1PPJG

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
molecule tags Oxidoreductase
total genus 20
structure length 73
sequence length 73
chains with identical sequence T
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ppjG00
3H1JG 1PPJG 1NTZG 2IBZG 1KB9H 1SQXG 1NTKG 2A06G 3L71G 4D6TG 3H1IG 1EZVG 3H1LG 1SQVG 1SQPG 1BCCG 1NTMG 5KLVG 1L0LG 1BGYG 3L70G 1BE3G 1SQBG 2FYUG 3L74G 1KYOH 3BCCG 3L75G 1PP9G 2BCCG 4PD4H 3L73G 1P84H 3CWBG 3H1HG 3H1KG 3CXHH 4U3FG 3TGUG 3L72G 3CX5H 1NU1G 1L0NG 1SQQG
chains in the Genus database with same CATH superfamily
1EQ7A 1IC2A 1S5LH 2E42A 3V2NA 5KLVG 3U1CA 1M8OB 1DD3A 5AVZB 2OTKE 3PTZA 1HH0A 1SQPD 2AXCA 3TGUG 2AEJA 1SS1A 3H1JG 4NPFX 1YJWP 3FWLA 1JMMA 3CWBE 1VQPP 1YITP 2P7JA 4U3FD 3V2QA 2Q9IA 1MKMA 2CPSA 2XKMA 3CC7P 3JCUE 3L71J 1USDA 1URQD 2JWDA 1SQVD 2ZYDA 2KZJA 1SFCD 3LIEA 5CCGC 3GMAA 3BCCE 3H1KJ 3JCUH 2R3CA 3B5NC 1IFPA 1WMKA 3Q2YA 1VQNP 2JP3A 3AE2C 1HBWA 5B66H 1LT9C 2A06D 1GW3A 2HODA 3SWKA 3H1ID 1VPCA 2OYHA 1S5LX 3CLQA 1R5LA 5APXA 4HH2A 2ZAEB 3V2RA 3CCLP 4UB6E 5E79E 2N1TD 3L71G 3KPEA 3CX5I 1KILA 2K9JB 3E7KA 3B5NA 1PIXA 1K9MQ 1N8RQ 3RBZA 1L2PA 3BATA 1AFOA 3H1KG 2KNCA 4UB6H 5E79H 2O01J 3CC2P 1LT9A 1FZFA 1NTMK 4KJMA 1KV4A 1CI6B 1L4AD 3RL0g 1X79B 2BCCD 5CMZA 1ZN5A 1OW8A 2QG4A 1NU1E 3WMM0 1PPJD 2WPQA 1IJDB 1QVGO 1SP4A 3V4QA 1PZQA 5AW6B 1GL2B 2XU6A 1M57D 5AVWB 1FS0E 3H1HD 3AE5C 4I7ZC 5AW3B 3CCMP 1G2CB 2P67A 1W2BO 2QJYB 3JC22 4WY4B 1BCCJ 2FYZA 5AVYB 2FXOA 2RMZA 3SFEC 1P84D 2KS1B 1KB9H 2Z5HA 1LTSC 1VQLP 5AW2B 3TGUE 1NAFA 2H43A 3VP8A 3H1JE 1LJ2A 2WZ7A 2YKQA 1RF1C 4H0LB 3EFFK 1SQPK 1SQBJ 2ZFCA 3L70D 3Q5RA 3OAKA 2W27A 1PP9D 4QMAA 3I55P 1BCCG 1ZLLA 3O8ZA 1LGHB 1SQQJ 2WPVB 1RE3A 5AW7B 2HYNA 1SQVK 4WB4A 1SVFA 2V7QJ 5AVUB 1FZCA 3R2PA 3TNUB 2Q7CA 3MIWA 3HUSA 3L72J 1MUUA 1SQBG 4K35A 5BU8B 1KORA 2ZT9B 1Q2NA 2C0WA 3L71E 3HD7B 3AECC 1URQC 4PD4D 3M0DC 3T97B 1SFCC 2UWJE 1SQQG 4BRYB 1GL2D 1OW6A 1J2JB 3HE4A 1VQOP 3H1KE 2E76C 1X8YA 5GTIE 1NTKJ 1LTJB 1OFCX 3SSUA 5M1BA 4OGQD 2FKWB 2K88A 3PHLA 2OYIC 3L72G 1HJBA 3HTKB 3CCQP 4WY4D 4RESB 1YHQP 2ZJSE 2N1TC 2E75C 1H89A 1LP1A 5DJTB 4GOEA 5H2FE 1OWAA 1RHZB 1EZVD 3GF7A 1NVOA 1LWUA 3CMEP 1HTLC 4H0LD 2QA4P 1NTKG 2OYIA 1RH5B 2R5DA 3M91A 5L8RJ 4U3FJ 3S4RA 2Y9YA 1J1EC 4I6MC 1YJNP 3L36A 1VF5D 1QGKB 1M1JA 1FZEA 5KKZB 3QWOC 1EC5A 4I1LA 4EDFA 3NTNA 1KILE 3EWKA 2KZIA 1AQTA 2YMKA 5KJ7A 3PP5A 2P1JA 1M1KQ 4DJGA 3H1IJ 4U3FG 1BCCE 5AW9B 1BE3J 3C8VA 2ZT9D 2M3EA 1P84I 1HVVA 1PGPA 2IFMA 5APWA 5CJ0A 1HGVA 2E5TA 2GUVA 3A7OA 5APQA 2FFDB 3P8CD 1YTZT 1SQBE 2BCCJ 3G71P 1ZOYC 2P10A 4LLHA 1S2EA 1IFJA 1ZW0A 3H1IG 3MP7B 3F89A 1BE3G 1NTZD 1SQQE 3TDKA 1A02F 3BRVB 1GU5A 2KIKA 3V2PA 4C7NB 5K5GB 4Y28J 4R4LA 2KSJA 2Y0EA 1Q7YQ 5CCHD 1QL1A 4ZMDA 3L72E 2BCCG 1SQXD 4D6TJ 3Q5SA 3P32A 2V7QH 1KYOE 2FYUJ 3WU2H 1NKNA 4PD4I 1KN7A 1PPJG 3D6ZA 4IFFA 1DD4A 1GL2C 4KT0J 2JDIH 2Y0DA 4W7YA 1KYOH 1JY3P 3LW5H 3TYYA 2WSSH 2NPSB 1NTKE 2IBZE 2JR8A 1MV8A 3H6PA 3VMAA 2RKLA 3L75D 5AVXB 2QJYC 4WY4C 4D6TG 1H8AA 1KQFB 3CX5D 3O6QA 5CBNA 4N6JA 1KB9I 2FYUG 3QH9A 3OW2O 2WPRA 2K1AA 1HUCA 2WVRA 1SLQA 1VQ7P 1VQ6P 3Q3DA 3EQ2A 2HPCA 2QE7H 4OVNF 3G6EP 2W8ZA 4H0LC 5KLIB 4U3FE 2E74D 4A7PA 3V5BA 1SFCB 2HFED 2Q3IA 2BASA 1HJ0A 3P7KA 2PFXA 1S72P 2GUSA 2MJZA 3MD0A 4BWNA 2AEFA 4L75A 1VL2A 2IPPA 2QEXP 1L0ND 2W6AA 3H1IE 1L0LD 3A5TA 1ZR4A 2N1TB 1BE3E 2ZT9C 1HWTC 3M06A 1Y8AA 3HD7C 3RK2B 2JWAA 4HJGH 2M5AA 4N78E 4GIFA 1NTZK 1YIJP 1JY2P 1L4AB 3TNUA 2H89C 2LXCB 1JO5A 1LTJC 1FJKA 2FYNB 2BCCE 3PH0A 4MN4C 4N3YB 3HD7A 3T97A 3B4SA 1PPJE 1CZQA 1Y47A 1SQXK 4BRYA 2ZVOB 2NZ2A 1KZUB 1PL5A 1IZNB 2PRRA 1EZVG 3H32A 3CCEP 1GZLA 3TK1A 1LTAC 2JKVA 3BASA 5AW4B 3HTKA 4ASWA 4CPGA 2A45H 3WUUA 1RQVA 3SWYA 4D6TE 4BXLA 1CSBA 4C46A 2G8YA 2FYUE 1BGYE 3G4SP 3CPWO 1G1JA 1FOSE 1KMIZ 3P8MC 1WT6A 5KKZC 3FXDA 3GLMA 3ABVC 3NMDA 4EI2A 3E1RA 1EDJA 3GF3A 1ZV8A 3KDPB 1S1CX 3CXHE 3WUTA 5CCGA 2WPSA 3M9QA 3RK2D 3C1LA 1NH4A 3RL0D 3CXHH 2ZXXA 1EDKA 3BVHA 2I1KA 3L73J 3L74E 3CCVP 4GKGA 2FFDC 4TLFA 2Q1KA 4DT0A 3N7NA 3AE3C 1K73Q 2AXTE 1N86A 4IFMA 2Y0CA 3EFGA 4JYBA 1ZRTD 1L0NK 5KAFE 2GM4A 2WSCJ 2Q6QA 3M9HA 1L0LK 1MZ9A 3ZDMA 4Y99C 2AXTH 2VRSA 1N7SD 2KI7B 1Y9BA 4HKZH 4OGQB 3L73G 3PLNA 5KLVE 2R44A 1BSNA 3CWBD 2ZYAA 1VQKP 1N73C 2V4HA 1NAYA 1VDFA 3PRJA 5TISE 1IO4A 1VQMP 4C7NA 4RO0A 1GDTA 1PGQA 1EZVE 2YIUB 3A0HE 3VMYA 3V6IA 1IFMA 2NPSC 3IFMA 5TISH 2WSFJ 1N2DC 2W6BA 1VF5B 2QM8A 4ZKPA 3A0HH 1JTHB 2GA1A 3F5HA 1JEKA 1NTMJ 1GK6A 3CCUP 1OXZA 1VQ9P 1WRGA 4ASVA 1AV1A 1RF1A 4XE5B 4WBAA 1QL2A 1L0NJ 3CMAP 1ZR2A 5C39A 5AW5B 5KLIC 1HGZA 2KOGA 1VQ4P 4GODA 3B71A 1BSHA 4IL6E 1H88A 1RF0C 1NTMG 4DZOA 4H13D 3VTPC 4IL6H 4JQ0D 2M3BA 1FZBA 3AEAC 1S3JA 5AW0B 3HE5B 1PGOA 1TU3F 1L0NG 2IX7C 1URQA 3RK3B 5GTHE 1JY3N 5GTIH 3S1KA 3M0DA 1SFCA 1LTGC 1KB9D 4YXWH 1RF0A 3RK2C 1SQPJ 3L35A 1ZXGA 5BVZA 4PV1D 2WT7B 1RE4C 3L73E 1JMBA 1JUNA 1L4AC 2HLOA 1FJPA 3TGUD 4IOIH 1QEXA 5H2FH 5AW8B 2FYNC 1AVYA 4WWIA 2N1TA 2O01H 1SQVJ 1PV3A 2KXPB 1M56D 4GOFA 2MKVA 3IF4A 4HB1A 2R5BA 1Z56A 1SQPG 3AE6C 2OQQA 4JF7A 1L4AA 2WSCH 2Y9ZA 5APTA 3AE8C 5AVVB 4EYYQ 3KYQA 4KHXA 1S9KD 4OH8B 2KNCB 1IFDA 3D6YA 2QJKC 1SQVG 2FXPA 3CX5E 2KP8A 2I8DA 2IFNA 2RN0A 2IDBA 1U57A 4GT1A 1LTBC 3L71D 3Q5PA 1MFZA 2B88A 3KZIE 1AJYA 2D2CD 1K04A 3MZWB 2B87B 2JJLA 3CCJP 2A06G 2E74B 1YQ4C 3KZIH 3K5BA 2YXQB 3RK3D 1JY2N 1E5WA 3AE4C 1GMJA 1T6AA 4Y99B 2QVAA 2R32A 1NTME 1NHLA 2WSFH 1Q82Q 3JSVC 3H1HJ 1JY3O 3CI9A 1EXIA 2XDJA 3B8EB 3KXDA 3OJAB 1GD2E 3CCRP 4HYTB 1L0NE 1T8ZA 3AE1C 1YJ9P 1N73B 3AEFC 3G9RA 1M7LA 2E43A 2K9JA 1GW4A 2HR3A 2OYOA 2ZYGA 3LIDA 3W67A 2KLUA 3SFDC 2WWWA 4DOJA 3H1HG 2N9BA 1CI6A 2FXMA 3L70J 4OGQC 2LR2A 1J1DB 2LXBA 1KILD 1DIPA 2PAJA 1PP9J 3B5ND 3M0AA 4PJ0E 3MUDC 1R5SA 1FZCB 1KQGB 3NXSA 1XTGB 1DX7A 1IFNA 4L74A 3D71A 2P2UA 3HUSB 1GL2A 2WTYA 1ZMEC 1FDMA 1BCCD 2IYPA 1NJIQ 1SQPE 1E79H 4UB8E 1G2CA 3E1IA 2YIUC 2WMMA 3L70G 4WY4A 1GU4A 2P58A 3A3YB 1PP9G 4UB8H 1VF5C 2KS1A 4YPCA 1SQVE 1X9VA 2WQYC 4IFDK 2W83C 1T3UA 1SQBD 4H44D 1IK9A 3A2AA 2YMYA 2QJPB 4ZKUA 1NO4A 1G1IA 1JY2O 1OMIA 1AA0A 1SQQD 1HF9A 2QIWA 2FBWC 2A06E 1LP1B 2O3JA 1OVUA 1U7JA 2KLVA 3MHVA 3SWFA 4C7RA 4O9BA 1LWUB 5B5EE 4W7ZA 3KQGA 2XV5A 1FOSF 3RL0B 3MTUE 1JCDA 4ZNCA 1KYOD 1DEBA 1M1JB 5B5EH 4YTPC 1NKZB 2G3AA 1K8AQ 2QRXA 1S5LE 2JO1A 3RK3C 5CJ4A 2IBZD 3CL3D 1N7SB 2O01N 3S9OA 2O1JA 2SPZA 1RQUA 1RY3A 2BEQD 3CD6P 3H1HE 1LTJA 5APVA 5CCHC 3HE5A 2QJKB 2KK7A 2OARA 3WUVA 1P84E 5AVSB 4JPZB 4EIJA 2KYVA 4NPEA 2Z5IA 2OYHC 1P84H 1KFNA 2WT7A 5CCHA 3N4XA 5B66E 2M0BA 1IFIA 4OWFA 3L70E 1JOCA 3VMXA 1KILC 2E76D 1PP9E 1FE6A 1YI2P 4AQRD 1NTZJ 3C9IA 5BU5A 3M9BA 3H1LD 1FDIA 1KFMA 1BE3D 1FZGA 5AVQB 1SQBK 2YO2A 1YTZI 1XTCC 2E75D 2FY8A 2ZVNB 3TF5A 1SQXJ 4N78D 2E74C 1JCCA 1SQQK 1X22A 4B86A 3KHUA 2OTLP 1KQLA 4PD4E 5KJ7D 1NTZG 4H44C 3GHGB 3AEBC 4H13B 5KAFH 2FFDA 1NWQA 2LKMA 4PD4H 3O6QB 1CW5A 2B87A 3RBXA 4NPDA 1NGMB 2W6JH 3L75J 2R3SA 1EDLA 2DW3A 3L4FA 1SQXG 1OIPA 3UIAA 3U1AA 2HPCB 1OW7A 1D7MA 3L37A 1NYHA 1KB9E 1GTWA 1UIXA 4YXDC 2WITA 1W5CE 4D6TD 1NTKK 4PV1B 1KYOI 2RH0A 1OX3A 2XNXA 4RJTA 2FYUD 1BGYD 4M3LA 3BCCD 5KTBA 2WSEJ 1OVRA 1RE3C 1H0TB 1J1DC 2KSEA 1N7LA 3L75G 1USEA 2HG5D 1N73A 2AEMA 1EXJA 4I2LC 2IBZI 2YXRB 1OZHA 1FZCC 4JYCA 2PP6A 3HUSC 3CXHD 3RGUA 2IZ0A 2NPSA 1KD1Q 1LT1A 4Z1MH 2H88C 1FU1A 1L0LJ 1QX8A 1GK4A 2M5AB 1KQSO 2J58A 3L74D 1S9KE 4TT3H 3VMZA 3AE9C 1YBKA 1JM0A 4EOTA 1YYCA 4K3AA 2QJPC 1NU1D 2D2CB 4WVZA 1K05A 2POHA 3LW5J 3W68A 3CC4P 1QLED 3R4YA 5AVTB 3P8CE 3IAOA 4XA4A 3AE7C 2Z4EA 5APSA 1YQ3C 2C0XA 4L73A 1L0LG 2YKPA 4LC1A 3RK3E 3H32B 2K37A 1MFTA 1ZP0C 1NTZE 1LWUC 3I5CA 5GTHH 5KLVD 3G3ZA 3RL0C 1AQ5A 3USSA 2B89A 1A02J 2B9BA 2E5YA 2J5UA 3CCSP 1M1JC 3II6A 3H1JD 3A0BE 3VP9A 1FAVA 1SQXE 4XFJA 5APUA 2HODB 1Q90D 2IBZG 5KJ7C 3I56P 1FDOA 2OYHB 3A0BH 1N7SC 3AEGC 2KUBA 1RE4A 4IL6X 3FGAD 1KILB 4U7JA 3B5NB 2K9YA 3BRTB 1T3JA 3IR9A 2A45I 2FYUK 3L75E 1DH3A 1LT9B 3V4WA 5EFWB 1LTTC 4RKUJ 1N7SA 1FC2C 2W90A 1KC8Q 3H1LJ 3NFQA 2QM7A 2NRGA 2QSIA 4LGDE 3CX5H 3HD7D 2JEEA 5AW1B 3D70A 3H1KD 2J59M 1T2KD 3VN0A 2K3RA 4JBZA 2I1JA 1FZAA 1X0TA 5KAIE 4H44B 2WSEH 2CPBA 5DJUB 3CXHI 3VYIA 3H1LG 2XZRA 5KAIH 2CK3H 1AVOA 1NU1K 2ITAA 3IN6A 4I7ZB 1R8EA 1L0LE 2H7HA 3CWBJ 3L73D 2BEZF 1IK7A 3Q1MA 2N9YB 3WU2E 2L5GB 3OA7A 3TSIA 3VOPA 1BDCA 1M90Q 1PFIA 5CHXA 1JNMA 3GHGC 4H13C 3GG2A 5CCGD 1BGYJ 2IYOA 5AVRB 3BCCJ 5KLVK 1UIIA 1KTMA 1RF1B 2A45G 2YO3A 1W2EA 1JB0J 3CWBG 2YKOA 2C9LY 4PJ0H 2O1KA 1VQ5P 3GHGA 5APYA 2C9NY 4PV1C 1S4XA 1Q86Q 4L76A 1BGYG 3FX0A 1U7MA 3BCCG 3AEDC 3HE4B 3U59A 3GW6A 1BDDA 3MUDA 2OGUA 1EZVI 2IZ1A 1LTIC 3L74J 1DEEG 2Q3EA 2XNDH 1URQB 1NU1J 2H8PD 3PJSK 4GDOA 1NTMD 2E76B 1H0TA 4R4MA 3ITKA 1FBMA 1JTHA 4W80A 4AYCA 2PGDA 3MGNA 1QVFO 5CBOA 3HRNA 3L74G 1NOHA 3L72D 2OYIB 2ZXEB 5KLVJ 2L91A 3H1LE 2YNYA 3H25A 2Q5UA 2E75B 1EDIA 2D2CC 3FWNA 1NU1G 1LNQA 4AUWA 2KB7P 3TGUJ 1OVVA 3AEEC 3FXEA 1T2KC 2OTJP 3H1JJ 4DCKA 1PGJA 1Q81Q 2M8RA 1NTKD 1ZRTE 2NPSD 1J1EB 1VQ8P 5TJHA
chains in the Genus database with same CATH topology
3H1JG 1PPJG 1NTZG 2IBZG 1KB9H 1SQXG 1NTKG 2A06G 3L71G 4D6TG 3H1IG 1EZVG 3H1LG 1SQVG 1SQPG 1BCCG 1NTMG 5KLVG 1L0LG 1BGYG 3L70G 1BE3G 1SQBG 2FYUG 3L74G 1KYOH 3BCCG 3L75G 1PP9G 2BCCG 4PD4H 3L73G 1P84H 3CWBG 3H1HG 3H1KG 3CXHH 4U3FG 3TGUG 3L72G 3CX5H 1NU1G 1L0NG 1SQQG
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3H1J G;  1PPJ G;  1NTZ G;  2IBZ G;  1KB9 H;  1SQX G;  1NTK G;  2A06 G;  3L71 G;  4D6T G;  3H1I G;  1EZV G;  3H1L G;  1SQV G;  1SQP G;  1BCC G;  1NTM G;  5KLV G;  1L0L G;  1BGY G;  3L70 G;  1BE3 G;  1SQB G;  2FYU G;  3L74 G;  1KYO H;  3BCC G;  3L75 G;  1PP9 G;  2BCC G;  4PD4 H;  3L73 G;  1P84 H;  3CWB G;  3H1H G;  3H1K G;  3CXH H;  4U3F G;  3TGU G;  3L72 G;  3CX5 H;  1NU1 G;  1L0N G;  1SQQ G; 
#chains in the Genus database with same CATH topology
 1EQ7 A;  1IC2 A;  1S5L H;  2E42 A;  3V2N A;  5KLV G;  3U1C A;  1M8O B;  1DD3 A;  5AVZ B;  2OTK E;  3PTZ A;  1HH0 A;  1SQP D;  2AXC A;  3TGU G;  2AEJ A;  1SS1 A;  3H1J G;  4NPF X;  1YJW P;  3FWL A;  1JMM A;  3CWB E;  1VQP P;  1YIT P;  2P7J A;  4U3F D;  3V2Q A;  2Q9I A;  1MKM A;  2CPS A;  2XKM A;  3CC7 P;  3JCU E;  3L71 J;  1USD A;  1URQ D;  2JWD A;  1SQV D;  2ZYD A;  2KZJ A;  1SFC D;  3LIE A;  5CCG C;  3GMA A;  3BCC E;  3H1K J;  3JCU H;  2R3C A;  3B5N C;  1IFP A;  1WMK A;  3Q2Y A;  1VQN P;  2JP3 A;  3AE2 C;  1HBW A;  5B66 H;  1LT9 C;  2A06 D;  1GW3 A;  2HOD A;  3SWK A;  3H1I D;  1VPC A;  2OYH A;  1S5L X;  3CLQ A;  1R5L A;  5APX A;  4HH2 A;  2ZAE B;  3V2R A;  3CCL P;  4UB6 E;  5E79 E;  2N1T D;  3L71 G;  3KPE A;  3CX5 I;  1KIL A;  2K9J B;  3E7K A;  3B5N A;  1PIX A;  1K9M Q;  1N8R Q;  3RBZ A;  1L2P A;  3BAT A;  1AFO A;  3H1K G;  2KNC A;  4UB6 H;  5E79 H;  2O01 J;  3CC2 P;  1LT9 A;  1FZF A;  1NTM K;  4KJM A;  1KV4 A;  1CI6 B;  1L4A D;  3RL0 g;  1X79 B;  2BCC D;  5CMZ A;  1ZN5 A;  1OW8 A;  2QG4 A;  1NU1 E;  3WMM 0;  1PPJ D;  2WPQ A;  1IJD B;  1QVG O;  1SP4 A;  3V4Q A;  1PZQ A;  5AW6 B;  1GL2 B;  2XU6 A;  1M57 D;  5AVW B;  1FS0 E;  3H1H D;  3AE5 C;  4I7Z C;  5AW3 B;  3CCM P;  1G2C B;  2P67 A;  1W2B O;  2QJY B;  3JC2 2;  4WY4 B;  1BCC J;  2FYZ A;  5AVY B;  2FXO A;  2RMZ A;  3SFE C;  1P84 D;  2KS1 B;  1KB9 H;  2Z5H A;  1LTS C;  1VQL P;  5AW2 B;  3TGU E;  1NAF A;  2H43 A;  3VP8 A;  3H1J E;  1LJ2 A;  2WZ7 A;  2YKQ A;  1RF1 C;  4H0L B;  3EFF K;  1SQP K;  1SQB J;  2ZFC A;  3L70 D;  3Q5R A;  3OAK A;  2W27 A;  1PP9 D;  4QMA A;  3I55 P;  1BCC G;  1ZLL A;  3O8Z A;  1LGH B;  1SQQ J;  2WPV B;  1RE3 A;  5AW7 B;  2HYN A;  1SQV K;  4WB4 A;  1SVF A;  2V7Q J;  5AVU B;  1FZC A;  3R2P A;  3TNU B;  2Q7C A;  3MIW A;  3HUS A;  3L72 J;  1MUU A;  1SQB G;  4K35 A;  5BU8 B;  1KOR A;  2ZT9 B;  1Q2N A;  2C0W A;  3L71 E;  3HD7 B;  3AEC C;  1URQ C;  4PD4 D;  3M0D C;  3T97 B;  1SFC C;  2UWJ E;  1SQQ G;  4BRY B;  1GL2 D;  1OW6 A;  1J2J B;  3HE4 A;  1VQO P;  3H1K E;  2E76 C;  1X8Y A;  5GTI E;  1NTK J;  1LTJ B;  1OFC X;  3SSU A;  5M1B A;  4OGQ D;  2FKW B;  2K88 A;  3PHL A;  2OYI C;  3L72 G;  1HJB A;  3HTK B;  3CCQ P;  4WY4 D;  4RES B;  1YHQ P;  2ZJS E;  2N1T C;  2E75 C;  1H89 A;  1LP1 A;  5DJT B;  4GOE A;  5H2F E;  1OWA A;  1RHZ B;  1EZV D;  3GF7 A;  1NVO A;  1LWU A;  3CME P;  1HTL C;  4H0L D;  2QA4 P;  1NTK G;  2OYI A;  1RH5 B;  2R5D A;  3M91 A;  5L8R J;  4U3F J;  3S4R A;  2Y9Y A;  1J1E C;  4I6M C;  1YJN P;  3L36 A;  1VF5 D;  1QGK B;  1M1J A;  1FZE A;  5KKZ B;  3QWO C;  1EC5 A;  4I1L A;  4EDF A;  3NTN A;  1KIL E;  3EWK A;  2KZI A;  1AQT A;  2YMK A;  5KJ7 A;  3PP5 A;  2P1J A;  1M1K Q;  4DJG A;  3H1I J;  4U3F G;  1BCC E;  5AW9 B;  1BE3 J;  3C8V A;  2ZT9 D;  2M3E A;  1P84 I;  1HVV A;  1PGP A;  2IFM A;  5APW A;  5CJ0 A;  1HGV A;  2E5T A;  2GUV A;  3A7O A;  5APQ A;  2FFD B;  3P8C D;  1YTZ T;  1SQB E;  2BCC J;  3G71 P;  1ZOY C;  2P10 A;  4LLH A;  1S2E A;  1IFJ A;  1ZW0 A;  3H1I G;  3MP7 B;  3F89 A;  1BE3 G;  1NTZ D;  1SQQ E;  3TDK A;  1A02 F;  3BRV B;  1GU5 A;  2KIK A;  3V2P A;  4C7N B;  5K5G B;  4Y28 J;  4R4L A;  2KSJ A;  2Y0E A;  1Q7Y Q;  5CCH D;  1QL1 A;  4ZMD A;  3L72 E;  2BCC G;  1SQX D;  4D6T J;  3Q5S A;  3P32 A;  2V7Q H;  1KYO E;  2FYU J;  3WU2 H;  1NKN A;  4PD4 I;  1KN7 A;  1PPJ G;  3D6Z A;  4IFF A;  1DD4 A;  1GL2 C;  4KT0 J;  2JDI H;  2Y0D A;  4W7Y A;  1KYO H;  1JY3 P;  3LW5 H;  3TYY A;  2WSS H;  2NPS B;  1NTK E;  2IBZ E;  2JR8 A;  1MV8 A;  3H6P A;  3VMA A;  2RKL A;  3L75 D;  5AVX B;  2QJY C;  4WY4 C;  4D6T G;  1H8A A;  1KQF B;  3CX5 D;  3O6Q A;  5CBN A;  4N6J A;  1KB9 I;  2FYU G;  3QH9 A;  3OW2 O;  2WPR A;  2K1A A;  1HUC A;  2WVR A;  1SLQ A;  1VQ7 P;  1VQ6 P;  3Q3D A;  3EQ2 A;  2HPC A;  2QE7 H;  4OVN F;  3G6E P;  2W8Z A;  4H0L C;  5KLI B;  4U3F E;  2E74 D;  4A7P A;  3V5B A;  1SFC B;  2HFE D;  2Q3I A;  2BAS A;  1HJ0 A;  3P7K A;  2PFX A;  1S72 P;  2GUS A;  2MJZ A;  3MD0 A;  4BWN A;  2AEF A;  4L75 A;  1VL2 A;  2IPP A;  2QEX P;  1L0N D;  2W6A A;  3H1I E;  1L0L D;  3A5T A;  1ZR4 A;  2N1T B;  1BE3 E;  2ZT9 C;  1HWT C;  3M06 A;  1Y8A A;  3HD7 C;  3RK2 B;  2JWA A;  4HJG H;  2M5A A;  4N78 E;  4GIF A;  1NTZ K;  1YIJ P;  1JY2 P;  1L4A B;  3TNU A;  2H89 C;  2LXC B;  1JO5 A;  1LTJ C;  1FJK A;  2FYN B;  2BCC E;  3PH0 A;  4MN4 C;  4N3Y B;  3HD7 A;  3T97 A;  3B4S A;  1PPJ E;  1CZQ A;  1Y47 A;  1SQX K;  4BRY A;  2ZVO B;  2NZ2 A;  1KZU B;  1PL5 A;  1IZN B;  2PRR A;  1EZV G;  3H32 A;  3CCE P;  1GZL A;  3TK1 A;  1LTA C;  2JKV A;  3BAS A;  5AW4 B;  3HTK A;  4ASW A;  4CPG A;  2A45 H;  3WUU A;  1RQV A;  3SWY A;  4D6T E;  4BXL A;  1CSB A;  4C46 A;  2G8Y A;  2FYU E;  1BGY E;  3G4S P;  3CPW O;  1G1J A;  1FOS E;  1KMI Z;  3P8M C;  1WT6 A;  5KKZ C;  3FXD A;  3GLM A;  3ABV C;  3NMD A;  4EI2 A;  3E1R A;  1EDJ A;  3GF3 A;  1ZV8 A;  3KDP B;  1S1C X;  3CXH E;  3WUT A;  5CCG A;  2WPS A;  3M9Q A;  3RK2 D;  3C1L A;  1NH4 A;  3RL0 D;  3CXH H;  2ZXX A;  1EDK A;  3BVH A;  2I1K A;  3L73 J;  3L74 E;  3CCV P;  4GKG A;  2FFD C;  4TLF A;  2Q1K A;  4DT0 A;  3N7N A;  3AE3 C;  1K73 Q;  2AXT E;  1N86 A;  4IFM A;  2Y0C A;  3EFG A;  4JYB A;  1ZRT D;  1L0N K;  5KAF E;  2GM4 A;  2WSC J;  2Q6Q A;  3M9H A;  1L0L K;  1MZ9 A;  3ZDM A;  4Y99 C;  2AXT H;  2VRS A;  1N7S D;  2KI7 B;  1Y9B A;  4HKZ H;  4OGQ B;  3L73 G;  3PLN A;  5KLV E;  2R44 A;  1BSN A;  3CWB D;  2ZYA A;  1VQK P;  1N73 C;  2V4H A;  1NAY A;  1VDF A;  3PRJ A;  5TIS E;  1IO4 A;  1VQM P;  4C7N A;  4RO0 A;  1GDT A;  1PGQ A;  1EZV E;  2YIU B;  3A0H E;  3VMY A;  3V6I A;  1IFM A;  2NPS C;  3IFM A;  5TIS H;  2WSF J;  1N2D C;  2W6B A;  1VF5 B;  2QM8 A;  4ZKP A;  3A0H H;  1JTH B;  2GA1 A;  3F5H A;  1JEK A;  1NTM J;  1GK6 A;  3CCU P;  1OXZ A;  1VQ9 P;  1WRG A;  4ASV A;  1AV1 A;  1RF1 A;  4XE5 B;  4WBA A;  1QL2 A;  1L0N J;  3CMA P;  1ZR2 A;  5C39 A;  5AW5 B;  5KLI C;  1HGZ A;  2KOG A;  1VQ4 P;  4GOD A;  3B71 A;  1BSH A;  4IL6 E;  1H88 A;  1RF0 C;  1NTM G;  4DZO A;  4H13 D;  3VTP C;  4IL6 H;  4JQ0 D;  2M3B A;  1FZB A;  3AEA C;  1S3J A;  5AW0 B;  3HE5 B;  1PGO A;  1TU3 F;  1L0N G;  2IX7 C;  1URQ A;  3RK3 B;  5GTH E;  1JY3 N;  5GTI H;  3S1K A;  3M0D A;  1SFC A;  1LTG C;  1KB9 D;  4YXW H;  1RF0 A;  3RK2 C;  1SQP J;  3L35 A;  1ZXG A;  5BVZ A;  4PV1 D;  2WT7 B;  1RE4 C;  3L73 E;  1JMB A;  1JUN A;  1L4A C;  2HLO A;  1FJP A;  3TGU D;  4IOI H;  1QEX A;  5H2F H;  5AW8 B;  2FYN C;  1AVY A;  4WWI A;  2N1T A;  2O01 H;  1SQV J;  1PV3 A;  2KXP B;  1M56 D;  4GOF A;  2MKV A;  3IF4 A;  4HB1 A;  2R5B A;  1Z56 A;  1SQP G;  3AE6 C;  2OQQ A;  4JF7 A;  1L4A A;  2WSC H;  2Y9Z A;  5APT A;  3AE8 C;  5AVV B;  4EYY Q;  3KYQ A;  4KHX A;  1S9K D;  4OH8 B;  2KNC B;  1IFD A;  3D6Y A;  2QJK C;  1SQV G;  2FXP A;  3CX5 E;  2KP8 A;  2I8D A;  2IFN A;  2RN0 A;  2IDB A;  1U57 A;  4GT1 A;  1LTB C;  3L71 D;  3Q5P A;  1MFZ A;  2B88 A;  3KZI E;  1AJY A;  2D2C D;  1K04 A;  3MZW B;  2B87 B;  2JJL A;  3CCJ P;  2A06 G;  2E74 B;  1YQ4 C;  3KZI H;  3K5B A;  2YXQ B;  3RK3 D;  1JY2 N;  1E5W A;  3AE4 C;  1GMJ A;  1T6A A;  4Y99 B;  2QVA A;  2R32 A;  1NTM E;  1NHL A;  2WSF H;  1Q82 Q;  3JSV C;  3H1H J;  1JY3 O;  3CI9 A;  1EXI A;  2XDJ A;  3B8E B;  3KXD A;  3OJA B;  1GD2 E;  3CCR P;  4HYT B;  1L0N E;  1T8Z A;  3AE1 C;  1YJ9 P;  1N73 B;  3AEF C;  3G9R A;  1M7L A;  2E43 A;  2K9J A;  1GW4 A;  2HR3 A;  2OYO A;  2ZYG A;  3LID A;  3W67 A;  2KLU A;  3SFD C;  2WWW A;  4DOJ A;  3H1H G;  2N9B A;  1CI6 A;  2FXM A;  3L70 J;  4OGQ C;  2LR2 A;  1J1D B;  2LXB A;  1KIL D;  1DIP A;  2PAJ A;  1PP9 J;  3B5N D;  3M0A A;  4PJ0 E;  3MUD C;  1R5S A;  1FZC B;  1KQG B;  3NXS A;  1XTG B;  1DX7 A;  1IFN A;  4L74 A;  3D71 A;  2P2U A;  3HUS B;  1GL2 A;  2WTY A;  1ZME C;  1FDM A;  1BCC D;  2IYP A;  1NJI Q;  1SQP E;  1E79 H;  4UB8 E;  1G2C A;  3E1I A;  2YIU C;  2WMM A;  3L70 G;  4WY4 A;  1GU4 A;  2P58 A;  3A3Y B;  1PP9 G;  4UB8 H;  1VF5 C;  2KS1 A;  4YPC A;  1SQV E;  1X9V A;  2WQY C;  4IFD K;  2W83 C;  1T3U A;  1SQB D;  4H44 D;  1IK9 A;  3A2A A;  2YMY A;  2QJP B;  4ZKU A;  1NO4 A;  1G1I A;  1JY2 O;  1OMI A;  1AA0 A;  1SQQ D;  1HF9 A;  2QIW A;  2FBW C;  2A06 E;  1LP1 B;  2O3J A;  1OVU A;  1U7J A;  2KLV A;  3MHV A;  3SWF A;  4C7R A;  4O9B A;  1LWU B;  5B5E E;  4W7Z A;  3KQG A;  2XV5 A;  1FOS F;  3RL0 B;  3MTU E;  1JCD A;  4ZNC A;  1KYO D;  1DEB A;  1M1J B;  5B5E H;  4YTP C;  1NKZ B;  2G3A A;  1K8A Q;  2QRX A;  1S5L E;  2JO1 A;  3RK3 C;  5CJ4 A;  2IBZ D;  3CL3 D;  1N7S B;  2O01 N;  3S9O A;  2O1J A;  2SPZ A;  1RQU A;  1RY3 A;  2BEQ D;  3CD6 P;  3H1H E;  1LTJ A;  5APV A;  5CCH C;  3HE5 A;  2QJK B;  2KK7 A;  2OAR A;  3WUV A;  1P84 E;  5AVS B;  4JPZ B;  4EIJ A;  2KYV A;  4NPE A;  2Z5I A;  2OYH C;  1P84 H;  1KFN A;  2WT7 A;  5CCH A;  3N4X A;  5B66 E;  2M0B A;  1IFI A;  4OWF A;  3L70 E;  1JOC A;  3VMX A;  1KIL C;  2E76 D;  1PP9 E;  1FE6 A;  1YI2 P;  4AQR D;  1NTZ J;  3C9I A;  5BU5 A;  3M9B A;  3H1L D;  1FDI A;  1KFM A;  1BE3 D;  1FZG A;  5AVQ B;  1SQB K;  2YO2 A;  1YTZ I;  1XTC C;  2E75 D;  2FY8 A;  2ZVN B;  3TF5 A;  1SQX J;  4N78 D;  2E74 C;  1JCC A;  1SQQ K;  1X22 A;  4B86 A;  3KHU A;  2OTL P;  1KQL A;  4PD4 E;  5KJ7 D;  1NTZ G;  4H44 C;  3GHG B;  3AEB C;  4H13 B;  5KAF H;  2FFD A;  1NWQ A;  2LKM A;  4PD4 H;  3O6Q B;  1CW5 A;  2B87 A;  3RBX A;  4NPD A;  1NGM B;  2W6J H;  3L75 J;  2R3S A;  1EDL A;  2DW3 A;  3L4F A;  1SQX G;  1OIP A;  3UIA A;  3U1A A;  2HPC B;  1OW7 A;  1D7M A;  3L37 A;  1NYH A;  1KB9 E;  1GTW A;  1UIX A;  4YXD C;  2WIT A;  1W5C E;  4D6T D;  1NTK K;  4PV1 B;  1KYO I;  2RH0 A;  1OX3 A;  2XNX A;  4RJT A;  2FYU D;  1BGY D;  4M3L A;  3BCC D;  5KTB A;  2WSE J;  1OVR A;  1RE3 C;  1H0T B;  1J1D C;  2KSE A;  1N7L A;  3L75 G;  1USE A;  2HG5 D;  1N73 A;  2AEM A;  1EXJ A;  4I2L C;  2IBZ I;  2YXR B;  1OZH A;  1FZC C;  4JYC A;  2PP6 A;  3HUS C;  3CXH D;  3RGU A;  2IZ0 A;  2NPS A;  1KD1 Q;  1LT1 A;  4Z1M H;  2H88 C;  1FU1 A;  1L0L J;  1QX8 A;  1GK4 A;  2M5A B;  1KQS O;  2J58 A;  3L74 D;  1S9K E;  4TT3 H;  3VMZ A;  3AE9 C;  1YBK A;  1JM0 A;  4EOT A;  1YYC A;  4K3A A;  2QJP C;  1NU1 D;  2D2C B;  4WVZ A;  1K05 A;  2POH A;  3LW5 J;  3W68 A;  3CC4 P;  1QLE D;  3R4Y A;  5AVT B;  3P8C E;  3IAO A;  4XA4 A;  3AE7 C;  2Z4E A;  5APS A;  1YQ3 C;  2C0X A;  4L73 A;  1L0L G;  2YKP A;  4LC1 A;  3RK3 E;  3H32 B;  2K37 A;  1MFT A;  1ZP0 C;  1NTZ E;  1LWU C;  3I5C A;  5GTH H;  5KLV D;  3G3Z A;  3RL0 C;  1AQ5 A;  3USS A;  2B89 A;  1A02 J;  2B9B A;  2E5Y A;  2J5U A;  3CCS P;  1M1J C;  3II6 A;  3H1J D;  3A0B E;  3VP9 A;  1FAV A;  1SQX E;  4XFJ A;  5APU A;  2HOD B;  1Q90 D;  2IBZ G;  5KJ7 C;  3I56 P;  1FDO A;  2OYH B;  3A0B H;  1N7S C;  3AEG C;  2KUB A;  1RE4 A;  4IL6 X;  3FGA D;  1KIL B;  4U7J A;  3B5N B;  2K9Y A;  3BRT B;  1T3J A;  3IR9 A;  2A45 I;  2FYU K;  3L75 E;  1DH3 A;  1LT9 B;  3V4W A;  5EFW B;  1LTT C;  4RKU J;  1N7S A;  1FC2 C;  2W90 A;  1KC8 Q;  3H1L J;  3NFQ A;  2QM7 A;  2NRG A;  2QSI A;  4LGD E;  3CX5 H;  3HD7 D;  2JEE A;  5AW1 B;  3D70 A;  3H1K D;  2J59 M;  1T2K D;  3VN0 A;  2K3R A;  4JBZ A;  2I1J A;  1FZA A;  1X0T A;  5KAI E;  4H44 B;  2WSE H;  2CPB A;  5DJU B;  3CXH I;  3VYI A;  3H1L G;  2XZR A;  5KAI H;  2CK3 H;  1AVO A;  1NU1 K;  2ITA A;  3IN6 A;  4I7Z B;  1R8E A;  1L0L E;  2H7H A;  3CWB J;  3L73 D;  2BEZ F;  1IK7 A;  3Q1M A;  2N9Y B;  3WU2 E;  2L5G B;  3OA7 A;  3TSI A;  3VOP A;  1BDC A;  1M90 Q;  1PFI A;  5CHX A;  1JNM A;  3GHG C;  4H13 C;  3GG2 A;  5CCG D;  1BGY J;  2IYO A;  5AVR B;  3BCC J;  5KLV K;  1UII A;  1KTM A;  1RF1 B;  2A45 G;  2YO3 A;  1W2E A;  1JB0 J;  3CWB G;  2YKO A;  2C9L Y;  4PJ0 H;  2O1K A;  1VQ5 P;  3GHG A;  5APY A;  2C9N Y;  4PV1 C;  1S4X A;  1Q86 Q;  4L76 A;  1BGY G;  3FX0 A;  1U7M A;  3BCC G;  3AED C;  3HE4 B;  3U59 A;  3GW6 A;  1BDD A;  3MUD A;  2OGU A;  1EZV I;  2IZ1 A;  1LTI C;  3L74 J;  1DEE G;  2Q3E A;  2XND H;  1URQ B;  1NU1 J;  2H8P D;  3PJS K;  4GDO A;  1NTM D;  2E76 B;  1H0T A;  4R4M A;  3ITK A;  1FBM A;  1JTH A;  4W80 A;  4AYC A;  2PGD A;  3MGN A;  1QVF O;  5CBO A;  3HRN A;  3L74 G;  1NOH A;  3L72 D;  2OYI B;  2ZXE B;  5KLV J;  2L91 A;  3H1L E;  2YNY A;  3H25 A;  2Q5U A;  2E75 B;  1EDI A;  2D2C C;  3FWN A;  1NU1 G;  1LNQ A;  4AUW A;  2KB7 P;  3TGU J;  1OVV A;  3AEE C;  3FXE A;  1T2K C;  2OTJ P;  3H1J J;  4DCK A;  1PGJ A;  1Q81 Q;  2M8R A;  1NTK D;  1ZRT E;  2NPS D;  1J1E B;  1VQ8 P;  5TJH A; 
#chains in the Genus database with same CATH homology
 3H1J G;  1PPJ G;  1NTZ G;  2IBZ G;  1KB9 H;  1SQX G;  1NTK G;  2A06 G;  3L71 G;  4D6T G;  3H1I G;  1EZV G;  3H1L G;  1SQV G;  1SQP G;  1BCC G;  1NTM G;  5KLV G;  1L0L G;  1BGY G;  3L70 G;  1BE3 G;  1SQB G;  2FYU G;  3L74 G;  1KYO H;  3BCC G;  3L75 G;  1PP9 G;  2BCC G;  4PD4 H;  3L73 G;  1P84 H;  3CWB G;  3H1H G;  3H1K G;  3CXH H;  4U3F G;  3TGU G;  3L72 G;  3CX5 H;  1NU1 G;  1L0N G;  1SQQ G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...