1UIIA

Crystal structure of geminin coiled-coil domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
61
structure length
61
Chain Sequence
ENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Geminin
publication title A dimerized coiled-coil domain and an adjoining part of geminin interact with two sites on Cdt1 for replication inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 28
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 1uiiA00
1UIIA 3WUVA 2WVRA 2Q6QA 3WUTA 4BRYA 3WUUA 3F5HA 4BRYB 3E1RA 2ZXXA
chains in the Genus database with same CATH superfamily
4PJ0H 5APYA 3V6IA 4PV1C 1PP9E 2Q5UA 3LIEA 3D71A 2ZFCA 3HE5B 4N78D 1CZQA 1KTMA 1LTIC 1SVFA 3CCRP 1OW8A 3VMAA 1LTAC 1SQPG 1GD2E 3B5NA 1G2CB 3L73J 3V2RA 3L72J 1HUCA 2WITA 2E75C 1M1JC 4YXWH 3HRNA 2Y0CA 1VQKP 2YKQA 3V2PA 1EDKA 1JUNA 5AVZB 3NXSA 4PD4I 1IFNA 3KDPB 1ZRTE 1N86A 1M90Q 3C1LA 2WSCJ 1JY3P 2P1JA 1MFTA 3M0AA 1HGVA 5BU8B 2A45G 1KZUB 4I7ZB 1FOSE 2ZJSE 1QX8A 1T6AA 3CX5D 3VOPA 1VDFA 1SQQD 3H1KJ 2K9JB 1SFCA 4PV1B 3O6QB 3RK3C 1XTGB 1IJDB 1L4AA 1SQVD 3IF4A 1NO4A 1L0NK 1NYHA 1SQBD 2RH0A 2FYUG 1RF0C 3WUUA 2OTJP 3VTPC 3VYIA 1FDIA 3I5CA 2BEQD 2M0BA 2ZVOB 1X22A 3HTKA 3A0BE 3L73E 5BU5A 3L72E 3MGNA 2IX7C 3AE9C 4ASVA 1EZVG 1M1JB 3AEEC 2C0WA 1RE3C 3CL3D 5APUA 2XU6A 4UB8E 3R4YA 1J1DC 2Z5HA 1NJIQ 4KT0J 2KXPB 2NPSD 2IFMA 4HB1A 5AVYB 3VMZA 1BCCD 1HTLC 1S9KD 5AVUB 1DX7A 4C46A 4OH8B 5AW6B 1GMJA 3H1KE 1CI6A 3CWBJ 5AW1B 1SQPK 1VQNP 5AW5B 1N73A 1CW5A 4DOJA 1IFDA 1KQFB 1SQQJ 3TGUD 3Q5RA 1SQVJ 1EDLA 2IBZE 3MTUE 3GMAA 5APWA 3AEAC 2AEJA 1KB9E 2PGDA 3B4SA 2FXMA 3CXHI 3CPWO 1Q7YQ 2YKPA 3FX0A 1SQQG 1N7SC 2L91A 1OFCX 4EIJA 1SQVG 5KLVD 1KYOD 2W6AA 2FYNC 3FGAD 4K3AA 5TJHA 3OAKA 3BCCD 1FBMA 3G4SP 3RL0D 4BWNA 3V2NA 2C0XA 3K5BA 1RF1A 2YNYA 5KJ7A 2O01N 3L75D 1RQUA 1BCCJ 3CWBE 2E5TA 4IOIH 1S72P 3C9IA 1PGOA 3U1CA 2QM8A 5L8RJ 1FC2C 1ZP0C 1VQ7P 3L70J 3G9RA 3NTNA 1K05A 2WSEH 4W80A 4LC1A 5AVVB 3TDKA 1IK9A 4NPFX 2KUBA 1BCCG 2XV5A 1T3JA 1YIJP 1A02F 4L73A 1YTZT 4EI2A 2E76D 2FXPA 1EQ7A 2QSIA 2C9NY 2FYNB 3TGUG 1Q90D 4HH2A 2Q3EA 3A0HE 3AE2C 3CLQA 2FYZA 1WT6A 3HD7D 1JCDA 3M9QA 1WRGA 1NTMJ 1SLQA 5GTIE 2JR8A 3N4XA 3L74D 2BEZF 4IFMA 2HR3A 2B88A 2KZIA 3L70E 5KLVG 3LW5J 1LWUB 3GHGA 1PIXA 1G2CA 2VRSA 2P7JA 1Y9BA 1SQQK 4HYTB 3E1IA 2Q3IA 3BCCG 1IFIA 1XTCC 1SQVK 2W83C 3II6A 1P84E 2C9LY 4M3LA 3L75G 1DEEG 2CK3H 2Y0DA 1E5WA 4IL6X 3HE4B 1GDTA 4PD4H 1HF9A 5H2FE 4IFDK 1H88A 1LTJC 1PPJD 2CPSA 3I55P 3VP8A 1KQGB 3CCLP 3L4FA 2K9JA 3L71E 4U7JA 1ZXGA 1AVYA 1JMMA 1OW7A 1MFZA 2K37A 1NTME 2NPSB 1OIPA 2O01H 3Q5SA 3FWNA 2JKVA 2HG5D 3RL0C 1CSBA 1QLED 1FDMA 2FBWC 2GM4A 3AE5C 5CCHD 2W6JH 2RKLA 5B66E 3BRTB 1KFNA 3MHVA 3CCUP 3PHLA 1J1EC 1M1JA 2PFXA 2WT7B 3A3YB 4R4MA 2I1JA 3AEFC 2Z4EA 3BATA 3M9BA 3L74G 2WQYC 3OJAB 2NZ2A 2YMKA 3HUSC 3OW2O 1NAFA 2Z5IA 2E5YA 2OYIC 2KS1A 5KKZC 2E76C 3H1ID 3AE1C 1FZGA 1FS0E 3VP9A 1NU1E 2D2CD 4GDOA 5KLVK 1VQMP 2XKMA 3JCUE 1KILD 4YXDC 3HD7C 1RF0A 2QJPB 3MZWB 4AYCA 1J2JB 1PPJG 2ZAEB 1S2EA 5C39A 3SWKA 1SP4A 5AVWB 1SQXD 2XNDH 1J1EB 1IK7A 2IDBA 1RE3A 2QE7H 3EFFK 1ZOYC 3CXHH 1W5CE 4UB6H 3WU2E 1TU3F 5AW9B 3KZIE 4TT3H 1LTBC 3Q3DA 2R5BA 1IC2A 3B8EB 2OYIB 4YPCA 3F5HA 2Y9YA 1GW3A 3AE3C 1BGYE 2I8DA 1Q86Q 4D6TJ 5B5EE 1RHZB 1H0TB 3GW6A 2QIWA 5GTHH 1GZLA 2P10A 3HD7B 3CCVP 1EXJA 1KV4A 3P8CE 5AW8B 1SQPJ 3H1IG 1OXZA 3L36A 3RK2D 5CCHC 1LGHB 1L0NE 1NWQA 2WSEJ 4TLFA 4HKZH 2AEFA 1UIIA 3PP5A 1N7SA 3M0DC 1S4XA 2GA1A 2ZYDA 1S5LH 5CCGD 4PD4D 1X0TA 1PGPA 2AXTH 1KC8Q 1H8AA 1SQXG 2OARA 1EDJA 2BCCE 3NMDA 1RQVA 4D6TE 1KB9D 2FFDC 2I1KA 2D2CC 1USEA 4JQ0D 4GOEA 2KI7B 2IBZI 2KYVA 1KILC 1RH5B 2FYUJ 2WZ7A 4L76A 3I56P 2JWDA 1KB9I 2YXRB 1SQPE 1KN7A 1IFPA 5APTA 3RK3E 1S3JA 2KLVA 3HE4A 1VQOP 1M1KQ 3H6PA 4OGQD 3U1AA 2KZJA 3TNUB 1BDCA 1FJKA 1ZR2A 2PP6A 1L2PA 4I6MC 1QVGO 1JO5A 1BE3D 1U7MA 1R5LA 3MIWA 4QMAA 4WY4D 4XFJA 3E1RA 5KTBA 2K3RA 2R44A 2AXCA 3AEGC 2FFDB 4IFFA 2D2CB 1EXIA 3SFEC 1FZFA 2YIUB 2IYOA 2O01J 5CJ0A 1KILB 1T3UA 4GOFA 2WT7A 3C8VA 2H7HA 1LP1B 4L75A 1DEBA 2QM7A 5TISH 1EZVE 1FZCC 1QEXA 1Q82Q 1GL2D 3CXHD 2E42A 1JY2O 3RK2C 2OYOA 1LTJA 1SQXK 5E79H 4N78E 1PFIA 1SQBJ 1NTZD 4K35A 1JMBA 1FZEA 1JY3N 1YJ9P 1LTGC 2E74D 2WVRA 3GF7A 1OWAA 3KHUA 2V7QH 4O9BA 5CCGC 3V4QA 1BE3J 1OVUA 2KOGA 3CD6P 1VF5D 3H1JD 2WSSH 3CCSP 1S1CX 2JWAA 1SQBG 1RY3A 2GUVA 3SFDC 1VQ6P 2YXQB 4LLHA 3SWYA 3ITKA 4N3YB 4ZKUA 4KJMA 1P84I 1BE3G 2FYUK 1X8YA 1AJYA 2QG4A 1Z56A 3CMAP 3RBXA 3HUSA 1URQB 3CX5E 1FZCB 1SQQE 3GF3A 1LWUC 1T2KD 4MN4C 3TSIA 1AV1A 3RK2B 1AA0A 2OYIA 1SQVE 4Y28J 3D6YA 1G1IA 2POHA 2ZYAA 1OZHA 3IN6A 2UWJE 3TGUJ 3KYQA 4NPDA 1NTZJ 1NKNA 1H0TA 3NFQA 5APVA 3VN0A 4JF7A 3D70A 2M5AB 3BVHA 3MUDC 2A06D 1FU1A 3HD7A 3AE8C 1PGQA 2KB7P 1VQ8P 1ZN5A 4WY4C 3H1JJ 5AVQB 4DT0A 5KLVJ 1JTHB 1NTZG 1HJ0A 2Q9IA 3BCCJ 5APXA 1Q81Q 3H1LD 2NPSC 4U3FD 3A0BH 3HE5A 1BCCE 1S9KE 1K04A 5AW4B 4IL6E 1NU1D 2R5DA 3L75J 3PTZA 3P7KA 1GK4A 3FXEA 3H1JG 1HBWA 1LT9C 3AE7C 1OX3A 1YBKA 3P8MC 4W7ZA 5KAFE 4UB8H 1NTKD 1NVOA 1KFMA 4H13D 4AQRD 3KPEA 5CMZA 2WSCH 3TGUE 5KAIE 1GL2C 1QVFO 3V5BA 4OGQB 2WSFH 1SQBK 4ZKPA 1OVVA 3W67A 1VQ4P 2E74C 5CBNA 3H1HD 4HJGH 2W90A 1VF5C 4WY4B 5KLVE 1KYOE 1L0LD 3SWFA 1R8EA 2PAJA 5CCHA 4H0LD 1YHQP 2CPBA 5KLIB 3BCCE 3FXDA 3O6QA 5AW0B 3MD0A 1KB9H 3M0DA 1AQ5A 1M56D 1X9VA 2P2UA 5CHXA 3L75E 2W8ZA 4U3FJ 1FDOA 2A06G 2QJPC 2W27A 3TNUA 4PJ0E 4R4LA 3L74J 1LT9B 3IFMA 3HTKB 3PRJA 1WMKA 3CMEP 1NTKJ 1GL2B 4ASWA 1MKMA 1FOSF 3PH0A 2B89A 4OVNF 2N1TD 1LJ2A 3H1LG 2HODB 2WPVB 4U3FG 2FFDA 3GLMA 3CC4P 3D6ZA 1NTZK 1NU1G 2E74B 2O1KA 2K88A 3H32B 1A02J 1PP9D 2YO3A 1KILA 3RL0g 2HLOA 2J59M 1NTKG 1VF5B 1VQ9P 3CCQP 1NKZB 1GTWA 1LP1A 1YQ3C 1CI6B 1L0LJ 1N73B 3CCEP 2E75D 2V4HA 2FKWB 4EYYQ 2QEXP 1MV8A 2BCCD 2HYNA 3H1HG 1QL1A 5EFWB 3A5TA 1IFJA 2KNCB 1H89A 1ZRTD 3S4RA 1L0LG 3T97B 2Q6QA 3H25A 4GT1A 4Z1MH 2HPCB 4H13C 3A0HH 3EWKA 3M06A 1DD4A 2PRRA 2JJLA 2N9YB 2V7QJ 1ZW0A 3FWLA 5GTIH 5AW3B 4RJTA 2ZVNB 4WVZA 3TK1A 3GG2A 1PP9J 1YI2P 1GK6A 1PPJE 3H1IJ 2R3CA 1AFOA 2M3EA 1FZCA 3Q1MA 1FE6A 3L73D 3L72D 1P84H 2WWWA 4H0LC 3RGUA 1PP9G 5APQA 1LT1A 2OQQA 1EC5A 3KXDA 5H2FH 3AEBC 1URQD 2A45I 3SSUA 2M5AA 5CCGA 3JSVC 4YTPC 1SQXJ 4H13B 1NTKK 3BASA 3ABVC 2IZ1A 5M1BA 3H1KD 2B9BA 2N1TC 2KSEA 3LW5H 4RESB 2G3AA 4ZMDA 2KLUA 5B66H 1YJNP 2IBZD 3H1IE 1LTTC 1DH3A 2L5GB 4RKUJ 1EZVI 1VL2A 1QGKB 1L0LK 1LWUA 3GHGB 1PZQA 1KILE 3MP7B 2YIUC 1N7SD 4H0LB 3WUVA 2IFNA 4A7PA 3EQ2A 4L74A 3CC7P 5AVTB 3PLNA 1AQTA 4XE5B 2B87B 3F89A 1RE4C 3OA7A 2IYPA 3JC22 1FAVA 5CBOA 2XDJA 3B5ND 4JPZB 1HJBA 4KHXA 4EDFA 2Y0EA 1SQXE 3MUDA 4RO0A 5APSA 3TF5A 3L73G 3L72G 1IFMA 3JCUH 2WSFJ 3R2PA 4WY4A 1FZAA 3CWBD 2GUSA 5AW2B 2N1TB 1N8RQ 2KK7A 5AVXB 2LXCB 2QJYB 2IZ0A 3CI9A 4OWFA 2OTKE 2NPSA 1OW6A 2J58A 2KP8A 3CX5I 1VPCA 1LT9A 2FY8A 5DJUB 1SFCD 2P67A 2KSJA 2P58A 1L4AD 1N2DC 1YQ4C 3H1KG 3WU2H 2FYUE 3KZIH 1NGMB 2E75B 5AVSB 1GL2A 1K73Q 2HODA 1NH4A 2KIKA 2IBZG 3L35A 4I1LA 3H32A 1URQC 4H44D 2O3JA 3IAOA 2OYHC 1GU5A 5B5EH 3AEDC 4W7YA 1KD1Q 2KS1B 3VMYA 4JYCA 4C7NB 3O8ZA 1YITP 2H43A 3L70D 4GIFA 4PD4E 1X79B 3RK3B 1W2BO 4Y99C 2H88C 3UIAA 1FJPA 1KORA 1P84D 2KNCA 3Q2YA 3CWBG 2ZT9D 2JO1A 1HH0A 1KQSO 3T97A 2ZXEB 2WTYA 1NHLA 1SS1A 2DW3A 4BXLA 2JEEA 1D7MA 2HPCA 2WPQA 4I2LC 1HWTC 1K8AQ 3EFGA 4WWIA 2Q1KA 1J1DB 1AVOA 1YTZI 1R5SA 3N7NA 3L71D 4C7RA 1NTMD 3LIDA 2OYHB 2RMZA 3B5NC 3BRVB 2QRXA 1KYOI 1NOHA 1JY2P 1SQBE 1DD3A 2M3BA 3B71A 3G6EP 3P32A 4OGQC 3TYYA 2Y9ZA 2O1JA 1FZBA 1N7LA 3AE6C 1BE3E 3USSA 4Y99B 5KJ7D 1T8ZA 1K9MQ 2HFED 4JBZA 1U57A 2LXBA 5K5GB 1JM0A 4BRYB 1VQLP 1HVVA 2ZYGA 1USDA 1YJWP 1JB0J 2E43A 5CJ4A 5KLIC 1SFCC 3WMM0 3L70G 1L4AC 1N7SB 2MJZA 2R3SA 2A45H 4LGDE 2N9BA 3QWOC 2RN0A 2ITAA 4XA4A 3L71J 3B5NB 3CXHE 4UB6E 4H44C 1QL2A 1JEKA 3CCMP 3G3ZA 1KQLA 1NTZE 4GODA 1W2EA 1U7JA 2JP3A 1PGJA 2IPPA 2M8RA 4ZNCA 3RBZA 2R32A 3L71G 1NTMG 1Y8AA 4N6JA 3H1JE 1ZR4A 3V2QA 2B87A 2K1AA 5GTHE 2NRGA 3WUTA 1JY2N 1N73C 1SFCB 1JCCA 4EOTA 2ZT9C 1L4AB 1BDDA 1PL5A 3AE4C 2QA4P 4JYBA 1VQPP 3H1LJ 2LKMA 2JDIH 4WBAA 4DCKA 2N1TA 1BGYD 3A2AA 1NU1J 1ZV8A 2OTLP 2J5UA 3E7KA 4H44B 1IO4A 1S5LE 2XNXA 3M9HA 1T2KC 1M57D 1EDIA 1OVRA 2AXTE 3P8CD 3CC2P 2QJKC 1GU4A 2OGUA 2WPRA 4PV1D 1L0ND 5AW7B 2WMMA 2YKOA 2A06E 3CX5H 1VQ5P 1MUUA 1RF1C 5KJ7C 1YYCA 3H1HJ 1RE4A 4GKGA 2SPZA 1NAYA 1S5LX 3A7OA 1ZMEC 2FXOA 3QH9A 1HGZA 2ZT9B 3Q5PA 1BSNA 3U59A 3G71P 3H1LE 4U3FE 1LTJB 4C7NA 3L74E 4D6TD 1JOCA 1BSHA 1BGYJ 1NTKE 4CPGA 3RL0B 1NTMK 1M7LA 3KQGA 1SQPD 2WPSA 2QJKB 3RK3D 1M8OB 1Q2NA 1GW4A 3ZDMA 2BASA 4IL6H 2XZRA 2ZXXA 2QJYC 1BGYG 1L0NJ 2H8PD 3H1HE 1LNQA 5KAFH 2K9YA 1RF1B 3W68A 2AEMA 1OMIA 1L0LE 3S9OA 2YO2A 5KAIH 1DIPA 3HUSB 4NPEA 1E79H 1URQA 1JNMA 3L37A 3GHGC 2OYHA 2QVAA 3PJSK 4AUWA 1L0NG 2E76B 5KKZB 5TISE 1MZ9A 1UIXA 5BVZA 5AVRB 4DZOA 2BCCJ 3AECC 1JY3O 1KMIZ 1Y47A 3CCJP 1ZLLA 1NU1K 5DJTB 1KYOH 5E79E 4WB4A 1G1JA 1LTSC 2FYUD 2H89C 2G8YA 2W6BA 3S1KA 3IR9A 3V4WA 4I7ZC 4BRYA 1IZNB 4B86A 4DJGA 2YMYA 2Q7CA 1JTHA 3VMXA 2BCCG 2MKVA 1EZVD 1PV3A 2LR2A 3M91A 4D6TG
chains in the Genus database with same CATH topology
1UIIA 3WUVA 2WVRA 2Q6QA 3WUTA 4BRYA 3WUUA 3F5HA 4BRYB 3E1RA 2ZXXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UII A;  3WUV A;  2WVR A;  2Q6Q A;  3WUT A;  4BRY A;  3WUU A;  3F5H A;  4BRY B;  3E1R A;  2ZXX A; 
#chains in the Genus database with same CATH topology
 4PJ0 H;  5APY A;  3V6I A;  4PV1 C;  1PP9 E;  2Q5U A;  3LIE A;  3D71 A;  2ZFC A;  3HE5 B;  4N78 D;  1CZQ A;  1KTM A;  1LTI C;  1SVF A;  3CCR P;  1OW8 A;  3VMA A;  1LTA C;  1SQP G;  1GD2 E;  3B5N A;  1G2C B;  3L73 J;  3V2R A;  3L72 J;  1HUC A;  2WIT A;  2E75 C;  1M1J C;  4YXW H;  3HRN A;  2Y0C A;  1VQK P;  2YKQ A;  3V2P A;  1EDK A;  1JUN A;  5AVZ B;  3NXS A;  4PD4 I;  1IFN A;  3KDP B;  1ZRT E;  1N86 A;  1M90 Q;  3C1L A;  2WSC J;  1JY3 P;  2P1J A;  1MFT A;  3M0A A;  1HGV A;  5BU8 B;  2A45 G;  1KZU B;  4I7Z B;  1FOS E;  2ZJS E;  1QX8 A;  1T6A A;  3CX5 D;  3VOP A;  1VDF A;  1SQQ D;  3H1K J;  2K9J B;  1SFC A;  4PV1 B;  3O6Q B;  3RK3 C;  1XTG B;  1IJD B;  1L4A A;  1SQV D;  3IF4 A;  1NO4 A;  1L0N K;  1NYH A;  1SQB D;  2RH0 A;  2FYU G;  1RF0 C;  3WUU A;  2OTJ P;  3VTP C;  3VYI A;  1FDI A;  3I5C A;  2BEQ D;  2M0B A;  2ZVO B;  1X22 A;  3HTK A;  3A0B E;  3L73 E;  5BU5 A;  3L72 E;  3MGN A;  2IX7 C;  3AE9 C;  4ASV A;  1EZV G;  1M1J B;  3AEE C;  2C0W A;  1RE3 C;  3CL3 D;  5APU A;  2XU6 A;  4UB8 E;  3R4Y A;  1J1D C;  2Z5H A;  1NJI Q;  4KT0 J;  2KXP B;  2NPS D;  2IFM A;  4HB1 A;  5AVY B;  3VMZ A;  1BCC D;  1HTL C;  1S9K D;  5AVU B;  1DX7 A;  4C46 A;  4OH8 B;  5AW6 B;  1GMJ A;  3H1K E;  1CI6 A;  3CWB J;  5AW1 B;  1SQP K;  1VQN P;  5AW5 B;  1N73 A;  1CW5 A;  4DOJ A;  1IFD A;  1KQF B;  1SQQ J;  3TGU D;  3Q5R A;  1SQV J;  1EDL A;  2IBZ E;  3MTU E;  3GMA A;  5APW A;  3AEA C;  2AEJ A;  1KB9 E;  2PGD A;  3B4S A;  2FXM A;  3CXH I;  3CPW O;  1Q7Y Q;  2YKP A;  3FX0 A;  1SQQ G;  1N7S C;  2L91 A;  1OFC X;  4EIJ A;  1SQV G;  5KLV D;  1KYO D;  2W6A A;  2FYN C;  3FGA D;  4K3A A;  5TJH A;  3OAK A;  3BCC D;  1FBM A;  3G4S P;  3RL0 D;  4BWN A;  3V2N A;  2C0X A;  3K5B A;  1RF1 A;  2YNY A;  5KJ7 A;  2O01 N;  3L75 D;  1RQU A;  1BCC J;  3CWB E;  2E5T A;  4IOI H;  1S72 P;  3C9I A;  1PGO A;  3U1C A;  2QM8 A;  5L8R J;  1FC2 C;  1ZP0 C;  1VQ7 P;  3L70 J;  3G9R A;  3NTN A;  1K05 A;  2WSE H;  4W80 A;  4LC1 A;  5AVV B;  3TDK A;  1IK9 A;  4NPF X;  2KUB A;  1BCC G;  2XV5 A;  1T3J A;  1YIJ P;  1A02 F;  4L73 A;  1YTZ T;  4EI2 A;  2E76 D;  2FXP A;  1EQ7 A;  2QSI A;  2C9N Y;  2FYN B;  3TGU G;  1Q90 D;  4HH2 A;  2Q3E A;  3A0H E;  3AE2 C;  3CLQ A;  2FYZ A;  1WT6 A;  3HD7 D;  1JCD A;  3M9Q A;  1WRG A;  1NTM J;  1SLQ A;  5GTI E;  2JR8 A;  3N4X A;  3L74 D;  2BEZ F;  4IFM A;  2HR3 A;  2B88 A;  2KZI A;  3L70 E;  5KLV G;  3LW5 J;  1LWU B;  3GHG A;  1PIX A;  1G2C A;  2VRS A;  2P7J A;  1Y9B A;  1SQQ K;  4HYT B;  3E1I A;  2Q3I A;  3BCC G;  1IFI A;  1XTC C;  1SQV K;  2W83 C;  3II6 A;  1P84 E;  2C9L Y;  4M3L A;  3L75 G;  1DEE G;  2CK3 H;  2Y0D A;  1E5W A;  4IL6 X;  3HE4 B;  1GDT A;  4PD4 H;  1HF9 A;  5H2F E;  4IFD K;  1H88 A;  1LTJ C;  1PPJ D;  2CPS A;  3I55 P;  3VP8 A;  1KQG B;  3CCL P;  3L4F A;  2K9J A;  3L71 E;  4U7J A;  1ZXG A;  1AVY A;  1JMM A;  1OW7 A;  1MFZ A;  2K37 A;  1NTM E;  2NPS B;  1OIP A;  2O01 H;  3Q5S A;  3FWN A;  2JKV A;  2HG5 D;  3RL0 C;  1CSB A;  1QLE D;  1FDM A;  2FBW C;  2GM4 A;  3AE5 C;  5CCH D;  2W6J H;  2RKL A;  5B66 E;  3BRT B;  1KFN A;  3MHV A;  3CCU P;  3PHL A;  1J1E C;  1M1J A;  2PFX A;  2WT7 B;  3A3Y B;  4R4M A;  2I1J A;  3AEF C;  2Z4E A;  3BAT A;  3M9B A;  3L74 G;  2WQY C;  3OJA B;  2NZ2 A;  2YMK A;  3HUS C;  3OW2 O;  1NAF A;  2Z5I A;  2E5Y A;  2OYI C;  2KS1 A;  5KKZ C;  2E76 C;  3H1I D;  3AE1 C;  1FZG A;  1FS0 E;  3VP9 A;  1NU1 E;  2D2C D;  4GDO A;  5KLV K;  1VQM P;  2XKM A;  3JCU E;  1KIL D;  4YXD C;  3HD7 C;  1RF0 A;  2QJP B;  3MZW B;  4AYC A;  1J2J B;  1PPJ G;  2ZAE B;  1S2E A;  5C39 A;  3SWK A;  1SP4 A;  5AVW B;  1SQX D;  2XND H;  1J1E B;  1IK7 A;  2IDB A;  1RE3 A;  2QE7 H;  3EFF K;  1ZOY C;  3CXH H;  1W5C E;  4UB6 H;  3WU2 E;  1TU3 F;  5AW9 B;  3KZI E;  4TT3 H;  1LTB C;  3Q3D A;  2R5B A;  1IC2 A;  3B8E B;  2OYI B;  4YPC A;  3F5H A;  2Y9Y A;  1GW3 A;  3AE3 C;  1BGY E;  2I8D A;  1Q86 Q;  4D6T J;  5B5E E;  1RHZ B;  1H0T B;  3GW6 A;  2QIW A;  5GTH H;  1GZL A;  2P10 A;  3HD7 B;  3CCV P;  1EXJ A;  1KV4 A;  3P8C E;  5AW8 B;  1SQP J;  3H1I G;  1OXZ A;  3L36 A;  3RK2 D;  5CCH C;  1LGH B;  1L0N E;  1NWQ A;  2WSE J;  4TLF A;  4HKZ H;  2AEF A;  1UII A;  3PP5 A;  1N7S A;  3M0D C;  1S4X A;  2GA1 A;  2ZYD A;  1S5L H;  5CCG D;  4PD4 D;  1X0T A;  1PGP A;  2AXT H;  1KC8 Q;  1H8A A;  1SQX G;  2OAR A;  1EDJ A;  2BCC E;  3NMD A;  1RQV A;  4D6T E;  1KB9 D;  2FFD C;  2I1K A;  2D2C C;  1USE A;  4JQ0 D;  4GOE A;  2KI7 B;  2IBZ I;  2KYV A;  1KIL C;  1RH5 B;  2FYU J;  2WZ7 A;  4L76 A;  3I56 P;  2JWD A;  1KB9 I;  2YXR B;  1SQP E;  1KN7 A;  1IFP A;  5APT A;  3RK3 E;  1S3J A;  2KLV A;  3HE4 A;  1VQO P;  1M1K Q;  3H6P A;  4OGQ D;  3U1A A;  2KZJ A;  3TNU B;  1BDC A;  1FJK A;  1ZR2 A;  2PP6 A;  1L2P A;  4I6M C;  1QVG O;  1JO5 A;  1BE3 D;  1U7M A;  1R5L A;  3MIW A;  4QMA A;  4WY4 D;  4XFJ A;  3E1R A;  5KTB A;  2K3R A;  2R44 A;  2AXC A;  3AEG C;  2FFD B;  4IFF A;  2D2C B;  1EXI A;  3SFE C;  1FZF A;  2YIU B;  2IYO A;  2O01 J;  5CJ0 A;  1KIL B;  1T3U A;  4GOF A;  2WT7 A;  3C8V A;  2H7H A;  1LP1 B;  4L75 A;  1DEB A;  2QM7 A;  5TIS H;  1EZV E;  1FZC C;  1QEX A;  1Q82 Q;  1GL2 D;  3CXH D;  2E42 A;  1JY2 O;  3RK2 C;  2OYO A;  1LTJ A;  1SQX K;  5E79 H;  4N78 E;  1PFI A;  1SQB J;  1NTZ D;  4K35 A;  1JMB A;  1FZE A;  1JY3 N;  1YJ9 P;  1LTG C;  2E74 D;  2WVR A;  3GF7 A;  1OWA A;  3KHU A;  2V7Q H;  4O9B A;  5CCG C;  3V4Q A;  1BE3 J;  1OVU A;  2KOG A;  3CD6 P;  1VF5 D;  3H1J D;  2WSS H;  3CCS P;  1S1C X;  2JWA A;  1SQB G;  1RY3 A;  2GUV A;  3SFD C;  1VQ6 P;  2YXQ B;  4LLH A;  3SWY A;  3ITK A;  4N3Y B;  4ZKU A;  4KJM A;  1P84 I;  1BE3 G;  2FYU K;  1X8Y A;  1AJY A;  2QG4 A;  1Z56 A;  3CMA P;  3RBX A;  3HUS A;  1URQ B;  3CX5 E;  1FZC B;  1SQQ E;  3GF3 A;  1LWU C;  1T2K D;  4MN4 C;  3TSI A;  1AV1 A;  3RK2 B;  1AA0 A;  2OYI A;  1SQV E;  4Y28 J;  3D6Y A;  1G1I A;  2POH A;  2ZYA A;  1OZH A;  3IN6 A;  2UWJ E;  3TGU J;  3KYQ A;  4NPD A;  1NTZ J;  1NKN A;  1H0T A;  3NFQ A;  5APV A;  3VN0 A;  4JF7 A;  3D70 A;  2M5A B;  3BVH A;  3MUD C;  2A06 D;  1FU1 A;  3HD7 A;  3AE8 C;  1PGQ A;  2KB7 P;  1VQ8 P;  1ZN5 A;  4WY4 C;  3H1J J;  5AVQ B;  4DT0 A;  5KLV J;  1JTH B;  1NTZ G;  1HJ0 A;  2Q9I A;  3BCC J;  5APX A;  1Q81 Q;  3H1L D;  2NPS C;  4U3F D;  3A0B H;  3HE5 A;  1BCC E;  1S9K E;  1K04 A;  5AW4 B;  4IL6 E;  1NU1 D;  2R5D A;  3L75 J;  3PTZ A;  3P7K A;  1GK4 A;  3FXE A;  3H1J G;  1HBW A;  1LT9 C;  3AE7 C;  1OX3 A;  1YBK A;  3P8M C;  4W7Z A;  5KAF E;  4UB8 H;  1NTK D;  1NVO A;  1KFM A;  4H13 D;  4AQR D;  3KPE A;  5CMZ A;  2WSC H;  3TGU E;  5KAI E;  1GL2 C;  1QVF O;  3V5B A;  4OGQ B;  2WSF H;  1SQB K;  4ZKP A;  1OVV A;  3W67 A;  1VQ4 P;  2E74 C;  5CBN A;  3H1H D;  4HJG H;  2W90 A;  1VF5 C;  4WY4 B;  5KLV E;  1KYO E;  1L0L D;  3SWF A;  1R8E A;  2PAJ A;  5CCH A;  4H0L D;  1YHQ P;  2CPB A;  5KLI B;  3BCC E;  3FXD A;  3O6Q A;  5AW0 B;  3MD0 A;  1KB9 H;  3M0D A;  1AQ5 A;  1M56 D;  1X9V A;  2P2U A;  5CHX A;  3L75 E;  2W8Z A;  4U3F J;  1FDO A;  2A06 G;  2QJP C;  2W27 A;  3TNU A;  4PJ0 E;  4R4L A;  3L74 J;  1LT9 B;  3IFM A;  3HTK B;  3PRJ A;  1WMK A;  3CME P;  1NTK J;  1GL2 B;  4ASW A;  1MKM A;  1FOS F;  3PH0 A;  2B89 A;  4OVN F;  2N1T D;  1LJ2 A;  3H1L G;  2HOD B;  2WPV B;  4U3F G;  2FFD A;  3GLM A;  3CC4 P;  3D6Z A;  1NTZ K;  1NU1 G;  2E74 B;  2O1K A;  2K88 A;  3H32 B;  1A02 J;  1PP9 D;  2YO3 A;  1KIL A;  3RL0 g;  2HLO A;  2J59 M;  1NTK G;  1VF5 B;  1VQ9 P;  3CCQ P;  1NKZ B;  1GTW A;  1LP1 A;  1YQ3 C;  1CI6 B;  1L0L J;  1N73 B;  3CCE P;  2E75 D;  2V4H A;  2FKW B;  4EYY Q;  2QEX P;  1MV8 A;  2BCC D;  2HYN A;  3H1H G;  1QL1 A;  5EFW B;  3A5T A;  1IFJ A;  2KNC B;  1H89 A;  1ZRT D;  3S4R A;  1L0L G;  3T97 B;  2Q6Q A;  3H25 A;  4GT1 A;  4Z1M H;  2HPC B;  4H13 C;  3A0H H;  3EWK A;  3M06 A;  1DD4 A;  2PRR A;  2JJL A;  2N9Y B;  2V7Q J;  1ZW0 A;  3FWL A;  5GTI H;  5AW3 B;  4RJT A;  2ZVN B;  4WVZ A;  3TK1 A;  3GG2 A;  1PP9 J;  1YI2 P;  1GK6 A;  1PPJ E;  3H1I J;  2R3C A;  1AFO A;  2M3E A;  1FZC A;  3Q1M A;  1FE6 A;  3L73 D;  3L72 D;  1P84 H;  2WWW A;  4H0L C;  3RGU A;  1PP9 G;  5APQ A;  1LT1 A;  2OQQ A;  1EC5 A;  3KXD A;  5H2F H;  3AEB C;  1URQ D;  2A45 I;  3SSU A;  2M5A A;  5CCG A;  3JSV C;  4YTP C;  1SQX J;  4H13 B;  1NTK K;  3BAS A;  3ABV C;  2IZ1 A;  5M1B A;  3H1K D;  2B9B A;  2N1T C;  2KSE A;  3LW5 H;  4RES B;  2G3A A;  4ZMD A;  2KLU A;  5B66 H;  1YJN P;  2IBZ D;  3H1I E;  1LTT C;  1DH3 A;  2L5G B;  4RKU J;  1EZV I;  1VL2 A;  1QGK B;  1L0L K;  1LWU A;  3GHG B;  1PZQ A;  1KIL E;  3MP7 B;  2YIU C;  1N7S D;  4H0L B;  3WUV A;  2IFN A;  4A7P A;  3EQ2 A;  4L74 A;  3CC7 P;  5AVT B;  3PLN A;  1AQT A;  4XE5 B;  2B87 B;  3F89 A;  1RE4 C;  3OA7 A;  2IYP A;  3JC2 2;  1FAV A;  5CBO A;  2XDJ A;  3B5N D;  4JPZ B;  1HJB A;  4KHX A;  4EDF A;  2Y0E A;  1SQX E;  3MUD A;  4RO0 A;  5APS A;  3TF5 A;  3L73 G;  3L72 G;  1IFM A;  3JCU H;  2WSF J;  3R2P A;  4WY4 A;  1FZA A;  3CWB D;  2GUS A;  5AW2 B;  2N1T B;  1N8R Q;  2KK7 A;  5AVX B;  2LXC B;  2QJY B;  2IZ0 A;  3CI9 A;  4OWF A;  2OTK E;  2NPS A;  1OW6 A;  2J58 A;  2KP8 A;  3CX5 I;  1VPC A;  1LT9 A;  2FY8 A;  5DJU B;  1SFC D;  2P67 A;  2KSJ A;  2P58 A;  1L4A D;  1N2D C;  1YQ4 C;  3H1K G;  3WU2 H;  2FYU E;  3KZI H;  1NGM B;  2E75 B;  5AVS B;  1GL2 A;  1K73 Q;  2HOD A;  1NH4 A;  2KIK A;  2IBZ G;  3L35 A;  4I1L A;  3H32 A;  1URQ C;  4H44 D;  2O3J A;  3IAO A;  2OYH C;  1GU5 A;  5B5E H;  3AED C;  4W7Y A;  1KD1 Q;  2KS1 B;  3VMY A;  4JYC A;  4C7N B;  3O8Z A;  1YIT P;  2H43 A;  3L70 D;  4GIF A;  4PD4 E;  1X79 B;  3RK3 B;  1W2B O;  4Y99 C;  2H88 C;  3UIA A;  1FJP A;  1KOR A;  1P84 D;  2KNC A;  3Q2Y A;  3CWB G;  2ZT9 D;  2JO1 A;  1HH0 A;  1KQS O;  3T97 A;  2ZXE B;  2WTY A;  1NHL A;  1SS1 A;  2DW3 A;  4BXL A;  2JEE A;  1D7M A;  2HPC A;  2WPQ A;  4I2L C;  1HWT C;  1K8A Q;  3EFG A;  4WWI A;  2Q1K A;  1J1D B;  1AVO A;  1YTZ I;  1R5S A;  3N7N A;  3L71 D;  4C7R A;  1NTM D;  3LID A;  2OYH B;  2RMZ A;  3B5N C;  3BRV B;  2QRX A;  1KYO I;  1NOH A;  1JY2 P;  1SQB E;  1DD3 A;  2M3B A;  3B71 A;  3G6E P;  3P32 A;  4OGQ C;  3TYY A;  2Y9Z A;  2O1J A;  1FZB A;  1N7L A;  3AE6 C;  1BE3 E;  3USS A;  4Y99 B;  5KJ7 D;  1T8Z A;  1K9M Q;  2HFE D;  4JBZ A;  1U57 A;  2LXB A;  5K5G B;  1JM0 A;  4BRY B;  1VQL P;  1HVV A;  2ZYG A;  1USD A;  1YJW P;  1JB0 J;  2E43 A;  5CJ4 A;  5KLI C;  1SFC C;  3WMM 0;  3L70 G;  1L4A C;  1N7S B;  2MJZ A;  2R3S A;  2A45 H;  4LGD E;  2N9B A;  3QWO C;  2RN0 A;  2ITA A;  4XA4 A;  3L71 J;  3B5N B;  3CXH E;  4UB6 E;  4H44 C;  1QL2 A;  1JEK A;  3CCM P;  3G3Z A;  1KQL A;  1NTZ E;  4GOD A;  1W2E A;  1U7J A;  2JP3 A;  1PGJ A;  2IPP A;  2M8R A;  4ZNC A;  3RBZ A;  2R32 A;  3L71 G;  1NTM G;  1Y8A A;  4N6J A;  3H1J E;  1ZR4 A;  3V2Q A;  2B87 A;  2K1A A;  5GTH E;  2NRG A;  3WUT A;  1JY2 N;  1N73 C;  1SFC B;  1JCC A;  4EOT A;  2ZT9 C;  1L4A B;  1BDD A;  1PL5 A;  3AE4 C;  2QA4 P;  4JYB A;  1VQP P;  3H1L J;  2LKM A;  2JDI H;  4WBA A;  4DCK A;  2N1T A;  1BGY D;  3A2A A;  1NU1 J;  1ZV8 A;  2OTL P;  2J5U A;  3E7K A;  4H44 B;  1IO4 A;  1S5L E;  2XNX A;  3M9H A;  1T2K C;  1M57 D;  1EDI A;  1OVR A;  2AXT E;  3P8C D;  3CC2 P;  2QJK C;  1GU4 A;  2OGU A;  2WPR A;  4PV1 D;  1L0N D;  5AW7 B;  2WMM A;  2YKO A;  2A06 E;  3CX5 H;  1VQ5 P;  1MUU A;  1RF1 C;  5KJ7 C;  1YYC A;  3H1H J;  1RE4 A;  4GKG A;  2SPZ A;  1NAY A;  1S5L X;  3A7O A;  1ZME C;  2FXO A;  3QH9 A;  1HGZ A;  2ZT9 B;  3Q5P A;  1BSN A;  3U59 A;  3G71 P;  3H1L E;  4U3F E;  1LTJ B;  4C7N A;  3L74 E;  4D6T D;  1JOC A;  1BSH A;  1BGY J;  1NTK E;  4CPG A;  3RL0 B;  1NTM K;  1M7L A;  3KQG A;  1SQP D;  2WPS A;  2QJK B;  3RK3 D;  1M8O B;  1Q2N A;  1GW4 A;  3ZDM A;  2BAS A;  4IL6 H;  2XZR A;  2ZXX A;  2QJY C;  1BGY G;  1L0N J;  2H8P D;  3H1H E;  1LNQ A;  5KAF H;  2K9Y A;  1RF1 B;  3W68 A;  2AEM A;  1OMI A;  1L0L E;  3S9O A;  2YO2 A;  5KAI H;  1DIP A;  3HUS B;  4NPE A;  1E79 H;  1URQ A;  1JNM A;  3L37 A;  3GHG C;  2OYH A;  2QVA A;  3PJS K;  4AUW A;  1L0N G;  2E76 B;  5KKZ B;  5TIS E;  1MZ9 A;  1UIX A;  5BVZ A;  5AVR B;  4DZO A;  2BCC J;  3AEC C;  1JY3 O;  1KMI Z;  1Y47 A;  3CCJ P;  1ZLL A;  1NU1 K;  5DJT B;  1KYO H;  5E79 E;  4WB4 A;  1G1J A;  1LTS C;  2FYU D;  2H89 C;  2G8Y A;  2W6B A;  3S1K A;  3IR9 A;  3V4W A;  4I7Z C;  4BRY A;  1IZN B;  4B86 A;  4DJG A;  2YMY A;  2Q7C A;  1JTH A;  3VMX A;  2BCC G;  2MKV A;  1EZV D;  1PV3 A;  2LR2 A;  3M91 A;  4D6T G; 
#chains in the Genus database with same CATH homology
 1UII A;  3WUV A;  2WVR A;  2Q6Q A;  3WUT A;  4BRY A;  3WUU A;  3F5H A;  4BRY B;  3E1R A;  2ZXX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...