4I6MC

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
LKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords Actin-related protein 7
total genus 30
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.-:
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07529 HSA HSA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i6mC00
5APWA 2WT7A 5CMZA 3NFQA 1A02J 5AW9B 1CI6A 2P2UA 1GK6A 1T2KD 2R5BA 1MV8A 3TYYA 5APQA 1YYCA 4JYCA 1GTWA 2W27A 4KHXA 4I2LC 3VTPC 3V4QA 2R3CA 4DZOA 3NMDA 1CSBA 2Z5IA 3KQGA 3V4WA 1JNMA 3SWFA 5AVYB 2KP8A 3OAKA 5APUA 1H88A 2WPQA 2IPPA 1DH3A 1SP4A 3LIEA 1GD2E 2WWWA 5AVWB 1NWQA 3MD0A 2R5DA 2E43A 3TK1A 1OXZA 1GK4A 1S9KD 2P7JA 4LC1A 3L35A 3A7OA 1KQLA 1CI6B 4C7NA 3A2AA 3KDPB 4I6MC 4JYBA 1MFZA 4B86A 3UIAA 2P67A 3VYIA 2C9NY 2YO2A 1H8AA 1G2CB 5APTA 5AVRB 1GU4A 5APSA 3A3YB 5AW0B 2WPRA 2ZFCA 5AW1B 4GKGA 3M06A 5AW6B 2C9LY 2N9BA 3P8MC 2E42A 1NAFA 2Q3IA 1MUUA 3M91A 1GZLA 4M3LA 3I5CA 3VMXA 3VMYA 1S9KE 4RESB 3IR9A 3M9BA 3L37A 1OWAA 4AUWA 3HE5A 2QM7A 2XU6A 3HE4A 2JJLA 3M9HA 5AW2B 5AW7B 4AYCA 3VMZA 5AVTB 3M0DA 3T97A 2ZXEB 3M0AA 2BASA 4EOTA 1HBWA 3O8ZA 1IO4A 3HE5B 1FOSE 1HWTC 1SLQA 2XZRA 5AVVB 5APVA 1FOSF 3P32A 1HUCA 3LIDA 5AVXB 5APXA 4GT1A 2XV5A 3VN0A 3V5BA 5AW8B 3B8EB 3P7KA 1J2JB 3NXSA 2QM8A 3L36A 3A5TA 2WT7B 2Q7CA 3TNUA 5AVUB 5AW4B 1H89A 2R32A 5AW3B 2WTYA 3HTKA 1HJBA 2YNYA 2Z5HA 5AVZB 1X8YA 1JUNA 2YO3A 1T2KC 3NTNA 4XE5B 2W6AA 3HE4B 3MGNA 2VRSA 4C46A 3TNUB 4C7NB 5APYA 4HYTB 5AW5B 5AVSB 1A02F 1GU5A 4AQRD 2Q5UA 1CZQA 2WPSA 1FAVA 2H7HA 5AVQB
chains in the Genus database with same CATH superfamily
3PP5A 1S4XA 1FZGA 1BE3J 1RE4A 1CI6A 1NOHA 3RK3E 3TGUG 3HD7B 1L0ND 1T2KD 1KD1Q 4H44B 3RBXA 2Y0CA 2PAJA 5APQA 3FWLA 1HGVA 2M8RA 2OYHA 4JYCA 2KS1A 1S5LE 1U7MA 1YITP 5KJ7C 2GUSA 3L73J 4IL6E 4N6JA 2Q1KA 1DEBA 2Z4EA 3KZIE 1CSBA 2WSCH 3H1JG 3NMDA 3V4WA 1KQSO 3WUTA 1DEEG 2HYNA 2O01J 4QMAA 2FFDB 2M3BA 3B5NB 3H1JD 2KP8A 3OAKA 2WSEJ 5CBOA 1VQLP 1N73C 1DX7A 1LP1B 3RK2D 1FZAA 1H88A 2C0XA 3F5HA 1YI2P 4OGQC 1PP9G 1SQVK 1SQQD 1T3JA 3GHGC 3I56P 2OARA 3LIEA 2CK3H 2DW3A 2QG4A 2AXTH 3H1HJ 1GMJA 1EZVD 2FKWB 4CPGA 5KAFH 1NWQA 2E43A 2KI7B 2K9YA 1E5WA 1OXZA 2ZT9D 3CXHI 2FYUK 2P7JA 3G9RA 3L71G 2KSEA 3L70G 3LW5J 4B86A 4JYBA 1NTKG 1GL2D 2LR2A 4Y28J 3AE8C 5KLVD 3RL0g 4OH8B 2Q6QA 1E79H 1IZNB 2FXMA 4LGDE 5BVZA 1G2CB 1H8AA 1OFCX 1ZMEC 5DJUB 5APSA 4W7YA 3HUSA 3L75E 2E75C 2Y0EA 1FJKA 2IBZD 2ZFCA 3H1ID 5CCGA 2BCCD 2KLVA 3KZIH 2N9BA 1P84E 3O6QA 1GDTA 1NAFA 1HF9A 2O01H 2Q3IA 4L73A 1L2PA 3ITKA 3I5CA 5KKZC 2FXPA 3VMXA 3WUUA 1LWUA 4PV1B 1NTMJ 4BXLA 3A0HH 1RF1A 1LGHB 1ZRTE 2OQQA 2ZJSE 1R5LA 4PJ0H 2JO1A 5KLVE 3M9HA 5GTHE 1ZR4A 1W5CE 2JJLA 4GOEA 2IYPA 5AW7B 1DIPA 2QSIA 5B5EH 2V7QJ 2W90A 1SQVJ 3RL0B 1IFJA 3CX5E 1L4AC 1FDOA 1SS1A 1KILD 1NO4A 1J1EC 2AXCA 3P8CE 3HUSB 1IJDB 2LXBA 3PRJA 3CCUP 1N7SA 4EOTA 2BASA 1YTZT 3LW5H 1X79B 5BU5A 1KYOI 1HGZA 2XZRA 4OWFA 2N1TA 1FOSF 3GF7A 2BEZF 1P84I 3WU2H 2E76B 3V2RA 2IDBA 4GOFA 2P58A 4U3FJ 2QIWA 3HTKB 3V5BA 4HH2A 4YXDC 5AW8B 3B8EB 2H8PD 4GIFA 4K3AA 3L36A 1SQXD 3G3ZA 2N1TD 5CCHC 2B88A 1NTKE 2QJYC 4U7JA 2Q7CA 2FYNB 2WSCJ 5KLIB 3CCEP 3CCLP 1Q81Q 1NTZD 3G71P 1PP9D 2QVAA 1OW8A 1HJBA 3RBZA 2YIUB 3EFFK 1SQQK 2Z5HA 2O3JA 2HPCA 1BGYD 4IL6X 2OYIB 4XE5B 2XNDH 1EC5A 1URQD 3BCCD 2I8DA 2BCCG 2J5UA 5B66H 5CCGD 1H0TA 2RKLA 2QA4P 4L74A 1IK9A 2HG5D 1NU1G 2JDIH 3L74J 2KZJA 3O6QB 3CWBJ 1VF5C 1LJ2A 1ZRTD 4JQ0D 1KILB 5H2FE 1QVGO 3AE2C 5AVSB 4ZNCA 1EZVI 2Y9ZA 1K9MQ 3CC7P 1AV1A 1JY3P 1NTKD 2BCCE 2IYOA 2WPSA 2A45G 1M1JC 1XTGB 4Y99B 1LTIC 5EFWB 1PP9J 3A0BE 1KYOE 3MHVA 5AVQB 4UB8H 2ZVOB 3AE4C 2PGDA 2P2UA 1SQXJ 3CCSP 4I7ZB 4ASVA 3F89A 3Q5RA 1N8RQ 1WMKA 1G1JA 1OVVA 1YYCA 3L4FA 1VPCA 2OYOA 3JCUE 1JY3O 3L70J 3L71J 3L73D 4KHXA 3RK2B 1GTWA 1IFIA 1SFCC 2O01N 3CCVP 1S5LX 1LWUC 2M3EA 2Z5IA 3CX5D 3KQGA 1JNMA 2N1TB 1K8AQ 1VQ8P 5K5GB 3FWNA 3SWFA 1Q82Q 1VQ4P 1URQB 1LTJB 1RHZB 1SQBD 2YMKA 1JEKA 3H1LG 3H1HE 1MFTA 2NPSA 3H1KJ 3SWYA 1USDA 1OMIA 4JPZB 2FBWC 1Y9BA 4L76A 3L70D 4YXWH 1RF1B 1SP4A 2WWWA 1YJ9P 1KQGB 2A06G 2E74B 2FYZA 3PJSK 2QRXA 1DD4A 1EZVG 4ZKUA 2A06D 3VOPA 2ZT9C 3EFGA 2AEFA 1IFDA 2KNCA 3L75J 3II6A 2FYUE 1KQLA 4U3FD 2IFNA 4C7NA 3Q5SA 3CD6P 2NPSD 3A2AA 4I6MC 4N78E 2JP3A 3H32A 2RH0A 5KLVK 4EYYQ 2C9NY 2YO2A 3H1LJ 1OVUA 4D6TD 3CXHD 4WBAA 1AQ5A 3H1KG 2D2CD 2KYVA 1BCCJ 2E75D 1WRGA 2WPRA 3I55P 4IFMA 1KILE 1RE3A 4NPDA 4GKGA 5AW1B 4PV1D 3M06A 2YKOA 1Q90D 5AW6B 1FZCA 2W83C 3P8MC 1KV4A 2E42A 3CX5I 1VQ6P 2XDJA 2YXRB 1MUUA 3M91A 4RKUJ 3BCCE 2P10A 2GA1A 3KXDA 4M3LA 4YPCA 4IFDK 3RL0D 1EQ7A 1S72P 3L75G 2KOGA 3IR9A 1L0NG 4R4LA 3A0HE 1KORA 4U3FG 5KAIH 1L0LK 4N3YB 3TGUD 2FFDC 4PD4E 4KJMA 3HE5A 2QM7A 1NH4A 1NTMD 2XU6A 3HE4A 1FZFA 1VDFA 3H1JJ 3PHLA 3SSUA 4AYCA 3VMZA 1RF0A 1NJIQ 1SFCD 5AVTB 2D2CC 3B5NA 3L72G 1X22A 3AEBC 3M0DA 1PGPA 4OGQD 1ZLLA 2JEEA 3E7KA 3GHGB 3T97B 3M0DC 3H1JE 1P84D 3K5BA 2E76D 2R44A 1W2BO 1GW3A 2A45I 1LT9B 1Q2NA 3O8ZA 1DD3A 1S3JA 3GF3A 2FYUJ 3Q2YA 3HE5B 2M5AA 2CPBA 2IZ1A 2WMMA 3H1HG 3KHUA 1NU1K 1U57A 2JR8A 2PFXA 3CLQA 3JC22 1H0TB 1JMBA 5KLVJ 3LIDA 1RH5B 5AVXB 4PD4D 2Y0DA 4GT1A 5CBNA 1GL2C 1N73A 1EXIA 2YMYA 2A06E 2OYHB 1FC2C 1IFMA 2ZVNB 1LT9A 1R8EA 1FDMA 1JM0A 1LT1A 1ZW0A 3MP7B 3P7KA 3NXSA 4OVNF 5DJTB 1SQPG 1N7SC 1VF5D 4ZMDA 1YJWP 2QJPC 1BGYJ 3P8CD 1VQOP 3B4SA 1OW7A 2POHA 2RMZA 3A5TA 4H44C 4WB4A 1BDCA 3TNUA 1KMIZ 1MKMA 4H0LC 1UIIA 2R32A 2KS1B 3GW6A 1H89A 3MTUE 2HR3A 5B5EE 2WSSH 1EZVE 3E1RA 3HTKA 5KKZB 1SQBJ 4A7PA 2YNYA 5H2FH 4KT0J 4W7ZA 1M8OB 1OIPA 1RQUA 4PV1C 3HD7D 4WY4A 5AVZB 1KQFB 3VP9A 4EDFA 3NTNA 1PPJD 1L0LD 1PZQA 1J1DC 3MGNA 1RF0C 1KFNA 2PRRA 1PGQA 1JOCA 3VP8A 1N73B 3BRVB 3TNUB 1LTAC 1SQPJ 2BEQD 3BASA 3QWOC 4NPFX 3TSIA 5APYA 1FE6A 2J58A 1J1EB 4D6TE 2J59M 4H13C 1SQVG 4RJTA 4IOIH 5E79E 1GU5A 4ZKPA 2JWAA 3V2PA 4DJGA 3IAOA 4H44D 1A02F 1FJPA 5GTIE 1ZR2A 2Q9IA 3JSVC 2JWDA 1JCCA 2QJKB 1S5LH 2W6JH 2WT7A 1Y47A 4UB6E 1BE3G 1KB9I 1QLED 1TU3F 4W80A 3TGUJ 4C7RA 1A02J 1EXJA 1RE3C 2HODA 3L70E 1N7LA 2R5BA 1PPJE 2YXQB 1VQNP 1MV8A 2KZIA 2CPSA 2Q3EA 2YKQA 2K9JB 4O9BA 1S2EA 3V4QA 2KB7P 1BDDA 5KAIE 2R3CA 1HJ0A 3AECC 1KB9E 2IBZG 4H13D 4DZOA 2HODB 3IF4A 1L0LG 1PPJG 2QJYB 5KLIC 1NTMK 2M5AB 3FXEA 2B87A 5AVYB 2E74D 1XTCC 3RGUA 2G3AA 3AE1C 4WWIA 3ZDMA 2WPQA 1FZCB 3Q1MA 1CW5A 1IFNA 4WY4C 1ZOYC 2IBZE 3RK3C 1L0NK 1NAYA 3H1IJ 3D71A 1NHLA 3IN6A 2MJZA 3L72D 3G4SP 4IL6H 2OYIC 1GD2E 4H0LD 5AVWB 1FS0E 4EIJA 5BU8B 1U7JA 1VQ9P 1N2DC 1S1CX 1URQA 2R5DA 3L73E 4D6TJ 1MZ9A 3H1LE 3WU2E 1GK4A 3RL0C 1HVVA 2ZYDA 2WSFJ 3HD7C 1BCCE 4BRYA 4WVZA 3HD7A 3L74G 1MFZA 4HKZH 2K88A 2WSEH 2YKPA 1IFPA 1NTKJ 2K3RA 1LTBC 1UIXA 2OGUA 2P67A 3AEDC 4LLHA 1SQBK 5AVRB 3SWKA 3G6EP 2P1JA 3EWKA 3H1HD 1IK7A 3A3YB 4TT3H 5AW0B 1NTZE 1KTMA 2I1KA 1SQVE 4BRYB 3H1IG 1T6AA 4I7ZC 1FZBA 1SQQJ 3R2PA 2C9LY 1JY3N 2E76C 1BGYE 1FZEA 3HRNA 1GZLA 3E1IA 3H32B 1M1JA 1SFCB 1PL5A 2IBZI 4RESB 2E5YA 1S9KE 1Q86Q 3L37A 2G8YA 2HPCB 3CC2P 3OJAB 1HTLC 1LTGC 1NTMG 3AEGC 4AUWA 3WMM0 3AEAC 2H43A 1PIXA 3MUDC 2UWJE 2FXOA 4HB1A 1AVOA 1LTJA 1OZHA 1KN7A 1KYOD 2HLOA 1N7SD 1L4AD 1X9VA 1SQXE 1SQQG 3N4XA 1YQ4C 2ZXEB 2NPSB 2O1JA 2ZYGA 1SQBG 3C1LA 1HBWA 3CCMP 3D6YA 2K1AA 5CCHA 2PP6A 2C0WA 1M57D 1SLQA 2NRGA 2NZ2A 2KIKA 1HWTC 2E75B 3MZWB 4GODA 5TISE 1VF5B 2KSJA 3CX5H 3C9IA 3L72E 1Y8AA 4L75A 2KNCB 3V2QA 4R4MA 1QGKB 1AJYA 5APXA 4BWNA 1L4AA 1L0LE 3VYIA 2V4HA 1YJNP 5KTBA 2K37A 2V7QH 2XV5A 3ABVC 3L73G 3VN0A 3D6ZA 2IX7C 1JCDA 2KUBA 3BRTB 3PH0A 4Y99C 3WUVA 1J2JB 3B71A 3BCCJ 1YQ3C 2W6BA 4DCKA 1ZP0C 3S9OA 3C8VA 1EDKA 3CWBE 3L74E 5TJHA 4Z1MH 3CC4P 3CI9A 1RE4C 1LP1A 2WT7B 5CCHD 3QH9A 1NKNA 3CPWO 3B5NC 5AW4B 1ZXGA 5AW3B 3CCQP 1P84H 2WTYA 2GM4A 2I1JA 3AE5C 1QL1A 3H1LD 1AQTA 4OGQB 4JBZA 4I1LA 1EDLA 5KJ7A 1JUNA 1LWUB 5CCGC 2KK7A 4YTPC 1FBMA 1AFOA 3MUDA 1URQC 2WZ7A 2BCCJ 1NU1J 2VRSA 3BCCG 3H1KD 3TGUE 1L0LJ 1VQ7P 2HFED 3CWBG 3AE3C 4MN4C 1NTME 2R3SA 3AE6C 2WSFH 3L72J 1OX3A 5KAFE 1CZQA 1LT9C 3U1CA 3Q5PA 2ZYAA 2H7HA 4PD4I 2E74C 5APWA 1LNQA 5CMZA 3NFQA 5GTHH 2ZT9B 2FFDA 4PJ0E 5AW9B 1KB9H 1SQQE 1SQXG 2FYUG 1VQPP 1JO5A 1GK6A 4NPEA 2B9BA 3CCJP 3PLNA 3AE9C 2OYHC 2OTJP 3TYYA 5M1BA 3GG2A 3FGAD 2W27A 3A0BH 1BSNA 2SPZA 4I2LC 1NU1D 2ZXXA 1BE3E 3VTPC 5B66E 4HJGH 3GMAA 1FDIA 1BCCD 2QEXP 3SFEC 1KFMA 1M7LA 1T3UA 4N78D 1K05A 1OVRA 2H88C 1BGYG 4H0LB 5APUA 2M0BA 2B87B 1RQVA 1JTHB 2IPPA 3GHGA 3L74D 4WY4D 1L4AB 1SQPE 2ZAEB 3RK3D 1DH3A 3H1IE 2KLUA 1KILA 1ZV8A 2LKMA 3HUSC 2L91A 5CHXA 1PFIA 3B5ND 1M1JB 1G2CA 1NYHA 1SFCA 2A45H 1J1DB 1SVFA 3MD0A 2XNXA 5GTIH 2WITA 3TK1A 1NVOA 3KPEA 3KYQA 1NU1E 2XKMA 1BE3D 1USEA 2D2CB 1S9KD 4LC1A 1ZN5A 3L35A 3L71E 4H13B 3A7OA 1KB9D 1CI6B 1NTZJ 3UIAA 1N86A 3KDPB 3AEEC 1WT6A 2IZ0A 5APTA 4GDOA 1GU4A 3RK2C 2AXTE 1M1KQ 2OTLP 1EDJA 4XFJA 1SQXK 1PP9E 4ASWA 1Q7YQ 1SQPK 1BCCG 3FX0A 4K35A 3N7NA 1QX8A 2N1TC 5C39A 1QVFO 2MKVA 2AEJA 2FYNC 2ITAA 3M9QA 3EQ2A 1PGOA 3U1AA 4EI2A 5E79H 1R5SA 1L0NJ 3VMYA 3CMAP 1L0NE 3AE7C 2OYIA 2YIUC 1N7SB 1NTZG 1QEXA 2FYUD 2QJPB 3M9BA 4U3FE 1K04A 2LXCB 5CJ0A 1OWAA 3SFDC 1VL2A 2RN0A 1AA0A 1AVYA 1YBKA 5AW2B 4TLFA 4UB8E 3H25A 1VQMP 1YHQP 3TF5A 3R4YA 1M56D 2WPVB 3W68A 1FZCC 3CCRP 1GL2A 4WY4B 1JB0J 3T97A 4DOJA 1SQVD 1VQ5P 3RK3B 3CWBD 1KILC 1JTHA 1NTKK 3MIWA 1JY2N 3CMEP 2W8ZA 2GUVA 3FXDA 3M0AA 1SQBE 5CJ4A 1Z56A 3TDKA 1OW6A 1X0TA 2AEMA 1YTZI 1IC2A 2WVRA 2H89C 1FOSE 1IO4A 5AVVB 2OTKE 2L5GB 1LTSC 3AEFC 3IFMA 1PV3A 5APVA 3P32A 4RO0A 2E5TA 5KJ7D 4D6TG 1HUCA 1JY2P 3OA7A 3VMAA 4JF7A 1T8ZA 5KLVG 3Q3DA 1NGMB 3H6PA 2K9JA 4PD4H 2QJKC 3L71D 1HH0A 3H1KE 1NTZK 1G1IA 1PGJA 2QM8A 3S4RA 1VQKP 3V6IA 3BVHA 1GW4A 1SQPD 2B89A 1KYOH 1JMMA 3CL3D 3U59A 3USSA 4XA4A 4DT0A 2WQYC 1LTJC 1LTTC 3CXHE 5AVUB 3CXHH 4IFFA 3L75D 2N9YB 1BSHA 1YIJP 2QE7H 1X8YA 1RF1C 2YO3A 1T2KC 1FU1A 3S1KA 2KXPB 3JCUH 2JKVA 2W6AA 3V2NA 5TISH 1D7MA 2Y9YA 2FY8A 3HE4B 4UB6H 3GLMA 5L8RJ 3D70A 1NKZB 4C46A 4C7NB 2O1KA 1JY2O 1RY3A 1W2EA 1QL2A 1KZUB 2IFMA 4HYTB 5AW5B 3W67A 3BATA 2NPSC 1GL2B 4AQRD 1EDIA 3OW2O 2Q5UA 1KC8Q 1M90Q 1FAVA 1K73Q 3PTZA
chains in the Genus database with same CATH topology
3PP5A 1FZGA 1RE4A 1CI6A 1NOHA 3HD7B 1T2KD 2PAJA 5APQA 1HGVA 2M8RA 2OYHA 4JYCA 5KJ7C 2GUSA 4N6JA 1DEBA 2Z4EA 3NMDA 1CSBA 2WSCH 3V4WA 2FFDB 2HYNA 2M3BA 3B5NB 2KP8A 3OAKA 1N73C 1DX7A 3RK2D 1FZAA 1H88A 2C0XA 1SQVK 1T3JA 3GHGC 2OARA 3LIEA 1NWQA 2FKWB 2E43A 1E5WA 1OXZA 2FYUK 2P7JA 4B86A 4JYBA 1GL2D 5BVZA 4OH8B 2FXMA 4LGDE 1H8AA 1G2CB 5APSA 4W7YA 3HUSA 5CCGA 2ZFCA 1FJKA 2KLVA 1GDTA 2N9BA 1NAFA 2O01H 2Q3IA 3I5CA 3VMXA 1LWUA 1RF1A 1LGHB 1ZR4A 3M9HA 2JJLA 5AW7B 3RL0B 1IFJA 1L4AC 1KILD 1NO4A 3P8CE 1J1EC 3HUSB 1IJDB 1N7SA 4EOTA 2BASA 1YTZT 3LW5H 1X79B 5BU5A 1HGZA 2XZRA 2N1TA 1FOSF 3V2RA 3HTKB 3V5BA 4HH2A 5AW8B 3B8EB 2H8PD 4GIFA 3L36A 3G3ZA 2N1TD 5CCHC 2Q7CA 1HJBA 1SQQK 2Z5HA 2HPCA 2OYIB 4XE5B 5CCGD 1URQD 1IK9A 2HG5D 1KILB 5AVSB 1JY3P 2WPSA 2A45G 1M1JC 1XTGB 4Y99B 1LTIC 5AVQB 2P2UA 3L4FA 1G1JA 1YYCA 1VPCA 1GTWA 1JY3O 4KHXA 3RK2B 1IFIA 1SFCC 1LWUC 2Z5IA 3KQGA 1JNMA 2N1TB 3SWFA 1URQB 1LTJB 2NPSA 3SWYA 1CW5A 1RF1B 1SP4A 2WWWA 2FYZA 4ZKUA 3VOPA 3EFGA 1IFDA 3II6A 1KQLA 2IFNA 4C7NA 2NPSD 3A2AA 4I6MC 4N78E 3H32A 5KLVK 2C9NY 2YO2A 4WBAA 2KYVA 1WRGA 2WPRA 4IFMA 1RE3A 5AW1B 4GKGA 3M06A 2YKOA 5AW6B 1FZCA 3P8MC 2E42A 2XDJA 1MUUA 3M91A 4M3LA 4IFDK 3RL0D 1EQ7A 2KOGA 3IR9A 1L0LK 4N3YB 2FFDC 3HE5A 2QM7A 1NH4A 2XU6A 3HE4A 1FZFA 1VDFA 4AYCA 3VMZA 1RF0A 1SFCD 5AVTB 3B5NA 3M0DA 1ZLLA 2JEEA 3GHGB 3M0DC 1GW3A 2A45I 1LT9B 3O8ZA 3HE5B 2CPBA 1NU1K 3CLQA 3LIDA 5AVXB 4GT1A 1N73A 1GL2C 2YMYA 2OYHB 1IFMA 1LT9A 1FDMA 3P7KA 3NXSA 1N7SC 3P8CD 2POHA 3A5TA 4WB4A 3TNUA 1H89A 2R32A 3MTUE 3HTKA 2YNYA 4W7ZA 4WY4A 5AVZB 3VP9A 3HD7D 3NTNA 1J1DC 3MGNA 1RF0C 1KFNA 3VP8A 1JOCA 1N73B 3BRVB 3TNUB 1LTAC 3BASA 3TSIA 5APYA 2J58A 1J1EB 2J59M 1A02F 1GU5A 4ZKPA 3V2PA 1FJPA 1ZR2A 2Q9IA 1JCCA 2WT7A 1A02J 4W80A 4C7RA 1RE3C 2HODA 1N7LA 2R5BA 1MV8A 2CPSA 2YKQA 4O9BA 3V4QA 2KB7P 2R3CA 4DZOA 2HODB 1NTMK 5AVYB 1XTCC 2WPQA 1FZCB 1IFNA 4WY4C 3RK3C 1L0NK 1NHLA 2MJZA 2OYIC 1GD2E 5AVWB 4EIJA 5BU8B 1N2DC 1URQA 2R5DA 1MZ9A 1GK4A 3RL0C 1HVVA 3HD7C 3HD7A 1MFZA 2WSEH 2YKPA 4LLHA 2P67A 3UIAA 1LTBC 3VYIA 5AVRB 1SQBK 2P1JA 3A3YB 5AW0B 2I1KA 2C9LY 1FZBA 3R2PA 1JY3N 1FZEA 3HRNA 1GZLA 3E1IA 3H32B 1M1JA 1SFCB 1S9KE 4RESB 3L37A 2HPCB 3OJAB 1HTLC 1LTGC 4AUWA 3WMM0 2H43A 1LTJA 2HLOA 1N7SD 1L4AD 1X9VA 3N4XA 2ZXEB 2NPSB 2O1JA 1HBWA 5CCHA 2PP6A 2C0WA 1HWTC 1SLQA 2KSJA 3C9IA 3V2QA 5APXA 1L4AA 1AQ5A 5KTBA 2XV5A 3VN0A 2IX7C 1JCDA 3BRTB 4Y99C 1J2JB 2W6BA 3CI9A 1RE4C 2WT7B 5CCHD 1NKNA 3B5NC 5AW4B 5AW3B 2WTYA 2GM4A 2I1JA 1QL1A 4I1LA 5KJ7A 1JUNA 1LWUB 5CCGC 1AFOA 1FBMA 3MUDA 1URQC 2WZ7A 2VRSA 2HFED 2WSFH 3U1CA 1CZQA 1LT9C 2H7HA 5APWA 5CMZA 3NFQA 2FFDA 5AW9B 1JO5A 1GK6A 2OYHC 3TYYA 2W27A 4I2LC 3VTPC 1KFMA 1M7LA 1T3UA 4N78D 5APUA 1JTHB 2IPPA 3GHGA 4WY4D 1L4AB 3RK3D 1DH3A 1PFIA 1KILA 1ZV8A 2LKMA 3HUSC 5CHXA 3B5ND 1M1JB 1G2CA 1SFCA 3MD0A 2A45H 1J1DB 1SVFA 2XNXA 2WITA 3TK1A 3KPEA 3KYQA 2XKMA 1S9KD 4LC1A 1ZN5A 3L35A 3A7OA 1CI6B 1N86A 3KDPB 1WT6A 5APTA 1GU4A 3RK2C 1SQXK 1SQPK 3N7NA 2N1TC 3M9QA 3EQ2A 3U1AA 3VMYA 2OYIA 3M9BA 1N7SB 5CJ0A 1OWAA 5AW2B 1FZCC 1GL2A 4WY4B 4DOJA 3T97A 3RK3B 1KILC 3MIWA 1JTHA 1NTKK 1JY2N 2GUVA 3M0AA 5CJ4A 1Z56A 1YTZI 1IC2A 1IO4A 1FOSE 5AVVB 2L5GB 1LTSC 3IFMA 5APVA 3P32A 5KJ7D 1HUCA 1JY2P 3OA7A 4JF7A 1T8ZA 3H6PA 1HH0A 1NTZK 1G1IA 2QM8A 3BVHA 1GW4A 3CL3D 1JMMA 3U59A 4XA4A 1LTJC 1LTTC 5AVUB 4IFFA 1X8YA 1RF1C 2YO3A 1T2KC 1FU1A 3V2NA 2W6AA 3HE4B 1NKZB 4C46A 4C7NB 2O1KA 1JY2O 1RY3A 1W2EA 1QL2A 1KZUB 2IFMA 4HYTB 5AW5B 3BATA 2NPSC 1GL2B 4AQRD 2Q5UA 1FAVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5APW A;  2WT7 A;  5CMZ A;  3NFQ A;  1A02 J;  5AW9 B;  1CI6 A;  2P2U A;  1GK6 A;  1T2K D;  2R5B A;  1MV8 A;  3TYY A;  5APQ A;  1YYC A;  4JYC A;  1GTW A;  2W27 A;  4KHX A;  4I2L C;  3VTP C;  3V4Q A;  2R3C A;  4DZO A;  3NMD A;  1CSB A;  2Z5I A;  3KQG A;  3V4W A;  1JNM A;  3SWF A;  5AVY B;  2KP8 A;  3OAK A;  5APU A;  1H88 A;  2WPQ A;  2IPP A;  1DH3 A;  1SP4 A;  3LIE A;  1GD2 E;  2WWW A;  5AVW B;  1NWQ A;  3MD0 A;  2R5D A;  2E43 A;  3TK1 A;  1OXZ A;  1GK4 A;  1S9K D;  2P7J A;  4LC1 A;  3L35 A;  3A7O A;  1KQL A;  1CI6 B;  4C7N A;  3A2A A;  3KDP B;  4I6M C;  4JYB A;  1MFZ A;  4B86 A;  3UIA A;  2P67 A;  3VYI A;  2C9N Y;  2YO2 A;  1H8A A;  1G2C B;  5APT A;  5AVR B;  1GU4 A;  5APS A;  3A3Y B;  5AW0 B;  2WPR A;  2ZFC A;  5AW1 B;  4GKG A;  3M06 A;  5AW6 B;  2C9L Y;  2N9B A;  3P8M C;  2E42 A;  1NAF A;  2Q3I A;  1MUU A;  3M91 A;  1GZL A;  4M3L A;  3I5C A;  3VMX A;  3VMY A;  1S9K E;  4RES B;  3IR9 A;  3M9B A;  3L37 A;  1OWA A;  4AUW A;  3HE5 A;  2QM7 A;  2XU6 A;  3HE4 A;  2JJL A;  3M9H A;  5AW2 B;  5AW7 B;  4AYC A;  3VMZ A;  5AVT B;  3M0D A;  3T97 A;  2ZXE B;  3M0A A;  2BAS A;  4EOT A;  1HBW A;  3O8Z A;  1IO4 A;  3HE5 B;  1FOS E;  1HWT C;  1SLQ A;  2XZR A;  5AVV B;  5APV A;  1FOS F;  3P32 A;  1HUC A;  3LID A;  5AVX B;  5APX A;  4GT1 A;  2XV5 A;  3VN0 A;  3V5B A;  5AW8 B;  3B8E B;  3P7K A;  1J2J B;  3NXS A;  2QM8 A;  3L36 A;  3A5T A;  2WT7 B;  2Q7C A;  3TNU A;  5AVU B;  5AW4 B;  1H89 A;  2R32 A;  5AW3 B;  2WTY A;  3HTK A;  1HJB A;  2YNY A;  2Z5H A;  5AVZ B;  1X8Y A;  1JUN A;  2YO3 A;  1T2K C;  3NTN A;  4XE5 B;  2W6A A;  3HE4 B;  3MGN A;  2VRS A;  4C46 A;  3TNU B;  4C7N B;  5APY A;  4HYT B;  5AW5 B;  5AVS B;  1A02 F;  1GU5 A;  4AQR D;  2Q5U A;  1CZQ A;  2WPS A;  1FAV A;  2H7H A;  5AVQ B; 
#chains in the Genus database with same CATH topology
 3PP5 A;  1S4X A;  1FZG A;  1BE3 J;  1RE4 A;  1CI6 A;  1NOH A;  3RK3 E;  3TGU G;  3HD7 B;  1L0N D;  1T2K D;  1KD1 Q;  4H44 B;  3RBX A;  2Y0C A;  2PAJ A;  5APQ A;  3FWL A;  1HGV A;  2M8R A;  2OYH A;  4JYC A;  2KS1 A;  1S5L E;  1U7M A;  1YIT P;  5KJ7 C;  2GUS A;  3L73 J;  4IL6 E;  4N6J A;  2Q1K A;  1DEB A;  2Z4E A;  3KZI E;  1CSB A;  2WSC H;  3H1J G;  3NMD A;  3V4W A;  1KQS O;  3WUT A;  1DEE G;  2HYN A;  2O01 J;  4QMA A;  2FFD B;  2M3B A;  3B5N B;  3H1J D;  2KP8 A;  3OAK A;  2WSE J;  5CBO A;  1VQL P;  1N73 C;  1DX7 A;  1LP1 B;  3RK2 D;  1FZA A;  1H88 A;  2C0X A;  3F5H A;  1YI2 P;  4OGQ C;  1PP9 G;  1SQV K;  1SQQ D;  1T3J A;  3GHG C;  3I56 P;  2OAR A;  3LIE A;  2CK3 H;  2DW3 A;  2QG4 A;  2AXT H;  3H1H J;  1GMJ A;  1EZV D;  2FKW B;  4CPG A;  5KAF H;  1NWQ A;  2E43 A;  2KI7 B;  2K9Y A;  1E5W A;  1OXZ A;  2ZT9 D;  3CXH I;  2FYU K;  2P7J A;  3G9R A;  3L71 G;  2KSE A;  3L70 G;  3LW5 J;  4B86 A;  4JYB A;  1NTK G;  1GL2 D;  2LR2 A;  4Y28 J;  3AE8 C;  5KLV D;  3RL0 g;  4OH8 B;  2Q6Q A;  1E79 H;  1IZN B;  2FXM A;  4LGD E;  5BVZ A;  1G2C B;  1H8A A;  1OFC X;  1ZME C;  5DJU B;  5APS A;  4W7Y A;  3HUS A;  3L75 E;  2E75 C;  2Y0E A;  1FJK A;  2IBZ D;  2ZFC A;  3H1I D;  5CCG A;  2BCC D;  2KLV A;  3KZI H;  2N9B A;  1P84 E;  3O6Q A;  1GDT A;  1NAF A;  1HF9 A;  2O01 H;  2Q3I A;  4L73 A;  1L2P A;  3ITK A;  3I5C A;  5KKZ C;  2FXP A;  3VMX A;  3WUU A;  1LWU A;  4PV1 B;  1NTM J;  4BXL A;  3A0H H;  1RF1 A;  1LGH B;  1ZRT E;  2OQQ A;  2ZJS E;  1R5L A;  4PJ0 H;  2JO1 A;  5KLV E;  3M9H A;  5GTH E;  1ZR4 A;  1W5C E;  2JJL A;  4GOE A;  2IYP A;  5AW7 B;  1DIP A;  2QSI A;  5B5E H;  2V7Q J;  2W90 A;  1SQV J;  3RL0 B;  1IFJ A;  3CX5 E;  1L4A C;  1FDO A;  1SS1 A;  1KIL D;  1NO4 A;  1J1E C;  2AXC A;  3P8C E;  3HUS B;  1IJD B;  2LXB A;  3PRJ A;  3CCU P;  1N7S A;  4EOT A;  2BAS A;  1YTZ T;  3LW5 H;  1X79 B;  5BU5 A;  1KYO I;  1HGZ A;  2XZR A;  4OWF A;  2N1T A;  1FOS F;  3GF7 A;  2BEZ F;  1P84 I;  3WU2 H;  2E76 B;  3V2R A;  2IDB A;  4GOF A;  2P58 A;  4U3F J;  2QIW A;  3HTK B;  3V5B A;  4HH2 A;  4YXD C;  5AW8 B;  3B8E B;  2H8P D;  4GIF A;  4K3A A;  3L36 A;  1SQX D;  3G3Z A;  2N1T D;  5CCH C;  2B88 A;  1NTK E;  2QJY C;  4U7J A;  2Q7C A;  2FYN B;  2WSC J;  5KLI B;  3CCE P;  3CCL P;  1Q81 Q;  1NTZ D;  3G71 P;  1PP9 D;  2QVA A;  1OW8 A;  1HJB A;  3RBZ A;  2YIU B;  3EFF K;  1SQQ K;  2Z5H A;  2O3J A;  2HPC A;  1BGY D;  4IL6 X;  2OYI B;  4XE5 B;  2XND H;  1EC5 A;  1URQ D;  3BCC D;  2I8D A;  2BCC G;  2J5U A;  5B66 H;  5CCG D;  1H0T A;  2RKL A;  2QA4 P;  4L74 A;  1IK9 A;  2HG5 D;  1NU1 G;  2JDI H;  3L74 J;  2KZJ A;  3O6Q B;  3CWB J;  1VF5 C;  1LJ2 A;  1ZRT D;  4JQ0 D;  1KIL B;  5H2F E;  1QVG O;  3AE2 C;  5AVS B;  4ZNC A;  1EZV I;  2Y9Z A;  1K9M Q;  3CC7 P;  1AV1 A;  1JY3 P;  1NTK D;  2BCC E;  2IYO A;  2WPS A;  2A45 G;  1M1J C;  1XTG B;  4Y99 B;  1LTI C;  5EFW B;  1PP9 J;  3A0B E;  1KYO E;  3MHV A;  5AVQ B;  4UB8 H;  2ZVO B;  3AE4 C;  2PGD A;  2P2U A;  1SQX J;  3CCS P;  4I7Z B;  4ASV A;  3F89 A;  3Q5R A;  1N8R Q;  1WMK A;  1G1J A;  1OVV A;  1YYC A;  3L4F A;  1VPC A;  2OYO A;  3JCU E;  1JY3 O;  3L70 J;  3L71 J;  3L73 D;  4KHX A;  3RK2 B;  1GTW A;  1IFI A;  1SFC C;  2O01 N;  3CCV P;  1S5L X;  1LWU C;  2M3E A;  2Z5I A;  3CX5 D;  3KQG A;  1JNM A;  2N1T B;  1K8A Q;  1VQ8 P;  5K5G B;  3FWN A;  3SWF A;  1Q82 Q;  1VQ4 P;  1URQ B;  1LTJ B;  1RHZ B;  1SQB D;  2YMK A;  1JEK A;  3H1L G;  3H1H E;  1MFT A;  2NPS A;  3H1K J;  3SWY A;  1USD A;  1OMI A;  4JPZ B;  2FBW C;  1Y9B A;  4L76 A;  3L70 D;  4YXW H;  1RF1 B;  1SP4 A;  2WWW A;  1YJ9 P;  1KQG B;  2A06 G;  2E74 B;  2FYZ A;  3PJS K;  2QRX A;  1DD4 A;  1EZV G;  4ZKU A;  2A06 D;  3VOP A;  2ZT9 C;  3EFG A;  2AEF A;  1IFD A;  2KNC A;  3L75 J;  3II6 A;  2FYU E;  1KQL A;  4U3F D;  2IFN A;  4C7N A;  3Q5S A;  3CD6 P;  2NPS D;  3A2A A;  4I6M C;  4N78 E;  2JP3 A;  3H32 A;  2RH0 A;  5KLV K;  4EYY Q;  2C9N Y;  2YO2 A;  3H1L J;  1OVU A;  4D6T D;  3CXH D;  4WBA A;  1AQ5 A;  3H1K G;  2D2C D;  2KYV A;  1BCC J;  2E75 D;  1WRG A;  2WPR A;  3I55 P;  4IFM A;  1KIL E;  1RE3 A;  4NPD A;  4GKG A;  5AW1 B;  4PV1 D;  3M06 A;  2YKO A;  1Q90 D;  5AW6 B;  1FZC A;  2W83 C;  3P8M C;  1KV4 A;  2E42 A;  3CX5 I;  1VQ6 P;  2XDJ A;  2YXR B;  1MUU A;  3M91 A;  4RKU J;  3BCC E;  2P10 A;  2GA1 A;  3KXD A;  4M3L A;  4YPC A;  4IFD K;  3RL0 D;  1EQ7 A;  1S72 P;  3L75 G;  2KOG A;  3IR9 A;  1L0N G;  4R4L A;  3A0H E;  1KOR A;  4U3F G;  5KAI H;  1L0L K;  4N3Y B;  3TGU D;  2FFD C;  4PD4 E;  4KJM A;  3HE5 A;  2QM7 A;  1NH4 A;  1NTM D;  2XU6 A;  3HE4 A;  1FZF A;  1VDF A;  3H1J J;  3PHL A;  3SSU A;  4AYC A;  3VMZ A;  1RF0 A;  1NJI Q;  1SFC D;  5AVT B;  2D2C C;  3B5N A;  3L72 G;  1X22 A;  3AEB C;  3M0D A;  1PGP A;  4OGQ D;  1ZLL A;  2JEE A;  3E7K A;  3GHG B;  3T97 B;  3M0D C;  3H1J E;  1P84 D;  3K5B A;  2E76 D;  2R44 A;  1W2B O;  1GW3 A;  2A45 I;  1LT9 B;  1Q2N A;  3O8Z A;  1DD3 A;  1S3J A;  3GF3 A;  2FYU J;  3Q2Y A;  3HE5 B;  2M5A A;  2CPB A;  2IZ1 A;  2WMM A;  3H1H G;  3KHU A;  1NU1 K;  1U57 A;  2JR8 A;  2PFX A;  3CLQ A;  3JC2 2;  1H0T B;  1JMB A;  5KLV J;  3LID A;  1RH5 B;  5AVX B;  4PD4 D;  2Y0D A;  4GT1 A;  5CBN A;  1GL2 C;  1N73 A;  1EXI A;  2YMY A;  2A06 E;  2OYH B;  1FC2 C;  1IFM A;  2ZVN B;  1LT9 A;  1R8E A;  1FDM A;  1JM0 A;  1LT1 A;  1ZW0 A;  3MP7 B;  3P7K A;  3NXS A;  4OVN F;  5DJT B;  1SQP G;  1N7S C;  1VF5 D;  4ZMD A;  1YJW P;  2QJP C;  1BGY J;  3P8C D;  1VQO P;  3B4S A;  1OW7 A;  2POH A;  2RMZ A;  3A5T A;  4H44 C;  4WB4 A;  1BDC A;  3TNU A;  1KMI Z;  1MKM A;  4H0L C;  1UII A;  2R32 A;  2KS1 B;  3GW6 A;  1H89 A;  3MTU E;  2HR3 A;  5B5E E;  2WSS H;  1EZV E;  3E1R A;  3HTK A;  5KKZ B;  1SQB J;  4A7P A;  2YNY A;  5H2F H;  4KT0 J;  4W7Z A;  1M8O B;  1OIP A;  1RQU A;  4PV1 C;  3HD7 D;  4WY4 A;  5AVZ B;  1KQF B;  3VP9 A;  4EDF A;  3NTN A;  1PPJ D;  1L0L D;  1PZQ A;  1J1D C;  3MGN A;  1RF0 C;  1KFN A;  2PRR A;  1PGQ A;  1JOC A;  3VP8 A;  1N73 B;  3BRV B;  3TNU B;  1LTA C;  1SQP J;  2BEQ D;  3BAS A;  3QWO C;  4NPF X;  3TSI A;  5APY A;  1FE6 A;  2J58 A;  1J1E B;  4D6T E;  2J59 M;  4H13 C;  1SQV G;  4RJT A;  4IOI H;  5E79 E;  1GU5 A;  4ZKP A;  2JWA A;  3V2P A;  4DJG A;  3IAO A;  4H44 D;  1A02 F;  1FJP A;  5GTI E;  1ZR2 A;  2Q9I A;  3JSV C;  2JWD A;  1JCC A;  2QJK B;  1S5L H;  2W6J H;  2WT7 A;  1Y47 A;  4UB6 E;  1BE3 G;  1KB9 I;  1QLE D;  1TU3 F;  4W80 A;  3TGU J;  4C7R A;  1A02 J;  1EXJ A;  1RE3 C;  2HOD A;  3L70 E;  1N7L A;  2R5B A;  1PPJ E;  2YXQ B;  1VQN P;  1MV8 A;  2KZI A;  2CPS A;  2Q3E A;  2YKQ A;  2K9J B;  4O9B A;  1S2E A;  3V4Q A;  2KB7 P;  1BDD A;  5KAI E;  2R3C A;  1HJ0 A;  3AEC C;  1KB9 E;  2IBZ G;  4H13 D;  4DZO A;  2HOD B;  3IF4 A;  1L0L G;  1PPJ G;  2QJY B;  5KLI C;  1NTM K;  2M5A B;  3FXE A;  2B87 A;  5AVY B;  2E74 D;  1XTC C;  3RGU A;  2G3A A;  3AE1 C;  4WWI A;  3ZDM A;  2WPQ A;  1FZC B;  3Q1M A;  1CW5 A;  1IFN A;  4WY4 C;  1ZOY C;  2IBZ E;  3RK3 C;  1L0N K;  1NAY A;  3H1I J;  3D71 A;  1NHL A;  3IN6 A;  2MJZ A;  3L72 D;  3G4S P;  4IL6 H;  2OYI C;  1GD2 E;  4H0L D;  5AVW B;  1FS0 E;  4EIJ A;  5BU8 B;  1U7J A;  1VQ9 P;  1N2D C;  1S1C X;  1URQ A;  2R5D A;  3L73 E;  4D6T J;  1MZ9 A;  3H1L E;  3WU2 E;  1GK4 A;  3RL0 C;  1HVV A;  2ZYD A;  2WSF J;  3HD7 C;  1BCC E;  4BRY A;  4WVZ A;  3HD7 A;  3L74 G;  1MFZ A;  4HKZ H;  2K88 A;  2WSE H;  2YKP A;  1IFP A;  1NTK J;  2K3R A;  1LTB C;  1UIX A;  2OGU A;  2P67 A;  3AED C;  4LLH A;  1SQB K;  5AVR B;  3SWK A;  3G6E P;  2P1J A;  3EWK A;  3H1H D;  1IK7 A;  3A3Y B;  4TT3 H;  5AW0 B;  1NTZ E;  1KTM A;  2I1K A;  1SQV E;  4BRY B;  3H1I G;  1T6A A;  4I7Z C;  1FZB A;  1SQQ J;  3R2P A;  2C9L Y;  1JY3 N;  2E76 C;  1BGY E;  1FZE A;  3HRN A;  1GZL A;  3E1I A;  3H32 B;  1M1J A;  1SFC B;  1PL5 A;  2IBZ I;  4RES B;  2E5Y A;  1S9K E;  1Q86 Q;  3L37 A;  2G8Y A;  2HPC B;  3CC2 P;  3OJA B;  1HTL C;  1LTG C;  1NTM G;  3AEG C;  4AUW A;  3WMM 0;  3AEA C;  2H43 A;  1PIX A;  3MUD C;  2UWJ E;  2FXO A;  4HB1 A;  1AVO A;  1LTJ A;  1OZH A;  1KN7 A;  1KYO D;  2HLO A;  1N7S D;  1L4A D;  1X9V A;  1SQX E;  1SQQ G;  3N4X A;  1YQ4 C;  2ZXE B;  2NPS B;  2O1J A;  2ZYG A;  1SQB G;  3C1L A;  1HBW A;  3CCM P;  3D6Y A;  2K1A A;  5CCH A;  2PP6 A;  2C0W A;  1M57 D;  1SLQ A;  2NRG A;  2NZ2 A;  2KIK A;  1HWT C;  2E75 B;  3MZW B;  4GOD A;  5TIS E;  1VF5 B;  2KSJ A;  3CX5 H;  3C9I A;  3L72 E;  1Y8A A;  4L75 A;  2KNC B;  3V2Q A;  4R4M A;  1QGK B;  1AJY A;  5APX A;  4BWN A;  1L4A A;  1L0L E;  3VYI A;  2V4H A;  1YJN P;  5KTB A;  2K37 A;  2V7Q H;  2XV5 A;  3ABV C;  3L73 G;  3VN0 A;  3D6Z A;  2IX7 C;  1JCD A;  2KUB A;  3BRT B;  3PH0 A;  4Y99 C;  3WUV A;  1J2J B;  3B71 A;  3BCC J;  1YQ3 C;  2W6B A;  4DCK A;  1ZP0 C;  3S9O A;  3C8V A;  1EDK A;  3CWB E;  3L74 E;  5TJH A;  4Z1M H;  3CC4 P;  3CI9 A;  1RE4 C;  1LP1 A;  2WT7 B;  5CCH D;  3QH9 A;  1NKN A;  3CPW O;  3B5N C;  5AW4 B;  1ZXG A;  5AW3 B;  3CCQ P;  1P84 H;  2WTY A;  2GM4 A;  2I1J A;  3AE5 C;  1QL1 A;  3H1L D;  1AQT A;  4OGQ B;  4JBZ A;  4I1L A;  1EDL A;  5KJ7 A;  1JUN A;  1LWU B;  5CCG C;  2KK7 A;  4YTP C;  1FBM A;  1AFO A;  3MUD A;  1URQ C;  2WZ7 A;  2BCC J;  1NU1 J;  2VRS A;  3BCC G;  3H1K D;  3TGU E;  1L0L J;  1VQ7 P;  2HFE D;  3CWB G;  3AE3 C;  4MN4 C;  1NTM E;  2R3S A;  3AE6 C;  2WSF H;  3L72 J;  1OX3 A;  5KAF E;  1CZQ A;  1LT9 C;  3U1C A;  3Q5P A;  2ZYA A;  2H7H A;  4PD4 I;  2E74 C;  5APW A;  1LNQ A;  5CMZ A;  3NFQ A;  5GTH H;  2ZT9 B;  2FFD A;  4PJ0 E;  5AW9 B;  1KB9 H;  1SQQ E;  1SQX G;  2FYU G;  1VQP P;  1JO5 A;  1GK6 A;  4NPE A;  2B9B A;  3CCJ P;  3PLN A;  3AE9 C;  2OYH C;  2OTJ P;  3TYY A;  5M1B A;  3GG2 A;  3FGA D;  2W27 A;  3A0B H;  1BSN A;  2SPZ A;  4I2L C;  1NU1 D;  2ZXX A;  1BE3 E;  3VTP C;  5B66 E;  4HJG H;  3GMA A;  1FDI A;  1BCC D;  2QEX P;  3SFE C;  1KFM A;  1M7L A;  1T3U A;  4N78 D;  1K05 A;  1OVR A;  2H88 C;  1BGY G;  4H0L B;  5APU A;  2M0B A;  2B87 B;  1RQV A;  1JTH B;  2IPP A;  3GHG A;  3L74 D;  4WY4 D;  1L4A B;  1SQP E;  2ZAE B;  3RK3 D;  1DH3 A;  3H1I E;  2KLU A;  1KIL A;  1ZV8 A;  2LKM A;  3HUS C;  2L91 A;  5CHX A;  1PFI A;  3B5N D;  1M1J B;  1G2C A;  1NYH A;  1SFC A;  2A45 H;  1J1D B;  1SVF A;  3MD0 A;  2XNX A;  5GTI H;  2WIT A;  3TK1 A;  1NVO A;  3KPE A;  3KYQ A;  1NU1 E;  2XKM A;  1BE3 D;  1USE A;  2D2C B;  1S9K D;  4LC1 A;  1ZN5 A;  3L35 A;  3L71 E;  4H13 B;  3A7O A;  1KB9 D;  1CI6 B;  1NTZ J;  3UIA A;  1N86 A;  3KDP B;  3AEE C;  1WT6 A;  2IZ0 A;  5APT A;  4GDO A;  1GU4 A;  3RK2 C;  2AXT E;  1M1K Q;  2OTL P;  1EDJ A;  4XFJ A;  1SQX K;  1PP9 E;  4ASW A;  1Q7Y Q;  1SQP K;  1BCC G;  3FX0 A;  4K35 A;  3N7N A;  1QX8 A;  2N1T C;  5C39 A;  1QVF O;  2MKV A;  2AEJ A;  2FYN C;  2ITA A;  3M9Q A;  3EQ2 A;  1PGO A;  3U1A A;  4EI2 A;  5E79 H;  1R5S A;  1L0N J;  3VMY A;  3CMA P;  1L0N E;  3AE7 C;  2OYI A;  2YIU C;  1N7S B;  1NTZ G;  1QEX A;  2FYU D;  2QJP B;  3M9B A;  4U3F E;  1K04 A;  2LXC B;  5CJ0 A;  1OWA A;  3SFD C;  1VL2 A;  2RN0 A;  1AA0 A;  1AVY A;  1YBK A;  5AW2 B;  4TLF A;  4UB8 E;  3H25 A;  1VQM P;  1YHQ P;  3TF5 A;  3R4Y A;  1M56 D;  2WPV B;  3W68 A;  1FZC C;  3CCR P;  1GL2 A;  4WY4 B;  1JB0 J;  3T97 A;  4DOJ A;  1SQV D;  1VQ5 P;  3RK3 B;  3CWB D;  1KIL C;  1JTH A;  1NTK K;  3MIW A;  1JY2 N;  3CME P;  2W8Z A;  2GUV A;  3FXD A;  3M0A A;  1SQB E;  5CJ4 A;  1Z56 A;  3TDK A;  1OW6 A;  1X0T A;  2AEM A;  1YTZ I;  1IC2 A;  2WVR A;  2H89 C;  1FOS E;  1IO4 A;  5AVV B;  2OTK E;  2L5G B;  1LTS C;  3AEF C;  3IFM A;  1PV3 A;  5APV A;  3P32 A;  4RO0 A;  2E5T A;  5KJ7 D;  4D6T G;  1HUC A;  1JY2 P;  3OA7 A;  3VMA A;  4JF7 A;  1T8Z A;  5KLV G;  3Q3D A;  1NGM B;  3H6P A;  2K9J A;  4PD4 H;  2QJK C;  3L71 D;  1HH0 A;  3H1K E;  1NTZ K;  1G1I A;  1PGJ A;  2QM8 A;  3S4R A;  1VQK P;  3V6I A;  3BVH A;  1GW4 A;  1SQP D;  2B89 A;  1KYO H;  1JMM A;  3CL3 D;  3U59 A;  3USS A;  4XA4 A;  4DT0 A;  2WQY C;  1LTJ C;  1LTT C;  3CXH E;  5AVU B;  3CXH H;  4IFF A;  3L75 D;  2N9Y B;  1BSH A;  1YIJ P;  2QE7 H;  1X8Y A;  1RF1 C;  2YO3 A;  1T2K C;  1FU1 A;  3S1K A;  2KXP B;  3JCU H;  2JKV A;  2W6A A;  3V2N A;  5TIS H;  1D7M A;  2Y9Y A;  2FY8 A;  3HE4 B;  4UB6 H;  3GLM A;  5L8R J;  3D70 A;  1NKZ B;  4C46 A;  4C7N B;  2O1K A;  1JY2 O;  1RY3 A;  1W2E A;  1QL2 A;  1KZU B;  2IFM A;  4HYT B;  5AW5 B;  3W67 A;  3BAT A;  2NPS C;  1GL2 B;  4AQR D;  1EDI A;  3OW2 O;  2Q5U A;  1KC8 Q;  1M90 Q;  1FAV A;  1K73 Q;  3PTZ A; 
#chains in the Genus database with same CATH homology
 3PP5 A;  1FZG A;  1RE4 A;  1CI6 A;  1NOH A;  3HD7 B;  1T2K D;  2PAJ A;  5APQ A;  1HGV A;  2M8R A;  2OYH A;  4JYC A;  5KJ7 C;  2GUS A;  4N6J A;  1DEB A;  2Z4E A;  3NMD A;  1CSB A;  2WSC H;  3V4W A;  2FFD B;  2HYN A;  2M3B A;  3B5N B;  2KP8 A;  3OAK A;  1N73 C;  1DX7 A;  3RK2 D;  1FZA A;  1H88 A;  2C0X A;  1SQV K;  1T3J A;  3GHG C;  2OAR A;  3LIE A;  1NWQ A;  2FKW B;  2E43 A;  1E5W A;  1OXZ A;  2FYU K;  2P7J A;  4B86 A;  4JYB A;  1GL2 D;  5BVZ A;  4OH8 B;  2FXM A;  4LGD E;  1H8A A;  1G2C B;  5APS A;  4W7Y A;  3HUS A;  5CCG A;  2ZFC A;  1FJK A;  2KLV A;  1GDT A;  2N9B A;  1NAF A;  2O01 H;  2Q3I A;  3I5C A;  3VMX A;  1LWU A;  1RF1 A;  1LGH B;  1ZR4 A;  3M9H A;  2JJL A;  5AW7 B;  3RL0 B;  1IFJ A;  1L4A C;  1KIL D;  1NO4 A;  3P8C E;  1J1E C;  3HUS B;  1IJD B;  1N7S A;  4EOT A;  2BAS A;  1YTZ T;  3LW5 H;  1X79 B;  5BU5 A;  1HGZ A;  2XZR A;  2N1T A;  1FOS F;  3V2R A;  3HTK B;  3V5B A;  4HH2 A;  5AW8 B;  3B8E B;  2H8P D;  4GIF A;  3L36 A;  3G3Z A;  2N1T D;  5CCH C;  2Q7C A;  1HJB A;  1SQQ K;  2Z5H A;  2HPC A;  2OYI B;  4XE5 B;  5CCG D;  1URQ D;  1IK9 A;  2HG5 D;  1KIL B;  5AVS B;  1JY3 P;  2WPS A;  2A45 G;  1M1J C;  1XTG B;  4Y99 B;  1LTI C;  5AVQ B;  2P2U A;  3L4F A;  1G1J A;  1YYC A;  1VPC A;  1GTW A;  1JY3 O;  4KHX A;  3RK2 B;  1IFI A;  1SFC C;  1LWU C;  2Z5I A;  3KQG A;  1JNM A;  2N1T B;  3SWF A;  1URQ B;  1LTJ B;  2NPS A;  3SWY A;  1CW5 A;  1RF1 B;  1SP4 A;  2WWW A;  2FYZ A;  4ZKU A;  3VOP A;  3EFG A;  1IFD A;  3II6 A;  1KQL A;  2IFN A;  4C7N A;  2NPS D;  3A2A A;  4I6M C;  4N78 E;  3H32 A;  5KLV K;  2C9N Y;  2YO2 A;  4WBA A;  2KYV A;  1WRG A;  2WPR A;  4IFM A;  1RE3 A;  5AW1 B;  4GKG A;  3M06 A;  2YKO A;  5AW6 B;  1FZC A;  3P8M C;  2E42 A;  2XDJ A;  1MUU A;  3M91 A;  4M3L A;  4IFD K;  3RL0 D;  1EQ7 A;  2KOG A;  3IR9 A;  1L0L K;  4N3Y B;  2FFD C;  3HE5 A;  2QM7 A;  1NH4 A;  2XU6 A;  3HE4 A;  1FZF A;  1VDF A;  4AYC A;  3VMZ A;  1RF0 A;  1SFC D;  5AVT B;  3B5N A;  3M0D A;  1ZLL A;  2JEE A;  3GHG B;  3M0D C;  1GW3 A;  2A45 I;  1LT9 B;  3O8Z A;  3HE5 B;  2CPB A;  1NU1 K;  3CLQ A;  3LID A;  5AVX B;  4GT1 A;  1N73 A;  1GL2 C;  2YMY A;  2OYH B;  1IFM A;  1LT9 A;  1FDM A;  3P7K A;  3NXS A;  1N7S C;  3P8C D;  2POH A;  3A5T A;  4WB4 A;  3TNU A;  1H89 A;  2R32 A;  3MTU E;  3HTK A;  2YNY A;  4W7Z A;  4WY4 A;  5AVZ B;  3VP9 A;  3HD7 D;  3NTN A;  1J1D C;  3MGN A;  1RF0 C;  1KFN A;  3VP8 A;  1JOC A;  1N73 B;  3BRV B;  3TNU B;  1LTA C;  3BAS A;  3TSI A;  5APY A;  2J58 A;  1J1E B;  2J59 M;  1A02 F;  1GU5 A;  4ZKP A;  3V2P A;  1FJP A;  1ZR2 A;  2Q9I A;  1JCC A;  2WT7 A;  1A02 J;  4W80 A;  4C7R A;  1RE3 C;  2HOD A;  1N7L A;  2R5B A;  1MV8 A;  2CPS A;  2YKQ A;  4O9B A;  3V4Q A;  2KB7 P;  2R3C A;  4DZO A;  2HOD B;  1NTM K;  5AVY B;  1XTC C;  2WPQ A;  1FZC B;  1IFN A;  4WY4 C;  3RK3 C;  1L0N K;  1NHL A;  2MJZ A;  2OYI C;  1GD2 E;  5AVW B;  4EIJ A;  5BU8 B;  1N2D C;  1URQ A;  2R5D A;  1MZ9 A;  1GK4 A;  3RL0 C;  1HVV A;  3HD7 C;  3HD7 A;  1MFZ A;  2WSE H;  2YKP A;  4LLH A;  2P67 A;  3UIA A;  1LTB C;  3VYI A;  5AVR B;  1SQB K;  2P1J A;  3A3Y B;  5AW0 B;  2I1K A;  2C9L Y;  1FZB A;  3R2P A;  1JY3 N;  1FZE A;  3HRN A;  1GZL A;  3E1I A;  3H32 B;  1M1J A;  1SFC B;  1S9K E;  4RES B;  3L37 A;  2HPC B;  3OJA B;  1HTL C;  1LTG C;  4AUW A;  3WMM 0;  2H43 A;  1LTJ A;  2HLO A;  1N7S D;  1L4A D;  1X9V A;  3N4X A;  2ZXE B;  2NPS B;  2O1J A;  1HBW A;  5CCH A;  2PP6 A;  2C0W A;  1HWT C;  1SLQ A;  2KSJ A;  3C9I A;  3V2Q A;  5APX A;  1L4A A;  1AQ5 A;  5KTB A;  2XV5 A;  3VN0 A;  2IX7 C;  1JCD A;  3BRT B;  4Y99 C;  1J2J B;  2W6B A;  3CI9 A;  1RE4 C;  2WT7 B;  5CCH D;  1NKN A;  3B5N C;  5AW4 B;  5AW3 B;  2WTY A;  2GM4 A;  2I1J A;  1QL1 A;  4I1L A;  5KJ7 A;  1JUN A;  1LWU B;  5CCG C;  1AFO A;  1FBM A;  3MUD A;  1URQ C;  2WZ7 A;  2VRS A;  2HFE D;  2WSF H;  3U1C A;  1CZQ A;  1LT9 C;  2H7H A;  5APW A;  5CMZ A;  3NFQ A;  2FFD A;  5AW9 B;  1JO5 A;  1GK6 A;  2OYH C;  3TYY A;  2W27 A;  4I2L C;  3VTP C;  1KFM A;  1M7L A;  1T3U A;  4N78 D;  5APU A;  1JTH B;  2IPP A;  3GHG A;  4WY4 D;  1L4A B;  3RK3 D;  1DH3 A;  1PFI A;  1KIL A;  1ZV8 A;  2LKM A;  3HUS C;  5CHX A;  3B5N D;  1M1J B;  1G2C A;  1SFC A;  3MD0 A;  2A45 H;  1J1D B;  1SVF A;  2XNX A;  2WIT A;  3TK1 A;  3KPE A;  3KYQ A;  2XKM A;  1S9K D;  4LC1 A;  1ZN5 A;  3L35 A;  3A7O A;  1CI6 B;  1N86 A;  3KDP B;  1WT6 A;  5APT A;  1GU4 A;  3RK2 C;  1SQX K;  1SQP K;  3N7N A;  2N1T C;  3M9Q A;  3EQ2 A;  3U1A A;  3VMY A;  2OYI A;  3M9B A;  1N7S B;  5CJ0 A;  1OWA A;  5AW2 B;  1FZC C;  1GL2 A;  4WY4 B;  4DOJ A;  3T97 A;  3RK3 B;  1KIL C;  3MIW A;  1JTH A;  1NTK K;  1JY2 N;  2GUV A;  3M0A A;  5CJ4 A;  1Z56 A;  1YTZ I;  1IC2 A;  1IO4 A;  1FOS E;  5AVV B;  2L5G B;  1LTS C;  3IFM A;  5APV A;  3P32 A;  5KJ7 D;  1HUC A;  1JY2 P;  3OA7 A;  4JF7 A;  1T8Z A;  3H6P A;  1HH0 A;  1NTZ K;  1G1I A;  2QM8 A;  3BVH A;  1GW4 A;  3CL3 D;  1JMM A;  3U59 A;  4XA4 A;  1LTJ C;  1LTT C;  5AVU B;  4IFF A;  1X8Y A;  1RF1 C;  2YO3 A;  1T2K C;  1FU1 A;  3V2N A;  2W6A A;  3HE4 B;  1NKZ B;  4C46 A;  4C7N B;  2O1K A;  1JY2 O;  1RY3 A;  1W2E A;  1QL2 A;  1KZU B;  2IFM A;  4HYT B;  5AW5 B;  3BAT A;  2NPS C;  1GL2 B;  4AQR D;  2Q5U A;  1FAV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...