4I6MC

Structure of arp7-arp9-snf2(hsa)-rtt102 subcomplex of swi/snf chromatin remodeler.
Total Genus 30
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
30
sequence length
69
structure length
69
Chain Sequence
LKLERKKTEAVARLKSMNKSAINQYNRRQDKKNKRLKFGHRLIATHTNLERDEQKRAEKKAKERLQALK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of an actin-related subcomplex of the SWI/SNF chromatin remodeler.
pubmed doi rcsb
source organism Saccharomyces cerevisiae
molecule tags Transcription/hydrolase
molecule keywords Actin-related protein 7
total genus 30
structure length 69
sequence length 69
ec nomenclature ec 3.6.4.-:
pdb deposition date 2012-11-29

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF07529 HSA HSA
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 4i6mC00
3M0AA 5AVQB 4XE5B 3O8ZA 2KP8A 1CI6B 3MGNA 2QM8A 2WPSA 1CI6A 1SLQA 3A2AA 1T2KC 3NXSA 5AW9B 1JUNA 1SP4A 2W27A 1J2JB 4B86A 2WPRA 5AVYB 3OAKA 3B8EB 1X8YA 4JYCA 1GU5A 3TYYA 4HYTB 1S9KD 3I5CA 1GZLA 2Z5HA 1FAVA 1HJBA 3SWFA 1FOSE 2WT7B 1MUUA 3M9BA 2ZXEB 2Q7CA 3VMXA 5APUA 3L37A 2JJLA 2ZFCA 4AYCA 3V4QA 2WT7A 1H88A 3KDPB 1YYCA 3TNUA 3L35A 3T97A 2C9LY 2VRSA 3LIDA 2WPQA 4M3LA 3LIEA 5AW3B 1OXZA 2YNYA 3M06A 1H89A 5APVA 1FOSF 4I2LC 5AVTB 3L36A 1OWAA 3HE4A 3NFQA 3TNUB 2E43A 2P67A 2P7JA 5APQA 3UIAA 3VMZA 3TK1A 1MV8A 1CSBA 2BASA 1GU4A 5AW2B 5AVRB 3V4WA 2XZRA 1MFZA 1NWQA 5APYA 1G2CB 2YO3A 4KHXA 4C7NB 5AW8B 4EOTA 1H8AA 2Q5UA 5APWA 1DH3A 2C9NY 1IO4A 1T2KD 4AUWA 3HE4B 2R5BA 3VYIA 4I6MC 3VMYA 5APXA 5AW0B 5AW7B 4C46A 3VN0A 5AW6B 4LC1A 1GD2E 5AVUB 4GT1A 1GK4A 5AVXB 4DZOA 2QM7A 2H7HA 1GK6A 2Z5IA 3A3YB 2IPPA 2WWWA 5APTA 1NAFA 2WTYA 3A7OA 3NMDA 3MD0A 2N9BA 2XU6A 2E42A 2Q3IA 1HBWA 5CMZA 3HTKA 1HUCA 3P32A 2P2UA 4AQRD 4JYBA 3VTPC 1JNMA 2R3CA 3V5BA 1GTWA 5APSA 4GKGA 1CZQA 3M9HA 5AW5B 2W6AA 4RESB 1HWTC 2R32A 3NTNA 1A02J 5AVWB 4C7NA 5AVZB 5AW4B 1A02F 5AVSB 1KQLA 3P8MC 3KQGA 3HE5B 5AVVB 1S9KE 2R5DA 3HE5A 5AW1B 3M91A 3A5TA 2XV5A 2YO2A 3IR9A 3M0DA 3P7KA
chains in the Genus database with same CATH superfamily
1RQUA 5GTIH 1OVUA 5AVQB 2BEZF 2H88C 3H1LE 1KILD 1KB9I 3L73J 2ZT9C 3CLQA 3H1ID 4H44C 1SQVG 1K05A 2JWDA 2QJKB 1YITP 3A0HE 4H13D 2WVRA 2FXPA 3BCCD 2R44A 3CI9A 1L2PA 2JKVA 3RL0C 1SQVJ 3CX5I 1GMJA 1OZHA 5AW9B 1VQOP 1LP1B 1KORA 2O01H 3CCJP 1J2JB 1M1JC 1T2KC 2WPRA 3H1JJ 1YTZT 1X8YA 1LGHB 1ZP0C 2JO1A 4JYCA 2JEEA 1BCCJ 4DT0A 1LJ2A 1UIIA 3CCUP 1SQBK 3AEAC 3CPWO 1L0LK 4U3FJ 4RJTA 2ZT9B 5GTIE 2Z5HA 3Q1MA 1UIXA 3S9OA 3BASA 1HJBA 2QJKC 3OJAB 3L74G 3MTUE 3TDKA 1IC2A 3C1LA 3D71A 1NU1J 1S5LE 1JTHB 1MUUA 3EFFK 3KXDA 2WT7B 2ZXEB 1FZCB 3D6YA 1SQPD 4MN4C 3VMXA 3ABVC 1X79B 1PP9J 3JCUH 3L37A 1WRGA 1JY3P 1U7JA 2FYNC 2JJLA 1JY2O 3L4FA 1KZUB 5C39A 4AYCA 1TU3F 1W2BO 2E74B 5KAIH 1M1KQ 1FS0E 2QJPC 1BE3E 4Y99B 5BU8B 3EWKA 3IAOA 1USEA 3OA7A 4GODA 1ZRTD 2D2CD 2BEQD 2OYOA 3T97A 3RGUA 3I55P 2VRSA 3LIDA 3H1KJ 2WPQA 2KSEA 2ZT9D 4M3LA 1VQ7P 3M9QA 3HD7B 1FZGA 2O01J 2HG5D 3C9IA 4R4LA 5KLVE 1SQBJ 1M7LA 2AEJA 1K9MQ 1NTME 3GF3A 3EFGA 2H89C 3L36A 2G8YA 2M0BA 5AVTB 1FOSF 4PD4D 3HE4A 2E5TA 1KYOI 1SQPG 1VF5C 5APQA 3UIAA 4C7RA 3TF5A 1CW5A 1SQVE 2ITAA 2JP3A 1CSBA 2ZVOB 3GMAA 1RHZB 1LT1A 3FWLA 3PP5A 3L74D 3B5NA 4H0LD 5AVRB 1OIPA 5AW2B 4I7ZC 3V4WA 2YO3A 1SS1A 3CWBJ 3A0HH 1NKZB 3PJSK 4KJMA 2IFNA 4KHXA 4TLFA 3TGUE 5BU5A 4EOTA 4ZKUA 1L4AD 1RF1A 1PGJA 5APWA 2C9NY 1IO4A 1YI2P 1IFMA 3CC4P 3CXHD 2IBZI 2OYHC 4IFDK 1BDCA 2R5BA 1HJ0A 1QVFO 3BCCG 1NYHA 3VMYA 5AW0B 4RO0A 2K3RA 5AW6B 2B9BA 3AECC 3L70E 3MP7B 4N78E 4I7ZB 1SQVD 3PH0A 3H1IG 5H2FH 2OYHA 5CCGA 1GD2E 5DJTB 3S4RA 2K1AA 3GF7A 2GA1A 1OFCX 3L73D 2Z5IA 3LW5J 3IN6A 1SQVK 4W7ZA 5KAIE 1JY2P 1K73Q 2WWWA 1KILC 3A7OA 4ASVA 3NMDA 2R3SA 3CXHI 1LTJB 2E75C 2I1JA 4HKZH 3CXHE 3RK3B 1USDA 2HODB 3HUSB 1SQPJ 2OYIC 5KLVK 3E7KA 1X0TA 4H0LC 5TISH 1NTKE 1VDFA 2O1KA 5H2FE 2R3CA 1L0NG 1JNMA 2BCCE 4L76A 5APSA 2H43A 1KB9D 2M5AB 3MIWA 5AW5B 3RK2D 3WU2E 1G1IA 2R32A 3L74E 2JWAA 3NTNA 1LTIC 1BE3G 2FXMA 3B5NB 2LR2A 3BRTB 5KLVD 3CCMP 3V2QA 1NGMB 3HRNA 1A02F 2D2CB 2FFDA 1KILA 2W6JH 4NPFX 2K88A 2K9JA 2KZIA 4WVZA 2YIUC 1S9KE 1DD4A 3HD7D 3A5TA 2IBZD 1FE6A 2WZ7A 5CJ4A 1RE3A 2CPBA 5BVZA 3CC7P 3FWNA 1SFCC 1OW8A 1FDIA 2AXTE 2C0WA 1AVOA 3H1IJ 4XA4A 3HD7A 3W68A 1AFOA 1VQNP 1L0LD 1IFPA 1JEKA 2CPSA 3Q2YA 3A0BH 1M1JB 4UB6E 1ZXGA 3H1KD 1S4XA 1N7LA 2KP8A 3SFDC 1HTLC 4PD4I 1HGZA 2MKVA 2RN0A 2Y0EA 1FZAA 2IBZE 1YBKA 5CHXA 1SLQA 1KQSO 1N73C 1KILE 2QIWA 4IL6H 1N73A 3OW2O 2YMKA 1LTBC 3H1JG 2FXOA 4RKUJ 4WY4C 2LXCB 3L71J 4H44B 1XTGB 3F89A 1VF5D 1LT9C 1NTZJ 3H1HJ 1ZW0A 1W5CE 2PRRA 1Y9BA 1AV1A 1RQVA 2FYUJ 3PRJA 1EXJA 3TYYA 1VQMP 4HYTB 3T97B 3I5CA 1K04A 5KAFH 1IK7A 3AEGC 1SVFA 2QJPB 4UB8H 5TJHA 5L8RJ 3SWFA 1KN7A 1KB9H 1W2EA 2A45I 4EDFA 1VQLP 2D2CC 1MFTA 1Y47A 2IZ1A 2QEXP 4XFJA 1IFIA 1LP1A 1OW7A 4D6TJ 2BCCD 3SFEC 1S1CX 3V4QA 1LWUB 3RK2B 2WT7A 1YIJP 3FXDA 3AE1C 2H8PD 1YYCA 3KDPB 4L74A 5KTBA 1U7MA 1HF9A 3TNUA 1N86A 1FZCC 1SQXD 1IFNA 2Q1KA 1SQBG 2YXQB 1GW3A 2W83C 1AVYA 5KAFE 3CCLP 3D70A 5AW3B 3ITKA 1NTKK 1PPJD 4UB8E 1QVGO 4N78D 1EDIA 1OXZA 1NTMJ 5APVA 5KKZB 3CCEP 1E79H 4I2LC 4GOEA 4Y99C 1SQXK 5GTHH 1NU1G 4ZMDA 2Q3EA 1LWUC 2PGDA 3L74J 2HLOA 4BRYA 2P7JA 4ASWA 3CCQP 3B5ND 3ZDMA 1EDKA 3L70J 3L72D 3MUDC 1PZQA 1GU4A 1BCCD 1PP9G 1P84E 1OMIA 1RE4A 2N1TC 2N9YB 1VQ5P 1KTMA 4YTPC 3TGUJ 2B88A 2NPSA 5KLIC 1ZMEC 5AW8B 1R8EA 1R5LA 1VQ6P 1YQ4C 2OGUA 2PP6A 4H44D 1NVOA 3AE8C 1DH3A 3GLMA 1IFJA 4BXLA 3IF4A 4AUWA 1KV4A 1SQQJ 3WUUA 1NAYA 1URQB 4I6MC 2YKPA 5APXA 3G9RA 5AW7B 1KYOH 1NTZK 4O9BA 4U3FD 1BDDA 1XTCC 2Y0DA 3L72J 3L70D 2A45G 5CJ0A 1NTKJ 1Q82Q 2I1KA 2M8RA 3N4XA 2KNCA 5K5GB 3CCRP 2LXBA 2IYOA 2ZYGA 3L71E 5EFWB 4DCKA 1GK4A 2HFED 4EYYQ 4DZOA 2QM7A 2H7HA 1NO4A 3AE4C 1M56D 1LTGC 3FX0A 4U7JA 3A3YB 4CPGA 2KI7B 1AJYA 2LKMA 1KFNA 1JOCA 2GUVA 2IPPA 1NAFA 2KYVA 5APTA 3RBXA 1J1EB 1KQGB 1SQQD 4Y28J 2QA4P 2E42A 1SQXE 3E1RA 3B5NC 1H0TA 1PIXA 2KUBA 5CMZA 2RMZA 4WY4B 1BGYG 1JMMA 3P32A 3AE6C 5B66H 4JYBA 1N7SC 2WSEJ 3VTPC 3AEDC 1N7SA 3AE2C 3V5BA 5KLVJ 1YTZI 3H32B 3KHUA 1NU1E 1FZFA 3QWOC 1CZQA 2GM4A 1LTJC 3TGUG 2WSFH 2OTJP 1FU1A 2ZVNB 2W90A 4C7NA 1IK9A 1LTAC 3AE5C 2V7QH 3KZIE 3O6QA 2KZJA 1RY3A 3L75D 1KQLA 2YXRB 3P8MC 4IL6E 2AEMA 2KK7A 1Q7YQ 2P58A 5KJ7D 5AW1B 3M91A 3U1AA 1JY2N 1DEEG 3RK3D 3BATA 3VMAA 2XV5A 2YO2A 3H1IE 1NTMG 4W7YA 2JR8A 4I1LA 3H1LD 3K5BA 4LGDE 4QMAA 2A06G 3PHLA 3V2NA 4C7NB 1QLED 1VQPP 1SQBE 1FDOA 4XE5B 1GL2A 2M3BA 1L0NJ 1URQD 1EZVG 3O8ZA 1EDJA 1BSNA 4W80A 1K8AQ 1OVRA 2FFDC 2QM8A 5E79H 1ZOYC 2WPSA 3A2AA 2Y9ZA 1VQKP 4YXWH 1VL2A 3RL0g 2HR3A 3AEEC 3SSUA 2FYUG 1S9KD 3S1KA 1SP4A 3H1HG 2W27A 2HPCB 1EQ7A 1G2CA 2B87A 1M8OB 4K3AA 2KIKA 3OAKA 2IZ0A 3RK3E 3GHGA 2OYIA 4IL6X 1PGPA 4JQ0D 1T6AA 1FAVA 2G3AA 1NTKD 2XNDH 2N1TD 1LT9B 3CCVP 3MHVA 1RE4C 2N1TA 1NTZG 2QJYB 4PD4H 1AA0A 2B89A 5GTHE 3L71G 1YJNP 5APUA 2FY8A 3M0DC 3AEBC 1VF5B 1KQFB 1NOHA 4D6TD 2RH0A 3RBZA 3L35A 3CWBD 1GW4A 2XKMA 2P1JA 1KMIZ 1J1DC 3GW6A 1P84I 2KSJA 3WUVA 1X22A 5CCHA 4WY4D 3H25A 1YJ9P 3CWBG 1M90Q 1HVVA 3RK2C 2QVAA 3MUDA 2QJYC 2YNYA 4D6TG 2V7QJ 2N1TB 3G71P 1H89A 1NHLA 2OTKE 1GL2C 1JMBA 3L73E 1NH4A 1L0NE 1OWAA 1LT9A 2A45H 2E76D 3NFQA 2E43A 2IFMA 3L71D 2Q9IA 3RK3C 2ZAEB 2OARA 1NTZD 1L0LJ 3HUSC 3TK1A 2OYIB 3V6IA 3Q5PA 3VP8A 1LTJA 1J1DB 2K37A 1NTKG 2FYZA 2XZRA 4PJ0E 1G2CB 5KJ7A 2YKQA 1NWQA 2E76C 2WITA 1URQC 1AQTA 4R4MA 3QH9A 1RH5B 1BCCE 1H8AA 3Q3DA 2WSCJ 3PTZA 1NTZE 2A06E 3H1HD 1SQQK 2FYUD 1SQQE 1QL1A 1JB0J 1QL2A 4IFFA 4C46A 3VN0A 1N8RQ 2WSFJ 4WB4A 2MJZA 2KS1A 1LTTC 4PV1C 3G6EP 1YHQP 3CL3D 5B66E 1EZVD 2HPCA 1FBMA 3C8VA 1FC2C 5AVUB 3G4SP 4OH8B 2O1JA 1OVVA 2POHA 5DJUB 1MKMA 5AVXB 2A06D 2C0XA 2J58A 3A0BE 3AE7C 3H1LG 4D6TE 3I56P 1FJKA 1NTMD 4YXDC 1M57D 1LWUA 1GL2B 2WMMA 3B4SA 1JY3N 1LNQA 1WMKA 3G3ZA 2KOGA 4N3YB 2L5GB 4U3FE 1N2DC 2WTYA 2Z4EA 2N9BA 2XU6A 3RL0D 3BVHA 2FYUE 1RF1B 2J5UA 1S5LH 5CBOA 1S72P 2QE7H 1SQXJ 1NTMK 2QG4A 3L75G 1EXIA 1HUCA 3TSIA 3L72E 3WU2H 2P2UA 1PP9E 4OGQD 4AQRD 2FBWC 2NZ2A 1EZVI 1FJPA 2IX7C 1J1EC 2ZJSE 3CX5E 1Q2NA 1R5SA 3L75J 3M9HA 3VP9A 3TGUD 2W6AA 2WSCH 4RESB 3Q5SA 1HWTC 4EI2A 3SWKA 2K9YA 1RE3C 5AVZB 3IFMA 4GDOA 5CCHC 3CC2P 4NPEA 3U59A 1BGYD 1DX7A 2NPSC 2Y0CA 3CMEP 1GL2D 3KQGA 1Z56A 3JCUE 1SQQG 3V2PA 1N73B 5AVVB 4L73A 2R5DA 2FKWB 4WWIA 3FGAD 3V2RA 1ZN5A 3AE9C 3R2PA 5B5EH 4JF7A 1JM0A 2ZYAA 3IR9A 4GIFA 1DEBA 1IFDA 1H0TB 3AE3C 2YKOA 1L0LE 1GU5A 3M0AA 3B71A 3LW5H 3BCCE 1BSHA 1QEXA 3H1LJ 5KJ7C 1PL5A 4WBAA 1CI6B 1VQ9P 3L70G 3MGNA 1Q81Q 4U3FG 2KLVA 1KYOD 1CI6A 3GHGC 2HODA 3HUSA 3F5HA 3NXSA 2KNCB 1JUNA 2E75B 1N7SD 3W67A 3VOPA 5E79E 1BGYE 2XDJA 2IDBA 3USSA 1BE3J 4B86A 5AVYB 3B8EB 1PGOA 2M5AA 3KPEA 3Q5RA 1P84H 1KB9E 1PGQA 1FZEA 4H13C 1AQ5A 2KXPB 1MZ9A 3AEFC 1GZLA 4YPCA 3WMM0 1T3JA 3MZWB 4GOFA 4OVNF 1S2EA 3RL0B 2AXCA 1PP9D 1BCCG 2HYNA 4KT0J 1KD1Q 1FOSE 3GHGB 3KZIH 2OQQA 3L75E 1DIPA 3M9BA 3L72G 2NPSB 1OX3A 2Q7CA 3PLNA 1FZBA 2KLUA 4IOIH 1NU1D 2PAJA 2ZFCA 3CX5D 3H6PA 3WUTA 2WSEH 3CX5H 4ZNCA 1T8ZA 1IZNB 1JCDA 1KYOE 4DOJA 5CBNA 1H88A 4TT3H 4PV1D 1PFIA 4JBZA 1PPJG 4PJ0H 2WSSH 1SQBD 4L75A 1NU1K 2SPZA 2C9LY 1SQXG 2OYHB 4UB6H 2DW3A 1WT6A 3LIEA 2CK3H 1RF0A 2E74C 2B87B 4A7PA 3M06A 4OGQB 1HGVA 2L91A 4OWFA 5B5EE 1GDTA 2AEFA 3BCCJ 3KYQA 1SQPK 2BCCG 2NPSD 2FYUK 3SWYA 3P8CD 1OW6A 2GUSA 3JSVC 3TNUB 2P67A 4EIJA 1VQ8P 1D7MA 3HD7C 3HTKB 1EZVE 3VMZA 2E5YA 1SFCD 2J59M 1MV8A 4BWNA 2BASA 2KS1B 4LLHA 1JCCA 3O6QB 1MFZA 5CCGC 1YQ3C 4H13B 5APYA 1A02J 1X9VA 1QX8A 2JDIH 1Q86Q 1Q90D 2RKLA 1P84D 2O01N 2WPVB 4K35A 3U1CA 2Q5UA 1KC8Q 4Z1MH 2WQYC 3II6A 1T2KD 4HH2A 3HE4B 4WY4A 3P8CE 2YMYA 3H1JD 1M1JA 1LTSC 2E76B 2V4HA 2XNXA 3VYIA 5CCHD 3CCSP 4NPDA 1VQ4P 2PFXA 2NRGA 4LC1A 1L4AC 3FXEA 1EDLA 1PPJE 2O3JA 2QRXA 3H1KG 4HB1A 1EC5A 3H32A 1VPCA 2E75D 4GT1A 1N7SB 3EQ2A 1JO5A 1L0LG 4PD4E 3H1HE 4HJGH 2M3EA 2QSIA 1GK6A 1FDMA 2K9JB 4OGQC 1NKNA 2W6BA 4IFMA 2ZXXA 3N7NA 5KKZC 2FFDB 4DJGA 2IBZG 1RF0C 4PV1B 3D6ZA 1HH0A 3JC22 3MD0A 1Y8AA 2KB7P 3H1JE 2Q3IA 1SQPE 3BRVB 1L0NK 1ZLLA 5CCGD 1JTHA 1NJIQ 1FZCA 1HBWA 3E1IA 3HTKA 1BE3D 1JY3O 5KLVG 1ZV8A 2I8DA 2BCCJ 2Y9YA 1GTWA 1U57A 4GKGA 2P10A 1KILB 2UWJE 2YIUB 4ZKPA 2E74D 1L0ND 5KLIB 3CMAP 1S5LX 1RF1C 1KFMA 5AVWB 1G1JA 1ZR2A 5AW4B 2OTLP 5AVSB 1ZR4A 1L4AA 1SFCB 1E5WA 1URQA 4JPZB 3CD6P 3R4YA 1S3JA 1IJDB 4H0LB 3HE5B 2AXTH 4N6JA 1QGKB 4BRYB 2FYNB 1ZRTE 2IYPA 1T3UA 3CWBE 1BGYJ 3CXHH 3HE5A 1PV3A 5M1BA 1YJWP 1DD3A 2ZYDA 1L4AB 1SFCA 3GG2A 3L73G 3H1KE 3M0DA 5TISE 3P7KA 2Q6QA 2W8ZA
chains in the Genus database with same CATH topology
5AVQB 1KILD 3CLQA 3CI9A 1T2KC 3RL0C 5AW9B 2O01H 1J2JB 1M1JC 2WPRA 1YTZT 1X8YA 1LGHB 4JYCA 2Z4EA 2JEEA 1GU5A 1SQBK 1S9KD 1L0LK 2Z5HA 3BASA 1HJBA 3OJAB 3MTUE 1IC2A 2WT7B 1JTHB 1MUUA 1FZCB 2ZXEB 3VMXA 1X79B 3L37A 1WRGA 1JY3P 2JJLA 3L4FA 2OYHC 1JY2O 1KZUB 4AYCA 4Y99B 5BU8B 3OA7A 3T97A 2VRSA 3LIDA 2WPQA 4M3LA 3M9QA 3HD7B 1FZGA 2HG5D 3C9IA 1M7LA 1FOSF 3EFGA 5AVTB 3L36A 3HE4A 5APQA 3UIAA 4C7RA 1CSBA 3PP5A 5AVRB 5AW2B 3B5NA 3V4WA 1RF1A 2YO3A 1NKZB 4KHXA 2IFNA 5BU5A 4EOTA 4ZKUA 1L4AD 5APWA 2C9NY 1IO4A 1IFMA 4IFDK 2R5BA 3VMYA 5AW0B 5AW6B 4N78E 2OYHA 5CCGA 1GD2E 2Z5IA 1SQVK 4W7ZA 1JY2P 2WWWA 1KILC 3A7OA 3NMDA 1LTJB 2I1JA 3RK3B 2HODB 3HUSB 2OYIC 5KLVK 1VDFA 2O1KA 1JNMA 2R3CA 5APSA 2H43A 5AW5B 3MIWA 3RK2D 3NTNA 1G1IA 2R32A 4WY4C 1A02J 1LTIC 2FXMA 3B5NB 3BRTB 1A02F 2FFDA 3V2QA 1CW5A 3HRNA 1KILA 1S9KE 3HD7D 3A5TA 2WZ7A 5CJ4A 1RE3A 2CPBA 5BVZA 1SFCC 4XA4A 2C0WA 3HD7A 1AFOA 2CPSA 1M1JB 2KP8A 1N7LA 1HTLC 1HGZA 5CHXA 1FZAA 1N73C 1SLQA 1N73A 1LTBC 1XTGB 1LT9C 3TYYA 4HYTB 3I5CA 1SVFA 3SWFA 1W2EA 2A45I 1IFIA 3V4QA 1LWUB 3RK2B 2WT7A 2H8PD 1YYCA 3KDPB 5KTBA 3TNUA 1N86A 1FZCC 1IFNA 1GW3A 5AW3B 1NTKK 4N78D 1OXZA 5APVA 4I2LC 4Y99C 1SQXK 1LWUC 2HLOA 2P7JA 3B5ND 1GU4A 1RE4A 2N1TC 2NPSA 5AW8B 2PP6A 1DH3A 1IFJA 4AUWA 1URQB 4I6MC 2YKPA 5APXA 5AW7B 1NTZK 4O9BA 1XTCC 2A45G 5CJ0A 2I1KA 2M8RA 3N4XA 1GK4A 2HFED 4DZOA 2QM7A 2H7HA 1NO4A 1LTGC 3A3YB 2LKMA 1KFNA 1JOCA 2GUVA 2IPPA 1NAFA 2KYVA 5APTA 1J1EB 2E42A 3B5NC 5CMZA 4WY4B 1JMMA 3P32A 4JYBA 1N7SC 3VTPC 1FZFA 1N7SA 3V5BA 1YTZI 3H32B 2GM4A 1CZQA 1LTJC 2WSFH 1FU1A 4C7NA 1IK9A 1LTAC 1RY3A 1KQLA 3P8MC 5KJ7D 5AW1B 3M91A 3U1AA 1JY2N 3RK3D 3BATA 2XV5A 2YO2A 4W7YA 4I1LA 4LGDE 4C7NB 3V2NA 4XE5B 1GL2A 2M3BA 1URQD 3O8ZA 4W80A 2FFDC 2QM8A 2WPSA 3A2AA 1SP4A 2W27A 2HPCB 1EQ7A 1G2CA 3OAKA 3GHGA 2OYIA 1FAVA 2N1TD 1LT9B 1RE4C 2N1TA 5APUA 3M0DC 1NOHA 3L35A 1GW4A 2XKMA 2P1JA 1J1DC 5CCHA 2KSJA 4WY4D 1HVVA 3RK2C 3MUDA 2YNYA 1H89A 2N1TB 1NHLA 1GL2C 1NH4A 1OWAA 1LT9A 2A45H 3NFQA 2E43A 2IFMA 2Q9IA 3RK3C 2OARA 3HUSC 2OYIB 3TK1A 3VP8A 1LTJA 1J1DB 2XZRA 1NWQA 2FYZA 1G2CB 5KJ7A 2YKQA 2WITA 1URQC 1H8AA 1SQQK 1QL1A 1QL2A 4IFFA 4C46A 3VN0A 4WB4A 2MJZA 1LTTC 2HPCA 3CL3D 1FBMA 5AVUB 4OH8B 2O1JA 2POHA 5AVXB 2C0XA 2J58A 1FJKA 1LWUA 1GL2B 3G3ZA 1JY3N 2WTYA 4N3YB 2KOGA 2L5GB 1N2DC 2N9BA 2XU6A 3RL0D 3BVHA 1RF1B 1NTMK 1HUCA 3TSIA 2P2UA 4AQRD 1FJPA 2IX7C 1J1EC 3M9HA 3VP9A 1HWTC 2W6AA 2WSCH 4RESB 1RE3C 5AVZB 3IFMA 5CCHC 1DX7A 3U59A 2NPSC 1GL2D 3KQGA 1Z56A 1N73B 3V2PA 5AVVB 2R5DA 2FKWB 3V2RA 1ZN5A 3R2PA 4JF7A 4GIFA 3IR9A 1DEBA 1IFDA 2YKOA 3M0AA 3LW5H 5KJ7C 4WBAA 1CI6B 3MGNA 2KLVA 1CI6A 3GHGC 2HODA 3HUSA 3NXSA 1JUNA 1N7SD 3VOPA 2XDJA 4B86A 5AVYB 3B8EB 3KPEA 1FZEA 1AQ5A 1MZ9A 3WMM0 1GZLA 1T3JA 3RL0B 2HYNA 1FOSE 3GHGB 3M9BA 2NPSB 2Q7CA 1FZBA 2PAJA 2ZFCA 3H6PA 2WSEH 1T8ZA 1H88A 1JCDA 4DOJA 1PFIA 1NU1K 2C9LY 2OYHB 3LIEA 1WT6A 1RF0A 3M06A 1HGVA 1GDTA 3KYQA 1SQPK 2NPSD 2FYUK 3SWYA 3P8CD 2GUSA 3TNUB 2P67A 4EIJA 3VMZA 3HD7C 3HTKB 1SFCD 2J59M 1MV8A 2BASA 4LLHA 1JCCA 1MFZA 5CCGC 5APYA 1X9VA 3U1CA 2Q5UA 3II6A 1T2KD 4HH2A 3HE4B 4WY4A 3P8CE 2YMYA 1M1JA 1LTSC 2XNXA 5CCHD 3VYIA 4LC1A 1L4AC 3H32A 1VPCA 4GT1A 1JO5A 1N7SB 3EQ2A 1GK6A 1FDMA 1NKNA 2W6BA 4IFMA 3N7NA 2FFDB 1RF0C 1HH0A 3MD0A 2KB7P 2Q3IA 3BRVB 1L0NK 1ZLLA 5CCGD 1JTHA 1FZCA 1HBWA 3E1IA 3HTKA 1JY3O 1ZV8A 1GTWA 4GKGA 1KILB 4ZKPA 1RF1C 1KFMA 5AVWB 1G1JA 1ZR2A 5AW4B 5AVSB 1ZR4A 1L4AA 1SFCB 1E5WA 1URQA 1IJDB 3HE5B 4N6JA 1T3UA 3HE5A 1L4AB 1SFCA 3M0DA 3P7KA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0A A;  5AVQ B;  4XE5 B;  3O8Z A;  2KP8 A;  1CI6 B;  3MGN A;  2QM8 A;  2WPS A;  1CI6 A;  1SLQ A;  3A2A A;  1T2K C;  3NXS A;  5AW9 B;  1JUN A;  1SP4 A;  2W27 A;  1J2J B;  4B86 A;  2WPR A;  5AVY B;  3OAK A;  3B8E B;  1X8Y A;  4JYC A;  1GU5 A;  3TYY A;  4HYT B;  1S9K D;  3I5C A;  1GZL A;  2Z5H A;  1FAV A;  1HJB A;  3SWF A;  1FOS E;  2WT7 B;  1MUU A;  3M9B A;  2ZXE B;  2Q7C A;  3VMX A;  5APU A;  3L37 A;  2JJL A;  2ZFC A;  4AYC A;  3V4Q A;  2WT7 A;  1H88 A;  3KDP B;  1YYC A;  3TNU A;  3L35 A;  3T97 A;  2C9L Y;  2VRS A;  3LID A;  2WPQ A;  4M3L A;  3LIE A;  5AW3 B;  1OXZ A;  2YNY A;  3M06 A;  1H89 A;  5APV A;  1FOS F;  4I2L C;  5AVT B;  3L36 A;  1OWA A;  3HE4 A;  3NFQ A;  3TNU B;  2E43 A;  2P67 A;  2P7J A;  5APQ A;  3UIA A;  3VMZ A;  3TK1 A;  1MV8 A;  1CSB A;  2BAS A;  1GU4 A;  5AW2 B;  5AVR B;  3V4W A;  2XZR A;  1MFZ A;  1NWQ A;  5APY A;  1G2C B;  2YO3 A;  4KHX A;  4C7N B;  5AW8 B;  4EOT A;  1H8A A;  2Q5U A;  5APW A;  1DH3 A;  2C9N Y;  1IO4 A;  1T2K D;  4AUW A;  3HE4 B;  2R5B A;  3VYI A;  4I6M C;  3VMY A;  5APX A;  5AW0 B;  5AW7 B;  4C46 A;  3VN0 A;  5AW6 B;  4LC1 A;  1GD2 E;  5AVU B;  4GT1 A;  1GK4 A;  5AVX B;  4DZO A;  2QM7 A;  2H7H A;  1GK6 A;  2Z5I A;  3A3Y B;  2IPP A;  2WWW A;  5APT A;  1NAF A;  2WTY A;  3A7O A;  3NMD A;  3MD0 A;  2N9B A;  2XU6 A;  2E42 A;  2Q3I A;  1HBW A;  5CMZ A;  3HTK A;  1HUC A;  3P32 A;  2P2U A;  4AQR D;  4JYB A;  3VTP C;  1JNM A;  2R3C A;  3V5B A;  1GTW A;  5APS A;  4GKG A;  1CZQ A;  3M9H A;  5AW5 B;  2W6A A;  4RES B;  1HWT C;  2R32 A;  3NTN A;  1A02 J;  5AVW B;  4C7N A;  5AVZ B;  5AW4 B;  1A02 F;  5AVS B;  1KQL A;  3P8M C;  3KQG A;  3HE5 B;  5AVV B;  1S9K E;  2R5D A;  3HE5 A;  5AW1 B;  3M91 A;  3A5T A;  2XV5 A;  2YO2 A;  3IR9 A;  3M0D A;  3P7K A; 
#chains in the Genus database with same CATH topology
 1RQU A;  5GTI H;  1OVU A;  5AVQ B;  2BEZ F;  2H88 C;  3H1L E;  1KIL D;  1KB9 I;  3L73 J;  2ZT9 C;  3CLQ A;  3H1I D;  4H44 C;  1SQV G;  1K05 A;  2JWD A;  2QJK B;  1YIT P;  3A0H E;  4H13 D;  2WVR A;  2FXP A;  3BCC D;  2R44 A;  3CI9 A;  1L2P A;  2JKV A;  3RL0 C;  1SQV J;  3CX5 I;  1GMJ A;  1OZH A;  5AW9 B;  1VQO P;  1LP1 B;  1KOR A;  2O01 H;  3CCJ P;  1J2J B;  1M1J C;  1T2K C;  2WPR A;  3H1J J;  1YTZ T;  1X8Y A;  1LGH B;  1ZP0 C;  2JO1 A;  4JYC A;  2JEE A;  1BCC J;  4DT0 A;  1LJ2 A;  1UII A;  3CCU P;  1SQB K;  3AEA C;  3CPW O;  1L0L K;  4U3F J;  4RJT A;  2ZT9 B;  5GTI E;  2Z5H A;  3Q1M A;  1UIX A;  3S9O A;  3BAS A;  1HJB A;  2QJK C;  3OJA B;  3L74 G;  3MTU E;  3TDK A;  1IC2 A;  3C1L A;  3D71 A;  1NU1 J;  1S5L E;  1JTH B;  1MUU A;  3EFF K;  3KXD A;  2WT7 B;  2ZXE B;  1FZC B;  3D6Y A;  1SQP D;  4MN4 C;  3VMX A;  3ABV C;  1X79 B;  1PP9 J;  3JCU H;  3L37 A;  1WRG A;  1JY3 P;  1U7J A;  2FYN C;  2JJL A;  1JY2 O;  3L4F A;  1KZU B;  5C39 A;  4AYC A;  1TU3 F;  1W2B O;  2E74 B;  5KAI H;  1M1K Q;  1FS0 E;  2QJP C;  1BE3 E;  4Y99 B;  5BU8 B;  3EWK A;  3IAO A;  1USE A;  3OA7 A;  4GOD A;  1ZRT D;  2D2C D;  2BEQ D;  2OYO A;  3T97 A;  3RGU A;  3I55 P;  2VRS A;  3LID A;  3H1K J;  2WPQ A;  2KSE A;  2ZT9 D;  4M3L A;  1VQ7 P;  3M9Q A;  3HD7 B;  1FZG A;  2O01 J;  2HG5 D;  3C9I A;  4R4L A;  5KLV E;  1SQB J;  1M7L A;  2AEJ A;  1K9M Q;  1NTM E;  3GF3 A;  3EFG A;  2H89 C;  3L36 A;  2G8Y A;  2M0B A;  5AVT B;  1FOS F;  4PD4 D;  3HE4 A;  2E5T A;  1KYO I;  1SQP G;  1VF5 C;  5APQ A;  3UIA A;  4C7R A;  3TF5 A;  1CW5 A;  1SQV E;  2ITA A;  2JP3 A;  1CSB A;  2ZVO B;  3GMA A;  1RHZ B;  1LT1 A;  3FWL A;  3PP5 A;  3L74 D;  3B5N A;  4H0L D;  5AVR B;  1OIP A;  5AW2 B;  4I7Z C;  3V4W A;  2YO3 A;  1SS1 A;  3CWB J;  3A0H H;  1NKZ B;  3PJS K;  4KJM A;  2IFN A;  4KHX A;  4TLF A;  3TGU E;  5BU5 A;  4EOT A;  4ZKU A;  1L4A D;  1RF1 A;  1PGJ A;  5APW A;  2C9N Y;  1IO4 A;  1YI2 P;  1IFM A;  3CC4 P;  3CXH D;  2IBZ I;  2OYH C;  4IFD K;  1BDC A;  2R5B A;  1HJ0 A;  1QVF O;  3BCC G;  1NYH A;  3VMY A;  5AW0 B;  4RO0 A;  2K3R A;  5AW6 B;  2B9B A;  3AEC C;  3L70 E;  3MP7 B;  4N78 E;  4I7Z B;  1SQV D;  3PH0 A;  3H1I G;  5H2F H;  2OYH A;  5CCG A;  1GD2 E;  5DJT B;  3S4R A;  2K1A A;  3GF7 A;  2GA1 A;  1OFC X;  3L73 D;  2Z5I A;  3LW5 J;  3IN6 A;  1SQV K;  4W7Z A;  5KAI E;  1JY2 P;  1K73 Q;  2WWW A;  1KIL C;  3A7O A;  4ASV A;  3NMD A;  2R3S A;  3CXH I;  1LTJ B;  2E75 C;  2I1J A;  4HKZ H;  3CXH E;  3RK3 B;  1USD A;  2HOD B;  3HUS B;  1SQP J;  2OYI C;  5KLV K;  3E7K A;  1X0T A;  4H0L C;  5TIS H;  1NTK E;  1VDF A;  2O1K A;  5H2F E;  2R3C A;  1L0N G;  1JNM A;  2BCC E;  4L76 A;  5APS A;  2H43 A;  1KB9 D;  2M5A B;  3MIW A;  5AW5 B;  3RK2 D;  3WU2 E;  1G1I A;  2R32 A;  3L74 E;  2JWA A;  3NTN A;  1LTI C;  1BE3 G;  2FXM A;  3B5N B;  2LR2 A;  3BRT B;  5KLV D;  3CCM P;  3V2Q A;  1NGM B;  3HRN A;  1A02 F;  2D2C B;  2FFD A;  1KIL A;  2W6J H;  4NPF X;  2K88 A;  2K9J A;  2KZI A;  4WVZ A;  2YIU C;  1S9K E;  1DD4 A;  3HD7 D;  3A5T A;  2IBZ D;  1FE6 A;  2WZ7 A;  5CJ4 A;  1RE3 A;  2CPB A;  5BVZ A;  3CC7 P;  3FWN A;  1SFC C;  1OW8 A;  1FDI A;  2AXT E;  2C0W A;  1AVO A;  3H1I J;  4XA4 A;  3HD7 A;  3W68 A;  1AFO A;  1VQN P;  1L0L D;  1IFP A;  1JEK A;  2CPS A;  3Q2Y A;  3A0B H;  1M1J B;  4UB6 E;  1ZXG A;  3H1K D;  1S4X A;  1N7L A;  2KP8 A;  3SFD C;  1HTL C;  4PD4 I;  1HGZ A;  2MKV A;  2RN0 A;  2Y0E A;  1FZA A;  2IBZ E;  1YBK A;  5CHX A;  1SLQ A;  1KQS O;  1N73 C;  1KIL E;  2QIW A;  4IL6 H;  1N73 A;  3OW2 O;  2YMK A;  1LTB C;  3H1J G;  2FXO A;  4RKU J;  4WY4 C;  2LXC B;  3L71 J;  4H44 B;  1XTG B;  3F89 A;  1VF5 D;  1LT9 C;  1NTZ J;  3H1H J;  1ZW0 A;  1W5C E;  2PRR A;  1Y9B A;  1AV1 A;  1RQV A;  2FYU J;  3PRJ A;  1EXJ A;  3TYY A;  1VQM P;  4HYT B;  3T97 B;  3I5C A;  1K04 A;  5KAF H;  1IK7 A;  3AEG C;  1SVF A;  2QJP B;  4UB8 H;  5TJH A;  5L8R J;  3SWF A;  1KN7 A;  1KB9 H;  1W2E A;  2A45 I;  4EDF A;  1VQL P;  2D2C C;  1MFT A;  1Y47 A;  2IZ1 A;  2QEX P;  4XFJ A;  1IFI A;  1LP1 A;  1OW7 A;  4D6T J;  2BCC D;  3SFE C;  1S1C X;  3V4Q A;  1LWU B;  3RK2 B;  2WT7 A;  1YIJ P;  3FXD A;  3AE1 C;  2H8P D;  1YYC A;  3KDP B;  4L74 A;  5KTB A;  1U7M A;  1HF9 A;  3TNU A;  1N86 A;  1FZC C;  1SQX D;  1IFN A;  2Q1K A;  1SQB G;  2YXQ B;  1GW3 A;  2W83 C;  1AVY A;  5KAF E;  3CCL P;  3D70 A;  5AW3 B;  3ITK A;  1NTK K;  1PPJ D;  4UB8 E;  1QVG O;  4N78 D;  1EDI A;  1OXZ A;  1NTM J;  5APV A;  5KKZ B;  3CCE P;  1E79 H;  4I2L C;  4GOE A;  4Y99 C;  1SQX K;  5GTH H;  1NU1 G;  4ZMD A;  2Q3E A;  1LWU C;  2PGD A;  3L74 J;  2HLO A;  4BRY A;  2P7J A;  4ASW A;  3CCQ P;  3B5N D;  3ZDM A;  1EDK A;  3L70 J;  3L72 D;  3MUD C;  1PZQ A;  1GU4 A;  1BCC D;  1PP9 G;  1P84 E;  1OMI A;  1RE4 A;  2N1T C;  2N9Y B;  1VQ5 P;  1KTM A;  4YTP C;  3TGU J;  2B88 A;  2NPS A;  5KLI C;  1ZME C;  5AW8 B;  1R8E A;  1R5L A;  1VQ6 P;  1YQ4 C;  2OGU A;  2PP6 A;  4H44 D;  1NVO A;  3AE8 C;  1DH3 A;  3GLM A;  1IFJ A;  4BXL A;  3IF4 A;  4AUW A;  1KV4 A;  1SQQ J;  3WUU A;  1NAY A;  1URQ B;  4I6M C;  2YKP A;  5APX A;  3G9R A;  5AW7 B;  1KYO H;  1NTZ K;  4O9B A;  4U3F D;  1BDD A;  1XTC C;  2Y0D A;  3L72 J;  3L70 D;  2A45 G;  5CJ0 A;  1NTK J;  1Q82 Q;  2I1K A;  2M8R A;  3N4X A;  2KNC A;  5K5G B;  3CCR P;  2LXB A;  2IYO A;  2ZYG A;  3L71 E;  5EFW B;  4DCK A;  1GK4 A;  2HFE D;  4EYY Q;  4DZO A;  2QM7 A;  2H7H A;  1NO4 A;  3AE4 C;  1M56 D;  1LTG C;  3FX0 A;  4U7J A;  3A3Y B;  4CPG A;  2KI7 B;  1AJY A;  2LKM A;  1KFN A;  1JOC A;  2GUV A;  2IPP A;  1NAF A;  2KYV A;  5APT A;  3RBX A;  1J1E B;  1KQG B;  1SQQ D;  4Y28 J;  2QA4 P;  2E42 A;  1SQX E;  3E1R A;  3B5N C;  1H0T A;  1PIX A;  2KUB A;  5CMZ A;  2RMZ A;  4WY4 B;  1BGY G;  1JMM A;  3P32 A;  3AE6 C;  5B66 H;  4JYB A;  1N7S C;  2WSE J;  3VTP C;  3AED C;  1N7S A;  3AE2 C;  3V5B A;  5KLV J;  1YTZ I;  3H32 B;  3KHU A;  1NU1 E;  1FZF A;  3QWO C;  1CZQ A;  2GM4 A;  1LTJ C;  3TGU G;  2WSF H;  2OTJ P;  1FU1 A;  2ZVN B;  2W90 A;  4C7N A;  1IK9 A;  1LTA C;  3AE5 C;  2V7Q H;  3KZI E;  3O6Q A;  2KZJ A;  1RY3 A;  3L75 D;  1KQL A;  2YXR B;  3P8M C;  4IL6 E;  2AEM A;  2KK7 A;  1Q7Y Q;  2P58 A;  5KJ7 D;  5AW1 B;  3M91 A;  3U1A A;  1JY2 N;  1DEE G;  3RK3 D;  3BAT A;  3VMA A;  2XV5 A;  2YO2 A;  3H1I E;  1NTM G;  4W7Y A;  2JR8 A;  4I1L A;  3H1L D;  3K5B A;  4LGD E;  4QMA A;  2A06 G;  3PHL A;  3V2N A;  4C7N B;  1QLE D;  1VQP P;  1SQB E;  1FDO A;  4XE5 B;  1GL2 A;  2M3B A;  1L0N J;  1URQ D;  1EZV G;  3O8Z A;  1EDJ A;  1BSN A;  4W80 A;  1K8A Q;  1OVR A;  2FFD C;  2QM8 A;  5E79 H;  1ZOY C;  2WPS A;  3A2A A;  2Y9Z A;  1VQK P;  4YXW H;  1VL2 A;  3RL0 g;  2HR3 A;  3AEE C;  3SSU A;  2FYU G;  1S9K D;  3S1K A;  1SP4 A;  3H1H G;  2W27 A;  2HPC B;  1EQ7 A;  1G2C A;  2B87 A;  1M8O B;  4K3A A;  2KIK A;  3OAK A;  2IZ0 A;  3RK3 E;  3GHG A;  2OYI A;  4IL6 X;  1PGP A;  4JQ0 D;  1T6A A;  1FAV A;  2G3A A;  1NTK D;  2XND H;  2N1T D;  1LT9 B;  3CCV P;  3MHV A;  1RE4 C;  2N1T A;  1NTZ G;  2QJY B;  4PD4 H;  1AA0 A;  2B89 A;  5GTH E;  3L71 G;  1YJN P;  5APU A;  2FY8 A;  3M0D C;  3AEB C;  1VF5 B;  1KQF B;  1NOH A;  4D6T D;  2RH0 A;  3RBZ A;  3L35 A;  3CWB D;  1GW4 A;  2XKM A;  2P1J A;  1KMI Z;  1J1D C;  3GW6 A;  1P84 I;  2KSJ A;  3WUV A;  1X22 A;  5CCH A;  4WY4 D;  3H25 A;  1YJ9 P;  3CWB G;  1M90 Q;  1HVV A;  3RK2 C;  2QVA A;  3MUD A;  2QJY C;  2YNY A;  4D6T G;  2V7Q J;  2N1T B;  3G71 P;  1H89 A;  1NHL A;  2OTK E;  1GL2 C;  1JMB A;  3L73 E;  1NH4 A;  1L0N E;  1OWA A;  1LT9 A;  2A45 H;  2E76 D;  3NFQ A;  2E43 A;  2IFM A;  3L71 D;  2Q9I A;  3RK3 C;  2ZAE B;  2OAR A;  1NTZ D;  1L0L J;  3HUS C;  3TK1 A;  2OYI B;  3V6I A;  3Q5P A;  3VP8 A;  1LTJ A;  1J1D B;  2K37 A;  1NTK G;  2FYZ A;  2XZR A;  4PJ0 E;  1G2C B;  5KJ7 A;  2YKQ A;  1NWQ A;  2E76 C;  2WIT A;  1URQ C;  1AQT A;  4R4M A;  3QH9 A;  1RH5 B;  1BCC E;  1H8A A;  3Q3D A;  2WSC J;  3PTZ A;  1NTZ E;  2A06 E;  3H1H D;  1SQQ K;  2FYU D;  1SQQ E;  1QL1 A;  1JB0 J;  1QL2 A;  4IFF A;  4C46 A;  3VN0 A;  1N8R Q;  2WSF J;  4WB4 A;  2MJZ A;  2KS1 A;  1LTT C;  4PV1 C;  3G6E P;  1YHQ P;  3CL3 D;  5B66 E;  1EZV D;  2HPC A;  1FBM A;  3C8V A;  1FC2 C;  5AVU B;  3G4S P;  4OH8 B;  2O1J A;  1OVV A;  2POH A;  5DJU B;  1MKM A;  5AVX B;  2A06 D;  2C0X A;  2J58 A;  3A0B E;  3AE7 C;  3H1L G;  4D6T E;  3I56 P;  1FJK A;  1NTM D;  4YXD C;  1M57 D;  1LWU A;  1GL2 B;  2WMM A;  3B4S A;  1JY3 N;  1LNQ A;  1WMK A;  3G3Z A;  2KOG A;  4N3Y B;  2L5G B;  4U3F E;  1N2D C;  2WTY A;  2Z4E A;  2N9B A;  2XU6 A;  3RL0 D;  3BVH A;  2FYU E;  1RF1 B;  2J5U A;  1S5L H;  5CBO A;  1S72 P;  2QE7 H;  1SQX J;  1NTM K;  2QG4 A;  3L75 G;  1EXI A;  1HUC A;  3TSI A;  3L72 E;  3WU2 H;  2P2U A;  1PP9 E;  4OGQ D;  4AQR D;  2FBW C;  2NZ2 A;  1EZV I;  1FJP A;  2IX7 C;  1J1E C;  2ZJS E;  3CX5 E;  1Q2N A;  1R5S A;  3L75 J;  3M9H A;  3VP9 A;  3TGU D;  2W6A A;  2WSC H;  4RES B;  3Q5S A;  1HWT C;  4EI2 A;  3SWK A;  2K9Y A;  1RE3 C;  5AVZ B;  3IFM A;  4GDO A;  5CCH C;  3CC2 P;  4NPE A;  3U59 A;  1BGY D;  1DX7 A;  2NPS C;  2Y0C A;  3CME P;  1GL2 D;  3KQG A;  1Z56 A;  3JCU E;  1SQQ G;  3V2P A;  1N73 B;  5AVV B;  4L73 A;  2R5D A;  2FKW B;  4WWI A;  3FGA D;  3V2R A;  1ZN5 A;  3AE9 C;  3R2P A;  5B5E H;  4JF7 A;  1JM0 A;  2ZYA A;  3IR9 A;  4GIF A;  1DEB A;  1IFD A;  1H0T B;  3AE3 C;  2YKO A;  1L0L E;  1GU5 A;  3M0A A;  3B71 A;  3LW5 H;  3BCC E;  1BSH A;  1QEX A;  3H1L J;  5KJ7 C;  1PL5 A;  4WBA A;  1CI6 B;  1VQ9 P;  3L70 G;  3MGN A;  1Q81 Q;  4U3F G;  2KLV A;  1KYO D;  1CI6 A;  3GHG C;  2HOD A;  3HUS A;  3F5H A;  3NXS A;  2KNC B;  1JUN A;  2E75 B;  1N7S D;  3W67 A;  3VOP A;  5E79 E;  1BGY E;  2XDJ A;  2IDB A;  3USS A;  1BE3 J;  4B86 A;  5AVY B;  3B8E B;  1PGO A;  2M5A A;  3KPE A;  3Q5R A;  1P84 H;  1KB9 E;  1PGQ A;  1FZE A;  4H13 C;  1AQ5 A;  2KXP B;  1MZ9 A;  3AEF C;  1GZL A;  4YPC A;  3WMM 0;  1T3J A;  3MZW B;  4GOF A;  4OVN F;  1S2E A;  3RL0 B;  2AXC A;  1PP9 D;  1BCC G;  2HYN A;  4KT0 J;  1KD1 Q;  1FOS E;  3GHG B;  3KZI H;  2OQQ A;  3L75 E;  1DIP A;  3M9B A;  3L72 G;  2NPS B;  1OX3 A;  2Q7C A;  3PLN A;  1FZB A;  2KLU A;  4IOI H;  1NU1 D;  2PAJ A;  2ZFC A;  3CX5 D;  3H6P A;  3WUT A;  2WSE H;  3CX5 H;  4ZNC A;  1T8Z A;  1IZN B;  1JCD A;  1KYO E;  4DOJ A;  5CBN A;  1H88 A;  4TT3 H;  4PV1 D;  1PFI A;  4JBZ A;  1PPJ G;  4PJ0 H;  2WSS H;  1SQB D;  4L75 A;  1NU1 K;  2SPZ A;  2C9L Y;  1SQX G;  2OYH B;  4UB6 H;  2DW3 A;  1WT6 A;  3LIE A;  2CK3 H;  1RF0 A;  2E74 C;  2B87 B;  4A7P A;  3M06 A;  4OGQ B;  1HGV A;  2L91 A;  4OWF A;  5B5E E;  1GDT A;  2AEF A;  3BCC J;  3KYQ A;  1SQP K;  2BCC G;  2NPS D;  2FYU K;  3SWY A;  3P8C D;  1OW6 A;  2GUS A;  3JSV C;  3TNU B;  2P67 A;  4EIJ A;  1VQ8 P;  1D7M A;  3HD7 C;  3HTK B;  1EZV E;  3VMZ A;  2E5Y A;  1SFC D;  2J59 M;  1MV8 A;  4BWN A;  2BAS A;  2KS1 B;  4LLH A;  1JCC A;  3O6Q B;  1MFZ A;  5CCG C;  1YQ3 C;  4H13 B;  5APY A;  1A02 J;  1X9V A;  1QX8 A;  2JDI H;  1Q86 Q;  1Q90 D;  2RKL A;  1P84 D;  2O01 N;  2WPV B;  4K35 A;  3U1C A;  2Q5U A;  1KC8 Q;  4Z1M H;  2WQY C;  3II6 A;  1T2K D;  4HH2 A;  3HE4 B;  4WY4 A;  3P8C E;  2YMY A;  3H1J D;  1M1J A;  1LTS C;  2E76 B;  2V4H A;  2XNX A;  3VYI A;  5CCH D;  3CCS P;  4NPD A;  1VQ4 P;  2PFX A;  2NRG A;  4LC1 A;  1L4A C;  3FXE A;  1EDL A;  1PPJ E;  2O3J A;  2QRX A;  3H1K G;  4HB1 A;  1EC5 A;  3H32 A;  1VPC A;  2E75 D;  4GT1 A;  1N7S B;  3EQ2 A;  1JO5 A;  1L0L G;  4PD4 E;  3H1H E;  4HJG H;  2M3E A;  2QSI A;  1GK6 A;  1FDM A;  2K9J B;  4OGQ C;  1NKN A;  2W6B A;  4IFM A;  2ZXX A;  3N7N A;  5KKZ C;  2FFD B;  4DJG A;  2IBZ G;  1RF0 C;  4PV1 B;  3D6Z A;  1HH0 A;  3JC2 2;  3MD0 A;  1Y8A A;  2KB7 P;  3H1J E;  2Q3I A;  1SQP E;  3BRV B;  1L0N K;  1ZLL A;  5CCG D;  1JTH A;  1NJI Q;  1FZC A;  1HBW A;  3E1I A;  3HTK A;  1BE3 D;  1JY3 O;  5KLV G;  1ZV8 A;  2I8D A;  2BCC J;  2Y9Y A;  1GTW A;  1U57 A;  4GKG A;  2P10 A;  1KIL B;  2UWJ E;  2YIU B;  4ZKP A;  2E74 D;  1L0N D;  5KLI B;  3CMA P;  1S5L X;  1RF1 C;  1KFM A;  5AVW B;  1G1J A;  1ZR2 A;  5AW4 B;  2OTL P;  5AVS B;  1ZR4 A;  1L4A A;  1SFC B;  1E5W A;  1URQ A;  4JPZ B;  3CD6 P;  3R4Y A;  1S3J A;  1IJD B;  4H0L B;  3HE5 B;  2AXT H;  4N6J A;  1QGK B;  4BRY B;  2FYN B;  1ZRT E;  2IYP A;  1T3U A;  3CWB E;  1BGY J;  3CXH H;  3HE5 A;  1PV3 A;  5M1B A;  1YJW P;  1DD3 A;  2ZYD A;  1L4A B;  1SFC A;  3GG2 A;  3L73 G;  3H1K E;  3M0D A;  5TIS E;  3P7K A;  2Q6Q A;  2W8Z A; 
#chains in the Genus database with same CATH homology
 5AVQ B;  1KIL D;  3CLQ A;  3CI9 A;  1T2K C;  3RL0 C;  5AW9 B;  2O01 H;  1J2J B;  1M1J C;  2WPR A;  1YTZ T;  1X8Y A;  1LGH B;  4JYC A;  2Z4E A;  2JEE A;  1GU5 A;  1SQB K;  1S9K D;  1L0L K;  2Z5H A;  3BAS A;  1HJB A;  3OJA B;  3MTU E;  1IC2 A;  2WT7 B;  1JTH B;  1MUU A;  1FZC B;  2ZXE B;  3VMX A;  1X79 B;  3L37 A;  1WRG A;  1JY3 P;  2JJL A;  3L4F A;  2OYH C;  1JY2 O;  1KZU B;  4AYC A;  4Y99 B;  5BU8 B;  3OA7 A;  3T97 A;  2VRS A;  3LID A;  2WPQ A;  4M3L A;  3M9Q A;  3HD7 B;  1FZG A;  2HG5 D;  3C9I A;  1M7L A;  1FOS F;  3EFG A;  5AVT B;  3L36 A;  3HE4 A;  5APQ A;  3UIA A;  4C7R A;  1CSB A;  3PP5 A;  5AVR B;  5AW2 B;  3B5N A;  3V4W A;  1RF1 A;  2YO3 A;  1NKZ B;  4KHX A;  2IFN A;  5BU5 A;  4EOT A;  4ZKU A;  1L4A D;  5APW A;  2C9N Y;  1IO4 A;  1IFM A;  4IFD K;  2R5B A;  3VMY A;  5AW0 B;  5AW6 B;  4N78 E;  2OYH A;  5CCG A;  1GD2 E;  2Z5I A;  1SQV K;  4W7Z A;  1JY2 P;  2WWW A;  1KIL C;  3A7O A;  3NMD A;  1LTJ B;  2I1J A;  3RK3 B;  2HOD B;  3HUS B;  2OYI C;  5KLV K;  1VDF A;  2O1K A;  1JNM A;  2R3C A;  5APS A;  2H43 A;  5AW5 B;  3MIW A;  3RK2 D;  3NTN A;  1G1I A;  2R32 A;  4WY4 C;  1A02 J;  1LTI C;  2FXM A;  3B5N B;  3BRT B;  1A02 F;  2FFD A;  3V2Q A;  1CW5 A;  3HRN A;  1KIL A;  1S9K E;  3HD7 D;  3A5T A;  2WZ7 A;  5CJ4 A;  1RE3 A;  2CPB A;  5BVZ A;  1SFC C;  4XA4 A;  2C0W A;  3HD7 A;  1AFO A;  2CPS A;  1M1J B;  2KP8 A;  1N7L A;  1HTL C;  1HGZ A;  5CHX A;  1FZA A;  1N73 C;  1SLQ A;  1N73 A;  1LTB C;  1XTG B;  1LT9 C;  3TYY A;  4HYT B;  3I5C A;  1SVF A;  3SWF A;  1W2E A;  2A45 I;  1IFI A;  3V4Q A;  1LWU B;  3RK2 B;  2WT7 A;  2H8P D;  1YYC A;  3KDP B;  5KTB A;  3TNU A;  1N86 A;  1FZC C;  1IFN A;  1GW3 A;  5AW3 B;  1NTK K;  4N78 D;  1OXZ A;  5APV A;  4I2L C;  4Y99 C;  1SQX K;  1LWU C;  2HLO A;  2P7J A;  3B5N D;  1GU4 A;  1RE4 A;  2N1T C;  2NPS A;  5AW8 B;  2PP6 A;  1DH3 A;  1IFJ A;  4AUW A;  1URQ B;  4I6M C;  2YKP A;  5APX A;  5AW7 B;  1NTZ K;  4O9B A;  1XTC C;  2A45 G;  5CJ0 A;  2I1K A;  2M8R A;  3N4X A;  1GK4 A;  2HFE D;  4DZO A;  2QM7 A;  2H7H A;  1NO4 A;  1LTG C;  3A3Y B;  2LKM A;  1KFN A;  1JOC A;  2GUV A;  2IPP A;  1NAF A;  2KYV A;  5APT A;  1J1E B;  2E42 A;  3B5N C;  5CMZ A;  4WY4 B;  1JMM A;  3P32 A;  4JYB A;  1N7S C;  3VTP C;  1FZF A;  1N7S A;  3V5B A;  1YTZ I;  3H32 B;  2GM4 A;  1CZQ A;  1LTJ C;  2WSF H;  1FU1 A;  4C7N A;  1IK9 A;  1LTA C;  1RY3 A;  1KQL A;  3P8M C;  5KJ7 D;  5AW1 B;  3M91 A;  3U1A A;  1JY2 N;  3RK3 D;  3BAT A;  2XV5 A;  2YO2 A;  4W7Y A;  4I1L A;  4LGD E;  4C7N B;  3V2N A;  4XE5 B;  1GL2 A;  2M3B A;  1URQ D;  3O8Z A;  4W80 A;  2FFD C;  2QM8 A;  2WPS A;  3A2A A;  1SP4 A;  2W27 A;  2HPC B;  1EQ7 A;  1G2C A;  3OAK A;  3GHG A;  2OYI A;  1FAV A;  2N1T D;  1LT9 B;  1RE4 C;  2N1T A;  5APU A;  3M0D C;  1NOH A;  3L35 A;  1GW4 A;  2XKM A;  2P1J A;  1J1D C;  5CCH A;  2KSJ A;  4WY4 D;  1HVV A;  3RK2 C;  3MUD A;  2YNY A;  1H89 A;  2N1T B;  1NHL A;  1GL2 C;  1NH4 A;  1OWA A;  1LT9 A;  2A45 H;  3NFQ A;  2E43 A;  2IFM A;  2Q9I A;  3RK3 C;  2OAR A;  3HUS C;  2OYI B;  3TK1 A;  3VP8 A;  1LTJ A;  1J1D B;  2XZR A;  1NWQ A;  2FYZ A;  1G2C B;  5KJ7 A;  2YKQ A;  2WIT A;  1URQ C;  1H8A A;  1SQQ K;  1QL1 A;  1QL2 A;  4IFF A;  4C46 A;  3VN0 A;  4WB4 A;  2MJZ A;  1LTT C;  2HPC A;  3CL3 D;  1FBM A;  5AVU B;  4OH8 B;  2O1J A;  2POH A;  5AVX B;  2C0X A;  2J58 A;  1FJK A;  1LWU A;  1GL2 B;  3G3Z A;  1JY3 N;  2WTY A;  4N3Y B;  2KOG A;  2L5G B;  1N2D C;  2N9B A;  2XU6 A;  3RL0 D;  3BVH A;  1RF1 B;  1NTM K;  1HUC A;  3TSI A;  2P2U A;  4AQR D;  1FJP A;  2IX7 C;  1J1E C;  3M9H A;  3VP9 A;  1HWT C;  2W6A A;  2WSC H;  4RES B;  1RE3 C;  5AVZ B;  3IFM A;  5CCH C;  1DX7 A;  3U59 A;  2NPS C;  1GL2 D;  3KQG A;  1Z56 A;  1N73 B;  3V2P A;  5AVV B;  2R5D A;  2FKW B;  3V2R A;  1ZN5 A;  3R2P A;  4JF7 A;  4GIF A;  3IR9 A;  1DEB A;  1IFD A;  2YKO A;  3M0A A;  3LW5 H;  5KJ7 C;  4WBA A;  1CI6 B;  3MGN A;  2KLV A;  1CI6 A;  3GHG C;  2HOD A;  3HUS A;  3NXS A;  1JUN A;  1N7S D;  3VOP A;  2XDJ A;  4B86 A;  5AVY B;  3B8E B;  3KPE A;  1FZE A;  1AQ5 A;  1MZ9 A;  3WMM 0;  1GZL A;  1T3J A;  3RL0 B;  2HYN A;  1FOS E;  3GHG B;  3M9B A;  2NPS B;  2Q7C A;  1FZB A;  2PAJ A;  2ZFC A;  3H6P A;  2WSE H;  1T8Z A;  1H88 A;  1JCD A;  4DOJ A;  1PFI A;  1NU1 K;  2C9L Y;  2OYH B;  3LIE A;  1WT6 A;  1RF0 A;  3M06 A;  1HGV A;  1GDT A;  3KYQ A;  1SQP K;  2NPS D;  2FYU K;  3SWY A;  3P8C D;  2GUS A;  3TNU B;  2P67 A;  4EIJ A;  3VMZ A;  3HD7 C;  3HTK B;  1SFC D;  2J59 M;  1MV8 A;  2BAS A;  4LLH A;  1JCC A;  1MFZ A;  5CCG C;  5APY A;  1X9V A;  3U1C A;  2Q5U A;  3II6 A;  1T2K D;  4HH2 A;  3HE4 B;  4WY4 A;  3P8C E;  2YMY A;  1M1J A;  1LTS C;  2XNX A;  5CCH D;  3VYI A;  4LC1 A;  1L4A C;  3H32 A;  1VPC A;  4GT1 A;  1JO5 A;  1N7S B;  3EQ2 A;  1GK6 A;  1FDM A;  1NKN A;  2W6B A;  4IFM A;  3N7N A;  2FFD B;  1RF0 C;  1HH0 A;  3MD0 A;  2KB7 P;  2Q3I A;  3BRV B;  1L0N K;  1ZLL A;  5CCG D;  1JTH A;  1FZC A;  1HBW A;  3E1I A;  3HTK A;  1JY3 O;  1ZV8 A;  1GTW A;  4GKG A;  1KIL B;  4ZKP A;  1RF1 C;  1KFM A;  5AVW B;  1G1J A;  1ZR2 A;  5AW4 B;  5AVS B;  1ZR4 A;  1L4A A;  1SFC B;  1E5W A;  1URQ A;  1IJD B;  3HE5 B;  4N6J A;  1T3U A;  3HE5 A;  1L4A B;  1SFC A;  3M0D A;  3P7K A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...