4I6MC

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
b'LKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQALK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Actin-related protein 7
publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
total genus 30
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.-:
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07529 HSA HSA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i6mC00
1GK4A 1CI6B 3M9HA 3MD0A 1FOSF 2WPRA 3KQGA 1GU5A 1H88A 1X8YA 2ZFCA 1T2KD 2P7JA 1NAFA 4XE5B 2XU6A 3T97A 2R3CA 1H89A 2H7HA 1CZQA 3OAKA 1CSBA 3HE4B 4HYTB 5AW7B 3LIDA 2Q7CA 4B86A 1SLQA 5AW6B 4AQRD 3I5CA 4EOTA 4I6MC 2C9LY 2N9BA 3NMDA 4DZOA 1MFZA 1GK6A 2BASA 3MGNA 2QM8A 1A02F 3M91A 2R5BA 1IO4A 3A7OA 5APVA 2R5DA 2E43A 5AVUB 5AW8B 2C9NY 3M0DA 5AVTB 2Z5IA 5AW1B 5AW5B 3V5BA 3TK1A 3VMYA 2R32A 3VTPC 1JNMA 1CI6A 3KDPB 5AVVB 3A3YB 5AW9B 3NTNA 3VMXA 1MV8A 5AVRB 3P32A 4GT1A 5APSA 4JYCA 2WT7B 5AVWB 4LC1A 3P8MC 4JYBA 1HWTC 2YNYA 3B8EB 4C7NA 3HE5B 1A02J 3VYIA 3HE4A 1GZLA 2P67A 2Q5UA 3NXSA 3UIAA 2XZRA 3TNUB 2YO3A 2QM7A 4C46A 3L37A 1HBWA 5APXA 1HUCA 5APTA 1YYCA 3O8ZA 3TYYA 2YO2A 3NFQA 5APWA 3L36A 2W6AA 3P7KA 5CMZA 5AW3B 1GD2E 4AYCA 2WWWA 3L35A 4M3LA 2Z5HA 1S9KD 5AW4B 5AVXB 5AW2B 3V4QA 1MUUA 1HJBA 2WPQA 5APYA 2IPPA 1J2JB 5AVQB 1GU4A 3A5TA 1S9KE 1H8AA 3M06A 4I2LC 3SWFA 3V4WA 1SP4A 1OXZA 5AVZB 2XV5A 2WTYA 2JJLA 3HE5A 1T2KC 2ZXEB 1FAVA 1FOSE 1JUNA 3TNUA 3A2AA 1OWAA 5AVYB 2E42A 4C7NB 3HTKA 3VMZA 5AVSB 1G2CB 5AW0B 1NWQA 3M0AA 2P2UA 5APUA 4GKGA 3LIEA 4AUWA 1GTWA 2W27A 3VN0A 3IR9A 2Q3IA 4KHXA 2KP8A 3M9BA 5APQA 1DH3A 1KQLA 2WT7A 4RESB 2WPSA 2VRSA
chains in the Genus database with same CATH superfamily
1EDKA 3CLQA 2RN0A 2BCCJ 1IFDA 1OW6A 1FZCB 3H1IJ 2QRXA 3L71G 3CX5E 1FZEA 5CJ0A 4CPGA 1LT9B 1SQBE 1FZAA 1EZVD 3C9IA 1N73C 4DZOA 2Q6QA 1JB0J 1RE4C 1A02F 4PV1C 1OVUA 1MZ9A 2C9NY 4H13B 2AXTH 3RK3C 3KDPB 2R44A 1JMMA 2IFNA 4JYBA 2XDJA 3FXDA 1URQC 3BCCG 1L0LE 1FBMA 2FFDC 5B5EH 1NTME 1HBWA 2H43A 1NTZE 5APTA 2QJKC 2E75C 3L74D 4U3FG 3AE9C 1ZR4A 3AEDC 5BVZA 1G1JA 2YKOA 2OARA 2ZJSE 1FAVA 5KLVE 3KHUA 2QE7H 3CPWO 3KZIE 5CHXA 3N7NA 5AW0B 1FE6A 5B66H 2Y0CA 1N73B 2FXPA 3VN0A 1M1JC 2KP8A 5B66E 5KAFE 5H2FH 3KQGA 5E79E 2AEFA 1X8YA 5H2FE 4PD4I 4ZKPA 2WVRA 3PRJA 2H7HA 4Y28J 4KT0J 2HYNA 1ZRTE 2I1JA 2OYOA 3RL0g 1SFCD 1SQXD 1URQB 3I5CA 2KZJA 1BE3G 4A7PA 1SFCA 3MGNA 2E75B 5AW8B 1JTHA 4N78E 1RF0A 4DOJA 4TLFA 1YIJP 1LTJC 1SQXJ 1XTGB 3CCUP 3AE5C 1GZLA 1IC2A 3MIWA 3UIAA 5GTIH 1Q82Q 1VF5D 1S5LH 5GTIE 2Q1KA 1S5LE 4IOIH 2A45I 1DEEG 3GHGC 5AW3B 2AEJA 1LGHB 3H1IE 3H1LD 1J2JB 1PP9G 1USDA 2RH0A 2POHA 4O9BA 4JQ0D 2WTYA 1N7SC 3Q5PA 2W8ZA 4C7NB 3RK2D 3AEEC 1GW4A 1VQ9P 1GDTA 3IR9A 3FGAD 1JTHB 1EZVE 2WPSA 3FWLA 4GDOA 1YQ3C 2N1TC 1P84D 4XE5B 1S1CX 3D70A 1EDLA 3HUSC 3MHVA 1CSBA 4K35A 1KB9H 1SLQA 1JY2N 2GM4A 3B5NA 2FYNC 3GG2A 1NU1D 2QM8A 3CD6P 1AFOA 1UIIA 3AECC 3L73G 3C1LA 1LTGC 1KZUB 3L74E 1Y9BA 4HB1A 1NTKJ 1HWTC 1Y47A 3V2PA 1K9MQ 1NU1J 2Q5UA 3CC4P 2QG4A 1QVGO 3L71D 1N2DC 1IFPA 2KOGA 3HD7C 3S4RA 3CCVP 5TISH 2QJPB 2NPSD 2ZVOB 1MUUA 4UB6H 3ZDMA 3RK2B 3Q5SA 1H8AA 4I2LC 3L71J 5AVZB 3RBXA 4RO0A 2YMKA 1L2PA 1JUNA 5KJ7D 3BCCD 3B5NB 4DCKA 5KJ7A 2LR2A 2IBZI 1LWUA 2WZ7A 1BDDA 5APUA 4AUWA 1FJPA 1SQXE 4U3FD 4W7ZA 3OJAB 3AEFC 1NAYA 1VQMP 1NAFA 5CCHC 3LIDA 4B86A 2K9JA 4EOTA 1MFZA 4GIFA 1G2CA 5CCGC 2OGUA 3WMM0 4YTPC 2QJYB 1HJ0A 4NPDA 1KYOD 2V7QJ 4U7JA 1JO5A 3VMYA 2KYVA 1PPJG 1EDJA 1KN7A 1RHZB 3H1LE 2P67A 4HKZH 3OA7A 2IX7C 2B89A 2QM7A 1M56D 2IZ0A 3TYYA 1VQ4P 4I7ZB 2FYUK 2YIUB 1LWUB 1SQVK 1BE3D 2WITA 3H1HG 4N6JA 3QH9A 1NGMB 1T6AA 2Y9YA 3EFFK 3A0BE 1FDIA 1PFIA 1L0NK 1U7JA 2J58A 1LTSC 2J5UA 2KSJA 2ZXEB 3BRTB 4WY4D 2G8YA 2K9JB 3HTKA 1P84H 1BE3J 3JC22 4JBZA 4WY4A 1P84E 1W2EA 1G2CB 1NWQA 1VQ6P 2H89C 2B87B 1GTWA 2W90A 3MUDA 1KQLA 4RESB 2QSIA 3WUUA 2E76C 3V2NA 1NU1E 1RY3A 2M3BA 2FYUG 1VPCA 1SQVG 2WSEH 5DJUB 1X0TA 1AQ5A 2Q7CA 3E7KA 5AW6B 1NOHA 1IK7A 4Z1MH 2Z4EA 3NMDA 1L0NG 2YKPA 2W6JH 2R5DA 3H32A 2W6BA 5AVUB 1J1DB 1ZOYC 3L71E 3M0DA 2Z5IA 3VTPC 4WB4A 4L75A 1MV8A 2IFMA 4GT1A 3CXHI 4JYCA 3G4SP 1YHQP 4XFJA 2IBZG 2PGDA 5KLVJ 4WY4B 3L36A 2HPCA 1AVOA 1YTZT 5CMZA 3H1KJ 1M57D 2PP6A 3V4QA 2XNDH 1RE3A 1BCCG 1DX7A 3LW5J 4N3YB 1K04A 3L73D 3CMAP 3EQ2A 3V2QA 3R2PA 1HGVA 3CCLP 1LTAC 2M0BA 1VDFA 4U3FE 1KFNA 1M8OB 3A2AA 1NO4A 3SSUA 2V7QH 4D6TD 3BRVB 4OGQC 1J1EB 3L72G 3WUTA 3L73J 2M5AA 2OYHC 4H44C 3EWKA 1KYOH 4PD4D 2R3CA 4D6TJ 1KYOE 1L4AC 1WT6A 1YJ9P 1R5SA 1HTLC 3MTUE 4WBAA 2E74C 1KORA 2ZYGA 3H1JG 1X22A 1SVFA 4GODA 1LTBC 2J59M 3F89A 1JY3N 3CX5H 2R32A 4ZMDA 2R3SA 1SS1A 4DT0A 4EDFA 1X9VA 2V4HA 2A06G 4LLHA 3CC7P 1BE3E 2KLVA 3GW6A 2WSFJ 2HR3A 3VYIA 3NXSA 2OYIC 3Q2YA 3V2RA 1HUCA 1N73A 4PV1D 1VL2A 1RE4A 2W6AA 1ZR2A 3MZWB 3RK3D 2WSCJ 2M5AB 1FS0E 3RL0C 1GU4A 1NHLA 4ZKUA 1URQD 1AV1A 3SFEC 1PPJD 1URQA 1BGYG 4WWIA 1OWAA 2E75D 4DJGA 2E42A 2QIWA 1M1KQ 3GLMA 4KJMA 3M9HA 3H1HD 3CWBG 4GOEA 3B4SA 3L74J 1KILC 3KZIH 3S1KA 2KXPB 3H1KE 3LW5H 2KNCA 5KAFH 1AA0A 1GK6A 1JMBA 2JP3A 3CCRP 2H88C 5E79H 1W5CE 4PV1B 1M1JA 2H8PD 3RK3B 5AVVB 4HJGH 1EC5A 5APSA 3BATA 3WUVA 4C7NA 5CBNA 2FYUD 2FFDB 1SQVD 1YJWP 3L73E 2AXCA 2QJKB 3AEBC 3D6ZA 2Z5HA 1L0ND 2PAJA 1RF1C 2K1AA 1BSHA 1Z56A 2CK3H 4D6TE 2ZT9C 2FYUJ 1YITP 3PJSK 2JJLA 3GF7A 1FOSE 2KNCB 1L0NJ 4PD4H 1FJKA 3JCUE 4PD4E 2IBZD 3GHGA 1OMIA 2P2UA 3LIEA 2W27A 3G71P 1VF5C 1M1JB 3R4YA 5DJTB 3L75G 1ZP0C 3AE1C 1HJBA 5M1BA 1IJDB 1NTZG 1BCCD 1GU5A 2P7JA 1N7SA 1KB9I 2YKQA 1AQTA 3VOPA 3H1LJ 2WSCH 3PH0A 4I6MC 3CL3D 1YBKA 4UB8H 1WRGA 3L72D 4UB8E 5AW1B 3AE8C 2A45H 2MKVA 2N1TD 1RF1B 2ZYAA 3I56P 1LTJB 3B5ND 2N1TA 2LKMA 2WT7B 5KLIC 2O1JA 3P8MC 3HUSA 3B8EB 3PLNA 5L8RJ 1PGPA 3BASA 2OTLP 2B88A 1FZGA 3L72J 2K3RA 1IFIA 1JY2P 3GHGB 1PGOA 2Q9IA 3H1JD 2K88A 3SWFA 1QX8A 1N7SB 2A06D 1QLED 3Q1MA 3H1HE 1ZV8A 1MKMA 4XA4A 1GL2C 2NPSC 1H88A 1YQ4C 2N1TB 3T97A 3HUSB 1E5WA 1CZQA 2BCCG 4OH8B 2UWJE 1U7MA 3H1IG 1Q81Q 1S2EA 2K9YA 1BGYD 2FYNB 3E1RA 1X79B 2BASA 4LGDE 2FYUE 2AEMA 1SQVE 2WPVB 2ITAA 1USEA 3BCCJ 4Y99C 5CCHD 4BRYA 3P32A 3CXHD 3TGUG 1VQ7P 1K05A 2JDIH 1L0NE 5CCHA 5K5GB 3CWBD 5CCGD 4U3FJ 1SQPK 3L4FA 5APXA 1PGJA 2B87A 3KPEA 3CI9A 1YYCA 3HD7B 4IL6X 5CCGA 2E5TA 2IYOA 1S9KD 1NYHA 2WPQA 2D2CC 2IPPA 1KC8Q 3M06A 2IBZE 4HH2A 1QL2A 4YPCA 1OXZA 3T97B 3W68A 2L5GB 3A0HE 2IDBA 1T2KC 4IFMA 4WVZA 3P8CD 2K37A 1NKZB 1BCCE 1PV3A 3M0AA 3KXDA 3A0BH 1YJNP 2RMZA 3TDKA 1IFJA 2JKVA 1SQPG 2E5YA 4BRYB 3WU2H 3BVHA 3L72E 3WU2E 1WMKA 5KKZC 1AVYA 3SWKA 3CCEP 4AQRD 2JR8A 3JSVC 1IZNB 2R5BA 2B9BA 1JEKA 1OX3A 2E76D 1EXIA 2Q3EA 1PP9D 3TK1A 1JCDA 1Q2NA 2P1JA 3L75D 2D2CB 3CCMP 2YNYA 3H1JE 1NTZD 1A02J 3TSIA 4C7RA 2FBWC 2DW3A 1BSNA 2QEXP 2L91A 1PP9J 2O1KA 3L35A 3SWYA 2A06E 3L75J 1DIPA 4H0LC 2Y0DA 1OIPA 1SQQK 2W83C 3W67A 3PTZA 1XTCC 2M8RA 2KSEA 1VQNP 1Q86Q 4GOFA 2OTKE 3BCCE 2P10A 2KIKA 1N86A 1S72P 1AJYA 4YXWH 1EDIA 1BGYE 2E76B 1NTKK 3PHLA 2YMYA 1LTIC 2ZFCA 1FZCC 1VQ8P 2FYZA 1NJIQ 1LT9C 3AE4C 5AW7B 4OGQD 1FDOA 3CXHH 4L76A 1OFCX 3CXHE 2CPBA 1M90Q 3M91A 1SQQG 3CWBE 3CX5I 1KFMA 4H44D 4H13C 5AVTB 3HRNA 3ITKA 2GUSA 2OYHA 3GF3A 5KTBA 1H0TA 1L4AA 2E74D 2FXOA 2YO3A 3L70G 2HODB 1NTKG 2PRRA 2BCCD 1LT1A 3NFQA 5APWA 3H1ID 1HGZA 1IFNA 2QA4P 1G1IA 2IYPA 1DD4A 3P8CE 1NVOA 2WSSH 2O01J 3RBZA 3HE5A 1LP1A 3TGUD 2OYIA 1JY2O 2OQQA 4OGQB 5AVSB 3S9OA 2MJZA 3RL0D 1FZFA 4PJ0H 1DH3A 1ZN5A 4PJ0E 1LNQA 2OYHB 4H44B 3U1AA 3TGUJ 2FFDA 1PIXA 2N9YB 1H89A 1KB9D 2AXTE 1H0TB 1L4AB 1Q7YQ 2KK7A 1PP9E 3RGUA 4BXLA 1M7LA 2XKMA 2E74B 3L75E 4QMAA 1R5LA 5B5EE 1ZMEC 1N8RQ 3MP7B 3QWOC 3IN6A 1LTTC 2WMMA 3Q3DA 3NTNA 2JWDA 1KILD 2KUBA 2ZVNB 2YXQB 1SQPD 1OVRA 3O6QA 3ABVC 1KILA 1CW5A 3HE5B 1SQBK 1LP1B 1JOCA 2OYIB 3FX0A 1D7MA 4C46A 3CMEP 3H1HJ 1VQKP 3P7KA 3USSA 3K5BA 1SQPJ 3RL0B 2BEZF 3CCJP 4OVNF 5TJHA 1L0LK 5EFWB 1Y8AA 1NTMK 1KQGB 3TNUA 1NTZK 1T3JA 1HF9A 1SFCC 1SQBG 1RF1A 3EFGA 2ZT9D 2KS1A 1LTJA 1SQVJ 2WT7A 1RF0C 3MD0A 1FOSF 5KAIH 1KQSO 2KI7B 2O01N 5KAIE 1ZXGA 2XU6A 3O6QB 1KILB 3JCUH 5KLVK 2LXBA 1EZVI 4IFDK 3FWNA 1L0LG 2IZ1A 2O01H 1JM0A 2WSFH 5APVA 4OWFA 2E43A 1PGQA 1NTMG 1N7SD 3D6YA 4I1LA 1JNMA 1CI6A 2BCCE 2I8DA 5AW9B 2P58A 2YXRB 5AVRB 4LC1A 1VQOP 2XZRA 3I55P 3TNUB 2JWAA 1BCCJ 2YO2A 1GD2E 2QJPC 2O3JA 4AYCA 2NRGA 4M3LA 5KLVG 3TGUE 5AW2B 3V6IA 1SFCB 5BU8B 1OZHA 2KS1B 1SQQD 5GTHH 3RK2C 3H1KG 3RK3E 5GTHE 2ZT9B 3U59A 5BU5A 1RQVA 1PL5A 1FZBA 1YI2P 1TU3F 1R8EA 1S5LX 5AVYB 1NKNA 4NPFX 1T3UA 1PPJE 1E79H 3B5NC 1PZQA 1SQQJ 3L70D 1VQPP 1KB9E 1MFTA 1NTKD 3E1IA 1VF5B 2ZAEB 4JF7A 3G9RA 1CI6B 4ASWA 4EI2A 5CJ4A 1FDMA 2JO1A 3HD7D 2KB7P 3TF5A 3H1JJ 2SPZA 3HD7A 3L70J 1BDCA 1KILE 4D6TG 2WQYC 2N9BA 1SQPE 4IL6H 1IO4A 1LJ2A 3A7OA 1K8AQ 3AE2C 4IFFA 1GL2D 4IL6E 2QJYC 2WSEJ 4L74A 2LXCB 1GL2A 5AW5B 5TISE 3Q5RA 3VMXA 2NPSA 3VMAA 1VQLP 4UB6E 5AVWB 5KLIB 2FKWB 3IAOA 3AE3C 3AE6C 4EIJA 4ASVA 5KJ7C 1NH4A 1Q90D 4I7ZC 5CBOA 2YIUC 1LWUC 3AEGC 5AVXB 5APYA 2FXMA 5AVQB 2HFED 1BGYJ 1SP4A 3D71A 2XV5A 1EZVG 3G3ZA 1QVFO 1OW7A 2A45G 4RKUJ 2D2CD 4TT3H 3CWBJ 1QL1A 4L73A 3M9BA 1JY3O 1GL2B 1UIXA 1FC2C 3A0HH 3M9QA 1KQFB 1KMIZ 2NPSB 1T2KD 4W80A 1P84I 3OAKA 2GA1A 4HYTB 3G6EP 3VP9A 3L74G 1VQ5P 2Y0EA 4BWNA 2C0WA 1SQXK 3CX5D 1J1DC 1HVVA 2C0XA 3V5BA 1SQBD 4Y99B 2JEEA 3PP5A 1OVVA 2OTJP 1T8ZA 2XNXA 1SQQE 2HLOA 3GMAA 3HE4A 3L37A 3N4XA 2GUVA 3CC2P 1YTZI 3IF4A 4WY4C 3U1CA 3C8VA 1U57A 1SQBJ 4NPEA 1IFMA 1L0LD 4YXDC 3MUDC 3B71A 3A5TA 1NTMD 4R4LA 3L70E 1S3JA 1KV4A 1NTKE 1K73Q 1SQXG 2FY8A 3OW2O 2ZXXA 1FU1A 1QGKB 2NZ2A 1L0LJ 2QVAA 1J1EC 3H25A 1EXJA 1QEXA 3IFMA 2BEQD 1NTMJ 3H6PA 1NTZJ 4H0LD 3M0DC 4KHXA 4EYYQ 1DEBA 3SFDC 1GK4A 1GW3A 3F5HA 5KLVD 4MN4C 2WPRA 3H1KD 1S4XA 2HODA 2PFXA 3AE7C 5KKZB 3HE4B 1KD1Q 2Y9ZA 2KLUA 4ZNCA 3II6A 2C9LY 1ZW0A 1EQ7A 2I1KA 3H1LG 3HTKB 1JCCA 1KYOI 1RE3C 1NU1K 1ZRTD 2CPSA 3A3YB 1HH0A 3KYQA 4JPZB 2G3AA 1FZCA 4RJTA 3AEAC 1LT9A 4N78D 1GMJA 2M3EA 2HG5D 4K3AA 3O8ZA 4H13D 1W2BO 2WWWA 5AW4B 4W7YA 1L4AD 3H32B 1RQUA 1S9KE 1RH5B 3FXEA 2KZIA 4H0LB 3V4WA 1KTMA 1NU1G 1N7LA 2RKLA 3CCSP 3VMZA 1DD3A 4R4MA 1OW8A 3CCQP 4GKGA 2ZYDA 1JY3P 1IK9A 2HPCB 2Q3IA 1ZLLA 5C39A 5APQA 3VP8A 2VRSA
chains in the Genus database with same CATH topology
3CLQA 3MD0A 3V2NA 1FOSF 1RY3A 1IFDA 2M3BA 2NPSC 1H88A 1VPCA 2N1TB 1FZCB 2WSEH 2XU6A 3T97A 3HUSB 1KILB 1E5WA 1FZEA 1CZQA 5KLVK 5CJ0A 1LT9B 1AQ5A 4OH8B 2Q7CA 5AW6B 1NOHA 1FZAA 2Z4EA 3C9IA 4IFDK 3NMDA 1X79B 4DZOA 1N73C 2BASA 1RE4C 1A02F 2O01H 2WSFH 2YKPA 4LGDE 5APVA 2R5DA 2E43A 3H32A 2W6BA 5AVUB 1J1DB 1N7SD 1MZ9A 2C9NY 3M0DA 2Z5IA 4I1LA 3RK3C 3VTPC 1JNMA 1CI6A 3KDPB 4WB4A 4Y99C 5AW9B 1MV8A 5AVRB 2IFMA 3P32A 4GT1A 5CCHD 4JYCA 4LC1A 1JMMA 2IFNA 4JYBA 2XDJA 5CCHA 1URQC 1FBMA 2FFDC 2XZRA 3TNUB 5CCGD 1HBWA 1SQPK 3L4FA 5APXA 2H43A 5APTA 3KPEA 3CI9A 1YYCA 3HD7B 2YO2A 4WY4B 3L36A 2HPCA 5CCGA 1YTZT 5CMZA 1GD2E 4AYCA 4M3LA 1S9KD 1ZR4A 2PP6A 5AW2B 3V4QA 1SFCB 5BU8B 5BVZA 1RE3A 2WPQA 1DX7A 4N3YB 2IPPA 3RK2C 1G1JA 2YKOA 3M06A 3U59A 5BU5A 4HH2A 1QL2A 3EQ2A 1OXZA 3V2QA 3R2PA 1HGVA 1FZBA 2L5GB 2OARA 1LTAC 1T2KC 1FAVA 1VDFA 4IFMA 1KFNA 3A2AA 1NO4A 5AVYB 1NKNA 3P8CD 1T3UA 1NKZB 3B5NC 3BRVB 1J1EB 5CHXA 3N7NA 5AW0B 3M0AA 3E1IA 1IFJA 1N73B 3VN0A 1M1JC 4JF7A 2KP8A 1CI6B 2OYHC 5CJ4A 3KQGA 1FDMA 1X8YA 3BVHA 3HD7D 2R3CA 4ZKPA 2H7HA 2KB7P 1L4AC 1WT6A 3HD7A 2HYNA 2I1JA 1HTLC 1SFCD 3MTUE 4AQRD 1URQB 3I5CA 4WBAA 2N9BA 1SFCA 3MGNA 1IO4A 1SVFA 2R5BA 3A7OA 4IFFA 1GL2D 1LTBC 2J59M 5AW8B 1JTHA 1JY3N 4N78E 1GL2A 5AW5B 3TK1A 1RF0A 2R32A 1JCDA 4DOJA 1X9VA 3VMXA 2NPSA 1LTJC 2P1JA 4LLHA 5AVWB 1XTGB 2FKWB 2KLVA 2YNYA 1A02J 3VYIA 4EIJA 1GZLA 1IC2A 3MIWA 3NXSA 3UIAA 2OYIC 3TSIA 3V2RA 1HUCA 4C7RA 5KJ7C 1N73A 2A45I 1NH4A 1RE4A 2W6AA 3GHGC 1LWUC 2O1KA 5AW3B 1ZR2A 3L35A 3SWYA 3RK3D 5AVXB 5APYA 1LGHB 1J2JB 2FXMA 5AVQB 3RL0C 2HFED 1GU4A 1NHLA 2POHA 4O9BA 1URQD 4ZKUA 1SP4A 2XV5A 2WTYA 1N7SC 1SQQK 3G3ZA 1URQA 1OWAA 2E42A 1XTCC 2M8RA 4C7NB 2A45G 3RK2D 1N86A 1GW4A 1GDTA 3IR9A 1QL1A 1JTHB 3M9BA 1GL2B 1JY3O 2WPSA 3M9QA 3M9HA 1NTKK 2YMYA 2NPSB 1LTIC 2ZFCA 1T2KD 2N1TC 1FZCC 4W80A 4XE5B 3HUSC 2FYZA 1KILC 3OAKA 1CSBA 1LT9C 4HYTB 5AW7B 1SLQA 1JY2N 3VP9A 3LW5H 2GM4A 3B5NA 2CPBA 1GK6A 2QM8A 3M91A 2C0WA 1AFOA 1SQXK 1J1DC 1HVVA 1KFMA 1M1JA 2C0XA 5AVTB 3V5BA 2H8PD 3HRNA 3RK3B 1LTGC 2GUSA 5AVVB 1KZUB 4Y99B 2OYHA 5KTBA 5APSA 2JEEA 3PP5A 3BATA 1HWTC 4C7NA 1L4AA 1T8ZA 2XNXA 3V2PA 2HLOA 2Q5UA 3HE4A 2FFDB 2YO3A 3L37A 2HODB 3N4XA 2GUVA 1N2DC 1YTZI 2KOGA 3HD7C 3NFQA 4WY4C 5APWA 3U1CA 1HGZA 1IFNA 2NPSD 1IFMA 2Z5HA 2PAJA 1RF1C 1MUUA 1G1IA 3P8CE 3RK2B 1Z56A 3A5TA 1H8AA 4I2LC 5AVZB 2JJLA 3HE5A 1FOSE 2OYIA 1JUNA 5KJ7D 1FU1A 1JY2O 3B5NB 5KJ7A 1J1EC 1FJKA 5AVSB 3IFMA 3GHGA 1LWUA 2WZ7A 2P2UA 5APQA 2MJZA 5APUA 3RL0D 3LIEA 4AUWA 3H6PA 2W27A 1FJPA 1M1JB 4KHXA 3M0DC 1FZFA 1DEBA 1HJBA 1DH3A 4W7ZA 3OJAB 1IJDB 1GK4A 1GW3A 1ZN5A 2OYHB 3U1AA 2WPRA 1GU5A 2FFDA 2P7JA 1NAFA 1N7SA 4RESB 1H89A 2HODA 5CCHC 1L4AB 2YKQA 3HE4B 3LIDA 3VOPA 4B86A 1M7LA 2WSCH 2XKMA 4EOTA 3II6A 4I6MC 2C9LY 1MFZA 4GIFA 1EQ7A 1G2CA 5CCGC 2I1KA 3CL3D 3HTKB 3WMM0 1JCCA 1WRGA 1RE3C 1JO5A 5AW1B 3VMYA 1NU1K 2A45H 2N1TD 2KYVA 2CPSA 3A3YB 1LTTC 1RF1B 3NTNA 1HH0A 3KYQA 1KILD 1LTJB 3B5ND 2N1TA 2LKMA 1FZCA 2WT7B 2O1JA 3P8MC 3HUSA 1KILA 3B8EB 1CW5A 3HE5B 1SQBK 1LT9A 2P67A 3OA7A 1JOCA 2OYIB 3BASA 2IX7C 2QM7A 4N78D 4C46A 2HG5D 1FZGA 3O8ZA 3TYYA 1IFIA 1JY2P 2FYUK 3P7KA 3GHGB 1LWUB 2WWWA 1SQVK 5AW4B 2WITA 2Q9IA 4W7YA 4N6JA 1L4AD 3H32B 3RL0B 1S9KE 3SWFA 3V4WA 1PFIA 1L0NK 1L0LK 2J58A 1LTSC 1N7SB 2KSJA 1NTMK 2ZXEB 3TNUA 3BRTB 1N7LA 1NTZK 4WY4D 1T3JA 3HTKA 1ZV8A 4WY4A 3VMZA 1SFCC 1W2EA 1G2CB 1NWQA 4GKGA 1GTWA 1RF1A 3EFGA 1JY3P 1IK9A 4XA4A 2HPCB 2Q3IA 3MUDA 1LTJA 1ZLLA 1GL2C 1KQLA 2WT7A 1RF0C 3VP8A 2VRSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GK4 A;  1CI6 B;  3M9H A;  3MD0 A;  1FOS F;  2WPR A;  3KQG A;  1GU5 A;  1H88 A;  1X8Y A;  2ZFC A;  1T2K D;  2P7J A;  1NAF A;  4XE5 B;  2XU6 A;  3T97 A;  2R3C A;  1H89 A;  2H7H A;  1CZQ A;  3OAK A;  1CSB A;  3HE4 B;  4HYT B;  5AW7 B;  3LID A;  2Q7C A;  4B86 A;  1SLQ A;  5AW6 B;  4AQR D;  3I5C A;  4EOT A;  4I6M C;  2C9L Y;  2N9B A;  3NMD A;  4DZO A;  1MFZ A;  1GK6 A;  2BAS A;  3MGN A;  2QM8 A;  1A02 F;  3M91 A;  2R5B A;  1IO4 A;  3A7O A;  5APV A;  2R5D A;  2E43 A;  5AVU B;  5AW8 B;  2C9N Y;  3M0D A;  5AVT B;  2Z5I A;  5AW1 B;  5AW5 B;  3V5B A;  3TK1 A;  3VMY A;  2R32 A;  3VTP C;  1JNM A;  1CI6 A;  3KDP B;  5AVV B;  3A3Y B;  5AW9 B;  3NTN A;  3VMX A;  1MV8 A;  5AVR B;  3P32 A;  4GT1 A;  5APS A;  4JYC A;  2WT7 B;  5AVW B;  4LC1 A;  3P8M C;  4JYB A;  1HWT C;  2YNY A;  3B8E B;  4C7N A;  3HE5 B;  1A02 J;  3VYI A;  3HE4 A;  1GZL A;  2P67 A;  2Q5U A;  3NXS A;  3UIA A;  2XZR A;  3TNU B;  2YO3 A;  2QM7 A;  4C46 A;  3L37 A;  1HBW A;  5APX A;  1HUC A;  5APT A;  1YYC A;  3O8Z A;  3TYY A;  2YO2 A;  3NFQ A;  5APW A;  3L36 A;  2W6A A;  3P7K A;  5CMZ A;  5AW3 B;  1GD2 E;  4AYC A;  2WWW A;  3L35 A;  4M3L A;  2Z5H A;  1S9K D;  5AW4 B;  5AVX B;  5AW2 B;  3V4Q A;  1MUU A;  1HJB A;  2WPQ A;  5APY A;  2IPP A;  1J2J B;  5AVQ B;  1GU4 A;  3A5T A;  1S9K E;  1H8A A;  3M06 A;  4I2L C;  3SWF A;  3V4W A;  1SP4 A;  1OXZ A;  5AVZ B;  2XV5 A;  2WTY A;  2JJL A;  3HE5 A;  1T2K C;  2ZXE B;  1FAV A;  1FOS E;  1JUN A;  3TNU A;  3A2A A;  1OWA A;  5AVY B;  2E42 A;  4C7N B;  3HTK A;  3VMZ A;  5AVS B;  1G2C B;  5AW0 B;  1NWQ A;  3M0A A;  2P2U A;  5APU A;  4GKG A;  3LIE A;  4AUW A;  1GTW A;  2W27 A;  3VN0 A;  3IR9 A;  2Q3I A;  4KHX A;  2KP8 A;  3M9B A;  5APQ A;  1DH3 A;  1KQL A;  2WT7 A;  4RES B;  2WPS A;  2VRS A; 
#chains in the Genus database with same CATH topology
 1EDK A;  3CLQ A;  2RN0 A;  2BCC J;  1IFD A;  1OW6 A;  1FZC B;  3H1I J;  2QRX A;  3L71 G;  3CX5 E;  1FZE A;  5CJ0 A;  4CPG A;  1LT9 B;  1SQB E;  1FZA A;  1EZV D;  3C9I A;  1N73 C;  4DZO A;  2Q6Q A;  1JB0 J;  1RE4 C;  1A02 F;  4PV1 C;  1OVU A;  1MZ9 A;  2C9N Y;  4H13 B;  2AXT H;  3RK3 C;  3KDP B;  2R44 A;  1JMM A;  2IFN A;  4JYB A;  2XDJ A;  3FXD A;  1URQ C;  3BCC G;  1L0L E;  1FBM A;  2FFD C;  5B5E H;  1NTM E;  1HBW A;  2H43 A;  1NTZ E;  5APT A;  2QJK C;  2E75 C;  3L74 D;  4U3F G;  3AE9 C;  1ZR4 A;  3AED C;  5BVZ A;  1G1J A;  2YKO A;  2OAR A;  2ZJS E;  1FAV A;  5KLV E;  3KHU A;  2QE7 H;  3CPW O;  3KZI E;  5CHX A;  3N7N A;  5AW0 B;  1FE6 A;  5B66 H;  2Y0C A;  1N73 B;  2FXP A;  3VN0 A;  1M1J C;  2KP8 A;  5B66 E;  5KAF E;  5H2F H;  3KQG A;  5E79 E;  2AEF A;  1X8Y A;  5H2F E;  4PD4 I;  4ZKP A;  2WVR A;  3PRJ A;  2H7H A;  4Y28 J;  4KT0 J;  2HYN A;  1ZRT E;  2I1J A;  2OYO A;  3RL0 g;  1SFC D;  1SQX D;  1URQ B;  3I5C A;  2KZJ A;  1BE3 G;  4A7P A;  1SFC A;  3MGN A;  2E75 B;  5AW8 B;  1JTH A;  4N78 E;  1RF0 A;  4DOJ A;  4TLF A;  1YIJ P;  1LTJ C;  1SQX J;  1XTG B;  3CCU P;  3AE5 C;  1GZL A;  1IC2 A;  3MIW A;  3UIA A;  5GTI H;  1Q82 Q;  1VF5 D;  1S5L H;  5GTI E;  2Q1K A;  1S5L E;  4IOI H;  2A45 I;  1DEE G;  3GHG C;  5AW3 B;  2AEJ A;  1LGH B;  3H1I E;  3H1L D;  1J2J B;  1PP9 G;  1USD A;  2RH0 A;  2POH A;  4O9B A;  4JQ0 D;  2WTY A;  1N7S C;  3Q5P A;  2W8Z A;  4C7N B;  3RK2 D;  3AEE C;  1GW4 A;  1VQ9 P;  1GDT A;  3IR9 A;  3FGA D;  1JTH B;  1EZV E;  2WPS A;  3FWL A;  4GDO A;  1YQ3 C;  2N1T C;  1P84 D;  4XE5 B;  1S1C X;  3D70 A;  1EDL A;  3HUS C;  3MHV A;  1CSB A;  4K35 A;  1KB9 H;  1SLQ A;  1JY2 N;  2GM4 A;  3B5N A;  2FYN C;  3GG2 A;  1NU1 D;  2QM8 A;  3CD6 P;  1AFO A;  1UII A;  3AEC C;  3L73 G;  3C1L A;  1LTG C;  1KZU B;  3L74 E;  1Y9B A;  4HB1 A;  1NTK J;  1HWT C;  1Y47 A;  3V2P A;  1K9M Q;  1NU1 J;  2Q5U A;  3CC4 P;  2QG4 A;  1QVG O;  3L71 D;  1N2D C;  1IFP A;  2KOG A;  3HD7 C;  3S4R A;  3CCV P;  5TIS H;  2QJP B;  2NPS D;  2ZVO B;  1MUU A;  4UB6 H;  3ZDM A;  3RK2 B;  3Q5S A;  1H8A A;  4I2L C;  3L71 J;  5AVZ B;  3RBX A;  4RO0 A;  2YMK A;  1L2P A;  1JUN A;  5KJ7 D;  3BCC D;  3B5N B;  4DCK A;  5KJ7 A;  2LR2 A;  2IBZ I;  1LWU A;  2WZ7 A;  1BDD A;  5APU A;  4AUW A;  1FJP A;  1SQX E;  4U3F D;  4W7Z A;  3OJA B;  3AEF C;  1NAY A;  1VQM P;  1NAF A;  5CCH C;  3LID A;  4B86 A;  2K9J A;  4EOT A;  1MFZ A;  4GIF A;  1G2C A;  5CCG C;  2OGU A;  3WMM 0;  4YTP C;  2QJY B;  1HJ0 A;  4NPD A;  1KYO D;  2V7Q J;  4U7J A;  1JO5 A;  3VMY A;  2KYV A;  1PPJ G;  1EDJ A;  1KN7 A;  1RHZ B;  3H1L E;  2P67 A;  4HKZ H;  3OA7 A;  2IX7 C;  2B89 A;  2QM7 A;  1M56 D;  2IZ0 A;  3TYY A;  1VQ4 P;  4I7Z B;  2FYU K;  2YIU B;  1LWU B;  1SQV K;  1BE3 D;  2WIT A;  3H1H G;  4N6J A;  3QH9 A;  1NGM B;  1T6A A;  2Y9Y A;  3EFF K;  3A0B E;  1FDI A;  1PFI A;  1L0N K;  1U7J A;  2J58 A;  1LTS C;  2J5U A;  2KSJ A;  2ZXE B;  3BRT B;  4WY4 D;  2G8Y A;  2K9J B;  3HTK A;  1P84 H;  1BE3 J;  3JC2 2;  4JBZ A;  4WY4 A;  1P84 E;  1W2E A;  1G2C B;  1NWQ A;  1VQ6 P;  2H89 C;  2B87 B;  1GTW A;  2W90 A;  3MUD A;  1KQL A;  4RES B;  2QSI A;  3WUU A;  2E76 C;  3V2N A;  1NU1 E;  1RY3 A;  2M3B A;  2FYU G;  1VPC A;  1SQV G;  2WSE H;  5DJU B;  1X0T A;  1AQ5 A;  2Q7C A;  3E7K A;  5AW6 B;  1NOH A;  1IK7 A;  4Z1M H;  2Z4E A;  3NMD A;  1L0N G;  2YKP A;  2W6J H;  2R5D A;  3H32 A;  2W6B A;  5AVU B;  1J1D B;  1ZOY C;  3L71 E;  3M0D A;  2Z5I A;  3VTP C;  4WB4 A;  4L75 A;  1MV8 A;  2IFM A;  4GT1 A;  3CXH I;  4JYC A;  3G4S P;  1YHQ P;  4XFJ A;  2IBZ G;  2PGD A;  5KLV J;  4WY4 B;  3L36 A;  2HPC A;  1AVO A;  1YTZ T;  5CMZ A;  3H1K J;  1M57 D;  2PP6 A;  3V4Q A;  2XND H;  1RE3 A;  1BCC G;  1DX7 A;  3LW5 J;  4N3Y B;  1K04 A;  3L73 D;  3CMA P;  3EQ2 A;  3V2Q A;  3R2P A;  1HGV A;  3CCL P;  1LTA C;  2M0B A;  1VDF A;  4U3F E;  1KFN A;  1M8O B;  3A2A A;  1NO4 A;  3SSU A;  2V7Q H;  4D6T D;  3BRV B;  4OGQ C;  1J1E B;  3L72 G;  3WUT A;  3L73 J;  2M5A A;  2OYH C;  4H44 C;  3EWK A;  1KYO H;  4PD4 D;  2R3C A;  4D6T J;  1KYO E;  1L4A C;  1WT6 A;  1YJ9 P;  1R5S A;  1HTL C;  3MTU E;  4WBA A;  2E74 C;  1KOR A;  2ZYG A;  3H1J G;  1X22 A;  1SVF A;  4GOD A;  1LTB C;  2J59 M;  3F89 A;  1JY3 N;  3CX5 H;  2R32 A;  4ZMD A;  2R3S A;  1SS1 A;  4DT0 A;  4EDF A;  1X9V A;  2V4H A;  2A06 G;  4LLH A;  3CC7 P;  1BE3 E;  2KLV A;  3GW6 A;  2WSF J;  2HR3 A;  3VYI A;  3NXS A;  2OYI C;  3Q2Y A;  3V2R A;  1HUC A;  1N73 A;  4PV1 D;  1VL2 A;  1RE4 A;  2W6A A;  1ZR2 A;  3MZW B;  3RK3 D;  2WSC J;  2M5A B;  1FS0 E;  3RL0 C;  1GU4 A;  1NHL A;  4ZKU A;  1URQ D;  1AV1 A;  3SFE C;  1PPJ D;  1URQ A;  1BGY G;  4WWI A;  1OWA A;  2E75 D;  4DJG A;  2E42 A;  2QIW A;  1M1K Q;  3GLM A;  4KJM A;  3M9H A;  3H1H D;  3CWB G;  4GOE A;  3B4S A;  3L74 J;  1KIL C;  3KZI H;  3S1K A;  2KXP B;  3H1K E;  3LW5 H;  2KNC A;  5KAF H;  1AA0 A;  1GK6 A;  1JMB A;  2JP3 A;  3CCR P;  2H88 C;  5E79 H;  1W5C E;  4PV1 B;  1M1J A;  2H8P D;  3RK3 B;  5AVV B;  4HJG H;  1EC5 A;  5APS A;  3BAT A;  3WUV A;  4C7N A;  5CBN A;  2FYU D;  2FFD B;  1SQV D;  1YJW P;  3L73 E;  2AXC A;  2QJK B;  3AEB C;  3D6Z A;  2Z5H A;  1L0N D;  2PAJ A;  1RF1 C;  2K1A A;  1BSH A;  1Z56 A;  2CK3 H;  4D6T E;  2ZT9 C;  2FYU J;  1YIT P;  3PJS K;  2JJL A;  3GF7 A;  1FOS E;  2KNC B;  1L0N J;  4PD4 H;  1FJK A;  3JCU E;  4PD4 E;  2IBZ D;  3GHG A;  1OMI A;  2P2U A;  3LIE A;  2W27 A;  3G71 P;  1VF5 C;  1M1J B;  3R4Y A;  5DJT B;  3L75 G;  1ZP0 C;  3AE1 C;  1HJB A;  5M1B A;  1IJD B;  1NTZ G;  1BCC D;  1GU5 A;  2P7J A;  1N7S A;  1KB9 I;  2YKQ A;  1AQT A;  3VOP A;  3H1L J;  2WSC H;  3PH0 A;  4I6M C;  3CL3 D;  1YBK A;  4UB8 H;  1WRG A;  3L72 D;  4UB8 E;  5AW1 B;  3AE8 C;  2A45 H;  2MKV A;  2N1T D;  1RF1 B;  2ZYA A;  3I56 P;  1LTJ B;  3B5N D;  2N1T A;  2LKM A;  2WT7 B;  5KLI C;  2O1J A;  3P8M C;  3HUS A;  3B8E B;  3PLN A;  5L8R J;  1PGP A;  3BAS A;  2OTL P;  2B88 A;  1FZG A;  3L72 J;  2K3R A;  1IFI A;  1JY2 P;  3GHG B;  1PGO A;  2Q9I A;  3H1J D;  2K88 A;  3SWF A;  1QX8 A;  1N7S B;  2A06 D;  1QLE D;  3Q1M A;  3H1H E;  1ZV8 A;  1MKM A;  4XA4 A;  1GL2 C;  2NPS C;  1H88 A;  1YQ4 C;  2N1T B;  3T97 A;  3HUS B;  1E5W A;  1CZQ A;  2BCC G;  4OH8 B;  2UWJ E;  1U7M A;  3H1I G;  1Q81 Q;  1S2E A;  2K9Y A;  1BGY D;  2FYN B;  3E1R A;  1X79 B;  2BAS A;  4LGD E;  2FYU E;  2AEM A;  1SQV E;  2WPV B;  2ITA A;  1USE A;  3BCC J;  4Y99 C;  5CCH D;  4BRY A;  3P32 A;  3CXH D;  3TGU G;  1VQ7 P;  1K05 A;  2JDI H;  1L0N E;  5CCH A;  5K5G B;  3CWB D;  5CCG D;  4U3F J;  1SQP K;  3L4F A;  5APX A;  1PGJ A;  2B87 A;  3KPE A;  3CI9 A;  1YYC A;  3HD7 B;  4IL6 X;  5CCG A;  2E5T A;  2IYO A;  1S9K D;  1NYH A;  2WPQ A;  2D2C C;  2IPP A;  1KC8 Q;  3M06 A;  2IBZ E;  4HH2 A;  1QL2 A;  4YPC A;  1OXZ A;  3T97 B;  3W68 A;  2L5G B;  3A0H E;  2IDB A;  1T2K C;  4IFM A;  4WVZ A;  3P8C D;  2K37 A;  1NKZ B;  1BCC E;  1PV3 A;  3M0A A;  3KXD A;  3A0B H;  1YJN P;  2RMZ A;  3TDK A;  1IFJ A;  2JKV A;  1SQP G;  2E5Y A;  4BRY B;  3WU2 H;  3BVH A;  3L72 E;  3WU2 E;  1WMK A;  5KKZ C;  1AVY A;  3SWK A;  3CCE P;  4AQR D;  2JR8 A;  3JSV C;  1IZN B;  2R5B A;  2B9B A;  1JEK A;  1OX3 A;  2E76 D;  1EXI A;  2Q3E A;  1PP9 D;  3TK1 A;  1JCD A;  1Q2N A;  2P1J A;  3L75 D;  2D2C B;  3CCM P;  2YNY A;  3H1J E;  1NTZ D;  1A02 J;  3TSI A;  4C7R A;  2FBW C;  2DW3 A;  1BSN A;  2QEX P;  2L91 A;  1PP9 J;  2O1K A;  3L35 A;  3SWY A;  2A06 E;  3L75 J;  1DIP A;  4H0L C;  2Y0D A;  1OIP A;  1SQQ K;  2W83 C;  3W67 A;  3PTZ A;  1XTC C;  2M8R A;  2KSE A;  1VQN P;  1Q86 Q;  4GOF A;  2OTK E;  3BCC E;  2P10 A;  2KIK A;  1N86 A;  1S72 P;  1AJY A;  4YXW H;  1EDI A;  1BGY E;  2E76 B;  1NTK K;  3PHL A;  2YMY A;  1LTI C;  2ZFC A;  1FZC C;  1VQ8 P;  2FYZ A;  1NJI Q;  1LT9 C;  3AE4 C;  5AW7 B;  4OGQ D;  1FDO A;  3CXH H;  4L76 A;  1OFC X;  3CXH E;  2CPB A;  1M90 Q;  3M91 A;  1SQQ G;  3CWB E;  3CX5 I;  1KFM A;  4H44 D;  4H13 C;  5AVT B;  3HRN A;  3ITK A;  2GUS A;  2OYH A;  3GF3 A;  5KTB A;  1H0T A;  1L4A A;  2E74 D;  2FXO A;  2YO3 A;  3L70 G;  2HOD B;  1NTK G;  2PRR A;  2BCC D;  1LT1 A;  3NFQ A;  5APW A;  3H1I D;  1HGZ A;  1IFN A;  2QA4 P;  1G1I A;  2IYP A;  1DD4 A;  3P8C E;  1NVO A;  2WSS H;  2O01 J;  3RBZ A;  3HE5 A;  1LP1 A;  3TGU D;  2OYI A;  1JY2 O;  2OQQ A;  4OGQ B;  5AVS B;  3S9O A;  2MJZ A;  3RL0 D;  1FZF A;  4PJ0 H;  1DH3 A;  1ZN5 A;  4PJ0 E;  1LNQ A;  2OYH B;  4H44 B;  3U1A A;  3TGU J;  2FFD A;  1PIX A;  2N9Y B;  1H89 A;  1KB9 D;  2AXT E;  1H0T B;  1L4A B;  1Q7Y Q;  2KK7 A;  1PP9 E;  3RGU A;  4BXL A;  1M7L A;  2XKM A;  2E74 B;  3L75 E;  4QMA A;  1R5L A;  5B5E E;  1ZME C;  1N8R Q;  3MP7 B;  3QWO C;  3IN6 A;  1LTT C;  2WMM A;  3Q3D A;  3NTN A;  2JWD A;  1KIL D;  2KUB A;  2ZVN B;  2YXQ B;  1SQP D;  1OVR A;  3O6Q A;  3ABV C;  1KIL A;  1CW5 A;  3HE5 B;  1SQB K;  1LP1 B;  1JOC A;  2OYI B;  3FX0 A;  1D7M A;  4C46 A;  3CME P;  3H1H J;  1VQK P;  3P7K A;  3USS A;  3K5B A;  1SQP J;  3RL0 B;  2BEZ F;  3CCJ P;  4OVN F;  5TJH A;  1L0L K;  5EFW B;  1Y8A A;  1NTM K;  1KQG B;  3TNU A;  1NTZ K;  1T3J A;  1HF9 A;  1SFC C;  1SQB G;  1RF1 A;  3EFG A;  2ZT9 D;  2KS1 A;  1LTJ A;  1SQV J;  2WT7 A;  1RF0 C;  3MD0 A;  1FOS F;  5KAI H;  1KQS O;  2KI7 B;  2O01 N;  5KAI E;  1ZXG A;  2XU6 A;  3O6Q B;  1KIL B;  3JCU H;  5KLV K;  2LXB A;  1EZV I;  4IFD K;  3FWN A;  1L0L G;  2IZ1 A;  2O01 H;  1JM0 A;  2WSF H;  5APV A;  4OWF A;  2E43 A;  1PGQ A;  1NTM G;  1N7S D;  3D6Y A;  4I1L A;  1JNM A;  1CI6 A;  2BCC E;  2I8D A;  5AW9 B;  2P58 A;  2YXR B;  5AVR B;  4LC1 A;  1VQO P;  2XZR A;  3I55 P;  3TNU B;  2JWA A;  1BCC J;  2YO2 A;  1GD2 E;  2QJP C;  2O3J A;  4AYC A;  2NRG A;  4M3L A;  5KLV G;  3TGU E;  5AW2 B;  3V6I A;  1SFC B;  5BU8 B;  1OZH A;  2KS1 B;  1SQQ D;  5GTH H;  3RK2 C;  3H1K G;  3RK3 E;  5GTH E;  2ZT9 B;  3U59 A;  5BU5 A;  1RQV A;  1PL5 A;  1FZB A;  1YI2 P;  1TU3 F;  1R8E A;  1S5L X;  5AVY B;  1NKN A;  4NPF X;  1T3U A;  1PPJ E;  1E79 H;  3B5N C;  1PZQ A;  1SQQ J;  3L70 D;  1VQP P;  1KB9 E;  1MFT A;  1NTK D;  3E1I A;  1VF5 B;  2ZAE B;  4JF7 A;  3G9R A;  1CI6 B;  4ASW A;  4EI2 A;  5CJ4 A;  1FDM A;  2JO1 A;  3HD7 D;  2KB7 P;  3TF5 A;  3H1J J;  2SPZ A;  3HD7 A;  3L70 J;  1BDC A;  1KIL E;  4D6T G;  2WQY C;  2N9B A;  1SQP E;  4IL6 H;  1IO4 A;  1LJ2 A;  3A7O A;  1K8A Q;  3AE2 C;  4IFF A;  1GL2 D;  4IL6 E;  2QJY C;  2WSE J;  4L74 A;  2LXC B;  1GL2 A;  5AW5 B;  5TIS E;  3Q5R A;  3VMX A;  2NPS A;  3VMA A;  1VQL P;  4UB6 E;  5AVW B;  5KLI B;  2FKW B;  3IAO A;  3AE3 C;  3AE6 C;  4EIJ A;  4ASV A;  5KJ7 C;  1NH4 A;  1Q90 D;  4I7Z C;  5CBO A;  2YIU C;  1LWU C;  3AEG C;  5AVX B;  5APY A;  2FXM A;  5AVQ B;  2HFE D;  1BGY J;  1SP4 A;  3D71 A;  2XV5 A;  1EZV G;  3G3Z A;  1QVF O;  1OW7 A;  2A45 G;  4RKU J;  2D2C D;  4TT3 H;  3CWB J;  1QL1 A;  4L73 A;  3M9B A;  1JY3 O;  1GL2 B;  1UIX A;  1FC2 C;  3A0H H;  3M9Q A;  1KQF B;  1KMI Z;  2NPS B;  1T2K D;  4W80 A;  1P84 I;  3OAK A;  2GA1 A;  4HYT B;  3G6E P;  3VP9 A;  3L74 G;  1VQ5 P;  2Y0E A;  4BWN A;  2C0W A;  1SQX K;  3CX5 D;  1J1D C;  1HVV A;  2C0X A;  3V5B A;  1SQB D;  4Y99 B;  2JEE A;  3PP5 A;  1OVV A;  2OTJ P;  1T8Z A;  2XNX A;  1SQQ E;  2HLO A;  3GMA A;  3HE4 A;  3L37 A;  3N4X A;  2GUV A;  3CC2 P;  1YTZ I;  3IF4 A;  4WY4 C;  3U1C A;  3C8V A;  1U57 A;  1SQB J;  4NPE A;  1IFM A;  1L0L D;  4YXD C;  3MUD C;  3B71 A;  3A5T A;  1NTM D;  4R4L A;  3L70 E;  1S3J A;  1KV4 A;  1NTK E;  1K73 Q;  1SQX G;  2FY8 A;  3OW2 O;  2ZXX A;  1FU1 A;  1QGK B;  2NZ2 A;  1L0L J;  2QVA A;  1J1E C;  3H25 A;  1EXJ A;  1QEX A;  3IFM A;  2BEQ D;  1NTM J;  3H6P A;  1NTZ J;  4H0L D;  3M0D C;  4KHX A;  4EYY Q;  1DEB A;  3SFD C;  1GK4 A;  1GW3 A;  3F5H A;  5KLV D;  4MN4 C;  2WPR A;  3H1K D;  1S4X A;  2HOD A;  2PFX A;  3AE7 C;  5KKZ B;  3HE4 B;  1KD1 Q;  2Y9Z A;  2KLU A;  4ZNC A;  3II6 A;  2C9L Y;  1ZW0 A;  1EQ7 A;  2I1K A;  3H1L G;  3HTK B;  1JCC A;  1KYO I;  1RE3 C;  1NU1 K;  1ZRT D;  2CPS A;  3A3Y B;  1HH0 A;  3KYQ A;  4JPZ B;  2G3A A;  1FZC A;  4RJT A;  3AEA C;  1LT9 A;  4N78 D;  1GMJ A;  2M3E A;  2HG5 D;  4K3A A;  3O8Z A;  4H13 D;  1W2B O;  2WWW A;  5AW4 B;  4W7Y A;  1L4A D;  3H32 B;  1RQU A;  1S9K E;  1RH5 B;  3FXE A;  2KZI A;  4H0L B;  3V4W A;  1KTM A;  1NU1 G;  1N7L A;  2RKL A;  3CCS P;  3VMZ A;  1DD3 A;  4R4M A;  1OW8 A;  3CCQ P;  4GKG A;  2ZYD A;  1JY3 P;  1IK9 A;  2HPC B;  2Q3I A;  1ZLL A;  5C39 A;  5APQ A;  3VP8 A;  2VRS A; 
#chains in the Genus database with same CATH homology
 3CLQ A;  3MD0 A;  3V2N A;  1FOS F;  1RY3 A;  1IFD A;  2M3B A;  2NPS C;  1H88 A;  1VPC A;  2N1T B;  1FZC B;  2WSE H;  2XU6 A;  3T97 A;  3HUS B;  1KIL B;  1E5W A;  1FZE A;  1CZQ A;  5KLV K;  5CJ0 A;  1LT9 B;  1AQ5 A;  4OH8 B;  2Q7C A;  5AW6 B;  1NOH A;  1FZA A;  2Z4E A;  3C9I A;  4IFD K;  3NMD A;  1X79 B;  4DZO A;  1N73 C;  2BAS A;  1RE4 C;  1A02 F;  2O01 H;  2WSF H;  2YKP A;  4LGD E;  5APV A;  2R5D A;  2E43 A;  3H32 A;  2W6B A;  5AVU B;  1J1D B;  1N7S D;  1MZ9 A;  2C9N Y;  3M0D A;  2Z5I A;  4I1L A;  3RK3 C;  3VTP C;  1JNM A;  1CI6 A;  3KDP B;  4WB4 A;  4Y99 C;  5AW9 B;  1MV8 A;  5AVR B;  2IFM A;  3P32 A;  4GT1 A;  5CCH D;  4JYC A;  4LC1 A;  1JMM A;  2IFN A;  4JYB A;  2XDJ A;  5CCH A;  1URQ C;  1FBM A;  2FFD C;  2XZR A;  3TNU B;  5CCG D;  1HBW A;  1SQP K;  3L4F A;  5APX A;  2H43 A;  5APT A;  3KPE A;  3CI9 A;  1YYC A;  3HD7 B;  2YO2 A;  4WY4 B;  3L36 A;  2HPC A;  5CCG A;  1YTZ T;  5CMZ A;  1GD2 E;  4AYC A;  4M3L A;  1S9K D;  1ZR4 A;  2PP6 A;  5AW2 B;  3V4Q A;  1SFC B;  5BU8 B;  5BVZ A;  1RE3 A;  2WPQ A;  1DX7 A;  4N3Y B;  2IPP A;  3RK2 C;  1G1J A;  2YKO A;  3M06 A;  3U59 A;  5BU5 A;  4HH2 A;  1QL2 A;  3EQ2 A;  1OXZ A;  3V2Q A;  3R2P A;  1HGV A;  1FZB A;  2L5G B;  2OAR A;  1LTA C;  1T2K C;  1FAV A;  1VDF A;  4IFM A;  1KFN A;  3A2A A;  1NO4 A;  5AVY B;  1NKN A;  3P8C D;  1T3U A;  1NKZ B;  3B5N C;  3BRV B;  1J1E B;  5CHX A;  3N7N A;  5AW0 B;  3M0A A;  3E1I A;  1IFJ A;  1N73 B;  3VN0 A;  1M1J C;  4JF7 A;  2KP8 A;  1CI6 B;  2OYH C;  5CJ4 A;  3KQG A;  1FDM A;  1X8Y A;  3BVH A;  3HD7 D;  2R3C A;  4ZKP A;  2H7H A;  2KB7 P;  1L4A C;  1WT6 A;  3HD7 A;  2HYN A;  2I1J A;  1HTL C;  1SFC D;  3MTU E;  4AQR D;  1URQ B;  3I5C A;  4WBA A;  2N9B A;  1SFC A;  3MGN A;  1IO4 A;  1SVF A;  2R5B A;  3A7O A;  4IFF A;  1GL2 D;  1LTB C;  2J59 M;  5AW8 B;  1JTH A;  1JY3 N;  4N78 E;  1GL2 A;  5AW5 B;  3TK1 A;  1RF0 A;  2R32 A;  1JCD A;  4DOJ A;  1X9V A;  3VMX A;  2NPS A;  1LTJ C;  2P1J A;  4LLH A;  5AVW B;  1XTG B;  2FKW B;  2KLV A;  2YNY A;  1A02 J;  3VYI A;  4EIJ A;  1GZL A;  1IC2 A;  3MIW A;  3NXS A;  3UIA A;  2OYI C;  3TSI A;  3V2R A;  1HUC A;  4C7R A;  5KJ7 C;  1N73 A;  2A45 I;  1NH4 A;  1RE4 A;  2W6A A;  3GHG C;  1LWU C;  2O1K A;  5AW3 B;  1ZR2 A;  3L35 A;  3SWY A;  3RK3 D;  5AVX B;  5APY A;  1LGH B;  1J2J B;  2FXM A;  5AVQ B;  3RL0 C;  2HFE D;  1GU4 A;  1NHL A;  2POH A;  4O9B A;  1URQ D;  4ZKU A;  1SP4 A;  2XV5 A;  2WTY A;  1N7S C;  1SQQ K;  3G3Z A;  1URQ A;  1OWA A;  2E42 A;  1XTC C;  2M8R A;  4C7N B;  2A45 G;  3RK2 D;  1N86 A;  1GW4 A;  1GDT A;  3IR9 A;  1QL1 A;  1JTH B;  3M9B A;  1GL2 B;  1JY3 O;  2WPS A;  3M9Q A;  3M9H A;  1NTK K;  2YMY A;  2NPS B;  1LTI C;  2ZFC A;  1T2K D;  2N1T C;  1FZC C;  4W80 A;  4XE5 B;  3HUS C;  2FYZ A;  1KIL C;  3OAK A;  1CSB A;  1LT9 C;  4HYT B;  5AW7 B;  1SLQ A;  1JY2 N;  3VP9 A;  3LW5 H;  2GM4 A;  3B5N A;  2CPB A;  1GK6 A;  2QM8 A;  3M91 A;  2C0W A;  1AFO A;  1SQX K;  1J1D C;  1HVV A;  1KFM A;  1M1J A;  2C0X A;  5AVT B;  3V5B A;  2H8P D;  3HRN A;  3RK3 B;  1LTG C;  2GUS A;  5AVV B;  1KZU B;  4Y99 B;  2OYH A;  5KTB A;  5APS A;  2JEE A;  3PP5 A;  3BAT A;  1HWT C;  4C7N A;  1L4A A;  1T8Z A;  2XNX A;  3V2P A;  2HLO A;  2Q5U A;  3HE4 A;  2FFD B;  2YO3 A;  3L37 A;  2HOD B;  3N4X A;  2GUV A;  1N2D C;  1YTZ I;  2KOG A;  3HD7 C;  3NFQ A;  4WY4 C;  5APW A;  3U1C A;  1HGZ A;  1IFN A;  2NPS D;  1IFM A;  2Z5H A;  2PAJ A;  1RF1 C;  1MUU A;  1G1I A;  3P8C E;  3RK2 B;  1Z56 A;  3A5T A;  1H8A A;  4I2L C;  5AVZ B;  2JJL A;  3HE5 A;  1FOS E;  2OYI A;  1JUN A;  5KJ7 D;  1FU1 A;  1JY2 O;  3B5N B;  5KJ7 A;  1J1E C;  1FJK A;  5AVS B;  3IFM A;  3GHG A;  1LWU A;  2WZ7 A;  2P2U A;  5APQ A;  2MJZ A;  5APU A;  3RL0 D;  3LIE A;  4AUW A;  3H6P A;  2W27 A;  1FJP A;  1M1J B;  4KHX A;  3M0D C;  1FZF A;  1DEB A;  1HJB A;  1DH3 A;  4W7Z A;  3OJA B;  1IJD B;  1GK4 A;  1GW3 A;  1ZN5 A;  2OYH B;  3U1A A;  2WPR A;  1GU5 A;  2FFD A;  2P7J A;  1NAF A;  1N7S A;  4RES B;  1H89 A;  2HOD A;  5CCH C;  1L4A B;  2YKQ A;  3HE4 B;  3LID A;  3VOP A;  4B86 A;  1M7L A;  2WSC H;  2XKM A;  4EOT A;  3II6 A;  4I6M C;  2C9L Y;  1MFZ A;  4GIF A;  1EQ7 A;  1G2C A;  5CCG C;  2I1K A;  3CL3 D;  3HTK B;  3WMM 0;  1JCC A;  1WRG A;  1RE3 C;  1JO5 A;  5AW1 B;  3VMY A;  1NU1 K;  2A45 H;  2N1T D;  2KYV A;  2CPS A;  3A3Y B;  1LTT C;  1RF1 B;  3NTN A;  1HH0 A;  3KYQ A;  1KIL D;  1LTJ B;  3B5N D;  2N1T A;  2LKM A;  1FZC A;  2WT7 B;  2O1J A;  3P8M C;  3HUS A;  1KIL A;  3B8E B;  1CW5 A;  3HE5 B;  1SQB K;  1LT9 A;  2P67 A;  3OA7 A;  1JOC A;  2OYI B;  3BAS A;  2IX7 C;  2QM7 A;  4N78 D;  4C46 A;  2HG5 D;  1FZG A;  3O8Z A;  3TYY A;  1IFI A;  1JY2 P;  2FYU K;  3P7K A;  3GHG B;  1LWU B;  2WWW A;  1SQV K;  5AW4 B;  2WIT A;  2Q9I A;  4W7Y A;  4N6J A;  1L4A D;  3H32 B;  3RL0 B;  1S9K E;  3SWF A;  3V4W A;  1PFI A;  1L0N K;  1L0L K;  2J58 A;  1LTS C;  1N7S B;  2KSJ A;  1NTM K;  2ZXE B;  3TNU A;  3BRT B;  1N7L A;  1NTZ K;  4WY4 D;  1T3J A;  3HTK A;  1ZV8 A;  4WY4 A;  3VMZ A;  1SFC C;  1W2E A;  1G2C B;  1NWQ A;  4GKG A;  1GTW A;  1RF1 A;  3EFG A;  1JY3 P;  1IK9 A;  4XA4 A;  2HPC B;  2Q3I A;  3MUD A;  1LTJ A;  1ZLL A;  1GL2 C;  1KQL A;  2WT7 A;  1RF0 C;  3VP8 A;  2VRS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...