1PPJG

Bovine cytochrome bc1 complex with stigmatellin and antimycin
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
73
structure length
73
Chain Sequence
RQFGHLTRVRHVITYSLSPFEQRAFPHYFSKGIPNVLRRTRACILRVAPPFVAFYLVYTWGTQEFEKSKRKNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords Ubiquinol-cytochrome C reductase complex core protein I, mit
publication title Binding of the Respiratory Chain Inhibitor Antimycin to the Mitochondrial bc(1) Complex: A New Crystal Structure Reveals an Altered Intramolecular Hydrogen-bonding Pattern.
pubmed doi rcsb
total genus 20
structure length 73
sequence length 73
chains with identical sequence T
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
G PF02939 UcrQ UcrQ family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.210 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Cytochrome b-c1 complex subunit 8 1ppjG00
2FYUG 3CX5H 1KB9H 1SQQG 3L74G 5KLVG 2BCCG 3TGUG 1BGYG 3H1KG 1NU1G 1SQBG 1BE3G 1SQVG 4PD4H 3H1LG 4D6TG 1L0LG 1NTMG 3CXHH 1L0NG 3H1JG 3L71G 1KYOH 3H1IG 1BCCG 1PP9G 2A06G 3L75G 1SQPG 1EZVG 3L72G 3BCCG 3L70G 2IBZG 1P84H 1SQXG 1NTKG 1PPJG 3CWBG 1NTZG 4U3FG 3H1HG 3L73G
chains in the Genus database with same CATH superfamily
3L71E 2MKVA 2N1TD 4WY4A 3IAOA 1VQ4P 1LT1A 2KLVA 1LT9A 1BE3D 2YMYA 4I6MC 3GG2A 3BASA 3H1JJ 3TGUE 2A45H 3BRTB 2QSIA 4D6TE 1HBWA 1GU4A 2PFXA 3JSVC 2Q1KA 2C0WA 3E1IA 2OYIA 2IPPA 3BCCE 4NPFX 1ZRTD 1L0LG 4M3LA 2N1TB 3L75D 4I7ZB 3VMZA 3KXDA 2QM8A 3H1HD 2Y0CA 1S72P 1JCDA 1BE3G 1VDFA 3IF4A 3MTUE 3AEBC 1AQTA 2OYHA 3AE2C 4HH2A 1NTMD 3A3YB 4N3YB 1GU5A 2NPSC 2I1KA 1VQ6P 2K88A 4PV1C 2NRGA 1NVOA 1W5CE 2R32A 1BGYD 2V7QJ 1NU1D 1SP4A 2WT7A 3L75G 2HFED 1N7LA 3VTPC 3PHLA 1SVFA 3H1HG 4ZKPA 4PV1D 1J1DC 1BSNA 1KC8Q 4LLHA 1T2KC 4PJ0H 1KN7A 2YO2A 1NTMG 1N7SC 1VQ5P 2KB7P 4YTPC 1T3JA 4ASWA 1Z56A 1PP9E 1BGYG 2NPSB 3L73D 5C39A 1NU1G 3S1KA 3H1KJ 4PV1B 5KLVD 2XNXA 3CCUP 2QE7H 3CCRP 1QX8A 2WSCJ 1L0NJ 1JO5A 2V7QH 1EXJA 3CCJP 5AVQB 2KNCA 4ZMDA 1SQPK 2JKVA 2HG5D 3U1AA 1KQGB 4AYCA 1JM0A 3MP7B 1OVVA 1EQ7A 1T8ZA 1VPCA 1J1DB 1L4AA 4WY4C 2Q6QA 2D2CC 5KAFE 1LT9C 2WSEH 3P8CD 2PP6A 1HUCA 1IFIA 1EDJA 4A7PA 1N7SB 3L73G 3RBZA 1N86A 2B88A 1AQ5A 5AW3B 3N7NA 5KLVG 2HODA 3WUTA 1SQQK 1JMBA 5AVVB 3Q3DA 1LJ2A 2MJZA 1KILA 2O01N 4OH8B 1NHLA 2ZT9C 2OYIC 1KZUB 2K9JA 3L37A 4DT0A 3RGUA 4WY4D 3H25A 1FDMA 4KJMA 5AVXB 4C7RA 2RH0A 5AW7B 3L70J 2WSCH 4EYYQ 3Q2YA 2OQQA 4EIJA 2IBZE 1VQ9P 2LR2A 3L71D 1SQVE 1H88A 4WY4B 2FYUG 2O01H 4LGDE 2D2CB 1LT9B 3PTZA 3AEAC 1IK9A 3TGUD 2E75C 2JDIH 4U3FE 1S2EA 4D6TD 3FX0A 4JQ0D 3H1LE 3O6QA 4XA4A 3V4QA 1P84E 3Q1MA 2Q3IA 1FU1A 2ZT9B 3BCCD 1NTKJ 2OYIB 3MIWA 2R5BA 2A06E 1Q90D 1KD1Q 2GUVA 1VQ8P 3CX5I 5APUA 1FC2C 2E75D 2E5TA 3L71G 1KYOH 1ZV8A 5K5GB 3R4YA 5GTIE 2P58A 1NJIQ 1FDIA 5H2FH 3CCMP 5CHXA 2M8RA 1GK6A 3UIAA 1OXZA 3Q5PA 3TGUG 3C1LA 3VN0A 1FZAA 4D6TG 1QVFO 2KXPB 3U59A 1LTTC 5AVWB 3SWKA 3O8ZA 3BCCG 3CXHI 2JJLA 2E75B 1M1JA 4OGQD 1KB9E 3A7OA 1TU3F 1JB0J 1Q82Q 2M3BA 5AW5B 3H1KD 2AEFA 3IR9A 2OTKE 2B9BA 5AW6B 2BCCE 1PGQA 3W68A 2J5UA 2QRXA 1YTZT 4RKUJ 4KT0J 4NPDA 1SQBD 5M1BA 1AV1A 1XTCC 2RMZA 1ZRTE 1OIPA 4W7YA 1KILC 5BU5A 1PP9D 1VL2A 5TISE 1L4AD 4NPEA 1X9VA 3L75E 3P8MC 4IFDK 3GW6A 3H1HE 4UB6E 1L0NK 1RF0A 3HD7A 2KNCB 3PJSK 2E76C 1S1CX 1WMKA 2CPBA 3CCQP 1JY3N 1KILD 1FZGA 1LTAC 1KYOD 3V2NA 3RL0B 3S9OA 2ZFCA 2WMMA 1JY2P 2FYNC 3CC2P 1PP9G 1BGYE 1MKMA 3CPWO 3I5CA 2R3SA 4AUWA 5AW1B 3FWLA 3HUSA 1PPJD 2Y0EA 1NTZD 2K9YA 1UIXA 2QJYC 3TNUA 1LTGC 2B87A 2HR3A 5TJHA 3SFEC 2QM7A 3RK3C 5E79H 1GW4A 2IBZD 1H0TA 1OMIA 3CCEP 2E76B 1SLQA 1Y9BA 1FZCA 4BWNA 2NPSA 2PGDA 3V2PA 5GTHH 2E5YA 1SQQE 2RN0A 5KLVE 2ZAEB 5B66H 2JP3A 2KK7A 3CD6P 2W6JH 1PPJG 2FYZA 2J58A 1NTZG 2FYNB 1PV3A 2I1JA 3RK3D 4U3FD 2WVRA 1M1JC 3KPEA 4GIFA 4PD4H 2Z4EA 1DD4A 2FXOA 3M0DA 1DX7A 3H1LD 5CCGC 4W7ZA 3D70A 3O6QB 1M1KQ 4ASVA 2QJYB 1PGJA 5APVA 2A06D 2IBZG 1NTKK 1RHZB 1N7SA 2H89C 4YPCA 1SQVG 1FOSE 2YKOA 3M9HA 3RK3B 2HLOA 1NAYA 1JTHB 3GMAA 3H32B 4TLFA 4MN4C 4U3FG 3H1JE 3HTKB 1EXIA 1MZ9A 3CWBJ 3CC7P 1RE4A 3H1LG 1YIJP 2BEZF 1N8RQ 1J1EC 1M1JB 2A06G 1JY2N 4DJGA 2ZJSE 1IC2A 2Q9IA 1RF0C 3HD7C 1LWUC 2WITA 5APWA 4W80A 4PJ0E 2BCCD 1S5LH 3CI9A 1HVVA 2ZYAA 4GODA 3TSIA 2FKWB 3FXEA 4B86A 3KZIH 4I1LA 2L5GB 1VQLP 1HF9A 5B5EH 1KFMA 1K05A 3S4RA 1M57D 3HD7D 5KTBA 5AW8B 4EDFA 4K3AA 3HUSC 2AXTH 3Q5SA 1SS1A 4GDOA 1AFOA 1J1EB 2BCCG 3C9IA 2W8ZA 2WPVB 1H8AA 2FBWC 3HD7B 3LIDA 1LWUB 1QL1A 1FZCC 1DD3A 3H1ID 3AEDC 2LKMA 2P2UA 1QGKB 3SFDC 2JWAA 2POHA 2Z5HA 4JF7A 1AA0A 1FZBA 3Q5RA 4H13C 3H1KE 2R5DA 3M0DC 1NO4A 5CCHA 1OZHA 2JR8A 3KQGA 3HUSB 1G1JA 1SQPD 2NPSD 3TNUB 1PFIA 4YXDC 1OVRA 2B87B 2ZVOB 1X22A 3C8VA 3AE4C 1AVYA 1KMIZ 1WRGA 1Y8AA 4GOEA 1G1IA 1NWQA 3H1IG 1SQBE 3A0BH 3A2AA 3G9RA 1H0TB 1FZCB 1SQQD 3D71A 1YI2P 5DJTB 1JUNA 1T2KD 1RE4C 1M56D 3EFFK 5CBOA 1N2DC 1N7SD 1SQPG 5APQA 4UB8H 4H13B 1MFTA 1URQA 3SWYA 1X0TA 1KILE 2FY8A 5CJ4A 3B5NA 1KYOE 1OVUA 4WB4A 4ZKUA 5H2FE 2IFMA 4KHXA 3T97A 4JPZB 1SQQG 2A45G 2PAJA 4WBAA 5KKZC 2C0XA 1IJDB 1PPJE 1NTZE 1QLED 3VMAA 3H1JD 4R4LA 1GK4A 1LNQA 4EOTA 3EQ2A 2D2CD 3L72J 4H0LC 1W2BO 1U57A 4Z1MH 3GHGC 1ZR4A 4L74A 4N78E 4ZNCA 1HGVA 2W83C 1NAFA 2ZT9D 1OWAA 3W67A 3P7KA 3L74J 1EZVE 3K5BA 3RK3E 3H1JG 1GL2A 1JY3P 5KKZB 2DW3A 1IFPA 3M0AA 3M06A 1JY2O 4EI2A 2LXBA 3AE5C 4GT1A 5CCHC 1P84I 3WU2H 3U1CA 4H0LB 1KV4A 4LC1A 4C7NB 3GHGB 1BCCJ 1JTHA 2KS1A 1DH3A 3H32A 4IL6H 4L73A 3V6IA 2L91A 3HTKA 2CK3H 3G71P 1HTLC 2E42A 5CCHD 3P32A 4IFFA 2YKQA 1BSHA 3B4SA 2ITAA 5KAFH 4BRYB 1VQKP 3OAKA 3AE6C 2G8YA 3A0HH 1PZQA 5CCGA 4C46A 1RQVA 2GM4A 4H44C 3ABVC 1KB9I 1URQC 3RK2C 1NH4A 1YQ3C 1L0ND 3RL0C 1LTSC 1IFNA 3B5NC 5E79E 1IFJA 1IFDA 1SQXJ 1M90Q 2P67A 1ZMEC 1IZNB 3CMAP 1FDOA 2KYVA 1JCCA 4HKZH 3V4WA 2W27A 5GTHE 2VRSA 3MZWB 2ZVNB 2KI7B 3OW2O 4WVZA 5B66E 3HE4B 3TYYA 1CI6A 3GF7A 3RL0D 3B5ND 1VQMP 1PIXA 1FS0E 2HYNA 2YXRB 1K04A 3R2PA 3H1KG 4PD4E 4GOFA 2YMKA 3QWOC 2WPQA 3TDKA 1L0NG 1L0LJ 2XKMA 5KAIE 3M91A 1LWUA 4H44B 1P84H 1KQSO 1URQB 3WUVA 2FFDA 3RK2B 1T6AA 3CX5H 3L70D 1Y47A 3H1IE 1HH0A 1FZEA 4Y28J 1SQBG 2H88C 2QJKB 1JMMA 3B5NB 1BE3J 1LTJA 4Y99C 2O1KA 3T97B 1UIIA 1GL2C 4HB1A 3I56P 1ZXGA 2YNYA 2E76D 4L75A 2AEJA 3L74D 1SQPE 1JOCA 2CPSA 2C9LY 1J2JB 3GLMA 2ZXEB 3CXHH 1USEA 3CCSP 3GF3A 5AVRB 1VQNP 3L75J 4HJGH 3L70G 1HJ0A 1U7MA 5BVZA 3H1HJ 2C9NY 1NTKD 3M9QA 4N78D 5CJ0A 1JEKA 4K35A 1CZQA 1S5LE 1VF5C 1M8OB 2Z5IA 1NTMJ 1Q81Q 3KZIE 2E74B 5CMZA 3AEFC 3NXSA 1Q2NA 5B5EE 1RF1C 1D7MA 1K8AQ 1Q7YQ 4Y99B 1HJBA 1VQ7P 1EZVD 2QG4A 1FE6A 2KZJA 3JCUH 2KUBA 1U7JA 4CPGA 1BGYJ 1NU1J 1GL2B 1ZLLA 2AXTE 3A5TA 3VMXA 1HWTC 2W6BA 2KIKA 1YYCA 1NTKG 2IDBA 2YIUC 4O9BA 1FOSF 1QVGO 5APSA 3H6PA 3BVHA 1DIPA 3CX5D 2KS1B 4DCKA 5CCGD 1EZVG 1VF5B 3L36A 1PGOA 3VOPA 1SQXD 3L73J 5APYA 5KLVJ 1SFCC 2KZIA 1RF1B 1LP1A 1NKNA 3HE5B 2O1JA 3FWNA 2P1JA 1GZLA 1FBMA 3NMDA 3D6YA 2WTYA 3LIEA 5APXA 3CCVP 3CXHD 1LTIC 1EDLA 3B8EB 3F5HA 1BDCA 4JYBA 2Y9YA 2FFDC 2XZRA 4N6JA 5KJ7A 2Q3EA 2YIUB 1S9KE 2IFNA 3A0BE 1YJWP 1LTJC 1JNMA 2P10A 4OVNF 2QJPC 1K73Q 4QMAA 1SQXK 4WWIA 1ZN5A 2FYUJ 3WUUA 2HPCA 2JWDA 2J59M 3V5BA 5DJUB 3OJAB 5AW2B 1CI6B 1SFCB 2M5AA 3MGNA 1AJYA 4UB8E 4IOIH 4C7NA 2FXPA 3GHGA 3KYQA 2R44A 4PD4D 1HGZA 1YBKA 5L8RJ 1L0LK 3L71J 3USSA 2FFDB 2V4HA 1EC5A 2H7HA 2GA1A 4BRYA 4U7JA 1LTJB 3TGUJ 2RKLA 2IZ1A 4R4MA 1YHQP 2QJPB 4D6TJ 3CCLP 2UWJE 3SWFA 1KFNA 3G4SP 3QH9A 2IX7C 3BCCJ 1L0NE 3FXDA 1IFMA 1JY3O 3D6ZA 1IK7A 4L76A 2KOGA 1KORA 4H13D 1S5LX 2WWWA 3HE4A 5AW9B 3MUDC 1R8EA 2R3CA 2WPSA 3AE7C 2WPRA 2WZ7A 2WSEJ 2AXCA 1DEBA 2IYPA 1NTMK 2P7JA 2Y9ZA 4DOJA 2W90A 2XNDH 1OW8A 3V2QA 2I8DA 3CWBD 3RL0g 3L72E 3WU2E 3NTNA 1NU1K 4I2LC 2BASA 2WSSH 3L70E 1ZR2A 2Q5UA 1RY3A 3VP9A 4BXLA 5KJ7C 2Q7CA 1N73A 1KYOI 4IL6E 1OW6A 1PGPA 5AW0B 1SQBJ 2QVAA 1BDDA 2JO1A 3ITKA 2O01J 3L74E 1PP9J 4XFJA 3WMM0 3CWBG 5KJ7D 3A0HE 2W6AA 2BEQD 2FYUD 1LP1B 3M9BA 3MHVA 5KLVK 1GDTA 2ZYDA 4RJTA 1NTKE 3LW5J 1T3UA 2KLUA 2IBZI 5APTA 2M3EA 3F89A 1W2EA 1BCCE 3AE9C 3V2RA 2N9BA 3CL3D 1S9KD 4H0LD 4HYTB 1EZVI 2XDJA 4JYCA 5AVUB 2OYHC 3VMYA 1NYHA 1G2CA 5AVSB 1NTZJ 2HPCB 2FYUK 5AVYB 2M5AB 3PH0A 2H43A 3CC4P 1DEEG 1X8YA 2OYOA 3LW5H 3PRJA 3CLQA 3CX5E 3N4XA 1R5SA 3L4FA 1YJNP 3PLNA 1OW7A 1A02F 1SQVJ 1SQXE 3BATA 2WQYC 3IFMA 2OTLP 1RF1A 1MFZA 2G3AA 3HE5A 4OGQC 2ZXXA 2H8PD 2ZYGA 4GKGA 1YQ4C 3AEGC 4U3FJ 1QEXA 3AEEC 2N9YB 2OYHB 2OARA 1GW3A 1ZOYC 2OGUA 3CXHE 3H1LJ 3JC22 2Y0DA 1FZFA 1GD2E 2XV5A 5EFWB 1S3JA 4DZOA 2QJKC 1L0LE 2KP8A 2K3RA 2QA4P 1KTMA 3AE3C 2AEMA 3L35A 3TF5A 1N73C 2M0BA 2OTJP 1EDKA 5AVZB 4IFMA 2KSEA 1YJ9P 2WT7B 1XTGB 4H44D 1QL2A 1GMJA 1M7LA 1YTZI 1RE3A 1URQD 1BE3E 3RK2D 1EDIA 1L4AC 3EWKA 2NZ2A 3EFGA 3G3ZA 1SFCA 3CMEP 1A02J 1GTWA 4OGQB 3JCUE 2GUSA 1NKZB 4XE5B 2YXQB 2XU6A 1FJPA 1OFCX 2N1TA 4PD4I 4OWFA 3BRVB 3L72D 3B71A 5AW4B 5CBNA 2E74C 5KLIC 2BCCJ 1MUUA 1KQFB 1CSBA 1ZP0C 3E1RA 4IL6X 1NGMB 1E5WA 1RQUA 1N73B 5GTIH 3AE1C 1NTME 3I55P 4AQRD 2K37A 2YKPA 3G6EP 1SQBK 1L4AB 2E74D 2WSFJ 3IN6A 2PRRA 1NU1E 3RBXA 5AVTB 3L72G 1KQLA 2HODB 2FXMA 1KB9H 1GL2D 2SPZA 1KILB 1H89A 1OX3A 2O3JA 1R5LA 2K9JB 3PP5A 3VP8A 2E43A 5KLIB 3H1IJ 2QEXP 1Q86Q 3E7KA 1E79H 1WT6A 1BCCD 5BU8B 2QIWA 3KDPB 1VQPP 2A45I 3TK1A 3L74G 1FAVA 4RESB 3ZDMA 1PL5A 2IYOA 1LGHB 1SQVD 3CWBE 3L73E 1FJKA 1ZW0A 1VF5D 2KSJA 2WSFH 1SQPJ 1G2CB 1LTBC 1NTZK 3MD0A 5TISH 2JEEA 2IZ0A 3VYIA 1VQOP 1L2PA 1AVOA 3SSUA 1MV8A 3II6A 1P84D 1BCCG 3NFQA 4UB6H 5KAIH 4RO0A 3MUDA 3AE8C 1YITP 1RE3C 1RH5B 2YO3A 3P8CE 1SQQJ 3KHUA 1NOHA 2B89A 1SQVK 1CW5A 2FYUE 4TT3H 1K9MQ 1X79B 2K1AA 2N1TC 1IO4A 1S4XA 2LXCB 1USDA 4YXWH 3AECC 3FGAD 1SFCD 4I7ZC 3HRNA 4JBZA 1L0LD 1KB9D 3OA7A 1SQXG
chains in the Genus database with same CATH topology
2FYUG 3CX5H 1KB9H 1SQQG 3L74G 5KLVG 2BCCG 3TGUG 1BGYG 3H1KG 1NU1G 1SQBG 1BE3G 1SQVG 4PD4H 3H1LG 4D6TG 1L0LG 1NTMG 3CXHH 1L0NG 3H1JG 3L71G 1KYOH 3H1IG 1BCCG 1PP9G 2A06G 3L75G 1SQPG 1EZVG 3L72G 3BCCG 3L70G 2IBZG 1P84H 1SQXG 1NTKG 1PPJG 3CWBG 1NTZG 4U3FG 3H1HG 3L73G
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2FYU G;  3CX5 H;  1KB9 H;  1SQQ G;  3L74 G;  5KLV G;  2BCC G;  3TGU G;  1BGY G;  3H1K G;  1NU1 G;  1SQB G;  1BE3 G;  1SQV G;  4PD4 H;  3H1L G;  4D6T G;  1L0L G;  1NTM G;  3CXH H;  1L0N G;  3H1J G;  3L71 G;  1KYO H;  3H1I G;  1BCC G;  1PP9 G;  2A06 G;  3L75 G;  1SQP G;  1EZV G;  3L72 G;  3BCC G;  3L70 G;  2IBZ G;  1P84 H;  1SQX G;  1NTK G;  1PPJ G;  3CWB G;  1NTZ G;  4U3F G;  3H1H G;  3L73 G; 
#chains in the Genus database with same CATH topology
 3L71 E;  2MKV A;  2N1T D;  4WY4 A;  3IAO A;  1VQ4 P;  1LT1 A;  2KLV A;  1LT9 A;  1BE3 D;  2YMY A;  4I6M C;  3GG2 A;  3BAS A;  3H1J J;  3TGU E;  2A45 H;  3BRT B;  2QSI A;  4D6T E;  1HBW A;  1GU4 A;  2PFX A;  3JSV C;  2Q1K A;  2C0W A;  3E1I A;  2OYI A;  2IPP A;  3BCC E;  4NPF X;  1ZRT D;  1L0L G;  4M3L A;  2N1T B;  3L75 D;  4I7Z B;  3VMZ A;  3KXD A;  2QM8 A;  3H1H D;  2Y0C A;  1S72 P;  1JCD A;  1BE3 G;  1VDF A;  3IF4 A;  3MTU E;  3AEB C;  1AQT A;  2OYH A;  3AE2 C;  4HH2 A;  1NTM D;  3A3Y B;  4N3Y B;  1GU5 A;  2NPS C;  2I1K A;  1VQ6 P;  2K88 A;  4PV1 C;  2NRG A;  1NVO A;  1W5C E;  2R32 A;  1BGY D;  2V7Q J;  1NU1 D;  1SP4 A;  2WT7 A;  3L75 G;  2HFE D;  1N7L A;  3VTP C;  3PHL A;  1SVF A;  3H1H G;  4ZKP A;  4PV1 D;  1J1D C;  1BSN A;  1KC8 Q;  4LLH A;  1T2K C;  4PJ0 H;  1KN7 A;  2YO2 A;  1NTM G;  1N7S C;  1VQ5 P;  2KB7 P;  4YTP C;  1T3J A;  4ASW A;  1Z56 A;  1PP9 E;  1BGY G;  2NPS B;  3L73 D;  5C39 A;  1NU1 G;  3S1K A;  3H1K J;  4PV1 B;  5KLV D;  2XNX A;  3CCU P;  2QE7 H;  3CCR P;  1QX8 A;  2WSC J;  1L0N J;  1JO5 A;  2V7Q H;  1EXJ A;  3CCJ P;  5AVQ B;  2KNC A;  4ZMD A;  1SQP K;  2JKV A;  2HG5 D;  3U1A A;  1KQG B;  4AYC A;  1JM0 A;  3MP7 B;  1OVV A;  1EQ7 A;  1T8Z A;  1VPC A;  1J1D B;  1L4A A;  4WY4 C;  2Q6Q A;  2D2C C;  5KAF E;  1LT9 C;  2WSE H;  3P8C D;  2PP6 A;  1HUC A;  1IFI A;  1EDJ A;  4A7P A;  1N7S B;  3L73 G;  3RBZ A;  1N86 A;  2B88 A;  1AQ5 A;  5AW3 B;  3N7N A;  5KLV G;  2HOD A;  3WUT A;  1SQQ K;  1JMB A;  5AVV B;  3Q3D A;  1LJ2 A;  2MJZ A;  1KIL A;  2O01 N;  4OH8 B;  1NHL A;  2ZT9 C;  2OYI C;  1KZU B;  2K9J A;  3L37 A;  4DT0 A;  3RGU A;  4WY4 D;  3H25 A;  1FDM A;  4KJM A;  5AVX B;  4C7R A;  2RH0 A;  5AW7 B;  3L70 J;  2WSC H;  4EYY Q;  3Q2Y A;  2OQQ A;  4EIJ A;  2IBZ E;  1VQ9 P;  2LR2 A;  3L71 D;  1SQV E;  1H88 A;  4WY4 B;  2FYU G;  2O01 H;  4LGD E;  2D2C B;  1LT9 B;  3PTZ A;  3AEA C;  1IK9 A;  3TGU D;  2E75 C;  2JDI H;  4U3F E;  1S2E A;  4D6T D;  3FX0 A;  4JQ0 D;  3H1L E;  3O6Q A;  4XA4 A;  3V4Q A;  1P84 E;  3Q1M A;  2Q3I A;  1FU1 A;  2ZT9 B;  3BCC D;  1NTK J;  2OYI B;  3MIW A;  2R5B A;  2A06 E;  1Q90 D;  1KD1 Q;  2GUV A;  1VQ8 P;  3CX5 I;  5APU A;  1FC2 C;  2E75 D;  2E5T A;  3L71 G;  1KYO H;  1ZV8 A;  5K5G B;  3R4Y A;  5GTI E;  2P58 A;  1NJI Q;  1FDI A;  5H2F H;  3CCM P;  5CHX A;  2M8R A;  1GK6 A;  3UIA A;  1OXZ A;  3Q5P A;  3TGU G;  3C1L A;  3VN0 A;  1FZA A;  4D6T G;  1QVF O;  2KXP B;  3U59 A;  1LTT C;  5AVW B;  3SWK A;  3O8Z A;  3BCC G;  3CXH I;  2JJL A;  2E75 B;  1M1J A;  4OGQ D;  1KB9 E;  3A7O A;  1TU3 F;  1JB0 J;  1Q82 Q;  2M3B A;  5AW5 B;  3H1K D;  2AEF A;  3IR9 A;  2OTK E;  2B9B A;  5AW6 B;  2BCC E;  1PGQ A;  3W68 A;  2J5U A;  2QRX A;  1YTZ T;  4RKU J;  4KT0 J;  4NPD A;  1SQB D;  5M1B A;  1AV1 A;  1XTC C;  2RMZ A;  1ZRT E;  1OIP A;  4W7Y A;  1KIL C;  5BU5 A;  1PP9 D;  1VL2 A;  5TIS E;  1L4A D;  4NPE A;  1X9V A;  3L75 E;  3P8M C;  4IFD K;  3GW6 A;  3H1H E;  4UB6 E;  1L0N K;  1RF0 A;  3HD7 A;  2KNC B;  3PJS K;  2E76 C;  1S1C X;  1WMK A;  2CPB A;  3CCQ P;  1JY3 N;  1KIL D;  1FZG A;  1LTA C;  1KYO D;  3V2N A;  3RL0 B;  3S9O A;  2ZFC A;  2WMM A;  1JY2 P;  2FYN C;  3CC2 P;  1PP9 G;  1BGY E;  1MKM A;  3CPW O;  3I5C A;  2R3S A;  4AUW A;  5AW1 B;  3FWL A;  3HUS A;  1PPJ D;  2Y0E A;  1NTZ D;  2K9Y A;  1UIX A;  2QJY C;  3TNU A;  1LTG C;  2B87 A;  2HR3 A;  5TJH A;  3SFE C;  2QM7 A;  3RK3 C;  5E79 H;  1GW4 A;  2IBZ D;  1H0T A;  1OMI A;  3CCE P;  2E76 B;  1SLQ A;  1Y9B A;  1FZC A;  4BWN A;  2NPS A;  2PGD A;  3V2P A;  5GTH H;  2E5Y A;  1SQQ E;  2RN0 A;  5KLV E;  2ZAE B;  5B66 H;  2JP3 A;  2KK7 A;  3CD6 P;  2W6J H;  1PPJ G;  2FYZ A;  2J58 A;  1NTZ G;  2FYN B;  1PV3 A;  2I1J A;  3RK3 D;  4U3F D;  2WVR A;  1M1J C;  3KPE A;  4GIF A;  4PD4 H;  2Z4E A;  1DD4 A;  2FXO A;  3M0D A;  1DX7 A;  3H1L D;  5CCG C;  4W7Z A;  3D70 A;  3O6Q B;  1M1K Q;  4ASV A;  2QJY B;  1PGJ A;  5APV A;  2A06 D;  2IBZ G;  1NTK K;  1RHZ B;  1N7S A;  2H89 C;  4YPC A;  1SQV G;  1FOS E;  2YKO A;  3M9H A;  3RK3 B;  2HLO A;  1NAY A;  1JTH B;  3GMA A;  3H32 B;  4TLF A;  4MN4 C;  4U3F G;  3H1J E;  3HTK B;  1EXI A;  1MZ9 A;  3CWB J;  3CC7 P;  1RE4 A;  3H1L G;  1YIJ P;  2BEZ F;  1N8R Q;  1J1E C;  1M1J B;  2A06 G;  1JY2 N;  4DJG A;  2ZJS E;  1IC2 A;  2Q9I A;  1RF0 C;  3HD7 C;  1LWU C;  2WIT A;  5APW A;  4W80 A;  4PJ0 E;  2BCC D;  1S5L H;  3CI9 A;  1HVV A;  2ZYA A;  4GOD A;  3TSI A;  2FKW B;  3FXE A;  4B86 A;  3KZI H;  4I1L A;  2L5G B;  1VQL P;  1HF9 A;  5B5E H;  1KFM A;  1K05 A;  3S4R A;  1M57 D;  3HD7 D;  5KTB A;  5AW8 B;  4EDF A;  4K3A A;  3HUS C;  2AXT H;  3Q5S A;  1SS1 A;  4GDO A;  1AFO A;  1J1E B;  2BCC G;  3C9I A;  2W8Z A;  2WPV B;  1H8A A;  2FBW C;  3HD7 B;  3LID A;  1LWU B;  1QL1 A;  1FZC C;  1DD3 A;  3H1I D;  3AED C;  2LKM A;  2P2U A;  1QGK B;  3SFD C;  2JWA A;  2POH A;  2Z5H A;  4JF7 A;  1AA0 A;  1FZB A;  3Q5R A;  4H13 C;  3H1K E;  2R5D A;  3M0D C;  1NO4 A;  5CCH A;  1OZH A;  2JR8 A;  3KQG A;  3HUS B;  1G1J A;  1SQP D;  2NPS D;  3TNU B;  1PFI A;  4YXD C;  1OVR A;  2B87 B;  2ZVO B;  1X22 A;  3C8V A;  3AE4 C;  1AVY A;  1KMI Z;  1WRG A;  1Y8A A;  4GOE A;  1G1I A;  1NWQ A;  3H1I G;  1SQB E;  3A0B H;  3A2A A;  3G9R A;  1H0T B;  1FZC B;  1SQQ D;  3D71 A;  1YI2 P;  5DJT B;  1JUN A;  1T2K D;  1RE4 C;  1M56 D;  3EFF K;  5CBO A;  1N2D C;  1N7S D;  1SQP G;  5APQ A;  4UB8 H;  4H13 B;  1MFT A;  1URQ A;  3SWY A;  1X0T A;  1KIL E;  2FY8 A;  5CJ4 A;  3B5N A;  1KYO E;  1OVU A;  4WB4 A;  4ZKU A;  5H2F E;  2IFM A;  4KHX A;  3T97 A;  4JPZ B;  1SQQ G;  2A45 G;  2PAJ A;  4WBA A;  5KKZ C;  2C0X A;  1IJD B;  1PPJ E;  1NTZ E;  1QLE D;  3VMA A;  3H1J D;  4R4L A;  1GK4 A;  1LNQ A;  4EOT A;  3EQ2 A;  2D2C D;  3L72 J;  4H0L C;  1W2B O;  1U57 A;  4Z1M H;  3GHG C;  1ZR4 A;  4L74 A;  4N78 E;  4ZNC A;  1HGV A;  2W83 C;  1NAF A;  2ZT9 D;  1OWA A;  3W67 A;  3P7K A;  3L74 J;  1EZV E;  3K5B A;  3RK3 E;  3H1J G;  1GL2 A;  1JY3 P;  5KKZ B;  2DW3 A;  1IFP A;  3M0A A;  3M06 A;  1JY2 O;  4EI2 A;  2LXB A;  3AE5 C;  4GT1 A;  5CCH C;  1P84 I;  3WU2 H;  3U1C A;  4H0L B;  1KV4 A;  4LC1 A;  4C7N B;  3GHG B;  1BCC J;  1JTH A;  2KS1 A;  1DH3 A;  3H32 A;  4IL6 H;  4L73 A;  3V6I A;  2L91 A;  3HTK A;  2CK3 H;  3G71 P;  1HTL C;  2E42 A;  5CCH D;  3P32 A;  4IFF A;  2YKQ A;  1BSH A;  3B4S A;  2ITA A;  5KAF H;  4BRY B;  1VQK P;  3OAK A;  3AE6 C;  2G8Y A;  3A0H H;  1PZQ A;  5CCG A;  4C46 A;  1RQV A;  2GM4 A;  4H44 C;  3ABV C;  1KB9 I;  1URQ C;  3RK2 C;  1NH4 A;  1YQ3 C;  1L0N D;  3RL0 C;  1LTS C;  1IFN A;  3B5N C;  5E79 E;  1IFJ A;  1IFD A;  1SQX J;  1M90 Q;  2P67 A;  1ZME C;  1IZN B;  3CMA P;  1FDO A;  2KYV A;  1JCC A;  4HKZ H;  3V4W A;  2W27 A;  5GTH E;  2VRS A;  3MZW B;  2ZVN B;  2KI7 B;  3OW2 O;  4WVZ A;  5B66 E;  3HE4 B;  3TYY A;  1CI6 A;  3GF7 A;  3RL0 D;  3B5N D;  1VQM P;  1PIX A;  1FS0 E;  2HYN A;  2YXR B;  1K04 A;  3R2P A;  3H1K G;  4PD4 E;  4GOF A;  2YMK A;  3QWO C;  2WPQ A;  3TDK A;  1L0N G;  1L0L J;  2XKM A;  5KAI E;  3M91 A;  1LWU A;  4H44 B;  1P84 H;  1KQS O;  1URQ B;  3WUV A;  2FFD A;  3RK2 B;  1T6A A;  3CX5 H;  3L70 D;  1Y47 A;  3H1I E;  1HH0 A;  1FZE A;  4Y28 J;  1SQB G;  2H88 C;  2QJK B;  1JMM A;  3B5N B;  1BE3 J;  1LTJ A;  4Y99 C;  2O1K A;  3T97 B;  1UII A;  1GL2 C;  4HB1 A;  3I56 P;  1ZXG A;  2YNY A;  2E76 D;  4L75 A;  2AEJ A;  3L74 D;  1SQP E;  1JOC A;  2CPS A;  2C9L Y;  1J2J B;  3GLM A;  2ZXE B;  3CXH H;  1USE A;  3CCS P;  3GF3 A;  5AVR B;  1VQN P;  3L75 J;  4HJG H;  3L70 G;  1HJ0 A;  1U7M A;  5BVZ A;  3H1H J;  2C9N Y;  1NTK D;  3M9Q A;  4N78 D;  5CJ0 A;  1JEK A;  4K35 A;  1CZQ A;  1S5L E;  1VF5 C;  1M8O B;  2Z5I A;  1NTM J;  1Q81 Q;  3KZI E;  2E74 B;  5CMZ A;  3AEF C;  3NXS A;  1Q2N A;  5B5E E;  1RF1 C;  1D7M A;  1K8A Q;  1Q7Y Q;  4Y99 B;  1HJB A;  1VQ7 P;  1EZV D;  2QG4 A;  1FE6 A;  2KZJ A;  3JCU H;  2KUB A;  1U7J A;  4CPG A;  1BGY J;  1NU1 J;  1GL2 B;  1ZLL A;  2AXT E;  3A5T A;  3VMX A;  1HWT C;  2W6B A;  2KIK A;  1YYC A;  1NTK G;  2IDB A;  2YIU C;  4O9B A;  1FOS F;  1QVG O;  5APS A;  3H6P A;  3BVH A;  1DIP A;  3CX5 D;  2KS1 B;  4DCK A;  5CCG D;  1EZV G;  1VF5 B;  3L36 A;  1PGO A;  3VOP A;  1SQX D;  3L73 J;  5APY A;  5KLV J;  1SFC C;  2KZI A;  1RF1 B;  1LP1 A;  1NKN A;  3HE5 B;  2O1J A;  3FWN A;  2P1J A;  1GZL A;  1FBM A;  3NMD A;  3D6Y A;  2WTY A;  3LIE A;  5APX A;  3CCV P;  3CXH D;  1LTI C;  1EDL A;  3B8E B;  3F5H A;  1BDC A;  4JYB A;  2Y9Y A;  2FFD C;  2XZR A;  4N6J A;  5KJ7 A;  2Q3E A;  2YIU B;  1S9K E;  2IFN A;  3A0B E;  1YJW P;  1LTJ C;  1JNM A;  2P10 A;  4OVN F;  2QJP C;  1K73 Q;  4QMA A;  1SQX K;  4WWI A;  1ZN5 A;  2FYU J;  3WUU A;  2HPC A;  2JWD A;  2J59 M;  3V5B A;  5DJU B;  3OJA B;  5AW2 B;  1CI6 B;  1SFC B;  2M5A A;  3MGN A;  1AJY A;  4UB8 E;  4IOI H;  4C7N A;  2FXP A;  3GHG A;  3KYQ A;  2R44 A;  4PD4 D;  1HGZ A;  1YBK A;  5L8R J;  1L0L K;  3L71 J;  3USS A;  2FFD B;  2V4H A;  1EC5 A;  2H7H A;  2GA1 A;  4BRY A;  4U7J A;  1LTJ B;  3TGU J;  2RKL A;  2IZ1 A;  4R4M A;  1YHQ P;  2QJP B;  4D6T J;  3CCL P;  2UWJ E;  3SWF A;  1KFN A;  3G4S P;  3QH9 A;  2IX7 C;  3BCC J;  1L0N E;  3FXD A;  1IFM A;  1JY3 O;  3D6Z A;  1IK7 A;  4L76 A;  2KOG A;  1KOR A;  4H13 D;  1S5L X;  2WWW A;  3HE4 A;  5AW9 B;  3MUD C;  1R8E A;  2R3C A;  2WPS A;  3AE7 C;  2WPR A;  2WZ7 A;  2WSE J;  2AXC A;  1DEB A;  2IYP A;  1NTM K;  2P7J A;  2Y9Z A;  4DOJ A;  2W90 A;  2XND H;  1OW8 A;  3V2Q A;  2I8D A;  3CWB D;  3RL0 g;  3L72 E;  3WU2 E;  3NTN A;  1NU1 K;  4I2L C;  2BAS A;  2WSS H;  3L70 E;  1ZR2 A;  2Q5U A;  1RY3 A;  3VP9 A;  4BXL A;  5KJ7 C;  2Q7C A;  1N73 A;  1KYO I;  4IL6 E;  1OW6 A;  1PGP A;  5AW0 B;  1SQB J;  2QVA A;  1BDD A;  2JO1 A;  3ITK A;  2O01 J;  3L74 E;  1PP9 J;  4XFJ A;  3WMM 0;  3CWB G;  5KJ7 D;  3A0H E;  2W6A A;  2BEQ D;  2FYU D;  1LP1 B;  3M9B A;  3MHV A;  5KLV K;  1GDT A;  2ZYD A;  4RJT A;  1NTK E;  3LW5 J;  1T3U A;  2KLU A;  2IBZ I;  5APT A;  2M3E A;  3F89 A;  1W2E A;  1BCC E;  3AE9 C;  3V2R A;  2N9B A;  3CL3 D;  1S9K D;  4H0L D;  4HYT B;  1EZV I;  2XDJ A;  4JYC A;  5AVU B;  2OYH C;  3VMY A;  1NYH A;  1G2C A;  5AVS B;  1NTZ J;  2HPC B;  2FYU K;  5AVY B;  2M5A B;  3PH0 A;  2H43 A;  3CC4 P;  1DEE G;  1X8Y A;  2OYO A;  3LW5 H;  3PRJ A;  3CLQ A;  3CX5 E;  3N4X A;  1R5S A;  3L4F A;  1YJN P;  3PLN A;  1OW7 A;  1A02 F;  1SQV J;  1SQX E;  3BAT A;  2WQY C;  3IFM A;  2OTL P;  1RF1 A;  1MFZ A;  2G3A A;  3HE5 A;  4OGQ C;  2ZXX A;  2H8P D;  2ZYG A;  4GKG A;  1YQ4 C;  3AEG C;  4U3F J;  1QEX A;  3AEE C;  2N9Y B;  2OYH B;  2OAR A;  1GW3 A;  1ZOY C;  2OGU A;  3CXH E;  3H1L J;  3JC2 2;  2Y0D A;  1FZF A;  1GD2 E;  2XV5 A;  5EFW B;  1S3J A;  4DZO A;  2QJK C;  1L0L E;  2KP8 A;  2K3R A;  2QA4 P;  1KTM A;  3AE3 C;  2AEM A;  3L35 A;  3TF5 A;  1N73 C;  2M0B A;  2OTJ P;  1EDK A;  5AVZ B;  4IFM A;  2KSE A;  1YJ9 P;  2WT7 B;  1XTG B;  4H44 D;  1QL2 A;  1GMJ A;  1M7L A;  1YTZ I;  1RE3 A;  1URQ D;  1BE3 E;  3RK2 D;  1EDI A;  1L4A C;  3EWK A;  2NZ2 A;  3EFG A;  3G3Z A;  1SFC A;  3CME P;  1A02 J;  1GTW A;  4OGQ B;  3JCU E;  2GUS A;  1NKZ B;  4XE5 B;  2YXQ B;  2XU6 A;  1FJP A;  1OFC X;  2N1T A;  4PD4 I;  4OWF A;  3BRV B;  3L72 D;  3B71 A;  5AW4 B;  5CBN A;  2E74 C;  5KLI C;  2BCC J;  1MUU A;  1KQF B;  1CSB A;  1ZP0 C;  3E1R A;  4IL6 X;  1NGM B;  1E5W A;  1RQU A;  1N73 B;  5GTI H;  3AE1 C;  1NTM E;  3I55 P;  4AQR D;  2K37 A;  2YKP A;  3G6E P;  1SQB K;  1L4A B;  2E74 D;  2WSF J;  3IN6 A;  2PRR A;  1NU1 E;  3RBX A;  5AVT B;  3L72 G;  1KQL A;  2HOD B;  2FXM A;  1KB9 H;  1GL2 D;  2SPZ A;  1KIL B;  1H89 A;  1OX3 A;  2O3J A;  1R5L A;  2K9J B;  3PP5 A;  3VP8 A;  2E43 A;  5KLI B;  3H1I J;  2QEX P;  1Q86 Q;  3E7K A;  1E79 H;  1WT6 A;  1BCC D;  5BU8 B;  2QIW A;  3KDP B;  1VQP P;  2A45 I;  3TK1 A;  3L74 G;  1FAV A;  4RES B;  3ZDM A;  1PL5 A;  2IYO A;  1LGH B;  1SQV D;  3CWB E;  3L73 E;  1FJK A;  1ZW0 A;  1VF5 D;  2KSJ A;  2WSF H;  1SQP J;  1G2C B;  1LTB C;  1NTZ K;  3MD0 A;  5TIS H;  2JEE A;  2IZ0 A;  3VYI A;  1VQO P;  1L2P A;  1AVO A;  3SSU A;  1MV8 A;  3II6 A;  1P84 D;  1BCC G;  3NFQ A;  4UB6 H;  5KAI H;  4RO0 A;  3MUD A;  3AE8 C;  1YIT P;  1RE3 C;  1RH5 B;  2YO3 A;  3P8C E;  1SQQ J;  3KHU A;  1NOH A;  2B89 A;  1SQV K;  1CW5 A;  2FYU E;  4TT3 H;  1K9M Q;  1X79 B;  2K1A A;  2N1T C;  1IO4 A;  1S4X A;  2LXC B;  1USD A;  4YXW H;  3AEC C;  3FGA D;  1SFC D;  4I7Z C;  3HRN A;  4JBZ A;  1L0L D;  1KB9 D;  3OA7 A;  1SQX G; 
#chains in the Genus database with same CATH homology
 2FYU G;  3CX5 H;  1KB9 H;  1SQQ G;  3L74 G;  5KLV G;  2BCC G;  3TGU G;  1BGY G;  3H1K G;  1NU1 G;  1SQB G;  1BE3 G;  1SQV G;  4PD4 H;  3H1L G;  4D6T G;  1L0L G;  1NTM G;  3CXH H;  1L0N G;  3H1J G;  3L71 G;  1KYO H;  3H1I G;  1BCC G;  1PP9 G;  2A06 G;  3L75 G;  1SQP G;  1EZV G;  3L72 G;  3BCC G;  3L70 G;  2IBZ G;  1P84 H;  1SQX G;  1NTK G;  1PPJ G;  3CWB G;  1NTZ G;  4U3F G;  3H1H G;  3L73 G; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...