4I6MC

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
LKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/hydrolase
molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
total genus 30
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.-:
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07529 HSA HSA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i6mC00
3KQGA 1G2CB 5AVWB 5APSA 3UIAA 3M9HA 2YNYA 2Z5IA 1JNMA 3VTPC 5AW1B 2N9BA 2YO3A 1CSBA 1X8YA 2R5DA 1IO4A 1MV8A 5AVVB 4AQRD 1T2KC 2R32A 5AW4B 5AVYB 5AW5B 3T97A 4B86A 4M3LA 3TNUA 2R3CA 2WPSA 3A3YB 3HE5A 3NFQA 3SWFA 4AYCA 4RESB 4DZOA 2BASA 5APWA 4AUWA 1SP4A 2WTYA 2P67A 4I2LC 5CMZA 2Q3IA 1HWTC 4JYBA 1H88A 1SLQA 3KDPB 3P32A 1CZQA 3A2AA 1FOSF 3VMXA 1GU4A 2ZXEB 3NTNA 5APYA 2XU6A 2WT7B 1OWAA 2Q5UA 5AW2B 3OAKA 3L37A 3M0AA 2C9NY 3HE4B 4C46A 4GT1A 4I6MC 3VMZA 2WPRA 4C7NB 5APVA 3LIEA 1S9KD 3V4QA 2JJLA 3M9BA 5AVRB 1A02J 4LC1A 5AVZB 1T2KD 3O8ZA 1A02F 3V4WA 2R5BA 3HTKA 2VRSA 1HJBA 5APUA 5APQA 3A5TA 2Q7CA 2P7JA 1CI6B 1H8AA 3A7OA 5APXA 1H89A 1FAVA 3TYYA 3HE5B 1FOSE 2Z5HA 5AW7B 1KQLA 5AVSB 5AW3B 2C9LY 3I5CA 5AW9B 2WT7A 2KP8A 5AW8B 4EOTA 1NAFA 2ZFCA 3P8MC 1NWQA 1HUCA 2W27A 3VN0A 3HE4A 3P7KA 1DH3A 3B8EB 5AW0B 1S9KE 2QM7A 4C7NA 2IPPA 4XE5B 2YO2A 1MFZA 5AVUB 3MD0A 2P2UA 4HYTB 1HBWA 3MGNA 3NXSA 5AW6B 5AVXB 1GTWA 1JUNA 1GK4A 2XZRA 4KHXA 3TNUB 2H7HA 3VMYA 3L36A 3L35A 1YYCA 3M0DA 3M91A 1GK6A 3M06A 1MUUA 4JYCA 5AVTB 2WWWA 2W6AA 3NMDA 1OXZA 3LIDA 1CI6A 3V5BA 2WPQA 3VYIA 2XV5A 2QM8A 1GD2E 1GZLA 1GU5A 2E43A 3TK1A 5APTA 1J2JB 5AVQB 2E42A 3IR9A 4GKGA
chains in the Genus database with same CATH superfamily
1FZGA 2HFED 3P8CE 5BVZA 1R8EA 1JY2O 2A45H 3VMAA 5CCGC 1VDFA 2R32A 1PPJD 2FXMA 2K9JA 3AE7C 2K9YA 1SQPE 1MKMA 1PIXA 3HE5A 3SWFA 1K05A 4GDOA 2KYVA 1RY3A 3BCCE 2XNXA 2QRXA 2W6BA 1NTZK 1L0ND 2E75C 2ZXXA 5APVA 3KZIH 1JMMA 2H89C 4LC1A 2WSEH 2N1TC 1LWUA 2WSFH 4D6TD 1NYHA 2FYNC 3TYYA 2IBZG 3HE5B 1L0LJ 2SPZA 4PV1D 3WUUA 1JY3O 2WT7A 2NRGA 1IFJA 3L71D 3P8MC 2QJYC 1NU1D 1HBWA 1X22A 3CD6P 5TISH 1KB9I 3H6PA 1BSNA 2YKQA 2O1KA 1QL2A 2E43A 3L71E 2J59M 4GKGA 3W67A 5AVWB 3E1IA 2Z5IA 1K9MQ 1JNMA 1Q7YQ 2R5DA 1VF5B 4WB4A 4W7ZA 5CJ4A 5CBNA 1EXJA 2KS1B 3TNUA 1JY3P 5KKZC 2WPSA 2JDIH 4ZMDA 4RESB 3RBXA 4AUWA 3GHGB 2I1KA 4KJMA 3H1KG 4BRYA 3CXHI 3AECC 2WSSH 2FBWC 4H44B 5APYA 1AQTA 2PAJA 1GL2B 3CPWO 2CPSA 1KILA 1L0NK 4U3FG 3RK3C 3SFDC 1EXIA 1FBMA 1HH0A 2MKVA 2O1JA 2VRSA 1M1JC 2Q7CA 3L74D 3SWYA 1LT9A 3BRVB 2BCCD 5AW9B 4PD4D 4H0LB 1HUCA 3S9OA 1NH4A 1NU1K 3M91A 3L74E 3I55P 4TT3H 5KLVD 5BU5A 2OTLP 1OXZA 1BCCD 2BCCE 1YQ4C 2LXBA 3L72J 4PD4E 1Q86Q 2QJKB 3H1ID 2Z4EA 1NTKK 4WY4B 2A06G 1MZ9A 4A7PA 2JKVA 1OW8A 3LW5H 4JQ0D 5KLVE 1SQXJ 2NPSC 1YITP 3HTKB 1BCCE 2BASA 5APWA 2WTYA 5CMZA 1SQVJ 3H1IE 3KDPB 3Q2YA 3CCMP 1Y47A 1EQ7A 1ZOYC 1SQVD 4MN4C 1EDLA 2Y9YA 2ZYDA 1OWAA 1U57A 1GW3A 3OAKA 1J1EB 3S4RA 1M7LA 1N7SA 3LIEA 1DX7A 3M9BA 2K1AA 1HJBA 2OGUA 4YTPC 5APUA 1VPCA 2NPSD 1SQVE 3Q5PA 4JF7A 1KQLA 5AVSB 4HJGH 1KORA 1JTHA 2GUSA 3OA7A 3H1HD 1RH5B 3HE4A 2JO1A 1LTAC 1IFPA 2IZ0A 2YO2A 1Q2NA 1JEKA 3VMYA 1HGZA 3M0DA 1LP1B 3MP7B 4NPFX 3WU2E 1YJWP 2L91A 2UWJE 3G3ZA 5KLVK 1GU5A 3OW2O 3FXEA 1ZRTD 1LNQA 2Q6QA 3H1HE 1VF5C 3BCCG 1BGYD 2ZVNB 1GW4A 1RE3C 2B87B 1LTJB 1PPJG 1S2EA 4M3LA 3GHGC 2QEXP 2IBZE 4PJ0E 1ZW0A 1QEXA 3TDKA 3MHVA 1SP4A 4H44C 1CZQA 2FFDA 3AE6C 1BGYE 1GMJA 1PL5A 3B5NC 2XU6A 2WITA 1SQBD 4UB8E 1N8RQ 1L0NG 1VF5D 2P58A 2YKPA 2C9NY 1SFCB 1NHLA 2QG4A 3H1KJ 2M5AB 1A02J 4LGDE 2ZT9B 4D6TG 1AV1A 1H0TB 4H0LC 1Q82Q 1VQ6P 4U3FJ 1SQBE 2HODA 1N73C 4EOTA 2BEQD 3L71G 4LLHA 1JMBA 3B5ND 1X0TA 3IFMA 3VOPA 1NU1G 2HPCB 2XZRA 3PH0A 3C8VA 3L36A 3MUDA 3FWNA 2QJKC 2K3RA 4WY4C 3MIWA 3HD7A 2DW3A 1FJKA 2OYIA 3D6ZA 2YNYA 1ZXGA 1FC2C 2RMZA 1KQFB 4H13C 3GF3A 3S1KA 4UB6E 2O3JA 5KAFE 1KILE 3A0HE 1P84D 3G71P 2E74D 3P32A 1FOSF 1LTIC 3AEDC 2B9BA 2MJZA 3CX5E 3HD7B 1SQBK 2LR2A 1KYOD 4IL6E 3V4QA 3JCUH 1P84E 2FYZA 1NTZJ 4ASWA 1ZR2A 4H13D 5CBOA 3VP8A 3L74G 1NTZD 2FKWB 2P7JA 3CCVP 1G2CA 1G1IA 1YIJP 5DJUB 1L4AB 1SQQD 2BCCG 1KQGB 1RE4C 1KYOE 1Q81Q 2O01H 2KSJA 5M1BA 2Q9IA 1MFZA 3NXSA 1QGKB 4C7RA 1NTZE 5KLVG 1BCCG 1SQQE 3F89A 1KFNA 1L2PA 2JP3A 3WUTA 1LGHB 3H1IG 4Y99B 1LTJC 3B71A 1G2CB 5APSA 1AFOA 1FZAA 3SSUA 3ITKA 1YI2P 5H2FH 1T3JA 3EFFK 1BE3D 3Q3DA 3CCQP 5KLIC 1FZCA 2KSEA 1LTSC 3KXDA 1HGVA 3IF4A 5L8RJ 1SQVG 2ZXEB 2QJPB 3K5BA 3NTNA 1SFCC 1FDIA 5CCHD 3CC2P 1M8OB 1LT1A 3E1RA 2OARA 3OJAB 1D7MA 1RF1A 5CJ0A 1BE3E 2WPRA 2ZT9C 2QE7H 1URQB 2R5BA 3PP5A 1S1CX 3FGAD 2P1JA 1EDKA 1FZCB 1L0NJ 3EQ2A 1EZVD 5GTHE 1X9VA 3W68A 1FDMA 1SQQK 1PPJE 2ZFCA 3H1HG 5B5EH 2CPBA 3P7KA 1PZQA 5CCGD 4C7NA 4YXWH 4D6TJ 1AVYA 2YMYA 3MGNA 4YPCA 2K9JB 1GK4A 2Y0DA 1VQ7P 3RL0B 3L71J 1EZVE 1L0NE 4IFFA 1NU1J 4N3YB 4PD4I 1PFIA 1BGYG 2E75D 4R4LA 4R4MA 2ZVOB 2FYUD 3RK2C 2E76B 1MV8A 1JCDA 1NJIQ 4D6TE 2KUBA 4OVNF 4B86A 1KMIZ 2V7QJ 1M57D 3HUSA 5B66E 2N1TD 1LWUB 1NTKD 2M3BA 1VQLP 3CC4P 1S5LH 3A2AA 1GU4A 1NU1E 4IFMA 1SQBG 2FYUE 2WT7B 4GT1A 1SS1A 1OVRA 3RK2D 3MZWB 2WSEJ 4W80A 3B5NA 5AVZB 3RL0g 2HR3A 3V4WA 1NTKE 1XTGB 3AE1C 1KB9H 1L4AC 5KJ7C 1IJDB 3A7OA 2GA1A 5KAIH 1NGMB 3AEEC 3KZIE 1FU1A 2YXQB 4U7JA 3L74J 2YXRB 1RQUA 1VQPP 5AVUB 3N7NA 5AW6B 5AVXB 3TNUB 1KN7A 2V4HA 3L35A 2BCCJ 1MUUA 1KD1Q 2WWWA 3NMDA 3VYIA 1CI6A 1N7LA 4Y99C 1ZMEC 1LJ2A 4BRYB 1OFCX 3CXHH 3KQGA 4QMAA 2O01N 3VTPC 4I7ZB 1FE6A 2W83C 2B89A 1KILB 3RK3D 3RBZA 2FYUK 2GUVA 5TISE 2D2CB 2OYOA 5KLVJ 2C0XA 2OYHA 5AVYB 1BCCJ 3T97A 2HLOA 3HRNA 2KNCA 1Y8AA 3PRJA 3V2NA 3H1IJ 4DOJA 1FS0E 2IBZI 3C9IA 2QJPC 1KB9D 1NTMD 1HWTC 1LT9B 2Q3EA 4IL6X 2ZYAA 3RK3E 3L37A 2ZAEB 1HF9A 1LTTC 2HYNA 1PGJA 2YMKA 1LTBC 5GTIH 1NTZG 1YJNP 1NOHA 1SQQG 2Z5HA 3MTUE 3I5CA 4K35A 4EDFA 3KHUA 1DD4A 3PTZA 2K88A 4HYTB 3RL0C 4UB8H 1JUNA 4KHXA 1OX3A 5KTBA 3SFEC 3F5HA 1AJYA 3H1HJ 3CI9A 1RF0A 5CHXA 2E76C 3IR9A 5AW1B 4IOIH 4W7YA 5CCHA 3KPEA 4AQRD 1N7SB 3QH9A 1BE3G 2PP6A 1LWUC 2R3CA 3BASA 3A3YB 3EFGA 4ZKUA 2RKLA 1BGYJ 1IK7A 1NAYA 1SLQA 1NTMK 3GMAA 3G9RA 1WT6A 1JTHB 2Q5UA 1VQ9P 3HE4B 4C46A 3CX5I 4I6MC 3QWOC 2AXCA 3A0BH 5CCGA 1GL2C 1ZRTE 2H8PD 4DCKA 1U7JA 2JR8A 1SQBJ 1P84I 3PJSK 1QLED 1EZVG 3AE3C 1JO5A 2C9LY 1KZUB 4UB6H 2KP8A 1W2BO 2QVAA 3CCJP 5AW0B 1SQXK 1KYOI 1VQNP 3PHLA 3N4XA 3CCLP 3ZDMA 3CX5H 1S3JA 1OMIA 1FDOA 2PGDA 3LIDA 4H44D 1AVOA 1QVFO 1GL2D 2XV5A 2N1TA 2YKOA 3TK1A 1BDDA 2FFDB 4I7ZC 1DEEG 1JB0J 1K04A 1HVVA 1KILC 3AEFC 2D2CC 3M9HA 4RJTA 2A45G 3ABVC 2FYUG 3H32A 4PV1B 1XTCC 1KV4A 1W5CE 5BU8B 1UIIA 2WZ7A 1LT9C 2IFNA 2XDJA 1NTKG 3L73D 2P67A 4H0LD 1EC5A 2Q3IA 4EYYQ 4JBZA 2HODB 4OWFA 2K37A 2AXTH 3L75D 2FYNB 1RHZB 2OQQA 3L4FA 2JJLA 1OVUA 1R5SA 2WMMA 2WSCH 1FZFA 3L73E 1KFMA 2PFXA 1J1EC 4WY4D 1OW7A 3D70A 1PGOA 3TGUD 2OYIB 3VN0A 3B8EB 1PV3A 1T3UA 1OZHA 3L70D 3KYQA 3VP9A 2KXPB 1QX8A 1SQQJ 2I8DA 2ITAA 4RO0A 1QL1A 1M1JA 1GD2E 1YQ3C 2WVRA 1EZVI 1PP9D 2W90A 2CK3H 4RKUJ 1N7SC 1DIPA 1X8YA 3L70E 4OH8B 1CW5A 4HKZH 3TF5A 3E7KA 1USDA 4K3AA 3H1JD 2KLVA 3NFQA 3CCSP 1NTMG 2BEZF 1PP9E 3GLMA 1H88A 3CCUP 2KIKA 1G1JA 1BE3J 3H25A 2A45I 1PGQA 1W2EA 3M0DC 5AVRB 3H1JE 3H1LG 2QA4P 1KQSO 2B88A 2NPSA 1VQ5P 1Z56A 1SQPD 2R44A 1K8AQ 3IN6A 5TJHA 1JM0A 1YHQP 3JCUE 2IPPA 1YYCA 2GM4A 2FFDC 3G4SP 3WUVA 1FJPA 3II6A 2V7QH 5AVQB 1SFCD 4PV1C 2NPSB 1PGPA 1CSBA 1VQKP 1RF1B 1YJ9P 2ZT9D 4NPEA 1AQ5A 3FX0A 3V2RA 2LXCB 3D71A 5E79E 2I1JA 1J1DB 1M1KQ 2FYUJ 3Q5SA 1JY2P 4ZNCA 3AEGC 5H2FE 5AW2B 2Y0EA 3B4SA 3GG2A 1TU3F 2AEJA 1L0LD 2H88C 3VMZA 4C7NB 1NTKJ 3MUDC 1RE3A 4IFDK 2G8YA 2KS1A 1DEBA 2QSIA 3AEAC 3FWLA 3A5TA 3HD7C 1N86A 3GHGA 1H8AA 4XFJA 4YXDC 3G6EP 1FAVA 4CPGA 1FOSE 2OYIC 1VQOP 1GL2A 1SQPK 1NAFA 4PD4H 1NWQA 1L0LE 1AA0A 2M3EA 2W27A 2IFMA 5EFWB 1USEA 1IFNA 2WSFJ 2R3SA 2QIWA 3AE4C 3HUSB 2WPVB 3CWBG 4WBAA 4KT0J 2WPQA 2OTJP 1LTGC 3HD7D 1VL2A 5B5EE 4OGQB 5K5GB 1R5LA 3UIAA 2N9BA 1N73A 2IYPA 1IZNB 1Y9BA 1S4XA 2E5YA 2WQYC 4ASVA 3B5NB 4L74A 2KOGA 1L4AD 5KJ7D 1IFIA 4DZOA 3L73G 3I56P 5DJTB 2FXOA 3U59A 3JSVC 2M0BA 1JY2N 1OW6A 1M56D 1ZR4A 4L73A 4WY4A 3U1AA 1EDJA 3L75G 1L0LK 1ZN5A 1NTMJ 1N73B 1A02F 1X79B 3HTKA 3AE2C 4DJGA 4GOEA 1S5LE 2W6JH 4WWIA 1K73Q 1CI6B 1N2DC 2IZ1A 3WU2H 2NZ2A 1URQC 5AW7B 3TGUG 2E74B 1FZEA 1DH3A 2IDBA 1SVFA 3H1LJ 3L72D 4HH2A 2Y0CA 1FZCC 3L70G 4WVZA 3H1LD 1KB9E 2OYHB 1NTME 3T97B 1IK9A 3USSA 2AEMA 3U1CA 2KNCB 3CC7P 3PLNA 5AVTB 5KAIE 1JY3N 4PJ0H 3CXHD 4H13B 1VQ4P 1PP9G 1SQXD 1RF1C 2OTKE 4EI2A 2JWAA 3D6YA 1URQD 3L72E 4N78D 4DT0A 1IC2A 1IO4A 3H1LE 2PRRA 1RE4A 4L76A 5AW4B 2RH0A 5AW5B 3O6QA 1J1DC 2AEFA 4O9BA 1LP1A 3H1JG 1ZV8A 3CXHE 4I2LC 3Q5RA 3FXDA 1SQXE 2YIUB 3LW5J 3M9QA 4N78E 3AE5C 1BSHA 2Y9ZA 3M0AA 3V6IA 2B87A 1LTJA 3CMEP 4NPDA 2ZJSE 2JEEA 1S9KD 3RL0D 1OIPA 4BWNA 1JOCA 2JWDA 2H43A 3O6QB 2KK7A 2LKMA 5APXA 1H89A 1QVGO 2IBZD 2RN0A 1KTMA 2G3AA 1SQPG 2KZJA 2E5TA 5AW3B 2E76D 4ZKPA 5AW8B 1SFCA 1S9KE 2QM7A 3HUSC 4GODA 1UIXA 1NVOA 2M5AA 3MD0A 5GTIE 2ZYGA 1GTWA 1YBKA 1EDIA 3BATA 3M06A 1T6AA 1HTLC 1H0TA 2W6AA 4OGQC 3AE9C 4HB1A 1WRGA 5KAFH 3A0HH 3CLQA 5KLIB 1YTZT 4L75A 1U7MA 2KLUA 3CWBJ 3C1LA 1SQVK 2M8RA 2HPCA 1VQ8P 2P10A 3CL3D 3CWBD 1E79H 1KC8Q 4IL6H 1NO4A 1IFMA 3CMAP 3BRTB 1P84H 3EWKA 3H1KD 4I1LA 4OGQD 1RQVA 2HG5D 1L0LG 3CWBE 4U3FD 1WMKA 3BVHA 1KYOH 2E75B 3L73J 1NKNA 2J5UA 3H1KE 2KI7B 5APQA 2Q1KA 2XNDH 2XKMA 2E74C 2N1TB 3L75J 1KILD 1FZBA 2FXPA 1BDCA 2D2CD 4U3FE 3A0BE 4EIJA 2OYHC 1DD3A 3R4YA 3H32B 2KB7P 4Y28J 4Z1MH 3GF7A 2QJYB 4GIFA 2P2UA 3AE8C 3CX5D 1Q90D 2H7HA 3V2PA 2C0WA 1T8ZA 3CCRP 4JYCA 3RK2B 2J58A 1HJ0A 3TGUJ 1GZLA 2N9YB 1L4AA 5KJ7A 5APTA 3L75E 1J2JB 3L70J 2E42A 2L5GB 3V2QA 2A06D 2FY8A 2YO3A 1YTZI 1NKZB 5AVVB 1T2KC 5C39A 2IYOA 4BXLA 1PP9J 3IAOA 3CCEP 2YIUC 4AYCA 3TGUE 3Q1MA 3TSIA 5KKZB 4N6JA 4JYBA 3VMXA 2A06E 3R2PA 3JC22 5GTHH 3H1JJ 1S5LX 2WSCJ 2POHA 4GOFA 1OVVA 2W8ZA 1E5WA 3GW6A 3O8ZA 1T2KD 3RK3B 1ZLLA 1M90Q 1RF0C 3WMM0 1S72P 1M1JB 3AEBC 5E79H 2AXTE 5CCHC 3RGUA 1N7SD 1JCCA 2KZIA 3L72G 3P8CD 1URQA 4XE5B 1GDTA 1SQPJ 1GK6A 4XA4A 3V5BA 1MFTA 5B66H 2O01J 1IFDA 2QM8A 4TLFA 1ZP0C 3BCCJ 3SWKA 2IX7C 1SQXG 4JPZB 1VQMP 3BCCD
chains in the Genus database with same CATH topology
1FZGA 3UIAA 2OYIA 2HFED 2YNYA 3P8CE 5AW1B 2N9BA 5BVZA 1JY2O 2A45H 1N73A 4W7YA 5CCHA 5CCGC 1VDFA 3KPEA 4AQRD 1N7SB 2R32A 2FXMA 2PP6A 3B5NB 1LWUC 2R3CA 3BASA 3A3YB 2KOGA 3EFGA 4ZKUA 3HE5A 1L4AD 5KJ7D 3SWFA 1IFIA 4DZOA 2KYVA 1RY3A 3U59A 1SLQA 3P32A 1JY2N 1FOSF 1NTMK 2XNXA 1LTIC 1ZR4A 2W6BA 1NTZK 4WY4A 1WT6A 3U1AA 2MJZA 1JTHB 3HD7B 1SQBK 2Q5UA 3HE4B 4C46A 4I6MC 5APVA 1L0LK 1ZN5A 3V4QA 1N73B 1JMMA 4LC1A 5CCGA 1A02F 2FYZA 1X79B 3HTKA 1GL2C 2H8PD 1ZR2A 2WSEH 2N1TC 1LWUA 2WSFH 3VP8A 2FKWB 2P7JA 1CI6B 1G2CA 1N2DC 1G1IA 3TYYA 3HE5B 1L4AB 1URQC 5AW7B 1JO5A 2C9LY 1JY3O 1KZUB 2WT7A 2KP8A 1IFJA 3P8MC 1RE4C 1FZEA 1DH3A 1SVFA 2O01H 5AW0B 1SQXK 4HH2A 2KSJA 1FZCC 3N4XA 2Q9IA 1MFZA 2OYHB 1HBWA 1IK9A 3U1CA 3NXSA 4C7RA 3H6PA 2YKQA 5AVTB 1JY3N 3LIDA 2O1KA 1GL2D 2XV5A 1QL2A 1KFNA 2N1TA 2YKOA 3TK1A 2E43A 2FFDB 1LGHB 1HVVA 4Y99B 1LTJC 1RF1C 1KILC 2J59M 4GKGA 1G2CB 5AVWB 5APSA 3E1IA 3M9HA 2Z5IA 1URQD 2A45G 1JNMA 1AFOA 4N78D 2R5DA 3H32A 1IC2A 1IO4A 4WB4A 1FZAA 4W7ZA 1RE4A 5CJ4A 5AW4B 1T3JA 5AW5B 1J1DC 4O9BA 3TNUA 1XTCC 1JY3P 1FZCA 2WPSA 5BU8B 1LTSC 2WZ7A 1LT9C 4RESB 2IFNA 2XDJA 1ZV8A 4AUWA 3GHGB 2I1KA 2P67A 4I2LC 2Q3IA 1HGVA 3M9QA 2ZXEB 3NTNA 1SFCC 2HODB 5APYA 5CCHD 2PAJA 1GL2B 4N78E 2CPSA 3OJAB 2OARA 3M0AA 1RF1A 1LTJA 1KILA 5CJ0A 1L0NK 3RK3C 2WPRA 2JEEA 1URQB 1S9KD 3L4FA 2JJLA 3RL0D 1FBMA 2WSCH 1HH0A 1JOCA 2O1JA 2R5BA 1FZFA 3PP5A 2VRSA 1M1JC 2H43A 2P1JA 1KFMA 2Q7CA 1FZCB 2LKMA 1J1EC 5APXA 1H89A 4WY4D 3EQ2A 1LT9A 3SWYA 3BRVB 1X9VA 5AW3B 5AW9B 4ZKPA 1FDMA 1SQQK 5AW8B 2ZFCA 1HUCA 2OYIB 3VN0A 2CPBA 3P7KA 1SFCA 3B8EB 1T3UA 1S9KE 2QM7A 5CCGD 3HUSC 4C7NA 1NH4A 3KYQA 1NU1K 2YMYA 3VP9A 3MD0A 3MGNA 1GTWA 1GK4A 3M91A 3BATA 3M06A 1HTLC 3RL0B 5BU5A 2W6AA 1OXZA 1QL1A 1M1JA 1WRGA 1GD2E 4IFFA 3CLQA 2Z4EA 4N3YB 1YTZT 1NTKK 1PFIA 4WY4B 1N7SC 1MZ9A 1X8YA 3RK2C 4OH8B 1CW5A 1MV8A 1JCDA 1SQVK 2M8RA 2HPCA 3LW5H 3CL3D 4B86A 3HUSA 2NPSC 1NO4A 3HTKB 2N1TD 1IFMA 2KLVA 3NFQA 2BASA 5APWA 1LWUB 2WTYA 3BRTB 5CMZA 2M3BA 1H88A 3KDPB 3A2AA 4I1LA 1G1JA 1GU4A 4IFMA 1EQ7A 2WT7B 1OWAA 2A45I 1GW3A 3OAKA 2HG5D 4GT1A 1J1EB 1W2EA 1M7LA 1N7SA 3BVHA 3LIEA 3RK2D 3M0DC 1DX7A 4W80A 3M9BA 3B5NA 5AVRB 1NKNA 5AVZB 3V4WA 1XTGB 1HJBA 1L4AC 5APUA 5APQA 5KJ7C 1VPCA 1IJDB 2NPSD 2XKMA 2NPSA 3A7OA 4JF7A 1Z56A 2N1TB 1KQLA 5AVSB 1KILD 1FZBA 1JTHA 2GUSA 3OA7A 3HE4A 4EIJA 2OYHC 1FU1A 3H32B 1LTAC 2KB7P 2IPPA 2YO2A 5AVUB 4GIFA 2P2UA 3N7NA 5AW6B 5AVXB 2H7HA 3TNUB 3V2PA 2C0WA 3VMYA 3L35A 1HGZA 1T8ZA 1YYCA 3M0DA 2GM4A 1MUUA 4JYCA 3RK2B 2FFDC 2WWWA 2J58A 3NMDA 3VYIA 1CI6A 3G3ZA 1FJPA 1N7LA 4Y99C 5KLVK 1GZLA 3II6A 1GU5A 1L4AA 5KJ7A 5APTA 1J2JB 5AVQB 1SFCD 2E42A 2NPSB 2L5GB 3KQGA 3V2QA 3VTPC 2YO3A 1GW4A 1CSBA 1RE3C 1RF1B 1LTJB 1KILB 3RK3D 2FYUK 1YTZI 2GUVA 1NKZB 5AVVB 1AQ5A 1T2KC 2C0XA 2OYHA 5AVYB 3T97A 2HLOA 3HRNA 3V2RA 4M3LA 3GHGC 3V2NA 4DOJA 2I1JA 4AYCA 1J1DB 3C9IA 1SP4A 3TSIA 1HWTC 4N6JA 4JYBA 1CZQA 2FFDA 1LT9B 1JY2P 3VMXA 3R2PA 3B5NC 2XU6A 2WITA 5AW2B 3L37A 2YKPA 2C9NY 1SFCB 1NHLA 3VMZA 2POHA 4C7NB 1LTTC 2HYNA 1RE3A 4IFDK 1A02J 1DEBA 1E5WA 1T2KD 3O8ZA 3RK3B 4LGDE 1ZLLA 1LTBC 1RF0C 3WMM0 3A5TA 3HD7C 1N86A 3GHGA 1H8AA 1FAVA 1M1JB 1FOSE 2OYIC 1NOHA 2Z5HA 3MTUE 2HODA 3I5CA 1GL2A 1N73C 1SQPK 4EOTA 5CCHC 1NAFA 1N7SD 1NWQA 2W27A 2IFMA 4LLHA 1JCCA 3B5ND 1IFNA 3IFMA 3P8CD 3VOPA 1URQA 2HPCB 4XE5B 3RL0C 4HYTB 1GDTA 1JUNA 2XZRA 4KHXA 3HUSB 3L36A 3MUDA 5KTBA 1GK6A 4WBAA 4XA4A 3V5BA 2WPQA 3CI9A 1LTGC 1IFDA 2QM8A 1RF0A 4WY4C 3HD7D 3MIWA 2IX7C 3HD7A 5CHXA 1FJKA 3IR9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KQG A;  1G2C B;  5AVW B;  5APS A;  3UIA A;  3M9H A;  2YNY A;  2Z5I A;  1JNM A;  3VTP C;  5AW1 B;  2N9B A;  2YO3 A;  1CSB A;  1X8Y A;  2R5D A;  1IO4 A;  1MV8 A;  5AVV B;  4AQR D;  1T2K C;  2R32 A;  5AW4 B;  5AVY B;  5AW5 B;  3T97 A;  4B86 A;  4M3L A;  3TNU A;  2R3C A;  2WPS A;  3A3Y B;  3HE5 A;  3NFQ A;  3SWF A;  4AYC A;  4RES B;  4DZO A;  2BAS A;  5APW A;  4AUW A;  1SP4 A;  2WTY A;  2P67 A;  4I2L C;  5CMZ A;  2Q3I A;  1HWT C;  4JYB A;  1H88 A;  1SLQ A;  3KDP B;  3P32 A;  1CZQ A;  3A2A A;  1FOS F;  3VMX A;  1GU4 A;  2ZXE B;  3NTN A;  5APY A;  2XU6 A;  2WT7 B;  1OWA A;  2Q5U A;  5AW2 B;  3OAK A;  3L37 A;  3M0A A;  2C9N Y;  3HE4 B;  4C46 A;  4GT1 A;  4I6M C;  3VMZ A;  2WPR A;  4C7N B;  5APV A;  3LIE A;  1S9K D;  3V4Q A;  2JJL A;  3M9B A;  5AVR B;  1A02 J;  4LC1 A;  5AVZ B;  1T2K D;  3O8Z A;  1A02 F;  3V4W A;  2R5B A;  3HTK A;  2VRS A;  1HJB A;  5APU A;  5APQ A;  3A5T A;  2Q7C A;  2P7J A;  1CI6 B;  1H8A A;  3A7O A;  5APX A;  1H89 A;  1FAV A;  3TYY A;  3HE5 B;  1FOS E;  2Z5H A;  5AW7 B;  1KQL A;  5AVS B;  5AW3 B;  2C9L Y;  3I5C A;  5AW9 B;  2WT7 A;  2KP8 A;  5AW8 B;  4EOT A;  1NAF A;  2ZFC A;  3P8M C;  1NWQ A;  1HUC A;  2W27 A;  3VN0 A;  3HE4 A;  3P7K A;  1DH3 A;  3B8E B;  5AW0 B;  1S9K E;  2QM7 A;  4C7N A;  2IPP A;  4XE5 B;  2YO2 A;  1MFZ A;  5AVU B;  3MD0 A;  2P2U A;  4HYT B;  1HBW A;  3MGN A;  3NXS A;  5AW6 B;  5AVX B;  1GTW A;  1JUN A;  1GK4 A;  2XZR A;  4KHX A;  3TNU B;  2H7H A;  3VMY A;  3L36 A;  3L35 A;  1YYC A;  3M0D A;  3M91 A;  1GK6 A;  3M06 A;  1MUU A;  4JYC A;  5AVT B;  2WWW A;  2W6A A;  3NMD A;  1OXZ A;  3LID A;  1CI6 A;  3V5B A;  2WPQ A;  3VYI A;  2XV5 A;  2QM8 A;  1GD2 E;  1GZL A;  1GU5 A;  2E43 A;  3TK1 A;  5APT A;  1J2J B;  5AVQ B;  2E42 A;  3IR9 A;  4GKG A; 
#chains in the Genus database with same CATH topology
 1FZG A;  2HFE D;  3P8C E;  5BVZ A;  1R8E A;  1JY2 O;  2A45 H;  3VMA A;  5CCG C;  1VDF A;  2R32 A;  1PPJ D;  2FXM A;  2K9J A;  3AE7 C;  2K9Y A;  1SQP E;  1MKM A;  1PIX A;  3HE5 A;  3SWF A;  1K05 A;  4GDO A;  2KYV A;  1RY3 A;  3BCC E;  2XNX A;  2QRX A;  2W6B A;  1NTZ K;  1L0N D;  2E75 C;  2ZXX A;  5APV A;  3KZI H;  1JMM A;  2H89 C;  4LC1 A;  2WSE H;  2N1T C;  1LWU A;  2WSF H;  4D6T D;  1NYH A;  2FYN C;  3TYY A;  2IBZ G;  3HE5 B;  1L0L J;  2SPZ A;  4PV1 D;  3WUU A;  1JY3 O;  2WT7 A;  2NRG A;  1IFJ A;  3L71 D;  3P8M C;  2QJY C;  1NU1 D;  1HBW A;  1X22 A;  3CD6 P;  5TIS H;  1KB9 I;  3H6P A;  1BSN A;  2YKQ A;  2O1K A;  1QL2 A;  2E43 A;  3L71 E;  2J59 M;  4GKG A;  3W67 A;  5AVW B;  3E1I A;  2Z5I A;  1K9M Q;  1JNM A;  1Q7Y Q;  2R5D A;  1VF5 B;  4WB4 A;  4W7Z A;  5CJ4 A;  5CBN A;  1EXJ A;  2KS1 B;  3TNU A;  1JY3 P;  5KKZ C;  2WPS A;  2JDI H;  4ZMD A;  4RES B;  3RBX A;  4AUW A;  3GHG B;  2I1K A;  4KJM A;  3H1K G;  4BRY A;  3CXH I;  3AEC C;  2WSS H;  2FBW C;  4H44 B;  5APY A;  1AQT A;  2PAJ A;  1GL2 B;  3CPW O;  2CPS A;  1KIL A;  1L0N K;  4U3F G;  3RK3 C;  3SFD C;  1EXI A;  1FBM A;  1HH0 A;  2MKV A;  2O1J A;  2VRS A;  1M1J C;  2Q7C A;  3L74 D;  3SWY A;  1LT9 A;  3BRV B;  2BCC D;  5AW9 B;  4PD4 D;  4H0L B;  1HUC A;  3S9O A;  1NH4 A;  1NU1 K;  3M91 A;  3L74 E;  3I55 P;  4TT3 H;  5KLV D;  5BU5 A;  2OTL P;  1OXZ A;  1BCC D;  2BCC E;  1YQ4 C;  2LXB A;  3L72 J;  4PD4 E;  1Q86 Q;  2QJK B;  3H1I D;  2Z4E A;  1NTK K;  4WY4 B;  2A06 G;  1MZ9 A;  4A7P A;  2JKV A;  1OW8 A;  3LW5 H;  4JQ0 D;  5KLV E;  1SQX J;  2NPS C;  1YIT P;  3HTK B;  1BCC E;  2BAS A;  5APW A;  2WTY A;  5CMZ A;  1SQV J;  3H1I E;  3KDP B;  3Q2Y A;  3CCM P;  1Y47 A;  1EQ7 A;  1ZOY C;  1SQV D;  4MN4 C;  1EDL A;  2Y9Y A;  2ZYD A;  1OWA A;  1U57 A;  1GW3 A;  3OAK A;  1J1E B;  3S4R A;  1M7L A;  1N7S A;  3LIE A;  1DX7 A;  3M9B A;  2K1A A;  1HJB A;  2OGU A;  4YTP C;  5APU A;  1VPC A;  2NPS D;  1SQV E;  3Q5P A;  4JF7 A;  1KQL A;  5AVS B;  4HJG H;  1KOR A;  1JTH A;  2GUS A;  3OA7 A;  3H1H D;  1RH5 B;  3HE4 A;  2JO1 A;  1LTA C;  1IFP A;  2IZ0 A;  2YO2 A;  1Q2N A;  1JEK A;  3VMY A;  1HGZ A;  3M0D A;  1LP1 B;  3MP7 B;  4NPF X;  3WU2 E;  1YJW P;  2L91 A;  2UWJ E;  3G3Z A;  5KLV K;  1GU5 A;  3OW2 O;  3FXE A;  1ZRT D;  1LNQ A;  2Q6Q A;  3H1H E;  1VF5 C;  3BCC G;  1BGY D;  2ZVN B;  1GW4 A;  1RE3 C;  2B87 B;  1LTJ B;  1PPJ G;  1S2E A;  4M3L A;  3GHG C;  2QEX P;  2IBZ E;  4PJ0 E;  1ZW0 A;  1QEX A;  3TDK A;  3MHV A;  1SP4 A;  4H44 C;  1CZQ A;  2FFD A;  3AE6 C;  1BGY E;  1GMJ A;  1PL5 A;  3B5N C;  2XU6 A;  2WIT A;  1SQB D;  4UB8 E;  1N8R Q;  1L0N G;  1VF5 D;  2P58 A;  2YKP A;  2C9N Y;  1SFC B;  1NHL A;  2QG4 A;  3H1K J;  2M5A B;  1A02 J;  4LGD E;  2ZT9 B;  4D6T G;  1AV1 A;  1H0T B;  4H0L C;  1Q82 Q;  1VQ6 P;  4U3F J;  1SQB E;  2HOD A;  1N73 C;  4EOT A;  2BEQ D;  3L71 G;  4LLH A;  1JMB A;  3B5N D;  1X0T A;  3IFM A;  3VOP A;  1NU1 G;  2HPC B;  2XZR A;  3PH0 A;  3C8V A;  3L36 A;  3MUD A;  3FWN A;  2QJK C;  2K3R A;  4WY4 C;  3MIW A;  3HD7 A;  2DW3 A;  1FJK A;  2OYI A;  3D6Z A;  2YNY A;  1ZXG A;  1FC2 C;  2RMZ A;  1KQF B;  4H13 C;  3GF3 A;  3S1K A;  4UB6 E;  2O3J A;  5KAF E;  1KIL E;  3A0H E;  1P84 D;  3G71 P;  2E74 D;  3P32 A;  1FOS F;  1LTI C;  3AED C;  2B9B A;  2MJZ A;  3CX5 E;  3HD7 B;  1SQB K;  2LR2 A;  1KYO D;  4IL6 E;  3V4Q A;  3JCU H;  1P84 E;  2FYZ A;  1NTZ J;  4ASW A;  1ZR2 A;  4H13 D;  5CBO A;  3VP8 A;  3L74 G;  1NTZ D;  2FKW B;  2P7J A;  3CCV P;  1G2C A;  1G1I A;  1YIJ P;  5DJU B;  1L4A B;  1SQQ D;  2BCC G;  1KQG B;  1RE4 C;  1KYO E;  1Q81 Q;  2O01 H;  2KSJ A;  5M1B A;  2Q9I A;  1MFZ A;  3NXS A;  1QGK B;  4C7R A;  1NTZ E;  5KLV G;  1BCC G;  1SQQ E;  3F89 A;  1KFN A;  1L2P A;  2JP3 A;  3WUT A;  1LGH B;  3H1I G;  4Y99 B;  1LTJ C;  3B71 A;  1G2C B;  5APS A;  1AFO A;  1FZA A;  3SSU A;  3ITK A;  1YI2 P;  5H2F H;  1T3J A;  3EFF K;  1BE3 D;  3Q3D A;  3CCQ P;  5KLI C;  1FZC A;  2KSE A;  1LTS C;  3KXD A;  1HGV A;  3IF4 A;  5L8R J;  1SQV G;  2ZXE B;  2QJP B;  3K5B A;  3NTN A;  1SFC C;  1FDI A;  5CCH D;  3CC2 P;  1M8O B;  1LT1 A;  3E1R A;  2OAR A;  3OJA B;  1D7M A;  1RF1 A;  5CJ0 A;  1BE3 E;  2WPR A;  2ZT9 C;  2QE7 H;  1URQ B;  2R5B A;  3PP5 A;  1S1C X;  3FGA D;  2P1J A;  1EDK A;  1FZC B;  1L0N J;  3EQ2 A;  1EZV D;  5GTH E;  1X9V A;  3W68 A;  1FDM A;  1SQQ K;  1PPJ E;  2ZFC A;  3H1H G;  5B5E H;  2CPB A;  3P7K A;  1PZQ A;  5CCG D;  4C7N A;  4YXW H;  4D6T J;  1AVY A;  2YMY A;  3MGN A;  4YPC A;  2K9J B;  1GK4 A;  2Y0D A;  1VQ7 P;  3RL0 B;  3L71 J;  1EZV E;  1L0N E;  4IFF A;  1NU1 J;  4N3Y B;  4PD4 I;  1PFI A;  1BGY G;  2E75 D;  4R4L A;  4R4M A;  2ZVO B;  2FYU D;  3RK2 C;  2E76 B;  1MV8 A;  1JCD A;  1NJI Q;  4D6T E;  2KUB A;  4OVN F;  4B86 A;  1KMI Z;  2V7Q J;  1M57 D;  3HUS A;  5B66 E;  2N1T D;  1LWU B;  1NTK D;  2M3B A;  1VQL P;  3CC4 P;  1S5L H;  3A2A A;  1GU4 A;  1NU1 E;  4IFM A;  1SQB G;  2FYU E;  2WT7 B;  4GT1 A;  1SS1 A;  1OVR A;  3RK2 D;  3MZW B;  2WSE J;  4W80 A;  3B5N A;  5AVZ B;  3RL0 g;  2HR3 A;  3V4W A;  1NTK E;  1XTG B;  3AE1 C;  1KB9 H;  1L4A C;  5KJ7 C;  1IJD B;  3A7O A;  2GA1 A;  5KAI H;  1NGM B;  3AEE C;  3KZI E;  1FU1 A;  2YXQ B;  4U7J A;  3L74 J;  2YXR B;  1RQU A;  1VQP P;  5AVU B;  3N7N A;  5AW6 B;  5AVX B;  3TNU B;  1KN7 A;  2V4H A;  3L35 A;  2BCC J;  1MUU A;  1KD1 Q;  2WWW A;  3NMD A;  3VYI A;  1CI6 A;  1N7L A;  4Y99 C;  1ZME C;  1LJ2 A;  4BRY B;  1OFC X;  3CXH H;  3KQG A;  4QMA A;  2O01 N;  3VTP C;  4I7Z B;  1FE6 A;  2W83 C;  2B89 A;  1KIL B;  3RK3 D;  3RBZ A;  2FYU K;  2GUV A;  5TIS E;  2D2C B;  2OYO A;  5KLV J;  2C0X A;  2OYH A;  5AVY B;  1BCC J;  3T97 A;  2HLO A;  3HRN A;  2KNC A;  1Y8A A;  3PRJ A;  3V2N A;  3H1I J;  4DOJ A;  1FS0 E;  2IBZ I;  3C9I A;  2QJP C;  1KB9 D;  1NTM D;  1HWT C;  1LT9 B;  2Q3E A;  4IL6 X;  2ZYA A;  3RK3 E;  3L37 A;  2ZAE B;  1HF9 A;  1LTT C;  2HYN A;  1PGJ A;  2YMK A;  1LTB C;  5GTI H;  1NTZ G;  1YJN P;  1NOH A;  1SQQ G;  2Z5H A;  3MTU E;  3I5C A;  4K35 A;  4EDF A;  3KHU A;  1DD4 A;  3PTZ A;  2K88 A;  4HYT B;  3RL0 C;  4UB8 H;  1JUN A;  4KHX A;  1OX3 A;  5KTB A;  3SFE C;  3F5H A;  1AJY A;  3H1H J;  3CI9 A;  1RF0 A;  5CHX A;  2E76 C;  3IR9 A;  5AW1 B;  4IOI H;  4W7Y A;  5CCH A;  3KPE A;  4AQR D;  1N7S B;  3QH9 A;  1BE3 G;  2PP6 A;  1LWU C;  2R3C A;  3BAS A;  3A3Y B;  3EFG A;  4ZKU A;  2RKL A;  1BGY J;  1IK7 A;  1NAY A;  1SLQ A;  1NTM K;  3GMA A;  3G9R A;  1WT6 A;  1JTH B;  2Q5U A;  1VQ9 P;  3HE4 B;  4C46 A;  3CX5 I;  4I6M C;  3QWO C;  2AXC A;  3A0B H;  5CCG A;  1GL2 C;  1ZRT E;  2H8P D;  4DCK A;  1U7J A;  2JR8 A;  1SQB J;  1P84 I;  3PJS K;  1QLE D;  1EZV G;  3AE3 C;  1JO5 A;  2C9L Y;  1KZU B;  4UB6 H;  2KP8 A;  1W2B O;  2QVA A;  3CCJ P;  5AW0 B;  1SQX K;  1KYO I;  1VQN P;  3PHL A;  3N4X A;  3CCL P;  3ZDM A;  3CX5 H;  1S3J A;  1OMI A;  1FDO A;  2PGD A;  3LID A;  4H44 D;  1AVO A;  1QVF O;  1GL2 D;  2XV5 A;  2N1T A;  2YKO A;  3TK1 A;  1BDD A;  2FFD B;  4I7Z C;  1DEE G;  1JB0 J;  1K04 A;  1HVV A;  1KIL C;  3AEF C;  2D2C C;  3M9H A;  4RJT A;  2A45 G;  3ABV C;  2FYU G;  3H32 A;  4PV1 B;  1XTC C;  1KV4 A;  1W5C E;  5BU8 B;  1UII A;  2WZ7 A;  1LT9 C;  2IFN A;  2XDJ A;  1NTK G;  3L73 D;  2P67 A;  4H0L D;  1EC5 A;  2Q3I A;  4EYY Q;  4JBZ A;  2HOD B;  4OWF A;  2K37 A;  2AXT H;  3L75 D;  2FYN B;  1RHZ B;  2OQQ A;  3L4F A;  2JJL A;  1OVU A;  1R5S A;  2WMM A;  2WSC H;  1FZF A;  3L73 E;  1KFM A;  2PFX A;  1J1E C;  4WY4 D;  1OW7 A;  3D70 A;  1PGO A;  3TGU D;  2OYI B;  3VN0 A;  3B8E B;  1PV3 A;  1T3U A;  1OZH A;  3L70 D;  3KYQ A;  3VP9 A;  2KXP B;  1QX8 A;  1SQQ J;  2I8D A;  2ITA A;  4RO0 A;  1QL1 A;  1M1J A;  1GD2 E;  1YQ3 C;  2WVR A;  1EZV I;  1PP9 D;  2W90 A;  2CK3 H;  4RKU J;  1N7S C;  1DIP A;  1X8Y A;  3L70 E;  4OH8 B;  1CW5 A;  4HKZ H;  3TF5 A;  3E7K A;  1USD A;  4K3A A;  3H1J D;  2KLV A;  3NFQ A;  3CCS P;  1NTM G;  2BEZ F;  1PP9 E;  3GLM A;  1H88 A;  3CCU P;  2KIK A;  1G1J A;  1BE3 J;  3H25 A;  2A45 I;  1PGQ A;  1W2E A;  3M0D C;  5AVR B;  3H1J E;  3H1L G;  2QA4 P;  1KQS O;  2B88 A;  2NPS A;  1VQ5 P;  1Z56 A;  1SQP D;  2R44 A;  1K8A Q;  3IN6 A;  5TJH A;  1JM0 A;  1YHQ P;  3JCU E;  2IPP A;  1YYC A;  2GM4 A;  2FFD C;  3G4S P;  3WUV A;  1FJP A;  3II6 A;  2V7Q H;  5AVQ B;  1SFC D;  4PV1 C;  2NPS B;  1PGP A;  1CSB A;  1VQK P;  1RF1 B;  1YJ9 P;  2ZT9 D;  4NPE A;  1AQ5 A;  3FX0 A;  3V2R A;  2LXC B;  3D71 A;  5E79 E;  2I1J A;  1J1D B;  1M1K Q;  2FYU J;  3Q5S A;  1JY2 P;  4ZNC A;  3AEG C;  5H2F E;  5AW2 B;  2Y0E A;  3B4S A;  3GG2 A;  1TU3 F;  2AEJ A;  1L0L D;  2H88 C;  3VMZ A;  4C7N B;  1NTK J;  3MUD C;  1RE3 A;  4IFD K;  2G8Y A;  2KS1 A;  1DEB A;  2QSI A;  3AEA C;  3FWL A;  3A5T A;  3HD7 C;  1N86 A;  3GHG A;  1H8A A;  4XFJ A;  4YXD C;  3G6E P;  1FAV A;  4CPG A;  1FOS E;  2OYI C;  1VQO P;  1GL2 A;  1SQP K;  1NAF A;  4PD4 H;  1NWQ A;  1L0L E;  1AA0 A;  2M3E A;  2W27 A;  2IFM A;  5EFW B;  1USE A;  1IFN A;  2WSF J;  2R3S A;  2QIW A;  3AE4 C;  3HUS B;  2WPV B;  3CWB G;  4WBA A;  4KT0 J;  2WPQ A;  2OTJ P;  1LTG C;  3HD7 D;  1VL2 A;  5B5E E;  4OGQ B;  5K5G B;  1R5L A;  3UIA A;  2N9B A;  1N73 A;  2IYP A;  1IZN B;  1Y9B A;  1S4X A;  2E5Y A;  2WQY C;  4ASV A;  3B5N B;  4L74 A;  2KOG A;  1L4A D;  5KJ7 D;  1IFI A;  4DZO A;  3L73 G;  3I56 P;  5DJT B;  2FXO A;  3U59 A;  3JSV C;  2M0B A;  1JY2 N;  1OW6 A;  1M56 D;  1ZR4 A;  4L73 A;  4WY4 A;  3U1A A;  1EDJ A;  3L75 G;  1L0L K;  1ZN5 A;  1NTM J;  1N73 B;  1A02 F;  1X79 B;  3HTK A;  3AE2 C;  4DJG A;  4GOE A;  1S5L E;  2W6J H;  4WWI A;  1K73 Q;  1CI6 B;  1N2D C;  2IZ1 A;  3WU2 H;  2NZ2 A;  1URQ C;  5AW7 B;  3TGU G;  2E74 B;  1FZE A;  1DH3 A;  2IDB A;  1SVF A;  3H1L J;  3L72 D;  4HH2 A;  2Y0C A;  1FZC C;  3L70 G;  4WVZ A;  3H1L D;  1KB9 E;  2OYH B;  1NTM E;  3T97 B;  1IK9 A;  3USS A;  2AEM A;  3U1C A;  2KNC B;  3CC7 P;  3PLN A;  5AVT B;  5KAI E;  1JY3 N;  4PJ0 H;  3CXH D;  4H13 B;  1VQ4 P;  1PP9 G;  1SQX D;  1RF1 C;  2OTK E;  4EI2 A;  2JWA A;  3D6Y A;  1URQ D;  3L72 E;  4N78 D;  4DT0 A;  1IC2 A;  1IO4 A;  3H1L E;  2PRR A;  1RE4 A;  4L76 A;  5AW4 B;  2RH0 A;  5AW5 B;  3O6Q A;  1J1D C;  2AEF A;  4O9B A;  1LP1 A;  3H1J G;  1ZV8 A;  3CXH E;  4I2L C;  3Q5R A;  3FXD A;  1SQX E;  2YIU B;  3LW5 J;  3M9Q A;  4N78 E;  3AE5 C;  1BSH A;  2Y9Z A;  3M0A A;  3V6I A;  2B87 A;  1LTJ A;  3CME P;  4NPD A;  2ZJS E;  2JEE A;  1S9K D;  3RL0 D;  1OIP A;  4BWN A;  1JOC A;  2JWD A;  2H43 A;  3O6Q B;  2KK7 A;  2LKM A;  5APX A;  1H89 A;  1QVG O;  2IBZ D;  2RN0 A;  1KTM A;  2G3A A;  1SQP G;  2KZJ A;  2E5T A;  5AW3 B;  2E76 D;  4ZKP A;  5AW8 B;  1SFC A;  1S9K E;  2QM7 A;  3HUS C;  4GOD A;  1UIX A;  1NVO A;  2M5A A;  3MD0 A;  5GTI E;  2ZYG A;  1GTW A;  1YBK A;  1EDI A;  3BAT A;  3M06 A;  1T6A A;  1HTL C;  1H0T A;  2W6A A;  4OGQ C;  3AE9 C;  4HB1 A;  1WRG A;  5KAF H;  3A0H H;  3CLQ A;  5KLI B;  1YTZ T;  4L75 A;  1U7M A;  2KLU A;  3CWB J;  3C1L A;  1SQV K;  2M8R A;  2HPC A;  1VQ8 P;  2P10 A;  3CL3 D;  3CWB D;  1E79 H;  1KC8 Q;  4IL6 H;  1NO4 A;  1IFM A;  3CMA P;  3BRT B;  1P84 H;  3EWK A;  3H1K D;  4I1L A;  4OGQ D;  1RQV A;  2HG5 D;  1L0L G;  3CWB E;  4U3F D;  1WMK A;  3BVH A;  1KYO H;  2E75 B;  3L73 J;  1NKN A;  2J5U A;  3H1K E;  2KI7 B;  5APQ A;  2Q1K A;  2XND H;  2XKM A;  2E74 C;  2N1T B;  3L75 J;  1KIL D;  1FZB A;  2FXP A;  1BDC A;  2D2C D;  4U3F E;  3A0B E;  4EIJ A;  2OYH C;  1DD3 A;  3R4Y A;  3H32 B;  2KB7 P;  4Y28 J;  4Z1M H;  3GF7 A;  2QJY B;  4GIF A;  2P2U A;  3AE8 C;  3CX5 D;  1Q90 D;  2H7H A;  3V2P A;  2C0W A;  1T8Z A;  3CCR P;  4JYC A;  3RK2 B;  2J58 A;  1HJ0 A;  3TGU J;  1GZL A;  2N9Y B;  1L4A A;  5KJ7 A;  5APT A;  3L75 E;  1J2J B;  3L70 J;  2E42 A;  2L5G B;  3V2Q A;  2A06 D;  2FY8 A;  2YO3 A;  1YTZ I;  1NKZ B;  5AVV B;  1T2K C;  5C39 A;  2IYO A;  4BXL A;  1PP9 J;  3IAO A;  3CCE P;  2YIU C;  4AYC A;  3TGU E;  3Q1M A;  3TSI A;  5KKZ B;  4N6J A;  4JYB A;  3VMX A;  2A06 E;  3R2P A;  3JC2 2;  5GTH H;  3H1J J;  1S5L X;  2WSC J;  2POH A;  4GOF A;  1OVV A;  2W8Z A;  1E5W A;  3GW6 A;  3O8Z A;  1T2K D;  3RK3 B;  1ZLL A;  1M90 Q;  1RF0 C;  3WMM 0;  1S72 P;  1M1J B;  3AEB C;  5E79 H;  2AXT E;  5CCH C;  3RGU A;  1N7S D;  1JCC A;  2KZI A;  3L72 G;  3P8C D;  1URQ A;  4XE5 B;  1GDT A;  1SQP J;  1GK6 A;  4XA4 A;  3V5B A;  1MFT A;  5B66 H;  2O01 J;  1IFD A;  2QM8 A;  4TLF A;  1ZP0 C;  3BCC J;  3SWK A;  2IX7 C;  1SQX G;  4JPZ B;  1VQM P;  3BCC D; 
#chains in the Genus database with same CATH homology
 1FZG A;  3UIA A;  2OYI A;  2HFE D;  2YNY A;  3P8C E;  5AW1 B;  2N9B A;  5BVZ A;  1JY2 O;  2A45 H;  1N73 A;  4W7Y A;  5CCH A;  5CCG C;  1VDF A;  3KPE A;  4AQR D;  1N7S B;  2R32 A;  2FXM A;  2PP6 A;  3B5N B;  1LWU C;  2R3C A;  3BAS A;  3A3Y B;  2KOG A;  3EFG A;  4ZKU A;  3HE5 A;  1L4A D;  5KJ7 D;  3SWF A;  1IFI A;  4DZO A;  2KYV A;  1RY3 A;  3U59 A;  1SLQ A;  3P32 A;  1JY2 N;  1FOS F;  1NTM K;  2XNX A;  1LTI C;  1ZR4 A;  2W6B A;  1NTZ K;  4WY4 A;  1WT6 A;  3U1A A;  2MJZ A;  1JTH B;  3HD7 B;  1SQB K;  2Q5U A;  3HE4 B;  4C46 A;  4I6M C;  5APV A;  1L0L K;  1ZN5 A;  3V4Q A;  1N73 B;  1JMM A;  4LC1 A;  5CCG A;  1A02 F;  2FYZ A;  1X79 B;  3HTK A;  1GL2 C;  2H8P D;  1ZR2 A;  2WSE H;  2N1T C;  1LWU A;  2WSF H;  3VP8 A;  2FKW B;  2P7J A;  1CI6 B;  1G2C A;  1N2D C;  1G1I A;  3TYY A;  3HE5 B;  1L4A B;  1URQ C;  5AW7 B;  1JO5 A;  2C9L Y;  1JY3 O;  1KZU B;  2WT7 A;  2KP8 A;  1IFJ A;  3P8M C;  1RE4 C;  1FZE A;  1DH3 A;  1SVF A;  2O01 H;  5AW0 B;  1SQX K;  4HH2 A;  2KSJ A;  1FZC C;  3N4X A;  2Q9I A;  1MFZ A;  2OYH B;  1HBW A;  1IK9 A;  3U1C A;  3NXS A;  4C7R A;  3H6P A;  2YKQ A;  5AVT B;  1JY3 N;  3LID A;  2O1K A;  1GL2 D;  2XV5 A;  1QL2 A;  1KFN A;  2N1T A;  2YKO A;  3TK1 A;  2E43 A;  2FFD B;  1LGH B;  1HVV A;  4Y99 B;  1LTJ C;  1RF1 C;  1KIL C;  2J59 M;  4GKG A;  1G2C B;  5AVW B;  5APS A;  3E1I A;  3M9H A;  2Z5I A;  1URQ D;  2A45 G;  1JNM A;  1AFO A;  4N78 D;  2R5D A;  3H32 A;  1IC2 A;  1IO4 A;  4WB4 A;  1FZA A;  4W7Z A;  1RE4 A;  5CJ4 A;  5AW4 B;  1T3J A;  5AW5 B;  1J1D C;  4O9B A;  3TNU A;  1XTC C;  1JY3 P;  1FZC A;  2WPS A;  5BU8 B;  1LTS C;  2WZ7 A;  1LT9 C;  4RES B;  2IFN A;  2XDJ A;  1ZV8 A;  4AUW A;  3GHG B;  2I1K A;  2P67 A;  4I2L C;  2Q3I A;  1HGV A;  3M9Q A;  2ZXE B;  3NTN A;  1SFC C;  2HOD B;  5APY A;  5CCH D;  2PAJ A;  1GL2 B;  4N78 E;  2CPS A;  3OJA B;  2OAR A;  3M0A A;  1RF1 A;  1LTJ A;  1KIL A;  5CJ0 A;  1L0N K;  3RK3 C;  2WPR A;  2JEE A;  1URQ B;  1S9K D;  3L4F A;  2JJL A;  3RL0 D;  1FBM A;  2WSC H;  1HH0 A;  1JOC A;  2O1J A;  2R5B A;  1FZF A;  3PP5 A;  2VRS A;  1M1J C;  2H43 A;  2P1J A;  1KFM A;  2Q7C A;  1FZC B;  2LKM A;  1J1E C;  5APX A;  1H89 A;  4WY4 D;  3EQ2 A;  1LT9 A;  3SWY A;  3BRV B;  1X9V A;  5AW3 B;  5AW9 B;  4ZKP A;  1FDM A;  1SQQ K;  5AW8 B;  2ZFC A;  1HUC A;  2OYI B;  3VN0 A;  2CPB A;  3P7K A;  1SFC A;  3B8E B;  1T3U A;  1S9K E;  2QM7 A;  5CCG D;  3HUS C;  4C7N A;  1NH4 A;  3KYQ A;  1NU1 K;  2YMY A;  3VP9 A;  3MD0 A;  3MGN A;  1GTW A;  1GK4 A;  3M91 A;  3BAT A;  3M06 A;  1HTL C;  3RL0 B;  5BU5 A;  2W6A A;  1OXZ A;  1QL1 A;  1M1J A;  1WRG A;  1GD2 E;  4IFF A;  3CLQ A;  2Z4E A;  4N3Y B;  1YTZ T;  1NTK K;  1PFI A;  4WY4 B;  1N7S C;  1MZ9 A;  1X8Y A;  3RK2 C;  4OH8 B;  1CW5 A;  1MV8 A;  1JCD A;  1SQV K;  2M8R A;  2HPC A;  3LW5 H;  3CL3 D;  4B86 A;  3HUS A;  2NPS C;  1NO4 A;  3HTK B;  2N1T D;  1IFM A;  2KLV A;  3NFQ A;  2BAS A;  5APW A;  1LWU B;  2WTY A;  3BRT B;  5CMZ A;  2M3B A;  1H88 A;  3KDP B;  3A2A A;  4I1L A;  1G1J A;  1GU4 A;  4IFM A;  1EQ7 A;  2WT7 B;  1OWA A;  2A45 I;  1GW3 A;  3OAK A;  2HG5 D;  4GT1 A;  1J1E B;  1W2E A;  1M7L A;  1N7S A;  3BVH A;  3LIE A;  3RK2 D;  3M0D C;  1DX7 A;  4W80 A;  3M9B A;  3B5N A;  5AVR B;  1NKN A;  5AVZ B;  3V4W A;  1XTG B;  1HJB A;  1L4A C;  5APU A;  5APQ A;  5KJ7 C;  1VPC A;  1IJD B;  2NPS D;  2XKM A;  2NPS A;  3A7O A;  4JF7 A;  1Z56 A;  2N1T B;  1KQL A;  5AVS B;  1KIL D;  1FZB A;  1JTH A;  2GUS A;  3OA7 A;  3HE4 A;  4EIJ A;  2OYH C;  1FU1 A;  3H32 B;  1LTA C;  2KB7 P;  2IPP A;  2YO2 A;  5AVU B;  4GIF A;  2P2U A;  3N7N A;  5AW6 B;  5AVX B;  2H7H A;  3TNU B;  3V2P A;  2C0W A;  3VMY A;  3L35 A;  1HGZ A;  1T8Z A;  1YYC A;  3M0D A;  2GM4 A;  1MUU A;  4JYC A;  3RK2 B;  2FFD C;  2WWW A;  2J58 A;  3NMD A;  3VYI A;  1CI6 A;  3G3Z A;  1FJP A;  1N7L A;  4Y99 C;  5KLV K;  1GZL A;  3II6 A;  1GU5 A;  1L4A A;  5KJ7 A;  5APT A;  1J2J B;  5AVQ B;  1SFC D;  2E42 A;  2NPS B;  2L5G B;  3KQG A;  3V2Q A;  3VTP C;  2YO3 A;  1GW4 A;  1CSB A;  1RE3 C;  1RF1 B;  1LTJ B;  1KIL B;  3RK3 D;  2FYU K;  1YTZ I;  2GUV A;  1NKZ B;  5AVV B;  1AQ5 A;  1T2K C;  2C0X A;  2OYH A;  5AVY B;  3T97 A;  2HLO A;  3HRN A;  3V2R A;  4M3L A;  3GHG C;  3V2N A;  4DOJ A;  2I1J A;  4AYC A;  1J1D B;  3C9I A;  1SP4 A;  3TSI A;  1HWT C;  4N6J A;  4JYB A;  1CZQ A;  2FFD A;  1LT9 B;  1JY2 P;  3VMX A;  3R2P A;  3B5N C;  2XU6 A;  2WIT A;  5AW2 B;  3L37 A;  2YKP A;  2C9N Y;  1SFC B;  1NHL A;  3VMZ A;  2POH A;  4C7N B;  1LTT C;  2HYN A;  1RE3 A;  4IFD K;  1A02 J;  1DEB A;  1E5W A;  1T2K D;  3O8Z A;  3RK3 B;  4LGD E;  1ZLL A;  1LTB C;  1RF0 C;  3WMM 0;  3A5T A;  3HD7 C;  1N86 A;  3GHG A;  1H8A A;  1FAV A;  1M1J B;  1FOS E;  2OYI C;  1NOH A;  2Z5H A;  3MTU E;  2HOD A;  3I5C A;  1GL2 A;  1N73 C;  1SQP K;  4EOT A;  5CCH C;  1NAF A;  1N7S D;  1NWQ A;  2W27 A;  2IFM A;  4LLH A;  1JCC A;  3B5N D;  1IFN A;  3IFM A;  3P8C D;  3VOP A;  1URQ A;  2HPC B;  4XE5 B;  3RL0 C;  4HYT B;  1GDT A;  1JUN A;  2XZR A;  4KHX A;  3HUS B;  3L36 A;  3MUD A;  5KTB A;  1GK6 A;  4WBA A;  4XA4 A;  3V5B A;  2WPQ A;  3CI9 A;  1LTG C;  1IFD A;  2QM8 A;  1RF0 A;  4WY4 C;  3HD7 D;  3MIW A;  2IX7 C;  3HD7 A;  5CHX A;  1FJK A;  3IR9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...