EQ7 A;  5I2K A;  2ZYO A;  4M4G A;  2HFB A;  1S50 A;  4QFP A;  2DWI A;  3CVG A;  3K2D A;  2VP1 A;  2Y7W A;  2I0C A;  1QUI A;  4OEV A;  2VD3 A;  2VHA A;  4QFN A;  1B9J A;  2REG A;  5CMM A;  3TQL A;  3B6Q A;  4G68 B;  3KZG A;  3MVY A;  4YKJ A;  1MQH A;  5ISU A;  1OMP A;  4I1D A;  2ABH A;  4C1U A;  2P1S A;  4KCC A;  2KLF A;  4Q0C A;  4F3B A;  1UIV A;  1B3G A;  3H06 B;  4NF6 B;  2XXX A;  4JB7 A;  3H4Z A;  3OEM A;  1N04 A;  4ZEK A;  2P58 A;  2UYF A;  2HAV A;  4FEB A;  4YB7 A;  3MC2 A;  4MF3 A;  4IY5 A;  1H0T A;  1LFG A;  1Y3Q A;  3N6T A;  1MS7 A;  1S3J A;  4HS7 A;  2YLN A;  3WAE A;  3FV2 A;  2OK2 A;  1IXH A;  4KHZ E;  1VFE A;  2XXP A;  1B7H A;  1MQI A;  1MY0 A;  3EHT A;  3O66 A;  4P11 A;  3CFX A;  2G93 A;  3FXQ A;  1SBP A;  5F7V A;  1A8F A;  2Q2C A;  1POT A;  4THI A;  5CBS A;  5I56 B;  3KSJ A;  2CMO A;  1H43 A;  1B3H A;  2F7B A;  4ISU A;  2B3B A;  2H4I A;  4LA9 A;  1B4H A;  4BDN A;  1Y3P A;  4U4X A;  1R9L A;  3MVW A;  3K01 A;  2DVC A;  3MWB A;  3RT8 A;  4PE5 B;  1I6Q A;  2PYY A;  2XD3 A;  1IIW A;  3UA8 A;  1Y4C A;  3ILT B;  4UAC A;  1IXG A;  1UIU A;  4G8M A;  1O63 A;  5CBN A;  3V5A A;  4FJP A;  3RNN A;  4O3B A;  3Q28 A;  3OO6 A;  3ECR A;  2RC7 A;  3BFU A;  4NF4 A;  1YCJ A;  1ZU0 A;  1QVS A;  1OVV A;  1SW1 A;  3KOT A;  3VVE A;  4ZED A;  3K0V A;  3PUX E;  4R9F A;  1MXX A;  4NE4 A;  1JMB A;  2DOJ A;  4RYA A;  2NOO A;  1N7X A;  1ZBM A;  3LC8 A;  1FCK A;  3VFJ A;  1MH4 A;  1URS A;  1LFH A;  3K1N A;  3R6U A;  1MG1 A;  2LR2 A;  2PT2 A;  3LR1 A;  2V3Q A;  5JTY B;  3E9X A;  4LON B;  1Y1M A;  2JWD A;  2DVZ A;  3IOU A;  2XXY A;  2Y7R A;  1XVY A;  1LAH E;  1CB6 A;  4ND9 A;  1H76 A;  3E3K A;  4IO5 A;  2BJJ X;  3CFL A;  1B46 A;  2QRY A;  4LP2 B;  1I69 A;  2Y7K A;  4K35 A;  3IB0 A;  1M5C A;  2O7U A;  3KJT A;  4HJG H;  1NKX A;  4OQO A;  4U1O A;  3I5O A;  5H8H B;  3K1M A;  2DXR A;  2UXA A;  4ZNC A;  1NNF A;  4X9T A;  4GOD A;  4EYY Q;  5DVF A;  3UN6 A;  3ILU B;  4U1Z A;  5I59 A;  1DTZ A;  2QL3 A;  4RY1 A;  1URG A;  4NWD A;  3VXB A;  2Z22 A;  2UYE A;  4QF9 A;  2XHD A;  1BDC A;  2GH9 A;  3FUZ A;  5IKB A;  1LAX A;  4R6Y A;  5I2N A;  4R6K A;  5DVJ A;  1NH8 A;  1KWH A;  2P2A A;  3MHV A;  3WAF A;  2Z8F A;  1IUD A;  4X1D A;  4RJZ A;  1LGB C;  3OOA A;  3PMV A;  4H8I A;  5CRY A;  4F1Y A;  4HCY A;  4JSO A;  5AA2 B;  5CMK A;  2ZNU A;  3V8X B;  2A5T B;  3KSX A;  3GZG A;  1AH5 A;  3TTR A;  2NWJ A;  3MVZ A;  5JEI A;  3MUQ A;  1NNP A;  3T66 A;  2XX8 A;  2RCB A;  2V3U A;  4U2R A;  1Z7N E;  5AA3 A;  2R71 A;  1B51 A;  5AA4 A;  2PBW A;  2XXR A;  1P1O A;  3TCF A;  1Q2N A;  3TDJ A;  3SEV A;  2KI7 B;  5KDT A;  2ZMB A;  3Q27 A;  3OO8 A;  3CFZ A;  1OVR A;  1Y1Z A;  3FV1 A;  3OEN A;  1H44 A;  4GWO A;  4GOF A;  3ZDM A;  2Q9T A;  1EU8 A;  3E13 X;  2O68 A;  3KBR A;  2I48 A;  1OVB A;  4GF8 A;  4KQP A;  1VE4 A;  2XXQ A;  3H3G A;  1M5E A;  1Y9U A;  1XS5 A;  5B70 A;  1H45 A;  1B3F A;  1JET A;  1A8E A;  4QSC A;  1D9Y A;  4NF5 B;  5AA4 B;  1NMU A;  1LFI A;  2LXC B;  5EFW B;  4FAT A;  1LB8 A;  1TXF A;  2Q2A A;  4R6H A;  4FOR A;  2XXW A;  4GXS B;  2PT1 A;  1LAF E;  2A5T A;  3B6W A;  1ZTY A;  4DCY A;  1BLF A;  3O6I A;  2HCA A;  4OEU A;  3CSG A;  2YJP A;  1URD A;  4GFR A;  3MPK A;  4ZE8 A;  4JBZ A;  3QWO C;  1A55 A;  2OBG A;  3TTK A;  3JZJ A;  3GLB A;  1GR2 A;  2KIK A;  5C39 A;  1AMF A;  3MQ9 A;  4I8C A;  3V83 A;  3LSW A;  3H6U A;  4F31 B;  4ZMD A;  4RA1 A;  1U7M A;  3TTL A;  3PPQ A;  5ICT A;  3FAS A;  2QMX A;  2ONS A;  1UTH A;  3MAM A;  2Y7I A;  1R6Z A;  5CM6 A;  3H6W A;  5I2K B;  1A54 A;  1PEB A;  2Z23 A;  4U23 A;  4OEN A;  1USY E;  3ZKL A;  2QS1 A;  2G29 A;  4N6P A;  4N07 A;  2E1S A;  3TUS A;  3BKI B;  3SET A;  4YKP A;  1RYO A;  2X26 A;  3N94 A;  1B3L A;  4NTL A;  3KJ7 A;  4IY6 A;  2B87 A;  2B3F A;  4MLQ A;  4RPO A;  5EHS A;  3TZA A;  5L8D A;  2F5X A;  5CBO A;  4GL8 A;  1MY3 A;  2XXT A;  3K4U A;  3DEL B;  5JK4 A;  2UWJ E;  1SVX B;  4R72 A;  1XOC A;  5DVI A;  5L9S A;  3O6H A;  1D9V A;  4OER A;  3E4R A;  1N76 A;  3U8Q A;  1JQF A;  1ZLQ A;  3FZV A;  1JM0 A;  2XXI A;  4ZEI A;  1XVX A;  2AIX A;  4GRK A;  4LQ2 A;  3T9U A;  1UTH B;  3T93 B;  4KFQ A;  1P1N A;  3TMG A;  2H25 A;  3GBB A;  3A09 A;  1VR5 A;  4WKM A;  1MDQ A;  4O3A A;  4GOE A;  4FEC A;  1MPC A;  2XXU A;  1OVT A;  1JVX A;  4ZZE A;  5HPQ A;  2WKY A;  3FVK A;  5AA1 A;  3UGW A;  4DLD A;  1TFA A;  5CMB A;  2KS1 B;  5FHM A;  4FE8 A;  2OLB A;  2OTK E;  5TP9 B;  2ANJ A;  3GBA A;  3JV9 A;  3L6G A;  4WWI A;  1ANF A;  2LXB A;  4H0W A;  3KEI A;  3FVO A;  3LSX A;  4OZ9 A;  4JWX A;  5H8F B;  3MZW B;  4G8H A;  2DYX A;  1B1X A;  4DIG A;  2KZI A;  2GHB A;  1SW4 A;  2O6A A;  1GGG A;  4WEP A;  1B6H A;  2QS4 A;  4JWY A;  2I0B A;  2AYS A;  4YIC A;  2I8D A;  4MLV A;  3UK4 A;  3S1K A;  4R2B A;  5KDT B;  3CI8 A;  1U7J A;  2I3V A;  1N3X A;  2DSF A;  3G3J A;  1DPP A;  3M3L A;  3USD A;  4ASV A;  4F19 A;  1LP1 A;  2ZAE B;  4GL0 A;  2UVG A;  1P1Q A;  2F8D A;  4XKP A;  1TWY A;  3H7M A;  4ZS9 A;  1DTG A;  1LBB A;  3FVG A;  3K6U A;  3N5L A;  1B0H A;  2UVH A;  4P0G A;  2I4C A;  3ONM A;  1WOD A;  1B5J A;  1EZP A;  1NFT A;  4JXI A;  3KN8 A;  1OQG A;  4ELO A;  2QJE A;  1US5 A;  3ZKK A;  3C4M A;  3UP9 A;  4IO3 A;  4ZDM A;  4IB2 A;  2HXW A;  1EDJ A;  1H3D A;  1MFT A;  3H6V A;  1SI0 A;  3O6G A;  1WDN A;  4L17 A;  4R74 A;  1USY H;  3B7D A;  2I4B A;  3RGU A;  1FW0 A;  1LB9 A;  3RN8 A;  1EDL A;  4G77 A;  5ITO A;  4QFK A;  4YB5 A;  3SER A;  4OHN A;  4NF4 B;  1Q1K A;  3OXN A;  4Q30 B;  3SEX A;  4F39 A;  3PMX A;  2VD2 A;  3RLF E;  1I6B A;  1AOV A;  2KUB A;  1Z7M E;  4JWO A;  3FXR A;  1QJM A;  3MP6 A;  3JYR A;  2O1M A;  1RYX A;  5LOM A;  4HCW A;  1SD3 A;  1Y47 A;  4OMB A;  4ZE9 A;  4HTG A;  4POX A;  4DE8 A;  2FYI A;  1A7L A;  3H6T A;  1S9T A;  3HN0 A;  1DSN A;  4ELQ A;  4LZ8 A;  1MY4 A;  4OES A;  2D5W A;  1M5F A;  3UOR A;  3PUW E;  3TEL A;  3EPE A;  4OWD A;  1US4 A;  3C33 A;  3G3H A;  2H98 A;  2H9B A;  2GHA A;  1P99 A;  2OWS A;  3KGC A;  3OO9 A;  2DP8 A;  3T9X B;  4BDQ A;  1PC3 A;  3FXE A;  2HR3 A;  3L6H A;  5TU0 A;  3PPO A;  4TOZ A;  3QSL A;  1B5H A;  3EHU A;  3I6V A;  4GVO A;  1P1W A;  2V3T A;  4ZZA A;  2H99 A;  5ELV A;  4NWC A;  3G3F A;  2QMW A;  1FTK A;  2GFE A;  4OVJ A;  1PBQ A;  4IGT A;  2REJ A;  4BDO A;  3IJO B;  4UA8 A;  4NF6 A;  1LT1 A;  2WMM A;  3TQW A;  2UVJ A;  2H5Y A;  4GLI A;  3W15 C;  3SEY A;  4GOT A;  4QSD A;  3IB1 A;  5I57 A;  3K6X A;  5DJU B;  1N0T A;  4NMY A;  3EN3 A;  2XX9 A;  4YU0 A;  4HB1 A;  1MM6 A;  3AXF A;  2O1L A;  4X1B A;  4MH5 A;  2F34 A;  1B32 A;  2D21 A;  1CE2 A;  3P7I A;  1R9Q A;  3LUY A;  1D3K A;  5FHO A;  1MPD A;  3K1P A;  2DE4 A;  1MY2 A;  2DS9 A;  3VV5 A;  4R73 A;  1I6A A;  4EUO A;  4ESX A;  4N13 A;  1FQA A;  4DDD A;  5L9O A;  1O7T A;  4IGR A;  2DQV A;  1EZ9 A;  1MM7 A;  5I56 A;  3S9L C;  3FXU A;  4Q5T A;  1JW1 A;  4JDF A;  2DXY A;  5CC2 A;  4C1T A;  4K3F A;  4F29 A;  4E0X A;  1GVC A;  1SQY A;  3PMW A;  1MXU A;  2HZL A;  2FA7 A;  4F1V A;  1LLS A;  4U21 A;  3RTF B;  1IQ7 A;  3GXA A;  1LST A;  2W7Y A;  4RXL A;  4IO7 A;  3HV1 A;  4XIG Q;  1B40 A;  4NPE A;  3FJ7 A;  2VOZ A;  4F18 A;  2XX7 A;  5H8F A;  3FVN A;  2QS3 A;  3H03 A;  1BIY A;  4KCD A;  1N3W A;  1N7W A;  1OQH A;  2M5A A;  4IO2 A;  3LSF B;  3PPN A;  2ZYN A;  1HSE A;  4Z7E A;  4TQU Q;  1FQB A;  3EHS A;  4YB6 A;  4LZ7 A;  3ODB A;  3Q26 A;  1OLC A;  4RK2 A;  3DP6 A;  2I3W A;  3V89 B;  3U1O A;  3CG3 A;  4DZ1 A;  4ZEB A;  1O64 A;  1B52 A;  3G3G A;  4FED A;  1QUL A;  5KCJ B;  2QS2 A;  5H8Q A;  3OSR A;  1GV8 A;  3TAJ A;  3MBP A;  5M2V A;  1QKB A;  2F6P A;  2Q88 A;  1BP5 A;  1DMB A;  3HST A;  4FAJ A;  4KJM A;  3I3V A;  3TYH A;  4FIM A;  2Y84 A;  4BXL A;  3C32 A;  2I49 A;  2NXO A;  1HSL A;  2ONK E;  3S9E A;  4XTC Q;  3KN7 A;  4MBP A;  3FD3 A;  4PET A;  4AQ4 A;  1QUJ A;  2DWJ A;  1ZJL A;  3VLU A;  3IAZ A;  4WED A;  4H8J A;  1B3E A;  2PMS A;  5CBR A;  3VVD A;  5TPA A;  5BUU A;  1ZKB A;  4QFL A;  2AL5 A;  2AL4 A;  2B65 A;  4H5F A;  2R44 A;  1SW2 A;  3C9H A;  4HKZ H;  2X7Q A;  1QKA A;  3IL1 B;  3R7X A;  5TP9 A;  3OSQ A;  1PDA A;  4TLM B;  2HQ0 A;  4H1X A;  2PVU A;  4ZEC A;  2NUV A;  5F1Q A;  1UQW A;  3MZ9 A;  3VE1 B;  3U93 A;  3IX1 A;  1ZIU A;  3N6U A;  1B58 A;  3UIF A;  5I84 A;  3SDF A;  3PD9 A;  3W9W A;  2DWA A;  3TEP A;  3T9V A;  3SES A;  4C0R A;  4RK9 A;  4OYV A;  3VXC A;  2ONR A;  1ZW0 A;  1R1N A;  1L5T A;  1MXZ A;  1NNT A;  2R9J A;  4OXV A;  4R75 A;  1SYH A;  5ICQ A;  5H8N A;  3BFT A;  3PUZ E;  2RKL A;  4ELR A;  4H67 A;  1XC1 A;  4EQ9 A;  1MQG A;  4F2Q A;  4EDP A;  2QVA A;  1JEU A;  3TPA A;  2SPZ A;  3PD8 A;  5AE4 A;  1DEE G;  3TCG A;  1B0L A;  1EC5 A;  4YKI A;  3IOT A;  4ASW A;  5TPA B;  4KPT A; 
#chains in the Genus database with same CATH topology
 1SS1 A;  1J1N A;  3E78 A;  4WY4 C;  3P8C D;  4GBW A;  1FBE A;  1FRP A;  3IAO A;  3CG1 A;  3PUY E;  2NPS D;  2I58 A;  4PFY A;  4QFO A;  4G4P A;  2XU6 A;  1BSH A;  4ECF A;  1EZV G;  1LP1 B;  3UIA A;  3G6E P;  2B4M A;  4E0W A;  1B7U A;  4JYB A;  1JO5 A;  2CZI A;  3TOD A;  4BDL A;  2YO2 A;  2D3I A;  1GW3 A;  1AIV A;  3SWY A;  1M1J C;  4UB6 E;  3GF3 A;  2HZK A;  1GD2 E;  2DWH A;  3MVX A;  5HBC A;  1MZ9 A;  4GWU A;  1TFD A;  1SQX D;  1NTM K;  3RL0 B;  4KYD A;  1CW5 A;  4G8N A;  3CCR P;  5GTI E;  4B86 A;  1G1I A;  4HW8 A;  4P56 A;  3RGY A;  2FBP A;  4NF8 A;  1Y9B A;  2O01 J;  3IR1 A;  3RBZ A;  1EH3 A;  1S5L H;  4PTK A;  5AVV B;  2W27 A;  5ET6 A;  5FTH A;  3QAX A;  4H13 D;  3VMY A;  3TSI A;  4EXK A;  5H8Q B;  4F3S A;  3O29 A;  5CCH C;  2QVV A;  1JUN A;  3MW0 A;  2JJK A;  2GA1 A;  4PFW A;  1N73 C;  2N1T C;  1G0H A;  1GU4 A;  4PQJ A;  1PIX A;  4I3E A;  5ET7 A;  2D2C C;  5ET5 A;  4XKQ A;  5J16 A;  1SQV D;  2F36 A;  4DXB A;  1DOT A;  4QSE A;  1JNF A;  4MNC A;  2F7A A;  1XHY A;  2QSX A;  1HJB A;  4JQ0 D;  4BLA A;  3L71 G;  3E79 A;  4ELP A;  3MJN A;  3W9V A;  1MY1 A;  3B5N A;  1X9V A;  3Q1M A;  3S2V A;  2ZYM A;  5AVQ B;  2Z5I A;  4KR5 A;  4DXC A;  3CIJ A;  1FJP A;  1GTK A;  3IF4 A;  1SQQ J;  3SEU A;  1ATG A;  4IL6 X;  3TK1 A;  3ZS6 A;  4BDR A;  3O28 A;  1H8A A;  3F89 A;  3K00 A;  4DI3 D;  5GTI H;  3O8Z A;  4XEQ A;  2E74 D;  2Z8D A;  5KJ7 D;  2IFM A;  4KYS A;  2I6E A;  4IL6 H;  3E7K A;  4GT1 A;  2FYN C;  3PH0 A;  1FZE A;  3WUV A;  3IOR A;  4WY4 D;  2ZFC A;  3CSB A;  3G3I A;  4OVQ A;  5CI5 A;  4YPC A;  1BCC E;  1JY3 O;  1FQD A;  1T0K A;  3A3U A;  2A45 H;  2RN0 A;  2ZNT A;  3RK3 C;  3SSU A;  1YBK A;  2Q89 A;  2KP8 A;  1SPI A;  1QL2 A;  2PFX A;  2P0S A;  3FIR A;  3ZSF A;  2BCC D;  3H1H G;  3D4G A;  1KZ8 A;  4NF8 B;  1HGZ A;  4OTE A;  3IK6 B;  2Q1K A;  1NAY A;  1L4A B;  3FAT A;  4GD5 A;  4GWS A;  4DXU A;  4NPD A;  4EDF A;  2KSJ A;  2VPN A;  2YPN A;  4F3P A;  2O7I A;  4YMB A;  5EYG A;  1PGJ A;  1BE3 E;  4MFI A;  3MP1 A;  5FHN A;  5AW1 B;  1SQQ G;  2K9J A;  2UVI A;  1VSO A;  4N91 A;  3L72 J;  4DCX A;  2FYU D;  5AW3 B;  1RF1 A;  3G3K A;  4C46 A;  1XTG B;  1TT1 A;  1ZR4 A;  3CRB A;  5A5X A;  3OW2 O;  5EQ7 A;  4U3F G;  3Q5R A;  1IZ1 A;  2M3E A;  1M7L A;  5APS A;  3MZ1 A;  3C31 A;  3HPI A;  5LDZ A;  1IFM A;  5DT6 A;  1A40 A;  5AVU B;  1KQF B;  2FBW C;  2ZT9 D;  3PGF A;  3H1K E;  3V5B A;  1A02 F;  1LBC A;  2CZL A;  1PB9 A;  3JCU H;  5A5X B;  5DW8 A;  4I62 A;  4MN4 C;  2CPB A;  4R2F A;  4N8Y A;  1AVY A;  1IFP A;  2B9B A;  4JVD A;  3M0D A;  3HD7 A;  2FFD B;  2B87 B;  1NWQ A;  3VLV A;  4KHX A;  1MXY A;  1HSJ A;  3H1I E;  3OO7 A;  1KQG B;  4X8R A;  2IA4 A;  1T3J A;  3HD7 D;  1L0N J;  4EF2 A;  2QRX A;  1WT6 A;  3FJG A;  3HCQ A;  3RYD A;  2XXV A;  4PFU A;  4F22 A;  3KPE A;  3RPL A;  3T96 B;  2XXH A;  2A06 G;  3C9I A;  3LW5 J;  4AB6 A;  1B2H A;  1PBP A;  1LTT C;  2BAS A;  2W6B A;  1H89 A;  3MP8 A;  1FC2 C;  2E76 B;  3FBP A;  1ZP0 C;  1SQV J;  4LC1 A;  1NV0 A;  3C36 A;  1QUK A;  1MPB A;  3FXD A;  1VL2 A;  1Y4T A;  1OLA A;  1LTJ C;  5M1B A;  3LV0 A;  3RT6 B;  3T22 A;  1NVO A;  1NTK J;  4LN5 A;  4OET A;  1PGP A;  4H44 B;  4OFJ A;  5F24 A;  3RTW B;  5DYH A;  3SEW A;  1IEJ A;  2Y0E A;  4MNI A;  2ZZW A;  5AVW B;  3PUV E;  3OMB A;  1KYO D;  3RK3 D;  1FZC B;  1EQ7 A;  1JEV A;  2Q3E A;  1N73 A;  3RQT A;  2K3R A;  3GF7 A;  3CCM P;  4PF8 A;  1D9Q A;  2IBZ G;  3NMD A;  4PP0 A;  3QK6 A;  1PB8 A;  4H5G A;  3O97 A;  1A99 A;  4OVN F;  2PX1 A;  2F35 A;  3QIM A;  1YJN P;  3R26 A;  2Y0C A;  1B4Z A;  1M57 D;  2Q5U A;  2B88 A;  3CXH I;  2ITA A;  3BCC J;  2ZT9 B;  2QJK C;  4G2Z A;  1HBW A;  5HM4 B;  3CC2 P;  4N78 E;  2DE2 A;  1RY3 A;  3H1H D;  3O9P A;  2RC9 A;  1URQ A;  1X0T A;  3M3K A;  1ZXG A;  3EQ1 A;  2F6G A;  3LBS A;  4P8B A;  3L72 G;  2M0B A;  3MYU A;  1LCF A;  4POW A;  2W6A A;  3DM0 A;  1LTS C;  1YIT P;  5AW7 B;  4I9D A;  5AW8 B;  1NTM E;  4N17 A;  2V84 A;  2C9N Y;  4XKR A;  1SQQ D;  1OX3 A;  3EF7 A;  4LUB A;  1Q35 A;  3HD7 B;  4ESW A;  1NTK K;  1L0L D;  3G7W A;  2E5Y A;  1SDX A;  2GQ1 A;  3RUM A;  5KAI E;  1B05 A;  2NPS B;  1NJI Q;  1MH3 A;  3RPL B;  2WBB A;  1FOS E;  1BTJ A;  1HH0 A;  1NL5 A;  1L0N G;  2OWT A;  2FYU E;  1SQX E;  3TF5 A;  1SYI A;  4IO6 A;  2WZ7 A;  2R8T A;  1YQ4 C;  2OTL P;  4U22 A;  2H7H A;  1YTZ I;  2OYO A;  5B7D A;  4I7Z C;  3HTK B;  2OZZ A;  1VFD A;  1J1E B;  5KKZ C;  3CI9 A;  1XT8 A;  3HHF A;  3RY3 A;  2K9J B;  3PTY A;  1BKA A;  4BWN A;  1SW5 A;  4GXA A;  2V25 A;  3L74 D;  4M1V A;  4MMP A;  2GRV A;  5DJT B;  3RBX A;  1JVY A;  5CMZ A;  2P10 A;  3FGS A;  4OFO A;  3TYY A;  4G68 C;  1GL2 A;  4KYE A;  3L73 E;  3L35 A;  1VDF A;  1FQE A;  3KHU A;  3QUJ A;  1AVO A;  1DPE A;  1U57 A;  1GK4 A;  3CXH E;  3IFM A;  4K3A A;  3G3Z A;  1FTM A;  4C7R A;  2R6G E;  2A5S A;  5AVS B;  4H0L D;  3JC2 2;  2JP3 A;  1KIL C;  3TFL A;  5H8S A;  1T3U A;  2O84 X;  1P84 D;  4WVZ A;  3S9M C;  1P84 E;  1MKM A;  5AVR B;  2YMY A;  4PV1 B;  2QPQ A;  5AA2 D;  1X22 A;  1JW5 A;  3IJX B;  4RPN A;  2OJT A;  4P0I A;  4GKG A;  5DEX A;  3E1R A;  2VGQ A;  3V4W A;  2KQZ A;  4GIZ A;  1PB7 A;  2HEU A;  3T9H B;  3VDF A;  2J5U A;  2RMZ A;  2OYI A;  1M1J B;  3H6P A;  1H0T B;  2A06 D;  2F97 A;  3TTM A;  3O6Q A;  2P7J A;  4I3Y A;  1IMC A;  1EDI A;  2B89 A;  1RQV A;  1H88 A;  1XTC C;  5EYF A;  2ZXT A;  2G8Y A;  4ZEF A;  4F3G A;  1G1J A;  1BGY D;  2IBZ D;  2E0S A;  5KCJ A;  4H13 B;  3CWB E;  2I1J A;  1POY 1;  4PFT A;  2AXT E;  2ZXX A;  2HHM A;  4RNS A;  1GZL A;  3IOV A;  4L75 A;  1HGV A;  3JCU E;  4D6T E;  1ELJ A;  2DE3 A;  2OCU A;  1QEX A;  4TLL B;  4JPZ B;  1EDK A;  4X48 A;  3U92 A;  1KQS O;  2P67 A;  5KAF E;  3FWN A;  3MPL A;  2RF1 A;  1EZV I;  5LTC A;  1YPN A;  4PAI A;  2PRR A;  1KV4 A;  1LEV A;  2QJY C;  3OEK A;  2HLO A;  2D2C B;  2NRG A;  2Z8E A;  5KZT A;  1FTL A;  3L75 D;  3TGU E;  2ZYK A;  3C8V A;  3L75 E;  1RE3 A;  1VDW A;  4LVQ A;  3T1B A;  3IR9 A;  3KZI H;  1FAV A;  1NH7 A;  2X7P A;  2VT5 A;  4GQO A;  1IMB A;  1N84 A;  1S9K D;  4AB5 A;  2FNC A;  4HYT B;  2CEX A;  4MCO A;  5IAI A;  4H46 A;  1FU1 A;  1TU3 F;  3IB2 A;  4G68 A;  3MZB A;  3HHG A;  1B1H A;  2LAO A;  2V93 A;  1RKM A;  2KZJ A;  3TDK A;  3EQ2 A;  3H1J G;  4YZZ A;  1ZMG A;  1Y3N A;  1NNK A;  1IMA A;  1FOS F;  1UTB A;  3CCV P;  2M8C A;  2O51 A;  5K2Y A;  1NV6 A;  1JTH A;  3TCH A;  3GW6 A;  5DEX B;  4YKK A;  2ZXE B;  2ZYD A;  3M9B A;  1L0N K;  3VVF A;  1EZO A;  1KIL A;  5CJ0 A;  1KFM A;  2FKW B;  1IXC A;  5IGA A;  5APT A;  2OQQ A;  4G61 A;  3THI A;  4F1U A;  2NVU B;  5H8H A;  5ITP A;  3F11 A;  3CWB D;  2F7C A;  1MQD A;  1GL2 C;  2K88 A;  3BBR A;  2Q3I A;  3D4C A;  1AL3 A;  3CR9 A;  3N26 A;  4LAT A;  5K5G B;  3IO4 A;  2ZNS A;  1SFC C;  2QJP C;  2WBD A;  1GL2 D;  2MKV A;  1K9Z A;  3K6V A;  1LCT A;  1NUY A;  1IJD B;  1KIL D;  2Q8J A;  1YI2 P;  1FQF A;  2O69 A;  4UB6 H;  2WSF J;  1D4N A;  3MIW A;  1FTO A;  1SI1 A;  1BDD A;  1OW8 A;  3KN3 A;  1M90 Q;  3L70 E;  4HE0 A;  1UTB B;  1J2J B;  3KG2 A;  4GWW A;  1NYH A;  1WVJ A;  1JW4 A;  3RPW A;  4P1E A;  4KD5 A;  5H8N B;  3B4S A;  3S4U A;  2RKM A;  1JCC A;  2KS1 A;  3FJM A;  5B66 H;  1JY3 N;  1YAE A;  1S7Y A;  1ZV8 A;  5CMC A;  2I1K A;  2HAU A;  4YTP C;  3IOW A;  4O3C A;  3K02 A;  4ONY A;  4JSD A;  2RCA A;  4F2O A;  1SQP G;  2M8R A;  4IO4 A;  3OD7 A;  3PPP A;  5JTY A;  1HTL C;  1MRP A;  3A3C A;  1USE A;  3C34 A;  4QHQ A;  2Y7P A;  1Y20 A;  1II5 A;  4OGQ B;  4R9G A;  2MKZ A;  2HOD A;  5AW5 B;  1NKZ B;  3Q3D A;  3KC0 A;  4EF1 A;  2IEE A;  1M5B A;  3H32 B;  4NG7 A;  3HE4 A;  4YAH X;  1URQ C;  4U4S A;  1E5W A;  1MXV A;  2THI A;  1F9B A;  1JY2 O;  3LSL A;  3OEL A;  5J1D A;  2MJZ A;  4XKN A;  3VLW A;  5T3J A;  2FYU K;  1SQX K;  1MQJ A;  4AUW A;  2HOD B;  1OVU A;  1IIT A;  2W83 C;  1MUU A;  1MDP 1;  3QUF A;  1FBM A;  4N6K A;  4Q8R A;  3PV0 E;  1FZC C;  1B5I A;  5AA2 A;  2ZT9 C;  4LZ5 A;  3S9N C;  1FQC A;  5KLI B;  1BCC G;  2CPS A;  2OYH A;  3QYT A;  1OIB A;  1VQL P;  3Q25 A;  3DLN A;  3H32 A;  4H44 C;  4IOI H;  3TKD A;  5I57 B;  1YZ0 A;  3C35 A;  3I56 P;  1FTJ A;  3QXM A;  4IL6 E;  2HYN A;  2QM7 A;  3PU5 A;  1M5D A;  1YTV A;  1Q7Y Q;  4KT0 J;  4CPG A;  3SKP A;  4EQB A;  2M5A B;  3DP8 A;  2ALU A;  1QW0 A;  3U1C A;  4QRZ A;  3L70 D;  3CL3 D;  4NPF X;  1LAG E;  5I2N B;  2V7Q H;  1BE3 G;  3V4Q A;  3M8U A;  1IXI A;  4RES B;  4ZKP A;  1L4A C;  3Q29 A;  3B8E B;  5EQ8 A;  3HO7 A;  3BAS A;  3NFQ A;  4OFL A;  3CX5 H;  2P3V A;  4BDM A;  2XNX A;  4PC9 A;  3HUS B;  1B7Z A;  5EHM A;  4KI0 E;  4RO0 A;  4NF5 A;  3B6T A;  3DP4 A;  2O01 N;  4PAF A;  2R5B A;  4PD4 E;  2IZ1 A;  1M56 D;  5L9M A;  1MXW A;  2RC8 A;  1SQB E;  2PP6 A;  4LQ5 A;  5I59 B;  5K2X A;  3IO6 A;  3O2A A;  1RE4 C;  3KOS A;  2XD2 A;  3K6W A;  4H65 A;  4NF0 A;  5I58 B;  4H6D A;  2POH A;  4EXL A;  2E5T A;  3H1I J;  3M3F A;  4Z0I A;  1P1U A;  2ESN A;  2RIN A;  3KFM A;  5DTB A;  3PPR A;  3TTN A;  5FTI A;  3U94 A;  4R4L A;  5I58 A;  3V2R A;  1NAF A;  3S4R A;  4I7Z B;  3L74 E;  3V2N A;  1IO4 A;  1YHQ P;  4H0L B;  1JTH B;  1VQ4 P;  5BWJ A;  1AV1 A;  2BEZ F;  3AED C;  1FDI A;  1JCD A;  2WPS A;  3RL0 g;  4NED A;  2F78 A;  4WXJ A;  1Z56 A;  1NTK G;  4U7J A;  4XXU A;  1T8Z A;  3CWB G;  4YMA A;  2W8Z A;  3U72 A;  1RQU A;  4EQ7 A;  5I2K A;  4NX1 A;  4UAB A;  3KBZ A;  3CXH H;  2QM8 A;  2ZYO A;  2NPS A;  2HFB A;  4M4G A;  1S50 A;  1S4X A;  4PFB A;  2KLU A;  4QFP A;  2DWI A;  3CVG A;  3K2D A;  1QVF O;  2QVU A;  2VP1 A;  2Y7W A;  2G3A A;  2I0C A;  1QUI A;  2WIT A;  4DI4 B;  4OEV A;  2VD3 A;  2VHA A;  4QFN A;  1B9J A;  2REG A;  5CMM A;  1NTM J;  3TQL A;  3B6Q A;  3K5B A;  3ISP A;  4G68 B;  3KZG A;  3MVY A;  4YKJ A;  1MQH A;  5ISU A;  2QJY B;  4YXD C;  1PPJ E;  1OMP A;  3GMA A;  1UIX A;  2PFZ A;  1S9K E;  4I1D A;  3RK3 E;  3KQG A;  2ABH A;  5IZ1 A;  4C1U A;  1NTZ D;  3CHG A;  2P1S A;  4KCC A;  2KLF A;  5APW A;  5I3S A;  4PV1 C;  4Q0C A;  4F3B A;  1UIV A;  3II6 A;  3ITK A;  1B3G A;  4PGP A;  2WX9 A;  4GX6 A;  2WSE H;  1KN7 A;  3H06 B;  4NF6 B;  1UII A;  3H25 A;  2XXX A;  4JB7 A;  3A7O A;  3H4Z A;  2C0W A;  3OEM A;  3B5N C;  1N04 A;  4N78 D;  3BIG A;  4ZEK A;  1KMI Z;  1L0L G;  2P58 A;  2UYF A;  2R5D A;  2XDJ A;  2HAV A;  3PLN A;  4FEB A;  4MJO A;  4YB7 A;  1URQ D;  3MC2 A;  4MF3 A;  4IY5 A;  1M1J A;  1H0T A;  1LFG A;  1YXI A;  1Y3Q A;  3N6T A;  1MS7 A;  1S3J A;  4HS7 A;  5ESY A;  2YLN A;  3WAE A;  1VQ6 P;  3G9R A;  1PGQ A;  4W7Z A;  3FV2 A;  1LT9 B;  2OK2 A;  1IXH A;  1FZG A;  4PDH A;  4KHZ E;  1VFE A;  2XXP A;  3KC1 A;  3L70 G;  4ZKU A;  1B7H A;  2H8P D;  4P47 A;  1MQI A;  1MY0 A;  3EHT A;  3O66 A;  3Q5P A;  2Y5L A;  4P11 A;  1S5L X;  1VQ5 P;  3CFX A;  1PPJ D;  1GL2 B;  2G93 A;  3FXQ A;  4JYC A;  4PE3 A;  1VQ7 P;  2KNC B;  2KK7 A;  3EFF K;  1VF5 B;  2N9Y B;  1YQ3 C;  1SFC A;  1SBP A;  1QL1 A;  5F7V A;  3CWB J;  1A8F A;  2Q2C A;  1N7S D;  1POT A;  4THI A;  5CBS A;  5I56 B;  5BU5 A;  3KSJ A;  2FXM A;  2CMO A;  2HG5 D;  1H43 A;  1B3H A;  2Y0D A;  1PZQ A;  4OA4 A;  2F7B A;  1RE4 A;  2FHY A;  1YYZ A;  4ISU A;  3AEA C;  2HFE D;  4DOJ A;  5CCH D;  2B3B A;  1L0L K;  2YIU B;  2H4I A;  4LA9 A;  1B4H A;  4BDN A;  4OAN A;  2JR8 A;  1L4A D;  2XV5 A;  1Y3P A;  1KTM A;  4U4X A;  1FDO A;  1R9L A;  3PHL A;  1NV1 A;  4N15 A;  1L4A A;  3M91 A;  3MVW A;  3K01 A;  1R5S A;  2DVC A;  3MWB A;  3RT8 A;  4PE5 B;  1I6Q A;  1FS0 E;  2PYY A;  2XD3 A;  1IIW A;  3CCJ P;  3UA8 A;  1BGY G;  3CCU P;  4OGQ D;  2FXO A;  2HPC A;  1ZME C;  1Y4C A;  3ILT B;  3E1I A;  4UAC A;  1IXG A;  2H88 C;  4R4M A;  1UIU A;  4G8M A;  1X8Y A;  3L71 D;  1O63 A;  5CBN A;  1LT9 A;  1N73 B;  1JY2 P;  3V5A A;  4RJT A;  4FJP A;  3RNN A;  1VQM P;  1FJ9 A;  4O3B A;  3Q28 A;  4PFI A;  3OO6 A;  3A3Y B;  3ECR A;  2PGD A;  2RC7 A;  3BFU A;  3CX5 E;  1YCJ A;  4NF4 A;  1ZU0 A;  1QVS A;  1OVV A;  1SW1 A;  2KB7 P;  3B5N D;  1NUX A;  3KOT A;  3VVE A;  4ZED A;  3K0V A;  1LWU B;  4PF6 A;  2AXC A;  1VPC A;  1FPE A;  1NTZ G;  4A7P A;  3PUX E;  4R9F A;  2QEX P;  1MXX A;  4NE4 A;  1JMB A;  4TT3 H;  1QX8 A;  4GWX A;  4PGN A;  1SQB D;  2DOJ A;  3L37 A;  4RYA A;  2NOO A;  1N7X A;  2BCC G;  1WMK A;  1ZBM A;  3CPW O;  3LC8 A;  1FCK A;  3VFJ A;  1MH4 A;  1URS A;  2A45 I;  1IZN B;  1LFH A;  3K1N A;  2Z4E A;  2XA5 A;  2HPC B;  3R6U A;  1P84 I;  1MG1 A;  2OYI C;  2LR2 A;  2PT2 A;  2Y9Y A;  3LR1 A;  5H2F H;  1IFD A;  2V3Q A;  4RKU J;  2B4L A;  5JTY B;  3BIH A;  3LUZ A;  3E9X A;  1LBZ A;  1FBH A;  2AEM A;  4U3F D;  1S2E A;  1S72 P;  1IFI A;  1OWA A;  4LON B;  1Y1M A;  4HH2 A;  2JWD A;  1Q90 D;  3KZI E;  2DVZ A;  3D1R A;  1KB9 D;  4QBA A;  3IOU A;  2XXY A;  2ZVO B;  2M3B A;  3F5H A;  2DW3 A;  1XVY A;  2Y7R A;  1LAH E;  5CCG D;  1CB6 A;  3M9Q A;  3AEE C;  4ND9 A;  1ZOY C;  1H76 A;  4O9B A;  1NTZ J;  3E3K A;  1CSB A;  3AEB C;  4IO5 A;  5AW9 B;  3AE2 C;  2IX7 C;  2BJJ X;  3CFL A;  1JNM A;  1B46 A;  3TNU A;  2AEJ A;  1OIP A;  2QRY A;  4LP2 B;  1I69 A;  2Y7K A;  1PPJ G;  3M0A A;  4K35 A;  3IB0 A;  2QG4 A;  1M5C A;  4IFD K;  2O7U A;  3KJT A;  1R5L A;  4PDD A;  5EYH A;  4HJG H;  3L4F A;  1NKX A;  4OQO A;  4U1O A;  3I5O A;  1GK6 A;  5H8H B;  5TIS E;  3K1M A;  2DXR A;  2KLV A;  2CK3 H;  1PP9 E;  2UXA A;  4ZNC A;  3M06 A;  1NNF A;  4MIJ A;  4X9T A;  4GOD A;  1FZB A;  4EYY Q;  3VN0 A;  1SFC D;  5DVF A;  3UN6 A;  3ILU B;  4U1Z A;  4IR8 A;  5I59 A;  1DTZ A;  4N81 A;  3RK2 B;  2GUV A;  2L5G B;  2QL3 A;  4RY1 A;  1DCU A;  2WPQ A;  1KZU B;  1URG A;  4NWD A;  3VXB A;  4OGQ C;  1FPI A;  2Z22 A;  3H1H J;  2UYE A;  4QF9 A;  2V4H A;  2XHD A;  3BCC D;  3IN6 A;  3KDP B;  1BDC A;  2GH9 A;  3FUZ A;  5IKB A;  1LAX A;  3A0H H;  4R6Y A;  1HF9 A;  5I2N A;  2OYH B;  1KYO E;  4R6K A;  5DVJ A;  1G2C A;  2W6J H;  3PP5 A;  1KWH A;  2P2U A;  3SWF A;  1NH8 A;  4DCK A;  2PFY A;  2P2A A;  3JSV C;  3MHV A;  4I2L C;  2FIX A;  1SQV E;  1IUD A;  2Z8F A;  3WAF A;  3CD6 P;  1RDZ A;  5B5E E;  3CLQ A;  1LBV A;  5B66 E;  4X1D A;  4RJZ A;  1J1D B;  1LGB C;  4OVS A;  3OOA A;  3PMV A;  1VQK P;  1S1C X;  4H8I A;  4N6J A;  5CRY A;  4F1Y A;  4HCY A;  4JSO A;  3SWK A;  1IME A;  1A02 J;  3AE6 C;  3P32 A;  5AA2 B;  5CMK A;  2ZNU A;  1QGX A;  3V8X B;  2KSE A;  1FZF A;  4GWZ A;  2A5T B;  2OX3 A;  3KSX A;  2FYN B;  3GZG A;  1AH5 A;  3TTR A;  2NWJ A;  3MVZ A;  5JEI A;  2E74 C;  3SFE C;  1L2P A;  1YJ9 P;  3MUQ A;  1NNP A;  3T66 A;  2XX8 A;  2RCB A;  5TJH A;  2V3U A;  4U2R A;  1Z7N E;  5AA3 A;  2R71 A;  1B51 A;  5AA4 A;  1NU1 E;  2PBW A;  4QMA A;  1K73 Q;  3MUD C;  2XXR A;  1P1O A;  3KXD A;  1KYO H;  4PV1 D;  3TCF A;  1Q2N A;  1EYK A;  3TDJ A;  4N3Y B;  3FGA D;  3KYQ A;  2NZ2 A;  1R8E A;  1EXJ A;  3SEV A;  2GM4 A;  1W2E A;  1JMM A;  2QIW A;  2CZH A;  3L74 G;  1FSA A;  5KAI H;  2KI7 B;  3VTP C;  2ZZV A;  5KDT A;  1VQP P;  2ZMB A;  3Q27 A;  3HD7 C;  3OO8 A;  5APQ A;  5KLV J;  3CFZ A;  2D2C D;  1OVR A;  1Y1Z A;  3FV1 A;  3OEN A;  4FBP A;  1H44 A;  3G4S P;  4GWO A;  4GOF A;  4LGD E;  4I1L A;  3ZDM A;  1EU8 A;  2Q9T A;  2JDI H;  3CCE P;  1FPJ A;  2FFD C;  4XFJ A;  3E13 X;  4XFE A;  2O68 A;  3KBR A;  3W68 A;  2I48 A;  1OVB A;  4GF8 A;  4KQP A;  1VE4 A;  1T2K C;  2XXQ A;  3AEG C;  2K1A A;  3H3G A;  1M5E A;  4KXP A;  3B8B A;  1Y9U A;  3PTZ A;  1XS5 A;  5B70 A;  1H45 A;  1B3F A;  1JET A;  1A8E A;  4QSC A;  2Z5H A;  1D9Y A;  4XF5 A;  1NHL A;  4HE2 A;  2KXP B;  4NF5 B;  5CJ4 A;  3HUS A;  1EZV E;  5AA4 B;  1NMU A;  1LFI A;  2LXC B;  5EFW B;  4FAT A;  2WT7 B;  1LB8 A;  1TXF A;  2VRS A;  1RHZ B;  1Q86 Q;  2Q2A A;  2XWI A;  5IM2 A;  4R6H A;  4X04 A;  5E79 E;  3PRJ A;  3V2P A;  4FOR A;  2XXW A;  4GXS B;  3D70 A;  2PT1 A;  2C0X A;  4H44 D;  1LAF E;  2A5T A;  3B6W A;  1NUZ A;  1GTW A;  1ZTY A;  4DCY A;  1BLF A;  4IFF A;  1INP A;  5I5P A;  1G0I A;  3O6I A;  3ABV C;  2HCA A;  4OEU A;  2F3D A;  2WYK A;  3H1J E;  3CSG A;  5FBP A;  3B5N B;  2YJP A;  2YO3 A;  1LTJ B;  1URD A;  4GFR A;  2JKV A;  3MPK A;  3L71 J;  4ZE8 A;  4JBZ A;  3BCC G;  2Q7C A;  3QWO C;  3T97 B;  1A55 A;  1IMF A;  2OBG A;  1AFO A;  3TTK A;  3JZJ A;  1L0L E;  3GLB A;  1IK7 A;  5A5L A;  1GR2 A;  2KIK A;  4N8G A;  5C39 A;  1AMF A;  3MQ9 A;  4I8C A;  4OVR A;  1NU1 D;  3V83 A;  3HE4 B;  3LSW A;  3H6U A;  1LTJ A;  4F31 B;  4ZMD A;  1QVG O;  2WSS H;  4RA1 A;  4MNP A;  5EQ9 A;  3O6Q B;  1U7M A;  3TTL A;  3PPQ A;  5ICT A;  1FPG A;  2RH0 A;  3FAS A;  2QMX A;  4PJ0 E;  1FJ6 A;  2ONS A;  1OMI A;  1W5C E;  2N1T A;  1UTH A;  1L0N E;  3MAM A;  2Y7I A;  1RDY A;  1R6Z A;  2NPS C;  5CM6 A;  2N1T D;  2N9B A;  3IFA A;  1DH3 A;  1IC2 A;  1FJK A;  2E75 C;  3H6W A;  4PBH A;  5I2K B;  1A54 A;  1VF5 C;  5H2F E;  1PEB A;  2Z23 A;  3WU2 H;  4U23 A;  4OEN A;  1N7S C;  1USY E;  3ZKL A;  4NHB A;  3M0D C;  2QS1 A;  1RF0 A;  2E43 A;  1KA1 A;  2G29 A;  3OA7 A;  3U59 A;  2KYV A;  2E75 B;  4N6P A;  4N07 A;  1EXI A;  2E1S A;  2JEE A;  2PCR A;  3BKI B;  3SET A;  3TUS A;  4YKP A;  3L73 G;  1RYO A;  2X26 A;  4Y99 B;  3N94 A;  1B3L A;  3CC7 P;  4TLF A;  4NTL A;  3KJ7 A;  4IY6 A;  3VMA A;  2B87 A;  4O94 A;  2B3F A;  4MLQ A;  4RPO A;  5EHS A;  3R4Y A;  1N2D C;  5L8D A;  3TZA A;  1N8R Q;  2F5X A;  3I55 P;  5CBO A;  1RF1 C;  1USD A;  4YXW H;  4GL8 A;  3CCS P;  3HTK A;  1MY3 A;  2XXT A;  1FDM A;  3A0B H;  1NV2 A;  2YIU C;  1SVF A;  2WVR A;  1NV3 A;  3DEL B;  3K4U A;  4WY4 A;  4AYC A;  5JK4 A;  1DD4 A;  1ZN5 A;  2UWJ E;  1SVX B;  5GTH H;  2BJI A;  3OAK A;  4R72 A;  5CCG A;  1XOC A;  1PP9 D;  4IFM A;  2L5V A;  2XXK A;  1LBW A;  5DVI A;  5L9S A;  3O6H A;  1D9V A;  4OER A;  2YKP A;  3E4R A;  1N76 A;  3U8Q A;  1JQF A;  1ZLQ A;  3FZV A;  1JM0 A;  2XXI A;  4ZEI A;  1XVX A;  1JY3 P;  1FE6 A;  2AIX A;  4GRK A;  1GDT A;  1DX7 A;  3AE1 C;  4LQ2 A;  5KJ7 A;  3BVH A;  3T9U A;  2N1T B;  1UTH B;  3T93 B;  1OXZ A;  4KFQ A;  1P1N A;  5KLV D;  2WPR A;  2WYP A;  2O1K A;  3TMG A;  3T97 A;  3NXS A;  2H25 A;  3GBB A;  3P8C E;  3A09 A;  1VR5 A;  4WKM A;  1MDQ A;  4O3A A;  4GOE A;  3CMA P;  3HE5 B;  1Q9D A;  1NU1 G;  2FVZ A;  2CEY A;  4FEC A;  1MPC A;  2XXU A;  1SQB G;  1OVT A;  1Y8A A;  4I6M C;  4L74 A;  2BCC E;  2J59 M;  3BRT B;  3W67 A;  1JVX A;  1IFJ A;  4ZZE A;  5HPQ A;  1G2C B;  1NO4 A;  3AE8 C;  1KB9 I;  2WKY A;  3CC4 P;  3RK3 B;  3FVK A;  5AA1 A;  3AE9 C;  3UGW A;  4DLD A;  1JY2 N;  1TFA A;  2OYH C;  5CMB A;  2K9Y A;  4H13 C;  2KS1 B;  5FHM A;  4FE8 A;  1ZLL A;  2OLB A;  5CCH A;  2OTK E;  2IYO A;  1FZC A;  5TP9 B;  2ANJ A;  3GBA A;  3L74 J;  3P7K A;  3JV9 A;  2IBZ E;  3L6G A;  5APU A;  4WWI A;  4C7N A;  3U65 A;  1GW4 A;  1ANF A;  2LXB A;  5APX A;  1NV5 A;  4H0W A;  3KEI A;  3FVO A;  3LSX A;  4OZ9 A;  2WT7 A;  2AEF A;  4JWX A;  5H8F B;  3MZW B;  4G8H A;  3L73 D;  2DYX A;  3HFU A;  1B1X A;  3A29 A;  4DIG A;  2KZI A;  2GHB A;  1KFN A;  1SW4 A;  1FPF A;  2O6A A;  1D7M A;  1GGG A;  3L71 E;  4MEV A;  1DD3 A;  4WEP A;  1B6H A;  2QS4 A;  4AS4 A;  4JWY A;  2I0B A;  2E74 B;  2AYS A;  4YIC A;  4MAG A;  2I8D A;  3M9H A;  4MLV A;  3UK4 A;  1NTK D;  1L0L J;  3S1K A;  1PP9 J;  3CI8 A;  4P9K A;  4PBQ A;  4R2B A;  1U7J A;  2I3V A;  5KDT B;  1N3X A;  4OVP A;  2ZZX A;  2DSF A;  3G3J A;  1DPP A;  3M3L A;  3USD A;  1KIL B;  5AVY B;  5AW0 B;  1PV3 A;  4ASV A;  4P3L A;  5AVZ B;  4F19 A;  2FYU G;  1PGO A;  3ROJ A;  1K05 A;  3T0J A;  1PP9 G;  2O01 H;  1RF1 B;  2YKQ A;  1LP1 A;  1GU5 A;  4PAK A;  2WSF H;  2ZJS E;  1CZQ A;  2ZAE B;  4GL0 A;  2UVG A;  1P1Q A;  2F8D A;  4XKP A;  1Q81 Q;  1TWY A;  1BGY J;  3H7M A;  4ZS9 A;  3AE4 C;  1DTG A;  1LBB A;  3FVG A;  3FXB A;  3K6U A;  1NU1 K;  3N5L A;  1KC8 Q;  1B0H A;  4HE1 A;  5KAF H;  2UVH A;  4P0G A;  2I4C A;  2LKM A;  3ONM A;  1WOD A;  1OFC X;  1FZA A;  1PL5 A;  1B5J A;  4PCD A;  1EZP A;  5E79 H;  4WBA A;  4JF7 A;  1NFT A;  4JXI A;  1SQP K;  1OQG A;  3KN8 A;  3RL0 C;  2QJE A;  4NGU A;  4ELO A;  1CNQ A;  4PJ0 H;  1VF5 D;  1URQ B;  2IZ0 A;  1KB9 H;  1US5 A;  3ZKK A;  1CI6 B;  2K37 A;  2QSI A;  3C4M A;  3SZP A;  1QLE D;  3UP9 A;  3H1L E;  1FPD A;  4HXV A;  4IO3 A;  4U3F E;  2R3C A;  4ZDM A;  1FBD A;  2L91 A;  3RK2 C;  3GHG A;  4IB2 A;  2HXW A;  1SQQ K;  1EDJ A;  1H3D A;  1MFT A;  1SP4 A;  3H6V A;  1SI0 A;  1NGM B;  3O6G A;  1WDN A;  3B50 A;  4L17 A;  4R74 A;  1USY H;  3B7D A;  5KJ7 C;  5KLV G;  2I4B A;  1LWU A;  3RGU A;  1YJW P;  1FW0 A;  1LB9 A;  3HRN A;  3RN8 A;  1EDL A;  1E79 H;  4G77 A;  5ITO A;  1AQ5 A;  4QFK A;  3SFD C;  4YB5 A;  3SER A;  1ZRT D;  4OHN A;  4NF4 B;  1NU1 J;  4BRY A;  4QXD A;  2IFN A;  1Q1K A;  1N7S B;  3OXN A;  4Q30 B;  2A06 E;  2E76 D;  3SEX A;  1KD1 Q;  1KIL E;  4F39 A;  3PMX A;  4AQR D;  2E42 A;  4D6T G;  2YXQ B;  2VD2 A;  3RLF E;  1BSN A;  2DDK A;  2FY8 A;  3Q2Y A;  3H1K J;  1I6B A;  2CZK A;  2KUB A;  1Z7M E;  1AOV A;  4WB4 A;  3LIE A;  4JWO A;  3FXR A;  1QJM A;  3MP6 A;  2QVR A;  4GIF A;  3JYR A;  2O1M A;  1RYX A;  5LOM A;  4HCW A;  1LT9 C;  1NTZ K;  1DIP A;  1SD3 A;  1M8O B;  1Y47 A;  4OMB A;  3L72 D;  4ZE9 A;  4HTG A;  4POX A;  4DE8 A;  2FYI A;  3TNU B;  5CHX A;  1A7L A;  5BVZ A;  1NH4 A;  3WMM 0;  3H6T A;  2V4C A;  3H1L D;  4GBV A;  1S9T A;  3HN0 A;  1DSN A;  3CCQ P;  4EOT A;  4ELQ A;  1NTK E;  4LZ8 A;  1HVV A;  2KOG A;  1RF0 C;  1MY4 A;  3MST A;  2BCC J;  4OES A;  4O7M A;  1AWB A;  1M5F A;  2C9L Y;  2D5W A;  3CCL P;  3UOR A;  2P1J A;  1LGH B;  3PUW E;  1S5L E;  3TEL A;  3EPE A;  2KNC A;  4XA4 A;  4P1L A;  1KYO I;  4OWD A;  1DK4 A;  3FWL A;  1US4 A;  3C33 A;  1MV8 A;  1FPL A;  3G3H A;  3L72 E;  3CX5 I;  2H98 A;  3V6I A;  1T2K D;  5APY A;  2WQY C;  2H9B A;  2WEF A;  1NTM G;  1WRG A;  1MFZ A;  2P3N A;  2GHA A;  1NKN A;  2QA4 P;  3A2A A;  1P99 A;  3G71 P;  2OWS A;  3KGC A;  4Y99 C;  3OO9 A;  2DP8 A;  3T9X B;  3IFC A;  3TGU J;  1SQX J;  2XWV A;  4BDQ A;  4H45 A;  2J58 A;  1PC3 A;  3FXE A;  2HR3 A;  3L6H A;  4NAP A;  5TU0 A;  4H0L C;  3PPO A;  4TOZ A;  1VQN P;  3QSL A;  1SLQ A;  1B5H A;  1SQX G;  3D6Z A;  3EHU A;  4W80 A;  1N7S A;  3I6V A;  4GVO A;  1P1W A;  2V3T A;  4ZZA A;  2H99 A;  2WSE J;  4MX6 A;  3AEC C;  5ELV A;  4I40 A;  4NWC A;  3G3F A;  2QMW A;  2AXT H;  1FTK A;  2GFE A;  4OVJ A;  1PBQ A;  4IGT A;  1BCC J;  2REJ A;  4BDO A;  1AA0 A;  3IJO B;  3P8M C;  2A45 G;  4M3L A;  4UA8 A;  4NF6 A;  1LT1 A;  5IZZ A;  2WMM A;  4DT0 A;  2UVJ A;  2H5Y A;  4GLI A;  3TQW A;  4MHF A;  3W15 C;  3MGN A;  1K04 A;  3SEY A;  3GHG B;  1JP4 A;  4GOT A;  2O1J A;  4QSD A;  5AW6 B;  3IB1 A;  3MTU E;  5I57 A;  3K6X A;  5DJU B;  1N0T A;  2OWZ A;  4NMY A;  1CI6 A;  3EN3 A;  3B71 A;  3L73 J;  2XX9 A;  4YU0 A;  4HB1 A;  1MM6 A;  3AXF A;  2O1L A;  3HE5 A;  1K9M Q;  4PFR A;  4X1B A;  2FIE A;  4MH5 A;  2XZR A;  2YKO A;  2F34 A;  3GLM A;  1B32 A;  2D21 A;  1CE2 A;  3P7I A;  5L8R J;  1R9Q A;  2H43 A;  3N4X A;  3PJS K;  4Y28 J;  1LBY A;  4W7Y A;  3LUY A;  2XWK A;  1D3K A;  5FHO A;  3WUU A;  1MPD A;  3K1P A;  1JB0 J;  2DE4 A;  1MY2 A;  1LNQ A;  2BEQ D;  2DS9 A;  3VV5 A;  3L70 J;  4R73 A;  1I6A A;  4EUO A;  2FFD A;  4ESX A;  5KLV K;  1VQ9 P;  4N13 A;  1P84 H;  1FQA A;  2HPG A;  4AS5 A;  1HJ0 A;  2Q6Q A;  4DDD A;  4D6T J;  5L9O A;  1O7T A;  4GX4 A;  4IGR A;  2DQV A;  3VMX A;  1EZ9 A;  1MM7 A;  5I56 A;  3S9L C;  1LJ2 A;  3FXU A;  4OWF A;  4Q5T A;  1PFI A;  3H1H E;  1JW1 A;  4JDF A;  2DXY A;  1SFC B;  2QJP B;  2GUS A;  3H1J D;  4O8M A;  5CC2 A;  4C1T A;  3R2P A;  3HUS C;  5AVT B;  3A0B E;  3L36 A;  4K3F A;  4F29 A;  3RK2 D;  4E0X A;  1GVC A;  2IPP A;  1RH5 B;  1T6A A;  4DJG A;  1SQY A;  5I7I A;  1SQQ E;  3MUD A;  3PMW A;  1EYJ A;  2WWW A;  1MXU A;  1NTM D;  3RL0 D;  3H1L G;  2HZL A;  3C1L A;  3D6Y A;  2WTY A;  2FA7 A;  4F1V A;  1LLS A;  4U21 A;  3RTF B;  2FYU J;  2OAR A;  2R3S A;  3VP8 A;  1HWT C;  4UB8 E;  1IQ7 A;  3Q5S A;  3GXA A;  3LID A;  1LST A;  2W7Y A;  1YTZ T;  1FBP A;  4OH8 B;  1AJY A;  4RXL A;  4IO7 A;  3HV1 A;  4XIG Q;  4EI2 A;  2WPV B;  1B40 A;  4NPE A;  3FJ7 A;  2VOZ A;  2IYP A;  2Q74 A;  4F18 A;  2XX7 A;  2OTJ P;  3H1J J;  1OZH A;  4GDO A;  5H8F A;  3FVN A;  5BU8 B;  1RDX A;  1OW6 A;  3OJA B;  2QS3 A;  2ZVN B;  3H03 A;  4NQ8 A;  3GYY A;  5EQA A;  1BIY A;  3EFG A;  3WUT A;  1Q82 Q;  4XE5 B;  1N3W A;  4KCD A;  5IZ3 A;  1N7W A;  1OQH A;  5AW2 B;  2M5A A;  4IO2 A;  1NV7 A;  3LSF B;  3PPN A;  2ZYN A;  1SQV K;  1HSE A;  4Z7E A;  4TQU Q;  1VQ8 P;  2OGU A;  4JVI A;  1FBC A;  1FQB A;  3EHS A;  4YB6 A;  3V2Q A;  1DEB A;  1NTZ E;  4LZ7 A;  5KLI C;  3ODB A;  3Q26 A;  1OLC A;  4RK2 A;  2V7Q J;  1JEK A;  1SQP D;  5AW4 B;  3DP6 A;  2E76 C;  1N7L A;  2I3W A;  2XND H;  3V89 B;  3NTN A;  3U1O A;  3CG3 A;  3H1K D;  4DZ1 A;  2IDB A;  2FXP A;  1FPK A;  4ZEB A;  1X79 B;  1O64 A;  1B52 A;  1DBZ A;  2YNY A;  3G3G A;  4FED A;  1QUL A;  5KCJ B;  4N6D A;  1LTI C;  4OVT A;  2QS2 A;  1NV4 A;  5TIS H;  1LTG C;  3H1I D;  3OSR A;  5H8Q A;  3TGU D;  3A5T A;  3LW5 H;  1GV8 A;  3TAJ A;  1NOH A;  4JVC A;  1IFN A;  2WSC J;  3VOP A;  3MBP A;  2Y9Z A;  3GHG C;  5M2V A;  1QKB A;  2R32 A;  2F6P A;  1SQP E;  1BCC D;  1BP5 A;  1DMB A;  1K8A Q;  2Q88 A;  3HST A;  4FAJ A;  4KJM A;  3N7N A;  3I3V A;  3TYH A;  4EIJ A;  5KTB A;  4FIM A;  1GMJ A;  4WY4 B;  2Y84 A;  4BXL A;  3C32 A;  1AQT A;  1K9Y A;  2I49 A;  3L75 J;  2NXO A;  4DZO A;  3AEF C;  1HSL A;  4L76 A;  2ONK E;  3S9E A;  3GG2 A;  4XTC Q;  3KN7 A;  2PAJ A;  1VQO P;  1J1E C;  5KKZ B;  3A0H E;  4MBP A;  5IZ3 B;  3FD3 A;  4PET A;  1FBG A;  4AQ4 A;  1BE3 D;  4LLH A;  3H1L J;  1KQL A;  1EZV D;  1QUJ A;  2DWJ A;  1YYC A;  1ZJL A;  3VLU A;  1FBF A;  3IAZ A;  4WED A;  4H8J A;  1ZR2 A;  2O3J A;  1B3E A;  2PMS A;  5CBR A;  3CX5 D;  3VVD A;  1NUW A;  1EYI A;  1L0N D;  1FPB A;  1W2B O;  5TPA A;  5BUU A;  1ZKB A;  3NOH A;  2ZYG A;  4QFL A;  1YIJ P;  2QFL A;  2IBZ I;  2WSC H;  1SQB K;  2AL5 A;  2AL4 A;  4NN3 A;  3S9O A;  2B65 A;  1N86 A;  3BCC E;  3MD0 A;  3VP9 A;  2R44 A;  2YMK A;  4H5F A;  1SW2 A;  1ZRT E;  2ZYA A;  2YXR B;  4PD4 D;  1LBX A;  3BRV B;  3C9H A;  4HKZ H;  4GX3 A;  4C7N B;  1KB9 E;  2X7Q A;  1QKA A;  2HXR A;  2JWA A;  3EKI A;  4Z1M H;  1NI9 A;  3IL1 B;  3R7X A;  5TP9 A;  3OSQ A;  2JJL A;  1PDA A;  3WU2 E;  2W90 A;  4TLM B;  2HQ0 A;  4H1X A;  2PVU A;  1M1K Q;  1SQP J;  4ZEC A;  3I5C A;  2NUV A;  5F1Q A;  1UQW A;  3MZ9 A;  3VE1 B;  2FYZ A;  1SQV G;  2Q8M A;  3IX1 A;  3U93 A;  3AE3 C;  1IMD A;  1ZIU A;  3N6U A;  1B58 A;  5KLV E;  4PD4 I;  2JO1 A;  3UIF A;  5I84 A;  3H1K G;  3SDF A;  4PD4 H;  3PD9 A;  3W9W A;  2QJK B;  2DWA A;  1J1D C;  3TEP A;  3T9V A;  1SQB J;  3SES A;  1BGY E;  3QMF A;  4C0R A;  4RK9 A;  3AE7 C;  1LTB C;  3H1I G;  1LWU C;  4OYV A;  1KOR A;  5AVX B;  3FX0 A;  3VXC A;  2ONR A;  1ZW0 A;  1R1N A;  4GWY A;  4BRY B;  1RE3 C;  4D6T D;  1L5T A;  1MXZ A;  1KA0 A;  2E75 D;  4N4U A;  5APV A;  1NNT A;  3EWK A;  2R9J A;  1HUC A;  3VMZ A;  4OXV A;  3CME P;  1JOC A;  4R75 A;  5GTH E;  1BK4 A;  1SYH A;  2H89 C;  4U3F J;  5ICQ A;  5H8N A;  3BFT A;  4O7I A;  2VPO A;  2Y5K A;  1BE3 J;  3PUZ E;  2OYI B;  2RKL A;  4ELR A;  1LTA C;  2F3B A;  4UB8 H;  4H67 A;  1FTA A;  3VYI A;  3TGU G;  3L75 G;  5ET8 A;  1IK9 A;  1XC1 A;  4EQ9 A;  1MQG A;  4F2Q A;  3QH9 A;  4EDP A;  3D71 A;  2QVA A;  2Q9I A;  1OW7 A;  3MP7 B;  1JEU A;  3TPA A;  2SPZ A;  3PD8 A;  5B5E H;  5AE4 A;  3U1A A;  1DEE G;  3TCG A;  1B0L A;  2QE7 H;  3USS A;  2XKM A;  3CXH D;  2XWO A;  3BAT A;  3AE5 C;  1EC5 A;  4YKI A;  4L73 A;  5CCG C;  3IOT A;  2KR0 A;  4ASW A;  1XI6 A;  1QGK B;  5TPA B;  4KPT A; 
#chains in the Genus database with same CATH homology
 1SS1 A;  1J1N A;  3CG1 A;  3PUY E;  2I58 A;  4PFY A;  4QFO A;  4G4P A;  4ECF A;  1LP1 B;  4E0W A;  1B7U A;  3TOD A;  4BDL A;  2D3I A;  1AIV A;  2HZK A;  2DWH A;  3MVX A;  5HBC A;  1TFD A;  4KYD A;  4G8N A;  4HW8 A;  3RGY A;  4NF8 A;  3IR1 A;  1EH3 A;  5FTH A;  3QAX A;  4EXK A;  5H8Q B;  4F3S A;  3O29 A;  3MW0 A;  4PFW A;  4PQJ A;  4XKQ A;  2F36 A;  4DXB A;  1DOT A;  4QSE A;  1JNF A;  2F7A A;  1XHY A;  2QSX A;  4BLA A;  4ELP A;  3MJN A;  3W9V A;  1MY1 A;  3S2V A;  2ZYM A;  4KR5 A;  4DXC A;  3CIJ A;  1GTK A;  3SEU A;  1ATG A;  3ZS6 A;  4BDR A;  3O28 A;  3K00 A;  2Z8D A;  4KYS A;  2I6E A;  3PH0 A;  3IOR A;  3CSB A;  3G3I A;  5CI5 A;  1FQD A;  1T0K A;  3A3U A;  2ZNT A;  2Q89 A;  2P0S A;  3FIR A;  3ZSF A;  3D4G A;  4NF8 B;  4OTE A;  3IK6 B;  2Q1K A;  3FAT A;  4GD5 A;  4DXU A;  4NPD A;  2YPN A;  4F3P A;  2O7I A;  4YMB A;  4MFI A;  3MP1 A;  5FHN A;  2UVI A;  1VSO A;  4DCX A;  3G3K A;  1TT1 A;  3CRB A;  5A5X A;  1IZ1 A;  3MZ1 A;  3C31 A;  3HPI A;  5DT6 A;  1A40 A;  3PGF A;  1LBC A;  2CZL A;  1PB9 A;  5A5X B;  4I62 A;  4MN4 C;  4R2F A;  2B87 B;  3VLV A;  1MXY A;  1HSJ A;  3OO7 A;  2IA4 A;  4EF2 A;  2QRX A;  3FJG A;  3HCQ A;  2XXV A;  4PFU A;  4F22 A;  3T96 B;  2XXH A;  4AB6 A;  1B2H A;  1PBP A;  3MP8 A;  1FC2 C;  3C36 A;  1QUK A;  1MPB A;  3FXD A;  1Y4T A;  1OLA A;  3RT6 B;  3T22 A;  1NVO A;  4OET A;  4OFJ A;  3RTW B;  5DYH A;  3SEW A;  1IEJ A;  3PUV E;  3OMB A;  1JEV A;  3RQT A;  2K3R A;  4PP0 A;  3QK6 A;  1PB8 A;  4H5G A;  3O97 A;  1A99 A;  2PX1 A;  2F35 A;  3QIM A;  3R26 A;  1B4Z A;  2B88 A;  4G2Z A;  5HM4 B;  2DE2 A;  3O9P A;  2RC9 A;  1X0T A;  3M3K A;  1ZXG A;  3EQ1 A;  2F6G A;  3LBS A;  2M0B A;  1LCF A;  4POW A;  3DM0 A;  4I9D A;  2V84 A;  4XKR A;  3EF7 A;  4LUB A;  1Q35 A;  4ESW A;  3G7W A;  1SDX A;  3RUM A;  1B05 A;  1MH3 A;  1BTJ A;  1NL5 A;  2OWT A;  1SYI A;  4IO6 A;  4U22 A;  5B7D A;  2OZZ A;  1VFD A;  1XT8 A;  3HHF A;  3RY3 A;  1BKA A;  1SW5 A;  4GXA A;  2V25 A;  4M1V A;  2GRV A;  5DJT B;  1JVY A;  3FGS A;  4OFO A;  4G68 C;  4KYE A;  1FQE A;  3QUJ A;  1DPE A;  4K3A A;  1FTM A;  2R6G E;  2A5S A;  3TFL A;  5H8S A;  2O84 X;  3S9M C;  5AA2 D;  2QPQ A;  1JW5 A;  3IJX B;  4RPN A;  2OJT A;  4P0I A;  5DEX A;  2VGQ A;  4GIZ A;  1PB7 A;  2HEU A;  3T9H B;  3VDF A;  1H0T B;  2F97 A;  3TTM A;  1EDI A;  2B89 A;  5EYF A;  2ZXT A;  4ZEF A;  4F3G A;  2E0S A;  5KCJ A;  4PFT A;  1POY 1;  4RNS A;  3IOV A;  1ELJ A;  2DE3 A;  4TLL B;  2OCU A;  1EDK A;  4X48 A;  3U92 A;  3MPL A;  2RF1 A;  1YPN A;  3OEK A;  2Z8E A;  5KZT A;  1FTL A;  2ZYK A;  4LVQ A;  1NH7 A;  4GQO A;  2X7P A;  1N84 A;  4AB5 A;  2FNC A;  5IAI A;  3IB2 A;  4G68 A;  3MZB A;  3HHG A;  1B1H A;  2LAO A;  2V93 A;  1RKM A;  2KZJ A;  4YZZ A;  1ZMG A;  1Y3N A;  1NNK A;  1UTB A;  2M8C A;  2O51 A;  5K2Y A;  3TCH A;  5DEX B;  4YKK A;  3VVF A;  1EZO A;  1IXC A;  3THI A;  4F1U A;  2NVU B;  5H8H A;  5ITP A;  3F11 A;  2F7C A;  1MQD A;  3BBR A;  3D4C A;  1AL3 A;  3CR9 A;  3N26 A;  4LAT A;  5K5G B;  3IO4 A;  2ZNS A;  3K6V A;  1LCT A;  2Q8J A;  1FQF A;  2O69 A;  1D4N A;  1SI1 A;  1FTO A;  1BDD A;  3KN3 A;  1UTB B;  3KG2 A;  1WVJ A;  1JW4 A;  3RPW A;  4KD5 A;  5H8N B;  3S4U A;  2RKM A;  3FJM A;  1YAE A;  1S7Y A;  5CMC A;  2HAU A;  3IOW A;  4O3C A;  3K02 A;  4ONY A;  4JSD A;  2RCA A;  4F2O A;  4IO4 A;  3OD7 A;  3PPP A;  5JTY A;  1MRP A;  3A3C A;  3C34 A;  4QHQ A;  2Y7P A;  1Y20 A;  1II5 A;  4R9G A;  4EF1 A;  2IEE A;  1M5B A;  4YAH X;  4U4S A;  1MXV A;  2THI A;  1F9B A;  3OEL A;  3LSL A;  5J1D A;  4XKN A;  3VLW A;  1MQJ A;  1OVU A;  1IIT A;  1MDP 1;  3QUF A;  4Q8R A;  3PV0 E;  1B5I A;  5AA2 A;  3S9N C;  4LZ5 A;  1FQC A;  3QYT A;  1OIB A;  3Q25 A;  3DLN A;  3TKD A;  4IOI H;  5I57 B;  3C35 A;  1FTJ A;  3QXM A;  3PU5 A;  1M5D A;  1YTV A;  3SKP A;  4CPG A;  4EQB A;  2M5A B;  3DP8 A;  2ALU A;  1QW0 A;  4QRZ A;  1LAG E;  4NPF X;  5I2N B;  3M8U A;  1IXI A;  3Q29 A;  3HO7 A;  4OFL A;  4BDM A;  1B7Z A;  5EHM A;  4KI0 E;  4NF5 A;  3B6T A;  3DP4 A;  5L9M A;  1MXW A;  2RC8 A;  4LQ5 A;  5I59 B;  5K2X A;  3IO6 A;  3O2A A;  4H65 A;  3KOS A;  2XD2 A;  3K6W A;  5I58 B;  4H6D A;  4EXL A;  3M3F A;  4Z0I A;  1P1U A;  2ESN A;  2RIN A;  3KFM A;  5DTB A;  3PPR A;  3TTN A;  5FTI A;  3U94 A;  5I58 A;  5BWJ A;  4NED A;  2F78 A;  4WXJ A;  4XXU A;  4YMA A;  3U72 A;  4EQ7 A;  5I2K A;  2ZYO A;  4M4G A;  2HFB A;  1S50 A;  4QFP A;  2DWI A;  3CVG A;  3K2D A;  2VP1 A;  2Y7W A;  2I0C A;  1QUI A;  4OEV A;  2VD3 A;  2VHA A;  4QFN A;  1B9J A;  2REG A;  5CMM A;  3TQL A;  3B6Q A;  4G68 B;  3KZG A;  3MVY A;  4YKJ A;  1MQH A;  5ISU A;  1OMP A;  4I1D A;  2ABH A;  4C1U A;  2P1S A;  4KCC A;  2KLF A;  4Q0C A;  4F3B A;  1UIV A;  1B3G A;  3H06 B;  4NF6 B;  2XXX A;  4JB7 A;  3H4Z A;  3OEM A;  1N04 A;  4ZEK A;  2P58 A;  2UYF A;  2HAV A;  4FEB A;  4YB7 A;  3MC2 A;  4MF3 A;  4IY5 A;  1H0T A;  1LFG A;  1Y3Q A;  3N6T A;  1MS7 A;  1S3J A;  4HS7 A;  2YLN A;  3WAE A;  3FV2 A;  2OK2 A;  1IXH A;  4KHZ E;  1VFE A;  2XXP A;  1B7H A;  1MQI A;  1MY0 A;  3EHT A;  3O66 A;  4P11 A;  3CFX A;  2G93 A;  3FXQ A;  1SBP A;  5F7V A;  1A8F A;  2Q2C A;  1POT A;  4THI A;  5CBS A;  5I56 B;  3KSJ A;  2CMO A;  1H43 A;  1B3H A;  2F7B A;  4ISU A;  2B3B A;  2H4I A;  4LA9 A;  1B4H A;  4BDN A;  1Y3P A;  4U4X A;  1R9L A;  3MVW A;  3K01 A;  2DVC A;  3MWB A;  3RT8 A;  4PE5 B;  1I6Q A;  2PYY A;  2XD3 A;  1IIW A;  3UA8 A;  1Y4C A;  3ILT B;  4UAC A;  1IXG A;  1UIU A;  4G8M A;  1O63 A;  5CBN A;  3V5A A;  4FJP A;  3RNN A;  4O3B A;  3Q28 A;  3OO6 A;  3ECR A;  2RC7 A;  3BFU A;  4NF4 A;  1YCJ A;  1ZU0 A;  1QVS A;  1OVV A;  1SW1 A;  3KOT A;  3VVE A;  4ZED A;  3K0V A;  3PUX E;  4R9F A;  1MXX A;  4NE4 A;  1JMB A;  2DOJ A;  4RYA A;  2NOO A;  1N7X A;  1ZBM A;  3LC8 A;  1FCK A;  3VFJ A;  1MH4 A;  1URS A;  1LFH A;  3K1N A;  3R6U A;  1MG1 A;  2LR2 A;  2PT2 A;  3LR1 A;  2V3Q A;  5JTY B;  3E9X A;  4LON B;  1Y1M A;  2JWD A;  2DVZ A;  3IOU A;  2XXY A;  2Y7R A;  1XVY A;  1LAH E;  1CB6 A;  4ND9 A;  1H76 A;  3E3K A;  4IO5 A;  2BJJ X;  3CFL A;  1B46 A;  2QRY A;  4LP2 B;  1I69 A;  2Y7K A;  4K35 A;  3IB0 A;  1M5C A;  2O7U A;  3KJT A;  4HJG H;  1NKX A;  4OQO A;  4U1O A;  3I5O A;  5H8H B;  3K1M A;  2DXR A;  2UXA A;  4ZNC A;  1NNF A;  4X9T A;  4GOD A;  4EYY Q;  5DVF A;  3UN6 A;  3ILU B;  4U1Z A;  5I59 A;  1DTZ A;  2QL3 A;  4RY1 A;  1URG A;  4NWD A;  3VXB A;  2Z22 A;  2UYE A;  4QF9 A;  2XHD A;  1BDC A;  2GH9 A;  3FUZ A;  5IKB A;  1LAX A;  4R6Y A;  5I2N A;  4R6K A;  5DVJ A;  1NH8 A;  1KWH A;  2P2A A;  3MHV A;  3WAF A;  2Z8F A;  1IUD A;  4X1D A;  4RJZ A;  1LGB C;  3OOA A;  3PMV A;  4H8I A;  5CRY A;  4F1Y A;  4HCY A;  4JSO A;  5AA2 B;  5CMK A;  2ZNU A;  3V8X B;  2A5T B;  3KSX A;  3GZG A;  1AH5 A;  3TTR A;  2NWJ A;  3MVZ A;  5JEI A;  3MUQ A;  1NNP A;  3T66 A;  2XX8 A;  2RCB A;  2V3U A;  4U2R A;  1Z7N E;  5AA3 A;  2R71 A;  1B51 A;  5AA4 A;  2PBW A;  2XXR A;  1P1O A;  3TCF A;  1Q2N A;  3TDJ A;  3SEV A;  2KI7 B;  5KDT A;  2ZMB A;  3Q27 A;  3OO8 A;  3CFZ A;  1OVR A;  1Y1Z A;  3FV1 A;  3OEN A;  1H44 A;  4GWO A;  4GOF A;  3ZDM A;  2Q9T A;  1EU8 A;  3E13 X;  2O68 A;  3KBR A;  2I48 A;  1OVB A;  4GF8 A;  4KQP A;  1VE4 A;  2XXQ A;  3H3G A;  1M5E A;  1Y9U A;  1XS5 A;  5B70 A;  1H45 A;  1B3F A;  1JET A;  1A8E A;  4QSC A;  1D9Y A;  4NF5 B;  5AA4 B;  1NMU A;  1LFI A;  2LXC B;  5EFW B;  4FAT A;  1LB8 A;  1TXF A;  2Q2A A;  4R6H A;  4FOR A;  2XXW A;  4GXS B;  2PT1 A;  1LAF E;  2A5T A;  3B6W A;  1ZTY A;  4DCY A;  1BLF A;  3O6I A;  2HCA A;  4OEU A;  3CSG A;  2YJP A;  1URD A;  4GFR A;  3MPK A;  4ZE8 A;  4JBZ A;  3QWO C;  1A55 A;  2OBG A;  3TTK A;  3JZJ A;  3GLB A;  1GR2 A;  2KIK A;  5C39 A;  1AMF A;  3MQ9 A;  4I8C A;  3V83 A;  3LSW A;  3H6U A;  4F31 B;  4ZMD A;  4RA1 A;  1U7M A;  3TTL A;  3PPQ A;  5ICT A;  3FAS A;  2QMX A;  2ONS A;  1UTH A;  3MAM A;  2Y7I A;  1R6Z A;  5CM6 A;  3H6W A;  5I2K B;  1A54 A;  1PEB A;  2Z23 A;  4U23 A;  4OEN A;  1USY E;  3ZKL A;  2QS1 A;  2G29 A;  4N6P A;  4N07 A;  2E1S A;  3TUS A;  3BKI B;  3SET A;  4YKP A;  1RYO A;  2X26 A;  3N94 A;  1B3L A;  4NTL A;  3KJ7 A;  4IY6 A;  2B87 A;  2B3F A;  4MLQ A;  4RPO A;  5EHS A;  3TZA A;  5L8D A;  2F5X A;  5CBO A;  4GL8 A;  1MY3 A;  2XXT A;  3K4U A;  3DEL B;  5JK4 A;  2UWJ E;  1SVX B;  4R72 A;  1XOC A;  5DVI A;  5L9S A;  3O6H A;  1D9V A;  4OER A;  3E4R A;  1N76 A;  3U8Q A;  1JQF A;  1ZLQ A;  3FZV A;  1JM0 A;  2XXI A;  4ZEI A;  1XVX A;  2AIX A;  4GRK A;  4LQ2 A;  3T9U A;  1UTH B;  3T93 B;  4KFQ A;  1P1N A;  3TMG A;  2H25 A;  3GBB A;  3A09 A;  1VR5 A;  4WKM A;  1MDQ A;  4O3A A;  4GOE A;  4FEC A;  1MPC A;  2XXU A;  1OVT A;  1JVX A;  4ZZE A;  5HPQ A;  2WKY A;  3FVK A;  5AA1 A;  3UGW A;  4DLD A;  1TFA A;  5CMB A;  2KS1 B;  5FHM A;  4FE8 A;  2OLB A;  2OTK E;  5TP9 B;  2ANJ A;  3GBA A;  3JV9 A;  3L6G A;  4WWI A;  1ANF A;  2LXB A;  4H0W A;  3KEI A;  3FVO A;  3LSX A;  4OZ9 A;  4JWX A;  5H8F B;  3MZW B;  4G8H A;  2DYX A;  1B1X A;  4DIG A;  2KZI A;  2GHB A;  1SW4 A;  2O6A A;  1GGG A;  4WEP A;  1B6H A;  2QS4 A;  4JWY A;  2I0B A;  2AYS A;  4YIC A;  2I8D A;  4MLV A;  3UK4 A;  3S1K A;  4R2B A;  5KDT B;  3CI8 A;  1U7J A;  2I3V A;  1N3X A;  2DSF A;  3G3J A;  1DPP A;  3M3L A;  3USD A;  4ASV A;  4F19 A;  1LP1 A;  2ZAE B;  4GL0 A;  2UVG A;  1P1Q A;  2F8D A;  4XKP A;  1TWY A;  3H7M A;  4ZS9 A;  1DTG A;  1LBB A;  3FVG A;  3K6U A;  3N5L A;  1B0H A;  2UVH A;  4P0G A;  2I4C A;  3ONM A;  1WOD A;  1B5J A;  1EZP A;  1NFT A;  4JXI A;  3KN8 A;  1OQG A;  4ELO A;  2QJE A;  1US5 A;  3ZKK A;  3C4M A;  3UP9 A;  4IO3 A;  4ZDM A;  4IB2 A;  2HXW A;  1EDJ A;  1H3D A;  1MFT A;  3H6V A;  1SI0 A;  3O6G A;  1WDN A;  4L17 A;  4R74 A;  1USY H;  3B7D A;  2I4B A;  3RGU A;  1FW0 A;  1LB9 A;  3RN8 A;  1EDL A;  4G77 A;  5ITO A;  4QFK A;  4YB5 A;  3SER A;  4OHN A;  4NF4 B;  1Q1K A;  3OXN A;  4Q30 B;  3SEX A;  4F39 A;  3PMX A;  2VD2 A;  3RLF E;  1I6B A;  1AOV A;  2KUB A;  1Z7M E;  4JWO A;  3FXR A;  1QJM A;  3MP6 A;  3JYR A;  2O1M A;  1RYX A;  5LOM A;  4HCW A;  1SD3 A;  1Y47 A;  4OMB A;  4ZE9 A;  4HTG A;  4POX A;  4DE8 A;  2FYI A;  1A7L A;  3H6T A;  1S9T A;  3HN0 A;  1DSN A;  4ELQ A;  4LZ8 A;  1MY4 A;  4OES A;  2D5W A;  1M5F A;  3UOR A;  3PUW E;  3TEL A;  3EPE A;  4OWD A;  1US4 A;  3C33 A;  3G3H A;  2H98 A;  2H9B A;  2GHA A;  1P99 A;  2OWS A;  3KGC A;  3OO9 A;  2DP8 A;  3T9X B;  4BDQ A;  1PC3 A;  3FXE A;  2HR3 A;  3L6H A;  5TU0 A;  3PPO A;  4TOZ A;  3QSL A;  1B5H A;  3EHU A;  3I6V A;  4GVO A;  1P1W A;  2V3T A;  4ZZA A;  2H99 A;  5ELV A;  4NWC A;  3G3F A;  2QMW A;  1FTK A;  2GFE A;  4OVJ A;  1PBQ A;  4IGT A;  2REJ A;  4BDO A;  3IJO B;  4UA8 A;  4NF6 A;  1LT1 A;  2WMM A;  3TQW A;  2UVJ A;  2H5Y A;  4GLI A;  3W15 C;  3SEY A;  4GOT A;  4QSD A;  3IB1 A;  5I57 A;  3K6X A;  5DJU B;  1N0T A;  4NMY A;  3EN3 A;  2XX9 A;  4YU0 A;  4HB1 A;  1MM6 A;  3AXF A;  2O1L A;  4X1B A;  4MH5 A;  2F34 A;  1B32 A;  2D21 A;  1CE2 A;  3P7I A;  1R9Q A;  3LUY A;  1D3K A;  5FHO A;  1MPD A;  3K1P A;  2DE4 A;  1MY2 A;  2DS9 A;  3VV5 A;  4R73 A;  1I6A A;  4EUO A;  4ESX A;  4N13 A;  1FQA A;  4DDD A;  5L9O A;  1O7T A;  4IGR A;  2DQV A;  1EZ9 A;  1MM7 A;  5I56 A;  3S9L C;  3FXU A;  4Q5T A;  1JW1 A;  4JDF A;  2DXY A;  5CC2 A;  4C1T A;  4K3F A;  4F29 A;  4E0X A;  1GVC A;  1SQY A;  3PMW A;  1MXU A;  2HZL A;  2FA7 A;  4F1V A;  1LLS A;  4U21 A;  3RTF B;  1IQ7 A;  3GXA A;  1LST A;  2W7Y A;  4RXL A;  4IO7 A;  3HV1 A;  4XIG Q;  1B40 A;  4NPE A;  3FJ7 A;  2VOZ A;  4F18 A;  2XX7 A;  5H8F A;  3FVN A;  2QS3 A;  3H03 A;  1BIY A;  4KCD A;  1N3W A;  1N7W A;  1OQH A;  2M5A A;  4IO2 A;  3LSF B;  3PPN A;  2ZYN A;  1HSE A;  4Z7E A;  4TQU Q;  1FQB A;  3EHS A;  4YB6 A;  4LZ7 A;  3ODB A;  3Q26 A;  1OLC A;  4RK2 A;  3DP6 A;  2I3W A;  3V89 B;  3U1O A;  3CG3 A;  4DZ1 A;  4ZEB A;  1O64 A;  1B52 A;  3G3G A;  4FED A;  1QUL A;  5KCJ B;  2QS2 A;  5H8Q A;  3OSR A;  1GV8 A;  3TAJ A;  3MBP A;  5M2V A;  1QKB A;  2F6P A;  2Q88 A;  1BP5 A;  1DMB A;  3HST A;  4FAJ A;  4KJM A;  3I3V A;  3TYH A;  4FIM A;  2Y84 A;  4BXL A;  3C32 A;  2I49 A;  2NXO A;  1HSL A;  2ONK E;  3S9E A;  4XTC Q;  3KN7 A;  4MBP A;  3FD3 A;  4PET A;  4AQ4 A;  1QUJ A;  2DWJ A;  1ZJL A;  3VLU A;  3IAZ A;  4WED A;  4H8J A;  1B3E A;  2PMS A;  5CBR A;  3VVD A;  5TPA A;  5BUU A;  1ZKB A;  4QFL A;  2AL5 A;  2AL4 A;  2B65 A;  4H5F A;  2R44 A;  1SW2 A;  3C9H A;  4HKZ H;  2X7Q A;  1QKA A;  3IL1 B;  3R7X A;  5TP9 A;  3OSQ A;  1PDA A;  4TLM B;  2HQ0 A;  4H1X A;  2PVU A;  4ZEC A;  2NUV A;  5F1Q A;  1UQW A;  3MZ9 A;  3VE1 B;  3U93 A;  3IX1 A;  1ZIU A;  3N6U A;  1B58 A;  3UIF A;  5I84 A;  3SDF A;  3PD9 A;  3W9W A;  2DWA A;  3TEP A;  3T9V A;  3SES A;  4C0R A;  4RK9 A;  4OYV A;  3VXC A;  2ONR A;  1ZW0 A;  1R1N A;  1L5T A;  1MXZ A;  1NNT A;  2R9J A;  4OXV A;  4R75 A;  1SYH A;  5ICQ A;  5H8N A;  3BFT A;  3PUZ E;  2RKL A;  4ELR A;  4H67 A;  1XC1 A;  4EQ9 A;  1MQG A;  4F2Q A;  4EDP A;  2QVA A;  1JEU A;  3TPA A;  2SPZ A;  3PD8 A;  5AE4 A;  1DEE G;  3TCG A;  1B0L A;  1EC5 A;  4YKI A;  3IOT A;  4ASW A;  5TPA B;  4KPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...