4JBZA

Structure of mcm10 coiled-coil region
Total Genus 131
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
131
sequence length
401
structure length
401
Chain Sequence
MKIEEGKLVIWINGDKGYNGLAEVGKKFEKDTGIKVTVEHPDKLEEKFPQVAATGDGPDIIFWAHDRFGGYAQSGLLAEITPAAAFQDKLYPFTWDAVRYNGKLIAYPIAVEALSLIYNKDLLPNPPKTWEEIPALDKELKAKGKSALMFNLQEPYFTWPLIAADGGYAFKYAAGKYDIKDVGVDNAGAKAGLTFLVDLIKNKHMNADTDYSIAEAAFNKGETAMTINGPWAWSNIDTSAVNYGVTVLPTFKGQPSKPFVGVLSAGINAASPNKELAKEFLENYLLTDEGLEAVNKDKPLGAVALKSYEEELAKDPRIAATMENAQKGEIMPNIPQMSAFWYAVRTAVINAASGRQTVDAALAAAQTNAAAMGVCQEKSKDELEDELRKMQAQMKKLQEQL
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MALTOSE-BINDING PERIPLASMIC PROTEIN FUSED WITH XENOPUS LAEVI
publication title Mcm10 self-association is mediated by an N-terminal coiled-coil domain.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Replication
total genus 131
structure length 401
sequence length 401
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2013-02-20

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01547 SBP_bac_1 Bacterial extracellular solute-binding protein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.420 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Immunoglobulin FC, subunit C 4jbzA03
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA02
3.40.190.10 Alpha Beta 3-Layer(aba) Sandwich D-Maltodextrin-Binding Protein; domain 2 Periplasmic binding protein-like II 4jbzA01
3H6WA 3PGFA 2B65A 3MZWB 2KS1B 4EQ9A 1UTBA 1H0TA 1IQ7A 4U4SA 1MXXA 2I6EA 4TQUQ 3ODBA 1FQAA 3TTNA 2UYEA 2QMXA 2ZYOA 1MQIA 1PEBA 1J1NA 3C33A 3UP9A 2ZNSA 3PUXE 4DCXA 3S1KA 3RNNA 2NVUB 2REJA 1B0LA 1ZTYA 3K2DA 1NNTA 4F3BA 1USYE 4ZE9A 5I57A 5DJTB 1YTVA 4LQ2A 1B5JA 4JB7A 4C0RA 1NNFA 1IXIA 2O7IA 3PD8A 5JTYB 5A5XA 1S50A 3MP1A 2DE4A 4PP0A 3UK4A 3E13X 4IO7A 1EDIA 2DWIA 2ZYKA 3M8UA 1MFTA 3TQWA 4OEUA 1L5TA 3PUZE 3K1MA 2B87B 2Z23A 4GL0A 4GOTA 3OENA 3MUQA 5HPQA 3A09A 4F18A 4Q0CA 3O6HA 1NNKA 4JSDA 4R74A 4X1BA 4ZNCA 1QULA 5I2NA 1GGGA 1MXYA 1BTJA 4HS7A 1LAXA 1QKBA 1DMBA 1Y1MA 4ELPA 2HZLA 4RYAA 5KCJB 4XXUA 3S9LC 4IY6A 1AOVA 3R6UA 2DE3A 1XOCA 2V3UA 3OELA 5IKBA 5DVIA 4IGTA 1MM7A 1B40A 5JEIA 4NF5B 1PB9A 2UVGA 4KR5A 4KYDA 4RJZA 1ZIUA 2XX8A 3PPPA 1Y47A 1PB7A 3RY3A 1XVXA 1YPNA 1FTJA 3FJGA 1UTHA 2F6PA 1OVTA 4OTEA 4U1ZA 1MQDA 1JQFA 1D3KA 4ZECA 1Y9UA 2NXOA 4ZEKA 4P0IA 2O69A 4HJGH 2VHAA 2I3VA 3QYTA 2XX7A 3CSGA 3IR1A 3G3IA 3TFLA 1OVBA 4H5GA 2K3RA 3DP8A 3KSJA 3DP6A 5KZTA 4L17A 3TELA 2I3WA 3SEYA 3QUFA 4RXLA 1Z7NE 2RINA 1QUIA 4GL8A 1B1HA 1SQYA 3VVFA 1LAHE 3N5LA 3M3LA 1FQEA 1OQGA 2UVHA 4TLMB 3SEVA 4MF3A 2PVUA 2QVAA 2R44A 4BDMA 2QRYA 1NKXA 3KN8A 2JWDA 1BKAA 1M5CA 4IO3A 1XHYA 2VD3A 4QFPA 1R6ZA 3FIRA 2H99A 4FEDA 1USYH 3T9HB 3IX1A 4YAHX 1X0TA 4R75A 4ZEDA 4OXVA 1MRPA 3V83A 1LFHA 4AQ4A 4ZDMA 5KDTA 4F22A 3Q28A 4BLAA 5FTHA 2XXPA 1LLSA 1N0TA 3KJ7A 3PPQA 1NMUA 1P1OA 1JEVA 3T9VA 1B7UA 4KPTA 3T66A 4QFOA 5ITPA 1UTBB 4I9DA 5I59A 2XXRA 2B3FA 5H8SA 5CBNA 3DM0A 3RPWA 4GODA 3SKPA 1MG1A 2HXWA 3O66A 4FE8A 3OXNA 1FW0A 3N6TA 1ZU0A 4RPNA 1D9YA 2F35A 4JSOA 4PFTA 2DP8A 3MQ9A 5TP9B 3K02A 3CRBA 4DCYA 4XKPA 3MVYA 3R26A 1B46A 3EQ1A 2F36A 3ILUB 1B9JA 3IORA 4KFQA 3VFJA 3HV1A 4JWXA 1BDCA 2F5XA 3PPOA 5HBCA 1URDA 3RN8A 1MQJA 1EZOA 3TKDA 3K4UA 1SW5A 4GF8A 2IEEA 3KBRA 4MFIA 2XD2A 3LSXA 1B3GA 4NE4A 5AA4A 4GOFA 3SEUA 3TUSA 4G2ZA 3KN3A 3FD3A 4F3SA 3V5AA 4ZEFA 3K6XA 4FATA 4DXCA 3W9VA 5CBSA 2QJEA 1B4HA 3TCHA 2HQ0A 4NF6B 5L9OA 4NPDA 4ZEIA 4GVOA 1LT1A 4DE8A 4I62A 3C32A 5AE4A 1NH8A 4QFNA 4TLLB 3VVDA 1JW5A 4R2FA 5CC2A 2RCBA 1VFDA 4IGRA 2I48A 3K00A 4OYVA 2F78A 1FTOA 1T0KA 1Y3NA 1B3LA 3TTRA 3D4GA 4DDDA 2DYXA 1IUDA 1NFTA 2OLBA 3FV1A 4XKRA 4R6YA 1DPEA 4GFRA 1QW0A 4LONB 3H06B 4NPEA 1LFGA 3OMBA 3FV2A 3F11A 3QWOC 1B3FA 4OFLA 1SDXA 3LR1A 1AMFA 5EFWB 3P7IA 3IK6B 4E0WA 2E0SA 3USDA 2I8DA 5AA2A 1Y1ZA 3E9XA 1JW1A 5CMCA 1A8FA 3IB1A 2F7BA 4GXAA 4K3AA 2XX9A 2QS4A 3IO4A 3O6IA 3UIFA 3MWBA 4GLIA 3RQTA 1MY2A 3S9MC 2R71A 2Q2CA 2H25A 3SEXA 3FXUA 2G29A 2M0BA 3K6WA 5TPAA 1DPPA 5H8FB 1OIBA 1R9QA 1IXHA 4EQ7A 3PMVA 4PETA 5CRYA 5CBRA 4EF1A 2Y7PA 3D4CA 5TU0A 4G68A 2LXCB 1CB6A 1M5BA 4WKMA 3IB2A 2LAOA 2FNCA 3RGYA 2M5AB 3CG1A 1LAFE 1Q1KA 4N07A 4X9TA 4F1YA 1H43A 5FTIA 5FHNA 3C36A 1HSEA 5AA3A 2Y7IA 3G3GA 4OZ9A 4PQJA 3TQLA 1Q35A 3FUZA 1SS1A 1D9VA 1MDQA 4R2BA 3PD9A 1MPDA 5FHOA 2VP1A 4OENA 3ZSFA 1DOTA 4DXBA 3RT6B 1GVCA 2QRXA 3FVNA 4LA9A 2D3IA 1II5A 2OCUA 2Z8FA 2XXTA 4RY1A 2FYIA 5CMBA 4OMBA 4OWDA 3SESA 1QUKA 2WMMA 2ZNUA 5DEXB 3FVOA 3FXQA 2QSXA 3PUYE 1Q2NA 1Y3PA 3VXCA 4E0XA 5J1DA 1P1UA 1R9LA 2Y7RA 2HZKA 3N6UA 1MXZA 4YICA 1DTZA 1OQHA 1Y4CA 2CMOA 4QFKA 3PPNA 2DSFA 4OERA 3N26A 2HAUA 5L9SA 3FZVA 4HB1A 3RGUA 3ZDMA 2IA4A 3B7DA 2GHAA 4FEBA 2W7YA 4G8HA 3TAJA 4IO6A 1LP1A 1IIWA 1I6BA 1OLAA 2AYSA 3Q26A 4PE5B 2HAVA 5HM4B 2XXIA 4HKZH 3FJMA 3TCGA 4O3AA 2ZMBA 3GXAA 4MLQA 2NUVA 4RPOA 1S9TA 5K5GB 5I2KA 1KWHA 4M4GA 3IOWA 1RYOA 3MBPA 5CBOA 1SBPA 4Q8RA 3LSWA 5ITOA 1M5DA 1DTGA 3U72A 1DSNA 2I0CA 4P11A 1S7YA 3K6UA 4DLDA 2XXXA 1VSOA 4C1UA 2H9BA 3CIJA 1MY0A 1BDDA 2RKMA 2Q88A 4R9FA 2F8DA 2DVZA 1XC1A 4U22A 5H8HB 2LR2A 1MPCA 2E1SA 1FQDA 3MVXA 2OK2A 4LVQA 1WDNA 4EQBA 1SVXB 3G3KA 1B4ZA 4TOZA 3IOTA 1MQHA 4ECFA 1EDJA 3SDFA 3U92A 3KN7A 1URSA 4GOEA 3V8XB 3QSLA 1XS5A 2AL5A 4ELQA 3QXMA 2DXRA 3BFUA 3QIMA 4WXJA 3GLBA 2QPQA 4ZS9A 4N6PA 4ELRA 3DLNA 2KIKA 5I58A 4F39A 5I56A 3MJNA 1RKMA 2PT1A 2HEUA 1B51A 4ESWA 3HO7A 2DXYA 3G7WA 3G3HA 3RUMA 3IOVA 2V93A 4P0GA 3TCFA 3WAEA 4XKNA 1JNFA 3N94A 1H45A 1UIVA 5CMMA 4KCDA 1LAGE 4FAJA 3MZBA 3RTWB 4NF8A 4YB6A 3CSBA 2I58A 4PFWA 2A5TA 1JETA 4FJPA 4GRKA 4R73A 4WWIA 2VGQA 4KD5A 4AB5A 2KI7B 3FXRA 3FJ7A 3H6UA 1LBCA 2H5YA 1H0TB 2RF1A 1YCJA 1H44A 2I4BA 1MXUA 1NVOA 1S3JA 1M5EA 5I84A 3CG3A 2PMSA 3U8QA 4RK9A 1SI1A 1JMBA 2UYFA 4IOIH 2G93A 2FA7A 1B7HA 2NOOA 3PUVE 3KOTA 1LCFA 3O28A 1PB8A 1B58A 3QK6A 3Q29A 1MDP1 3Q25A 4HCYA 1IEJA 3MPLA 3FGSA 3TDJA 1AIVA 2O7UA 5EHMA 1LGBC 3K0VA 3UN6A 3IAZA 5I57B 1QVSA 2I49A 3I6VA 4F2OA 3MZ1A 4QHQA 2O84X 4MH5A 1ZLQA 5ISUA 4ASVA 5A5XB 3UGWA 4ZMDA 2PX1A 1WODA 4O3BA 4QF9A 1QUJA 2OWSA 2M8CA 1ZW0A 2HFBA 3FVGA 2THIA 3SEWA 2F7CA 1HSJA 4YKJA 2OZZA 3ILTB 1BIYA 2F97A 1URGA 1Y4TA 3GBBA 4NPFX 5ELVA 2XXUA 2B3BA 4R9GA 5JTYA 4BDQA 3OEMA 4K35A 3HCQA 2DQVA 5I2NB 4OETA 1BP5A 2P0SA 3MP8A 1R1NA 4Q5TA 1A54A 1UIUA 1LB9A 4I1DA 1FTLA 2PT2A 2B87A 4G8MA 4U1OA 2ABHA 3MP6A 2V3QA 2ONKE 4MBPA 3L6GA 4F3PA 1TFAA 3TYHA 3FXDA 4ONYA 3O6GA 3KJTA 4YMBA 4BDOA 1A55A 1OLCA 4G4PA 3GZGA 5F7VA 4HTGA 5DJUB 4C1TA 1UTHB 4F1UA 1FQBA 1XT8A 2REGA 3WAFA 5KCJA 4BXLA 4Z0IA 1B32A 5K2YA 1SD3A 4LZ8A 3S9EA 1I69A 3TTMA 3LC8A 2F6GA 4G8NA 3VLUA 2ZYNA 4NF5A 2DOJA 4M1VA 3A3UA 4GXSB 2RKLA 1MPBA 1DEEG 4NMYA 2CZLA 4H65A 3W9WA 3IOUA 3AXFA 2DVCA 3KEIA 4KCCA 2LXBA 4LQ5A 1ELJA 4ELOA 2I4CA 2AIXA 4NWDA 4THIA 5H8QA 1IXGA 1GTKA 1EC5A 1US4A 4F2QA 3OO8A 3HPIA 1CE2A 1PDAA 5FHMA 4YKPA 1UQWA 3BKIB 4QSCA 1BLFA 3CFZA 4G68C 4OEVA 4GD5A 1B6HA 2VD2A 3LBSA 3EF7A 4F29A 3KOSA 1MY4A 3OSRA 4OQOA 3MC2A 4IB2A 3HSTA 4KJMA 1POTA 1SW2A 3R7XA 4RK2A 3MHVA 4N13A 3U94A 1AL3A 4H0WA 2A5TB 5KDTB 3I3VA 2Q8JA 1B1XA 1I6QA 1PBPA 4EUOA 3TPAA 1N04A 1N7WA 1P1NA 4X1DA 1P1WA 3M3FA 3IB0A 4H67A 5DT6A 1A40A 3QAXA 1US5A 2UVIA 3CVGA 3MVWA 1VE4A 1B52A 5I59B 1IZ1A 1U7JA 3MVZA 2O1MA 2DWHA 2WKYA 3PUWE 3OD7A 4POWA 2ESNA 2Z22A 1IXCA 3T96B 1WVJA 1OMPA 1LCTA 3IL1B 2O6AA 1LBBA 1EZPA 3VLWA 2ANJA 1EH3A 4PFYA 3LSLA 5AA1A 3BBRA 1GV8A 2DE2A 1TWYA 4YB7A 2NWJA 1MS7A 4ZZEA 3MAMA 1A99A 3E4RA 3B6QA 2X26A 4KI0E 2F34A 3KSXA 4LZ7A 2B89A 3H6TA 2Z8EA 3B6WA 1A8EA 2Y7KA 2SPZA 5K2XA 4QRZA 2D5WA 4QFLA 4FECA 2O1LA 1B05A 3S9NC 1GR2A 2XXVA 1O7TA 3PV0E 2XXYA 3OO6A 1XVYA 4YB5A 3VE1B 4BDRA 3VLVA 1SW4A 1O63A 1N3WA 2GFEA 4XIGQ 5AA2D 4IO4A 2H4IA 1B3EA 1MY1A 1TFDA 5TP9A 3C35A 2BJJX 2OWTA 2A5SA 1ZKBA 4DIGA 4QSEA 3THIA 5AA4B 4CPGA 3IJXB 4H6DA 4ISUA 2ZAEB 3O29A 4JXIA 4ZEBA 2ZXTA 3PU5A 4OESA 1SYHA 3SETA 4LP2B 3MPKA 4U21A 2X7PA 2XXQA 4OHNA 1P99A 2DWAA 1ANFA 2RCAA 4ASWA 1IITA 2R6GE 3H03A 3U93A 2OBGA 2V25A 3TODA 3RT8A 2KLFA 1Y3QA 1TXFA 3HN0A 5H8NA 3EHSA 2B88A 3H4ZA 3VV5A 4OVJA 4H1XA 3JYRA 1H76A 3VVEA 3OO7A 3TEPA 3EHUA 1FCKA 2DWJA 4IY5A 1Y20A 2Y84A 4YMAA 2KUBA 4KHZE 1QKAA 5DTBA 5CMKA 3G3FA 4NF6A 4GQOA 3KFMA 4BDLA 3OOAA 1M5FA 2Z8DA 4PFUA 2D21A 3MW0A 4IO5A 1N3XA 3U1OA 3GBAA 2P2AA 2GHBA 3LUYA 4H8JA 3V89B 1FQCA 1O64A 4NTLA 3JZJA 3DP4A 4EXLA 1LSTA 1D4NA 3EPEA 3K1NA 1A7LA 5BWJA 5H8QB 1AH5A 2RC7A 3C9HA 5AA2B 1NNPA 2GRVA 2YLNA 1LFIA 1N7XA 2VOZA 3FATA 5LOMA 4HCWA 4RNSA 5TPAB 2V3TA 2Q89A 3TTKA 1JEUA 3CI8A 4OFJA 3TZAA 4AB6A 1B5IA 3C31A 4X48A 2V84A 4QSDA 3OEKA 4MLVA 1B3HA 3PMWA 3FXEA 4ESXA 1MXWA 3C34A 2ALUA 4G68B 5CM6A 2XXHA 1HSLA 4JDFA 1OVUA 5B70A 4NF4A 4XKQA 2Q9TA 1EDKA 2ONRA 1P1QA 4JWOA 2Y7WA 4FORA 5H8FA 2HCAA 1YAEA 1I6AA 2UXAA 4H5FA 3W15C 4F1VA 3TMGA 3L6HA 2XHDA 1B7ZA 1EU8A 4LATA 3S4UA 1FTMA 4HW8A 3K6VA 2HR3A 3I5OA 2M5AA 4RA1A 2AL4A 1JW4A 1EZ9A 5CI5A 4YKIA 5L8DA 1MXVA 3UORA 4K3FA 4R6KA 2P58A 1U7MA 3HHFA 3OSQA 4NEDA 1ZXGA 3T9UA 3H7MA 3K1PA 4EYYQ 2F7AA 3RLFE 5ICQA 3EHTA 2X7QA 3ZKKA 2OJTA 2KZJA 2Q2AA 3QUJA 1SW1A 5DYHA 3LSFB 2QL3A 3SERA 1ZMGA 4POXA 1JM0A 4R6HA 5DEXA 1F9BA 3TTLA 4ND9A 3CR9A 4U4XA 2ZYMA 2PYYA 1TT1A 2P1SA 3KGCA 1NH7A 2YJPA 3ZKLA 1LP1B 1MH3A 4ZZAA 3DELB 4BDNA 1PBQA 2I0BA 1ATGA 3VDFA 2RC9A 4U23A 4UA8A 1Z7ME 4YZZA 5H8NB 5I2KB 4MN4C 1H3DA 2Q1KA 1NL5A 3ONMA 5BUUA 4ZE8A 1PC3A 1SYIA 3CFLA 3VXBA 4WEPA 1VR5A 4DXUA 5B7DA 3OO9A 4Z7EA 4JWYA 3IO6A 1OVVA 3UA8A 5ICTA 3CFXA 1FQFA 3IJOB 4GIZA 3C4MA 3A3CA 3PMXA 4YU0A 3S2VA 3K01A 4EDPA 2RC8A 2UVJA 5DVFA 4I8CA 3JV9A 3FVKA 4LUBA 1FTKA 1JVXA 2QS2A 2O51A 4F3GA 4EF2A 2PBWA 2XD3A 1EDLA 3H3GA 3E3KA 1MM6A 3O97A 3BFTA 5EHSA 4FIMA 3ECRA 3T93B 3Q27A 1ZBMA 4UACA 3T22A 2DS9A 1JVYA 5H8HA 5I58B 4IO2A 2ZNTA 4KYSA 1B5HA 5I56B 5IAIA 4EXKA 2O68A 1ZJLA 4KQPA 3G3JA 2QS1A 2GH9A 1MH4A 4DZ1A 4U2RA 4GWOA 4O3CA 2ONSA 2YPNA 1MQGA 1FC2C 1OVRA 3B6TA 3T9XB 4NWCA 1N84A 1SI0A 3PPRA 2QS3A 2OTKE 2XXWA 4F31B 4WEDA 4XTCQ 4NF4B 1N76A 3H6VA 4LZ5A 1VFEA 3MZ9A 4F19A 1B0HA 3O9PA 4NF8B 3FASA 4KYEA 2H98A 2KZIA 1POY1 5F1QA 2QMWA 5M2VA 5C39A 2UWJE 1B2HA 2R9JA 1QJMA 1RYXA 4JBZA 5EYFA 1MY3A 1LB8A 3M3KA 3O2AA 4R72A 4YKKA 5JK4A 3PH0A 3RTFB 5DVJA 3ZS6A 3KZGA 4Q30B 4H8IA 3HHGA 4OFOA 4G77A 5L9MA 3KG2A 3EN3A
chains in the Genus database with same CATH superfamily
2E76D 3H6WA 3CD6P 3A0HH 3AEGC 3PGFA 3Q5RA 3MUDA 2B65A 3OW2O 3M0AA 4JQ0D 3MZWB 2KS1B 3VMYA 4EQ9A 1UTBA 1BCCE 1H0TA 1IQ7A 4U4SA 1SQPE 2C9LY 1MXXA 2HPGA 2I6EA 2OGUA 2O1JA 2ZT9C 4TQUQ 4G61A 3ODBA 1FBMA 1FQAA 3TTNA 4WY4C 5APWA 2UYEA 2QMXA 2ZYOA 1MQIA 4P1EA 2QVRA 4GWUA 1PEBA 2KNCA 1J1NA 3GLMA 3C33A 2AEJA 3UP9A 2ZNSA 3AE4C 2WPSA 1CSBA 5AVXB 1NI9A 4GT1A 3PUXE 1YYZA 2N1TD 3KHUA 4DCXA 3S1KA 1NV5A 3RNNA 2NVUB 2FIEA 2REJA 1B0LA 1ZTYA 4WY4A 3K2DA 1NNTA 4F3BA 2FKWB 1USYE 4ZE9A 5I57A 3TGUD 5AW2B 5DJTB 4OWFA 1YTVA 4LQ2A 1L4AC 1B5JA 1L0NK 4JB7A 2QJPB 3HTKA 4D6TE 1FZEA 4C0RA 2FYUG 1NNFA 1RF1B 1IXIA 1T3JA 2O7IA 2JR8A 3PD8A 1KQLA 1BE3G 5JTYB 5A5XA 1VQ9P 1S50A 3MP1A 2QSIA 2XXKA 1S2EA 3AE5C 2DE4A 3AECC 5IZ1A 3VYIA 4PP0A 2ZVNB 1Q90D 3UK4A 3E13X 3B5ND 4IO7A 1EDIA 3HUSB 3Q1MA 1Z56A 2DWIA 2ZYKA 2E75D 3M8UA 1MFTA 3TQWA 4OEUA 1L5TA 3PUZE 3K1MA 4PV1C 5B5EE 5TISH 1S72P 2B87B 3L70E 1NU1D 2Z23A 4GL0A 1VL2A 3A5TA 4OVTA 1FZFA 3L73E 2JKVA 3CCLP 3KDPB 4GOTA 1EZVE 3OENA 2NPSD 1NV0A 3MUQA 5HPQA 3A09A 4I3YA 4AS5A 4F18A 2VPNA 4Q0CA 3O6HA 1DEBA 3LW5J 4IFDK 1NNKA 4JSDA 4R74A 3UIAA 3NOHA 4X1BA 3CWBD 1FPBA 4ZNCA 1QULA 5I2NA 1GGGA 1MXYA 1BTJA 1JB0J 2BCCJ 4HS7A 1LAXA 1QKBA 1DMBA 1Y1MA 3U1CA 3P7KA 1VQOP 4ELPA 2HZLA 4RYAA 5KCJB 4XXUA 3RL0g 4IY6A 3SZPA 3S9LC 1AOVA 3R6UA 2E76B 1EXJA 1DD4A 3EWKA 2DE3A 1XOCA 2V3UA 4WVZA 3OELA 5IKBA 5DVIA 4OANA 1CNQA 4IGTA 5ET7A 1MM7A 1B40A 5JEIA 5AW9B 2H88C 4NF5B 1PB9A 2UVGA 1JCDA 3L72D 3E1RA 4KR5A 1FPGA 4KYDA 4RJZA 1ZIUA 3N7NA 3CPWO 2XX8A 1VF5C 3RL0D 1LBYA 1BGYJ 3PPPA 3BIHA 1Y47A 5EYHA 1PB7A 3RY3A 1XVXA 1YPNA 4GWWA 1FTJA 3FJGA 1S5LE 1UTHA 1SFCC 2F6PA 5CHXA 1EZVD 2Z5IA 1OVTA 4OTEA 1GK4A 4U1ZA 3I5CA 1SQPK 1MQDA 4U3FD 1D3KA 1JQFA 2N1TB 2E5TA 4ZECA 2ZYDA 3SWKA 2OYIC 1Y9UA 2NXOA 2PFXA 4ZEKA 4P0IA 2O69A 4HJGH 4I1LA 1LTGC 2VHAA 2I3VA 3QYTA 2F3DA 1PP9G 5AVZB 4I40A 2HYNA 5APSA 1SQQE 4PAFA 1ZN5A 2XX7A 2VPOA 1KD1Q 3CSGA 3G3IA 3IR1A 4O94A 3TFLA 1OVBA 4H5GA 2N9YB 2HHMA 2K3RA 3DP8A 3KSJA 2OYIA 1PPJE 2E42A 3DP6A 5KZTA 2KSEA 4L17A 1BK4A 1LBVA 2I3WA 3SEYA 4NQ8A 3TELA 3QUFA 3USSA 3B5NB 1Z7NE 2P1JA 4RXLA 2RINA 4O8MA 1SQXD 2Z4EA 3L74G 1QUIA 4GL8A 2YIUC 1B1HA 1SQYA 3VVFA 2E75B 1L0NG 1KZUB 1IK7A 1L4AD 1LAHE 3N5LA 5IZZA 3M3LA 1P84D 5M1BA 1FQEA 1OQGA 2UVHA 4TLMB 3SEVA 3D1RA 3TNUA 3LIDA 4MF3A 1W2BO 2QVAA 2R44A 2PVUA 1GL2C 2BJIA 2P3NA 4BDMA 3H1KD 2QRYA 1NKXA 5AW1B 3KN8A 4DI3D 1T2KC 2NPSB 2JWDA 1BKAA 1M5CA 4IO3A 1NTKK 1R5LA 1XHYA 2VD3A 4QFPA 4GIFA 2KP8A 1R6ZA 3FIRA 2H99A 2I1JA 2L5GB 1QVFO 4FEDA 1USYH 3T9HB 3T97B 3IX1A 4PV1D 4YAHX 1X0TA 1NAYA 4R75A 5ESYA 4ZEDA 1IFPA 4OXVA 4HE2A 1MRPA 3V83A 5J16A 4PBHA 4GWSA 1LFHA 1IMEA 3F89A 4AQ4A 4OVSA 4ZDMA 4IL6E 3AEBC 5KDTA 4F22A 3Q28A 1Q82Q 5FTHA 4BLAA 2XXPA 1LLSA 1Y9BA 1GZLA 1QX8A 3L35A 1N0TA 3KJ7A 3PPQA 1NMUA 1P1OA 1JEVA 3T9VA 2JO1A 1B7UA 2ITAA 2P3VA 1P84I 5APXA 4KPTA 3T66A 4QFOA 5ITPA 5B5EH 1UTBB 4I9DA 3RL0B 3M9BA 2Q9IA 5I59A 2PFZA 2XXRA 3KBZA 1EYJA 1QGXA 2B3FA 5H8SA 3G71P 1FU1A 5CBNA 3TK1A 1N7SC 1M7LA 3IR9A 5AW5B 3DM0A 2AXTE 3RPWA 4GODA 3SKPA 2GM4A 2CEYA 3H1HG 4PFRA 1MG1A 2HXWA 3O66A 4FE8A 3H1JJ 2FBWC 4N6DA 3OXNA 1FW0A 3KZIE 1G1IA 3RPLB 3N6TA 1ZU0A 1GU5A 4RPNA 4AYCA 3JSVC 1D9YA 2F35A 4YTPC 4OA4A 1VF5D 4JSOA 2A45I 3U1AA 1NTMD 4PFTA 3Q5SA 2KK7A 2DP8A 1QLED 4BRYA 4U7JA 3MQ9A 5TP9B 3K02A 3CRBA 4GX4A 1USDA 3L71J 1K9YA 4O7MA 4DCYA 4XKPA 3MVYA 1SFCD 3R26A 1SQBJ 4NN3A 1NUXA 3HTKB 1J1DC 1B46A 3EQ1A 1N73C 2F36A 1ZV8A 3HE4A 3ILUB 3HRNA 1B9JA 2VRSA 2YMKA 3IORA 4KFQA 3AE6C 4UB8E 3VFJA 5KAIE 3HV1A 4PD4I 5AW7B 4JWXA 3W67A 2YO3A 1BDCA 2F5XA 3PPOA 4EIJA 1K9ZA 4C7NA 1L4AB 3EKIA 5HBCA 3HFUA 3L4FA 1URDA 3RN8A 2FFDA 1MQJA 1EZOA 4L75A 3II6A 3R2PA 3TKDA 1RE4A 1H89A 4QXDA 1KYOE 1DD3A 2XWIA 2J59M 3H1LG 3BRVB 1VQKP 3K4UA 1SW5A 4GF8A 1IO4A 2L91A 2IEEA 2WX9A 3KBRA 4MFIA 2XD2A 3A0BE 1FPDA 2YXRB 3LSXA 3VP8A 1B3GA 4NE4A 2R3SA 4GOFA 2PCRA 3SEUA 5AA4A 1LTIC 3TUSA 3CCSP 4G2ZA 4GWXA 3BVHA 3KC0A 1IFNA 1X79B 3KN3A 1D7MA 2OYHC 3H1IJ 3TF5A 3MYUA 3GF3A 3FD3A 4F3SA 4W7YA 3TGUJ 4GBVA 2WT7A 3V5AA 1GL2D 2FY8A 2HPCB 1JP4A 4PGNA 4ZEFA 4WBAA 3K6XA 1NTKG 4FATA 5LTCA 4DXCA 1NGMB 3R4YA 4QMAA 1MUUA 1FS0E 1VQ7P 2W6BA 4XA4A 2FYUD 1GU4A 3W9VA 2RMZA 5IZ3B 1BE3D 1HF9A 2ZXEB 3Q5PA 5CBSA 2QJEA 1B4HA 3TCHA 2HQ0A 4NF6B 5L9OA 3PJSK 4NPDA 1BCCJ 4ZEIA 4GVOA 1LT1A 1QL2A 4DE8A 2OARA 1LBZA 3WUTA 2WPRA 3BCCE 4I62A 4I2LC 3C32A 3L75G 4Y28J 5AE4A 3BASA 1NH8A 4QFNA 4TLLB 1QVGO 1QEXA 4H0LC 2JJKA 2WYKA 3VVDA 2WEFA 2J58A 3HD7C 1JW5A 4R2FA 5CC2A 2RCBA 1JTHB 1VFDA 1RQUA 4IGRA 1VF5B 2I48A 2P10A 3K00A 4OYVA 1LTJA 2F78A 1FTOA 1T0KA 1Y3NA 1B3LA 3TTRA 3D4GA 4DDDA 1G2CA 2DYXA 1IUDA 1NFTA 2OLBA 3FV1A 4XKRA 1N7SD 2E5YA 2KOGA 4R6YA 3CCVP 2GA1A 3HD7A 4IL6H 1SFCB 2XNDH 1DPEA 4GFRA 1QW0A 4LONB 1M56D 3H06B 4NPEA 1LFGA 1JY3P 1HGZA 3FV2A 3OMBA 3F11A 3QWOC 2OYIB 1B3FA 4OFLA 5KLVE 1SDXA 3LR1A 3CC4P 3L72J 2J5UA 3OA7A 1AMFA 1RE3C 5EFWB 3P7IA 3IK6B 4E0WA 2WVRA 2E0SA 1CI6A 2AXTH 1IMAA 2HODA 3CHGA 3USDA 2I8DA 3GF7A 3VMZA 3L70J 5AA2A 3V5BA 1Y1ZA 3E9XA 2QJYC 1JW1A 1YQ4C 4GX3A 3TNUB 3KZIH 5CMCA 4IFMA 5AVSB 3B71A 1H88A 1A8FA 3IB1A 2F7BA 4GXAA 4K3AA 1UIXA 4U3FJ 2QS4A 2XX9A 3IO4A 3O6IA 3UIFA 2HG5D 2JEEA 2KR0A 3MWBA 4GLIA 3RQTA 5EYGA 1MY2A 3ISPA 3S9MC 2R71A 2Q2CA 2H25A 3M0DA 1FPJA 3FXUA 3SEXA 4N81A 4X8RA 2G29A 3HE5B 2M0BA 3K6WA 5TPAA 1DPPA 3B8BA 3P8CD 1FJKA 5H8FB 1OIBA 4H13C 1IXHA 1R9QA 4EQ7A 4JVIA 2WSFJ 3PMVA 3KYQA 1GL2B 4PETA 5EQAA 5CRYA 2E43A 2H43A 1JCCA 5CBRA 4EF1A 2XU6A 1PP9D 2Y7PA 3D4CA 1M1JC 5TU0A 4WB4A 4UB8H 4G68A 2LXCB 1CB6A 5KAIH 1FJ9A 1N2DC 1KQGB 3BIGA 4MCOA 2YXQB 1M5BA 4WKMA 4BWNA 3IB2A 4L73A 2IFNA 2LAOA 3E79A 2FNCA 3RGYA 3MUDC 1EQ7A 1Q7YQ 4FBPA 2M5AB 3CG1A 1LAFE 3ROJA 1M1JA 3L74D 1Q1KA 1KYOH 4N07A 4X9TA 4P9KA 1H43A 5AVYB 4F1YA 5FTIA 3VMAA 1VQLP 3C36A 5FHNA 1L0ND 2H89C 3A29A 2F3BA 1IMFA 1HSEA 5AA3A 1K8AQ 3A0BH 4XE5B 2Y7IA 2M8RA 3H1KJ 3G3GA 4OZ9A 4PQJA 3TQLA 1Q35A 2V4HA 5AW4B 3FUZA 1SS1A 1D9VA 3MSTA 1MDQA 4YXDC 4R2BA 3PD9A 1MPDA 5TJHA 3WMM0 5FHOA 2VP1A 5AW8B 4OENA 4LC1A 3ZSFA 1DOTA 1RQVA 4NAPA 4DXBA 1IFMA 3RT6B 1GVCA 2QRXA 3FVNA 1SQVG 4LA9A 1L0LE 3V4QA 1NUZA 2D3IA 3GMAA 1II5A 2OCUA 2Z8FA 2XXTA 1NU1E 5KLIC 1N7SB 1LWUA 1HJ0A 2IYPA 4PE3A 4RY1A 4BRYB 1HH0A 1SQQJ 2IZ1A 4H0LD 2FYIA 3F5HA 4I3EA 1IFJA 3SFEC 5CMBA 4OMBA 4OWDA 3SESA 1TU3F 1QUKA 4PCDA 2WMMA 2BCCG 2ZNUA 5DEXB 3FVOA 3FXQA 5AW3B 2QSXA 1URQC 3PUYE 1OFCX 1Q2NA 3CWBE 2B9BA 3IFMA 1PZQA 1Y3PA 3VXCA 1G1JA 4W80A 1LBWA 2O1KA 5CMZA 4E0XA 4PBQA 5J1DA 1P1UA 3V6IA 1FBPA 1R9LA 1J1DB 2HLOA 1N73B 2Y7RA 1PV3A 3SFDC 2HZKA 1URQA 1UIIA 3N6UA 1OWAA 1MXZA 4YICA 2O3JA 2IDBA 1DTZA 5KJ7D 1OQHA 1BGYG 3G6EP 1Y4CA 1Y8AA 2CMOA 4P56A 3PPNA 4QFKA 5APYA 3CCEP 2DSFA 3CXHD 3L72E 4OERA 3N26A 4DOJA 2OX3A 2HAUA 5L9SA 1KB9D 1DCUA 4IR8A 3FZVA 4HB1A 1J1EC 1Q86Q 3E78A 3RGUA 3ZDMA 2YMYA 1H8AA 1L0LD 4N8GA 2IA4A 3B7DA 1SQBK 3BRTB 2GHAA 3O8ZA 4FEBA 4R4LA 3LIEA 2W7YA 4G8HA 3TAJA 4IO6A 1LP1A 4TT3H 1IIWA 3E7KA 2ZYAA 3ABVC 1I6BA 1OLAA 2AYSA 1OW8A 3Q26A 1LJ2A 4C7RA 4DCKA 5H2FE 4PE5B 2HAVA 1YTZI 4U3FE 5HM4B 2XXIA 1PL5A 4HKZH 3FJMA 3V2RA 2OYHB 2K9JA 5APQA 3TCGA 4KXPA 1NWQA 4GWZA 4O3AA 2ZMBA 1BSNA 4H13D 3GXAA 4MLQA 2NUVA 2IX7C 3CI9A 4JVCA 4RPOA 1S9TA 4DJGA 5BVZA 5K5GB 3LUZA 5I3SA 5I2KA 1LTAC 2Q3EA 4MIJA 2QVUA 1E79H 5EQ8A 4Z1MH 2FYZA 5LDZA 1KWHA 2Z5HA 3NTNA 4M4GA 3IOWA 1RYOA 3MBPA 4OVQA 5CBOA 2K1AA 3CXHI 1NYHA 1SBPA 2AXCA 4PFIA 4Q8RA 1NJIQ 1VQPP 1FZCA 3LSWA 5ITOA 1KB9I 3W68A 1M5DA 2FYNC 1DTGA 3U72A 1SQXE 1DSNA 2I0CA 2H7HA 4P11A 2N9BA 5AVQB 5DW8A 4XFEA 1S7YA 3K6UA 4NHBA 1RHZB 4DLDA 3WU2E 5CJ0A 2XXXA 1P84E 1VSOA 3D70A 4HH2A 2H9BA 3CIJA 4C1UA 2POHA 1MY0A 2A06D 1BDDA 2QA4P 2RKMA 3RBXA 1X8YA 3H1KE 2Q88A 4R9FA 4H0LB 5ET8A 2F8DA 2DVZA 1XC1A 1T3UA 4U22A 4GKGA 1GTWA 5H8HB 2LR2A 1MPCA 1NTKD 2QJKC 2E1SA 3T0JA 1M57D 1BE3J 3M91A 1FQDA 3MVXA 2OK2A 1K73Q 1D9QA 2FHYA 4LVQA 1WDNA 4EQBA 2ZT9D 1NU1K 1SVXB 3O6QB 3G3KA 1B4ZA 4TOZA 3IOTA 1MQHA 4ECFA 1EDJA 4WY4D 3CCRP 1AQ5A 2MJZA 3L36A 3SDFA 3U92A 2HXRA 3KN7A 1URSA 4GOEA 1CI6B 1NKNA 1MZ9A 2HODB 1U57A 3V8XB 3QSLA 3EQ2A 1ZR2A 1XS5A 2AL5A 4ELQA 4GBWA 1KILC 2YKPA 4N8YA 1IZNB 3L75D 3TDKA 2OWZA 3QXMA 4KT0J 4AS4A 2DXRA 1HUCA 3BFUA 3QIMA 1JY3N 4WXJA 2WPVB 3GLBA 2QPQA 4N6PA 4ZS9A 4ELRA 3DLNA 2KIKA 5I58A 1YITP 4F39A 5I56A 3MJNA 1RKMA 4KHXA 2PT1A 2HEUA 1B51A 4ESWA 3CMEP 3HO7A 3H1JG 2KQZA 4DZOA 3L37A 2DXYA 3G7WA 1KILA 2QJYB 5APUA 4MNIA 3G3HA 1RY3A 3RUMA 3IOVA 1VQNP 2V93A 4P0GA 1NOHA 1JY2N 2Y9YA 3TCFA 1HVVA 3WAEA 1NAFA 3AE7C 1AFOA 3L71G 3FWNA 3RK3C 1FPFA 4XKNA 4YXWH 1NTME 4O9BA 1JNFA 2MKVA 1SQBG 3N94A 3GHGA 4H13B 2NZ2A 4LN5A 4NG7A 1FSAA 1H45A 4IFFA 1UIVA 4ZKPA 5CMMA 4KCDA 3BCCJ 1NV3A 1M1JB 1LAGE 4FAJA 2D2CC 3MZBA 4AQRD 1N86A 2ZXXA 5GTHE 4RESB 1NV6A 3CSBA 2I58A 4NF8A 4PFWA 4YB6A 3RTWB 3H32B 2A5TA 1JETA 1LTBC 2ZZVA 4FJPA 4GRKA 4JYCA 1NTZD 3VTPC 4R73A 4WWIA 4TLFA 1RF0C 3A2AA 2BEZF 3AE2C 2VGQA 1L2PA 4KD5A 2IBZG 2DDKA 4AB5A 2KI7B 5CCGC 3FXRA 1EYKA 3FJ7A 3H6UA 1LBCA 4P3LA 3CC2P 2H5YA 1FJPA 1BSHA 1SLQA 2ZVOB 1H0TB 1IC2A 2W83C 4PD4D 2RF1A 1YCJA 4I7ZC 1H44A 2I4BA 1HTLC 3FWLA 1MXUA 1NVOA 2QIWA 5KKZC 2FXPA 1S3JA 3OJAB 5H2FH 1R8EA 1RF0A 2WZ7A 1M5EA 4JPZB 5CJ4A 5I84A 3CG3A 2JP3A 2PMSA 3U8QA 4RK9A 2KSJA 3H1IG 1AVOA 4B86A 1SI1A 1JMBA 5CCGA 4JVDA 3LV0A 4C46A 2UYFA 4IOIH 2BEQD 2G93A 2FA7A 3TGUG 2KNCB 1YHQP 1B7HA 2NOOA 3PUVE 1IMCA 3KOTA 4LLHA 1FDMA 1KFMA 4YPCA 1LCFA 4XFJA 5KLVJ 3O28A 1PB8A 1B58A 2WSFH 3QK6A 3Q29A 2ZT9B 2O01N 1KTMA 2KLUA 1MDP1 1Q9DA 3Q25A 4HCYA 1IEJA 3MPLA 3FGSA 3TDJA 4WY4B 1AIVA 2O7UA 5EHMA 1LGBC 4OVPA 3K0VA 3UN6A 3IAZA 2KS1A 5I57B 2Y0EA 1QVSA 1WT6A 1KN7A 2I49A 1BCCG 3I6VA 4F2OA 2FYUE 5B66E 1SQPG 3MZ1A 3CCQP 2FFDC 2C0WA 4PTKA 4QHQA 1AVYA 2O84X 4MH5A 1AA0A 1RE4C 2L5VA 1BE3E 1S4XA 3QH9A 1ZLQA 5ISUA 4ASVA 2FBPA 5A5XB 3WU2H 2Q3IA 3UGWA 4ZMDA 2PX1A 1WODA 1P84H 1LEVA 1YQ3C 2QM8A 5AVVB 3CCUP 4O3BA 1SP4A 4QF9A 2RH0A 1QUJA 1SQQK 3CCJP 3VP9A 1SQVD 2OWSA 1USEA 2G3AA 2M8CA 1ZW0A 2HFBA 1S5LH 2Q5UA 3FVGA 2IYOA 2THIA 3SEWA 1M90Q 2F7CA 2XNXA 4JF7A 1HSJA 4YKJA 2OZZA 1LGHB 3D6YA 3ILTB 1BIYA 3N4XA 3S9OA 2F97A 2V4CA 1URGA 1Y4TA 1DH3A 3GBBA 4NPFX 5CCHA 2WPQA 5ELVA 2XXUA 2B3BA 2A45H 1J1EB 2BCCD 1RF1A 4MNPA 4N6KA 4D6TG 1PFIA 4NX1A 4R9GA 4PV1B 5JTYA 4BDQA 3OEMA 3V2PA 1IFDA 4K35A 1VQ6P 3HCQA 2IFMA 2DQVA 5I2NB 1NO4A 5T3JA 4OETA 3L72G 1BP5A 3HUSA 1T2KD 2P0SA 3MP8A 1A02F 1R1NA 3AEDC 4Q5TA 1A54A 1UIUA 1LB9A 4I1DA 2G8YA 1FTLA 2PT2A 1INPA 1NTMK 3RK3D 2B87A 1WMKA 3E1IA 2K37A 3NFQA 3IFAA 4G8MA 1FZAA 3L70G 4DT0A 2ABHA 5APTA 3WUUA 1IMBA 2V3QA 1FJ6A 3MP6A 1BGYD 4U1OA 3L73G 4XEQA 2ONKE 4MBPA 3L6GA 1L0LJ 2DW3A 1TFAA 4F3PA 3TYHA 3FXDA 1EZVG 1K05A 1KORA 4N4UA 2D2CD 4ONYA 3O6GA 1NU1J 3KJTA 4YMBA 4X04A 4BDOA 1YBKA 1A55A 1OLCA 2GQ1A 1LTJC 3AEEC 5I7IA 4G4PA 5BU8B 3GZGA 5F7VA 3JCUE 4HTGA 3NMDA 5DJUB 3IAOA 3AEAC 2FYNB 3OAKA 4C1TA 1ZOYC 4EI2A 1UTHB 4F1UA 1FQBA 1GK6A 3CX5D 1XT8A 2REGA 3U65A 3WAFA 1S9KD 2K88A 5KCJA 4BXLA 3CWBJ 3P8CE 4Z0IA 1NHLA 1B32A 4XF5A 5K2YA 1SD3A 2PGDA 4LZ8A 3S9EA 1I69A 3TTMA 3LC8A 2F6GA 5GTHH 4G8NA 3VLUA 3FXBA 2ZYNA 4NF5A 1JY3O 1PP9E 2DOJA 4M1VA 3A3UA 2QJKB 4GXSB 2RKLA 1MPBA 1DEEG 1FZBA 2R8TA 4NMYA 2N1TC 1FPIA 2CZLA 2W8ZA 2IZ0A 4H65A 3W9WA 1GDTA 3AXFA 3IOUA 3Q3DA 2XKMA 2DVCA 4NGUA 3KEIA 4KCCA 3L74E 2LXBA 4LQ5A 1ELJA 1FDIA 4ELOA 1L0NE 2AIXA 2W6JH 2I4CA 4NWDA 4THIA 5H8QA 1IXGA 1GTKA 4RO0A 1EC5A 3M0DC 2FYUK 1US4A 2N1TA 4OGQC 5F24A 4F2QA 3OO8A 1SPIA 3HPIA 1KZ8A 1CE2A 1PDAA 3AE3C 3CX5I 1JY2P 5FHMA 4YKPA 1FTAA 3B5NC 1UQWA 3IFCA 3BKIB 5AVUB 4QSCA 2YIUB 4UB6E 3H6PA 1BLFA 1FOSE 3CFZA 1SQQG 4G68C 4OEVA 4GD5A 1KYOI 1HWTC 1B6HA 1VQMP 2VD2A 3LBSA 3EF7A 4F29A 1VPCA 1MY4A 3KOSA 3M06A 3OSRA 1PPJG 1AV1A 4L76A 4OQOA 1S5LX 5B66H 3B5NA 3MC2A 1X9VA 4IB2A 2CZKA 4M3LA 3B8EB 3QMFA 1PGJA 3HSTA 4KJMA 1AJYA 1POTA 1SW2A 3R7XA 4P8BA 4RK2A 3B4SA 4N91A 3MHVA 4PDHA 1NH4A 2C0XA 4N13A 3RK3B 3U94A 3G9RA 1AL3A 4H0WA 2A5TB 3BATA 5KDTB 3I3VA 1SQXJ 2Q8JA 1B1XA 1I6QA 1PBPA 1KQSO 4EUOA 2W90A 5EQ9A 4MMPA 3TPAA 1N04A 1N7WA 1P1NA 4X1DA 4EOTA 1P1WA 3M3FA 4I6MC 3IB0A 2NPSA 1HBWA 1YJNP 4H67A 4PAKA 5DT6A 2MKZA 1A40A 3QAXA 1US5A 2D2CB 2UVIA 3CVGA 1A02J 3MVWA 1VE4A 3WUVA 1B52A 3H1JD 2FXMA 4HXVA 1IZ1A 5I59B 1U7JA 3MVZA 2XDJA 2WSCH 2O1MA 4GDOA 3NXSA 2DWHA 3T97A 2WKYA 1LWUC 3PUWE 2ZFCA 3OD7A 3CXHE 3AE8C 3CMAP 4POWA 2ESNA 2Z22A 4H45A 2W6AA 5EQ7A 1KB9E 1LTTC 3T1BA 1IXCA 3T96B 3RL0C 1WVJA 1IFIA 2Y0CA 3L71D 1YYCA 4I7ZB 1OMPA 1LCTA 3IL1B 5KKZB 1VDWA 3FGAD 1LNQA 2O6AA 1LBBA 1SQBD 5AVRB 3KC1A 1OXZA 1EZPA 1FAVA 3PRJA 3VLWA 1LT9C 1EH3A 2ANJA 4PFYA 3LSLA 5AA1A 3BBRA 1GV8A 2DE2A 1TWYA 4YB7A 1YTZT 2OQQA 1XTGB 1MS7A 2NWJA 4ZZEA 2O01H 4MAGA 3MAMA 4PGPA 1A99A 3HD7D 3B6QA 2X26A 3E4RA 1FE6A 4KI0E 5GTIE 2F34A 3KSXA 4LZ7A 4EDFA 2B89A 1NTZJ 3H6TA 2Z8EA 3B6WA 1JEKA 4HYTB 3HE4B 4OH8B 1A8EA 2Y7KA 1FBFA 2SPZA 5K2XA 1LT9A 1T6AA 4QRZA 2D5WA 1JUNA 4QFLA 4FECA 2IBZD 2O1LA 1GW4A 2KB7P 1B05A 3S9NC 1FDOA 1ZLLA 1GR2A 1W2EA 3RPLA 1X22A 3MIWA 2XXVA 1O7TA 3PV0E 4H46A 3JCUH 2XXYA 4C7NB 3OO6A 1XVYA 4IL6X 2FFDB 4YB5A 3VE1B 3C1LA 1SW4A 3VLVA 4BDRA 2AEMA 1O63A 3H1LE 1N3WA 2QEXP 2GFEA 4XIGQ 5KLVK 5AA2D 4IO4A 4RJTA 2H4IA 1B3EA 5E79E 3H1HD 1MY1A 1TFDA 5TP9A 3H1ID 2BJJX 2OWTA 3C35A 2A5SA 1FBCA 1ZKBA 4N6JA 3SWYA 4DIGA 4QSEA 2ZYGA 3THIA 5AA4B 4CPGA 3IJXB 1NTMJ 1SVFA 4H6DA 4ISUA 1GMJA 1YJWP 2ZAEB 3O29A 3M9QA 2A06E 4OGQD 3V2NA 4JXIA 4ZEBA 2ZXTA 3PU5A 4OESA 3PHLA 1SYHA 3SETA 2WT7B 4LP2B 3MPKA 3H25A 4U21A 1NTKE 2X7PA 2XXQA 4OHNA 2OTJP 2WBDA 1L4AA 1P99A 3IF4A 5BU5A 2DWAA 1BCCD 2FVZA 1ANFA 2RCAA 1N8RQ 1SQPD 4ASWA 4OVRA 1IITA 2R6GE 3H03A 2IBZI 5AW6B 1W5CE 2M3BA 3U93A 1FZCC 5AVWB 2OBGA 2V25A 3TODA 3RT8A 2YO2A 1K9MQ 1HJBA 2KLFA 1Y3QA 1SQVJ 1TXFA 1FPKA 3HN0A 5H8NA 3EHSA 2B88A 2XA5A 3H4ZA 3VV5A 4OVJA 4R4MA 4H1XA 3JYRA 1H76A 3L75E 3VVEA 3OO7A 4W7ZA 2FIXA 2YKQA 4UB6H 2Q74A 2V7QJ 3H1LD 3TEPA 3EHUA 1FPEA 2HPCA 1DIPA 3RK2C 4QBAA 1FCKA 2DWJA 4IY5A 2HFED 1Y20A 2Y84A 4YMAA 2QVVA 1NV1A 4D6TD 2KUBA 4KHZE 1LTJB 1QKAA 5IZ3A 2CPBA 2ZZWA 3IN6A 5DTBA 2H8PD 5CMKA 1WRGA 3G3FA 1G2CB 3Q2YA 3B50A 4NF6A 3VMXA 4GQOA 3KFMA 4BDLA 3OOAA 1M5FA 3HD7B 3CLQA 2Z8DA 2FYUJ 4PFUA 3G3ZA 1DX7A 2P67A 4NF0A 2D21A 3MW0A 4IO5A 1N3XA 1IMDA 3U1OA 2R3CA 3BCCG 2P2AA 3GBAA 5L8RJ 2GHBA 3LUYA 2JWAA 4H8JA 1L0LK 3GW6A 1JNMA 4PDDA 3V89B 2GUSA 1FQCA 1FBDA 1O64A 4NTLA 3JZJA 3DP4A 4EXLA 2WSEH 3L70D 4Y99C 4P1LA 5IGAA 1FBHA 3V4WA 1FOSF 3L73D 1LSTA 1D4NA 3SWFA 3EPEA 3K1NA 2Y5LA 2Q6QA 3K5BA 1A7LA 5BWJA 1IJDB 1JTHA 5H8QB 1AH5A 2RC7A 3CXHH 3AE1C 3C9HA 1YJ9P 5AA2B 2E74C 1NTZE 1NNPA 2GRVA 1KB9H 1URQD 2WSCJ 1N7LA 2YLNA 1LFIA 1N7XA 2VOZA 2R5DA 1SFCA 1ZRTE 4MEVA 1DK4A 4PD4E 3FATA 5LOMA 4HCWA 1NUYA 1FPLA 1NUWA 1NV7A 4OGQB 4RNSA 4HE1A 4N78E 5TPAB 3AE9C 3V2QA 2V3TA 3GHGC 5KLVG 2Q89A 2PFYA 3TTKA 1JEUA 3CI8A 5GTIH 4OFJA 3TZAA 4AB6A 1B5IA 3C31A 4X48A 2V84A 4PJ0E 4QSDA 3OEKA 1ZMEC 4MLVA 3D6ZA 3PP5A 1B3HA 1RDYA 3KQGA 3PMWA 3FXEA 4OVNF 1MXWA 4ESXA 3C34A 2ALUA 4G68B 2O01J 2RN0A 5CM6A 1M1KQ 2XXHA 1HSLA 3FX0A 3RYDA 2P2UA 4JDFA 1AQTA 4H44C 1OVUA 5KTBA 5B70A 1EZVI 3AEFC 4NF4A 2QE7H 4XKQA 1KV4A 2Q9TA 3MP7B 1OW6A 1VDFA 2GUVA 5APVA 1EDKA 2ONRA 1P1QA 5E79H 1OW7A 4JWOA 3HE5A 2Y7WA 3S4RA 4FORA 5H8FA 2HCAA 2ZZXA 5ET6A 1YAEA 1I6AA 1J2JB 2UXAA 4H5FA 1GL2A 3W15C 4F1VA 5KAFE 3TMGA 3KXDA 2CZIA 1ZRTD 3L6HA 1KA0A 1SQVE 2PAJA 3RBZA 1SQQD 1QGKB 2XHDA 1B7ZA 1EU8A 4LATA 2XWKA 4MX6A 3PLNA 3S4UA 1KILE 1FTMA 5AW0B 4HW8A 1PPJD 4N78D 3K6VA 1LWUB 1PP9J 3VN0A 2CZHA 2HR3A 1KC8Q 1GD2E 2M5AA 3I5OA 4RA1A 1SQXK 4MJOA 2AL4A 1JW4A 2YNYA 3RK2D 1HGVA 2BCCE 1EZ9A 5CI5A 4YKIA 2PRRA 5L8DA 1FZGA 1MXVA 3UORA 4K3FA 5KLIB 4R6KA 1LT9B 2P58A 1VQ8P 3L74J 1U7MA 3HHFA 3OSQA 1L0NJ 3SSUA 1ZXGA 4NEDA 3T9UA 3H7MA 3K1PA 4EYYQ 2F7AA 3RLFE 2XZRA 5ICQA 4P47A 1L0LG 3RK3E 3EHTA 2X7QA 3EFGA 2OYOA 2QM7A 3ZKKA 1URQB 1N7SA 2OJTA 2BASA 1NU1G 2KZJA 2Q2AA 3QUJA 3KPEA 1BGYE 4RKUJ 3TYYA 2CPSA 1FBGA 1SW1A 4PC9A 3PTYA 5DYHA 1KA1A 3LSFB 2QL3A 1MFZA 3SERA 1ZMGA 2CK3H 1GW3A 4ZKUA 1CZQA 4MNCA 5CCHC 4POXA 2QJPC 1JM0A 4R6HA 1NKZB 5DEXA 1F9BA 1RF1C 3TSIA 4ND9A 3TTLA 3CR9A 4U4XA 2ZYMA 2PYYA 1JMMA 3P32A 1ZR4A 1TT1A 2P1SA 4N17A 3KGCA 1NH7A 1KILD 1NTZK 2E74D 2YJPA 3ZKLA 4MHFA 3CWBG 1LP1B 2WQYC 4PF8A 1MH3A 1K04A 3CX5E 4N15A 4PFBA 4ZZAA 2WTYA 3HUSC 3DELB 1S9KE 3U59A 1MV8A 4BDNA 1N73A 3I55P 2JJLA 1JO5A 1PBQA 2I1KA 1RDXA 2K9JB 2K9YA 3GYYA 1EXIA 2I0BA 2KYVA 1ATGA 3VDFA 2RC9A 4U23A 1JOCA 4UA8A 1Z7ME 1KMIZ 1ZP0C 2WSEJ 4YZZA 5H8NB 3A0HE 2P7JA 4MN4C 5I2KB 1H3DA 2Q1KA 1NL5A 3ONMA 5BUUA 1XTCC 4ZE8A 3G4SP 3EFFK 1PGQA 3H1HJ 1PC3A 1SYIA 4GX6A 2KXPB 3CFLA 2A06G 3VXBA 4PD4H 4WEPA 4H44D 1VR5A 4DXUA 5B7DA 1FZCB 2M3EA 3OO9A 4Z7EA 3MD0A 2VT5A 1VQ5P 2IPPA 5AVTB 3D71A 1PGOA 4JWYA 3IO6A 1OVVA 4U3FG 4LGDE 2W27A 2OYHA 2E76C 4PJ0H 3UA8A 4N3YB 2NRGA 5ICTA 3CFXA 4GWYA 2KLVA 1FQFA 1S1CX 3IJOB 4GIZA 3C4MA 3A3CA 3PMXA 3JC22 4YU0A 1SQPJ 3RK2B 3K01A 3S2VA 4EDPA 3C9IA 2RC8A 2UVJA 2R5BA 5CCGD 5DVFA 3A7OA 5A5LA 4I8CA 3JV9A 1OMIA 1SQVK 2C9NY 3FVKA 4LUBA 3CCMP 1FTKA 3M9HA 1JVXA 2QS2A 4O7IA 2O51A 1KYOD 4F3GA 1Q81Q 4EF2A 2JDIH 1SQXG 1AWBA 1YZ0A 1XI6A 5ET5A 2PBWA 2XD3A 1OZHA 5FBPA 1EDLA 3H3GA 3E3KA 2XV5A 3H1LJ 1MM6A 5KAFH 3O97A 3BFTA 5EHSA 1VQ4P 4FIMA 3ECRA 1OX3A 3T93B 2WBBA 3Q27A 1ZBMA 4Y99B 3C8VA 4A7PA 3H1KG 2B4MA 4UACA 3T22A 2WSSH 2DS9A 1JVYA 2ZJSE 5H8HA 4IO2A 5I58B 2Q8MA 2ZNTA 4KYSA 5TISE 2YKOA 4D6TJ 1B5HA 5I56B 5IAIA 1JY2O 2WITA 4EXKA 3LW5H 2AEFA 3H1JE 2O68A 4AUWA 1ZJLA 4KQPA 1PIXA 1FRPA 3G3JA 2QS1A 2GH9A 2V7QH 1RH5B 1KILB 2E74B 1MH4A 2PP6A 2QFLA 4DZ1A 3FBPA 3O6QA 4PAIA 5KJ7C 4U2RA 2Y0DA 1NTKJ 2A45G 5IM2A 4GWOA 4O3CA 2ONSA 2Q7CA 4HE0A 2YPNA 1MQGA 1QL1A 1FC2C 3I56P 1OVRA 3L71E 2E75C 3B6TA 5CCHD 3BCCD 1YIJP 3T9XB 1SQBE 1DBZA 1R5SA 3L73J 4NWCA 3GHGB 1NV2A 1EYIA 5KJ7A 1E5WA 1NTZG 1N84A 1SI0A 3GG2A 3PPRA 2QS3A 2OTKE 2XXWA 4F31B 1PGPA 2Y9ZA 1RE3A 1YI2P 4WEDA 4NF4B 3ITKA 1N76A 3H6VA 4XTCQ 2NPSC 2FXOA 1G0IA 4LZ5A 1VFEA 1OIPA 4L74A 3MZ9A 3CC7P 4F19A 3P8MC 1B0HA 3O9PA 3L75J 4NF8B 3CL3D 2QG4A 2LKMA 1KFNA 4H44B 1KQFB 1LBXA 1NV4A 3FASA 4PF6A 4DI4B 2IBZE 4KYEA 2H98A 2KZIA 1POY1 1T8ZA 4JYBA 5F1QA 2QMWA 1LTSC 5M2VA 5I5PA 1M8OB 5C39A 3A3YB 1RDZA 2UWJE 1YXIA 1B2HA 1MKMA 2R9JA 1QJMA 1FBEA 1CW5A 1RYXA 2XWOA 4UABA 4JBZA 2OTLP 3CX5H 3VOPA 1MY3A 5EYFA 1NTMG 1LB8A 3M3KA 3O2AA 3PTZA 5KLVD 3H1HE 4R72A 1IK9A 2XWVA 3MGNA 3H1IE 2WYPA 1G0HA 4YKKA 5JK4A 3MTUE 2R32A 3PH0A 3RTFB 3TGUE 5DVJA 3ZS6A 3KZGA 2WWWA 2CEXA 2Y5KA 4Q30B 4H8IA 3HHGA 4OFOA 4G77A 3H32A 5L9MA 3KG2A 2B4LA 3EN3A
chains in the Genus database with same CATH topology
3H6WA 3PGFA 2B65A 3MZWB 2KS1B 4EQ9A 1UTBA 1H0TA 1IQ7A 4U4SA 1MXXA 2I6EA 4TQUQ 3ODBA 1FQAA 3TTNA 2UYEA 2QMXA 2ZYOA 1MQIA 1PEBA 1J1NA 3C33A 3UP9A 2ZNSA 3PUXE 4DCXA 3S1KA 3RNNA 2NVUB 2REJA 1B0LA 1ZTYA 3K2DA 1NNTA 4F3BA 1USYE 4ZE9A 5I57A 5DJTB 1YTVA 4LQ2A 1B5JA 4JB7A 4C0RA 1NNFA 1IXIA 2O7IA 3PD8A 5JTYB 5A5XA 1S50A 3MP1A 2DE4A 4PP0A 3UK4A 3E13X 4IO7A 1EDIA 2DWIA 2ZYKA 3M8UA 1MFTA 3TQWA 4OEUA 1L5TA 3PUZE 3K1MA 2B87B 2Z23A 4GL0A 4GOTA 3OENA 3MUQA 5HPQA 3A09A 4F18A 4Q0CA 3O6HA 1NNKA 4JSDA 4R74A 4X1BA 4ZNCA 1QULA 5I2NA 1GGGA 1MXYA 1BTJA 4HS7A 1LAXA 1QKBA 1DMBA 1Y1MA 4ELPA 2HZLA 4RYAA 5KCJB 4XXUA 3S9LC 4IY6A 1AOVA 3R6UA 2DE3A 1XOCA 2V3UA 3OELA 5IKBA 5DVIA 4IGTA 1MM7A 1B40A 5JEIA 4NF5B 1PB9A 2UVGA 4KR5A 4KYDA 4RJZA 1ZIUA 2XX8A 3PPPA 1Y47A 1PB7A 3RY3A 1XVXA 1YPNA 1FTJA 3FJGA 1UTHA 2F6PA 1OVTA 4OTEA 4U1ZA 1MQDA 1JQFA 1D3KA 4ZECA 1Y9UA 2NXOA 4ZEKA 4P0IA 2O69A 4HJGH 2VHAA 2I3VA 3QYTA 2XX7A 3CSGA 3IR1A 3G3IA 3TFLA 1OVBA 4H5GA 2K3RA 3DP8A 3KSJA 3DP6A 5KZTA 4L17A 3TELA 2I3WA 3SEYA 3QUFA 4RXLA 1Z7NE 2RINA 1QUIA 4GL8A 1B1HA 1SQYA 3VVFA 1LAHE 3N5LA 3M3LA 1FQEA 1OQGA 2UVHA 4TLMB 3SEVA 4MF3A 2PVUA 2QVAA 2R44A 4BDMA 2QRYA 1NKXA 3KN8A 2JWDA 1BKAA 1M5CA 4IO3A 1XHYA 2VD3A 4QFPA 1R6ZA 3FIRA 2H99A 4FEDA 1USYH 3T9HB 3IX1A 4YAHX 1X0TA 4R75A 4ZEDA 4OXVA 1MRPA 3V83A 1LFHA 4AQ4A 4ZDMA 5KDTA 4F22A 3Q28A 4BLAA 5FTHA 2XXPA 1LLSA 1N0TA 3KJ7A 3PPQA 1NMUA 1P1OA 1JEVA 3T9VA 1B7UA 4KPTA 3T66A 4QFOA 5ITPA 1UTBB 4I9DA 5I59A 2XXRA 2B3FA 5H8SA 5CBNA 3DM0A 3RPWA 4GODA 3SKPA 1MG1A 2HXWA 3O66A 4FE8A 3OXNA 1FW0A 3N6TA 1ZU0A 4RPNA 1D9YA 2F35A 4JSOA 4PFTA 2DP8A 3MQ9A 5TP9B 3K02A 3CRBA 4DCYA 4XKPA 3MVYA 3R26A 1B46A 3EQ1A 2F36A 3ILUB 1B9JA 3IORA 4KFQA 3VFJA 3HV1A 4JWXA 1BDCA 2F5XA 3PPOA 5HBCA 1URDA 3RN8A 1MQJA 1EZOA 3TKDA 3K4UA 1SW5A 4GF8A 2IEEA 3KBRA 4MFIA 2XD2A 3LSXA 1B3GA 4NE4A 5AA4A 4GOFA 3SEUA 3TUSA 4G2ZA 3KN3A 3FD3A 4F3SA 3V5AA 4ZEFA 3K6XA 4FATA 4DXCA 3W9VA 5CBSA 2QJEA 1B4HA 3TCHA 2HQ0A 4NF6B 5L9OA 4NPDA 4ZEIA 4GVOA 1LT1A 4DE8A 4I62A 3C32A 5AE4A 1NH8A 4QFNA 4TLLB 3VVDA 1JW5A 4R2FA 5CC2A 2RCBA 1VFDA 4IGRA 2I48A 3K00A 4OYVA 2F78A 1FTOA 1T0KA 1Y3NA 1B3LA 3TTRA 3D4GA 4DDDA 2DYXA 1IUDA 1NFTA 2OLBA 3FV1A 4XKRA 4R6YA 1DPEA 4GFRA 1QW0A 4LONB 3H06B 4NPEA 1LFGA 3OMBA 3FV2A 3F11A 3QWOC 1B3FA 4OFLA 1SDXA 3LR1A 1AMFA 5EFWB 3P7IA 3IK6B 4E0WA 2E0SA 3USDA 2I8DA 5AA2A 1Y1ZA 3E9XA 1JW1A 5CMCA 1A8FA 3IB1A 2F7BA 4GXAA 4K3AA 2XX9A 2QS4A 3IO4A 3O6IA 3UIFA 3MWBA 4GLIA 3RQTA 1MY2A 3S9MC 2R71A 2Q2CA 2H25A 3SEXA 3FXUA 2G29A 2M0BA 3K6WA 5TPAA 1DPPA 5H8FB 1OIBA 1R9QA 1IXHA 4EQ7A 3PMVA 4PETA 5CRYA 5CBRA 4EF1A 2Y7PA 3D4CA 5TU0A 4G68A 2LXCB 1CB6A 1M5BA 4WKMA 3IB2A 2LAOA 2FNCA 3RGYA 2M5AB 3CG1A 1LAFE 1Q1KA 4N07A 4X9TA 4F1YA 1H43A 5FTIA 5FHNA 3C36A 1HSEA 5AA3A 2Y7IA 3G3GA 4OZ9A 4PQJA 3TQLA 1Q35A 3FUZA 1SS1A 1D9VA 1MDQA 4R2BA 3PD9A 1MPDA 5FHOA 2VP1A 4OENA 3ZSFA 1DOTA 4DXBA 3RT6B 1GVCA 2QRXA 3FVNA 4LA9A 2D3IA 1II5A 2OCUA 2Z8FA 2XXTA 4RY1A 2FYIA 5CMBA 4OMBA 4OWDA 3SESA 1QUKA 2WMMA 2ZNUA 5DEXB 3FVOA 3FXQA 2QSXA 3PUYE 1Q2NA 1Y3PA 3VXCA 4E0XA 5J1DA 1P1UA 1R9LA 2Y7RA 2HZKA 3N6UA 1MXZA 4YICA 1DTZA 1OQHA 1Y4CA 2CMOA 4QFKA 3PPNA 2DSFA 4OERA 3N26A 2HAUA 5L9SA 3FZVA 4HB1A 3RGUA 3ZDMA 2IA4A 3B7DA 2GHAA 4FEBA 2W7YA 4G8HA 3TAJA 4IO6A 1LP1A 1IIWA 1I6BA 1OLAA 2AYSA 3Q26A 4PE5B 2HAVA 5HM4B 2XXIA 4HKZH 3FJMA 3TCGA 4O3AA 2ZMBA 3GXAA 4MLQA 2NUVA 4RPOA 1S9TA 5K5GB 5I2KA 1KWHA 4M4GA 3IOWA 1RYOA 3MBPA 5CBOA 1SBPA 4Q8RA 3LSWA 5ITOA 1M5DA 1DTGA 3U72A 1DSNA 2I0CA 4P11A 1S7YA 3K6UA 4DLDA 2XXXA 1VSOA 4C1UA 2H9BA 3CIJA 1MY0A 1BDDA 2RKMA 2Q88A 4R9FA 2F8DA 2DVZA 1XC1A 4U22A 5H8HB 2LR2A 1MPCA 2E1SA 1FQDA 3MVXA 2OK2A 4LVQA 1WDNA 4EQBA 1SVXB 3G3KA 1B4ZA 4TOZA 3IOTA 1MQHA 4ECFA 1EDJA 3SDFA 3U92A 3KN7A 1URSA 4GOEA 3V8XB 3QSLA 1XS5A 2AL5A 4ELQA 3QXMA 2DXRA 3BFUA 3QIMA 4WXJA 3GLBA 2QPQA 4ZS9A 4N6PA 4ELRA 3DLNA 2KIKA 5I58A 4F39A 5I56A 3MJNA 1RKMA 2PT1A 2HEUA 1B51A 4ESWA 3HO7A 2DXYA 3G7WA 3G3HA 3RUMA 3IOVA 2V93A 4P0GA 3TCFA 3WAEA 4XKNA 1JNFA 3N94A 1H45A 1UIVA 5CMMA 4KCDA 1LAGE 4FAJA 3MZBA 3RTWB 4NF8A 4YB6A 3CSBA 2I58A 4PFWA 2A5TA 1JETA 4FJPA 4GRKA 4R73A 4WWIA 2VGQA 4KD5A 4AB5A 2KI7B 3FXRA 3FJ7A 3H6UA 1LBCA 2H5YA 1H0TB 2RF1A 1YCJA 1H44A 2I4BA 1MXUA 1NVOA 1S3JA 1M5EA 5I84A 3CG3A 2PMSA 3U8QA 4RK9A 1SI1A 1JMBA 2UYFA 4IOIH 2G93A 2FA7A 1B7HA 2NOOA 3PUVE 3KOTA 1LCFA 3O28A 1PB8A 1B58A 3QK6A 3Q29A 1MDP1 3Q25A 4HCYA 1IEJA 3MPLA 3FGSA 3TDJA 1AIVA 2O7UA 5EHMA 1LGBC 3K0VA 3UN6A 3IAZA 5I57B 1QVSA 2I49A 3I6VA 4F2OA 3MZ1A 4QHQA 2O84X 4MH5A 1ZLQA 5ISUA 4ASVA 5A5XB 3UGWA 4ZMDA 2PX1A 1WODA 4O3BA 4QF9A 1QUJA 2OWSA 2M8CA 1ZW0A 2HFBA 3FVGA 2THIA 3SEWA 2F7CA 1HSJA 4YKJA 2OZZA 3ILTB 1BIYA 2F97A 1URGA 1Y4TA 3GBBA 4NPFX 5ELVA 2XXUA 2B3BA 4R9GA 5JTYA 4BDQA 3OEMA 4K35A 3HCQA 2DQVA 5I2NB 4OETA 1BP5A 2P0SA 3MP8A 1R1NA 4Q5TA 1A54A 1UIUA 1LB9A 4I1DA 1FTLA 2PT2A 2B87A 4G8MA 4U1OA 2ABHA 3MP6A 2V3QA 2ONKE 4MBPA 3L6GA 4F3PA 1TFAA 3TYHA 3FXDA 4ONYA 3O6GA 3KJTA 4YMBA 4BDOA 1A55A 1OLCA 4G4PA 3GZGA 5F7VA 4HTGA 5DJUB 4C1TA 1UTHB 4F1UA 1FQBA 1XT8A 2REGA 3WAFA 5KCJA 4BXLA 4Z0IA 1B32A 5K2YA 1SD3A 4LZ8A 3S9EA 1I69A 3TTMA 3LC8A 2F6GA 4G8NA 3VLUA 2ZYNA 4NF5A 2DOJA 4M1VA 3A3UA 4GXSB 2RKLA 1MPBA 1DEEG 4NMYA 2CZLA 4H65A 3W9WA 3IOUA 3AXFA 2DVCA 3KEIA 4KCCA 2LXBA 4LQ5A 1ELJA 4ELOA 2I4CA 2AIXA 4NWDA 4THIA 5H8QA 1IXGA 1GTKA 1EC5A 1US4A 4F2QA 3OO8A 3HPIA 1CE2A 1PDAA 5FHMA 4YKPA 1UQWA 3BKIB 4QSCA 1BLFA 3CFZA 4G68C 4OEVA 4GD5A 1B6HA 2VD2A 3LBSA 3EF7A 4F29A 3KOSA 1MY4A 3OSRA 4OQOA 3MC2A 4IB2A 3HSTA 4KJMA 1POTA 1SW2A 3R7XA 4RK2A 3MHVA 4N13A 3U94A 1AL3A 4H0WA 2A5TB 5KDTB 3I3VA 2Q8JA 1B1XA 1I6QA 1PBPA 4EUOA 3TPAA 1N04A 1N7WA 1P1NA 4X1DA 1P1WA 3M3FA 3IB0A 4H67A 5DT6A 1A40A 3QAXA 1US5A 2UVIA 3CVGA 3MVWA 1VE4A 1B52A 5I59B 1IZ1A 1U7JA 3MVZA 2O1MA 2DWHA 2WKYA 3PUWE 3OD7A 4POWA 2ESNA 2Z22A 1IXCA 3T96B 1WVJA 1OMPA 1LCTA 3IL1B 2O6AA 1LBBA 1EZPA 3VLWA 2ANJA 1EH3A 4PFYA 3LSLA 5AA1A 3BBRA 1GV8A 2DE2A 1TWYA 4YB7A 2NWJA 1MS7A 4ZZEA 3MAMA 1A99A 3E4RA 3B6QA 2X26A 4KI0E 2F34A 3KSXA 4LZ7A 2B89A 3H6TA 2Z8EA 3B6WA 1A8EA 2Y7KA 2SPZA 5K2XA 4QRZA 2D5WA 4QFLA 4FECA 2O1LA 1B05A 3S9NC 1GR2A 2XXVA 1O7TA 3PV0E 2XXYA 3OO6A 1XVYA 4YB5A 3VE1B 4BDRA 3VLVA 1SW4A 1O63A 1N3WA 2GFEA 4XIGQ 5AA2D 4IO4A 2H4IA 1B3EA 1MY1A 1TFDA 5TP9A 3C35A 2BJJX 2OWTA 2A5SA 1ZKBA 4DIGA 4QSEA 3THIA 5AA4B 4CPGA 3IJXB 4H6DA 4ISUA 2ZAEB 3O29A 4JXIA 4ZEBA 2ZXTA 3PU5A 4OESA 1SYHA 3SETA 4LP2B 3MPKA 4U21A 2X7PA 2XXQA 4OHNA 1P99A 2DWAA 1ANFA 2RCAA 4ASWA 1IITA 2R6GE 3H03A 3U93A 2OBGA 2V25A 3TODA 3RT8A 2KLFA 1Y3QA 1TXFA 3HN0A 5H8NA 3EHSA 2B88A 3H4ZA 3VV5A 4OVJA 4H1XA 3JYRA 1H76A 3VVEA 3OO7A 3TEPA 3EHUA 1FCKA 2DWJA 4IY5A 1Y20A 2Y84A 4YMAA 2KUBA 4KHZE 1QKAA 5DTBA 5CMKA 3G3FA 4NF6A 4GQOA 3KFMA 4BDLA 3OOAA 1M5FA 2Z8DA 4PFUA 2D21A 3MW0A 4IO5A 1N3XA 3U1OA 3GBAA 2P2AA 2GHBA 3LUYA 4H8JA 3V89B 1FQCA 1O64A 4NTLA 3JZJA 3DP4A 4EXLA 1LSTA 1D4NA 3EPEA 3K1NA 1A7LA 5BWJA 5H8QB 1AH5A 2RC7A 3C9HA 5AA2B 1NNPA 2GRVA 2YLNA 1LFIA 1N7XA 2VOZA 3FATA 5LOMA 4HCWA 4RNSA 5TPAB 2V3TA 2Q89A 3TTKA 1JEUA 3CI8A 4OFJA 3TZAA 4AB6A 1B5IA 3C31A 4X48A 2V84A 4QSDA 3OEKA 4MLVA 1B3HA 3PMWA 3FXEA 4ESXA 1MXWA 3C34A 2ALUA 4G68B 5CM6A 2XXHA 1HSLA 4JDFA 1OVUA 5B70A 4NF4A 4XKQA 2Q9TA 1EDKA 2ONRA 1P1QA 4JWOA 2Y7WA 4FORA 5H8FA 2HCAA 1YAEA 1I6AA 2UXAA 4H5FA 3W15C 4F1VA 3TMGA 3L6HA 2XHDA 1B7ZA 1EU8A 4LATA 3S4UA 1FTMA 4HW8A 3K6VA 2HR3A 3I5OA 2M5AA 4RA1A 2AL4A 1JW4A 1EZ9A 5CI5A 4YKIA 5L8DA 1MXVA 3UORA 4K3FA 4R6KA 2P58A 1U7MA 3HHFA 3OSQA 4NEDA 1ZXGA 3T9UA 3H7MA 3K1PA 4EYYQ 2F7AA 3RLFE 5ICQA 3EHTA 2X7QA 3ZKKA 2OJTA 2KZJA 2Q2AA 3QUJA 1SW1A 5DYHA 3LSFB 2QL3A 3SERA 1ZMGA 4POXA 1JM0A 4R6HA 5DEXA 1F9BA 3TTLA 4ND9A 3CR9A 4U4XA 2ZYMA 2PYYA 1TT1A 2P1SA 3KGCA 1NH7A 2YJPA 3ZKLA 1LP1B 1MH3A 4ZZAA 3DELB 4BDNA 1PBQA 2I0BA 1ATGA 3VDFA 2RC9A 4U23A 4UA8A 1Z7ME 4YZZA 5H8NB 5I2KB 4MN4C 1H3DA 2Q1KA 1NL5A 3ONMA 5BUUA 4ZE8A 1PC3A 1SYIA 3CFLA 3VXBA 4WEPA 1VR5A 4DXUA 5B7DA 3OO9A 4Z7EA 4JWYA 3IO6A 1OVVA 3UA8A 5ICTA 3CFXA 1FQFA 3IJOB 4GIZA 3C4MA 3A3CA 3PMXA 4YU0A 3S2VA 3K01A 4EDPA 2RC8A 2UVJA 5DVFA 4I8CA 3JV9A 3FVKA 4LUBA 1FTKA 1JVXA 2QS2A 2O51A 4F3GA 4EF2A 2PBWA 2XD3A 1EDLA 3H3GA 3E3KA 1MM6A 3O97A 3BFTA 5EHSA 4FIMA 3ECRA 3T93B 3Q27A 1ZBMA 4UACA 3T22A 2DS9A 1JVYA 5H8HA 5I58B 4IO2A 2ZNTA 4KYSA 1B5HA 5I56B 5IAIA 4EXKA 2O68A 1ZJLA 4KQPA 3G3JA 2QS1A 2GH9A 1MH4A 4DZ1A 4U2RA 4GWOA 4O3CA 2ONSA 2YPNA 1MQGA 1FC2C 1OVRA 3B6TA 3T9XB 4NWCA 1N84A 1SI0A 3PPRA 2QS3A 2OTKE 2XXWA 4F31B 4WEDA 4XTCQ 4NF4B 1N76A 3H6VA 4LZ5A 1VFEA 3MZ9A 4F19A 1B0HA 3O9PA 4NF8B 3FASA 4KYEA 2H98A 2KZIA 1POY1 5F1QA 2QMWA 5M2VA 5C39A 2UWJE 1B2HA 2R9JA 1QJMA 1RYXA 4JBZA 5EYFA 1MY3A 1LB8A 3M3KA 3O2AA 4R72A 4YKKA 5JK4A 3PH0A 3RTFB 5DVJA 3ZS6A 3KZGA 4Q30B 4H8IA 3HHGA 4OFOA 4G77A 5L9MA 3KG2A 3EN3A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H6W A;  3PGF A;  2B65 A;  3MZW B;  2KS1 B;  4EQ9 A;  1UTB A;  1H0T A;  1IQ7 A;  4U4S A;  1MXX A;  2I6E A;  4TQU Q;  3ODB A;  1FQA A;  3TTN A;  2UYE A;  2QMX A;  2ZYO A;  1MQI A;  1PEB A;  1J1N A;  3C33 A;  3UP9 A;  2ZNS A;  3PUX E;  4DCX A;  3S1K A;  3RNN A;  2NVU B;  2REJ A;  1B0L A;  1ZTY A;  3K2D A;  1NNT A;  4F3B A;  1USY E;  4ZE9 A;  5I57 A;  5DJT B;  1YTV A;  4LQ2 A;  1B5J A;  4JB7 A;  4C0R A;  1NNF A;  1IXI A;  2O7I A;  3PD8 A;  5JTY B;  5A5X A;  1S50 A;  3MP1 A;  2DE4 A;  4PP0 A;  3UK4 A;  3E13 X;  4IO7 A;  1EDI A;  2DWI A;  2ZYK A;  3M8U A;  1MFT A;  3TQW A;  4OEU A;  1L5T A;  3PUZ E;  3K1M A;  2B87 B;  2Z23 A;  4GL0 A;  4GOT A;  3OEN A;  3MUQ A;  5HPQ A;  3A09 A;  4F18 A;  4Q0C A;  3O6H A;  1NNK A;  4JSD A;  4R74 A;  4X1B A;  4ZNC A;  1QUL A;  5I2N A;  1GGG A;  1MXY A;  1BTJ A;  4HS7 A;  1LAX A;  1QKB A;  1DMB A;  1Y1M A;  4ELP A;  2HZL A;  4RYA A;  5KCJ B;  4XXU A;  3S9L C;  4IY6 A;  1AOV A;  3R6U A;  2DE3 A;  1XOC A;  2V3U A;  3OEL A;  5IKB A;  5DVI A;  4IGT A;  1MM7 A;  1B40 A;  5JEI A;  4NF5 B;  1PB9 A;  2UVG A;  4KR5 A;  4KYD A;  4RJZ A;  1ZIU A;  2XX8 A;  3PPP A;  1Y47 A;  1PB7 A;  3RY3 A;  1XVX A;  1YPN A;  1FTJ A;  3FJG A;  1UTH A;  2F6P A;  1OVT A;  4OTE A;  4U1Z A;  1MQD A;  1JQF A;  1D3K A;  4ZEC A;  1Y9U A;  2NXO A;  4ZEK A;  4P0I A;  2O69 A;  4HJG H;  2VHA A;  2I3V A;  3QYT A;  2XX7 A;  3CSG A;  3IR1 A;  3G3I A;  3TFL A;  1OVB A;  4H5G A;  2K3R A;  3DP8 A;  3KSJ A;  3DP6 A;  5KZT A;  4L17 A;  3TEL A;  2I3W A;  3SEY A;  3QUF A;  4RXL A;  1Z7N E;  2RIN A;  1QUI A;  4GL8 A;  1B1H A;  1SQY A;  3VVF A;  1LAH E;  3N5L A;  3M3L A;  1FQE A;  1OQG A;  2UVH A;  4TLM B;  3SEV A;  4MF3 A;  2PVU A;  2QVA A;  2R44 A;  4BDM A;  2QRY A;  1NKX A;  3KN8 A;  2JWD A;  1BKA A;  1M5C A;  4IO3 A;  1XHY A;  2VD3 A;  4QFP A;  1R6Z A;  3FIR A;  2H99 A;  4FED A;  1USY H;  3T9H B;  3IX1 A;  4YAH X;  1X0T A;  4R75 A;  4ZED A;  4OXV A;  1MRP A;  3V83 A;  1LFH A;  4AQ4 A;  4ZDM A;  5KDT A;  4F22 A;  3Q28 A;  4BLA A;  5FTH A;  2XXP A;  1LLS A;  1N0T A;  3KJ7 A;  3PPQ A;  1NMU A;  1P1O A;  1JEV A;  3T9V A;  1B7U A;  4KPT A;  3T66 A;  4QFO A;  5ITP A;  1UTB B;  4I9D A;  5I59 A;  2XXR A;  2B3F A;  5H8S A;  5CBN A;  3DM0 A;  3RPW A;  4GOD A;  3SKP A;  1MG1 A;  2HXW A;  3O66 A;  4FE8 A;  3OXN A;  1FW0 A;  3N6T A;  1ZU0 A;  4RPN A;  1D9Y A;  2F35 A;  4JSO A;  4PFT A;  2DP8 A;  3MQ9 A;  5TP9 B;  3K02 A;  3CRB A;  4DCY A;  4XKP A;  3MVY A;  3R26 A;  1B46 A;  3EQ1 A;  2F36 A;  3ILU B;  1B9J A;  3IOR A;  4KFQ A;  3VFJ A;  3HV1 A;  4JWX A;  1BDC A;  2F5X A;  3PPO A;  5HBC A;  1URD A;  3RN8 A;  1MQJ A;  1EZO A;  3TKD A;  3K4U A;  1SW5 A;  4GF8 A;  2IEE A;  3KBR A;  4MFI A;  2XD2 A;  3LSX A;  1B3G A;  4NE4 A;  5AA4 A;  4GOF A;  3SEU A;  3TUS A;  4G2Z A;  3KN3 A;  3FD3 A;  4F3S A;  3V5A A;  4ZEF A;  3K6X A;  4FAT A;  4DXC A;  3W9V A;  5CBS A;  2QJE A;  1B4H A;  3TCH A;  2HQ0 A;  4NF6 B;  5L9O A;  4NPD A;  4ZEI A;  4GVO A;  1LT1 A;  4DE8 A;  4I62 A;  3C32 A;  5AE4 A;  1NH8 A;  4QFN A;  4TLL B;  3VVD A;  1JW5 A;  4R2F A;  5CC2 A;  2RCB A;  1VFD A;  4IGR A;  2I48 A;  3K00 A;  4OYV A;  2F78 A;  1FTO A;  1T0K A;  1Y3N A;  1B3L A;  3TTR A;  3D4G A;  4DDD A;  2DYX A;  1IUD A;  1NFT A;  2OLB A;  3FV1 A;  4XKR A;  4R6Y A;  1DPE A;  4GFR A;  1QW0 A;  4LON B;  3H06 B;  4NPE A;  1LFG A;  3OMB A;  3FV2 A;  3F11 A;  3QWO C;  1B3F A;  4OFL A;  1SDX A;  3LR1 A;  1AMF A;  5EFW B;  3P7I A;  3IK6 B;  4E0W A;  2E0S A;  3USD A;  2I8D A;  5AA2 A;  1Y1Z A;  3E9X A;  1JW1 A;  5CMC A;  1A8F A;  3IB1 A;  2F7B A;  4GXA A;  4K3A A;  2XX9 A;  2QS4 A;  3IO4 A;  3O6I A;  3UIF A;  3MWB A;  4GLI A;  3RQT A;  1MY2 A;  3S9M C;  2R71 A;  2Q2C A;  2H25 A;  3SEX A;  3FXU A;  2G29 A;  2M0B A;  3K6W A;  5TPA A;  1DPP A;  5H8F B;  1OIB A;  1R9Q A;  1IXH A;  4EQ7 A;  3PMV A;  4PET A;  5CRY A;  5CBR A;  4EF1 A;  2Y7P A;  3D4C A;  5TU0 A;  4G68 A;  2LXC B;  1CB6 A;  1M5B A;  4WKM A;  3IB2 A;  2LAO A;  2FNC A;  3RGY A;  2M5A B;  3CG1 A;  1LAF E;  1Q1K A;  4N07 A;  4X9T A;  4F1Y A;  1H43 A;  5FTI A;  5FHN A;  3C36 A;  1HSE A;  5AA3 A;  2Y7I A;  3G3G A;  4OZ9 A;  4PQJ A;  3TQL A;  1Q35 A;  3FUZ A;  1SS1 A;  1D9V A;  1MDQ A;  4R2B A;  3PD9 A;  1MPD A;  5FHO A;  2VP1 A;  4OEN A;  3ZSF A;  1DOT A;  4DXB A;  3RT6 B;  1GVC A;  2QRX A;  3FVN A;  4LA9 A;  2D3I A;  1II5 A;  2OCU A;  2Z8F A;  2XXT A;  4RY1 A;  2FYI A;  5CMB A;  4OMB A;  4OWD A;  3SES A;  1QUK A;  2WMM A;  2ZNU A;  5DEX B;  3FVO A;  3FXQ A;  2QSX A;  3PUY E;  1Q2N A;  1Y3P A;  3VXC A;  4E0X A;  5J1D A;  1P1U A;  1R9L A;  2Y7R A;  2HZK A;  3N6U A;  1MXZ A;  4YIC A;  1DTZ A;  1OQH A;  1Y4C A;  2CMO A;  4QFK A;  3PPN A;  2DSF A;  4OER A;  3N26 A;  2HAU A;  5L9S A;  3FZV A;  4HB1 A;  3RGU A;  3ZDM A;  2IA4 A;  3B7D A;  2GHA A;  4FEB A;  2W7Y A;  4G8H A;  3TAJ A;  4IO6 A;  1LP1 A;  1IIW A;  1I6B A;  1OLA A;  2AYS A;  3Q26 A;  4PE5 B;  2HAV A;  5HM4 B;  2XXI A;  4HKZ H;  3FJM A;  3TCG A;  4O3A A;  2ZMB A;  3GXA A;  4MLQ A;  2NUV A;  4RPO A;  1S9T A;  5K5G B;  5I2K A;  1KWH A;  4M4G A;  3IOW A;  1RYO A;  3MBP A;  5CBO A;  1SBP A;  4Q8R A;  3LSW A;  5ITO A;  1M5D A;  1DTG A;  3U72 A;  1DSN A;  2I0C A;  4P11 A;  1S7Y A;  3K6U A;  4DLD A;  2XXX A;  1VSO A;  4C1U A;  2H9B A;  3CIJ A;  1MY0 A;  1BDD A;  2RKM A;  2Q88 A;  4R9F A;  2F8D A;  2DVZ A;  1XC1 A;  4U22 A;  5H8H B;  2LR2 A;  1MPC A;  2E1S A;  1FQD A;  3MVX A;  2OK2 A;  4LVQ A;  1WDN A;  4EQB A;  1SVX B;  3G3K A;  1B4Z A;  4TOZ A;  3IOT A;  1MQH A;  4ECF A;  1EDJ A;  3SDF A;  3U92 A;  3KN7 A;  1URS A;  4GOE A;  3V8X B;  3QSL A;  1XS5 A;  2AL5 A;  4ELQ A;  3QXM A;  2DXR A;  3BFU A;  3QIM A;  4WXJ A;  3GLB A;  2QPQ A;  4ZS9 A;  4N6P A;  4ELR A;  3DLN A;  2KIK A;  5I58 A;  4F39 A;  5I56 A;  3MJN A;  1RKM A;  2PT1 A;  2HEU A;  1B51 A;  4ESW A;  3HO7 A;  2DXY A;  3G7W A;  3G3H A;  3RUM A;  3IOV A;  2V93 A;  4P0G A;  3TCF A;  3WAE A;  4XKN A;  1JNF A;  3N94 A;  1H45 A;  1UIV A;  5CMM A;  4KCD A;  1LAG E;  4FAJ A;  3MZB A;  3RTW B;  4NF8 A;  4YB6 A;  3CSB A;  2I58 A;  4PFW A;  2A5T A;  1JET A;  4FJP A;  4GRK A;  4R73 A;  4WWI A;  2VGQ A;  4KD5 A;  4AB5 A;  2KI7 B;  3FXR A;  3FJ7 A;  3H6U A;  1LBC A;  2H5Y A;  1H0T B;  2RF1 A;  1YCJ A;  1H44 A;  2I4B A;  1MXU A;  1NVO A;  1S3J A;  1M5E A;  5I84 A;  3CG3 A;  2PMS A;  3U8Q A;  4RK9 A;  1SI1 A;  1JMB A;  2UYF A;  4IOI H;  2G93 A;  2FA7 A;  1B7H A;  2NOO A;  3PUV E;  3KOT A;  1LCF A;  3O28 A;  1PB8 A;  1B58 A;  3QK6 A;  3Q29 A;  1MDP 1;  3Q25 A;  4HCY A;  1IEJ A;  3MPL A;  3FGS A;  3TDJ A;  1AIV A;  2O7U A;  5EHM A;  1LGB C;  3K0V A;  3UN6 A;  3IAZ A;  5I57 B;  1QVS A;  2I49 A;  3I6V A;  4F2O A;  3MZ1 A;  4QHQ A;  2O84 X;  4MH5 A;  1ZLQ A;  5ISU A;  4ASV A;  5A5X B;  3UGW A;  4ZMD A;  2PX1 A;  1WOD A;  4O3B A;  4QF9 A;  1QUJ A;  2OWS A;  2M8C A;  1ZW0 A;  2HFB A;  3FVG A;  2THI A;  3SEW A;  2F7C A;  1HSJ A;  4YKJ A;  2OZZ A;  3ILT B;  1BIY A;  2F97 A;  1URG A;  1Y4T A;  3GBB A;  4NPF X;  5ELV A;  2XXU A;  2B3B A;  4R9G A;  5JTY A;  4BDQ A;  3OEM A;  4K35 A;  3HCQ A;  2DQV A;  5I2N B;  4OET A;  1BP5 A;  2P0S A;  3MP8 A;  1R1N A;  4Q5T A;  1A54 A;  1UIU A;  1LB9 A;  4I1D A;  1FTL A;  2PT2 A;  2B87 A;  4G8M A;  4U1O A;  2ABH A;  3MP6 A;  2V3Q A;  2ONK E;  4MBP A;  3L6G A;  4F3P A;  1TFA A;  3TYH A;  3FXD A;  4ONY A;  3O6G A;  3KJT A;  4YMB A;  4BDO A;  1A55 A;  1OLC A;  4G4P A;  3GZG A;  5F7V A;  4HTG A;  5DJU B;  4C1T A;  1UTH B;  4F1U A;  1FQB A;  1XT8 A;  2REG A;  3WAF A;  5KCJ A;  4BXL A;  4Z0I A;  1B32 A;  5K2Y A;  1SD3 A;  4LZ8 A;  3S9E A;  1I69 A;  3TTM A;  3LC8 A;  2F6G A;  4G8N A;  3VLU A;  2ZYN A;  4NF5 A;  2DOJ A;  4M1V A;  3A3U A;  4GXS B;  2RKL A;  1MPB A;  1DEE G;  4NMY A;  2CZL A;  4H65 A;  3W9W A;  3IOU A;  3AXF A;  2DVC A;  3KEI A;  4KCC A;  2LXB A;  4LQ5 A;  1ELJ A;  4ELO A;  2I4C A;  2AIX A;  4NWD A;  4THI A;  5H8Q A;  1IXG A;  1GTK A;  1EC5 A;  1US4 A;  4F2Q A;  3OO8 A;  3HPI A;  1CE2 A;  1PDA A;  5FHM A;  4YKP A;  1UQW A;  3BKI B;  4QSC A;  1BLF A;  3CFZ A;  4G68 C;  4OEV A;  4GD5 A;  1B6H A;  2VD2 A;  3LBS A;  3EF7 A;  4F29 A;  3KOS A;  1MY4 A;  3OSR A;  4OQO A;  3MC2 A;  4IB2 A;  3HST A;  4KJM A;  1POT A;  1SW2 A;  3R7X A;  4RK2 A;  3MHV A;  4N13 A;  3U94 A;  1AL3 A;  4H0W A;  2A5T B;  5KDT B;  3I3V A;  2Q8J A;  1B1X A;  1I6Q A;  1PBP A;  4EUO A;  3TPA A;  1N04 A;  1N7W A;  1P1N A;  4X1D A;  1P1W A;  3M3F A;  3IB0 A;  4H67 A;  5DT6 A;  1A40 A;  3QAX A;  1US5 A;  2UVI A;  3CVG A;  3MVW A;  1VE4 A;  1B52 A;  5I59 B;  1IZ1 A;  1U7J A;  3MVZ A;  2O1M A;  2DWH A;  2WKY A;  3PUW E;  3OD7 A;  4POW A;  2ESN A;  2Z22 A;  1IXC A;  3T96 B;  1WVJ A;  1OMP A;  1LCT A;  3IL1 B;  2O6A A;  1LBB A;  1EZP A;  3VLW A;  2ANJ A;  1EH3 A;  4PFY A;  3LSL A;  5AA1 A;  3BBR A;  1GV8 A;  2DE2 A;  1TWY A;  4YB7 A;  2NWJ A;  1MS7 A;  4ZZE A;  3MAM A;  1A99 A;  3E4R A;  3B6Q A;  2X26 A;  4KI0 E;  2F34 A;  3KSX A;  4LZ7 A;  2B89 A;  3H6T A;  2Z8E A;  3B6W A;  1A8E A;  2Y7K A;  2SPZ A;  5K2X A;  4QRZ A;  2D5W A;  4QFL A;  4FEC A;  2O1L A;  1B05 A;  3S9N C;  1GR2 A;  2XXV A;  1O7T A;  3PV0 E;  2XXY A;  3OO6 A;  1XVY A;  4YB5 A;  3VE1 B;  4BDR A;  3VLV A;  1SW4 A;  1O63 A;  1N3W A;  2GFE A;  4XIG Q;  5AA2 D;  4IO4 A;  2H4I A;  1B3E A;  1MY1 A;  1TFD A;  5TP9 A;  3C35 A;  2BJJ X;  2OWT A;  2A5S A;  1ZKB A;  4DIG A;  4QSE A;  3THI A;  5AA4 B;  4CPG A;  3IJX B;  4H6D A;  4ISU A;  2ZAE B;  3O29 A;  4JXI A;  4ZEB A;  2ZXT A;  3PU5 A;  4OES A;  1SYH A;  3SET A;  4LP2 B;  3MPK A;  4U21 A;  2X7P A;  2XXQ A;  4OHN A;  1P99 A;  2DWA A;  1ANF A;  2RCA A;  4ASW A;  1IIT A;  2R6G E;  3H03 A;  3U93 A;  2OBG A;  2V25 A;  3TOD A;  3RT8 A;  2KLF A;  1Y3Q A;  1TXF A;  3HN0 A;  5H8N A;  3EHS A;  2B88 A;  3H4Z A;  3VV5 A;  4OVJ A;  4H1X A;  3JYR A;  1H76 A;  3VVE A;  3OO7 A;  3TEP A;  3EHU A;  1FCK A;  2DWJ A;  4IY5 A;  1Y20 A;  2Y84 A;  4YMA A;  2KUB A;  4KHZ E;  1QKA A;  5DTB A;  5CMK A;  3G3F A;  4NF6 A;  4GQO A;  3KFM A;  4BDL A;  3OOA A;  1M5F A;  2Z8D A;  4PFU A;  2D21 A;  3MW0 A;  4IO5 A;  1N3X A;  3U1O A;  3GBA A;  2P2A A;  2GHB A;  3LUY A;  4H8J A;  3V89 B;  1FQC A;  1O64 A;  4NTL A;  3JZJ A;  3DP4 A;  4EXL A;  1LST A;  1D4N A;  3EPE A;  3K1N A;  1A7L A;  5BWJ A;  5H8Q B;  1AH5 A;  2RC7 A;  3C9H A;  5AA2 B;  1NNP A;  2GRV A;  2YLN A;  1LFI A;  1N7X A;  2VOZ A;  3FAT A;  5LOM A;  4HCW A;  4RNS A;  5TPA B;  2V3T A;  2Q89 A;  3TTK A;  1JEU A;  3CI8 A;  4OFJ A;  3TZA A;  4AB6 A;  1B5I A;  3C31 A;  4X48 A;  2V84 A;  4QSD A;  3OEK A;  4MLV A;  1B3H A;  3PMW A;  3FXE A;  4ESX A;  1MXW A;  3C34 A;  2ALU A;  4G68 B;  5CM6 A;  2XXH A;  1HSL A;  4JDF A;  1OVU A;  5B70 A;  4NF4 A;  4XKQ A;  2Q9T A;  1EDK A;  2ONR A;  1P1Q A;  4JWO A;  2Y7W A;  4FOR A;  5H8F A;  2HCA A;  1YAE A;  1I6A A;  2UXA A;  4H5F A;  3W15 C;  4F1V A;  3TMG A;  3L6H A;  2XHD A;  1B7Z A;  1EU8 A;  4LAT A;  3S4U A;  1FTM A;  4HW8 A;  3K6V A;  2HR3 A;  3I5O A;  2M5A A;  4RA1 A;  2AL4 A;  1JW4 A;  1EZ9 A;  5CI5 A;  4YKI A;  5L8D A;  1MXV A;  3UOR A;  4K3F A;  4R6K A;  2P58 A;  1U7M A;  3HHF A;  3OSQ A;  4NED A;  1ZXG A;  3T9U A;  3H7M A;  3K1P A;  4EYY Q;  2F7A A;  3RLF E;  5ICQ A;  3EHT A;  2X7Q A;  3ZKK A;  2OJT A;  2KZJ A;  2Q2A A;  3QUJ A;  1SW1 A;  5DYH A;  3LSF B;  2QL3 A;  3SER A;  1ZMG A;  4POX A;  1JM0 A;  4R6H A;  5DEX A;  1F9B A;  3TTL A;  4ND9 A;  3CR9 A;  4U4X A;  2ZYM A;  2PYY A;  1TT1 A;  2P1S A;  3KGC A;  1NH7 A;  2YJP A;  3ZKL A;  1LP1 B;  1MH3 A;  4ZZA A;  3DEL B;  4BDN A;  1PBQ A;  2I0B A;  1ATG A;  3VDF A;  2RC9 A;  4U23 A;  4UA8 A;  1Z7M E;  4YZZ A;  5H8N B;  5I2K B;  4MN4 C;  1H3D A;  2Q1K A;  1NL5 A;  3ONM A;  5BUU A;  4ZE8 A;  1PC3 A;  1SYI A;  3CFL A;  3VXB A;  4WEP A;  1VR5 A;  4DXU A;  5B7D A;  3OO9 A;  4Z7E A;  4JWY A;  3IO6 A;  1OVV A;  3UA8 A;  5ICT A;  3CFX A;  1FQF A;  3IJO B;  4GIZ A;  3C4M A;  3A3C A;  3PMX A;  4YU0 A;  3S2V A;  3K01 A;  4EDP A;  2RC8 A;  2UVJ A;  5DVF A;  4I8C A;  3JV9 A;  3FVK A;  4LUB A;  1FTK A;  1JVX A;  2QS2 A;  2O51 A;  4F3G A;  4EF2 A;  2PBW A;  2XD3 A;  1EDL A;  3H3G A;  3E3K A;  1MM6 A;  3O97 A;  3BFT A;  5EHS A;  4FIM A;  3ECR A;  3T93 B;  3Q27 A;  1ZBM A;  4UAC A;  3T22 A;  2DS9 A;  1JVY A;  5H8H A;  5I58 B;  4IO2 A;  2ZNT A;  4KYS A;  1B5H A;  5I56 B;  5IAI A;  4EXK A;  2O68 A;  1ZJL A;  4KQP A;  3G3J A;  2QS1 A;  2GH9 A;  1MH4 A;  4DZ1 A;  4U2R A;  4GWO A;  4O3C A;  2ONS A;  2YPN A;  1MQG A;  1FC2 C;  1OVR A;  3B6T A;  3T9X B;  4NWC A;  1N84 A;  1SI0 A;  3PPR A;  2QS3 A;  2OTK E;  2XXW A;  4F31 B;  4WED A;  4XTC Q;  4NF4 B;  1N76 A;  3H6V A;  4LZ5 A;  1VFE A;  3MZ9 A;  4F19 A;  1B0H A;  3O9P A;  4NF8 B;  3FAS A;  4KYE A;  2H98 A;  2KZI A;  1POY 1;  5F1Q A;  2QMW A;  5M2V A;  5C39 A;  2UWJ E;  1B2H A;  2R9J A;  1QJM A;  1RYX A;  4JBZ A;  5EYF A;  1MY3 A;  1LB8 A;  3M3K A;  3O2A A;  4R72 A;  4YKK A;  5JK4 A;  3PH0 A;  3RTF B;  5DVJ A;  3ZS6 A;  3KZG A;  4Q30 B;  4H8I A;  3HHG A;  4OFO A;  4G77 A;  5L9M A;  3KG2 A;  3EN3 A; 
#chains in the Genus database with same CATH topology
 2E76 D;  3H6W A;  3CD6 P;  3A0H H;  3AEG C;  3PGF A;  3Q5R A;  3MUD A;  2B65 A;  3OW2 O;  3M0A A;  4JQ0 D;  3MZW B;  2KS1 B;  3VMY A;  4EQ9 A;  1UTB A;  1BCC E;  1H0T A;  1IQ7 A;  4U4S A;  1SQP E;  2C9L Y;  1MXX A;  2HPG A;  2I6E A;  2OGU A;  2O1J A;  2ZT9 C;  4TQU Q;  4G61 A;  3ODB A;  1FBM A;  1FQA A;  3TTN A;  4WY4 C;  5APW A;  2UYE A;  2QMX A;  2ZYO A;  1MQI A;  4P1E A;  2QVR A;  4GWU A;  1PEB A;  2KNC A;  1J1N A;  3GLM A;  3C33 A;  2AEJ A;  3UP9 A;  2ZNS A;  3AE4 C;  2WPS A;  1CSB A;  5AVX B;  1NI9 A;  4GT1 A;  3PUX E;  1YYZ A;  2N1T D;  3KHU A;  4DCX A;  3S1K A;  1NV5 A;  3RNN A;  2NVU B;  2FIE A;  2REJ A;  1B0L A;  1ZTY A;  4WY4 A;  3K2D A;  1NNT A;  4F3B A;  2FKW B;  1USY E;  4ZE9 A;  5I57 A;  3TGU D;  5AW2 B;  5DJT B;  4OWF A;  1YTV A;  4LQ2 A;  1L4A C;  1B5J A;  1L0N K;  4JB7 A;  2QJP B;  3HTK A;  4D6T E;  1FZE A;  4C0R A;  2FYU G;  1NNF A;  1RF1 B;  1IXI A;  1T3J A;  2O7I A;  2JR8 A;  3PD8 A;  1KQL A;  1BE3 G;  5JTY B;  5A5X A;  1VQ9 P;  1S50 A;  3MP1 A;  2QSI A;  2XXK A;  1S2E A;  3AE5 C;  2DE4 A;  3AEC C;  5IZ1 A;  3VYI A;  4PP0 A;  2ZVN B;  1Q90 D;  3UK4 A;  3E13 X;  3B5N D;  4IO7 A;  1EDI A;  3HUS B;  3Q1M A;  1Z56 A;  2DWI A;  2ZYK A;  2E75 D;  3M8U A;  1MFT A;  3TQW A;  4OEU A;  1L5T A;  3PUZ E;  3K1M A;  4PV1 C;  5B5E E;  5TIS H;  1S72 P;  2B87 B;  3L70 E;  1NU1 D;  2Z23 A;  4GL0 A;  1VL2 A;  3A5T A;  4OVT A;  1FZF A;  3L73 E;  2JKV A;  3CCL P;  3KDP B;  4GOT A;  1EZV E;  3OEN A;  2NPS D;  1NV0 A;  3MUQ A;  5HPQ A;  3A09 A;  4I3Y A;  4AS5 A;  4F18 A;  2VPN A;  4Q0C A;  3O6H A;  1DEB A;  3LW5 J;  4IFD K;  1NNK A;  4JSD A;  4R74 A;  3UIA A;  3NOH A;  4X1B A;  3CWB D;  1FPB A;  4ZNC A;  1QUL A;  5I2N A;  1GGG A;  1MXY A;  1BTJ A;  1JB0 J;  2BCC J;  4HS7 A;  1LAX A;  1QKB A;  1DMB A;  1Y1M A;  3U1C A;  3P7K A;  1VQO P;  4ELP A;  2HZL A;  4RYA A;  5KCJ B;  4XXU A;  3RL0 g;  4IY6 A;  3SZP A;  3S9L C;  1AOV A;  3R6U A;  2E76 B;  1EXJ A;  1DD4 A;  3EWK A;  2DE3 A;  1XOC A;  2V3U A;  4WVZ A;  3OEL A;  5IKB A;  5DVI A;  4OAN A;  1CNQ A;  4IGT A;  5ET7 A;  1MM7 A;  1B40 A;  5JEI A;  5AW9 B;  2H88 C;  4NF5 B;  1PB9 A;  2UVG A;  1JCD A;  3L72 D;  3E1R A;  4KR5 A;  1FPG A;  4KYD A;  4RJZ A;  1ZIU A;  3N7N A;  3CPW O;  2XX8 A;  1VF5 C;  3RL0 D;  1LBY A;  1BGY J;  3PPP A;  3BIH A;  1Y47 A;  5EYH A;  1PB7 A;  3RY3 A;  1XVX A;  1YPN A;  4GWW A;  1FTJ A;  3FJG A;  1S5L E;  1UTH A;  1SFC C;  2F6P A;  5CHX A;  1EZV D;  2Z5I A;  1OVT A;  4OTE A;  1GK4 A;  4U1Z A;  3I5C A;  1SQP K;  1MQD A;  4U3F D;  1D3K A;  1JQF A;  2N1T B;  2E5T A;  4ZEC A;  2ZYD A;  3SWK A;  2OYI C;  1Y9U A;  2NXO A;  2PFX A;  4ZEK A;  4P0I A;  2O69 A;  4HJG H;  4I1L A;  1LTG C;  2VHA A;  2I3V A;  3QYT A;  2F3D A;  1PP9 G;  5AVZ B;  4I40 A;  2HYN A;  5APS A;  1SQQ E;  4PAF A;  1ZN5 A;  2XX7 A;  2VPO A;  1KD1 Q;  3CSG A;  3G3I A;  3IR1 A;  4O94 A;  3TFL A;  1OVB A;  4H5G A;  2N9Y B;  2HHM A;  2K3R A;  3DP8 A;  3KSJ A;  2OYI A;  1PPJ E;  2E42 A;  3DP6 A;  5KZT A;  2KSE A;  4L17 A;  1BK4 A;  1LBV A;  2I3W A;  3SEY A;  4NQ8 A;  3TEL A;  3QUF A;  3USS A;  3B5N B;  1Z7N E;  2P1J A;  4RXL A;  2RIN A;  4O8M A;  1SQX D;  2Z4E A;  3L74 G;  1QUI A;  4GL8 A;  2YIU C;  1B1H A;  1SQY A;  3VVF A;  2E75 B;  1L0N G;  1KZU B;  1IK7 A;  1L4A D;  1LAH E;  3N5L A;  5IZZ A;  3M3L A;  1P84 D;  5M1B A;  1FQE A;  1OQG A;  2UVH A;  4TLM B;  3SEV A;  3D1R A;  3TNU A;  3LID A;  4MF3 A;  1W2B O;  2QVA A;  2R44 A;  2PVU A;  1GL2 C;  2BJI A;  2P3N A;  4BDM A;  3H1K D;  2QRY A;  1NKX A;  5AW1 B;  3KN8 A;  4DI3 D;  1T2K C;  2NPS B;  2JWD A;  1BKA A;  1M5C A;  4IO3 A;  1NTK K;  1R5L A;  1XHY A;  2VD3 A;  4QFP A;  4GIF A;  2KP8 A;  1R6Z A;  3FIR A;  2H99 A;  2I1J A;  2L5G B;  1QVF O;  4FED A;  1USY H;  3T9H B;  3T97 B;  3IX1 A;  4PV1 D;  4YAH X;  1X0T A;  1NAY A;  4R75 A;  5ESY A;  4ZED A;  1IFP A;  4OXV A;  4HE2 A;  1MRP A;  3V83 A;  5J16 A;  4PBH A;  4GWS A;  1LFH A;  1IME A;  3F89 A;  4AQ4 A;  4OVS A;  4ZDM A;  4IL6 E;  3AEB C;  5KDT A;  4F22 A;  3Q28 A;  1Q82 Q;  5FTH A;  4BLA A;  2XXP A;  1LLS A;  1Y9B A;  1GZL A;  1QX8 A;  3L35 A;  1N0T A;  3KJ7 A;  3PPQ A;  1NMU A;  1P1O A;  1JEV A;  3T9V A;  2JO1 A;  1B7U A;  2ITA A;  2P3V A;  1P84 I;  5APX A;  4KPT A;  3T66 A;  4QFO A;  5ITP A;  5B5E H;  1UTB B;  4I9D A;  3RL0 B;  3M9B A;  2Q9I A;  5I59 A;  2PFZ A;  2XXR A;  3KBZ A;  1EYJ A;  1QGX A;  2B3F A;  5H8S A;  3G71 P;  1FU1 A;  5CBN A;  3TK1 A;  1N7S C;  1M7L A;  3IR9 A;  5AW5 B;  3DM0 A;  2AXT E;  3RPW A;  4GOD A;  3SKP A;  2GM4 A;  2CEY A;  3H1H G;  4PFR A;  1MG1 A;  2HXW A;  3O66 A;  4FE8 A;  3H1J J;  2FBW C;  4N6D A;  3OXN A;  1FW0 A;  3KZI E;  1G1I A;  3RPL B;  3N6T A;  1ZU0 A;  1GU5 A;  4RPN A;  4AYC A;  3JSV C;  1D9Y A;  2F35 A;  4YTP C;  4OA4 A;  1VF5 D;  4JSO A;  2A45 I;  3U1A A;  1NTM D;  4PFT A;  3Q5S A;  2KK7 A;  2DP8 A;  1QLE D;  4BRY A;  4U7J A;  3MQ9 A;  5TP9 B;  3K02 A;  3CRB A;  4GX4 A;  1USD A;  3L71 J;  1K9Y A;  4O7M A;  4DCY A;  4XKP A;  3MVY A;  1SFC D;  3R26 A;  1SQB J;  4NN3 A;  1NUX A;  3HTK B;  1J1D C;  1B46 A;  3EQ1 A;  1N73 C;  2F36 A;  1ZV8 A;  3HE4 A;  3ILU B;  3HRN A;  1B9J A;  2VRS A;  2YMK A;  3IOR A;  4KFQ A;  3AE6 C;  4UB8 E;  3VFJ A;  5KAI E;  3HV1 A;  4PD4 I;  5AW7 B;  4JWX A;  3W67 A;  2YO3 A;  1BDC A;  2F5X A;  3PPO A;  4EIJ A;  1K9Z A;  4C7N A;  1L4A B;  3EKI A;  5HBC A;  3HFU A;  3L4F A;  1URD A;  3RN8 A;  2FFD A;  1MQJ A;  1EZO A;  4L75 A;  3II6 A;  3R2P A;  3TKD A;  1RE4 A;  1H89 A;  4QXD A;  1KYO E;  1DD3 A;  2XWI A;  2J59 M;  3H1L G;  3BRV B;  1VQK P;  3K4U A;  1SW5 A;  4GF8 A;  1IO4 A;  2L91 A;  2IEE A;  2WX9 A;  3KBR A;  4MFI A;  2XD2 A;  3A0B E;  1FPD A;  2YXR B;  3LSX A;  3VP8 A;  1B3G A;  4NE4 A;  2R3S A;  4GOF A;  2PCR A;  3SEU A;  5AA4 A;  1LTI C;  3TUS A;  3CCS P;  4G2Z A;  4GWX A;  3BVH A;  3KC0 A;  1IFN A;  1X79 B;  3KN3 A;  1D7M A;  2OYH C;  3H1I J;  3TF5 A;  3MYU A;  3GF3 A;  3FD3 A;  4F3S A;  4W7Y A;  3TGU J;  4GBV A;  2WT7 A;  3V5A A;  1GL2 D;  2FY8 A;  2HPC B;  1JP4 A;  4PGN A;  4ZEF A;  4WBA A;  3K6X A;  1NTK G;  4FAT A;  5LTC A;  4DXC A;  1NGM B;  3R4Y A;  4QMA A;  1MUU A;  1FS0 E;  1VQ7 P;  2W6B A;  4XA4 A;  2FYU D;  1GU4 A;  3W9V A;  2RMZ A;  5IZ3 B;  1BE3 D;  1HF9 A;  2ZXE B;  3Q5P A;  5CBS A;  2QJE A;  1B4H A;  3TCH A;  2HQ0 A;  4NF6 B;  5L9O A;  3PJS K;  4NPD A;  1BCC J;  4ZEI A;  4GVO A;  1LT1 A;  1QL2 A;  4DE8 A;  2OAR A;  1LBZ A;  3WUT A;  2WPR A;  3BCC E;  4I62 A;  4I2L C;  3C32 A;  3L75 G;  4Y28 J;  5AE4 A;  3BAS A;  1NH8 A;  4QFN A;  4TLL B;  1QVG O;  1QEX A;  4H0L C;  2JJK A;  2WYK A;  3VVD A;  2WEF A;  2J58 A;  3HD7 C;  1JW5 A;  4R2F A;  5CC2 A;  2RCB A;  1JTH B;  1VFD A;  1RQU A;  4IGR A;  1VF5 B;  2I48 A;  2P10 A;  3K00 A;  4OYV A;  1LTJ A;  2F78 A;  1FTO A;  1T0K A;  1Y3N A;  1B3L A;  3TTR A;  3D4G A;  4DDD A;  1G2C A;  2DYX A;  1IUD A;  1NFT A;  2OLB A;  3FV1 A;  4XKR A;  1N7S D;  2E5Y A;  2KOG A;  4R6Y A;  3CCV P;  2GA1 A;  3HD7 A;  4IL6 H;  1SFC B;  2XND H;  1DPE A;  4GFR A;  1QW0 A;  4LON B;  1M56 D;  3H06 B;  4NPE A;  1LFG A;  1JY3 P;  1HGZ A;  3FV2 A;  3OMB A;  3F11 A;  3QWO C;  2OYI B;  1B3F A;  4OFL A;  5KLV E;  1SDX A;  3LR1 A;  3CC4 P;  3L72 J;  2J5U A;  3OA7 A;  1AMF A;  1RE3 C;  5EFW B;  3P7I A;  3IK6 B;  4E0W A;  2WVR A;  2E0S A;  1CI6 A;  2AXT H;  1IMA A;  2HOD A;  3CHG A;  3USD A;  2I8D A;  3GF7 A;  3VMZ A;  3L70 J;  5AA2 A;  3V5B A;  1Y1Z A;  3E9X A;  2QJY C;  1JW1 A;  1YQ4 C;  4GX3 A;  3TNU B;  3KZI H;  5CMC A;  4IFM A;  5AVS B;  3B71 A;  1H88 A;  1A8F A;  3IB1 A;  2F7B A;  4GXA A;  4K3A A;  1UIX A;  4U3F J;  2QS4 A;  2XX9 A;  3IO4 A;  3O6I A;  3UIF A;  2HG5 D;  2JEE A;  2KR0 A;  3MWB A;  4GLI A;  3RQT A;  5EYG A;  1MY2 A;  3ISP A;  3S9M C;  2R71 A;  2Q2C A;  2H25 A;  3M0D A;  1FPJ A;  3FXU A;  3SEX A;  4N81 A;  4X8R A;  2G29 A;  3HE5 B;  2M0B A;  3K6W A;  5TPA A;  1DPP A;  3B8B A;  3P8C D;  1FJK A;  5H8F B;  1OIB A;  4H13 C;  1IXH A;  1R9Q A;  4EQ7 A;  4JVI A;  2WSF J;  3PMV A;  3KYQ A;  1GL2 B;  4PET A;  5EQA A;  5CRY A;  2E43 A;  2H43 A;  1JCC A;  5CBR A;  4EF1 A;  2XU6 A;  1PP9 D;  2Y7P A;  3D4C A;  1M1J C;  5TU0 A;  4WB4 A;  4UB8 H;  4G68 A;  2LXC B;  1CB6 A;  5KAI H;  1FJ9 A;  1N2D C;  1KQG B;  3BIG A;  4MCO A;  2YXQ B;  1M5B A;  4WKM A;  4BWN A;  3IB2 A;  4L73 A;  2IFN A;  2LAO A;  3E79 A;  2FNC A;  3RGY A;  3MUD C;  1EQ7 A;  1Q7Y Q;  4FBP A;  2M5A B;  3CG1 A;  1LAF E;  3ROJ A;  1M1J A;  3L74 D;  1Q1K A;  1KYO H;  4N07 A;  4X9T A;  4P9K A;  1H43 A;  5AVY B;  4F1Y A;  5FTI A;  3VMA A;  1VQL P;  3C36 A;  5FHN A;  1L0N D;  2H89 C;  3A29 A;  2F3B A;  1IMF A;  1HSE A;  5AA3 A;  1K8A Q;  3A0B H;  4XE5 B;  2Y7I A;  2M8R A;  3H1K J;  3G3G A;  4OZ9 A;  4PQJ A;  3TQL A;  1Q35 A;  2V4H A;  5AW4 B;  3FUZ A;  1SS1 A;  1D9V A;  3MST A;  1MDQ A;  4YXD C;  4R2B A;  3PD9 A;  1MPD A;  5TJH A;  3WMM 0;  5FHO A;  2VP1 A;  5AW8 B;  4OEN A;  4LC1 A;  3ZSF A;  1DOT A;  1RQV A;  4NAP A;  4DXB A;  1IFM A;  3RT6 B;  1GVC A;  2QRX A;  3FVN A;  1SQV G;  4LA9 A;  1L0L E;  3V4Q A;  1NUZ A;  2D3I A;  3GMA A;  1II5 A;  2OCU A;  2Z8F A;  2XXT A;  1NU1 E;  5KLI C;  1N7S B;  1LWU A;  1HJ0 A;  2IYP A;  4PE3 A;  4RY1 A;  4BRY B;  1HH0 A;  1SQQ J;  2IZ1 A;  4H0L D;  2FYI A;  3F5H A;  4I3E A;  1IFJ A;  3SFE C;  5CMB A;  4OMB A;  4OWD A;  3SES A;  1TU3 F;  1QUK A;  4PCD A;  2WMM A;  2BCC G;  2ZNU A;  5DEX B;  3FVO A;  3FXQ A;  5AW3 B;  2QSX A;  1URQ C;  3PUY E;  1OFC X;  1Q2N A;  3CWB E;  2B9B A;  3IFM A;  1PZQ A;  1Y3P A;  3VXC A;  1G1J A;  4W80 A;  1LBW A;  2O1K A;  5CMZ A;  4E0X A;  4PBQ A;  5J1D A;  1P1U A;  3V6I A;  1FBP A;  1R9L A;  1J1D B;  2HLO A;  1N73 B;  2Y7R A;  1PV3 A;  3SFD C;  2HZK A;  1URQ A;  1UII A;  3N6U A;  1OWA A;  1MXZ A;  4YIC A;  2O3J A;  2IDB A;  1DTZ A;  5KJ7 D;  1OQH A;  1BGY G;  3G6E P;  1Y4C A;  1Y8A A;  2CMO A;  4P56 A;  3PPN A;  4QFK A;  5APY A;  3CCE P;  2DSF A;  3CXH D;  3L72 E;  4OER A;  3N26 A;  4DOJ A;  2OX3 A;  2HAU A;  5L9S A;  1KB9 D;  1DCU A;  4IR8 A;  3FZV A;  4HB1 A;  1J1E C;  1Q86 Q;  3E78 A;  3RGU A;  3ZDM A;  2YMY A;  1H8A A;  1L0L D;  4N8G A;  2IA4 A;  3B7D A;  1SQB K;  3BRT B;  2GHA A;  3O8Z A;  4FEB A;  4R4L A;  3LIE A;  2W7Y A;  4G8H A;  3TAJ A;  4IO6 A;  1LP1 A;  4TT3 H;  1IIW A;  3E7K A;  2ZYA A;  3ABV C;  1I6B A;  1OLA A;  2AYS A;  1OW8 A;  3Q26 A;  1LJ2 A;  4C7R A;  4DCK A;  5H2F E;  4PE5 B;  2HAV A;  1YTZ I;  4U3F E;  5HM4 B;  2XXI A;  1PL5 A;  4HKZ H;  3FJM A;  3V2R A;  2OYH B;  2K9J A;  5APQ A;  3TCG A;  4KXP A;  1NWQ A;  4GWZ A;  4O3A A;  2ZMB A;  1BSN A;  4H13 D;  3GXA A;  4MLQ A;  2NUV A;  2IX7 C;  3CI9 A;  4JVC A;  4RPO A;  1S9T A;  4DJG A;  5BVZ A;  5K5G B;  3LUZ A;  5I3S A;  5I2K A;  1LTA C;  2Q3E A;  4MIJ A;  2QVU A;  1E79 H;  5EQ8 A;  4Z1M H;  2FYZ A;  5LDZ A;  1KWH A;  2Z5H A;  3NTN A;  4M4G A;  3IOW A;  1RYO A;  3MBP A;  4OVQ A;  5CBO A;  2K1A A;  3CXH I;  1NYH A;  1SBP A;  2AXC A;  4PFI A;  4Q8R A;  1NJI Q;  1VQP P;  1FZC A;  3LSW A;  5ITO A;  1KB9 I;  3W68 A;  1M5D A;  2FYN C;  1DTG A;  3U72 A;  1SQX E;  1DSN A;  2I0C A;  2H7H A;  4P11 A;  2N9B A;  5AVQ B;  5DW8 A;  4XFE A;  1S7Y A;  3K6U A;  4NHB A;  1RHZ B;  4DLD A;  3WU2 E;  5CJ0 A;  2XXX A;  1P84 E;  1VSO A;  3D70 A;  4HH2 A;  2H9B A;  3CIJ A;  4C1U A;  2POH A;  1MY0 A;  2A06 D;  1BDD A;  2QA4 P;  2RKM A;  3RBX A;  1X8Y A;  3H1K E;  2Q88 A;  4R9F A;  4H0L B;  5ET8 A;  2F8D A;  2DVZ A;  1XC1 A;  1T3U A;  4U22 A;  4GKG A;  1GTW A;  5H8H B;  2LR2 A;  1MPC A;  1NTK D;  2QJK C;  2E1S A;  3T0J A;  1M57 D;  1BE3 J;  3M91 A;  1FQD A;  3MVX A;  2OK2 A;  1K73 Q;  1D9Q A;  2FHY A;  4LVQ A;  1WDN A;  4EQB A;  2ZT9 D;  1NU1 K;  1SVX B;  3O6Q B;  3G3K A;  1B4Z A;  4TOZ A;  3IOT A;  1MQH A;  4ECF A;  1EDJ A;  4WY4 D;  3CCR P;  1AQ5 A;  2MJZ A;  3L36 A;  3SDF A;  3U92 A;  2HXR A;  3KN7 A;  1URS A;  4GOE A;  1CI6 B;  1NKN A;  1MZ9 A;  2HOD B;  1U57 A;  3V8X B;  3QSL A;  3EQ2 A;  1ZR2 A;  1XS5 A;  2AL5 A;  4ELQ A;  4GBW A;  1KIL C;  2YKP A;  4N8Y A;  1IZN B;  3L75 D;  3TDK A;  2OWZ A;  3QXM A;  4KT0 J;  4AS4 A;  2DXR A;  1HUC A;  3BFU A;  3QIM A;  1JY3 N;  4WXJ A;  2WPV B;  3GLB A;  2QPQ A;  4N6P A;  4ZS9 A;  4ELR A;  3DLN A;  2KIK A;  5I58 A;  1YIT P;  4F39 A;  5I56 A;  3MJN A;  1RKM A;  4KHX A;  2PT1 A;  2HEU A;  1B51 A;  4ESW A;  3CME P;  3HO7 A;  3H1J G;  2KQZ A;  4DZO A;  3L37 A;  2DXY A;  3G7W A;  1KIL A;  2QJY B;  5APU A;  4MNI A;  3G3H A;  1RY3 A;  3RUM A;  3IOV A;  1VQN P;  2V93 A;  4P0G A;  1NOH A;  1JY2 N;  2Y9Y A;  3TCF A;  1HVV A;  3WAE A;  1NAF A;  3AE7 C;  1AFO A;  3L71 G;  3FWN A;  3RK3 C;  1FPF A;  4XKN A;  4YXW H;  1NTM E;  4O9B A;  1JNF A;  2MKV A;  1SQB G;  3N94 A;  3GHG A;  4H13 B;  2NZ2 A;  4LN5 A;  4NG7 A;  1FSA A;  1H45 A;  4IFF A;  1UIV A;  4ZKP A;  5CMM A;  4KCD A;  3BCC J;  1NV3 A;  1M1J B;  1LAG E;  4FAJ A;  2D2C C;  3MZB A;  4AQR D;  1N86 A;  2ZXX A;  5GTH E;  4RES B;  1NV6 A;  3CSB A;  2I58 A;  4NF8 A;  4PFW A;  4YB6 A;  3RTW B;  3H32 B;  2A5T A;  1JET A;  1LTB C;  2ZZV A;  4FJP A;  4GRK A;  4JYC A;  1NTZ D;  3VTP C;  4R73 A;  4WWI A;  4TLF A;  1RF0 C;  3A2A A;  2BEZ F;  3AE2 C;  2VGQ A;  1L2P A;  4KD5 A;  2IBZ G;  2DDK A;  4AB5 A;  2KI7 B;  5CCG C;  3FXR A;  1EYK A;  3FJ7 A;  3H6U A;  1LBC A;  4P3L A;  3CC2 P;  2H5Y A;  1FJP A;  1BSH A;  1SLQ A;  2ZVO B;  1H0T B;  1IC2 A;  2W83 C;  4PD4 D;  2RF1 A;  1YCJ A;  4I7Z C;  1H44 A;  2I4B A;  1HTL C;  3FWL A;  1MXU A;  1NVO A;  2QIW A;  5KKZ C;  2FXP A;  1S3J A;  3OJA B;  5H2F H;  1R8E A;  1RF0 A;  2WZ7 A;  1M5E A;  4JPZ B;  5CJ4 A;  5I84 A;  3CG3 A;  2JP3 A;  2PMS A;  3U8Q A;  4RK9 A;  2KSJ A;  3H1I G;  1AVO A;  4B86 A;  1SI1 A;  1JMB A;  5CCG A;  4JVD A;  3LV0 A;  4C46 A;  2UYF A;  4IOI H;  2BEQ D;  2G93 A;  2FA7 A;  3TGU G;  2KNC B;  1YHQ P;  1B7H A;  2NOO A;  3PUV E;  1IMC A;  3KOT A;  4LLH A;  1FDM A;  1KFM A;  4YPC A;  1LCF A;  4XFJ A;  5KLV J;  3O28 A;  1PB8 A;  1B58 A;  2WSF H;  3QK6 A;  3Q29 A;  2ZT9 B;  2O01 N;  1KTM A;  2KLU A;  1MDP 1;  1Q9D A;  3Q25 A;  4HCY A;  1IEJ A;  3MPL A;  3FGS A;  3TDJ A;  4WY4 B;  1AIV A;  2O7U A;  5EHM A;  1LGB C;  4OVP A;  3K0V A;  3UN6 A;  3IAZ A;  2KS1 A;  5I57 B;  2Y0E A;  1QVS A;  1WT6 A;  1KN7 A;  2I49 A;  1BCC G;  3I6V A;  4F2O A;  2FYU E;  5B66 E;  1SQP G;  3MZ1 A;  3CCQ P;  2FFD C;  2C0W A;  4PTK A;  4QHQ A;  1AVY A;  2O84 X;  4MH5 A;  1AA0 A;  1RE4 C;  2L5V A;  1BE3 E;  1S4X A;  3QH9 A;  1ZLQ A;  5ISU A;  4ASV A;  2FBP A;  5A5X B;  3WU2 H;  2Q3I A;  3UGW A;  4ZMD A;  2PX1 A;  1WOD A;  1P84 H;  1LEV A;  1YQ3 C;  2QM8 A;  5AVV B;  3CCU P;  4O3B A;  1SP4 A;  4QF9 A;  2RH0 A;  1QUJ A;  1SQQ K;  3CCJ P;  3VP9 A;  1SQV D;  2OWS A;  1USE A;  2G3A A;  2M8C A;  1ZW0 A;  2HFB A;  1S5L H;  2Q5U A;  3FVG A;  2IYO A;  2THI A;  3SEW A;  1M90 Q;  2F7C A;  2XNX A;  4JF7 A;  1HSJ A;  4YKJ A;  2OZZ A;  1LGH B;  3D6Y A;  3ILT B;  1BIY A;  3N4X A;  3S9O A;  2F97 A;  2V4C A;  1URG A;  1Y4T A;  1DH3 A;  3GBB A;  4NPF X;  5CCH A;  2WPQ A;  5ELV A;  2XXU A;  2B3B A;  2A45 H;  1J1E B;  2BCC D;  1RF1 A;  4MNP A;  4N6K A;  4D6T G;  1PFI A;  4NX1 A;  4R9G A;  4PV1 B;  5JTY A;  4BDQ A;  3OEM A;  3V2P A;  1IFD A;  4K35 A;  1VQ6 P;  3HCQ A;  2IFM A;  2DQV A;  5I2N B;  1NO4 A;  5T3J A;  4OET A;  3L72 G;  1BP5 A;  3HUS A;  1T2K D;  2P0S A;  3MP8 A;  1A02 F;  1R1N A;  3AED C;  4Q5T A;  1A54 A;  1UIU A;  1LB9 A;  4I1D A;  2G8Y A;  1FTL A;  2PT2 A;  1INP A;  1NTM K;  3RK3 D;  2B87 A;  1WMK A;  3E1I A;  2K37 A;  3NFQ A;  3IFA A;  4G8M A;  1FZA A;  3L70 G;  4DT0 A;  2ABH A;  5APT A;  3WUU A;  1IMB A;  2V3Q A;  1FJ6 A;  3MP6 A;  1BGY D;  4U1O A;  3L73 G;  4XEQ A;  2ONK E;  4MBP A;  3L6G A;  1L0L J;  2DW3 A;  1TFA A;  4F3P A;  3TYH A;  3FXD A;  1EZV G;  1K05 A;  1KOR A;  4N4U A;  2D2C D;  4ONY A;  3O6G A;  1NU1 J;  3KJT A;  4YMB A;  4X04 A;  4BDO A;  1YBK A;  1A55 A;  1OLC A;  2GQ1 A;  1LTJ C;  3AEE C;  5I7I A;  4G4P A;  5BU8 B;  3GZG A;  5F7V A;  3JCU E;  4HTG A;  3NMD A;  5DJU B;  3IAO A;  3AEA C;  2FYN B;  3OAK A;  4C1T A;  1ZOY C;  4EI2 A;  1UTH B;  4F1U A;  1FQB A;  1GK6 A;  3CX5 D;  1XT8 A;  2REG A;  3U65 A;  3WAF A;  1S9K D;  2K88 A;  5KCJ A;  4BXL A;  3CWB J;  3P8C E;  4Z0I A;  1NHL A;  1B32 A;  4XF5 A;  5K2Y A;  1SD3 A;  2PGD A;  4LZ8 A;  3S9E A;  1I69 A;  3TTM A;  3LC8 A;  2F6G A;  5GTH H;  4G8N A;  3VLU A;  3FXB A;  2ZYN A;  4NF5 A;  1JY3 O;  1PP9 E;  2DOJ A;  4M1V A;  3A3U A;  2QJK B;  4GXS B;  2RKL A;  1MPB A;  1DEE G;  1FZB A;  2R8T A;  4NMY A;  2N1T C;  1FPI A;  2CZL A;  2W8Z A;  2IZ0 A;  4H65 A;  3W9W A;  1GDT A;  3AXF A;  3IOU A;  3Q3D A;  2XKM A;  2DVC A;  4NGU A;  3KEI A;  4KCC A;  3L74 E;  2LXB A;  4LQ5 A;  1ELJ A;  1FDI A;  4ELO A;  1L0N E;  2AIX A;  2W6J H;  2I4C A;  4NWD A;  4THI A;  5H8Q A;  1IXG A;  1GTK A;  4RO0 A;  1EC5 A;  3M0D C;  2FYU K;  1US4 A;  2N1T A;  4OGQ C;  5F24 A;  4F2Q A;  3OO8 A;  1SPI A;  3HPI A;  1KZ8 A;  1CE2 A;  1PDA A;  3AE3 C;  3CX5 I;  1JY2 P;  5FHM A;  4YKP A;  1FTA A;  3B5N C;  1UQW A;  3IFC A;  3BKI B;  5AVU B;  4QSC A;  2YIU B;  4UB6 E;  3H6P A;  1BLF A;  1FOS E;  3CFZ A;  1SQQ G;  4G68 C;  4OEV A;  4GD5 A;  1KYO I;  1HWT C;  1B6H A;  1VQM P;  2VD2 A;  3LBS A;  3EF7 A;  4F29 A;  1VPC A;  1MY4 A;  3KOS A;  3M06 A;  3OSR A;  1PPJ G;  1AV1 A;  4L76 A;  4OQO A;  1S5L X;  5B66 H;  3B5N A;  3MC2 A;  1X9V A;  4IB2 A;  2CZK A;  4M3L A;  3B8E B;  3QMF A;  1PGJ A;  3HST A;  4KJM A;  1AJY A;  1POT A;  1SW2 A;  3R7X A;  4P8B A;  4RK2 A;  3B4S A;  4N91 A;  3MHV A;  4PDH A;  1NH4 A;  2C0X A;  4N13 A;  3RK3 B;  3U94 A;  3G9R A;  1AL3 A;  4H0W A;  2A5T B;  3BAT A;  5KDT B;  3I3V A;  1SQX J;  2Q8J A;  1B1X A;  1I6Q A;  1PBP A;  1KQS O;  4EUO A;  2W90 A;  5EQ9 A;  4MMP A;  3TPA A;  1N04 A;  1N7W A;  1P1N A;  4X1D A;  4EOT A;  1P1W A;  3M3F A;  4I6M C;  3IB0 A;  2NPS A;  1HBW A;  1YJN P;  4H67 A;  4PAK A;  5DT6 A;  2MKZ A;  1A40 A;  3QAX A;  1US5 A;  2D2C B;  2UVI A;  3CVG A;  1A02 J;  3MVW A;  1VE4 A;  3WUV A;  1B52 A;  3H1J D;  2FXM A;  4HXV A;  1IZ1 A;  5I59 B;  1U7J A;  3MVZ A;  2XDJ A;  2WSC H;  2O1M A;  4GDO A;  3NXS A;  2DWH A;  3T97 A;  2WKY A;  1LWU C;  3PUW E;  2ZFC A;  3OD7 A;  3CXH E;  3AE8 C;  3CMA P;  4POW A;  2ESN A;  2Z22 A;  4H45 A;  2W6A A;  5EQ7 A;  1KB9 E;  1LTT C;  3T1B A;  1IXC A;  3T96 B;  3RL0 C;  1WVJ A;  1IFI A;  2Y0C A;  3L71 D;  1YYC A;  4I7Z B;  1OMP A;  1LCT A;  3IL1 B;  5KKZ B;  1VDW A;  3FGA D;  1LNQ A;  2O6A A;  1LBB A;  1SQB D;  5AVR B;  3KC1 A;  1OXZ A;  1EZP A;  1FAV A;  3PRJ A;  3VLW A;  1LT9 C;  1EH3 A;  2ANJ A;  4PFY A;  3LSL A;  5AA1 A;  3BBR A;  1GV8 A;  2DE2 A;  1TWY A;  4YB7 A;  1YTZ T;  2OQQ A;  1XTG B;  1MS7 A;  2NWJ A;  4ZZE A;  2O01 H;  4MAG A;  3MAM A;  4PGP A;  1A99 A;  3HD7 D;  3B6Q A;  2X26 A;  3E4R A;  1FE6 A;  4KI0 E;  5GTI E;  2F34 A;  3KSX A;  4LZ7 A;  4EDF A;  2B89 A;  1NTZ J;  3H6T A;  2Z8E A;  3B6W A;  1JEK A;  4HYT B;  3HE4 B;  4OH8 B;  1A8E A;  2Y7K A;  1FBF A;  2SPZ A;  5K2X A;  1LT9 A;  1T6A A;  4QRZ A;  2D5W A;  1JUN A;  4QFL A;  4FEC A;  2IBZ D;  2O1L A;  1GW4 A;  2KB7 P;  1B05 A;  3S9N C;  1FDO A;  1ZLL A;  1GR2 A;  1W2E A;  3RPL A;  1X22 A;  3MIW A;  2XXV A;  1O7T A;  3PV0 E;  4H46 A;  3JCU H;  2XXY A;  4C7N B;  3OO6 A;  1XVY A;  4IL6 X;  2FFD B;  4YB5 A;  3VE1 B;  3C1L A;  1SW4 A;  3VLV A;  4BDR A;  2AEM A;  1O63 A;  3H1L E;  1N3W A;  2QEX P;  2GFE A;  4XIG Q;  5KLV K;  5AA2 D;  4IO4 A;  4RJT A;  2H4I A;  1B3E A;  5E79 E;  3H1H D;  1MY1 A;  1TFD A;  5TP9 A;  3H1I D;  2BJJ X;  2OWT A;  3C35 A;  2A5S A;  1FBC A;  1ZKB A;  4N6J A;  3SWY A;  4DIG A;  4QSE A;  2ZYG A;  3THI A;  5AA4 B;  4CPG A;  3IJX B;  1NTM J;  1SVF A;  4H6D A;  4ISU A;  1GMJ A;  1YJW P;  2ZAE B;  3O29 A;  3M9Q A;  2A06 E;  4OGQ D;  3V2N A;  4JXI A;  4ZEB A;  2ZXT A;  3PU5 A;  4OES A;  3PHL A;  1SYH A;  3SET A;  2WT7 B;  4LP2 B;  3MPK A;  3H25 A;  4U21 A;  1NTK E;  2X7P A;  2XXQ A;  4OHN A;  2OTJ P;  2WBD A;  1L4A A;  1P99 A;  3IF4 A;  5BU5 A;  2DWA A;  1BCC D;  2FVZ A;  1ANF A;  2RCA A;  1N8R Q;  1SQP D;  4ASW A;  4OVR A;  1IIT A;  2R6G E;  3H03 A;  2IBZ I;  5AW6 B;  1W5C E;  2M3B A;  3U93 A;  1FZC C;  5AVW B;  2OBG A;  2V25 A;  3TOD A;  3RT8 A;  2YO2 A;  1K9M Q;  1HJB A;  2KLF A;  1Y3Q A;  1SQV J;  1TXF A;  1FPK A;  3HN0 A;  5H8N A;  3EHS A;  2B88 A;  2XA5 A;  3H4Z A;  3VV5 A;  4OVJ A;  4R4M A;  4H1X A;  3JYR A;  1H76 A;  3L75 E;  3VVE A;  3OO7 A;  4W7Z A;  2FIX A;  2YKQ A;  4UB6 H;  2Q74 A;  2V7Q J;  3H1L D;  3TEP A;  3EHU A;  1FPE A;  2HPC A;  1DIP A;  3RK2 C;  4QBA A;  1FCK A;  2DWJ A;  4IY5 A;  2HFE D;  1Y20 A;  2Y84 A;  4YMA A;  2QVV A;  1NV1 A;  4D6T D;  2KUB A;  4KHZ E;  1LTJ B;  1QKA A;  5IZ3 A;  2CPB A;  2ZZW A;  3IN6 A;  5DTB A;  2H8P D;  5CMK A;  1WRG A;  3G3F A;  1G2C B;  3Q2Y A;  3B50 A;  4NF6 A;  3VMX A;  4GQO A;  3KFM A;  4BDL A;  3OOA A;  1M5F A;  3HD7 B;  3CLQ A;  2Z8D A;  2FYU J;  4PFU A;  3G3Z A;  1DX7 A;  2P67 A;  4NF0 A;  2D21 A;  3MW0 A;  4IO5 A;  1N3X A;  1IMD A;  3U1O A;  2R3C A;  3BCC G;  2P2A A;  3GBA A;  5L8R J;  2GHB A;  3LUY A;  2JWA A;  4H8J A;  1L0L K;  3GW6 A;  1JNM A;  4PDD A;  3V89 B;  2GUS A;  1FQC A;  1FBD A;  1O64 A;  4NTL A;  3JZJ A;  3DP4 A;  4EXL A;  2WSE H;  3L70 D;  4Y99 C;  4P1L A;  5IGA A;  1FBH A;  3V4W A;  1FOS F;  3L73 D;  1LST A;  1D4N A;  3SWF A;  3EPE A;  3K1N A;  2Y5L A;  2Q6Q A;  3K5B A;  1A7L A;  5BWJ A;  1IJD B;  1JTH A;  5H8Q B;  1AH5 A;  2RC7 A;  3CXH H;  3AE1 C;  3C9H A;  1YJ9 P;  5AA2 B;  2E74 C;  1NTZ E;  1NNP A;  2GRV A;  1KB9 H;  1URQ D;  2WSC J;  1N7L A;  2YLN A;  1LFI A;  1N7X A;  2VOZ A;  2R5D A;  1SFC A;  1ZRT E;  4MEV A;  1DK4 A;  4PD4 E;  3FAT A;  5LOM A;  4HCW A;  1NUY A;  1FPL A;  1NUW A;  1NV7 A;  4OGQ B;  4RNS A;  4HE1 A;  4N78 E;  5TPA B;  3AE9 C;  3V2Q A;  2V3T A;  3GHG C;  5KLV G;  2Q89 A;  2PFY A;  3TTK A;  1JEU A;  3CI8 A;  5GTI H;  4OFJ A;  3TZA A;  4AB6 A;  1B5I A;  3C31 A;  4X48 A;  2V84 A;  4PJ0 E;  4QSD A;  3OEK A;  1ZME C;  4MLV A;  3D6Z A;  3PP5 A;  1B3H A;  1RDY A;  3KQG A;  3PMW A;  3FXE A;  4OVN F;  1MXW A;  4ESX A;  3C34 A;  2ALU A;  4G68 B;  2O01 J;  2RN0 A;  5CM6 A;  1M1K Q;  2XXH A;  1HSL A;  3FX0 A;  3RYD A;  2P2U A;  4JDF A;  1AQT A;  4H44 C;  1OVU A;  5KTB A;  5B70 A;  1EZV I;  3AEF C;  4NF4 A;  2QE7 H;  4XKQ A;  1KV4 A;  2Q9T A;  3MP7 B;  1OW6 A;  1VDF A;  2GUV A;  5APV A;  1EDK A;  2ONR A;  1P1Q A;  5E79 H;  1OW7 A;  4JWO A;  3HE5 A;  2Y7W A;  3S4R A;  4FOR A;  5H8F A;  2HCA A;  2ZZX A;  5ET6 A;  1YAE A;  1I6A A;  1J2J B;  2UXA A;  4H5F A;  1GL2 A;  3W15 C;  4F1V A;  5KAF E;  3TMG A;  3KXD A;  2CZI A;  1ZRT D;  3L6H A;  1KA0 A;  1SQV E;  2PAJ A;  3RBZ A;  1SQQ D;  1QGK B;  2XHD A;  1B7Z A;  1EU8 A;  4LAT A;  2XWK A;  4MX6 A;  3PLN A;  3S4U A;  1KIL E;  1FTM A;  5AW0 B;  4HW8 A;  1PPJ D;  4N78 D;  3K6V A;  1LWU B;  1PP9 J;  3VN0 A;  2CZH A;  2HR3 A;  1KC8 Q;  1GD2 E;  2M5A A;  3I5O A;  4RA1 A;  1SQX K;  4MJO A;  2AL4 A;  1JW4 A;  2YNY A;  3RK2 D;  1HGV A;  2BCC E;  1EZ9 A;  5CI5 A;  4YKI A;  2PRR A;  5L8D A;  1FZG A;  1MXV A;  3UOR A;  4K3F A;  5KLI B;  4R6K A;  1LT9 B;  2P58 A;  1VQ8 P;  3L74 J;  1U7M A;  3HHF A;  3OSQ A;  1L0N J;  3SSU A;  1ZXG A;  4NED A;  3T9U A;  3H7M A;  3K1P A;  4EYY Q;  2F7A A;  3RLF E;  2XZR A;  5ICQ A;  4P47 A;  1L0L G;  3RK3 E;  3EHT A;  2X7Q A;  3EFG A;  2OYO A;  2QM7 A;  3ZKK A;  1URQ B;  1N7S A;  2OJT A;  2BAS A;  1NU1 G;  2KZJ A;  2Q2A A;  3QUJ A;  3KPE A;  1BGY E;  4RKU J;  3TYY A;  2CPS A;  1FBG A;  1SW1 A;  4PC9 A;  3PTY A;  5DYH A;  1KA1 A;  3LSF B;  2QL3 A;  1MFZ A;  3SER A;  1ZMG A;  2CK3 H;  1GW3 A;  4ZKU A;  1CZQ A;  4MNC A;  5CCH C;  4POX A;  2QJP C;  1JM0 A;  4R6H A;  1NKZ B;  5DEX A;  1F9B A;  1RF1 C;  3TSI A;  4ND9 A;  3TTL A;  3CR9 A;  4U4X A;  2ZYM A;  2PYY A;  1JMM A;  3P32 A;  1ZR4 A;  1TT1 A;  2P1S A;  4N17 A;  3KGC A;  1NH7 A;  1KIL D;  1NTZ K;  2E74 D;  2YJP A;  3ZKL A;  4MHF A;  3CWB G;  1LP1 B;  2WQY C;  4PF8 A;  1MH3 A;  1K04 A;  3CX5 E;  4N15 A;  4PFB A;  4ZZA A;  2WTY A;  3HUS C;  3DEL B;  1S9K E;  3U59 A;  1MV8 A;  4BDN A;  1N73 A;  3I55 P;  2JJL A;  1JO5 A;  1PBQ A;  2I1K A;  1RDX A;  2K9J B;  2K9Y A;  3GYY A;  1EXI A;  2I0B A;  2KYV A;  1ATG A;  3VDF A;  2RC9 A;  4U23 A;  1JOC A;  4UA8 A;  1Z7M E;  1KMI Z;  1ZP0 C;  2WSE J;  4YZZ A;  5H8N B;  3A0H E;  2P7J A;  4MN4 C;  5I2K B;  1H3D A;  2Q1K A;  1NL5 A;  3ONM A;  5BUU A;  1XTC C;  4ZE8 A;  3G4S P;  3EFF K;  1PGQ A;  3H1H J;  1PC3 A;  1SYI A;  4GX6 A;  2KXP B;  3CFL A;  2A06 G;  3VXB A;  4PD4 H;  4WEP A;  4H44 D;  1VR5 A;  4DXU A;  5B7D A;  1FZC B;  2M3E A;  3OO9 A;  4Z7E A;  3MD0 A;  2VT5 A;  1VQ5 P;  2IPP A;  5AVT B;  3D71 A;  1PGO A;  4JWY A;  3IO6 A;  1OVV A;  4U3F G;  4LGD E;  2W27 A;  2OYH A;  2E76 C;  4PJ0 H;  3UA8 A;  4N3Y B;  2NRG A;  5ICT A;  3CFX A;  4GWY A;  2KLV A;  1FQF A;  1S1C X;  3IJO B;  4GIZ A;  3C4M A;  3A3C A;  3PMX A;  3JC2 2;  4YU0 A;  1SQP J;  3RK2 B;  3K01 A;  3S2V A;  4EDP A;  3C9I A;  2RC8 A;  2UVJ A;  2R5B A;  5CCG D;  5DVF A;  3A7O A;  5A5L A;  4I8C A;  3JV9 A;  1OMI A;  1SQV K;  2C9N Y;  3FVK A;  4LUB A;  3CCM P;  1FTK A;  3M9H A;  1JVX A;  2QS2 A;  4O7I A;  2O51 A;  1KYO D;  4F3G A;  1Q81 Q;  4EF2 A;  2JDI H;  1SQX G;  1AWB A;  1YZ0 A;  1XI6 A;  5ET5 A;  2PBW A;  2XD3 A;  1OZH A;  5FBP A;  1EDL A;  3H3G A;  3E3K A;  2XV5 A;  3H1L J;  1MM6 A;  5KAF H;  3O97 A;  3BFT A;  5EHS A;  1VQ4 P;  4FIM A;  3ECR A;  1OX3 A;  3T93 B;  2WBB A;  3Q27 A;  1ZBM A;  4Y99 B;  3C8V A;  4A7P A;  3H1K G;  2B4M A;  4UAC A;  3T22 A;  2WSS H;  2DS9 A;  1JVY A;  2ZJS E;  5H8H A;  4IO2 A;  5I58 B;  2Q8M A;  2ZNT A;  4KYS A;  5TIS E;  2YKO A;  4D6T J;  1B5H A;  5I56 B;  5IAI A;  1JY2 O;  2WIT A;  4EXK A;  3LW5 H;  2AEF A;  3H1J E;  2O68 A;  4AUW A;  1ZJL A;  4KQP A;  1PIX A;  1FRP A;  3G3J A;  2QS1 A;  2GH9 A;  2V7Q H;  1RH5 B;  1KIL B;  2E74 B;  1MH4 A;  2PP6 A;  2QFL A;  4DZ1 A;  3FBP A;  3O6Q A;  4PAI A;  5KJ7 C;  4U2R A;  2Y0D A;  1NTK J;  2A45 G;  5IM2 A;  4GWO A;  4O3C A;  2ONS A;  2Q7C A;  4HE0 A;  2YPN A;  1MQG A;  1QL1 A;  1FC2 C;  3I56 P;  1OVR A;  3L71 E;  2E75 C;  3B6T A;  5CCH D;  3BCC D;  1YIJ P;  3T9X B;  1SQB E;  1DBZ A;  1R5S A;  3L73 J;  4NWC A;  3GHG B;  1NV2 A;  1EYI A;  5KJ7 A;  1E5W A;  1NTZ G;  1N84 A;  1SI0 A;  3GG2 A;  3PPR A;  2QS3 A;  2OTK E;  2XXW A;  4F31 B;  1PGP A;  2Y9Z A;  1RE3 A;  1YI2 P;  4WED A;  4NF4 B;  3ITK A;  1N76 A;  3H6V A;  4XTC Q;  2NPS C;  2FXO A;  1G0I A;  4LZ5 A;  1VFE A;  1OIP A;  4L74 A;  3MZ9 A;  3CC7 P;  4F19 A;  3P8M C;  1B0H A;  3O9P A;  3L75 J;  4NF8 B;  3CL3 D;  2QG4 A;  2LKM A;  1KFN A;  4H44 B;  1KQF B;  1LBX A;  1NV4 A;  3FAS A;  4PF6 A;  4DI4 B;  2IBZ E;  4KYE A;  2H98 A;  2KZI A;  1POY 1;  1T8Z A;  4JYB A;  5F1Q A;  2QMW A;  1LTS C;  5M2V A;  5I5P A;  1M8O B;  5C39 A;  3A3Y B;  1RDZ A;  2UWJ E;  1YXI A;  1B2H A;  1MKM A;  2R9J A;  1QJM A;  1FBE A;  1CW5 A;  1RYX A;  2XWO A;  4UAB A;  4JBZ A;  2OTL P;  3CX5 H;  3VOP A;  1MY3 A;  5EYF A;  1NTM G;  1LB8 A;  3M3K A;  3O2A A;  3PTZ A;  5KLV D;  3H1H E;  4R72 A;  1IK9 A;  2XWV A;  3MGN A;  3H1I E;  2WYP A;  1G0H A;  4YKK A;  5JK4 A;  3MTU E;  2R32 A;  3PH0 A;  3RTF B;  3TGU E;  5DVJ A;  3ZS6 A;  3KZG A;  2WWW A;  2CEX A;  2Y5K A;  4Q30 B;  4H8I A;  3HHG A;  4OFO A;  4G77 A;  3H32 A;  5L9M A;  3KG2 A;  2B4L A;  3EN3 A; 
#chains in the Genus database with same CATH homology
 3H6W A;  3PGF A;  2B65 A;  3MZW B;  2KS1 B;  4EQ9 A;  1UTB A;  1H0T A;  1IQ7 A;  4U4S A;  1MXX A;  2I6E A;  4TQU Q;  3ODB A;  1FQA A;  3TTN A;  2UYE A;  2QMX A;  2ZYO A;  1MQI A;  1PEB A;  1J1N A;  3C33 A;  3UP9 A;  2ZNS A;  3PUX E;  4DCX A;  3S1K A;  3RNN A;  2NVU B;  2REJ A;  1B0L A;  1ZTY A;  3K2D A;  1NNT A;  4F3B A;  1USY E;  4ZE9 A;  5I57 A;  5DJT B;  1YTV A;  4LQ2 A;  1B5J A;  4JB7 A;  4C0R A;  1NNF A;  1IXI A;  2O7I A;  3PD8 A;  5JTY B;  5A5X A;  1S50 A;  3MP1 A;  2DE4 A;  4PP0 A;  3UK4 A;  3E13 X;  4IO7 A;  1EDI A;  2DWI A;  2ZYK A;  3M8U A;  1MFT A;  3TQW A;  4OEU A;  1L5T A;  3PUZ E;  3K1M A;  2B87 B;  2Z23 A;  4GL0 A;  4GOT A;  3OEN A;  3MUQ A;  5HPQ A;  3A09 A;  4F18 A;  4Q0C A;  3O6H A;  1NNK A;  4JSD A;  4R74 A;  4X1B A;  4ZNC A;  1QUL A;  5I2N A;  1GGG A;  1MXY A;  1BTJ A;  4HS7 A;  1LAX A;  1QKB A;  1DMB A;  1Y1M A;  4ELP A;  2HZL A;  4RYA A;  5KCJ B;  4XXU A;  3S9L C;  4IY6 A;  1AOV A;  3R6U A;  2DE3 A;  1XOC A;  2V3U A;  3OEL A;  5IKB A;  5DVI A;  4IGT A;  1MM7 A;  1B40 A;  5JEI A;  4NF5 B;  1PB9 A;  2UVG A;  4KR5 A;  4KYD A;  4RJZ A;  1ZIU A;  2XX8 A;  3PPP A;  1Y47 A;  1PB7 A;  3RY3 A;  1XVX A;  1YPN A;  1FTJ A;  3FJG A;  1UTH A;  2F6P A;  1OVT A;  4OTE A;  4U1Z A;  1MQD A;  1JQF A;  1D3K A;  4ZEC A;  1Y9U A;  2NXO A;  4ZEK A;  4P0I A;  2O69 A;  4HJG H;  2VHA A;  2I3V A;  3QYT A;  2XX7 A;  3CSG A;  3IR1 A;  3G3I A;  3TFL A;  1OVB A;  4H5G A;  2K3R A;  3DP8 A;  3KSJ A;  3DP6 A;  5KZT A;  4L17 A;  3TEL A;  2I3W A;  3SEY A;  3QUF A;  4RXL A;  1Z7N E;  2RIN A;  1QUI A;  4GL8 A;  1B1H A;  1SQY A;  3VVF A;  1LAH E;  3N5L A;  3M3L A;  1FQE A;  1OQG A;  2UVH A;  4TLM B;  3SEV A;  4MF3 A;  2PVU A;  2QVA A;  2R44 A;  4BDM A;  2QRY A;  1NKX A;  3KN8 A;  2JWD A;  1BKA A;  1M5C A;  4IO3 A;  1XHY A;  2VD3 A;  4QFP A;  1R6Z A;  3FIR A;  2H99 A;  4FED A;  1USY H;  3T9H B;  3IX1 A;  4YAH X;  1X0T A;  4R75 A;  4ZED A;  4OXV A;  1MRP A;  3V83 A;  1LFH A;  4AQ4 A;  4ZDM A;  5KDT A;  4F22 A;  3Q28 A;  4BLA A;  5FTH A;  2XXP A;  1LLS A;  1N0T A;  3KJ7 A;  3PPQ A;  1NMU A;  1P1O A;  1JEV A;  3T9V A;  1B7U A;  4KPT A;  3T66 A;  4QFO A;  5ITP A;  1UTB B;  4I9D A;  5I59 A;  2XXR A;  2B3F A;  5H8S A;  5CBN A;  3DM0 A;  3RPW A;  4GOD A;  3SKP A;  1MG1 A;  2HXW A;  3O66 A;  4FE8 A;  3OXN A;  1FW0 A;  3N6T A;  1ZU0 A;  4RPN A;  1D9Y A;  2F35 A;  4JSO A;  4PFT A;  2DP8 A;  3MQ9 A;  5TP9 B;  3K02 A;  3CRB A;  4DCY A;  4XKP A;  3MVY A;  3R26 A;  1B46 A;  3EQ1 A;  2F36 A;  3ILU B;  1B9J A;  3IOR A;  4KFQ A;  3VFJ A;  3HV1 A;  4JWX A;  1BDC A;  2F5X A;  3PPO A;  5HBC A;  1URD A;  3RN8 A;  1MQJ A;  1EZO A;  3TKD A;  3K4U A;  1SW5 A;  4GF8 A;  2IEE A;  3KBR A;  4MFI A;  2XD2 A;  3LSX A;  1B3G A;  4NE4 A;  5AA4 A;  4GOF A;  3SEU A;  3TUS A;  4G2Z A;  3KN3 A;  3FD3 A;  4F3S A;  3V5A A;  4ZEF A;  3K6X A;  4FAT A;  4DXC A;  3W9V A;  5CBS A;  2QJE A;  1B4H A;  3TCH A;  2HQ0 A;  4NF6 B;  5L9O A;  4NPD A;  4ZEI A;  4GVO A;  1LT1 A;  4DE8 A;  4I62 A;  3C32 A;  5AE4 A;  1NH8 A;  4QFN A;  4TLL B;  3VVD A;  1JW5 A;  4R2F A;  5CC2 A;  2RCB A;  1VFD A;  4IGR A;  2I48 A;  3K00 A;  4OYV A;  2F78 A;  1FTO A;  1T0K A;  1Y3N A;  1B3L A;  3TTR A;  3D4G A;  4DDD A;  2DYX A;  1IUD A;  1NFT A;  2OLB A;  3FV1 A;  4XKR A;  4R6Y A;  1DPE A;  4GFR A;  1QW0 A;  4LON B;  3H06 B;  4NPE A;  1LFG A;  3OMB A;  3FV2 A;  3F11 A;  3QWO C;  1B3F A;  4OFL A;  1SDX A;  3LR1 A;  1AMF A;  5EFW B;  3P7I A;  3IK6 B;  4E0W A;  2E0S A;  3USD A;  2I8D A;  5AA2 A;  1Y1Z A;  3E9X A;  1JW1 A;  5CMC A;  1A8F A;  3IB1 A;  2F7B A;  4GXA A;  4K3A A;  2XX9 A;  2QS4 A;  3IO4 A;  3O6I A;  3UIF A;  3MWB A;  4GLI A;  3RQT A;  1MY2 A;  3S9M C;  2R71 A;  2Q2C A;  2H25 A;  3SEX A;  3FXU A;  2G29 A;  2M0B A;  3K6W A;  5TPA A;  1DPP A;  5H8F B;  1OIB A;  1R9Q A;  1IXH A;  4EQ7 A;  3PMV A;  4PET A;  5CRY A;  5CBR A;  4EF1 A;  2Y7P A;  3D4C A;  5TU0 A;  4G68 A;  2LXC B;  1CB6 A;  1M5B A;  4WKM A;  3IB2 A;  2LAO A;  2FNC A;  3RGY A;  2M5A B;  3CG1 A;  1LAF E;  1Q1K A;  4N07 A;  4X9T A;  4F1Y A;  1H43 A;  5FTI A;  5FHN A;  3C36 A;  1HSE A;  5AA3 A;  2Y7I A;  3G3G A;  4OZ9 A;  4PQJ A;  3TQL A;  1Q35 A;  3FUZ A;  1SS1 A;  1D9V A;  1MDQ A;  4R2B A;  3PD9 A;  1MPD A;  5FHO A;  2VP1 A;  4OEN A;  3ZSF A;  1DOT A;  4DXB A;  3RT6 B;  1GVC A;  2QRX A;  3FVN A;  4LA9 A;  2D3I A;  1II5 A;  2OCU A;  2Z8F A;  2XXT A;  4RY1 A;  2FYI A;  5CMB A;  4OMB A;  4OWD A;  3SES A;  1QUK A;  2WMM A;  2ZNU A;  5DEX B;  3FVO A;  3FXQ A;  2QSX A;  3PUY E;  1Q2N A;  1Y3P A;  3VXC A;  4E0X A;  5J1D A;  1P1U A;  1R9L A;  2Y7R A;  2HZK A;  3N6U A;  1MXZ A;  4YIC A;  1DTZ A;  1OQH A;  1Y4C A;  2CMO A;  4QFK A;  3PPN A;  2DSF A;  4OER A;  3N26 A;  2HAU A;  5L9S A;  3FZV A;  4HB1 A;  3RGU A;  3ZDM A;  2IA4 A;  3B7D A;  2GHA A;  4FEB A;  2W7Y A;  4G8H A;  3TAJ A;  4IO6 A;  1LP1 A;  1IIW A;  1I6B A;  1OLA A;  2AYS A;  3Q26 A;  4PE5 B;  2HAV A;  5HM4 B;  2XXI A;  4HKZ H;  3FJM A;  3TCG A;  4O3A A;  2ZMB A;  3GXA A;  4MLQ A;  2NUV A;  4RPO A;  1S9T A;  5K5G B;  5I2K A;  1KWH A;  4M4G A;  3IOW A;  1RYO A;  3MBP A;  5CBO A;  1SBP A;  4Q8R A;  3LSW A;  5ITO A;  1M5D A;  1DTG A;  3U72 A;  1DSN A;  2I0C A;  4P11 A;  1S7Y A;  3K6U A;  4DLD A;  2XXX A;  1VSO A;  4C1U A;  2H9B A;  3CIJ A;  1MY0 A;  1BDD A;  2RKM A;  2Q88 A;  4R9F A;  2F8D A;  2DVZ A;  1XC1 A;  4U22 A;  5H8H B;  2LR2 A;  1MPC A;  2E1S A;  1FQD A;  3MVX A;  2OK2 A;  4LVQ A;  1WDN A;  4EQB A;  1SVX B;  3G3K A;  1B4Z A;  4TOZ A;  3IOT A;  1MQH A;  4ECF A;  1EDJ A;  3SDF A;  3U92 A;  3KN7 A;  1URS A;  4GOE A;  3V8X B;  3QSL A;  1XS5 A;  2AL5 A;  4ELQ A;  3QXM A;  2DXR A;  3BFU A;  3QIM A;  4WXJ A;  3GLB A;  2QPQ A;  4ZS9 A;  4N6P A;  4ELR A;  3DLN A;  2KIK A;  5I58 A;  4F39 A;  5I56 A;  3MJN A;  1RKM A;  2PT1 A;  2HEU A;  1B51 A;  4ESW A;  3HO7 A;  2DXY A;  3G7W A;  3G3H A;  3RUM A;  3IOV A;  2V93 A;  4P0G A;  3TCF A;  3WAE A;  4XKN A;  1JNF A;  3N94 A;  1H45 A;  1UIV A;  5CMM A;  4KCD A;  1LAG E;  4FAJ A;  3MZB A;  3RTW B;  4NF8 A;  4YB6 A;  3CSB A;  2I58 A;  4PFW A;  2A5T A;  1JET A;  4FJP A;  4GRK A;  4R73 A;  4WWI A;  2VGQ A;  4KD5 A;  4AB5 A;  2KI7 B;  3FXR A;  3FJ7 A;  3H6U A;  1LBC A;  2H5Y A;  1H0T B;  2RF1 A;  1YCJ A;  1H44 A;  2I4B A;  1MXU A;  1NVO A;  1S3J A;  1M5E A;  5I84 A;  3CG3 A;  2PMS A;  3U8Q A;  4RK9 A;  1SI1 A;  1JMB A;  2UYF A;  4IOI H;  2G93 A;  2FA7 A;  1B7H A;  2NOO A;  3PUV E;  3KOT A;  1LCF A;  3O28 A;  1PB8 A;  1B58 A;  3QK6 A;  3Q29 A;  1MDP 1;  3Q25 A;  4HCY A;  1IEJ A;  3MPL A;  3FGS A;  3TDJ A;  1AIV A;  2O7U A;  5EHM A;  1LGB C;  3K0V A;  3UN6 A;  3IAZ A;  5I57 B;  1QVS A;  2I49 A;  3I6V A;  4F2O A;  3MZ1 A;  4QHQ A;  2O84 X;  4MH5 A;  1ZLQ A;  5ISU A;  4ASV A;  5A5X B;  3UGW A;  4ZMD A;  2PX1 A;  1WOD A;  4O3B A;  4QF9 A;  1QUJ A;  2OWS A;  2M8C A;  1ZW0 A;  2HFB A;  3FVG A;  2THI A;  3SEW A;  2F7C A;  1HSJ A;  4YKJ A;  2OZZ A;  3ILT B;  1BIY A;  2F97 A;  1URG A;  1Y4T A;  3GBB A;  4NPF X;  5ELV A;  2XXU A;  2B3B A;  4R9G A;  5JTY A;  4BDQ A;  3OEM A;  4K35 A;  3HCQ A;  2DQV A;  5I2N B;  4OET A;  1BP5 A;  2P0S A;  3MP8 A;  1R1N A;  4Q5T A;  1A54 A;  1UIU A;  1LB9 A;  4I1D A;  1FTL A;  2PT2 A;  2B87 A;  4G8M A;  4U1O A;  2ABH A;  3MP6 A;  2V3Q A;  2ONK E;  4MBP A;  3L6G A;  4F3P A;  1TFA A;  3TYH A;  3FXD A;  4ONY A;  3O6G A;  3KJT A;  4YMB A;  4BDO A;  1A55 A;  1OLC A;  4G4P A;  3GZG A;  5F7V A;  4HTG A;  5DJU B;  4C1T A;  1UTH B;  4F1U A;  1FQB A;  1XT8 A;  2REG A;  3WAF A;  5KCJ A;  4BXL A;  4Z0I A;  1B32 A;  5K2Y A;  1SD3 A;  4LZ8 A;  3S9E A;  1I69 A;  3TTM A;  3LC8 A;  2F6G A;  4G8N A;  3VLU A;  2ZYN A;  4NF5 A;  2DOJ A;  4M1V A;  3A3U A;  4GXS B;  2RKL A;  1MPB A;  1DEE G;  4NMY A;  2CZL A;  4H65 A;  3W9W A;  3IOU A;  3AXF A;  2DVC A;  3KEI A;  4KCC A;  2LXB A;  4LQ5 A;  1ELJ A;  4ELO A;  2I4C A;  2AIX A;  4NWD A;  4THI A;  5H8Q A;  1IXG A;  1GTK A;  1EC5 A;  1US4 A;  4F2Q A;  3OO8 A;  3HPI A;  1CE2 A;  1PDA A;  5FHM A;  4YKP A;  1UQW A;  3BKI B;  4QSC A;  1BLF A;  3CFZ A;  4G68 C;  4OEV A;  4GD5 A;  1B6H A;  2VD2 A;  3LBS A;  3EF7 A;  4F29 A;  3KOS A;  1MY4 A;  3OSR A;  4OQO A;  3MC2 A;  4IB2 A;  3HST A;  4KJM A;  1POT A;  1SW2 A;  3R7X A;  4RK2 A;  3MHV A;  4N13 A;  3U94 A;  1AL3 A;  4H0W A;  2A5T B;  5KDT B;  3I3V A;  2Q8J A;  1B1X A;  1I6Q A;  1PBP A;  4EUO A;  3TPA A;  1N04 A;  1N7W A;  1P1N A;  4X1D A;  1P1W A;  3M3F A;  3IB0 A;  4H67 A;  5DT6 A;  1A40 A;  3QAX A;  1US5 A;  2UVI A;  3CVG A;  3MVW A;  1VE4 A;  1B52 A;  5I59 B;  1IZ1 A;  1U7J A;  3MVZ A;  2O1M A;  2DWH A;  2WKY A;  3PUW E;  3OD7 A;  4POW A;  2ESN A;  2Z22 A;  1IXC A;  3T96 B;  1WVJ A;  1OMP A;  1LCT A;  3IL1 B;  2O6A A;  1LBB A;  1EZP A;  3VLW A;  2ANJ A;  1EH3 A;  4PFY A;  3LSL A;  5AA1 A;  3BBR A;  1GV8 A;  2DE2 A;  1TWY A;  4YB7 A;  2NWJ A;  1MS7 A;  4ZZE A;  3MAM A;  1A99 A;  3E4R A;  3B6Q A;  2X26 A;  4KI0 E;  2F34 A;  3KSX A;  4LZ7 A;  2B89 A;  3H6T A;  2Z8E A;  3B6W A;  1A8E A;  2Y7K A;  2SPZ A;  5K2X A;  4QRZ A;  2D5W A;  4QFL A;  4FEC A;  2O1L A;  1B05 A;  3S9N C;  1GR2 A;  2XXV A;  1O7T A;  3PV0 E;  2XXY A;  3OO6 A;  1XVY A;  4YB5 A;  3VE1 B;  4BDR A;  3VLV A;  1SW4 A;  1O63 A;  1N3W A;  2GFE A;  4XIG Q;  5AA2 D;  4IO4 A;  2H4I A;  1B3E A;  1MY1 A;  1TFD A;  5TP9 A;  3C35 A;  2BJJ X;  2OWT A;  2A5S A;  1ZKB A;  4DIG A;  4QSE A;  3THI A;  5AA4 B;  4CPG A;  3IJX B;  4H6D A;  4ISU A;  2ZAE B;  3O29 A;  4JXI A;  4ZEB A;  2ZXT A;  3PU5 A;  4OES A;  1SYH A;  3SET A;  4LP2 B;  3MPK A;  4U21 A;  2X7P A;  2XXQ A;  4OHN A;  1P99 A;  2DWA A;  1ANF A;  2RCA A;  4ASW A;  1IIT A;  2R6G E;  3H03 A;  3U93 A;  2OBG A;  2V25 A;  3TOD A;  3RT8 A;  2KLF A;  1Y3Q A;  1TXF A;  3HN0 A;  5H8N A;  3EHS A;  2B88 A;  3H4Z A;  3VV5 A;  4OVJ A;  4H1X A;  3JYR A;  1H76 A;  3VVE A;  3OO7 A;  3TEP A;  3EHU A;  1FCK A;  2DWJ A;  4IY5 A;  1Y20 A;  2Y84 A;  4YMA A;  2KUB A;  4KHZ E;  1QKA A;  5DTB A;  5CMK A;  3G3F A;  4NF6 A;  4GQO A;  3KFM A;  4BDL A;  3OOA A;  1M5F A;  2Z8D A;  4PFU A;  2D21 A;  3MW0 A;  4IO5 A;  1N3X A;  3U1O A;  3GBA A;  2P2A A;  2GHB A;  3LUY A;  4H8J A;  3V89 B;  1FQC A;  1O64 A;  4NTL A;  3JZJ A;  3DP4 A;  4EXL A;  1LST A;  1D4N A;  3EPE A;  3K1N A;  1A7L A;  5BWJ A;  5H8Q B;  1AH5 A;  2RC7 A;  3C9H A;  5AA2 B;  1NNP A;  2GRV A;  2YLN A;  1LFI A;  1N7X A;  2VOZ A;  3FAT A;  5LOM A;  4HCW A;  4RNS A;  5TPA B;  2V3T A;  2Q89 A;  3TTK A;  1JEU A;  3CI8 A;  4OFJ A;  3TZA A;  4AB6 A;  1B5I A;  3C31 A;  4X48 A;  2V84 A;  4QSD A;  3OEK A;  4MLV A;  1B3H A;  3PMW A;  3FXE A;  4ESX A;  1MXW A;  3C34 A;  2ALU A;  4G68 B;  5CM6 A;  2XXH A;  1HSL A;  4JDF A;  1OVU A;  5B70 A;  4NF4 A;  4XKQ A;  2Q9T A;  1EDK A;  2ONR A;  1P1Q A;  4JWO A;  2Y7W A;  4FOR A;  5H8F A;  2HCA A;  1YAE A;  1I6A A;  2UXA A;  4H5F A;  3W15 C;  4F1V A;  3TMG A;  3L6H A;  2XHD A;  1B7Z A;  1EU8 A;  4LAT A;  3S4U A;  1FTM A;  4HW8 A;  3K6V A;  2HR3 A;  3I5O A;  2M5A A;  4RA1 A;  2AL4 A;  1JW4 A;  1EZ9 A;  5CI5 A;  4YKI A;  5L8D A;  1MXV A;  3UOR A;  4K3F A;  4R6K A;  2P58 A;  1U7M A;  3HHF A;  3OSQ A;  4NED A;  1ZXG A;  3T9U A;  3H7M A;  3K1P A;  4EYY Q;  2F7A A;  3RLF E;  5ICQ A;  3EHT A;  2X7Q A;  3ZKK A;  2OJT A;  2KZJ A;  2Q2A A;  3QUJ A;  1SW1 A;  5DYH A;  3LSF B;  2QL3 A;  3SER A;  1ZMG A;  4POX A;  1JM0 A;  4R6H A;  5DEX A;  1F9B A;  3TTL A;  4ND9 A;  3CR9 A;  4U4X A;  2ZYM A;  2PYY A;  1TT1 A;  2P1S A;  3KGC A;  1NH7 A;  2YJP A;  3ZKL A;  1LP1 B;  1MH3 A;  4ZZA A;  3DEL B;  4BDN A;  1PBQ A;  2I0B A;  1ATG A;  3VDF A;  2RC9 A;  4U23 A;  4UA8 A;  1Z7M E;  4YZZ A;  5H8N B;  5I2K B;  4MN4 C;  1H3D A;  2Q1K A;  1NL5 A;  3ONM A;  5BUU A;  4ZE8 A;  1PC3 A;  1SYI A;  3CFL A;  3VXB A;  4WEP A;  1VR5 A;  4DXU A;  5B7D A;  3OO9 A;  4Z7E A;  4JWY A;  3IO6 A;  1OVV A;  3UA8 A;  5ICT A;  3CFX A;  1FQF A;  3IJO B;  4GIZ A;  3C4M A;  3A3C A;  3PMX A;  4YU0 A;  3S2V A;  3K01 A;  4EDP A;  2RC8 A;  2UVJ A;  5DVF A;  4I8C A;  3JV9 A;  3FVK A;  4LUB A;  1FTK A;  1JVX A;  2QS2 A;  2O51 A;  4F3G A;  4EF2 A;  2PBW A;  2XD3 A;  1EDL A;  3H3G A;  3E3K A;  1MM6 A;  3O97 A;  3BFT A;  5EHS A;  4FIM A;  3ECR A;  3T93 B;  3Q27 A;  1ZBM A;  4UAC A;  3T22 A;  2DS9 A;  1JVY A;  5H8H A;  5I58 B;  4IO2 A;  2ZNT A;  4KYS A;  1B5H A;  5I56 B;  5IAI A;  4EXK A;  2O68 A;  1ZJL A;  4KQP A;  3G3J A;  2QS1 A;  2GH9 A;  1MH4 A;  4DZ1 A;  4U2R A;  4GWO A;  4O3C A;  2ONS A;  2YPN A;  1MQG A;  1FC2 C;  1OVR A;  3B6T A;  3T9X B;  4NWC A;  1N84 A;  1SI0 A;  3PPR A;  2QS3 A;  2OTK E;  2XXW A;  4F31 B;  4WED A;  4XTC Q;  4NF4 B;  1N76 A;  3H6V A;  4LZ5 A;  1VFE A;  3MZ9 A;  4F19 A;  1B0H A;  3O9P A;  4NF8 B;  3FAS A;  4KYE A;  2H98 A;  2KZI A;  1POY 1;  5F1Q A;  2QMW A;  5M2V A;  5C39 A;  2UWJ E;  1B2H A;  2R9J A;  1QJM A;  1RYX A;  4JBZ A;  5EYF A;  1MY3 A;  1LB8 A;  3M3K A;  3O2A A;  4R72 A;  4YKK A;  5JK4 A;  3PH0 A;  3RTF B;  5DVJ A;  3ZS6 A;  3KZG A;  4Q30 B;  4H8I A;  3HHG A;  4OFO A;  4G77 A;  5L9M A;  3KG2 A;  3EN3 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...