4I6MC

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
LKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 30
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.-:
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07529 HSA HSA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i6mC00
3MGNA 2WPSA 1CZQA 3VMXA 5AW0B 1J2JB 5AVWB 5AW6B 2QM7A 2VRSA 4KHXA 1GK6A 4EOTA 5APTA 1GD2E 2BASA 2IPPA 3NMDA 3M06A 1GU4A 2ZFCA 1HUCA 3V4WA 3O8ZA 3M0DA 1NWQA 2Q7CA 3KDPB 2QM8A 3NXSA 5APUA 3TYYA 3NTNA 1T2KD 2WTYA 4DZOA 5APWA 2JJLA 2YO2A 3TNUA 3A5TA 5AVUB 1H8AA 1FOSE 2C9LY 5AW7B 2P7JA 3TNUB 1HWTC 3HE4B 2WT7B 2XZRA 5AVXB 2W6AA 5APQA 4JYBA 1G2CB 3KQGA 3NFQA 1OWAA 2W27A 3UIAA 1H88A 5CMZA 3M0AA 4M3LA 5AVRB 2Q3IA 5AVYB 5AW3B 1CSBA 1MV8A 3VN0A 5AVVB 1SP4A 1A02J 1FAVA 2E43A 1X8YA 2WWWA 5AW5B 1YYCA 5AW8B 2R32A 2Z5IA 2P2UA 4RESB 1IO4A 1S9KE 5AW1B 4C46A 4XE5B 3P7KA 4HYTB 4GKGA 3A3YB 1T2KC 3OAKA 1NAFA 2ZXEB 2WPQA 1MUUA 2WPRA 2H7HA 4C7NA 3P8MC 1A02F 5AVQB 1H89A 1GK4A 4C7NB 2YNYA 1KQLA 3L37A 2KP8A 3VMYA 3M9BA 5AW9B 1S9KD 5AVZB 3A7OA 2XV5A 3LIDA 3V5BA 5APVA 1HBWA 3M91A 5APSA 3L36A 1JNMA 3L35A 1JUNA 1GTWA 5AW4B 2P67A 1FOSF 2E42A 3V4QA 2R3CA 5AVSB 1MFZA 4AYCA 3TK1A 4AUWA 3M9HA 3T97A 1HJBA 4I2LC 3P32A 1DH3A 4I6MC 2R5BA 2YO3A 4AQRD 5AVTB 4B86A 3VMZA 3A2AA 1GU5A 1GZLA 3HE5A 4LC1A 1CI6A 2R5DA 3HTKA 4GT1A 5AW2B 5APXA 2N9BA 2XU6A 3I5CA 3B8EB 3HE4A 3LIEA 4JYCA 3VTPC 2WT7A 2Q5UA 3MD0A 2Z5HA 3HE5B 1SLQA 5APYA 3VYIA 2C9NY 1CI6B 3SWFA 3IR9A 1OXZA
chains in the Genus database with same CATH superfamily
3GHGC 3VMXA 3SWYA 1W5CE 1N7SA 4W7YA 2K1AA 2B88A 1G1IA 3M0DA 3MZWB 3HUSC 1GL2A 2Q7CA 3AEBC 2QJPC 1ZRTE 3CXHH 3PP5A 4PD4I 1Q81Q 3CCQP 4K35A 2KZIA 2WT7B 1QX8A 2A06E 3RL0D 5E79E 3M0AA 5TISE 1N86A 2OYHB 2WWWA 1RF1B 3MP7B 1IO4A 1JMBA 1FS0E 1SS1A 3E1RA 4H13B 1M8OB 3AEGC 1X79B 5CCGD 1MUUA 3R4YA 1BCCG 1L0LG 1N2DC 2AXCA 2FFDB 5AVQB 4C7RA 3RGUA 1OIPA 1WMKA 3AEEC 3S9OA 1IFIA 1KB9H 5GTIH 3LIDA 1L0NK 3VMAA 1ZMEC 2GUVA 2CK3H 2PAJA 1KYOD 4N78D 3C1LA 3T97A 3B5NA 1LTSC 3L72J 3TSIA 4EDFA 1T3UA 1LTBC 3U59A 1LT9B 3QH9A 2WMMA 3HTKA 2JWDA 1N7SC 1CI6B 3WU2E 1KTMA 1YIJP 4O9BA 3M0DC 1OW8A 2IBZE 2YKOA 2FXOA 2WZ7A 3KZIE 3FXDA 2WTYA 5KJ7A 4ZKPA 4GDOA 2M5AB 3TGUE 1RF1A 3VN0A 1FAVA 4XFJA 3PLNA 2ZYDA 2FFDA 3C8VA 4Z1MH 1OFCX 1VF5B 3BCCE 3D71A 3P8MC 3MUDA 1EXIA 3L71G 3L37A 2W6BA 1RHZB 3A0BE 1SQBK 4PJ0E 3L70D 1USEA 1FZAA 3V2RA 2WVRA 3GF3A 3B5NC 1N8RQ 1SQQD 3RK2C 3M9HA 3H25A 1BGYG 1LT9A 2RH0A 1FDIA 4I6MC 1IFJA 3N4XA 4H0LD 4HJGH 5CBNA 1JEKA 1L0NE 1CI6A 2XU6A 3CX5E 1T3JA 3MGNA 1CZQA 5M1BA 1EDIA 3H1HD 1M56D 3RL0B 3HD7A 5APTA 2XKMA 2FYZA 1HVVA 3AE1C 5KJ7C 1IZNB 4OWFA 1BDDA 4KT0J 3I55P 2M5AA 1P84I 1P84E 3AE8C 5AW7B 2OYHC 1ZOYC 4LLHA 1RF1C 2ZT9D 5APQA 1NAYA 2OQQA 1EDKA 1ZR4A 4H13C 1KORA 1G2CB 3NFQA 2E74D 2AXTH 5KLVD 2Q3IA 2FFDC 1JO5A 4YXWH 1HJ0A 2P1JA 2W6JH 3CXHD 3KYQA 3MUDC 1OX3A 3E7KA 1YJ9P 2WSSH 1H89A 2G8YA 2N1TB 1FJKA 3M9BA 1S9KD 1N7SD 1NTKK 4UB6H 3L74D 1PIXA 4A7PA 1GL2D 1LT9C 1VQOP 5KAIE 3SWKA 2R3CA 3GF7A 4AYCA 3BATA 1M1KQ 3CCLP 1SQPK 2V7QH 1AA0A 2WSFJ 1LWUB 2Q5UA 4UB8H 1DIPA 1NTMD 2P58A 4KHXA 5B66E 1R5LA 3L70J 2ZYGA 2BEZF 2WSEH 2FYUG 3D6ZA 2HG5D 1NTZG 1EDLA 5CCGA 2PGDA 1S72P 5APWA 3A5TA 3SFDC 1NU1G 3FGAD 2XDJA 1FOSE 1G2CA 3H1KD 2KLVA 3USSA 2W6AA 3H32B 2IBZG 3Q5SA 3L75G 1OWAA 3UIAA 3CPWO 1SQQK 1S3JA 2E43A 1EC5A 1YYCA 3B5ND 3H1HJ 2O01N 1BE3D 2N1TA 3TGUG 4H0LB 3CI9A 4XA4A 1KYOI 1KYOE 1JY2P 1L4AB 3V5BA 2BCCG 3BCCG 5KLVJ 2KZJA 3RK3E 1YI2P 1YBKA 1OW7A 2JR8A 5KJ7D 1FZFA 3P32A 4L74A 2FBWC 2G3AA 1NTKE 3AEFC 3RL0C 1Y47A 3WMM0 1E79H 2ZT9B 3U1AA 4IL6E 2QM7A 1VQ8P 2ZJSE 4WBAA 2E76B 1EDJA 2E74B 2BASA 5CCGC 3M06A 2HR3A 4D6TG 2IYPA 3O8ZA 1S1CX 4ASVA 4N6JA 5B5EH 4BRYA 1FDOA 1SQPE 1EZVD 1L0NG 5APUA 2Z4EA 1Y9BA 1HGVA 4YTPC 3H32A 2OTLP 1SQXD 3G3ZA 3KQGA 2M3EA 3CMAP 1HGZA 2I8DA 1NTMJ 1KQSO 2KSJA 2N1TC 1LTJB 1GL2B 4XE5B 3OJAB 1DD3A 2A45G 3KXDA 3JC22 1SQQE 1L4AA 5AVZB 3HD7D 1RE4A 3L72D 3SSUA 1ZW0A 3N7NA 2J58A 2IFNA 1LWUC 3B71A 4EIJA 5AVSB 1BE3J 1NYHA 3H1HE 4NPDA 3RL0g 1VQ9P 1KFNA 1Y8AA 3Q2YA 3AE6C 2AEJA 1YQ3C 3AE3C 2GM4A 3CMEP 1VF5D 3H1JD 2E75D 4HH2A 1QEXA 1OW6A 1SQBG 2O3JA 2ITAA 2NZ2A 3WUTA 3CWBE 2C9LY 3CXHI 3CXHE 4H44D 1ZXGA 1PP9D 4TLFA 5CMZA 1SQVD 5K5GB 1LTJA 1T6AA 2IZ0A 5EFWB 4H0LC 3EWKA 1K05A 1S9KE 1RH5B 1JY3N 2Q6QA 4PD4E 4ASWA 3L73D 1K9MQ 3L74E 1L4AC 2H7HA 2WSCH 2UWJE 1FZEA 2POHA 3D70A 1KQLA 2GA1A 3LW5H 1DD4A 4WY4D 1J1EB 1SQXJ 2MJZA 1RE3A 2DW3A 3E1IA 2KYVA 4Y99B 3VP8A 5GTIE 1SFCB 2ZVOB 5H2FH 2ZYAA 3L4FA 1FDMA 2ZT9C 1GMJA 2Q1KA 2E76C 2E74C 1K8AQ 5E79H 2E5TA 3SWFA 2SPZA 1GD2E 1HUCA 2HFED 3H1KE 1NTKG 1FZBA 2N1TD 3G6EP 1QL2A 1X9VA 2CPBA 1JMMA 1MFTA 4JBZA 1HWTC 1BE3E 2KOGA 1LTJC 1GL2C 2WITA 2YKQA 1M1JB 1KN7A 1ZN5A 2W27A 2QJYB 3HD7B 1SQPG 3H1LD 1D7MA 2NPSA 5AW1B 3H1JJ 3P7KA 4EYYQ 1KILD 1PGOA 2B89A 3RBXA 2B9BA 1ZP0C 2V7QJ 1RE3C 1S2EA 3WU2H 2OYOA 3AECC 1Q86Q 4K3AA 1SFCA 3FWNA 3L35A 1PP9J 1R5SA 1QVFO 1PPJE 2JO1A 1SQVJ 2WSEJ 2E75B 3KZIH 2H88C 4YPCA 1SQQG 2N9YB 4AQRD 2J59M 3H6PA 4U3FJ 4HB1A 3L73J 4IFDK 5AW2B 3WUUA 2OGUA 3HE4A 1HF9A 1AVYA 1EZVI 1EZVE 3GW6A 4H44B 2WPSA 1LNQA 2KK7A 1VQPP 2IDBA 1SQXE 1IFPA 2QSIA 3ZDMA 1GW3A 4KJMA 1PL5A 3TYYA 4DZOA 1L4AD 3W68A 1HH0A 5DJTB 2C0XA 1M1JA 3L71D 1YITP 1NGMB 3A0BH 2Y9ZA 4PJ0H 4WY4B 2AEFA 1PGPA 4WVZA 3MIWA 1A02J 2LR2A 2OTKE 1QL1A 2AXTE 3GG2A 2Y0EA 1TU3F 2JP3A 1BGYD 3CWBG 2Y9YA 4GKGA 2ZXEB 2WPQA 1J1EC 3L72E 1QGKB 2HODB 2NRGA 4W7ZA 4NPFX 1BCCJ 1L0LJ 2E76D 4Y99C 2YNYA 3CX5H 1SFCC 2QA4P 2V4HA 2KP8A 3G71P 1LTGC 5APVA 3H1ID 1JUNA 2HYNA 3A0HH 3L74G 1VQ4P 4BWNA 1OVUA 2Q9IA 1UIIA 2A06G 3H1LJ 1ZLLA 3GLMA 1DH3A 1NVOA 1P84H 2A45H 1Q82Q 1S5LH 2W8ZA 3VYIA 5APYA 5CJ4A 4YXDC 1BSHA 2K37A 1VQLP 2QE7H 2VRSA 4UB8E 1LT1A 2PP6A 3U1CA 2QM8A 1PP9E 3NXSA 1KB9D 1M1JC 5BU8B 1SQVE 3IN6A 2QJYC 1VPCA 4LGDE 1IC2A 5GTHE 3HD7C 5KKZB 3JCUE 1KILB 3TNUB 1AQ5A 4ZKUA 3CCRP 5BU5A 4WY4A 1KD1Q 3L73E 3H1KG 3TF5A 2LKMA 2B87B 1SP4A 5CCHD 1EXJA 5KAIH 5AW8B 3S4RA 1LTTC 4BRYB 4L76A 4C46A 3ITKA 3A3YB 4ZMDA 1NAFA 2HODA 2RKLA 2HPCB 2Y0DA 3M9QA 1W2EA 5AW9B 1VF5C 2PFXA 2E75C 3A7OA 1M90Q 2XV5A 3L71J 3V2NA 5B66H 1GTWA 2WQYC 4N3YB 4OVNF 5AW4B 2D2CD 3AE2C 1PGJA 1GDTA 2FYUD 1NTZD 3TK1A 4H44C 3V2QA 2O01H 5C39A 1NU1D 1BGYJ 1GZLA 4N78E 2QIWA 4LC1A 1N7LA 3MD0A 1FOSF 2IBZD 3L75D 2R3SA 1PPJG 3KHUA 1PFIA 2KS1B 2NPSD 2K3RA 2E5YA 2YIUB 2ZFCA 1PZQA 3H1IJ 1LTIC 2L91A 1NWQA 1Z56A 1LTAC 3C9IA 3NTNA 3AE7C 1KILA 3TNUA 2WSCJ 2FYNB 4WY4C 5B5EE 5AVUB 1CW5A 1EZVG 5KLVK 3KPEA 3H1LE 2PRRA 2QRXA 1Q90D 1KYOH 5AVXB 1SFCD 1U57A 2B87A 4EI2A 1KILE 4I7ZB 2BCCD 1FE6A 3CD6P 1IJDB 2Z5IA 1J1DB 2HPCA 1DX7A 4L73A 3D6YA 2IZ1A 5BVZA 3Q5PA 3BRVB 1S5LX 4IL6H 2ZAEB 3PH0A 2C0WA 5APSA 3L36A 4D6TD 3L72G 3L70E 3PTZA 1L0ND 1HJBA 2KSEA 2YO3A 4B86A 5AVTB 3CX5D 3A2AA 1NTMK 1U7JA 4ZNCA 1ZR2A 1PV3A 2C9NY 2KS1A 2FY8A 5AW6B 2GUSA 1YHQP 3MHVA 1AV1A 3NMDA 1ZV8A 3L71E 5KKZC 1KILC 2RN0A 3FX0A 2Q3EA 2FYUJ 1NTZJ 2YXQB 2QEXP 1NU1J 4OGQB 1BGYE 1S4XA 4NPEA 3PHLA 4M3LA 5AVVB 3L75J 2D2CB 5KLVE 1NO4A 2YXRB 3V6IA 2JDIH 2H8PD 2KNCB 3H1IE 3FXEA 3IFMA 1Q2NA 4QMAA 3TGUJ 1VQMP 4TT3H 2J5UA 3B4SA 3R2PA 2Y0CA 2K9YA 5KAFH 4U3FD 1X0TA 3SFEC 3IAOA 2NPSB 1KQFB 2BCCJ 1SQBD 2K88A 2KUBA 3BCCJ 2YMKA 1WT6A 3VOPA 3Q5RA 1RE4C 3CCVP 5H2FE 1JOCA 1JY2O 3CC7P 2YIUC 2ZVNB 2IX7C 1KB9I 1KB9E 5AVWB 5AW0B 1OVVA 3I56P 3F5HA 2LXCB 5CCHA 2FYNC 2M3BA 1NTME 4PD4H 4DCKA 1SQXK 1YJNP 2KXPB 4D6TJ 1L0NJ 1FC2C 4I7ZC 4RJTA 3HE4B 1JY3P 1JCDA 5TISH 4GOFA 4R4MA 1SVFA 2I1KA 1J1DC 1H88A 2AEMA 4IL6X 1MV8A 5AW3B 1HTLC 2K9JA 5L8RJ 4BXLA 1BCCD 1L0LD 1R8EA 2KNCA 3H1LG 4L75A 3O6QB 3G4SP 2WPRA 1KZUB 1GK4A 5TJHA 3S1KA 2FYUE 1NTZE 3MTUE 3BVHA 1VL2A 4JPZB 2O1KA 2JEEA 3RK3D 1JTHB 1NU1E 4OH8B 2R44A 2E42A 1RY3A 1WRGA 2QJKB 3V4QA 1NTKD 1UIXA 1NH4A 3GMAA 5CBOA 2IBZI 3L75E 2OYIB 1FZCB 3Q3DA 1NHLA 3RBZA 2R5DA 1KV4A 2WT7A 4R4LA 3HE5B 1G1JA 5CCHC 1OXZA 4IOIH 1J2JB 3L70G 1SQPD 2OYHA 2H43A 3V4WA 1VQ6P 4OGQC 3F89A 4PV1D 1KFMA 3CC2P 2YO2A 1SQBJ 4RKUJ 2BCCE 4GIFA 1SQVK 1QLED 1URQB 2XZRA 2D2CC 1M7LA 1MZ9A 2H89C 1XTCC 3P8CD 3H1HG 4JF7A 1CSBA 2P10A 2M0BA 2JWAA 3AE5C 1VQ7P 4WWIA 3O6QA 4RO0A 1IFDA 3V2PA 2IFMA 1VQKP 1XTGB 3OAKA 2JKVA 2O01J 2I1JA 1OMIA 4D6TE 3EQ2A 2NPSC 1JTHA 3CX5I 3M91A 5KLVG 1H0TB 2P67A 3H1IG 2OYIA 1FZCA 2FKWB 2OARA 4HKZH 3A0HE 1IK7A 3VMZA 4JQ0D 3HE5A 2QG4A 1BSNA 1NKZB 2A45I 4UB6E 1S5LE 4I1LA 5KLIB 1N73B 1L0LK 1Q7YQ 3CCSP 4GOEA 1GU4A 4CPGA 2LXBA 1VQNP 3CWBD 3H1JE 1NTKJ 2JJLA 1KMIZ 3AE4C 1URQA 1H8AA 5CJ0A 4GODA 1M57D 1JY3O 2KLUA 1AFOA 1NTMG 1ZRTD 5AVRB 5AVYB 3FWLA 4PD4D 1X8YA 2RMZA 3RK3B 4RESB 1SQPJ 2A06D 3OA7A 1T2KC 1OZHA 3JSVC 1NKNA 2HLOA 4U3FE 4C7NB 1U7MA 1OVRA 1RQVA 2QJKC 3VMYA 1SQBE 4MN4C 2QVAA 2W90A 1H0TA 1HBWA 2OYIC 1FZCC 1PGQA 3TDKA 2O1JA 2CPSA 3K5BA 3WUVA 1YJWP 1BE3G 1JB0J 2FXMA 1USDA 2KIKA 4OGQD 2R5BA 1JY2N 5GTHH 1GW4A 4PV1B 3JCUH 3BASA 1SQQJ 4GT1A 2OTJP 5APXA 2N9BA 2XNXA 3B8EB 3LIEA 3VTPC 5KTBA 1N73A 1VDFA 3PRJA 3OW2O 1GK6A 2YMYA 4EOTA 4DT0A 2IYOA 1LJ2A 1KQGB 2IPPA 1MKMA 3II6A 1URQC 3GHGB 4Y28J 1QVGO 3W67A 1NJIQ 3RK2D 1W2BO 2P7JA 1FZGA 3HUSB 3AEAC 1BCCE 1AQTA 1L0LE 4DJGA 2QJPB 1RQUA 1EQ7A 1RF0A 5CHXA 2W83C 1K73Q 1VQ5P 2L5GB 1YQ4C 3TGUD 4HYTB 3BRTB 4C7NA 1A02F 3CWBJ 3LW5J 1SQXG 1LWUA 1NOHA 3CLQA 3Q1MA 1AJYA 1PPJD 1LP1B 3BCCD 3CCMP 4H13D 1IFMA 1IK9A 1K04A 4AUWA 3CCEP 3L74J 1E5WA 1GU5A 5KLIC 1N73C 2KI7B 3CL3D 3IR9A 4WB4A 2WPVB 3AE9C 1DEBA 4U7JA 3GHGA 1DEEG 3AEDC 1N7SB 3CC4P 3PJSK 3KDPB 1T2KD 3P8CE 3HUSA 3CCUP 1AVOA 2WSFH 3RK3C 1RF0C 1LGHB 1YTZI 1L2PA 1IFNA 4JYBA 1YTZT 3IF4A 3H1JG 3H1KJ 1P84D 1T8ZA 5AW5B 3HRNA 2R32A 3EFGA 2P2UA 3ABVC 2BEQD 1JM0A 1JCCA 1X22A 1FJPA 2MKVA 1LP1A 4DOJA 2FYUK 2YKPA 1PP9G 1NTZK 3QWOC 3EFFK 2ZXXA 1SQVG 1JNMA 2K9JB 3G9RA 2M8RA 4PV1C 2XNDH 4IFMA 1NU1K 1FU1A 1KC8Q 1MFZA 5KAFE 1URQD 4U3FG 3VP9A 4I2LC 5DJUB 1BDCA 3L73G 2KB7P 3T97B 3B5NB 3RK2B 3I5CA 1FBMA 4IFFA 4JYCA 3CCJP 4W80A 2Z5HA 2FXPA 3HTKB 1SLQA
chains in the Genus database with same CATH topology
3GHGC 3VMXA 1J2JB 3SWYA 3U1AA 2QM7A 1N7SA 2VRSA 3WMM0 4WBAA 4W7YA 2BASA 2PP6A 5CCGC 3M06A 2OYHA 2H43A 3V4WA 1G1IA 3O8ZA 3M0DA 4N6JA 3U1CA 3HUSC 1GL2A 2Q7CA 2QM8A 3NXSA 5APUA 1KFMA 1M1JC 2Z4EA 5BU8B 3PP5A 2YO2A 1VPCA 4LGDE 1IC2A 1HGVA 4GIFA 3HD7C 1SQVK 1KILB 3H32A 3TNUB 1AQ5A 4ZKUA 1URQB 2WT7B 2XZRA 5BU5A 4WY4A 3G3ZA 1M7LA 3KQGA 1MZ9A 3RL0D 3M0AA 1XTCC 3P8CD 4JF7A 2LKMA 1CSBA 1SP4A 1N86A 5CCHD 1HGZA 2OYHB 2WWWA 1RF1B 5AW8B 2KSJA 1IO4A 2N1TC 1IFDA 1LTTC 1LTJB 1GL2B 3V2PA 4C46A 4XE5B 2IFMA 1X79B 3A3YB 5CCGD 1XTGB 3OAKA 3OJAB 1NAFA 2HODA 1MUUA 2A45G 1N2DC 2FFDB 2I1JA 5AVQB 2HPCB 4C7RA 3M9QA 1L4AA 3EQ2A 2NPSC 1W2EA 5AW9B 1IFIA 5AVZB 1JTHA 3A7OA 3HD7D 2XV5A 3LIDA 3V2NA 1L0NK 1RE4A 3M91A 3N7NA 2J58A 1GTWA 4N3YB 5AW4B 2P67A 2IFNA 2GUVA 1GDTA 2OYIA 1FZCA 1LWUC 2PAJA 4EIJA 2FKWB 2OARA 4N78D 5AVSB 3TK1A 3T97A 3B5NA 1LTSC 3TSIA 1T3UA 1LTBC 3V2QA 2O01H 3VMZA 3U59A 1LT9B 1GZLA 4N78E 3HE5A 4LC1A 3HTKA 1KFNA 1N7LA 1N7SC 3MD0A 1NKZB 1CI6B 1FOSF 2GM4A 4O9BA 2A45I 1PFIA 3M0DC 4I1LA 1N73B 2NPSD 1L0LK 4HH2A 1GU4A 2ZFCA 1LTIC 1NWQA 1Z56A 1LTAC 2YKOA 2WZ7A 3C9IA 3NTNA 2WTYA 1KILA 2JJLA 3TNUA 5KJ7A 1URQA 4WY4C 5AVUB 1CW5A 1H8AA 5KLVK 3KPEA 5CJ0A 2C9LY 4ZKPA 1JY3O 5AVXB 1SFCD 1AFOA 5CMZA 5AVRB 1RF1A 5AVYB 3VN0A 1LTJA 1FAVA 1X8YA 3RK3B 1IJDB 2Z5IA 4RESB 1S9KE 1JY3N 3OA7A 1J1DB 2FFDA 1T2KC 1L4AC 2HPCA 1DX7A 2H7HA 2WSCH 1NKNA 3P8MC 2HLOA 3MUDA 5BVZA 1FZEA 2POHA 4C7NB 1KQLA 3L37A 2W6BA 3VMYA 3LW5H 4WY4D 3BRVB 1J1EB 1SQBK 2MJZA 2C0WA 1RE3A 5APSA 1HBWA 3L36A 1FZAA 2OYIC 1FZCC 3E1IA 3V2RA 2KYVA 4Y99B 3B5NC 3VP8A 1SFCB 2O1JA 2CPSA 3RK2C 3M9HA 2FXMA 1HJBA 3L4FA 1LT9A 1FDMA 4I6MC 2R5BA 2YO3A 1IFJA 1JY2N 3N4XA 5AVTB 4B86A 1GW4A 3A2AA 1NTMK 3BASA 1ZR2A 1CI6A 4GT1A 5APXA 2N9BA 2XNXA 2XU6A 3B8EB 3LIEA 3VTPC 5KTBA 1T3JA 2C9NY 3SWFA 1N73A 1VDFA 3MGNA 1CZQA 5AW6B 2GUSA 1GK6A 2YMYA 3RL0B 4EOTA 3HD7A 5APTA 1GD2E 2IPPA 3II6A 3NMDA 1ZV8A 2XKMA 2FYZA 1HUCA 2HFED 1HVVA 1KILC 1FZBA 5KJ7C 1URQC 3GHGB 2N1TD 1QL2A 1X9VA 2CPBA 3RK2D 1JMMA 5AW7B 2P7JA 1FZGA 2OYHC 3HUSB 1HWTC 4LLHA 2KOGA 1RF1C 5APQA 1ZR4A 1LTJC 1GL2C 2WITA 2YKQA 1G2CB 1M1JB 3NFQA 1ZN5A 2W27A 4M3LA 1EQ7A 1RF0A 3HD7B 2Q3IA 5CHXA 5AVVB 2FFDC 1JO5A 2P1JA 2NPSA 2L5GB 3KYQA 5AW1B 1NO4A 3P7KA 4HYTB 2H8PD 3BRTB 1KILD 3IFMA 4C7NA 1A02F 1H89A 2N1TB 1RE3C 1FJKA 1LWUA 1NOHA 3M9BA 1S9KD 1N7SD 3CLQA 1NTKK 1SFCA 3R2PA 3L35A 1GL2D 1LT9C 2NPSB 1IFMA 5CCHC 2R3CA 1IK9A 4AYCA 3BATA 4AUWA 1E5WA 1WT6A 3VOPA 4AQRD 1RE4C 2J59M 3H6PA 1GU5A 1JOCA 1N73C 1JY2O 4IFDK 1SQPK 5AW2B 1LWUB 3HE4A 2Q5UA 2IX7C 3CL3D 3IR9A 2WPSA 4WB4A 5AW0B 5AVWB 1DEBA 4KHXA 5CCHA 3GHGA 2M3BA 1N7SB 2WSEH 1GW3A 2HG5D 3KDPB 1SQXK 5CCGA 3TYYA 1T2KD 3P8CE 4DZOA 5APWA 3A5TA 1L4AD 3HUSA 2XDJA 1HH0A 1FOSE 2C0XA 1G2CA 1M1JA 2WSFH 3HE4B 3RK3C 1JY3P 2KLVA 1JCDA 1RF0C 2W6AA 1LGHB 1YTZI 1IFNA 1SVFA 4JYBA 3H32B 1OWAA 2I1KA 1J1DC 3UIAA 1H88A 1YTZT 4WY4B 1SQQK 5AW3B 1MV8A 1HTLC 3MIWA 1A02J 2E43A 1QL1A 1T8ZA 5AW5B 1YYCA 3B5ND 3HRNA 2R32A 3EFGA 2P2UA 4GKGA 1JCCA 2ZXEB 2WPQA 1J1EC 2WPRA 2N1TA 1FJPA 2HODB 1KZUB 4W7ZA 1GK4A 3CI9A 4Y99C 2YNYA 4XA4A 1SFCC 2KP8A 4DOJA 3MTUE 2FYUK 2YKPA 3BVHA 1JY2P 1L4AB 1NTZK 1LTGC 2O1KA 3V5BA 5APVA 2JEEA 3RK3D 1JTHB 4OH8B 1JNMA 1JUNA 2HYNA 2E42A 2M8RA 1RY3A 4IFMA 1NU1K 1WRGA 3V4QA 1FU1A 1NH4A 2Q9IA 1MFZA 5KJ7D 1URQD 1FZFA 3VP9A 4I2LC 1ZLLA 3P32A 1DH3A 2OYIB 1FZCB 2KB7P 3B5NB 1NHLA 3RL0C 2A45H 2R5DA 3RK2B 3I5CA 1FBMA 4IFFA 4JYCA 2WT7A 4W80A 2Z5HA 3HE5B 1G1JA 5APYA 3VYIA 5CJ4A 3HTKB 1SLQA 1OXZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MGN A;  2WPS A;  1CZQ A;  3VMX A;  5AW0 B;  1J2J B;  5AVW B;  5AW6 B;  2QM7 A;  2VRS A;  4KHX A;  1GK6 A;  4EOT A;  5APT A;  1GD2 E;  2BAS A;  2IPP A;  3NMD A;  3M06 A;  1GU4 A;  2ZFC A;  1HUC A;  3V4W A;  3O8Z A;  3M0D A;  1NWQ A;  2Q7C A;  3KDP B;  2QM8 A;  3NXS A;  5APU A;  3TYY A;  3NTN A;  1T2K D;  2WTY A;  4DZO A;  5APW A;  2JJL A;  2YO2 A;  3TNU A;  3A5T A;  5AVU B;  1H8A A;  1FOS E;  2C9L Y;  5AW7 B;  2P7J A;  3TNU B;  1HWT C;  3HE4 B;  2WT7 B;  2XZR A;  5AVX B;  2W6A A;  5APQ A;  4JYB A;  1G2C B;  3KQG A;  3NFQ A;  1OWA A;  2W27 A;  3UIA A;  1H88 A;  5CMZ A;  3M0A A;  4M3L A;  5AVR B;  2Q3I A;  5AVY B;  5AW3 B;  1CSB A;  1MV8 A;  3VN0 A;  5AVV B;  1SP4 A;  1A02 J;  1FAV A;  2E43 A;  1X8Y A;  2WWW A;  5AW5 B;  1YYC A;  5AW8 B;  2R32 A;  2Z5I A;  2P2U A;  4RES B;  1IO4 A;  1S9K E;  5AW1 B;  4C46 A;  4XE5 B;  3P7K A;  4HYT B;  4GKG A;  3A3Y B;  1T2K C;  3OAK A;  1NAF A;  2ZXE B;  2WPQ A;  1MUU A;  2WPR A;  2H7H A;  4C7N A;  3P8M C;  1A02 F;  5AVQ B;  1H89 A;  1GK4 A;  4C7N B;  2YNY A;  1KQL A;  3L37 A;  2KP8 A;  3VMY A;  3M9B A;  5AW9 B;  1S9K D;  5AVZ B;  3A7O A;  2XV5 A;  3LID A;  3V5B A;  5APV A;  1HBW A;  3M91 A;  5APS A;  3L36 A;  1JNM A;  3L35 A;  1JUN A;  1GTW A;  5AW4 B;  2P67 A;  1FOS F;  2E42 A;  3V4Q A;  2R3C A;  5AVS B;  1MFZ A;  4AYC A;  3TK1 A;  4AUW A;  3M9H A;  3T97 A;  1HJB A;  4I2L C;  3P32 A;  1DH3 A;  4I6M C;  2R5B A;  2YO3 A;  4AQR D;  5AVT B;  4B86 A;  3VMZ A;  3A2A A;  1GU5 A;  1GZL A;  3HE5 A;  4LC1 A;  1CI6 A;  2R5D A;  3HTK A;  4GT1 A;  5AW2 B;  5APX A;  2N9B A;  2XU6 A;  3I5C A;  3B8E B;  3HE4 A;  3LIE A;  4JYC A;  3VTP C;  2WT7 A;  2Q5U A;  3MD0 A;  2Z5H A;  3HE5 B;  1SLQ A;  5APY A;  3VYI A;  2C9N Y;  1CI6 B;  3SWF A;  3IR9 A;  1OXZ A; 
#chains in the Genus database with same CATH topology
 3GHG C;  3VMX A;  3SWY A;  1W5C E;  1N7S A;  4W7Y A;  2K1A A;  2B88 A;  1G1I A;  3M0D A;  3MZW B;  3HUS C;  1GL2 A;  2Q7C A;  3AEB C;  2QJP C;  1ZRT E;  3CXH H;  3PP5 A;  4PD4 I;  1Q81 Q;  3CCQ P;  4K35 A;  2KZI A;  2WT7 B;  1QX8 A;  2A06 E;  3RL0 D;  5E79 E;  3M0A A;  5TIS E;  1N86 A;  2OYH B;  2WWW A;  1RF1 B;  3MP7 B;  1IO4 A;  1JMB A;  1FS0 E;  1SS1 A;  3E1R A;  4H13 B;  1M8O B;  3AEG C;  1X79 B;  5CCG D;  1MUU A;  3R4Y A;  1BCC G;  1L0L G;  1N2D C;  2AXC A;  2FFD B;  5AVQ B;  4C7R A;  3RGU A;  1OIP A;  1WMK A;  3AEE C;  3S9O A;  1IFI A;  1KB9 H;  5GTI H;  3LID A;  1L0N K;  3VMA A;  1ZME C;  2GUV A;  2CK3 H;  2PAJ A;  1KYO D;  4N78 D;  3C1L A;  3T97 A;  3B5N A;  1LTS C;  3L72 J;  3TSI A;  4EDF A;  1T3U A;  1LTB C;  3U59 A;  1LT9 B;  3QH9 A;  2WMM A;  3HTK A;  2JWD A;  1N7S C;  1CI6 B;  3WU2 E;  1KTM A;  1YIJ P;  4O9B A;  3M0D C;  1OW8 A;  2IBZ E;  2YKO A;  2FXO A;  2WZ7 A;  3KZI E;  3FXD A;  2WTY A;  5KJ7 A;  4ZKP A;  4GDO A;  2M5A B;  3TGU E;  1RF1 A;  3VN0 A;  1FAV A;  4XFJ A;  3PLN A;  2ZYD A;  2FFD A;  3C8V A;  4Z1M H;  1OFC X;  1VF5 B;  3BCC E;  3D71 A;  3P8M C;  3MUD A;  1EXI A;  3L71 G;  3L37 A;  2W6B A;  1RHZ B;  3A0B E;  1SQB K;  4PJ0 E;  3L70 D;  1USE A;  1FZA A;  3V2R A;  2WVR A;  3GF3 A;  3B5N C;  1N8R Q;  1SQQ D;  3RK2 C;  3M9H A;  3H25 A;  1BGY G;  1LT9 A;  2RH0 A;  1FDI A;  4I6M C;  1IFJ A;  3N4X A;  4H0L D;  4HJG H;  5CBN A;  1JEK A;  1L0N E;  1CI6 A;  2XU6 A;  3CX5 E;  1T3J A;  3MGN A;  1CZQ A;  5M1B A;  1EDI A;  3H1H D;  1M56 D;  3RL0 B;  3HD7 A;  5APT A;  2XKM A;  2FYZ A;  1HVV A;  3AE1 C;  5KJ7 C;  1IZN B;  4OWF A;  1BDD A;  4KT0 J;  3I55 P;  2M5A A;  1P84 I;  1P84 E;  3AE8 C;  5AW7 B;  2OYH C;  1ZOY C;  4LLH A;  1RF1 C;  2ZT9 D;  5APQ A;  1NAY A;  2OQQ A;  1EDK A;  1ZR4 A;  4H13 C;  1KOR A;  1G2C B;  3NFQ A;  2E74 D;  2AXT H;  5KLV D;  2Q3I A;  2FFD C;  1JO5 A;  4YXW H;  1HJ0 A;  2P1J A;  2W6J H;  3CXH D;  3KYQ A;  3MUD C;  1OX3 A;  3E7K A;  1YJ9 P;  2WSS H;  1H89 A;  2G8Y A;  2N1T B;  1FJK A;  3M9B A;  1S9K D;  1N7S D;  1NTK K;  4UB6 H;  3L74 D;  1PIX A;  4A7P A;  1GL2 D;  1LT9 C;  1VQO P;  5KAI E;  3SWK A;  2R3C A;  3GF7 A;  4AYC A;  3BAT A;  1M1K Q;  3CCL P;  1SQP K;  2V7Q H;  1AA0 A;  2WSF J;  1LWU B;  2Q5U A;  4UB8 H;  1DIP A;  1NTM D;  2P58 A;  4KHX A;  5B66 E;  1R5L A;  3L70 J;  2ZYG A;  2BEZ F;  2WSE H;  2FYU G;  3D6Z A;  2HG5 D;  1NTZ G;  1EDL A;  5CCG A;  2PGD A;  1S72 P;  5APW A;  3A5T A;  3SFD C;  1NU1 G;  3FGA D;  2XDJ A;  1FOS E;  1G2C A;  3H1K D;  2KLV A;  3USS A;  2W6A A;  3H32 B;  2IBZ G;  3Q5S A;  3L75 G;  1OWA A;  3UIA A;  3CPW O;  1SQQ K;  1S3J A;  2E43 A;  1EC5 A;  1YYC A;  3B5N D;  3H1H J;  2O01 N;  1BE3 D;  2N1T A;  3TGU G;  4H0L B;  3CI9 A;  4XA4 A;  1KYO I;  1KYO E;  1JY2 P;  1L4A B;  3V5B A;  2BCC G;  3BCC G;  5KLV J;  2KZJ A;  3RK3 E;  1YI2 P;  1YBK A;  1OW7 A;  2JR8 A;  5KJ7 D;  1FZF A;  3P32 A;  4L74 A;  2FBW C;  2G3A A;  1NTK E;  3AEF C;  3RL0 C;  1Y47 A;  3WMM 0;  1E79 H;  2ZT9 B;  3U1A A;  4IL6 E;  2QM7 A;  1VQ8 P;  2ZJS E;  4WBA A;  2E76 B;  1EDJ A;  2E74 B;  2BAS A;  5CCG C;  3M06 A;  2HR3 A;  4D6T G;  2IYP A;  3O8Z A;  1S1C X;  4ASV A;  4N6J A;  5B5E H;  4BRY A;  1FDO A;  1SQP E;  1EZV D;  1L0N G;  5APU A;  2Z4E A;  1Y9B A;  1HGV A;  4YTP C;  3H32 A;  2OTL P;  1SQX D;  3G3Z A;  3KQG A;  2M3E A;  3CMA P;  1HGZ A;  2I8D A;  1NTM J;  1KQS O;  2KSJ A;  2N1T C;  1LTJ B;  1GL2 B;  4XE5 B;  3OJA B;  1DD3 A;  2A45 G;  3KXD A;  3JC2 2;  1SQQ E;  1L4A A;  5AVZ B;  3HD7 D;  1RE4 A;  3L72 D;  3SSU A;  1ZW0 A;  3N7N A;  2J58 A;  2IFN A;  1LWU C;  3B71 A;  4EIJ A;  5AVS B;  1BE3 J;  1NYH A;  3H1H E;  4NPD A;  3RL0 g;  1VQ9 P;  1KFN A;  1Y8A A;  3Q2Y A;  3AE6 C;  2AEJ A;  1YQ3 C;  3AE3 C;  2GM4 A;  3CME P;  1VF5 D;  3H1J D;  2E75 D;  4HH2 A;  1QEX A;  1OW6 A;  1SQB G;  2O3J A;  2ITA A;  2NZ2 A;  3WUT A;  3CWB E;  2C9L Y;  3CXH I;  3CXH E;  4H44 D;  1ZXG A;  1PP9 D;  4TLF A;  5CMZ A;  1SQV D;  5K5G B;  1LTJ A;  1T6A A;  2IZ0 A;  5EFW B;  4H0L C;  3EWK A;  1K05 A;  1S9K E;  1RH5 B;  1JY3 N;  2Q6Q A;  4PD4 E;  4ASW A;  3L73 D;  1K9M Q;  3L74 E;  1L4A C;  2H7H A;  2WSC H;  2UWJ E;  1FZE A;  2POH A;  3D70 A;  1KQL A;  2GA1 A;  3LW5 H;  1DD4 A;  4WY4 D;  1J1E B;  1SQX J;  2MJZ A;  1RE3 A;  2DW3 A;  3E1I A;  2KYV A;  4Y99 B;  3VP8 A;  5GTI E;  1SFC B;  2ZVO B;  5H2F H;  2ZYA A;  3L4F A;  1FDM A;  2ZT9 C;  1GMJ A;  2Q1K A;  2E76 C;  2E74 C;  1K8A Q;  5E79 H;  2E5T A;  3SWF A;  2SPZ A;  1GD2 E;  1HUC A;  2HFE D;  3H1K E;  1NTK G;  1FZB A;  2N1T D;  3G6E P;  1QL2 A;  1X9V A;  2CPB A;  1JMM A;  1MFT A;  4JBZ A;  1HWT C;  1BE3 E;  2KOG A;  1LTJ C;  1GL2 C;  2WIT A;  2YKQ A;  1M1J B;  1KN7 A;  1ZN5 A;  2W27 A;  2QJY B;  3HD7 B;  1SQP G;  3H1L D;  1D7M A;  2NPS A;  5AW1 B;  3H1J J;  3P7K A;  4EYY Q;  1KIL D;  1PGO A;  2B89 A;  3RBX A;  2B9B A;  1ZP0 C;  2V7Q J;  1RE3 C;  1S2E A;  3WU2 H;  2OYO A;  3AEC C;  1Q86 Q;  4K3A A;  1SFC A;  3FWN A;  3L35 A;  1PP9 J;  1R5S A;  1QVF O;  1PPJ E;  2JO1 A;  1SQV J;  2WSE J;  2E75 B;  3KZI H;  2H88 C;  4YPC A;  1SQQ G;  2N9Y B;  4AQR D;  2J59 M;  3H6P A;  4U3F J;  4HB1 A;  3L73 J;  4IFD K;  5AW2 B;  3WUU A;  2OGU A;  3HE4 A;  1HF9 A;  1AVY A;  1EZV I;  1EZV E;  3GW6 A;  4H44 B;  2WPS A;  1LNQ A;  2KK7 A;  1VQP P;  2IDB A;  1SQX E;  1IFP A;  2QSI A;  3ZDM A;  1GW3 A;  4KJM A;  1PL5 A;  3TYY A;  4DZO A;  1L4A D;  3W68 A;  1HH0 A;  5DJT B;  2C0X A;  1M1J A;  3L71 D;  1YIT P;  1NGM B;  3A0B H;  2Y9Z A;  4PJ0 H;  4WY4 B;  2AEF A;  1PGP A;  4WVZ A;  3MIW A;  1A02 J;  2LR2 A;  2OTK E;  1QL1 A;  2AXT E;  3GG2 A;  2Y0E A;  1TU3 F;  2JP3 A;  1BGY D;  3CWB G;  2Y9Y A;  4GKG A;  2ZXE B;  2WPQ A;  1J1E C;  3L72 E;  1QGK B;  2HOD B;  2NRG A;  4W7Z A;  4NPF X;  1BCC J;  1L0L J;  2E76 D;  4Y99 C;  2YNY A;  3CX5 H;  1SFC C;  2QA4 P;  2V4H A;  2KP8 A;  3G71 P;  1LTG C;  5APV A;  3H1I D;  1JUN A;  2HYN A;  3A0H H;  3L74 G;  1VQ4 P;  4BWN A;  1OVU A;  2Q9I A;  1UII A;  2A06 G;  3H1L J;  1ZLL A;  3GLM A;  1DH3 A;  1NVO A;  1P84 H;  2A45 H;  1Q82 Q;  1S5L H;  2W8Z A;  3VYI A;  5APY A;  5CJ4 A;  4YXD C;  1BSH A;  2K37 A;  1VQL P;  2QE7 H;  2VRS A;  4UB8 E;  1LT1 A;  2PP6 A;  3U1C A;  2QM8 A;  1PP9 E;  3NXS A;  1KB9 D;  1M1J C;  5BU8 B;  1SQV E;  3IN6 A;  2QJY C;  1VPC A;  4LGD E;  1IC2 A;  5GTH E;  3HD7 C;  5KKZ B;  3JCU E;  1KIL B;  3TNU B;  1AQ5 A;  4ZKU A;  3CCR P;  5BU5 A;  4WY4 A;  1KD1 Q;  3L73 E;  3H1K G;  3TF5 A;  2LKM A;  2B87 B;  1SP4 A;  5CCH D;  1EXJ A;  5KAI H;  5AW8 B;  3S4R A;  1LTT C;  4BRY B;  4L76 A;  4C46 A;  3ITK A;  3A3Y B;  4ZMD A;  1NAF A;  2HOD A;  2RKL A;  2HPC B;  2Y0D A;  3M9Q A;  1W2E A;  5AW9 B;  1VF5 C;  2PFX A;  2E75 C;  3A7O A;  1M90 Q;  2XV5 A;  3L71 J;  3V2N A;  5B66 H;  1GTW A;  2WQY C;  4N3Y B;  4OVN F;  5AW4 B;  2D2C D;  3AE2 C;  1PGJ A;  1GDT A;  2FYU D;  1NTZ D;  3TK1 A;  4H44 C;  3V2Q A;  2O01 H;  5C39 A;  1NU1 D;  1BGY J;  1GZL A;  4N78 E;  2QIW A;  4LC1 A;  1N7L A;  3MD0 A;  1FOS F;  2IBZ D;  3L75 D;  2R3S A;  1PPJ G;  3KHU A;  1PFI A;  2KS1 B;  2NPS D;  2K3R A;  2E5Y A;  2YIU B;  2ZFC A;  1PZQ A;  3H1I J;  1LTI C;  2L91 A;  1NWQ A;  1Z56 A;  1LTA C;  3C9I A;  3NTN A;  3AE7 C;  1KIL A;  3TNU A;  2WSC J;  2FYN B;  4WY4 C;  5B5E E;  5AVU B;  1CW5 A;  1EZV G;  5KLV K;  3KPE A;  3H1L E;  2PRR A;  2QRX A;  1Q90 D;  1KYO H;  5AVX B;  1SFC D;  1U57 A;  2B87 A;  4EI2 A;  1KIL E;  4I7Z B;  2BCC D;  1FE6 A;  3CD6 P;  1IJD B;  2Z5I A;  1J1D B;  2HPC A;  1DX7 A;  4L73 A;  3D6Y A;  2IZ1 A;  5BVZ A;  3Q5P A;  3BRV B;  1S5L X;  4IL6 H;  2ZAE B;  3PH0 A;  2C0W A;  5APS A;  3L36 A;  4D6T D;  3L72 G;  3L70 E;  3PTZ A;  1L0N D;  1HJB A;  2KSE A;  2YO3 A;  4B86 A;  5AVT B;  3CX5 D;  3A2A A;  1NTM K;  1U7J A;  4ZNC A;  1ZR2 A;  1PV3 A;  2C9N Y;  2KS1 A;  2FY8 A;  5AW6 B;  2GUS A;  1YHQ P;  3MHV A;  1AV1 A;  3NMD A;  1ZV8 A;  3L71 E;  5KKZ C;  1KIL C;  2RN0 A;  3FX0 A;  2Q3E A;  2FYU J;  1NTZ J;  2YXQ B;  2QEX P;  1NU1 J;  4OGQ B;  1BGY E;  1S4X A;  4NPE A;  3PHL A;  4M3L A;  5AVV B;  3L75 J;  2D2C B;  5KLV E;  1NO4 A;  2YXR B;  3V6I A;  2JDI H;  2H8P D;  2KNC B;  3H1I E;  3FXE A;  3IFM A;  1Q2N A;  4QMA A;  3TGU J;  1VQM P;  4TT3 H;  2J5U A;  3B4S A;  3R2P A;  2Y0C A;  2K9Y A;  5KAF H;  4U3F D;  1X0T A;  3SFE C;  3IAO A;  2NPS B;  1KQF B;  2BCC J;  1SQB D;  2K88 A;  2KUB A;  3BCC J;  2YMK A;  1WT6 A;  3VOP A;  3Q5R A;  1RE4 C;  3CCV P;  5H2F E;  1JOC A;  1JY2 O;  3CC7 P;  2YIU C;  2ZVN B;  2IX7 C;  1KB9 I;  1KB9 E;  5AVW B;  5AW0 B;  1OVV A;  3I56 P;  3F5H A;  2LXC B;  5CCH A;  2FYN C;  2M3B A;  1NTM E;  4PD4 H;  4DCK A;  1SQX K;  1YJN P;  2KXP B;  4D6T J;  1L0N J;  1FC2 C;  4I7Z C;  4RJT A;  3HE4 B;  1JY3 P;  1JCD A;  5TIS H;  4GOF A;  4R4M A;  1SVF A;  2I1K A;  1J1D C;  1H88 A;  2AEM A;  4IL6 X;  1MV8 A;  5AW3 B;  1HTL C;  2K9J A;  5L8R J;  4BXL A;  1BCC D;  1L0L D;  1R8E A;  2KNC A;  3H1L G;  4L75 A;  3O6Q B;  3G4S P;  2WPR A;  1KZU B;  1GK4 A;  5TJH A;  3S1K A;  2FYU E;  1NTZ E;  3MTU E;  3BVH A;  1VL2 A;  4JPZ B;  2O1K A;  2JEE A;  3RK3 D;  1JTH B;  1NU1 E;  4OH8 B;  2R44 A;  2E42 A;  1RY3 A;  1WRG A;  2QJK B;  3V4Q A;  1NTK D;  1UIX A;  1NH4 A;  3GMA A;  5CBO A;  2IBZ I;  3L75 E;  2OYI B;  1FZC B;  3Q3D A;  1NHL A;  3RBZ A;  2R5D A;  1KV4 A;  2WT7 A;  4R4L A;  3HE5 B;  1G1J A;  5CCH C;  1OXZ A;  4IOI H;  1J2J B;  3L70 G;  1SQP D;  2OYH A;  2H43 A;  3V4W A;  1VQ6 P;  4OGQ C;  3F89 A;  4PV1 D;  1KFM A;  3CC2 P;  2YO2 A;  1SQB J;  4RKU J;  2BCC E;  4GIF A;  1SQV K;  1QLE D;  1URQ B;  2XZR A;  2D2C C;  1M7L A;  1MZ9 A;  2H89 C;  1XTC C;  3P8C D;  3H1H G;  4JF7 A;  1CSB A;  2P10 A;  2M0B A;  2JWA A;  3AE5 C;  1VQ7 P;  4WWI A;  3O6Q A;  4RO0 A;  1IFD A;  3V2P A;  2IFM A;  1VQK P;  1XTG B;  3OAK A;  2JKV A;  2O01 J;  2I1J A;  1OMI A;  4D6T E;  3EQ2 A;  2NPS C;  1JTH A;  3CX5 I;  3M91 A;  5KLV G;  1H0T B;  2P67 A;  3H1I G;  2OYI A;  1FZC A;  2FKW B;  2OAR A;  4HKZ H;  3A0H E;  1IK7 A;  3VMZ A;  4JQ0 D;  3HE5 A;  2QG4 A;  1BSN A;  1NKZ B;  2A45 I;  4UB6 E;  1S5L E;  4I1L A;  5KLI B;  1N73 B;  1L0L K;  1Q7Y Q;  3CCS P;  4GOE A;  1GU4 A;  4CPG A;  2LXB A;  1VQN P;  3CWB D;  3H1J E;  1NTK J;  2JJL A;  1KMI Z;  3AE4 C;  1URQ A;  1H8A A;  5CJ0 A;  4GOD A;  1M57 D;  1JY3 O;  2KLU A;  1AFO A;  1NTM G;  1ZRT D;  5AVR B;  5AVY B;  3FWL A;  4PD4 D;  1X8Y A;  2RMZ A;  3RK3 B;  4RES B;  1SQP J;  2A06 D;  3OA7 A;  1T2K C;  1OZH A;  3JSV C;  1NKN A;  2HLO A;  4U3F E;  4C7N B;  1U7M A;  1OVR A;  1RQV A;  2QJK C;  3VMY A;  1SQB E;  4MN4 C;  2QVA A;  2W90 A;  1H0T A;  1HBW A;  2OYI C;  1FZC C;  1PGQ A;  3TDK A;  2O1J A;  2CPS A;  3K5B A;  3WUV A;  1YJW P;  1BE3 G;  1JB0 J;  2FXM A;  1USD A;  2KIK A;  4OGQ D;  2R5B A;  1JY2 N;  5GTH H;  1GW4 A;  4PV1 B;  3JCU H;  3BAS A;  1SQQ J;  4GT1 A;  2OTJ P;  5APX A;  2N9B A;  2XNX A;  3B8E B;  3LIE A;  3VTP C;  5KTB A;  1N73 A;  1VDF A;  3PRJ A;  3OW2 O;  1GK6 A;  2YMY A;  4EOT A;  4DT0 A;  2IYO A;  1LJ2 A;  1KQG B;  2IPP A;  1MKM A;  3II6 A;  1URQ C;  3GHG B;  4Y28 J;  1QVG O;  3W67 A;  1NJI Q;  3RK2 D;  1W2B O;  2P7J A;  1FZG A;  3HUS B;  3AEA C;  1BCC E;  1AQT A;  1L0L E;  4DJG A;  2QJP B;  1RQU A;  1EQ7 A;  1RF0 A;  5CHX A;  2W83 C;  1K73 Q;  1VQ5 P;  2L5G B;  1YQ4 C;  3TGU D;  4HYT B;  3BRT B;  4C7N A;  1A02 F;  3CWB J;  3LW5 J;  1SQX G;  1LWU A;  1NOH A;  3CLQ A;  3Q1M A;  1AJY A;  1PPJ D;  1LP1 B;  3BCC D;  3CCM P;  4H13 D;  1IFM A;  1IK9 A;  1K04 A;  4AUW A;  3CCE P;  3L74 J;  1E5W A;  1GU5 A;  5KLI C;  1N73 C;  2KI7 B;  3CL3 D;  3IR9 A;  4WB4 A;  2WPV B;  3AE9 C;  1DEB A;  4U7J A;  3GHG A;  1DEE G;  3AED C;  1N7S B;  3CC4 P;  3PJS K;  3KDP B;  1T2K D;  3P8C E;  3HUS A;  3CCU P;  1AVO A;  2WSF H;  3RK3 C;  1RF0 C;  1LGH B;  1YTZ I;  1L2P A;  1IFN A;  4JYB A;  1YTZ T;  3IF4 A;  3H1J G;  3H1K J;  1P84 D;  1T8Z A;  5AW5 B;  3HRN A;  2R32 A;  3EFG A;  2P2U A;  3ABV C;  2BEQ D;  1JM0 A;  1JCC A;  1X22 A;  1FJP A;  2MKV A;  1LP1 A;  4DOJ A;  2FYU K;  2YKP A;  1PP9 G;  1NTZ K;  3QWO C;  3EFF K;  2ZXX A;  1SQV G;  1JNM A;  2K9J B;  3G9R A;  2M8R A;  4PV1 C;  2XND H;  4IFM A;  1NU1 K;  1FU1 A;  1KC8 Q;  1MFZ A;  5KAF E;  1URQ D;  4U3F G;  3VP9 A;  4I2L C;  5DJU B;  1BDC A;  3L73 G;  2KB7 P;  3T97 B;  3B5N B;  3RK2 B;  3I5C A;  1FBM A;  4IFF A;  4JYC A;  3CCJ P;  4W80 A;  2Z5H A;  2FXP A;  3HTK B;  1SLQ A; 
#chains in the Genus database with same CATH homology
 3GHG C;  3VMX A;  1J2J B;  3SWY A;  3U1A A;  2QM7 A;  1N7S A;  2VRS A;  3WMM 0;  4WBA A;  4W7Y A;  2BAS A;  2PP6 A;  5CCG C;  3M06 A;  2OYH A;  2H43 A;  3V4W A;  1G1I A;  3O8Z A;  3M0D A;  4N6J A;  3U1C A;  3HUS C;  1GL2 A;  2Q7C A;  2QM8 A;  3NXS A;  5APU A;  1KFM A;  1M1J C;  2Z4E A;  5BU8 B;  3PP5 A;  2YO2 A;  1VPC A;  4LGD E;  1IC2 A;  1HGV A;  4GIF A;  3HD7 C;  1SQV K;  1KIL B;  3H32 A;  3TNU B;  1AQ5 A;  4ZKU A;  1URQ B;  2WT7 B;  2XZR A;  5BU5 A;  4WY4 A;  3G3Z A;  1M7L A;  3KQG A;  1MZ9 A;  3RL0 D;  3M0A A;  1XTC C;  3P8C D;  4JF7 A;  2LKM A;  1CSB A;  1SP4 A;  1N86 A;  5CCH D;  1HGZ A;  2OYH B;  2WWW A;  1RF1 B;  5AW8 B;  2KSJ A;  1IO4 A;  2N1T C;  1IFD A;  1LTT C;  1LTJ B;  1GL2 B;  3V2P A;  4C46 A;  4XE5 B;  2IFM A;  1X79 B;  3A3Y B;  5CCG D;  1XTG B;  3OAK A;  3OJA B;  1NAF A;  2HOD A;  1MUU A;  2A45 G;  1N2D C;  2FFD B;  2I1J A;  5AVQ B;  2HPC B;  4C7R A;  3M9Q A;  1L4A A;  3EQ2 A;  2NPS C;  1W2E A;  5AW9 B;  1IFI A;  5AVZ B;  1JTH A;  3A7O A;  3HD7 D;  2XV5 A;  3LID A;  3V2N A;  1L0N K;  1RE4 A;  3M91 A;  3N7N A;  2J58 A;  1GTW A;  4N3Y B;  5AW4 B;  2P67 A;  2IFN A;  2GUV A;  1GDT A;  2OYI A;  1FZC A;  1LWU C;  2PAJ A;  4EIJ A;  2FKW B;  2OAR A;  4N78 D;  5AVS B;  3TK1 A;  3T97 A;  3B5N A;  1LTS C;  3TSI A;  1T3U A;  1LTB C;  3V2Q A;  2O01 H;  3VMZ A;  3U59 A;  1LT9 B;  1GZL A;  4N78 E;  3HE5 A;  4LC1 A;  3HTK A;  1KFN A;  1N7L A;  1N7S C;  3MD0 A;  1NKZ B;  1CI6 B;  1FOS F;  2GM4 A;  4O9B A;  2A45 I;  1PFI A;  3M0D C;  4I1L A;  1N73 B;  2NPS D;  1L0L K;  4HH2 A;  1GU4 A;  2ZFC A;  1LTI C;  1NWQ A;  1Z56 A;  1LTA C;  2YKO A;  2WZ7 A;  3C9I A;  3NTN A;  2WTY A;  1KIL A;  2JJL A;  3TNU A;  5KJ7 A;  1URQ A;  4WY4 C;  5AVU B;  1CW5 A;  1H8A A;  5KLV K;  3KPE A;  5CJ0 A;  2C9L Y;  4ZKP A;  1JY3 O;  5AVX B;  1SFC D;  1AFO A;  5CMZ A;  5AVR B;  1RF1 A;  5AVY B;  3VN0 A;  1LTJ A;  1FAV A;  1X8Y A;  3RK3 B;  1IJD B;  2Z5I A;  4RES B;  1S9K E;  1JY3 N;  3OA7 A;  1J1D B;  2FFD A;  1T2K C;  1L4A C;  2HPC A;  1DX7 A;  2H7H A;  2WSC H;  1NKN A;  3P8M C;  2HLO A;  3MUD A;  5BVZ A;  1FZE A;  2POH A;  4C7N B;  1KQL A;  3L37 A;  2W6B A;  3VMY A;  3LW5 H;  4WY4 D;  3BRV B;  1J1E B;  1SQB K;  2MJZ A;  2C0W A;  1RE3 A;  5APS A;  1HBW A;  3L36 A;  1FZA A;  2OYI C;  1FZC C;  3E1I A;  3V2R A;  2KYV A;  4Y99 B;  3B5N C;  3VP8 A;  1SFC B;  2O1J A;  2CPS A;  3RK2 C;  3M9H A;  2FXM A;  1HJB A;  3L4F A;  1LT9 A;  1FDM A;  4I6M C;  2R5B A;  2YO3 A;  1IFJ A;  1JY2 N;  3N4X A;  5AVT B;  4B86 A;  1GW4 A;  3A2A A;  1NTM K;  3BAS A;  1ZR2 A;  1CI6 A;  4GT1 A;  5APX A;  2N9B A;  2XNX A;  2XU6 A;  3B8E B;  3LIE A;  3VTP C;  5KTB A;  1T3J A;  2C9N Y;  3SWF A;  1N73 A;  1VDF A;  3MGN A;  1CZQ A;  5AW6 B;  2GUS A;  1GK6 A;  2YMY A;  3RL0 B;  4EOT A;  3HD7 A;  5APT A;  1GD2 E;  2IPP A;  3II6 A;  3NMD A;  1ZV8 A;  2XKM A;  2FYZ A;  1HUC A;  2HFE D;  1HVV A;  1KIL C;  1FZB A;  5KJ7 C;  1URQ C;  3GHG B;  2N1T D;  1QL2 A;  1X9V A;  2CPB A;  3RK2 D;  1JMM A;  5AW7 B;  2P7J A;  1FZG A;  2OYH C;  3HUS B;  1HWT C;  4LLH A;  2KOG A;  1RF1 C;  5APQ A;  1ZR4 A;  1LTJ C;  1GL2 C;  2WIT A;  2YKQ A;  1G2C B;  1M1J B;  3NFQ A;  1ZN5 A;  2W27 A;  4M3L A;  1EQ7 A;  1RF0 A;  3HD7 B;  2Q3I A;  5CHX A;  5AVV B;  2FFD C;  1JO5 A;  2P1J A;  2NPS A;  2L5G B;  3KYQ A;  5AW1 B;  1NO4 A;  3P7K A;  4HYT B;  2H8P D;  3BRT B;  1KIL D;  3IFM A;  4C7N A;  1A02 F;  1H89 A;  2N1T B;  1RE3 C;  1FJK A;  1LWU A;  1NOH A;  3M9B A;  1S9K D;  1N7S D;  3CLQ A;  1NTK K;  1SFC A;  3R2P A;  3L35 A;  1GL2 D;  1LT9 C;  2NPS B;  1IFM A;  5CCH C;  2R3C A;  1IK9 A;  4AYC A;  3BAT A;  4AUW A;  1E5W A;  1WT6 A;  3VOP A;  4AQR D;  1RE4 C;  2J59 M;  3H6P A;  1GU5 A;  1JOC A;  1N73 C;  1JY2 O;  4IFD K;  1SQP K;  5AW2 B;  1LWU B;  3HE4 A;  2Q5U A;  2IX7 C;  3CL3 D;  3IR9 A;  2WPS A;  4WB4 A;  5AW0 B;  5AVW B;  1DEB A;  4KHX A;  5CCH A;  3GHG A;  2M3B A;  1N7S B;  2WSE H;  1GW3 A;  2HG5 D;  3KDP B;  1SQX K;  5CCG A;  3TYY A;  1T2K D;  3P8C E;  4DZO A;  5APW A;  3A5T A;  1L4A D;  3HUS A;  2XDJ A;  1HH0 A;  1FOS E;  2C0X A;  1G2C A;  1M1J A;  2WSF H;  3HE4 B;  3RK3 C;  1JY3 P;  2KLV A;  1JCD A;  1RF0 C;  2W6A A;  1LGH B;  1YTZ I;  1IFN A;  1SVF A;  4JYB A;  3H32 B;  1OWA A;  2I1K A;  1J1D C;  3UIA A;  1H88 A;  1YTZ T;  4WY4 B;  1SQQ K;  5AW3 B;  1MV8 A;  1HTL C;  3MIW A;  1A02 J;  2E43 A;  1QL1 A;  1T8Z A;  5AW5 B;  1YYC A;  3B5N D;  3HRN A;  2R32 A;  3EFG A;  2P2U A;  4GKG A;  1JCC A;  2ZXE B;  2WPQ A;  1J1E C;  2WPR A;  2N1T A;  1FJP A;  2HOD B;  1KZU B;  4W7Z A;  1GK4 A;  3CI9 A;  4Y99 C;  2YNY A;  4XA4 A;  1SFC C;  2KP8 A;  4DOJ A;  3MTU E;  2FYU K;  2YKP A;  3BVH A;  1JY2 P;  1L4A B;  1NTZ K;  1LTG C;  2O1K A;  3V5B A;  5APV A;  2JEE A;  3RK3 D;  1JTH B;  4OH8 B;  1JNM A;  1JUN A;  2HYN A;  2E42 A;  2M8R A;  1RY3 A;  4IFM A;  1NU1 K;  1WRG A;  3V4Q A;  1FU1 A;  1NH4 A;  2Q9I A;  1MFZ A;  5KJ7 D;  1URQ D;  1FZF A;  3VP9 A;  4I2L C;  1ZLL A;  3P32 A;  1DH3 A;  2OYI B;  1FZC B;  2KB7 P;  3B5N B;  1NHL A;  3RL0 C;  2A45 H;  2R5D A;  3RK2 B;  3I5C A;  1FBM A;  4IFF A;  4JYC A;  2WT7 A;  4W80 A;  2Z5H A;  3HE5 B;  1G1J A;  5APY A;  3VYI A;  5CJ4 A;  3HTK B;  1SLQ A;  1OXZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...