4I6MC

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
LKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords Actin-related protein 7
total genus 30
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.-:
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07529 HSA HSA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i6mC00
3TYYA 3O8ZA 1GU4A 2YO2A 5AVXB 5AW1B 3A7OA 1MFZA 2N9BA 5AVRB 3A3YB 2C9NY 1G2CB 3NTNA 3L36A 1HBWA 4AUWA 3MD0A 1H8AA 2P2UA 3P32A 3NXSA 2WPSA 3NMDA 3HE4A 5APSA 2JJLA 2XU6A 3M9BA 2QM8A 2YO3A 4I2LC 1CZQA 3LIEA 2R3CA 5AW9B 4AYCA 1YYCA 1JNMA 1CI6B 1T2KD 1FOSF 4DZOA 3M9HA 4JYCA 1FAVA 1GK4A 5AW8B 3M0DA 4GKGA 1J2JB 2WT7A 2W6AA 3M0AA 4HYTB 2IPPA 3P8MC 3TNUB 5APWA 3TK1A 1HJBA 1GTWA 1HUCA 5AVYB 2WTYA 3P7KA 1CSBA 5AVWB 5AW2B 3T97A 2W27A 5APYA 1GU5A 5AVVB 1A02J 4AQRD 1GD2E 5AVTB 2H7HA 1OWAA 3A5TA 1NWQA 3A2AA 2E42A 4EOTA 3OAKA 2R5BA 2P67A 1FOSE 5APTA 3L37A 2Q7CA 3M91A 2YNYA 1H89A 3KDPB 1A02F 3I5CA 2XV5A 5AW7B 1JUNA 1HWTC 1MUUA 2KP8A 2R32A 2P7JA 4KHXA 3HE4B 1SLQA 3B8EB 3VN0A 5AW3B 4JYBA 3UIAA 5AW0B 3TNUA 2Z5IA 3HTKA 2VRSA 2E43A 2Z5HA 3HE5A 4LC1A 5AVUB 1DH3A 1KQLA 5AW4B 3VMYA 2BASA 2WPRA 3VMZA 3M06A 3NFQA 1H88A 2WT7B 1IO4A 3VYIA 3V5BA 1S9KD 1GK6A 1X8YA 1SP4A 5AVZB 4C7NA 1CI6A 5AVQB 3VMXA 2XZRA 3V4QA 3HE5B 3SWFA 3V4WA 5APUA 4C46A 5AW6B 2WPQA 2QM7A 5APXA 2WWWA 4C7NB 1OXZA 1S9KE 2Q3IA 4I6MC 5CMZA 5AW5B 1GZLA 2Q5UA 2C9LY 3KQGA 4RESB 1NAFA 2ZFCA 4XE5B 5APQA 3IR9A 3MGNA 5APVA 2R5DA 4M3LA 5AVSB 1MV8A 2ZXEB 4B86A 3LIDA 3VTPC 1T2KC 4GT1A 3L35A
chains in the Genus database with same CATH superfamily
3TYYA 1M57D 3O8ZA 1IFNA 1KB9D 1N7SB 1RQVA 1SQQD 2I1JA 2OYHC 2D2CD 2QJKC 3D6ZA 2NRGA 2YXRB 3F89A 4U3FJ 2P58A 2N9YB 1LTGC 3RL0C 3BCCG 1AV1A 4H44C 1NO4A 3G6EP 2AXTE 2E74B 1YITP 1FU1A 3KHUA 3RK3B 1RF0A 1SFCD 2G8YA 3CX5H 2Q3EA 2PAJA 3NMDA 1N73B 3RK2D 2KZJA 3AE9C 3L74J 1SQPJ 5GTIE 3S4RA 1BDCA 2QE7H 2M5AA 3H1LJ 4ZMDA 2BCCD 2J58A 2YKPA 3LIEA 5AW9B 1YYCA 1T2KD 1IK7A 4DZOA 2E76C 1ZR4A 3M9HA 1YTZI 2KLVA 3H25A 5AW8B 2XNXA 2NPSC 4IL6E 3L72J 1XTGB 1NTKG 3H1KJ 1FE6A 1RHZB 2W6AA 1M1JB 3H1LG 1HGVA 1YI2P 1S5LE 4HYTB 3AEGC 3MUDA 3L73J 4OWFA 1KMIZ 3CCQP 2K3RA 1BE3J 1PGPA 1GTWA 1SQVG 1HH0A 1FBMA 1HUCA 1KZUB 4WBAA 1S4XA 3VP8A 5KJ7C 3B5NA 3L72G 1FZCB 5AVWB 1KORA 3KZIE 2IFMA 3EQ2A 1M56D 2ITAA 1KILC 5KLIB 2P1JA 1T3UA 2C0XA 2KK7A 3ITKA 4HKZH 1BE3G 2K88A 4I1LA 4AQRD 1A02J 1PFIA 2H7HA 3TDKA 3A5TA 1PP9J 3CWBJ 3GHGC 1SQPG 1XTCC 4IFMA 1YIJP 1N2DC 3LW5J 2OTLP 4TLFA 1VF5C 1SQVE 2QJYC 2SPZA 1MZ9A 3LW5H 4U7JA 1NTZG 4NPEA 1YJNP 2OYIA 1FZEA 1L0NG 2H8PD 3A0HH 3FWNA 3MUDC 3S9OA 4R4LA 5KAIE 1OVUA 1RY3A 3MP7B 1VQKP 3JCUE 4H44B 3SFEC 3L75J 2IBZD 3I5CA 5AW7B 3T97B 3EWKA 1QVGO 2P7JA 5KKZB 3G9RA 4KHXA 1RE3C 1SQVD 3GMAA 5B66E 1Q82Q 4H0LD 3OA7A 1QLED 2KNCB 1U57A 3UIAA 2PP6A 1LT9C 3AEFC 5AW0B 3HTKA 2VRSA 3RL0D 4L76A 3TNUA 1GMJA 4PD4E 3L70G 3H1IE 1VQMP 2GA1A 1KN7A 2AXTH 3GG2A 1JTHA 4DOJA 3GF3A 2W90A 3CCVP 1PGJA 2NPSA 4XA4A 3Q5RA 2HPCA 1L2PA 3S1KA 1SQPE 1LTJC 3L73E 1P84I 3VMYA 1NTME 1ZXGA 1URQD 1M1JC 2BCCG 2FXPA 1YTZT 1YJ9P 3H1JJ 3VYIA 1S9KD 1EDIA 1K04A 2Q6QA 2XNDH 5BU8B 3W67A 1RE3A 1P84D 1LTSC 5AVQB 2XZRA 3CX5E 3BCCJ 3CXHI 3HE5B 4H13B 1X22A 4PV1B 1JOCA 4RO0A 1KYOI 2KOGA 2B87B 3AE4C 3HRNA 4UB6E 2YMYA 4L73A 2O3JA 1Q7YQ 1SFCA 2KIKA 2WPQA 4W7ZA 2Q1KA 1EZVI 1EC5A 1L0ND 1OXZA 3L70E 4I6MC 3BRVB 5KLVD 2IZ0A 1RQUA 1VF5B 2RMZA 2QJYB 1PPJD 1NJIQ 4RESB 1JCDA 1JEKA 3L75E 3CWBG 1NTMJ 1JY3O 5GTIH 5CCHC 1DX7A 4M3LA 1MV8A 2FXOA 2ZT9D 2YMKA 1IFJA 1URQC 2OYOA 2PRRA 1L4AC 2WSEJ 3CX5I 1S1CX 1NVOA 3CXHE 2HYNA 3H6PA 3L35A 4NPFX 2A45I 1NYHA 2Q9IA 2FYUJ 1FZCA 1ZOYC 2ZAEB 1SQQE 4UB8H 3F5HA 2YIUB 2KZIA 3A7OA 4OH8B 2GUVA 2XDJA 3H32B 2N9BA 2FFDB 4YXDC 1SFCB 1JMMA 1N7SD 1YBKA 2C9NY 2O1JA 1LTTC 3M0DC 3NTNA 4JBZA 3AE6C 1NGMB 4D6TJ 1FDMA 1LTJA 3L36A 2OYHB 1BCCD 3MD0A 2WITA 1H8AA 2P2UA 2FXMA 2C0WA 3NXSA 1SQBE 2L5GB 5CCGC 4DJGA 1ZRTE 2WSCH 5CBNA 1ZR2A 3CI9A 4ZKPA 3HE4A 2QA4P 4RKUJ 5APSA 1JY3P 1T8ZA 1LP1B 2QM8A 3H1KD 4I2LC 3TF5A 1VQ6P 1VF5D 1Y8AA 2M0BA 2R3CA 1N7LA 2I8DA 4AYCA 1K73Q 2WSFJ 3PH0A 3V2QA 1L4AD 2E5TA 3CCSP 1JNMA 1N73C 1FAVA 2V7QH 2W6JH 2KLUA 4I7ZB 3II6A 1BCCJ 4N3YB 1L0NE 2N1TD 3H1JE 4KJMA 2E75B 3H1LD 3U59A 3CCMP 3EFGA 4YPCA 1LTAC 1ZV8A 2LXCB 3H1HJ 4YXWH 1EDJA 2JWAA 2IPPA 2E76B 3L74E 3TGUJ 3HD7D 3G3ZA 3TNUB 5APWA 5K5GB 3Q5PA 3BCCE 1Q2NA 1HJBA 1ZMEC 2WTYA 1BCCG 4WVZA 1SQBD 4ZNCA 1JTHB 3FGAD 2AEFA 2FYUD 2W6BA 1L0LD 4W80A 1KD1Q 1NTKJ 3L70D 5AW2B 3T97A 3AEEC 2QRXA 1VQ7P 5KLVG 4D6TG 4WWIA 1BGYE 1L4AB 1W5CE 1ZLLA 5AVVB 3V2RA 3WUVA 5CJ4A 1KILA 2A06G 2JP3A 1FZCC 1OWAA 2KS1A 4PD4I 2QJKB 1NWQA 1VPCA 3CCLP 3A2AA 4LGDE 2IDBA 2E75D 3GF7A 5C39A 1VDFA 3H1HD 1FZAA 4GIFA 2YIUC 3OAKA 4ASWA 5KLVJ 2P67A 3CPWO 3JC22 5APTA 1IFIA 2FY8A 4PD4D 1KILB 3RK3C 1Z56A 1RF1C 4D6TD 3WU2H 4BWNA 3L71E 2B87A 3CWBD 1D7MA 1Y47A 2HFED 1KTMA 1NTKD 1PP9D 2NZ2A 2XV5A 2Y0DA 3L70J 2R32A 3M9BA 1JO5A 3AE8C 1YHQP 1LTBC 1SLQA 4H44D 2KI7B 3H32A 3VN0A 2K9JB 3SWYA 4IL6H 1AQTA 1AQ5A 4DCKA 1BDDA 2E43A 1J1EB 1NTZK 2AEJA 2O01J 1FDIA 1KYOH 3GW6A 3HE5A 4Y99C 2LXBA 1VQPP 3PP5A 1ZN5A 2WSCJ 3IFMA 1DH3A 1NU1K 3H1HE 3OJAB 1VQOP 3CC2P 5GTHH 3L74G 3CCRP 1KV4A 4H0LC 3O6QA 3JSVC 2BASA 1SQXD 3Q5SA 2R44A 5E79H 1LTIC 3O6QB 3C1LA 3PTZA 3L71J 1KB9I 1NTKE 3FWLA 1X8YA 2FFDA 1OX3A 3VP9A 5TISH 4IOIH 1DIPA 3VMXA 1T6AA 3AE1C 3BRTB 1Y9BA 3SSUA 2ZYGA 3V4QA 1LTJB 1SQPD 5APUA 2O1KA 2WMMA 3V4WA 2OYHA 2FFDC 4L74A 3V6IA 2B9BA 1VQ5P 3MIWA 1EZVD 4HB1A 1Q90D 1JMBA 4L75A 1N8RQ 2O01N 1UIIA 1S9KE 2Q3IA 4TT3H 1R5LA 2FKWB 4RJTA 1MFTA 1SQQK 2CPBA 4K3AA 3AEAC 4IL6X 4XFJA 5CMZA 1GZLA 1RF0C 5AW5B 1X79B 4EYYQ 1PV3A 1KFNA 1TU3F 1ZP0C 2YKQA 3E7KA 1NAFA 3Q1MA 4XE5B 5APQA 3SWKA 3W68A 4BRYA 5L8RJ 5KKZC 5AVSB 2WSFH 2HPCB 2ZXEB 1NTZJ 1T2KC 1FZFA 1EZVG 5KAIH 3TGUE 4BRYB 3CMAP 2H88C 4OGQB 3RBZA 1LT9B 3B5NC 2OQQA 1YQ3C 3CD6P 3CXHH 2KSJA 3EFFK 3KZIH 3MTUE 2YO2A 1URQB 3RK2C 5CCGD 2WVRA 5AVXB 5AW1B 3RBXA 3ZDMA 2JEEA 1DD3A 4GODA 3R4YA 1JY2P 1MFZA 2QJPB 3L75G 3GHGA 2OYIB 5AVRB 3BVHA 3MHVA 3D70A 1G2CB 4JPZB 3L72D 3HUSC 3H1ID 5KJ7A 3B71A 1EDKA 3P32A 1DEEG 2CK3H 2LR2A 2E5YA 2CPSA 2JJLA 2OARA 1HGZA 3AE2C 3H1KG 1GL2A 1KILE 1JY3N 1OMIA 2XKMA 2YO3A 1PGOA 4OGQD 1UIXA 3G4SP 2QEXP 1RE4C 1J1DB 2KSEA 3L75D 4ZKUA 3TGUG 3CC7P 1PZQA 1SQXE 1FOSF 2WSEH 4JYCA 1LT1A 2IX7C 4NPDA 5CCHD 3D71A 1L0LE 1EQ7A 3V2PA 1FZGA 4DT0A 3M0DA 2M5AB 4Y28J 1SQBJ 1J2JB 2IBZI 2QIWA 2WT7A 1K9MQ 4OVNF 2A45G 3ABVC 5CCGA 2Z4EA 2RH0A 3H1KE 5H2FE 3TK1A 1QVFO 3HUSA 2IBZE 2NPSD 2V4HA 5AVYB 2E75C 2QG4A 4EI2A 2MKVA 2QSIA 2E76D 1M1JA 3SFDC 2B88A 4ASVA 1KQSO 3AE5C 1U7JA 1G1IA 2QVAA 5M1BA 1M8OB 2LKMA 1GL2C 2M8RA 3HD7C 3A0BE 2YXQB 5APYA 2HR3A 4EDFA 2ZT9B 2KUBA 2BEQD 2OTKE 1G1JA 3CWBE 3WUUA 4BXLA 1VL2A 2W83C 2K9JA 2JKVA 5TISE 1SQVJ 5BVZA 5KTBA 2K37A 1NU1G 1EXJA 1SFCC 5E79E 5BU5A 1M7LA 1AA0A 1QX8A 2J59M 3VTPC 1NH4A 2MJZA 1FOSE 3L37A 2Q7CA 2V7QJ 2WPVB 3M91A 1KC8Q 2KB7P 2PGDA 1CW5A 1H89A 3KDPB 4D6TE 3E1RA 1EDLA 1JUNA 1HWTC 1MUUA 2KP8A 2IBZG 3IAOA 1FC2C 4GOFA 3B8EB 5AW3B 3L74D 5CCHA 2Y0CA 3CCUP 4JF7A 5EFWB 1NTMD 1URQA 1LWUB 1H0TB 1L0LK 1SS1A 2K9YA 1IFPA 1OVVA 4WY4B 1L0LG 2Z5HA 1RF1B 1NOHA 2YKOA 4LC1A 3H1JG 1WT6A 5AVUB 1KQFB 2JR8A 3L71G 2HLOA 2POHA 3WU2E 1BE3D 4UB8E 1BGYJ 5CBOA 1HTLC 5AW4B 3TGUD 3B5ND 3CX5D 2WPRA 3U1AA 2W8ZA 3M06A 1WMKA 1GW3A 1JCCA 4WY4A 4Y99B 1H88A 1OZHA 5KLVK 4IFFA 1J1EC 1BSNA 1P84H 1RH5B 2D2CC 2IZ1A 2O01H 4C7RA 1IO4A 3B4SA 1SP4A 4H0LB 3CL3D 2HODA 1ZW0A 2WQYC 4EIJA 3N7NA 3IF4A 2BCCJ 1NHLA 2A06E 1KQGB 2AXCA 2R3SA 3H1HG 4KT0J 2IFNA 2KYVA 4CPGA 4WY4D 1EZVE 1LT9A 2ZT9C 4C46A 5GTHE 3CCEP 1DEBA 2M3BA 1QL1A 2QM7A 5KJ7D 3U1CA 2WWWA 2HODB 1S72P 3C9IA 1KYOE 3K5BA 2NPSB 3KXDA 1NTZD 1N86A 2ZVNB 3KPEA 1GL2D 2B89A 1PP9G 5B5EE 3CCJP 2ZFCA 1NU1J 1S5LX 2FYNB 5DJUB 3VMAA 4U3FE 3P8CD 5APVA 2R5DA 5CHXA 2L91A 1KB9H 3PLNA 2ZJSE 1OW6A 1AVYA 1GW4A 3LIDA 4GOEA 3AECC 5KAFE 4B86A 2E74C 3VOPA 1VQ4P 1FS0E 5KLIC 1M1KQ 4YTPC 3L4FA 1VQ9P 1AFOA 3KYQA 1PIXA 3HTKB 1GU4A 4PJ0H 3BATA 4K35A 1SQPK 1USDA 1WRGA 4A7PA 3RK3E 1LGHB 3A3YB 3MZWB 1W2BO 2JO1A 3IN6A 5DJTB 2JWDA 2FYUG 1QGKB 4R4MA 4OGQC 1Q86Q 3RK2B 1HBWA 1IFMA 2K1AA 4AUWA 1LWUA 3D6YA 2WPSA 3FXEA 4Z1MH 1PP9E 3L71D 3GLMA 4LLHA 4IFDK 1S3JA 1BGYG 3H1JD 3QWOC 2XU6A 4U3FG 2QJPC 3RK3D 1AJYA 1DD4A 3QH9A 3OW2O 2H43A 1QL2A 1CZQA 1W2EA 2GUSA 2FYUK 1NTMG 2KS1B 1CI6B 3A0HE 1FJPA 1T3JA 1FZBA 1GDTA 1AVOA 3H1IG 1GK4A 1NAYA 2IYPA 2IYOA 1LP1A 4N78D 1G2CA 4GKGA 1OFCX 1M90Q 3M0AA 4MN4C 1HF9A 4HJGH 1BGYD 2RN0A 1KILD 1E5WA 1NU1E 2UWJE 3P8MC 4WB4A 3CC4P 1H0TA 1J1DC 1E79H 1JY2N 1L4AA 1S5LH 1NKNA 1SQVK 2Y0EA 2FBWC 3P7KA 3A0BH 2FYNC 3G71P 1SQXJ 4PV1D 1CSBA 3Q3DA 3PJSK 3B5NB 3GHGB 2RKLA 2W27A 1NTKK 1GU5A 1NKZB 3AEDC 1PL5A 2N1TC 2H89C 2KNCA 2DW3A 3FX0A 3HD7A 2A45H 4H13C 4PV1C 5CJ0A 5AVTB 1Q81Q 1JB0J 3TSIA 3AE7C 2OYIC 1GL2B 2E42A 1KFMA 2M3EA 1X9VA 3V2NA 1IC2A 4PD4H 2BCCE 4EOTA 2R5BA 1SQBK 1HJ0A 3HD7B 3HUSB 2YNYA 2HG5D 1YJWP 5KAFH 1VQ8P 3AEBC 1L0LJ 5H2FH 4W7YA 1A02F 1ZRTD 1S2EA 1PPJG 4N6JA 1K05A 2G3AA 4O9BA 2AEMA 3HE4B 3E1IA 3FXDA 5B5EH 2FYUE 1JY2O 4JYBA 5TJHA 1N73A 3L72E 1K8AQ 1QEXA 1N7SC 4UB6H 1FJKA 2N1TA 2J5UA 2Z5IA 2OGUA 5B66H 3CLQA 1L0NK 1R8EA 1SVFA 1LJ2A 1BSHA 3RL0B 3PHLA 3WUTA 1JM0A 4JQ0D 2WZ7A 3H1LE 3N4XA 1KQLA 1LWUC 1R5SA 3Q2YA 2A06D 3WMM0 2ZXXA 4HH2A 4PJ0E 3RL0g 3I55P 3CMEP 3VMZA 2ZVOB 3BCCD 3NFQA 2WT7B 1OIPA 1USEA 1SQBG 3V5BA 4WY4C 1GK6A 4H13D 3I56P 1OW8A 5AVZB 4C7NA 2GM4A 1PPJE 1SQQG 3R2PA 1CI6A 4QMAA 1N7SA 1IJDB 2E74D 1BE3E 1X0TA 3SWFA 1RE4A 3P8CE 1NU1D 1U7MA 1VQLP 2OTJP 1BCCE 1OVRA 4GDOA 1SQXG 3L73G 1NTMK 2N1TB 3PRJA 5AW6B 5APXA 1SQXK 2D2CB 3USSA 2WSSH 4I7ZC 4C7NB 2Y9ZA 3BASA 1VQNP 2BEZF 1MKMA 1SQQJ 3C8VA 1IK9A 1P84E 5KLVE 1GD2E 1RF1A 2FYZA 1PGQA 2Q5UA 3KQGA 3AE3C 1HVVA 1KB9E 3M9QA 2C9LY 4U3FD 3IR9A 1IFDA 2I1KA 2KXPB 1YQ4C 1IZNB 2JDIH 2P10A 2ZYDA 3MGNA 1OW7A 1EXIA 3H1IJ 2PFXA 2Y9YA 1L0NJ 1LNQA 3CXHD 1FDOA 3L73D 4GT1A 4N78E 3RGUA 3JCUH 1KYOD 1NTZE 2ZYAA
chains in the Genus database with same CATH topology
3TYYA 3O8ZA 1IFNA 1N7SB 2I1JA 2OYHC 1LTGC 3RL0C 1NO4A 1FU1A 3RK3B 1RF0A 1SFCD 1N73B 2PAJA 3NMDA 3RK2D 2YKPA 2J58A 3LIEA 5AW9B 1YYCA 1T2KD 4DZOA 1ZR4A 3M9HA 1YTZI 2KLVA 5AW8B 2XNXA 2NPSC 1XTGB 2W6AA 1M1JB 1HGVA 4HYTB 3MUDA 1GTWA 1HH0A 4WBAA 1FBMA 1HUCA 1KZUB 3VP8A 5KJ7C 1FZCB 3B5NA 5AVWB 2IFMA 3EQ2A 1KILC 2P1JA 1T3UA 2C0XA 4AQRD 4I1LA 1A02J 2H7HA 1PFIA 3A5TA 3GHGC 1XTCC 4IFMA 1N2DC 2OYIA 1MZ9A 3LW5H 1FZEA 2H8PD 1RY3A 3I5CA 5AW7B 2P7JA 4KHXA 1RE3C 3OA7A 3UIAA 2PP6A 1LT9C 5AW0B 3RL0D 3HTKA 2VRSA 3TNUA 4DOJA 1JTHA 2NPSA 4XA4A 2HPCA 1LTJC 3VMYA 1URQD 1M1JC 1YTZT 3VYIA 1S9KD 5BU8B 1RE3A 1LTSC 5AVQB 2XZRA 3HE5B 1JOCA 2KOGA 3HRNA 2YMYA 1SFCA 2WPQA 4W7ZA 1OXZA 4I6MC 3BRVB 4RESB 1JCDA 1JY3O 5CCHC 1DX7A 4M3LA 1MV8A 1IFJA 1URQC 4WB4A 3VTPC 1L4AC 3H6PA 2HYNA 3L35A 2A45I 2Q9IA 1FZCA 3A7OA 4OH8B 2GUVA 2XDJA 3H32B 2N9BA 2FFDB 1SFCB 1JMMA 1N7SD 2C9NY 2O1JA 1LTTC 3M0DC 3NTNA 1FDMA 1LTJA 3L36A 2OYHB 3MD0A 2WITA 1H8AA 2P2UA 2FXMA 2C0WA 3NXSA 2L5GB 5CCGC 2WSCH 1ZR2A 3CI9A 4ZKPA 3HE4A 5APSA 1JY3P 1T8ZA 2QM8A 4I2LC 2R3CA 1N7LA 4AYCA 1JNMA 3V2QA 1L4AD 1N73C 1FAVA 3II6A 4N3YB 2N1TD 3U59A 1FZFA 3EFGA 1LTAC 1ZV8A 2IPPA 3HD7D 3G3ZA 3TNUB 5APWA 1HJBA 2WTYA 1JTHB 4W80A 2W6BA 5AW2B 3T97A 3V2RA 1L4AB 1ZLLA 5AVVB 5CJ4A 1KILA 1FZCC 1OWAA 1NWQA 1VPCA 3A2AA 4LGDE 1VDFA 1FZAA 4GIFA 3OAKA 2P67A 5APTA 1IFIA 3RK3C 1KILB 1Z56A 1RF1C 2HFED 2XV5A 2R32A 1JO5A 1LTBC 1SLQA 3VN0A 3H32A 3SWYA 2E43A 1J1EB 1NTZK 3HE5A 4Y99C 3PP5A 1ZN5A 1DH3A 3IFMA 1NU1K 3OJAB 2BASA 1LTIC 1X8YA 2FFDA 3VP9A 3VMXA 3V4QA 3BRTB 3V4WA 1LTJB 2OYHA 5APUA 2O1KA 3MIWA 1S9KE 2Q3IA 2FKWB 2CPBA 1SQQK 5CMZA 5AW5B 1GZLA 1RF0C 1X79B 1KFNA 2YKQA 1NAFA 4XE5B 5APQA 5AVSB 2WSFH 2HPCB 2ZXEB 1T2KC 1LT9B 3B5NC 2KSJA 3MTUE 2YO2A 1URQB 3RK2C 5CCGD 5AVXB 5AW1B 2JEEA 1JY2P 1MFZA 3GHGA 2OYIB 5AVRB 3BVHA 1G2CB 3HUSC 5KJ7A 3P32A 2CPSA 2JJLA 2OARA 1HGZA 3M9BA 2FFDC 1GL2A 2XKMA 1JY3N 1AQ5A 2YO3A 2GM4A 1RE4C 1J1DB 4ZKUA 1FOSF 2WSEH 4JYCA 5CCHD 2IX7C 1EQ7A 3V2PA 1FZGA 3M0DA 1J2JB 2WT7A 2A45G 5CCGA 2Z4EA 3TK1A 3HUSA 2NPSD 5AVYB 1M1JA 1G1IA 2LKMA 1GL2C 2M8RA 3HD7C 5APYA 1G1JA 5BVZA 5KTBA 1SFCC 5BU5A 1M7LA 2J59M 1NH4A 2MJZA 1FOSE 3L37A 2Q7CA 3M91A 2KB7P 1CW5A 1H89A 3KDPB 1JUNA 1HWTC 1MUUA 2KP8A 3B8EB 5AW3B 5CCHA 4JF7A 1URQA 1LWUB 1L0LK 4WY4B 2Z5HA 1RF1B 1NOHA 2YKOA 4LC1A 5AVUB 1WT6A 2HLOA 2POHA 1HTLC 5AW4B 3B5ND 2WPRA 3U1AA 3M06A 4Y99B 1GW3A 1JCCA 4WY4A 1H88A 5KLVK 4IFFA 1J1EC 1IO4A 2O01H 4C7RA 1SP4A 3CL3D 2HODA 4EIJA 3N7NA 1NHLA 2IFNA 2KYVA 4WY4D 1LT9A 4C46A 1DEBA 2M3BA 1QL1A 2QM7A 5KJ7D 3U1CA 2WWWA 2HODB 3C9IA 2NPSB 1N86A 3KPEA 1GL2D 2ZFCA 3P8CD 5APVA 2R5DA 5CHXA 4B86A 3LIDA 1GW4A 3VOPA 3L4FA 1AFOA 3KYQA 3HTKB 1GU4A 3BATA 1SQPK 1WRGA 1LGHB 3A3YB 3RK2B 1HBWA 1IFMA 4AUWA 1LWUA 2WPSA 4LLHA 4IFDK 3RK3D 2XU6A 2H43A 1QL2A 1CZQA 1W2EA 2GUSA 2FYUK 1CI6B 1FJPA 1T3JA 1FZBA 1GDTA 1GK4A 4N78D 1G2CA 4GKGA 3M0AA 1KILD 1E5WA 3P8MC 1J1DC 1JY2N 1L4AA 1NKNA 1SQVK 3P7KA 1CSBA 3B5NB 3GHGB 2W27A 1NTKK 1GU5A 1NKZB 2N1TC 3HD7A 5CJ0A 5AVTB 1GD2E 2A45H 3TSIA 2OYIC 1GL2B 2E42A 1KFMA 1X9VA 3V2NA 1IC2A 4EOTA 2R5BA 1SQBK 3HUSB 3HD7B 2YNYA 2HG5D 1A02F 4W7YA 4N6JA 4O9BA 3HE4B 3E1IA 1JY2O 4JYBA 1N73A 1N7SC 1FJKA 2N1TA 2Z5IA 3CLQA 1L0NK 1SVFA 3RL0B 2WZ7A 3N4XA 1KQLA 1LWUC 3WMM0 4HH2A 3VMZA 3NFQA 2WT7B 3V5BA 4WY4C 1GK6A 5AVZB 4C7NA 3R2PA 1CI6A 1N7SA 1IJDB 3SWFA 1RE4A 3P8CE 5AW6B 1NTMK 2N1TB 5APXA 1SQXK 4C7NB 3BASA 1IK9A 1RF1A 2FYZA 2Q5UA 3KQGA 3M9QA 2C9LY 1HVVA 3IR9A 1IFDA 2I1KA 3MGNA 4GT1A 4N78E
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3TYY A;  3O8Z A;  1GU4 A;  2YO2 A;  5AVX B;  5AW1 B;  3A7O A;  1MFZ A;  2N9B A;  5AVR B;  3A3Y B;  2C9N Y;  1G2C B;  3NTN A;  3L36 A;  1HBW A;  4AUW A;  3MD0 A;  1H8A A;  2P2U A;  3P32 A;  3NXS A;  2WPS A;  3NMD A;  3HE4 A;  5APS A;  2JJL A;  2XU6 A;  3M9B A;  2QM8 A;  2YO3 A;  4I2L C;  1CZQ A;  3LIE A;  2R3C A;  5AW9 B;  4AYC A;  1YYC A;  1JNM A;  1CI6 B;  1T2K D;  1FOS F;  4DZO A;  3M9H A;  4JYC A;  1FAV A;  1GK4 A;  5AW8 B;  3M0D A;  4GKG A;  1J2J B;  2WT7 A;  2W6A A;  3M0A A;  4HYT B;  2IPP A;  3P8M C;  3TNU B;  5APW A;  3TK1 A;  1HJB A;  1GTW A;  1HUC A;  5AVY B;  2WTY A;  3P7K A;  1CSB A;  5AVW B;  5AW2 B;  3T97 A;  2W27 A;  5APY A;  1GU5 A;  5AVV B;  1A02 J;  4AQR D;  1GD2 E;  5AVT B;  2H7H A;  1OWA A;  3A5T A;  1NWQ A;  3A2A A;  2E42 A;  4EOT A;  3OAK A;  2R5B A;  2P67 A;  1FOS E;  5APT A;  3L37 A;  2Q7C A;  3M91 A;  2YNY A;  1H89 A;  3KDP B;  1A02 F;  3I5C A;  2XV5 A;  5AW7 B;  1JUN A;  1HWT C;  1MUU A;  2KP8 A;  2R32 A;  2P7J A;  4KHX A;  3HE4 B;  1SLQ A;  3B8E B;  3VN0 A;  5AW3 B;  4JYB A;  3UIA A;  5AW0 B;  3TNU A;  2Z5I A;  3HTK A;  2VRS A;  2E43 A;  2Z5H A;  3HE5 A;  4LC1 A;  5AVU B;  1DH3 A;  1KQL A;  5AW4 B;  3VMY A;  2BAS A;  2WPR A;  3VMZ A;  3M06 A;  3NFQ A;  1H88 A;  2WT7 B;  1IO4 A;  3VYI A;  3V5B A;  1S9K D;  1GK6 A;  1X8Y A;  1SP4 A;  5AVZ B;  4C7N A;  1CI6 A;  5AVQ B;  3VMX A;  2XZR A;  3V4Q A;  3HE5 B;  3SWF A;  3V4W A;  5APU A;  4C46 A;  5AW6 B;  2WPQ A;  2QM7 A;  5APX A;  2WWW A;  4C7N B;  1OXZ A;  1S9K E;  2Q3I A;  4I6M C;  5CMZ A;  5AW5 B;  1GZL A;  2Q5U A;  2C9L Y;  3KQG A;  4RES B;  1NAF A;  2ZFC A;  4XE5 B;  5APQ A;  3IR9 A;  3MGN A;  5APV A;  2R5D A;  4M3L A;  5AVS B;  1MV8 A;  2ZXE B;  4B86 A;  3LID A;  3VTP C;  1T2K C;  4GT1 A;  3L35 A; 
#chains in the Genus database with same CATH topology
 3TYY A;  1M57 D;  3O8Z A;  1IFN A;  1KB9 D;  1N7S B;  1RQV A;  1SQQ D;  2I1J A;  2OYH C;  2D2C D;  2QJK C;  3D6Z A;  2NRG A;  2YXR B;  3F89 A;  4U3F J;  2P58 A;  2N9Y B;  1LTG C;  3RL0 C;  3BCC G;  1AV1 A;  4H44 C;  1NO4 A;  3G6E P;  2AXT E;  2E74 B;  1YIT P;  1FU1 A;  3KHU A;  3RK3 B;  1RF0 A;  1SFC D;  2G8Y A;  3CX5 H;  2Q3E A;  2PAJ A;  3NMD A;  1N73 B;  3RK2 D;  2KZJ A;  3AE9 C;  3L74 J;  1SQP J;  5GTI E;  3S4R A;  1BDC A;  2QE7 H;  2M5A A;  3H1L J;  4ZMD A;  2BCC D;  2J58 A;  2YKP A;  3LIE A;  5AW9 B;  1YYC A;  1T2K D;  1IK7 A;  4DZO A;  2E76 C;  1ZR4 A;  3M9H A;  1YTZ I;  2KLV A;  3H25 A;  5AW8 B;  2XNX A;  2NPS C;  4IL6 E;  3L72 J;  1XTG B;  1NTK G;  3H1K J;  1FE6 A;  1RHZ B;  2W6A A;  1M1J B;  3H1L G;  1HGV A;  1YI2 P;  1S5L E;  4HYT B;  3AEG C;  3MUD A;  3L73 J;  4OWF A;  1KMI Z;  3CCQ P;  2K3R A;  1BE3 J;  1PGP A;  1GTW A;  1SQV G;  1HH0 A;  1FBM A;  1HUC A;  1KZU B;  4WBA A;  1S4X A;  3VP8 A;  5KJ7 C;  3B5N A;  3L72 G;  1FZC B;  5AVW B;  1KOR A;  3KZI E;  2IFM A;  3EQ2 A;  1M56 D;  2ITA A;  1KIL C;  5KLI B;  2P1J A;  1T3U A;  2C0X A;  2KK7 A;  3ITK A;  4HKZ H;  1BE3 G;  2K88 A;  4I1L A;  4AQR D;  1A02 J;  1PFI A;  2H7H A;  3TDK A;  3A5T A;  1PP9 J;  3CWB J;  3GHG C;  1SQP G;  1XTC C;  4IFM A;  1YIJ P;  1N2D C;  3LW5 J;  2OTL P;  4TLF A;  1VF5 C;  1SQV E;  2QJY C;  2SPZ A;  1MZ9 A;  3LW5 H;  4U7J A;  1NTZ G;  4NPE A;  1YJN P;  2OYI A;  1FZE A;  1L0N G;  2H8P D;  3A0H H;  3FWN A;  3MUD C;  3S9O A;  4R4L A;  5KAI E;  1OVU A;  1RY3 A;  3MP7 B;  1VQK P;  3JCU E;  4H44 B;  3SFE C;  3L75 J;  2IBZ D;  3I5C A;  5AW7 B;  3T97 B;  3EWK A;  1QVG O;  2P7J A;  5KKZ B;  3G9R A;  4KHX A;  1RE3 C;  1SQV D;  3GMA A;  5B66 E;  1Q82 Q;  4H0L D;  3OA7 A;  1QLE D;  2KNC B;  1U57 A;  3UIA A;  2PP6 A;  1LT9 C;  3AEF C;  5AW0 B;  3HTK A;  2VRS A;  3RL0 D;  4L76 A;  3TNU A;  1GMJ A;  4PD4 E;  3L70 G;  3H1I E;  1VQM P;  2GA1 A;  1KN7 A;  2AXT H;  3GG2 A;  1JTH A;  4DOJ A;  3GF3 A;  2W90 A;  3CCV P;  1PGJ A;  2NPS A;  4XA4 A;  3Q5R A;  2HPC A;  1L2P A;  3S1K A;  1SQP E;  1LTJ C;  3L73 E;  1P84 I;  3VMY A;  1NTM E;  1ZXG A;  1URQ D;  1M1J C;  2BCC G;  2FXP A;  1YTZ T;  1YJ9 P;  3H1J J;  3VYI A;  1S9K D;  1EDI A;  1K04 A;  2Q6Q A;  2XND H;  5BU8 B;  3W67 A;  1RE3 A;  1P84 D;  1LTS C;  5AVQ B;  2XZR A;  3CX5 E;  3BCC J;  3CXH I;  3HE5 B;  4H13 B;  1X22 A;  4PV1 B;  1JOC A;  4RO0 A;  1KYO I;  2KOG A;  2B87 B;  3AE4 C;  3HRN A;  4UB6 E;  2YMY A;  4L73 A;  2O3J A;  1Q7Y Q;  1SFC A;  2KIK A;  2WPQ A;  4W7Z A;  2Q1K A;  1EZV I;  1EC5 A;  1L0N D;  1OXZ A;  3L70 E;  4I6M C;  3BRV B;  5KLV D;  2IZ0 A;  1RQU A;  1VF5 B;  2RMZ A;  2QJY B;  1PPJ D;  1NJI Q;  4RES B;  1JCD A;  1JEK A;  3L75 E;  3CWB G;  1NTM J;  1JY3 O;  5GTI H;  5CCH C;  1DX7 A;  4M3L A;  1MV8 A;  2FXO A;  2ZT9 D;  2YMK A;  1IFJ A;  1URQ C;  2OYO A;  2PRR A;  1L4A C;  2WSE J;  3CX5 I;  1S1C X;  1NVO A;  3CXH E;  2HYN A;  3H6P A;  3L35 A;  4NPF X;  2A45 I;  1NYH A;  2Q9I A;  2FYU J;  1FZC A;  1ZOY C;  2ZAE B;  1SQQ E;  4UB8 H;  3F5H A;  2YIU B;  2KZI A;  3A7O A;  4OH8 B;  2GUV A;  2XDJ A;  3H32 B;  2N9B A;  2FFD B;  4YXD C;  1SFC B;  1JMM A;  1N7S D;  1YBK A;  2C9N Y;  2O1J A;  1LTT C;  3M0D C;  3NTN A;  4JBZ A;  3AE6 C;  1NGM B;  4D6T J;  1FDM A;  1LTJ A;  3L36 A;  2OYH B;  1BCC D;  3MD0 A;  2WIT A;  1H8A A;  2P2U A;  2FXM A;  2C0W A;  3NXS A;  1SQB E;  2L5G B;  5CCG C;  4DJG A;  1ZRT E;  2WSC H;  5CBN A;  1ZR2 A;  3CI9 A;  4ZKP A;  3HE4 A;  2QA4 P;  4RKU J;  5APS A;  1JY3 P;  1T8Z A;  1LP1 B;  2QM8 A;  3H1K D;  4I2L C;  3TF5 A;  1VQ6 P;  1VF5 D;  1Y8A A;  2M0B A;  2R3C A;  1N7L A;  2I8D A;  4AYC A;  1K73 Q;  2WSF J;  3PH0 A;  3V2Q A;  1L4A D;  2E5T A;  3CCS P;  1JNM A;  1N73 C;  1FAV A;  2V7Q H;  2W6J H;  2KLU A;  4I7Z B;  3II6 A;  1BCC J;  4N3Y B;  1L0N E;  2N1T D;  3H1J E;  4KJM A;  2E75 B;  3H1L D;  3U59 A;  3CCM P;  3EFG A;  4YPC A;  1LTA C;  1ZV8 A;  2LXC B;  3H1H J;  4YXW H;  1EDJ A;  2JWA A;  2IPP A;  2E76 B;  3L74 E;  3TGU J;  3HD7 D;  3G3Z A;  3TNU B;  5APW A;  5K5G B;  3Q5P A;  3BCC E;  1Q2N A;  1HJB A;  1ZME C;  2WTY A;  1BCC G;  4WVZ A;  1SQB D;  4ZNC A;  1JTH B;  3FGA D;  2AEF A;  2FYU D;  2W6B A;  1L0L D;  4W80 A;  1KD1 Q;  1NTK J;  3L70 D;  5AW2 B;  3T97 A;  3AEE C;  2QRX A;  1VQ7 P;  5KLV G;  4D6T G;  4WWI A;  1BGY E;  1L4A B;  1W5C E;  1ZLL A;  5AVV B;  3V2R A;  3WUV A;  5CJ4 A;  1KIL A;  2A06 G;  2JP3 A;  1FZC C;  1OWA A;  2KS1 A;  4PD4 I;  2QJK B;  1NWQ A;  1VPC A;  3CCL P;  3A2A A;  4LGD E;  2IDB A;  2E75 D;  3GF7 A;  5C39 A;  1VDF A;  3H1H D;  1FZA A;  4GIF A;  2YIU C;  3OAK A;  4ASW A;  5KLV J;  2P67 A;  3CPW O;  3JC2 2;  5APT A;  1IFI A;  2FY8 A;  4PD4 D;  1KIL B;  3RK3 C;  1Z56 A;  1RF1 C;  4D6T D;  3WU2 H;  4BWN A;  3L71 E;  2B87 A;  3CWB D;  1D7M A;  1Y47 A;  2HFE D;  1KTM A;  1NTK D;  1PP9 D;  2NZ2 A;  2XV5 A;  2Y0D A;  3L70 J;  2R32 A;  3M9B A;  1JO5 A;  3AE8 C;  1YHQ P;  1LTB C;  1SLQ A;  4H44 D;  2KI7 B;  3H32 A;  3VN0 A;  2K9J B;  3SWY A;  4IL6 H;  1AQT A;  1AQ5 A;  4DCK A;  1BDD A;  2E43 A;  1J1E B;  1NTZ K;  2AEJ A;  2O01 J;  1FDI A;  1KYO H;  3GW6 A;  3HE5 A;  4Y99 C;  2LXB A;  1VQP P;  3PP5 A;  1ZN5 A;  2WSC J;  3IFM A;  1DH3 A;  1NU1 K;  3H1H E;  3OJA B;  1VQO P;  3CC2 P;  5GTH H;  3L74 G;  3CCR P;  1KV4 A;  4H0L C;  3O6Q A;  3JSV C;  2BAS A;  1SQX D;  3Q5S A;  2R44 A;  5E79 H;  1LTI C;  3O6Q B;  3C1L A;  3PTZ A;  3L71 J;  1KB9 I;  1NTK E;  3FWL A;  1X8Y A;  2FFD A;  1OX3 A;  3VP9 A;  5TIS H;  4IOI H;  1DIP A;  3VMX A;  1T6A A;  3AE1 C;  3BRT B;  1Y9B A;  3SSU A;  2ZYG A;  3V4Q A;  1LTJ B;  1SQP D;  5APU A;  2O1K A;  2WMM A;  3V4W A;  2OYH A;  2FFD C;  4L74 A;  3V6I A;  2B9B A;  1VQ5 P;  3MIW A;  1EZV D;  4HB1 A;  1Q90 D;  1JMB A;  4L75 A;  1N8R Q;  2O01 N;  1UII A;  1S9K E;  2Q3I A;  4TT3 H;  1R5L A;  2FKW B;  4RJT A;  1MFT A;  1SQQ K;  2CPB A;  4K3A A;  3AEA C;  4IL6 X;  4XFJ A;  5CMZ A;  1GZL A;  1RF0 C;  5AW5 B;  1X79 B;  4EYY Q;  1PV3 A;  1KFN A;  1TU3 F;  1ZP0 C;  2YKQ A;  3E7K A;  1NAF A;  3Q1M A;  4XE5 B;  5APQ A;  3SWK A;  3W68 A;  4BRY A;  5L8R J;  5KKZ C;  5AVS B;  2WSF H;  2HPC B;  2ZXE B;  1NTZ J;  1T2K C;  1FZF A;  1EZV G;  5KAI H;  3TGU E;  4BRY B;  3CMA P;  2H88 C;  4OGQ B;  3RBZ A;  1LT9 B;  3B5N C;  2OQQ A;  1YQ3 C;  3CD6 P;  3CXH H;  2KSJ A;  3EFF K;  3KZI H;  3MTU E;  2YO2 A;  1URQ B;  3RK2 C;  5CCG D;  2WVR A;  5AVX B;  5AW1 B;  3RBX A;  3ZDM A;  2JEE A;  1DD3 A;  4GOD A;  3R4Y A;  1JY2 P;  1MFZ A;  2QJP B;  3L75 G;  3GHG A;  2OYI B;  5AVR B;  3BVH A;  3MHV A;  3D70 A;  1G2C B;  4JPZ B;  3L72 D;  3HUS C;  3H1I D;  5KJ7 A;  3B71 A;  1EDK A;  3P32 A;  1DEE G;  2CK3 H;  2LR2 A;  2E5Y A;  2CPS A;  2JJL A;  2OAR A;  1HGZ A;  3AE2 C;  3H1K G;  1GL2 A;  1KIL E;  1JY3 N;  1OMI A;  2XKM A;  2YO3 A;  1PGO A;  4OGQ D;  1UIX A;  3G4S P;  2QEX P;  1RE4 C;  1J1D B;  2KSE A;  3L75 D;  4ZKU A;  3TGU G;  3CC7 P;  1PZQ A;  1SQX E;  1FOS F;  2WSE H;  4JYC A;  1LT1 A;  2IX7 C;  4NPD A;  5CCH D;  3D71 A;  1L0L E;  1EQ7 A;  3V2P A;  1FZG A;  4DT0 A;  3M0D A;  2M5A B;  4Y28 J;  1SQB J;  1J2J B;  2IBZ I;  2QIW A;  2WT7 A;  1K9M Q;  4OVN F;  2A45 G;  3ABV C;  5CCG A;  2Z4E A;  2RH0 A;  3H1K E;  5H2F E;  3TK1 A;  1QVF O;  3HUS A;  2IBZ E;  2NPS D;  2V4H A;  5AVY B;  2E75 C;  2QG4 A;  4EI2 A;  2MKV A;  2QSI A;  2E76 D;  1M1J A;  3SFD C;  2B88 A;  4ASV A;  1KQS O;  3AE5 C;  1U7J A;  1G1I A;  2QVA A;  5M1B A;  1M8O B;  2LKM A;  1GL2 C;  2M8R A;  3HD7 C;  3A0B E;  2YXQ B;  5APY A;  2HR3 A;  4EDF A;  2ZT9 B;  2KUB A;  2BEQ D;  2OTK E;  1G1J A;  3CWB E;  3WUU A;  4BXL A;  1VL2 A;  2W83 C;  2K9J A;  2JKV A;  5TIS E;  1SQV J;  5BVZ A;  5KTB A;  2K37 A;  1NU1 G;  1EXJ A;  1SFC C;  5E79 E;  5BU5 A;  1M7L A;  1AA0 A;  1QX8 A;  2J59 M;  3VTP C;  1NH4 A;  2MJZ A;  1FOS E;  3L37 A;  2Q7C A;  2V7Q J;  2WPV B;  3M91 A;  1KC8 Q;  2KB7 P;  2PGD A;  1CW5 A;  1H89 A;  3KDP B;  4D6T E;  3E1R A;  1EDL A;  1JUN A;  1HWT C;  1MUU A;  2KP8 A;  2IBZ G;  3IAO A;  1FC2 C;  4GOF A;  3B8E B;  5AW3 B;  3L74 D;  5CCH A;  2Y0C A;  3CCU P;  4JF7 A;  5EFW B;  1NTM D;  1URQ A;  1LWU B;  1H0T B;  1L0L K;  1SS1 A;  2K9Y A;  1IFP A;  1OVV A;  4WY4 B;  1L0L G;  2Z5H A;  1RF1 B;  1NOH A;  2YKO A;  4LC1 A;  3H1J G;  1WT6 A;  5AVU B;  1KQF B;  2JR8 A;  3L71 G;  2HLO A;  2POH A;  3WU2 E;  1BE3 D;  4UB8 E;  1BGY J;  5CBO A;  1HTL C;  5AW4 B;  3TGU D;  3B5N D;  3CX5 D;  2WPR A;  3U1A A;  2W8Z A;  3M06 A;  1WMK A;  1GW3 A;  1JCC A;  4WY4 A;  4Y99 B;  1H88 A;  1OZH A;  5KLV K;  4IFF A;  1J1E C;  1BSN A;  1P84 H;  1RH5 B;  2D2C C;  2IZ1 A;  2O01 H;  4C7R A;  1IO4 A;  3B4S A;  1SP4 A;  4H0L B;  3CL3 D;  2HOD A;  1ZW0 A;  2WQY C;  4EIJ A;  3N7N A;  3IF4 A;  2BCC J;  1NHL A;  2A06 E;  1KQG B;  2AXC A;  2R3S A;  3H1H G;  4KT0 J;  2IFN A;  2KYV A;  4CPG A;  4WY4 D;  1EZV E;  1LT9 A;  2ZT9 C;  4C46 A;  5GTH E;  3CCE P;  1DEB A;  2M3B A;  1QL1 A;  2QM7 A;  5KJ7 D;  3U1C A;  2WWW A;  2HOD B;  1S72 P;  3C9I A;  1KYO E;  3K5B A;  2NPS B;  3KXD A;  1NTZ D;  1N86 A;  2ZVN B;  3KPE A;  1GL2 D;  2B89 A;  1PP9 G;  5B5E E;  3CCJ P;  2ZFC A;  1NU1 J;  1S5L X;  2FYN B;  5DJU B;  3VMA A;  4U3F E;  3P8C D;  5APV A;  2R5D A;  5CHX A;  2L91 A;  1KB9 H;  3PLN A;  2ZJS E;  1OW6 A;  1AVY A;  1GW4 A;  3LID A;  4GOE A;  3AEC C;  5KAF E;  4B86 A;  2E74 C;  3VOP A;  1VQ4 P;  1FS0 E;  5KLI C;  1M1K Q;  4YTP C;  3L4F A;  1VQ9 P;  1AFO A;  3KYQ A;  1PIX A;  3HTK B;  1GU4 A;  4PJ0 H;  3BAT A;  4K35 A;  1SQP K;  1USD A;  1WRG A;  4A7P A;  3RK3 E;  1LGH B;  3A3Y B;  3MZW B;  1W2B O;  2JO1 A;  3IN6 A;  5DJT B;  2JWD A;  2FYU G;  1QGK B;  4R4M A;  4OGQ C;  1Q86 Q;  3RK2 B;  1HBW A;  1IFM A;  2K1A A;  4AUW A;  1LWU A;  3D6Y A;  2WPS A;  3FXE A;  4Z1M H;  1PP9 E;  3L71 D;  3GLM A;  4LLH A;  4IFD K;  1S3J A;  1BGY G;  3H1J D;  3QWO C;  2XU6 A;  4U3F G;  2QJP C;  3RK3 D;  1AJY A;  1DD4 A;  3QH9 A;  3OW2 O;  2H43 A;  1QL2 A;  1CZQ A;  1W2E A;  2GUS A;  2FYU K;  1NTM G;  2KS1 B;  1CI6 B;  3A0H E;  1FJP A;  1T3J A;  1FZB A;  1GDT A;  1AVO A;  3H1I G;  1GK4 A;  1NAY A;  2IYP A;  2IYO A;  1LP1 A;  4N78 D;  1G2C A;  4GKG A;  1OFC X;  1M90 Q;  3M0A A;  4MN4 C;  1HF9 A;  4HJG H;  1BGY D;  2RN0 A;  1KIL D;  1E5W A;  1NU1 E;  2UWJ E;  3P8M C;  4WB4 A;  3CC4 P;  1H0T A;  1J1D C;  1E79 H;  1JY2 N;  1L4A A;  1S5L H;  1NKN A;  1SQV K;  2Y0E A;  2FBW C;  3P7K A;  3A0B H;  2FYN C;  3G71 P;  1SQX J;  4PV1 D;  1CSB A;  3Q3D A;  3PJS K;  3B5N B;  3GHG B;  2RKL A;  2W27 A;  1NTK K;  1GU5 A;  1NKZ B;  3AED C;  1PL5 A;  2N1T C;  2H89 C;  2KNC A;  2DW3 A;  3FX0 A;  3HD7 A;  2A45 H;  4H13 C;  4PV1 C;  5CJ0 A;  5AVT B;  1Q81 Q;  1JB0 J;  3TSI A;  3AE7 C;  2OYI C;  1GL2 B;  2E42 A;  1KFM A;  2M3E A;  1X9V A;  3V2N A;  1IC2 A;  4PD4 H;  2BCC E;  4EOT A;  2R5B A;  1SQB K;  1HJ0 A;  3HD7 B;  3HUS B;  2YNY A;  2HG5 D;  1YJW P;  5KAF H;  1VQ8 P;  3AEB C;  1L0L J;  5H2F H;  4W7Y A;  1A02 F;  1ZRT D;  1S2E A;  1PPJ G;  4N6J A;  1K05 A;  2G3A A;  4O9B A;  2AEM A;  3HE4 B;  3E1I A;  3FXD A;  5B5E H;  2FYU E;  1JY2 O;  4JYB A;  5TJH A;  1N73 A;  3L72 E;  1K8A Q;  1QEX A;  1N7S C;  4UB6 H;  1FJK A;  2N1T A;  2J5U A;  2Z5I A;  2OGU A;  5B66 H;  3CLQ A;  1L0N K;  1R8E A;  1SVF A;  1LJ2 A;  1BSH A;  3RL0 B;  3PHL A;  3WUT A;  1JM0 A;  4JQ0 D;  2WZ7 A;  3H1L E;  3N4X A;  1KQL A;  1LWU C;  1R5S A;  3Q2Y A;  2A06 D;  3WMM 0;  2ZXX A;  4HH2 A;  4PJ0 E;  3RL0 g;  3I55 P;  3CME P;  3VMZ A;  2ZVO B;  3BCC D;  3NFQ A;  2WT7 B;  1OIP A;  1USE A;  1SQB G;  3V5B A;  4WY4 C;  1GK6 A;  4H13 D;  3I56 P;  1OW8 A;  5AVZ B;  4C7N A;  2GM4 A;  1PPJ E;  1SQQ G;  3R2P A;  1CI6 A;  4QMA A;  1N7S A;  1IJD B;  2E74 D;  1BE3 E;  1X0T A;  3SWF A;  1RE4 A;  3P8C E;  1NU1 D;  1U7M A;  1VQL P;  2OTJ P;  1BCC E;  1OVR A;  4GDO A;  1SQX G;  3L73 G;  1NTM K;  2N1T B;  3PRJ A;  5AW6 B;  5APX A;  1SQX K;  2D2C B;  3USS A;  2WSS H;  4I7Z C;  4C7N B;  2Y9Z A;  3BAS A;  1VQN P;  2BEZ F;  1MKM A;  1SQQ J;  3C8V A;  1IK9 A;  1P84 E;  5KLV E;  1GD2 E;  1RF1 A;  2FYZ A;  1PGQ A;  2Q5U A;  3KQG A;  3AE3 C;  1HVV A;  1KB9 E;  3M9Q A;  2C9L Y;  4U3F D;  3IR9 A;  1IFD A;  2I1K A;  2KXP B;  1YQ4 C;  1IZN B;  2JDI H;  2P10 A;  2ZYD A;  3MGN A;  1OW7 A;  1EXI A;  3H1I J;  2PFX A;  2Y9Y A;  1L0N J;  1LNQ A;  3CXH D;  1FDO A;  3L73 D;  4GT1 A;  4N78 E;  3RGU A;  3JCU H;  1KYO D;  1NTZ E;  2ZYA A; 
#chains in the Genus database with same CATH homology
 3TYY A;  3O8Z A;  1IFN A;  1N7S B;  2I1J A;  2OYH C;  1LTG C;  3RL0 C;  1NO4 A;  1FU1 A;  3RK3 B;  1RF0 A;  1SFC D;  1N73 B;  2PAJ A;  3NMD A;  3RK2 D;  2YKP A;  2J58 A;  3LIE A;  5AW9 B;  1YYC A;  1T2K D;  4DZO A;  1ZR4 A;  3M9H A;  1YTZ I;  2KLV A;  5AW8 B;  2XNX A;  2NPS C;  1XTG B;  2W6A A;  1M1J B;  1HGV A;  4HYT B;  3MUD A;  1GTW A;  1HH0 A;  4WBA A;  1FBM A;  1HUC A;  1KZU B;  3VP8 A;  5KJ7 C;  1FZC B;  3B5N A;  5AVW B;  2IFM A;  3EQ2 A;  1KIL C;  2P1J A;  1T3U A;  2C0X A;  4AQR D;  4I1L A;  1A02 J;  2H7H A;  1PFI A;  3A5T A;  3GHG C;  1XTC C;  4IFM A;  1N2D C;  2OYI A;  1MZ9 A;  3LW5 H;  1FZE A;  2H8P D;  1RY3 A;  3I5C A;  5AW7 B;  2P7J A;  4KHX A;  1RE3 C;  3OA7 A;  3UIA A;  2PP6 A;  1LT9 C;  5AW0 B;  3RL0 D;  3HTK A;  2VRS A;  3TNU A;  4DOJ A;  1JTH A;  2NPS A;  4XA4 A;  2HPC A;  1LTJ C;  3VMY A;  1URQ D;  1M1J C;  1YTZ T;  3VYI A;  1S9K D;  5BU8 B;  1RE3 A;  1LTS C;  5AVQ B;  2XZR A;  3HE5 B;  1JOC A;  2KOG A;  3HRN A;  2YMY A;  1SFC A;  2WPQ A;  4W7Z A;  1OXZ A;  4I6M C;  3BRV B;  4RES B;  1JCD A;  1JY3 O;  5CCH C;  1DX7 A;  4M3L A;  1MV8 A;  1IFJ A;  1URQ C;  4WB4 A;  3VTP C;  1L4A C;  3H6P A;  2HYN A;  3L35 A;  2A45 I;  2Q9I A;  1FZC A;  3A7O A;  4OH8 B;  2GUV A;  2XDJ A;  3H32 B;  2N9B A;  2FFD B;  1SFC B;  1JMM A;  1N7S D;  2C9N Y;  2O1J A;  1LTT C;  3M0D C;  3NTN A;  1FDM A;  1LTJ A;  3L36 A;  2OYH B;  3MD0 A;  2WIT A;  1H8A A;  2P2U A;  2FXM A;  2C0W A;  3NXS A;  2L5G B;  5CCG C;  2WSC H;  1ZR2 A;  3CI9 A;  4ZKP A;  3HE4 A;  5APS A;  1JY3 P;  1T8Z A;  2QM8 A;  4I2L C;  2R3C A;  1N7L A;  4AYC A;  1JNM A;  3V2Q A;  1L4A D;  1N73 C;  1FAV A;  3II6 A;  4N3Y B;  2N1T D;  3U59 A;  1FZF A;  3EFG A;  1LTA C;  1ZV8 A;  2IPP A;  3HD7 D;  3G3Z A;  3TNU B;  5APW A;  1HJB A;  2WTY A;  1JTH B;  4W80 A;  2W6B A;  5AW2 B;  3T97 A;  3V2R A;  1L4A B;  1ZLL A;  5AVV B;  5CJ4 A;  1KIL A;  1FZC C;  1OWA A;  1NWQ A;  1VPC A;  3A2A A;  4LGD E;  1VDF A;  1FZA A;  4GIF A;  3OAK A;  2P67 A;  5APT A;  1IFI A;  3RK3 C;  1KIL B;  1Z56 A;  1RF1 C;  2HFE D;  2XV5 A;  2R32 A;  1JO5 A;  1LTB C;  1SLQ A;  3VN0 A;  3H32 A;  3SWY A;  2E43 A;  1J1E B;  1NTZ K;  3HE5 A;  4Y99 C;  3PP5 A;  1ZN5 A;  1DH3 A;  3IFM A;  1NU1 K;  3OJA B;  2BAS A;  1LTI C;  1X8Y A;  2FFD A;  3VP9 A;  3VMX A;  3V4Q A;  3BRT B;  3V4W A;  1LTJ B;  2OYH A;  5APU A;  2O1K A;  3MIW A;  1S9K E;  2Q3I A;  2FKW B;  2CPB A;  1SQQ K;  5CMZ A;  5AW5 B;  1GZL A;  1RF0 C;  1X79 B;  1KFN A;  2YKQ A;  1NAF A;  4XE5 B;  5APQ A;  5AVS B;  2WSF H;  2HPC B;  2ZXE B;  1T2K C;  1LT9 B;  3B5N C;  2KSJ A;  3MTU E;  2YO2 A;  1URQ B;  3RK2 C;  5CCG D;  5AVX B;  5AW1 B;  2JEE A;  1JY2 P;  1MFZ A;  3GHG A;  2OYI B;  5AVR B;  3BVH A;  1G2C B;  3HUS C;  5KJ7 A;  3P32 A;  2CPS A;  2JJL A;  2OAR A;  1HGZ A;  3M9B A;  2FFD C;  1GL2 A;  2XKM A;  1JY3 N;  1AQ5 A;  2YO3 A;  2GM4 A;  1RE4 C;  1J1D B;  4ZKU A;  1FOS F;  2WSE H;  4JYC A;  5CCH D;  2IX7 C;  1EQ7 A;  3V2P A;  1FZG A;  3M0D A;  1J2J B;  2WT7 A;  2A45 G;  5CCG A;  2Z4E A;  3TK1 A;  3HUS A;  2NPS D;  5AVY B;  1M1J A;  1G1I A;  2LKM A;  1GL2 C;  2M8R A;  3HD7 C;  5APY A;  1G1J A;  5BVZ A;  5KTB A;  1SFC C;  5BU5 A;  1M7L A;  2J59 M;  1NH4 A;  2MJZ A;  1FOS E;  3L37 A;  2Q7C A;  3M91 A;  2KB7 P;  1CW5 A;  1H89 A;  3KDP B;  1JUN A;  1HWT C;  1MUU A;  2KP8 A;  3B8E B;  5AW3 B;  5CCH A;  4JF7 A;  1URQ A;  1LWU B;  1L0L K;  4WY4 B;  2Z5H A;  1RF1 B;  1NOH A;  2YKO A;  4LC1 A;  5AVU B;  1WT6 A;  2HLO A;  2POH A;  1HTL C;  5AW4 B;  3B5N D;  2WPR A;  3U1A A;  3M06 A;  4Y99 B;  1GW3 A;  1JCC A;  4WY4 A;  1H88 A;  5KLV K;  4IFF A;  1J1E C;  1IO4 A;  2O01 H;  4C7R A;  1SP4 A;  3CL3 D;  2HOD A;  4EIJ A;  3N7N A;  1NHL A;  2IFN A;  2KYV A;  4WY4 D;  1LT9 A;  4C46 A;  1DEB A;  2M3B A;  1QL1 A;  2QM7 A;  5KJ7 D;  3U1C A;  2WWW A;  2HOD B;  3C9I A;  2NPS B;  1N86 A;  3KPE A;  1GL2 D;  2ZFC A;  3P8C D;  5APV A;  2R5D A;  5CHX A;  4B86 A;  3LID A;  1GW4 A;  3VOP A;  3L4F A;  1AFO A;  3KYQ A;  3HTK B;  1GU4 A;  3BAT A;  1SQP K;  1WRG A;  1LGH B;  3A3Y B;  3RK2 B;  1HBW A;  1IFM A;  4AUW A;  1LWU A;  2WPS A;  4LLH A;  4IFD K;  3RK3 D;  2XU6 A;  2H43 A;  1QL2 A;  1CZQ A;  1W2E A;  2GUS A;  2FYU K;  1CI6 B;  1FJP A;  1T3J A;  1FZB A;  1GDT A;  1GK4 A;  4N78 D;  1G2C A;  4GKG A;  3M0A A;  1KIL D;  1E5W A;  3P8M C;  1J1D C;  1JY2 N;  1L4A A;  1NKN A;  1SQV K;  3P7K A;  1CSB A;  3B5N B;  3GHG B;  2W27 A;  1NTK K;  1GU5 A;  1NKZ B;  2N1T C;  3HD7 A;  5CJ0 A;  5AVT B;  1GD2 E;  2A45 H;  3TSI A;  2OYI C;  1GL2 B;  2E42 A;  1KFM A;  1X9V A;  3V2N A;  1IC2 A;  4EOT A;  2R5B A;  1SQB K;  3HUS B;  3HD7 B;  2YNY A;  2HG5 D;  1A02 F;  4W7Y A;  4N6J A;  4O9B A;  3HE4 B;  3E1I A;  1JY2 O;  4JYB A;  1N73 A;  1N7S C;  1FJK A;  2N1T A;  2Z5I A;  3CLQ A;  1L0N K;  1SVF A;  3RL0 B;  2WZ7 A;  3N4X A;  1KQL A;  1LWU C;  3WMM 0;  4HH2 A;  3VMZ A;  3NFQ A;  2WT7 B;  3V5B A;  4WY4 C;  1GK6 A;  5AVZ B;  4C7N A;  3R2P A;  1CI6 A;  1N7S A;  1IJD B;  3SWF A;  1RE4 A;  3P8C E;  5AW6 B;  1NTM K;  2N1T B;  5APX A;  1SQX K;  4C7N B;  3BAS A;  1IK9 A;  1RF1 A;  2FYZ A;  2Q5U A;  3KQG A;  3M9Q A;  2C9L Y;  1HVV A;  3IR9 A;  1IFD A;  2I1K A;  3MGN A;  4GT1 A;  4N78 E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...