1UIIA

Crystal structure of geminin coiled-coil domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
61
structure length
61
Chain Sequence
ENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A dimerized coiled-coil domain and an adjoining part of geminin interact with two sites on Cdt1 for replication inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
molecule keywords Geminin
total genus 28
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 1uiiA00
3WUTA 3WUVA 2Q6QA 1UIIA 2ZXXA 3WUUA 4BRYA 3F5HA 3E1RA 4BRYB 2WVRA
chains in the Genus database with same CATH superfamily
2BCCJ 2IPPA 2KLVA 3WUVA 1FJPA 4K3AA 5KAIE 4WBAA 5B5EE 1EZVD 1N86A 1GW4A 1YJNP 1RF0A 1GL2A 3MD0A 1GK4A 5KLVE 2OTKE 4EDFA 5KLVD 1JY2O 2FFDA 3A5TA 2WPQA 1LGHB 1WRGA 4DZOA 1IFMA 2YMKA 4YPCA 1USDA 4YXDC 4DOJA 2PAJA 1P84H 2M5AA 3E1RA 3H1JD 3L75E 1L4AC 3CCUP 5TISE 3AE1C 3V4WA 1QEXA 1X22A 2H88C 1JNMA 1N7SD 1T3UA 2FFDC 1KYOH 1BCCE 2Q1KA 1RF0C 1GD2E 4U7JA 1LTBC 5APVA 1AVYA 2IBZD 4GKGA 4PV1D 4WB4A 3SWKA 3L70E 4DT0A 3WUUA 1Q7YQ 2XU6A 2KNCA 1EXIA 2A06E 1DD4A 1M1JC 1JEKA 2O01J 2OQQA 3H1JG 3CL3D 3L71J 4WWIA 5AVXB 5CCGA 2A45I 1LJ2A 1SQPG 2HFED 3AEFC 3KQGA 2J58A 1DEEG 4W7ZA 2D2CB 4AQRD 1BE3J 4IFDK 1PV3A 2WZ7A 4UB8H 5E79E 1NKNA 1SQQK 2V4HA 2HODA 3VP8A 4ZKPA 5GTIH 1RF1B 2UWJE 3BCCG 2QJPC 4RESB 2KZJA 2QJYB 1S5LH 1H0TB 4C7NB 3G9RA 1AFOA 3RL0B 3H1LG 1IFDA 2GUSA 4KT0J 3O6QA 1OW8A 3RK2C 1RY3A 1NU1E 5AW5B 1LTGC 1NVOA 1SQXE 3SWYA 2QEXP 1NYHA 2N1TC 1LNQA 5L8RJ 3Q3DA 1UIXA 3H1HD 2ZXEB 3V2PA 1H89A 4U3FD 1T3JA 2DW3A 4U3FE 1M8OB 4IOIH 1VQ8P 2OTLP 2M5AB 3GMAA 3BCCD 2W8ZA 3LIDA 4WY4C 3UIAA 2AEJA 2E74B 1KB9H 1P84I 2KLUA 3D6YA 1SQVG 5EFWB 4KJMA 2A06D 1U7MA 2YIUB 1L0LG 3M0AA 1AJYA 3AE5C 2XZRA 2YXRB 4N3YB 5AVQB 1EDIA 1NTMD 3AE9C 1L0NE 3E1IA 1EXJA 3A0BE 2C9NY 1PP9J 2W6BA 1S2EA 1SQQE 1LTSC 3HTKA 2ZYGA 4HYTB 1FE6A 1SQXJ 1XTCC 3LW5H 2HPCB 1NTZK 4CPGA 1BSNA 2PRRA 3TDKA 3V2NA 2QM8A 3RL0D 3OJAB 3MIWA 1NTKG 1KZUB 3CXHI 1PGOA 1ZRTE 2KP8A 1KILD 2YMYA 1ZRTD 3KHUA 1ZN5A 1J2JB 1VF5D 3CI9A 1W2BO 3HE4A 1NTMK 5APYA 1SQBJ 1KFMA 2QM7A 3D6ZA 2NPSA 1N73C 1G2CB 1WT6A 2P7JA 3I55P 3B71A 1S5LX 1RF1A 1NTZD 2L91A 2QVAA 1SFCD 2G8YA 1MZ9A 2Y9YA 4OGQD 2ZYAA 4ZMDA 1AQ5A 2AXCA 2PFXA 1FU1A 4PD4H 3L73G 2J59M 2LR2A 2FYUD 3L71E 1NHLA 1NWQA 3II6A 2QIWA 4H0LB 4HKZH 1KYOI 1PP9D 1BE3G 1KILC 2Q3IA 1E5WA 2M3BA 3AE8C 5AVWB 3V5BA 3VN0A 2IX7C 2RMZA 1N8RQ 2E75B 3HRNA 2CPBA 2JP3A 3MUDC 1NTKJ 5KAIH 1NTZG 1KILB 1USEA 1FJKA 2AXTH 3A7OA 3OAKA 1DEBA 2V7QJ 3FXDA 4H0LC 3RK2D 3ITKA 2FYUG 3JCUH 4OVNF 3G71P 2RN0A 1E79H 1OVUA 1SQBD 4H13B 1NH4A 3RK3E 5K5GB 2E42A 1SQVJ 1S9KE 2OGUA 1FZCB 3M9QA 1DD3A 3CC4P 1Y47A 1OVVA 5BU8B 1PPJD 3BASA 4GT1A 3D71A 1KC8Q 1N73B 2KSEA 1LP1B 3L70D 3FWNA 5APQA 2B9BA 2OTJP 2JR8A 1NTMG 1PGPA 2MKVA 1J1EB 1LWUB 2FXOA 2K1AA 3HUSA 3SWFA 3S1KA 5CCHA 3MZWB 1URQD 1W2EA 4IL6E 1H0TA 4PJ0H 1ZLLA 5AVVB 1LTJB 4BRYA 5CHXA 1GDTA 5AW9B 3V2QA 1HUCA 1KQFB 2FY8A 5H2FH 2FYUJ 2R3CA 1VQLP 4TT3H 1YJ9P 1BSHA 2VRSA 3CX5I 3GLMA 3H1HE 4L76A 3HUSC 2Q7CA 3CXHD 1S5LE 4PV1B 4U3FJ 3SSUA 2M0BA 3TGUG 5BU5A 1NTZJ 1Q90D 3IF4A 3CCVP 1FOSE 2E5TA 1CZQA 2K88A 2NPSC 1L0NK 4N78D 1MFTA 1U7JA 3TSIA 3W67A 1H88A 2CPSA 3JC22 4Y28J 3IR9A 1OZHA 3C8VA 1VQ4P 2GM4A 2O01H 2Y9ZA 3L36A 3AEAC 3M9HA 4L75A 2Q6QA 2Q3EA 2XNXA 5CJ0A 2ITAA 3L73D 2XNDH 3S9OA 1GL2D 3FGAD 3ZDMA 3N4XA 4RO0A 2HPCA 1DX7A 1JCDA 1VQ6P 2KZIA 3H1LE 1YTZI 1FOSF 3RL0C 2BEZF 2K3RA 3VOPA 1BGYJ 1PIXA 3PRJA 1JY3O 2QJYC 2Q5UA 3V4QA 1FZEA 3AE7C 2HLOA 1FDIA 3MUDA 5KJ7C 5B5EH 4H44D 2G3AA 3MP7B 1OX3A 5APUA 2HODB 5AVZB 3CCEP 1JO5A 1G1JA 1OFCX 2YNYA 3P8MC 2BEQD 3CLQA 1VF5C 4I1LA 2BCCG 1VQ5P 2H7HA 3AEDC 4C7NA 1JUNA 1S1CX 1JY3N 1L0NG 2WPRA 2Y0DA 2YO3A 2K37A 1R5SA 1ZP0C 4JYBA 2SPZA 2E43A 1AVOA 3FXEA 2ZT9D 3O6QB 1VL2A 1JY2N 5C39A 2WVRA 1HF9A 1H8AA 1Y8AA 3L70G 2YKPA 3AE4C 3PTZA 4H44B 2IFNA 1QVGO 2JEEA 1URQB 2FFDB 2FYUK 2WMMA 2FXPA 1Y9BA 5KJ7D 2H8PD 1AQTA 3L75J 4B86A 1KV4A 1SQPE 1YBKA 1S72P 3AEGC 1U57A 4W7YA 5KAFE 2ZXXA 1OMIA 3L4FA 5AW6B 1IJDB 3H25A 3RGUA 1QVFO 1JCCA 5H2FE 3H32B 3H1KG 3GF3A 3B5NA 2MJZA 4GOFA 3VMYA 4UB8E 4PD4D 5CCGC 1FZFA 3VTPC 4ASWA 2KUBA 1J1DC 4BWNA 1RE4A 2HG5D 5KLIC 1SQBK 2QJKC 2WT7B 1OVRA 1S3JA 1SS1A 1CSBA 1ZXGA 3GG2A 1RQVA 1FZAA 3PH0A 2KK7A 3B5NC 4JF7A 4Y99C 1NJIQ 5DJUB 1N7LA 1FAVA 1YQ4C 2AEMA 2ZAEB 3HD7C 3S4RA 1K8AQ 3HE4B 5APSA 4L73A 4YTPC 3RK3D 1PGQA 2WPVB 3H1IE 4I6MC 5KJ7A 1YI2P 1GL2C 3L72E 2M8RA 2Y0EA 3L72D 4ZKUA 4D6TE 1PP9E 2FYZA 3Q5SA 3A0HH 3H1JJ 5KKZB 2IBZI 1EZVE 5CBOA 2P2UA 2AEFA 3CX5E 4ASVA 1ZW0A 1SQQG 3L74D 2IBZG 3FX0A 1EDKA 1IK7A 1Z56A 3L74E 4RJTA 1GL2B 2ZVOB 2I1KA 4NPEA 3TYYA 4EIJA 3OW2O 3KXDA 3HD7D 1VQ9P 2XDJA 1SQBE 3RK3C 3G6EP 2XV5A 2JKVA 3H32A 1NO4A 1SQXD 3L72J 2FKWB 3B5NB 3A2AA 1L0ND 5E79H 5GTIE 1ZR4A 3L35A 3PHLA 3USSA 5KLIB 3CCLP 3BATA 4N78E 1YTZT 3T97B 1GU5A 1FDMA 4NPFX 2OYHC 3A0HE 5APXA 2YXQB 3F5HA 3L75G 3U1AA 1FZGA 1JTHA 4D6TG 1L2PA 1P84E 1QX8A 1BGYE 4IFFA 4MN4C 1KILE 1BGYD 4W80A 3V2RA 4XFJA 5AW7B 1MFZA 1SQXG 1BCCG 2C0XA 3C9IA 1SQXK 3H1HG 3KDPB 4GODA 2WSSH 1BE3E 2PP6A 3AE2C 5KLVG 3VMZA 5GTHE 1N7SC 1URQC 4HJGH 4H44C 1ZOYC 1GZLA 1SQPK 3HD7A 5AVRB 1L0LD 1OW7A 1W5CE 2E5YA 1LTJA 3CWBD 5CCGD 4JPZB 1M7LA 4LGDE 1YITP 3CD6P 1M56D 1K04A 1MV8A 1GK6A 2ZT9C 2AXTE 1GTWA 1CW5A 1CI6A 2B89A 2E76C 3L74J 1KD1Q 3V6IA 1URQA 3WU2H 1VF5B 2IZ0A 1HTLC 3BCCE 3BRVB 4UB6E 1HJBA 1HBWA 2FYNB 2WQYC 3H1KJ 2GA1A 3I56P 1MKMA 2B87B 2JJLA 1IFJA 1NTKE 1SQPD 3H1LD 5CJ4A 2L5GB 1NGMB 1R5LA 1P84D 4I7ZC 4EI2A 1YHQP 4OGQB 3VYIA 4C7RA 1SFCB 1X8YA 1IZNB 2WSCJ 1EDJA 5TJHA 2RH0A 1T2KC 1LT9B 5AW4B 5TISH 1Q2NA 5CCHC 2N1TD 2WT7A 3T97A 3CCSP 1S9KD 1L0LE 2WTYA 2KXPB 1VQNP 3QWOC 4O9BA 2C0WA 2R3SA 1HJ0A 3AE3C 3VMAA 2PGDA 1S4XA 2IZ1A 2NPSB 1JB0J 1LP1A 1OWAA 3IN6A 3KPEA 1K73Q 2ZFCA 1T6AA 5KTBA 2OYOA 2OYIB 4PV1C 1LWUA 3HUSB 1VQ7P 3KZIH 1FC2C 4KHXA 1EDLA 4D6TJ 1NKZB 2A06G 3KYQA 4EOTA 3H1JE 3L75D 3LIEA 2R5BA 2C9LY 1NTKD 1M57D 3A0BH 1GW3A 3GHGB 1GU4A 4BXLA 1HH0A 1LTJC 2R44A 2ZVNB 1BCCD 3M9BA 3R4YA 1RH5B 2NPSD 2Z5IA 1NOHA 4GDOA 4K35A 1YIJP 2QRXA 1J1EC 1LWUC 1FBMA 1VPCA 2B87A 2WSFH 4DJGA 4I2LC 3H6PA 1VDFA 1IO4A 3E7KA 2H89C 1PPJG 2YO2A 3KZIE 2D2CD 3F89A 4PD4I 2OARA 2WSEH 2GUVA 3L71G 4YXWH 1FZCC 1RE4C 3C1LA 4IL6X 1PZQA 1VQPP 2BCCE 1FDOA 2O1JA 3EQ2A 3L70J 3PLNA 4H13C 1RE3A 4U3FG 2J5UA 1Q81Q 4QMAA 2CK3H 3HTKB 2W83C 3BVHA 1DIPA 2V7QH 1SQVE 3TK1A 1SQVD 2WSEJ 2JDIH 4PJ0E 1OXZA 2W90A 1KYOE 3B5ND 3M06A 4Z1MH 2P58A 1NU1K 2E75C 1G1IA 2FXMA 3FWLA 2W27A 1G2CA 3OA7A 3CX5D 1YJWP 2Z4EA 1IC2A 2HR3A 2N9BA 1X9VA 1OIPA 3MTUE 4C46A 1UIIA 5B66E 3QH9A 3CWBE 3GHGA 1M1KQ 2LXBA 1HWTC 1IFNA 4M3LA 3VMXA 1L0LK 1SQVK 2JO1A 2O3JA 3H1LJ 4JBZA 3SFDC 3WUTA 3CCMP 4ZNCA 4OWFA 2Q9IA 1NTME 5AVSB 4JQ0D 1IFPA 2FYUE 3ABVC 3LW5J 2I1JA 3CXHE 5GTHH 3BCCJ 1KFNA 1AA0A 3CCRP 1GMJA 1A02J 5APWA 2KYVA 5AW2B 2NZ2A 3U1CA 1M90Q 1SQPJ 3EFGA 1IFIA 1KQGB 3A3YB 5AW0B 1Q86Q 3VP9A 2YKOA 2WSFJ 3HE5B 2Y0CA 3P8CE 5APTA 1YQ3C 2A45H 3NXSA 4XA4A 1OW6A 3L73E 1NU1G 2KB7P 3CWBJ 3H1IG 3Q5RA 4L74A 1LT9A 2LXCB 4IL6H 3GHGC 4PD4E 3GF7A 1PP9G 3IAOA 2P67A 1NAYA 1K9MQ 1BE3D 3MGNA 2YKQA 5AVUB 5BVZA 4GIFA 5CCHD 4R4MA 3G4SP 1JTHB 1FZCA 3SFEC 3TNUB 1JY2P 3NTNA 4OH8B 1L0LJ 2JWAA 1T2KD 3I5CA 2QSIA 2OYIC 3TNUA 3CCQP 2IBZE 3JCUE 1D7MA 3W68A 2YIUC 1KB9I 4N6JA 3CMAP 1LTTC 2OYHA 2E74C 2JWDA 2W6AA 2ZJSE 3H1ID 3L71D 4HH2A 4TLFA 4WY4B 1R8EA 3M0DA 4BRYB 4EYYQ 2WITA 3GW6A 1SQBG 1SVFA 1EQ7A 1HGZA 1SLQA 1HVVA 1T8ZA 3G3ZA 1QLED 1RE3C 1JMMA 2N1TB 3Q2YA 1VQMP 1X79B 1SQQJ 3RK2B 3D70A 1LT9C 3N7NA 5M1BA 5KLVK 2XKMA 3CPWO 3MHVA 3PJSK 3Q5PA 1CI6B 1NTKK 1ZV8A 1LT1A 1SFCC 2K9YA 1L4AD 3H1HJ 4OGQC 4I7ZB 1QL1A 2N9YB 1JOCA 2QJPB 4WY4D 1VQOP 1RF1C 1KB9D 3CCJP 1N2DC 3CC2P 1KILA 1KORA 2D2CC 2FYNC 2ZYDA 3PP5A 2A45G 5CMZA 4NPDA 3AE6C 4AYCA 1M1JA 1PGJA 1K05A 1HGVA 2KS1B 2IDBA 2IYOA 2NRGA 3RBXA 3CXHH 3L73J 3AEEC 2E76B 3HE5A 4XE5B 1M1JB 2KS1A 3P32A 3Q1MA 4H13D 2O1KA 2ZT9B 2H43A 3L72G 3TGUE 2R32A 3TGUD 2KNCB 2B88A 1NTMJ 3NFQA 5AVTB 1EZVG 2QA4P 1FZBA 5CBNA 1MUUA 1N7SB 3M91A 1SQQD 3P7KA 1DH3A 1KYOD 4AUWA 1BDCA 1L4AB 2Z5HA 2BASA 3AEBC 1NU1D 5AW1B 3B4SA 1L4AA 3JSVC 4GOEA 2OYIA 3H1IJ 3RL0g 3CMEP 1BCCJ 5KAFH 2WPSA 1LTAC 2E75D 2IYPA 1KN7A 1KB9E 5AW3B 1PL5A 2K9JA 3B8EB 1YYCA 3NMDA 3TGUJ 3WMM0 2OYHB 3H1KD 4HB1A 1BDDA 3L37A 2N1TA 3AECC 3K5BA 2K9JB 4RKUJ 1PFIA 1WMKA 2IFMA 2R5DA 3EWKA 5KLVJ 1ZR2A 1JM0A 3U59A 4JYCA 3M0DC 5B66H 3BRTB 5AVYB 3RK3B 1QL2A 1AV1A 2BCCD 1LTIC 2QE7H 1XTGB 2POHA 1BGYG 1A02F 1EZVI 2KSJA 2KOGA 1RQUA 4LC1A 4A7PA 2KIKA 2LKMA 1JY3P 4H0LD 3P8CD 3R2PA 3IFMA 3L74G 1SFCA 4WVZA 2RKLA 1X0TA 2KI7B 5DJTB 1FS0E 4DCKA 1NU1J 3CWBG 1ZMEC 1Q82Q 5KKZC 3O8ZA 4LLHA 1VQKP 1N7SA 1QGKB 4R4LA 2P1JA 2QG4A 3CX5H 1RHZB 2P10A 1N73A 3CC7P 2O01N 1KTMA 3WU2E 2E76D 3TF5A 3H1KE 1NTZE 2FBWC 4UB6H 3EFFK 1JMBA 1SP4A 1TU3F 3HD7B 4WY4A 2HYNA 2M3EA 3RBZA 5AW8B 1KQLA 1IK9A 2WSCH 4Y99B 1KQSO 1L0NJ 2WWWA 1NAFA 1PPJE 2W6JH 2QJKB 4IFMA 2I8DA 2E74D 4D6TD 1KMIZ 1EC5A 1J1DB
chains in the Genus database with same CATH topology
3WUTA 3WUVA 2Q6QA 1UIIA 2ZXXA 3WUUA 4BRYA 3F5HA 3E1RA 4BRYB 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUT A;  3WUV A;  2Q6Q A;  1UII A;  2ZXX A;  3WUU A;  4BRY A;  3F5H A;  3E1R A;  4BRY B;  2WVR A; 
#chains in the Genus database with same CATH topology
 2BCC J;  2IPP A;  2KLV A;  3WUV A;  1FJP A;  4K3A A;  5KAI E;  4WBA A;  5B5E E;  1EZV D;  1N86 A;  1GW4 A;  1YJN P;  1RF0 A;  1GL2 A;  3MD0 A;  1GK4 A;  5KLV E;  2OTK E;  4EDF A;  5KLV D;  1JY2 O;  2FFD A;  3A5T A;  2WPQ A;  1LGH B;  1WRG A;  4DZO A;  1IFM A;  2YMK A;  4YPC A;  1USD A;  4YXD C;  4DOJ A;  2PAJ A;  1P84 H;  2M5A A;  3E1R A;  3H1J D;  3L75 E;  1L4A C;  3CCU P;  5TIS E;  3AE1 C;  3V4W A;  1QEX A;  1X22 A;  2H88 C;  1JNM A;  1N7S D;  1T3U A;  2FFD C;  1KYO H;  1BCC E;  2Q1K A;  1RF0 C;  1GD2 E;  4U7J A;  1LTB C;  5APV A;  1AVY A;  2IBZ D;  4GKG A;  4PV1 D;  4WB4 A;  3SWK A;  3L70 E;  4DT0 A;  3WUU A;  1Q7Y Q;  2XU6 A;  2KNC A;  1EXI A;  2A06 E;  1DD4 A;  1M1J C;  1JEK A;  2O01 J;  2OQQ A;  3H1J G;  3CL3 D;  3L71 J;  4WWI A;  5AVX B;  5CCG A;  2A45 I;  1LJ2 A;  1SQP G;  2HFE D;  3AEF C;  3KQG A;  2J58 A;  1DEE G;  4W7Z A;  2D2C B;  4AQR D;  1BE3 J;  4IFD K;  1PV3 A;  2WZ7 A;  4UB8 H;  5E79 E;  1NKN A;  1SQQ K;  2V4H A;  2HOD A;  3VP8 A;  4ZKP A;  5GTI H;  1RF1 B;  2UWJ E;  3BCC G;  2QJP C;  4RES B;  2KZJ A;  2QJY B;  1S5L H;  1H0T B;  4C7N B;  3G9R A;  1AFO A;  3RL0 B;  3H1L G;  1IFD A;  2GUS A;  4KT0 J;  3O6Q A;  1OW8 A;  3RK2 C;  1RY3 A;  1NU1 E;  5AW5 B;  1LTG C;  1NVO A;  1SQX E;  3SWY A;  2QEX P;  1NYH A;  2N1T C;  1LNQ A;  5L8R J;  3Q3D A;  1UIX A;  3H1H D;  2ZXE B;  3V2P A;  1H89 A;  4U3F D;  1T3J A;  2DW3 A;  4U3F E;  1M8O B;  4IOI H;  1VQ8 P;  2OTL P;  2M5A B;  3GMA A;  3BCC D;  2W8Z A;  3LID A;  4WY4 C;  3UIA A;  2AEJ A;  2E74 B;  1KB9 H;  1P84 I;  2KLU A;  3D6Y A;  1SQV G;  5EFW B;  4KJM A;  2A06 D;  1U7M A;  2YIU B;  1L0L G;  3M0A A;  1AJY A;  3AE5 C;  2XZR A;  2YXR B;  4N3Y B;  5AVQ B;  1EDI A;  1NTM D;  3AE9 C;  1L0N E;  3E1I A;  1EXJ A;  3A0B E;  2C9N Y;  1PP9 J;  2W6B A;  1S2E A;  1SQQ E;  1LTS C;  3HTK A;  2ZYG A;  4HYT B;  1FE6 A;  1SQX J;  1XTC C;  3LW5 H;  2HPC B;  1NTZ K;  4CPG A;  1BSN A;  2PRR A;  3TDK A;  3V2N A;  2QM8 A;  3RL0 D;  3OJA B;  3MIW A;  1NTK G;  1KZU B;  3CXH I;  1PGO A;  1ZRT E;  2KP8 A;  1KIL D;  2YMY A;  1ZRT D;  3KHU A;  1ZN5 A;  1J2J B;  1VF5 D;  3CI9 A;  1W2B O;  3HE4 A;  1NTM K;  5APY A;  1SQB J;  1KFM A;  2QM7 A;  3D6Z A;  2NPS A;  1N73 C;  1G2C B;  1WT6 A;  2P7J A;  3I55 P;  3B71 A;  1S5L X;  1RF1 A;  1NTZ D;  2L91 A;  2QVA A;  1SFC D;  2G8Y A;  1MZ9 A;  2Y9Y A;  4OGQ D;  2ZYA A;  4ZMD A;  1AQ5 A;  2AXC A;  2PFX A;  1FU1 A;  4PD4 H;  3L73 G;  2J59 M;  2LR2 A;  2FYU D;  3L71 E;  1NHL A;  1NWQ A;  3II6 A;  2QIW A;  4H0L B;  4HKZ H;  1KYO I;  1PP9 D;  1BE3 G;  1KIL C;  2Q3I A;  1E5W A;  2M3B A;  3AE8 C;  5AVW B;  3V5B A;  3VN0 A;  2IX7 C;  2RMZ A;  1N8R Q;  2E75 B;  3HRN A;  2CPB A;  2JP3 A;  3MUD C;  1NTK J;  5KAI H;  1NTZ G;  1KIL B;  1USE A;  1FJK A;  2AXT H;  3A7O A;  3OAK A;  1DEB A;  2V7Q J;  3FXD A;  4H0L C;  3RK2 D;  3ITK A;  2FYU G;  3JCU H;  4OVN F;  3G71 P;  2RN0 A;  1E79 H;  1OVU A;  1SQB D;  4H13 B;  1NH4 A;  3RK3 E;  5K5G B;  2E42 A;  1SQV J;  1S9K E;  2OGU A;  1FZC B;  3M9Q A;  1DD3 A;  3CC4 P;  1Y47 A;  1OVV A;  5BU8 B;  1PPJ D;  3BAS A;  4GT1 A;  3D71 A;  1KC8 Q;  1N73 B;  2KSE A;  1LP1 B;  3L70 D;  3FWN A;  5APQ A;  2B9B A;  2OTJ P;  2JR8 A;  1NTM G;  1PGP A;  2MKV A;  1J1E B;  1LWU B;  2FXO A;  2K1A A;  3HUS A;  3SWF A;  3S1K A;  5CCH A;  3MZW B;  1URQ D;  1W2E A;  4IL6 E;  1H0T A;  4PJ0 H;  1ZLL A;  5AVV B;  1LTJ B;  4BRY A;  5CHX A;  1GDT A;  5AW9 B;  3V2Q A;  1HUC A;  1KQF B;  2FY8 A;  5H2F H;  2FYU J;  2R3C A;  1VQL P;  4TT3 H;  1YJ9 P;  1BSH A;  2VRS A;  3CX5 I;  3GLM A;  3H1H E;  4L76 A;  3HUS C;  2Q7C A;  3CXH D;  1S5L E;  4PV1 B;  4U3F J;  3SSU A;  2M0B A;  3TGU G;  5BU5 A;  1NTZ J;  1Q90 D;  3IF4 A;  3CCV P;  1FOS E;  2E5T A;  1CZQ A;  2K88 A;  2NPS C;  1L0N K;  4N78 D;  1MFT A;  1U7J A;  3TSI A;  3W67 A;  1H88 A;  2CPS A;  3JC2 2;  4Y28 J;  3IR9 A;  1OZH A;  3C8V A;  1VQ4 P;  2GM4 A;  2O01 H;  2Y9Z A;  3L36 A;  3AEA C;  3M9H A;  4L75 A;  2Q6Q A;  2Q3E A;  2XNX A;  5CJ0 A;  2ITA A;  3L73 D;  2XND H;  3S9O A;  1GL2 D;  3FGA D;  3ZDM A;  3N4X A;  4RO0 A;  2HPC A;  1DX7 A;  1JCD A;  1VQ6 P;  2KZI A;  3H1L E;  1YTZ I;  1FOS F;  3RL0 C;  2BEZ F;  2K3R A;  3VOP A;  1BGY J;  1PIX A;  3PRJ A;  1JY3 O;  2QJY C;  2Q5U A;  3V4Q A;  1FZE A;  3AE7 C;  2HLO A;  1FDI A;  3MUD A;  5KJ7 C;  5B5E H;  4H44 D;  2G3A A;  3MP7 B;  1OX3 A;  5APU A;  2HOD B;  5AVZ B;  3CCE P;  1JO5 A;  1G1J A;  1OFC X;  2YNY A;  3P8M C;  2BEQ D;  3CLQ A;  1VF5 C;  4I1L A;  2BCC G;  1VQ5 P;  2H7H A;  3AED C;  4C7N A;  1JUN A;  1S1C X;  1JY3 N;  1L0N G;  2WPR A;  2Y0D A;  2YO3 A;  2K37 A;  1R5S A;  1ZP0 C;  4JYB A;  2SPZ A;  2E43 A;  1AVO A;  3FXE A;  2ZT9 D;  3O6Q B;  1VL2 A;  1JY2 N;  5C39 A;  2WVR A;  1HF9 A;  1H8A A;  1Y8A A;  3L70 G;  2YKP A;  3AE4 C;  3PTZ A;  4H44 B;  2IFN A;  1QVG O;  2JEE A;  1URQ B;  2FFD B;  2FYU K;  2WMM A;  2FXP A;  1Y9B A;  5KJ7 D;  2H8P D;  1AQT A;  3L75 J;  4B86 A;  1KV4 A;  1SQP E;  1YBK A;  1S72 P;  3AEG C;  1U57 A;  4W7Y A;  5KAF E;  2ZXX A;  1OMI A;  3L4F A;  5AW6 B;  1IJD B;  3H25 A;  3RGU A;  1QVF O;  1JCC A;  5H2F E;  3H32 B;  3H1K G;  3GF3 A;  3B5N A;  2MJZ A;  4GOF A;  3VMY A;  4UB8 E;  4PD4 D;  5CCG C;  1FZF A;  3VTP C;  4ASW A;  2KUB A;  1J1D C;  4BWN A;  1RE4 A;  2HG5 D;  5KLI C;  1SQB K;  2QJK C;  2WT7 B;  1OVR A;  1S3J A;  1SS1 A;  1CSB A;  1ZXG A;  3GG2 A;  1RQV A;  1FZA A;  3PH0 A;  2KK7 A;  3B5N C;  4JF7 A;  4Y99 C;  1NJI Q;  5DJU B;  1N7L A;  1FAV A;  1YQ4 C;  2AEM A;  2ZAE B;  3HD7 C;  3S4R A;  1K8A Q;  3HE4 B;  5APS A;  4L73 A;  4YTP C;  3RK3 D;  1PGQ A;  2WPV B;  3H1I E;  4I6M C;  5KJ7 A;  1YI2 P;  1GL2 C;  3L72 E;  2M8R A;  2Y0E A;  3L72 D;  4ZKU A;  4D6T E;  1PP9 E;  2FYZ A;  3Q5S A;  3A0H H;  3H1J J;  5KKZ B;  2IBZ I;  1EZV E;  5CBO A;  2P2U A;  2AEF A;  3CX5 E;  4ASV A;  1ZW0 A;  1SQQ G;  3L74 D;  2IBZ G;  3FX0 A;  1EDK A;  1IK7 A;  1Z56 A;  3L74 E;  4RJT A;  1GL2 B;  2ZVO B;  2I1K A;  4NPE A;  3TYY A;  4EIJ A;  3OW2 O;  3KXD A;  3HD7 D;  1VQ9 P;  2XDJ A;  1SQB E;  3RK3 C;  3G6E P;  2XV5 A;  2JKV A;  3H32 A;  1NO4 A;  1SQX D;  3L72 J;  2FKW B;  3B5N B;  3A2A A;  1L0N D;  5E79 H;  5GTI E;  1ZR4 A;  3L35 A;  3PHL A;  3USS A;  5KLI B;  3CCL P;  3BAT A;  4N78 E;  1YTZ T;  3T97 B;  1GU5 A;  1FDM A;  4NPF X;  2OYH C;  3A0H E;  5APX A;  2YXQ B;  3F5H A;  3L75 G;  3U1A A;  1FZG A;  1JTH A;  4D6T G;  1L2P A;  1P84 E;  1QX8 A;  1BGY E;  4IFF A;  4MN4 C;  1KIL E;  1BGY D;  4W80 A;  3V2R A;  4XFJ A;  5AW7 B;  1MFZ A;  1SQX G;  1BCC G;  2C0X A;  3C9I A;  1SQX K;  3H1H G;  3KDP B;  4GOD A;  2WSS H;  1BE3 E;  2PP6 A;  3AE2 C;  5KLV G;  3VMZ A;  5GTH E;  1N7S C;  1URQ C;  4HJG H;  4H44 C;  1ZOY C;  1GZL A;  1SQP K;  3HD7 A;  5AVR B;  1L0L D;  1OW7 A;  1W5C E;  2E5Y A;  1LTJ A;  3CWB D;  5CCG D;  4JPZ B;  1M7L A;  4LGD E;  1YIT P;  3CD6 P;  1M56 D;  1K04 A;  1MV8 A;  1GK6 A;  2ZT9 C;  2AXT E;  1GTW A;  1CW5 A;  1CI6 A;  2B89 A;  2E76 C;  3L74 J;  1KD1 Q;  3V6I A;  1URQ A;  3WU2 H;  1VF5 B;  2IZ0 A;  1HTL C;  3BCC E;  3BRV B;  4UB6 E;  1HJB A;  1HBW A;  2FYN B;  2WQY C;  3H1K J;  2GA1 A;  3I56 P;  1MKM A;  2B87 B;  2JJL A;  1IFJ A;  1NTK E;  1SQP D;  3H1L D;  5CJ4 A;  2L5G B;  1NGM B;  1R5L A;  1P84 D;  4I7Z C;  4EI2 A;  1YHQ P;  4OGQ B;  3VYI A;  4C7R A;  1SFC B;  1X8Y A;  1IZN B;  2WSC J;  1EDJ A;  5TJH A;  2RH0 A;  1T2K C;  1LT9 B;  5AW4 B;  5TIS H;  1Q2N A;  5CCH C;  2N1T D;  2WT7 A;  3T97 A;  3CCS P;  1S9K D;  1L0L E;  2WTY A;  2KXP B;  1VQN P;  3QWO C;  4O9B A;  2C0W A;  2R3S A;  1HJ0 A;  3AE3 C;  3VMA A;  2PGD A;  1S4X A;  2IZ1 A;  2NPS B;  1JB0 J;  1LP1 A;  1OWA A;  3IN6 A;  3KPE A;  1K73 Q;  2ZFC A;  1T6A A;  5KTB A;  2OYO A;  2OYI B;  4PV1 C;  1LWU A;  3HUS B;  1VQ7 P;  3KZI H;  1FC2 C;  4KHX A;  1EDL A;  4D6T J;  1NKZ B;  2A06 G;  3KYQ A;  4EOT A;  3H1J E;  3L75 D;  3LIE A;  2R5B A;  2C9L Y;  1NTK D;  1M57 D;  3A0B H;  1GW3 A;  3GHG B;  1GU4 A;  4BXL A;  1HH0 A;  1LTJ C;  2R44 A;  2ZVN B;  1BCC D;  3M9B A;  3R4Y A;  1RH5 B;  2NPS D;  2Z5I A;  1NOH A;  4GDO A;  4K35 A;  1YIJ P;  2QRX A;  1J1E C;  1LWU C;  1FBM A;  1VPC A;  2B87 A;  2WSF H;  4DJG A;  4I2L C;  3H6P A;  1VDF A;  1IO4 A;  3E7K A;  2H89 C;  1PPJ G;  2YO2 A;  3KZI E;  2D2C D;  3F89 A;  4PD4 I;  2OAR A;  2WSE H;  2GUV A;  3L71 G;  4YXW H;  1FZC C;  1RE4 C;  3C1L A;  4IL6 X;  1PZQ A;  1VQP P;  2BCC E;  1FDO A;  2O1J A;  3EQ2 A;  3L70 J;  3PLN A;  4H13 C;  1RE3 A;  4U3F G;  2J5U A;  1Q81 Q;  4QMA A;  2CK3 H;  3HTK B;  2W83 C;  3BVH A;  1DIP A;  2V7Q H;  1SQV E;  3TK1 A;  1SQV D;  2WSE J;  2JDI H;  4PJ0 E;  1OXZ A;  2W90 A;  1KYO E;  3B5N D;  3M06 A;  4Z1M H;  2P58 A;  1NU1 K;  2E75 C;  1G1I A;  2FXM A;  3FWL A;  2W27 A;  1G2C A;  3OA7 A;  3CX5 D;  1YJW P;  2Z4E A;  1IC2 A;  2HR3 A;  2N9B A;  1X9V A;  1OIP A;  3MTU E;  4C46 A;  1UII A;  5B66 E;  3QH9 A;  3CWB E;  3GHG A;  1M1K Q;  2LXB A;  1HWT C;  1IFN A;  4M3L A;  3VMX A;  1L0L K;  1SQV K;  2JO1 A;  2O3J A;  3H1L J;  4JBZ A;  3SFD C;  3WUT A;  3CCM P;  4ZNC A;  4OWF A;  2Q9I A;  1NTM E;  5AVS B;  4JQ0 D;  1IFP A;  2FYU E;  3ABV C;  3LW5 J;  2I1J A;  3CXH E;  5GTH H;  3BCC J;  1KFN A;  1AA0 A;  3CCR P;  1GMJ A;  1A02 J;  5APW A;  2KYV A;  5AW2 B;  2NZ2 A;  3U1C A;  1M90 Q;  1SQP J;  3EFG A;  1IFI A;  1KQG B;  3A3Y B;  5AW0 B;  1Q86 Q;  3VP9 A;  2YKO A;  2WSF J;  3HE5 B;  2Y0C A;  3P8C E;  5APT A;  1YQ3 C;  2A45 H;  3NXS A;  4XA4 A;  1OW6 A;  3L73 E;  1NU1 G;  2KB7 P;  3CWB J;  3H1I G;  3Q5R A;  4L74 A;  1LT9 A;  2LXC B;  4IL6 H;  3GHG C;  4PD4 E;  3GF7 A;  1PP9 G;  3IAO A;  2P67 A;  1NAY A;  1K9M Q;  1BE3 D;  3MGN A;  2YKQ A;  5AVU B;  5BVZ A;  4GIF A;  5CCH D;  4R4M A;  3G4S P;  1JTH B;  1FZC A;  3SFE C;  3TNU B;  1JY2 P;  3NTN A;  4OH8 B;  1L0L J;  2JWA A;  1T2K D;  3I5C A;  2QSI A;  2OYI C;  3TNU A;  3CCQ P;  2IBZ E;  3JCU E;  1D7M A;  3W68 A;  2YIU C;  1KB9 I;  4N6J A;  3CMA P;  1LTT C;  2OYH A;  2E74 C;  2JWD A;  2W6A A;  2ZJS E;  3H1I D;  3L71 D;  4HH2 A;  4TLF A;  4WY4 B;  1R8E A;  3M0D A;  4BRY B;  4EYY Q;  2WIT A;  3GW6 A;  1SQB G;  1SVF A;  1EQ7 A;  1HGZ A;  1SLQ A;  1HVV A;  1T8Z A;  3G3Z A;  1QLE D;  1RE3 C;  1JMM A;  2N1T B;  3Q2Y A;  1VQM P;  1X79 B;  1SQQ J;  3RK2 B;  3D70 A;  1LT9 C;  3N7N A;  5M1B A;  5KLV K;  2XKM A;  3CPW O;  3MHV A;  3PJS K;  3Q5P A;  1CI6 B;  1NTK K;  1ZV8 A;  1LT1 A;  1SFC C;  2K9Y A;  1L4A D;  3H1H J;  4OGQ C;  4I7Z B;  1QL1 A;  2N9Y B;  1JOC A;  2QJP B;  4WY4 D;  1VQO P;  1RF1 C;  1KB9 D;  3CCJ P;  1N2D C;  3CC2 P;  1KIL A;  1KOR A;  2D2C C;  2FYN C;  2ZYD A;  3PP5 A;  2A45 G;  5CMZ A;  4NPD A;  3AE6 C;  4AYC A;  1M1J A;  1PGJ A;  1K05 A;  1HGV A;  2KS1 B;  2IDB A;  2IYO A;  2NRG A;  3RBX A;  3CXH H;  3L73 J;  3AEE C;  2E76 B;  3HE5 A;  4XE5 B;  1M1J B;  2KS1 A;  3P32 A;  3Q1M A;  4H13 D;  2O1K A;  2ZT9 B;  2H43 A;  3L72 G;  3TGU E;  2R32 A;  3TGU D;  2KNC B;  2B88 A;  1NTM J;  3NFQ A;  5AVT B;  1EZV G;  2QA4 P;  1FZB A;  5CBN A;  1MUU A;  1N7S B;  3M91 A;  1SQQ D;  3P7K A;  1DH3 A;  1KYO D;  4AUW A;  1BDC A;  1L4A B;  2Z5H A;  2BAS A;  3AEB C;  1NU1 D;  5AW1 B;  3B4S A;  1L4A A;  3JSV C;  4GOE A;  2OYI A;  3H1I J;  3RL0 g;  3CME P;  1BCC J;  5KAF H;  2WPS A;  1LTA C;  2E75 D;  2IYP A;  1KN7 A;  1KB9 E;  5AW3 B;  1PL5 A;  2K9J A;  3B8E B;  1YYC A;  3NMD A;  3TGU J;  3WMM 0;  2OYH B;  3H1K D;  4HB1 A;  1BDD A;  3L37 A;  2N1T A;  3AEC C;  3K5B A;  2K9J B;  4RKU J;  1PFI A;  1WMK A;  2IFM A;  2R5D A;  3EWK A;  5KLV J;  1ZR2 A;  1JM0 A;  3U59 A;  4JYC A;  3M0D C;  5B66 H;  3BRT B;  5AVY B;  3RK3 B;  1QL2 A;  1AV1 A;  2BCC D;  1LTI C;  2QE7 H;  1XTG B;  2POH A;  1BGY G;  1A02 F;  1EZV I;  2KSJ A;  2KOG A;  1RQU A;  4LC1 A;  4A7P A;  2KIK A;  2LKM A;  1JY3 P;  4H0L D;  3P8C D;  3R2P A;  3IFM A;  3L74 G;  1SFC A;  4WVZ A;  2RKL A;  1X0T A;  2KI7 B;  5DJT B;  1FS0 E;  4DCK A;  1NU1 J;  3CWB G;  1ZME C;  1Q82 Q;  5KKZ C;  3O8Z A;  4LLH A;  1VQK P;  1N7S A;  1QGK B;  4R4L A;  2P1J A;  2QG4 A;  3CX5 H;  1RHZ B;  2P10 A;  1N73 A;  3CC7 P;  2O01 N;  1KTM A;  3WU2 E;  2E76 D;  3TF5 A;  3H1K E;  1NTZ E;  2FBW C;  4UB6 H;  3EFF K;  1JMB A;  1SP4 A;  1TU3 F;  3HD7 B;  4WY4 A;  2HYN A;  2M3E A;  3RBZ A;  5AW8 B;  1KQL A;  1IK9 A;  2WSC H;  4Y99 B;  1KQS O;  1L0N J;  2WWW A;  1NAF A;  1PPJ E;  2W6J H;  2QJK B;  4IFM A;  2I8D A;  2E74 D;  4D6T D;  1KMI Z;  1EC5 A;  1J1D B; 
#chains in the Genus database with same CATH homology
 3WUT A;  3WUV A;  2Q6Q A;  1UII A;  2ZXX A;  3WUU A;  4BRY A;  3F5H A;  3E1R A;  4BRY B;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...