1UIIA

Crystal structure of geminin coiled-coil domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
61
structure length
61
Chain Sequence
ENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Geminin
publication title A dimerized coiled-coil domain and an adjoining part of geminin interact with two sites on Cdt1 for replication inhibition
pubmed doi rcsb
source organism Homo sapiens
molecule tags Cell cycle
total genus 28
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 1uiiA00
3WUUA 2ZXXA 3F5HA 3WUVA 4BRYB 1UIIA 3E1RA 3WUTA 2Q6QA 4BRYA 2WVRA
chains in the Genus database with same CATH superfamily
2POHA 1DIPA 4IFDK 2KNCB 5AW3B 1LWUC 1FS0E 1N7SA 2BCCJ 2ZYDA 2L91A 2YMYA 3L36A 3D71A 2IYOA 1P84E 4O9BA 3SWKA 3OAKA 1GDTA 1IFIA 4HYTB 2H89C 3AEGC 4XFJA 1YQ3C 2ZYAA 5TISE 1CI6B 1P84H 1L0LE 2FFDC 1NTKE 2K37A 2Y0CA 4LGDE 5APWA 3JCUE 5TISH 3TGUD 4BRYB 3G9RA 1SQXD 1MFTA 1M1JC 3L74D 3Q3DA 1QVGO 2P58A 3HUSA 1H89A 3JCUH 2B88A 1U7MA 3VN0A 1LT9C 2Y0DA 2H8PD 3PP5A 1JY3P 1SQQD 4IL6X 2WQYC 3HRNA 4H0LD 4JYCA 1IFDA 4D6TD 3K5BA 3TGUE 1KZUB 1M57D 1NTKK 5CCHC 1SQXE 5AVSB 3U1AA 3L74E 2R5BA 2V4HA 1CZQA 2BEZF 4L74A 3RL0C 3CCEP 3CMEP 2OYHB 3EWKA 4NPDA 2KIKA 1S4XA 1JO5A 1GL2A 2KSEA 3H1HD 2JP3A 2QM7A 1N86A 2QJKC 3CX5D 2WZ7A 1SQQE 3EQ2A 1GW3A 3CCJP 3A7OA 1VL2A 2IX7C 2OYIC 1VQ5P 4D6TE 3I56P 1OVUA 2N1TB 1M56D 1PZQA 2HPCA 3HE5B 5KKZC 1OX3A 3II6A 3A0BE 2WPQA 1A02J 5AVQB 1SQXK 2OTKE 3P8MC 1S5LX 5L8RJ 1LWUB 1FJPA 2KYVA 3R4YA 3A0BH 1Y9BA 3H1HE 1LP1B 1EZVD 2KZIA 3M9HA 3MD0A 3CX5E 1OVVA 2V7QJ 1RF1A 3CI9A 1NTZG 2Z4EA 1BE3G 2W27A 2I1KA 1VF5C 3L37A 2QJYB 1WT6A 5DJTB 3CX5H 1SQQK 1M8OB 1BGYG 2FFDB 1BE3J 3L72J 2A45G 2QVAA 1IFNA 2QRXA 4OWFA 3BVHA 4N6JA 3AE6C 3AEDC 1IO4A 1IFJA 1KYOI 3RK2D 1KORA 3BCCJ 1OW8A 5E79E 1FC2C 1M1JB 2Q3IA 1S72P 1BCCG 1USEA 1EZVE 2JR8A 2B9BA 3R2PA 1NJIQ 3F5HA 3L70D 5E79H 1ZMEC 1FOSE 3CCUP 3C8VA 1RQUA 4IOIH 3FXEA 2N9YB 4W7YA 1RE3C 1GK4A 4JPZB 1NYHA 1PGPA 2ZT9C 3PRJA 2LR2A 2XKMA 1KB9I 2KLUA 4RJTA 3RK3C 1JY2N 4R4MA 3H1ID 2O1KA 2NZ2A 3AE2C 5CJ0A 3W67A 1Q2NA 3GHGA 3RL0B 1HJ0A 4DZOA 3D70A 5CCGD 1KD1Q 3L70E 3NTNA 1S9KD 3U59A 3LIEA 2QJKB 3E7KA 4Y99C 1YTZT 3B4SA 1L0ND 1VQLP 3S9OA 1PGOA 1RF0A 4WY4A 2E43A 2C9LY 3CXHI 2OYIB 1SFCA 1FZEA 3HTKA 5KKZB 3H1IE 3VMXA 3B5NA 1T3JA 4RO0A 4EI2A 2HYNA 2HODA 1KV4A 3FX0A 2K9YA 1S9KE 1NOHA 1LT9A 2R5DA 1NTZD 1JY3O 3SWFA 3T97B 1L0NE 2KLVA 2N1TD 1CW5A 3I55P 1PGQA 1NAFA 3P32A 1VQ8P 1QGKB 1R5LA 5KJ7D 1BGYD 1VF5B 1MUUA 1VQOP 2P7JA 2K1AA 1QEXA 2IFMA 3GLMA 4C7RA 5BU5A 1L0LG 4ZMDA 1OIPA 5AVYB 2E75B 2NPSA 1NTKG 2M3EA 1FE6A 2HLOA 1LTTC 1SP4A 2RMZA 1SQVD 3ITKA 4JQ0D 2CK3H 2OQQA 2P1JA 2FYUD 1NTKJ 2JEEA 2Q5UA 3KYQA 1PFIA 1NTZE 4AYCA 1KYOD 2MJZA 1JY2P 4UB8E 2B89A 1K05A 1L0NK 1NH4A 3VMYA 1BGYE 3AE7C 5AW9B 3N7NA 5AVXB 3MUDA 5AW2B 1JUNA 1K73Q 3KHUA 1ZR2A 1QLED 5GTIE 2ZT9B 4UB8H 2PGDA 1G2CB 2L5GB 1J1DC 1LNQA 5AVRB 3BATA 2A45H 3RK3B 3V2RA 1SQVE 3IAOA 3TGUG 1MV8A 2OGUA 5GTIH 2KZJA 2J5UA 2E76B 3H32B 1N8RQ 3KXDA 3CWBG 1EDKA 2GUSA 1KB9D 2QA4P 2ZFCA 2Q3EA 5AW7B 3TGUJ 1KYOE 1SQXJ 1NTZK 1KMIZ 1L4AC 3B8EB 3VMZA 4Y99B 3L74J 4H44C 2AXTE 2KB7P 3GG2A 5CCHD 2ITAA 1SQPD 1DH3A 3QH9A 1JTHA 2O01N 1KYOH 1SQQG 1IFPA 5APTA 3RL0D 4XA4A 3VOPA 2AXTH 2W90A 2N9BA 4D6TG 1G1JA 1OW6A 5AW4B 1SQQJ 2FYNC 5H2FE 2OYHC 1VQPP 2M5AA 2YKOA 4HKZH 3CXHD 1SQVK 2JWDA 3L4FA 4D6TJ 1KB9E 1OVRA 4DCKA 1QL2A 3JSVC 5H2FH 1AVOA 3SSUA 3H1HG 2HR3A 3HE4A 2JKVA 1N73C 3FWNA 2KXPB 1SQPE 2ZVNB 1KB9H 5KLVD 4C7NB 2PP6A 1FU1A 3H1HJ 2XNXA 2E74C 1PPJG 2K3RA 3NMDA 2WSEH 1NKZB 3GF7A 2C9NY 1IJDB 3OJAB 2OTLP 2QM8A 5APXA 3A0HE 1KQLA 4I6MC 5AW6B 1FZCC 2JJLA 1K04A 3O6QA 4WWIA 2O1JA 1D7MA 1VF5D 2O3JA 2Z5IA 3MGNA 3A0HH 1HVVA 1EZVG 2IZ1A 2Q1KA 5KLVE 3CCVP 2QJYC 3USSA 2JO1A 4I2LC 2J59M 2GA1A 2IYPA 1LTGC 5AW8B 1SQPK 2LXCB 1A02F 1Q86Q 3M06A 2P67A 3E1RA 1J1DB 3PTZA 1W2BO 2W6BA 5KLIC 3CWBD 2A06D 2FXOA 4U3FD 5GTHE 3V4WA 2PRRA 2ZXEB 3IFMA 2D2CC 1Y47A 3SWYA 1URQB 1YI2P 3MZWB 2ZT9D 1L4AB 1ZLLA 3L70G 5GTHH 4H44B 2J58A 1KN7A 2QEXP 3RK3D 2WTYA 5KLVK 4AUWA 1J1EC 3CL3D 1SVFA 1YBKA 1OMIA 2WITA 1L0LK 1JMBA 2KNCA 4ZKUA 1T6AA 3CD6P 4GKGA 2H88C 1EQ7A 1LTBC 3V6IA 1FZGA 1NO4A 3CWBE 2A06E 3H1IG 2FYNB 4U3FE 2XU6A 1VQKP 4PD4I 1JY2O 1K9MQ 2WSFH 3BRVB 1OWAA 3H1IJ 2Y9ZA 1NTMD 4TLFA 1CI6A 1BSHA 2XZRA 1N73B 3L71G 3D6ZA 4WVZA 3RK3E 1L0NG 1KTMA 2W6JH 1EXJA 3AEEC 2R44A 3RBZA 1UIXA 1PPJD 1FDOA 4BRYA 4I7ZC 3O8ZA 2CPSA 2E74B 1L0NJ 5BU8B 3VYIA 5AVUB 1M1KQ 5CJ4A 3HD7C 1G1IA 3I5CA 3A5TA 1YTZI 2KUBA 5EFWB 2BCCD 2YXRB 1LTJB 5APVA 1FZCB 1S2EA 3WMM0 1EXIA 1HGVA 1T3UA 1NTME 1GK6A 1RHZB 3M91A 5CCGA 2B87B 3IN6A 2H7HA 4NPEA 5BVZA 1PPJE 2NRGA 1XTGB 3VTPC 1GTWA 3Q5SA 1KILC 1NTZJ 3VP9A 2IFNA 4ASWA 2E75C 3AE5C 1VPCA 2OYHA 3WU2E 2E5YA 1BGYJ 2BCCE 2LKMA 5B5EE 2K9JB 3TDKA 5APUA 5KLIB 1IC2A 2KS1B 1SQVG 4ASVA 3EFFK 2FYUG 2WPVB 4OGQB 4YTPC 2D2CB 3WU2H 5B66E 3Q1MA 3G71P 5B5EH 1NTMK 1SQVJ 1BCCJ 1R8EA 2N1TA 3FXDA 5KAIE 5B66H 3HE5A 1AFOA 1PP9D 5KJ7A 3N4XA 1J1EB 1AV1A 2DW3A 5CBOA 4TT3H 1LWUA 5KAIH 3AEFC 3EFGA 1LP1A 1L4AD 2E76C 1EDJA 1X79B 4H44D 2FXMA 2RKLA 3QWOC 1DD4A 5AW1B 4YXDC 3L71D 2WSCH 1PV3A 1KQGB 2FFDA 1VQ9P 2WT7B 1N7SC 3KDPB 1EC5A 1PP9E 3RGUA 4GT1A 1RE4C 4WB4A 1SQPG 1NU1D 4UB6E 3H1JD 2R3CA 1GU5A 4I7ZB 1DD3A 2CPBA 1M1JA 1N7LA 2WSEJ 1S3JA 1YITP 1SQPJ 3HD7B 4UB6H 1J2JB 4QMAA 5DJUB 2Y9YA 3PLNA 4H13B 3L71E 2IBZI 1P84I 1JNMA 1KQFB 2E74D 1AJYA 1W5CE 1HWTC 2KOGA 1NU1E 3H1JE 5KLVG 4HH2A 5CHXA 2YIUC 4GDOA 5CCHA 3OW2O 1KILB 2M3BA 1KQSO 1OXZA 4GOFA 5KLVJ 3PHLA 3WUTA 1OFCX 3BCCD 1ZRTD 1L0LJ 3LW5H 3NFQA 3H25A 2Z5HA 1N2DC 2OYIA 1H8AA 3TNUB 2YKPA 2WPRA 1ZP0C 3V4QA 1NU1K 1GL2C 1VQ7P 2D2CD 3BCCE 3S4RA 1YHQP 1ZRTE 4PJ0E 4W80A 2FYUE 3T97A 2A06G 2IPPA 3ABVC 4U3FG 1AVYA 1SQBD 1URQC 3AE4C 1MFZA 2QJPC 1LT1A 1NGMB 4PJ0H 1HBWA 3OA7A 4C46A 2WSFJ 3H1LG 1LJ2A 3CWBJ 1AQ5A 4U3FJ 2AEJA 5AVZB 1KILA 1FOSF 4AQRD 4WBAA 2ZJSE 3L73D 4IFMA 1N7SB 3RBXA 1VQMP 3M0DC 4B86A 1VQ4P 2YO2A 4KT0J 3V5BA 3CCQP 3LIDA 1Q90D 3AE3C 1JOCA 4A7PA 2PFXA 3F89A 1VQNP 1MKMA 1WMKA 1OZHA 2FYUK 1SQBE 2QG4A 3AECC 1FZFA 4I1LA 1Q82Q 3CX5I 3TF5A 1NTMG 1RE3A 1VQ6P 3VP8A 3L73E 5AW5B 4BXLA 2R32A 3M0AA 1G2CA 3MP7B 3HD7D 2IBZD 4IL6E 1P84D 1U7JA 3HUSB 1NTMJ 2YIUB 2C0WA 3TYYA 3NXSA 4HB1A 1YJ9P 1TU3F 4DJGA 4KJMA 4YXWH 4M3LA 3H32A 4JF7A 3CXHE 4IL6H 2Q6QA 1LTJC 2IZ0A 2HG5D 2BCCG 1GZLA 3H6PA 2M0BA 4L76A 1PIXA 1SQBK 2W83C 2ZAEB 3CXHH 1KILD 1ZR4A 3M9BA 1RE4A 4CPGA 2E75D 2YO3A 1FJKA 3E1IA 3SFDC 2IBZE 3GHGC 3RK2B 3H1KD 1JB0J 1W2EA 2WWWA 1GL2B 1ZOYC 2QSIA 5AVVB 2H43A 4L75A 1E5WA 1PL5A 2FKWB 4N3YB 3L75D 1RF0C 4WY4C 1S5LE 1NKNA 1IK7A 1H0TB 4OGQC 1T2KC 1SFCC 2YMKA 1GU4A 4C7NA 3H1LD 1KILE 2OARA 2HPCB 3CCLP 2QJPB 2OTJP 1S5LH 3GMAA 4EYYQ 3B5NC 4NPFX 1NAYA 3TK1A 2WSCJ 3C1LA 1Q7YQ 1QL1A 3A2AA 2Q9IA 3KPEA 3H1KE 4DOJA 3L70J 1HGZA 1PP9G 2E76D 1T8ZA 2Y0EA 2AEFA 1RF1B 3P8CD 3L75E 2I1JA 3GF3A 1PP9J 3G4SP 2ZVOB 4L73A 2ZXXA 4EDFA 3H1LE 1N7SD 1LTAC 2G8YA 1X0TA 3V2PA 3CC4P 2NPSC 2MKVA 3VMAA 1DEBA 4HJGH 2OYOA 2YNYA 1R5SA 1EDIA 2KSJA 4RESB 2YKQA 3L71J 2M8RA 1NU1G 3H1JG 1NHLA 2O01H 2WSSH 4JBZA 4EOTA 2E5TA 2WVRA 3P8CE 4LC1A 3CCMP 4W7ZA 1H0TA 1KC8Q 1X9VA 1NU1J 3H1JJ 3MUDC 1URQA 4H13C 2FBWC 1ZW0A 3IR9A 1L4AA 1LTSC 3LW5J 4Y28J 1FAVA 4PV1C 1IZNB 2W8ZA 3W68A 1S1CX 1VDFA 3M0DA 2QIWA 2A45I 3GHGB 3Q5PA 1H88A 2FXPA 1DX7A 1HF9A 3L72G 4Z1MH 2XDJA 1FZAA 1IK9A 3BCCG 1KFMA 4WY4B 1GD2E 3AEAC 1N73A 1EDLA 2GUVA 1SFCB 3L35A 2Q7CA 3HTKB 1JCCA 1GL2D 3WUUA 2BEQD 3B5NB 2FYUJ 5APSA 3CC7P 1Q81Q 2PAJA 1L2PA 2LXBA 3MIWA 2GM4A 3AE1C 3V2QA 4GOEA 2HODB 4OVNF 5TJHA 1LT9B 3CPWO 1ZV8A 1Z56A 1LTJA 1FZCA 3KZIE 3AE9C 1URQD 1AA0A 1M90Q 3MHVA 2B87A 2KI7B 3KZIH 2P2UA 1BDDA 1U57A 2K88A 1SQBG 4H0LC 1E79H 2NPSB 3M9QA 4N78D 4PD4D 1NWQA 1NVOA 3JC22 1BDCA 1JM0A 1SQBJ 2UWJE 3L73G 2IDBA 1FDMA 2G3AA 2JDIH 1SLQA 2R3SA 1YYCA 1RH5B 2K9JA 3G6EP 5APYA 3FWLA 1GW4A 2KS1A 2E42A 1M7LA 3L73J 2JWAA 2AEMA 2AXCA 1KFNA 2XV5A 3C9IA 3U1CA 5AVTB 4PV1B 4N78E 1AQTA 4PD4E 4KHXA 1PGJA 4ZKPA 1FDIA 2KK7A 3HUSC 1BE3D 3GW6A 3L72D 3ZDMA 5KTBA 4PD4H 2IBZG 3CCRP 4K35A 1MZ9A 3AE8C 1Y8AA 1ZN5A 5APQA 5C39A 1XTCC 1JTHB 1SS1A 4BWNA 2WT7A 2BASA 3G3ZA 3UIAA 1BCCD 3TSIA 3P7KA 2WPSA 2FYZA 3S1KA 2YXQB 1FZBA 1GMJA 3CC2P 3BASA 2V7QH 2M5AB 2W6AA 1OW7A 1YJNP 1BE3E 3RK2C 3L72E 2RN0A 4WY4D 5CBNA 3HD7A 1JMMA 1JCDA 4K3AA 3H1KG 4XE5B 4JYBA 4OGQD 1YIJP 3HE4B 1JEKA 1T2KD 1SFCD 1X22A 4LLHA 4U7JA 1DEEG 1HH0A 4IFFA 3H1KJ 2FY8A 3AEBC 3B5ND 3L75G 3WUVA 1LGHB 4GIFA 5K5GB 2QE7H 2VRSA 1BCCE 3MTUE 1SQXG 4H0LB 3PJSK 3Q2YA 3L75J 1BSNA 3L74G 1LTIC 1RQVA 4DT0A 5AVWB 1RY3A 3B71A 3H1LJ 3O6QB 2SPZA 1CSBA 1YQ4C 3KQGA 3BRTB 5CCGC 2KP8A 1ZXGA 5CMZA 1RF1C 2O01J 1X8YA 2WMMA 3CMAP 3IF4A 2HFED 1QX8A 2NPSD 3D6YA 4R4LA 3V2NA 1IFMA 1UIIA 1QVFO 1K8AQ 2RH0A 3A3YB 3TNUA 1FBMA 4MN4C 1JY3N 2ZYGA 1USDA 4RKUJ 2I8DA 1HUCA 3CCSP 4YPCA 3Q5RA 1WRGA 5M1BA 2C0XA 5KAFE 3RL0g 2XNDH 5AW0B 4ZNCA 4OH8B 4H13D 3FGAD 1YJWP 4EIJA 2N1TC 2P10A 1L0LD 4PV1D 1HTLC 3CLQA 3PH0A 1HJBA 3SFEC 1NTKD 5KAFH 5KJ7C 4GODA 1EZVI
chains in the Genus database with same CATH topology
3WUUA 2ZXXA 3F5HA 3WUVA 4BRYB 1UIIA 3E1RA 3WUTA 2Q6QA 4BRYA 2WVRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WUU A;  2ZXX A;  3F5H A;  3WUV A;  4BRY B;  1UII A;  3E1R A;  3WUT A;  2Q6Q A;  4BRY A;  2WVR A; 
#chains in the Genus database with same CATH topology
 2POH A;  1DIP A;  4IFD K;  2KNC B;  5AW3 B;  1LWU C;  1FS0 E;  1N7S A;  2BCC J;  2ZYD A;  2L91 A;  2YMY A;  3L36 A;  3D71 A;  2IYO A;  1P84 E;  4O9B A;  3SWK A;  3OAK A;  1GDT A;  1IFI A;  4HYT B;  2H89 C;  3AEG C;  4XFJ A;  1YQ3 C;  2ZYA A;  5TIS E;  1CI6 B;  1P84 H;  1L0L E;  2FFD C;  1NTK E;  2K37 A;  2Y0C A;  4LGD E;  5APW A;  3JCU E;  5TIS H;  3TGU D;  4BRY B;  3G9R A;  1SQX D;  1MFT A;  1M1J C;  3L74 D;  3Q3D A;  1QVG O;  2P58 A;  3HUS A;  1H89 A;  3JCU H;  2B88 A;  1U7M A;  3VN0 A;  1LT9 C;  2Y0D A;  2H8P D;  3PP5 A;  1JY3 P;  1SQQ D;  4IL6 X;  2WQY C;  3HRN A;  4H0L D;  4JYC A;  1IFD A;  4D6T D;  3K5B A;  3TGU E;  1KZU B;  1M57 D;  1NTK K;  5CCH C;  1SQX E;  5AVS B;  3U1A A;  3L74 E;  2R5B A;  2V4H A;  1CZQ A;  2BEZ F;  4L74 A;  3RL0 C;  3CCE P;  3CME P;  2OYH B;  3EWK A;  4NPD A;  2KIK A;  1S4X A;  1JO5 A;  1GL2 A;  2KSE A;  3H1H D;  2JP3 A;  2QM7 A;  1N86 A;  2QJK C;  3CX5 D;  2WZ7 A;  1SQQ E;  3EQ2 A;  1GW3 A;  3CCJ P;  3A7O A;  1VL2 A;  2IX7 C;  2OYI C;  1VQ5 P;  4D6T E;  3I56 P;  1OVU A;  2N1T B;  1M56 D;  1PZQ A;  2HPC A;  3HE5 B;  5KKZ C;  1OX3 A;  3II6 A;  3A0B E;  2WPQ A;  1A02 J;  5AVQ B;  1SQX K;  2OTK E;  3P8M C;  1S5L X;  5L8R J;  1LWU B;  1FJP A;  2KYV A;  3R4Y A;  3A0B H;  1Y9B A;  3H1H E;  1LP1 B;  1EZV D;  2KZI A;  3M9H A;  3MD0 A;  3CX5 E;  1OVV A;  2V7Q J;  1RF1 A;  3CI9 A;  1NTZ G;  2Z4E A;  1BE3 G;  2W27 A;  2I1K A;  1VF5 C;  3L37 A;  2QJY B;  1WT6 A;  5DJT B;  3CX5 H;  1SQQ K;  1M8O B;  1BGY G;  2FFD B;  1BE3 J;  3L72 J;  2A45 G;  2QVA A;  1IFN A;  2QRX A;  4OWF A;  3BVH A;  4N6J A;  3AE6 C;  3AED C;  1IO4 A;  1IFJ A;  1KYO I;  3RK2 D;  1KOR A;  3BCC J;  1OW8 A;  5E79 E;  1FC2 C;  1M1J B;  2Q3I A;  1S72 P;  1BCC G;  1USE A;  1EZV E;  2JR8 A;  2B9B A;  3R2P A;  1NJI Q;  3F5H A;  3L70 D;  5E79 H;  1ZME C;  1FOS E;  3CCU P;  3C8V A;  1RQU A;  4IOI H;  3FXE A;  2N9Y B;  4W7Y A;  1RE3 C;  1GK4 A;  4JPZ B;  1NYH A;  1PGP A;  2ZT9 C;  3PRJ A;  2LR2 A;  2XKM A;  1KB9 I;  2KLU A;  4RJT A;  3RK3 C;  1JY2 N;  4R4M A;  3H1I D;  2O1K A;  2NZ2 A;  3AE2 C;  5CJ0 A;  3W67 A;  1Q2N A;  3GHG A;  3RL0 B;  1HJ0 A;  4DZO A;  3D70 A;  5CCG D;  1KD1 Q;  3L70 E;  3NTN A;  1S9K D;  3U59 A;  3LIE A;  2QJK B;  3E7K A;  4Y99 C;  1YTZ T;  3B4S A;  1L0N D;  1VQL P;  3S9O A;  1PGO A;  1RF0 A;  4WY4 A;  2E43 A;  2C9L Y;  3CXH I;  2OYI B;  1SFC A;  1FZE A;  3HTK A;  5KKZ B;  3H1I E;  3VMX A;  3B5N A;  1T3J A;  4RO0 A;  4EI2 A;  2HYN A;  2HOD A;  1KV4 A;  3FX0 A;  2K9Y A;  1S9K E;  1NOH A;  1LT9 A;  2R5D A;  1NTZ D;  1JY3 O;  3SWF A;  3T97 B;  1L0N E;  2KLV A;  2N1T D;  1CW5 A;  3I55 P;  1PGQ A;  1NAF A;  3P32 A;  1VQ8 P;  1QGK B;  1R5L A;  5KJ7 D;  1BGY D;  1VF5 B;  1MUU A;  1VQO P;  2P7J A;  2K1A A;  1QEX A;  2IFM A;  3GLM A;  4C7R A;  5BU5 A;  1L0L G;  4ZMD A;  1OIP A;  5AVY B;  2E75 B;  2NPS A;  1NTK G;  2M3E A;  1FE6 A;  2HLO A;  1LTT C;  1SP4 A;  2RMZ A;  1SQV D;  3ITK A;  4JQ0 D;  2CK3 H;  2OQQ A;  2P1J A;  2FYU D;  1NTK J;  2JEE A;  2Q5U A;  3KYQ A;  1PFI A;  1NTZ E;  4AYC A;  1KYO D;  2MJZ A;  1JY2 P;  4UB8 E;  2B89 A;  1K05 A;  1L0N K;  1NH4 A;  3VMY A;  1BGY E;  3AE7 C;  5AW9 B;  3N7N A;  5AVX B;  3MUD A;  5AW2 B;  1JUN A;  1K73 Q;  3KHU A;  1ZR2 A;  1QLE D;  5GTI E;  2ZT9 B;  4UB8 H;  2PGD A;  1G2C B;  2L5G B;  1J1D C;  1LNQ A;  5AVR B;  3BAT A;  2A45 H;  3RK3 B;  3V2R A;  1SQV E;  3IAO A;  3TGU G;  1MV8 A;  2OGU A;  5GTI H;  2KZJ A;  2J5U A;  2E76 B;  3H32 B;  1N8R Q;  3KXD A;  3CWB G;  1EDK A;  2GUS A;  1KB9 D;  2QA4 P;  2ZFC A;  2Q3E A;  5AW7 B;  3TGU J;  1KYO E;  1SQX J;  1NTZ K;  1KMI Z;  1L4A C;  3B8E B;  3VMZ A;  4Y99 B;  3L74 J;  4H44 C;  2AXT E;  2KB7 P;  3GG2 A;  5CCH D;  2ITA A;  1SQP D;  1DH3 A;  3QH9 A;  1JTH A;  2O01 N;  1KYO H;  1SQQ G;  1IFP A;  5APT A;  3RL0 D;  4XA4 A;  3VOP A;  2AXT H;  2W90 A;  2N9B A;  4D6T G;  1G1J A;  1OW6 A;  5AW4 B;  1SQQ J;  2FYN C;  5H2F E;  2OYH C;  1VQP P;  2M5A A;  2YKO A;  4HKZ H;  3CXH D;  1SQV K;  2JWD A;  3L4F A;  4D6T J;  1KB9 E;  1OVR A;  4DCK A;  1QL2 A;  3JSV C;  5H2F H;  1AVO A;  3SSU A;  3H1H G;  2HR3 A;  3HE4 A;  2JKV A;  1N73 C;  3FWN A;  2KXP B;  1SQP E;  2ZVN B;  1KB9 H;  5KLV D;  4C7N B;  2PP6 A;  1FU1 A;  3H1H J;  2XNX A;  2E74 C;  1PPJ G;  2K3R A;  3NMD A;  2WSE H;  1NKZ B;  3GF7 A;  2C9N Y;  1IJD B;  3OJA B;  2OTL P;  2QM8 A;  5APX A;  3A0H E;  1KQL A;  4I6M C;  5AW6 B;  1FZC C;  2JJL A;  1K04 A;  3O6Q A;  4WWI A;  2O1J A;  1D7M A;  1VF5 D;  2O3J A;  2Z5I A;  3MGN A;  3A0H H;  1HVV A;  1EZV G;  2IZ1 A;  2Q1K A;  5KLV E;  3CCV P;  2QJY C;  3USS A;  2JO1 A;  4I2L C;  2J59 M;  2GA1 A;  2IYP A;  1LTG C;  5AW8 B;  1SQP K;  2LXC B;  1A02 F;  1Q86 Q;  3M06 A;  2P67 A;  3E1R A;  1J1D B;  3PTZ A;  1W2B O;  2W6B A;  5KLI C;  3CWB D;  2A06 D;  2FXO A;  4U3F D;  5GTH E;  3V4W A;  2PRR A;  2ZXE B;  3IFM A;  2D2C C;  1Y47 A;  3SWY A;  1URQ B;  1YI2 P;  3MZW B;  2ZT9 D;  1L4A B;  1ZLL A;  3L70 G;  5GTH H;  4H44 B;  2J58 A;  1KN7 A;  2QEX P;  3RK3 D;  2WTY A;  5KLV K;  4AUW A;  1J1E C;  3CL3 D;  1SVF A;  1YBK A;  1OMI A;  2WIT A;  1L0L K;  1JMB A;  2KNC A;  4ZKU A;  1T6A A;  3CD6 P;  4GKG A;  2H88 C;  1EQ7 A;  1LTB C;  3V6I A;  1FZG A;  1NO4 A;  3CWB E;  2A06 E;  3H1I G;  2FYN B;  4U3F E;  2XU6 A;  1VQK P;  4PD4 I;  1JY2 O;  1K9M Q;  2WSF H;  3BRV B;  1OWA A;  3H1I J;  2Y9Z A;  1NTM D;  4TLF A;  1CI6 A;  1BSH A;  2XZR A;  1N73 B;  3L71 G;  3D6Z A;  4WVZ A;  3RK3 E;  1L0N G;  1KTM A;  2W6J H;  1EXJ A;  3AEE C;  2R44 A;  3RBZ A;  1UIX A;  1PPJ D;  1FDO A;  4BRY A;  4I7Z C;  3O8Z A;  2CPS A;  2E74 B;  1L0N J;  5BU8 B;  3VYI A;  5AVU B;  1M1K Q;  5CJ4 A;  3HD7 C;  1G1I A;  3I5C A;  3A5T A;  1YTZ I;  2KUB A;  5EFW B;  2BCC D;  2YXR B;  1LTJ B;  5APV A;  1FZC B;  1S2E A;  3WMM 0;  1EXI A;  1HGV A;  1T3U A;  1NTM E;  1GK6 A;  1RHZ B;  3M91 A;  5CCG A;  2B87 B;  3IN6 A;  2H7H A;  4NPE A;  5BVZ A;  1PPJ E;  2NRG A;  1XTG B;  3VTP C;  1GTW A;  3Q5S A;  1KIL C;  1NTZ J;  3VP9 A;  2IFN A;  4ASW A;  2E75 C;  3AE5 C;  1VPC A;  2OYH A;  3WU2 E;  2E5Y A;  1BGY J;  2BCC E;  2LKM A;  5B5E E;  2K9J B;  3TDK A;  5APU A;  5KLI B;  1IC2 A;  2KS1 B;  1SQV G;  4ASV A;  3EFF K;  2FYU G;  2WPV B;  4OGQ B;  4YTP C;  2D2C B;  3WU2 H;  5B66 E;  3Q1M A;  3G71 P;  5B5E H;  1NTM K;  1SQV J;  1BCC J;  1R8E A;  2N1T A;  3FXD A;  5KAI E;  5B66 H;  3HE5 A;  1AFO A;  1PP9 D;  5KJ7 A;  3N4X A;  1J1E B;  1AV1 A;  2DW3 A;  5CBO A;  4TT3 H;  1LWU A;  5KAI H;  3AEF C;  3EFG A;  1LP1 A;  1L4A D;  2E76 C;  1EDJ A;  1X79 B;  4H44 D;  2FXM A;  2RKL A;  3QWO C;  1DD4 A;  5AW1 B;  4YXD C;  3L71 D;  2WSC H;  1PV3 A;  1KQG B;  2FFD A;  1VQ9 P;  2WT7 B;  1N7S C;  3KDP B;  1EC5 A;  1PP9 E;  3RGU A;  4GT1 A;  1RE4 C;  4WB4 A;  1SQP G;  1NU1 D;  4UB6 E;  3H1J D;  2R3C A;  1GU5 A;  4I7Z B;  1DD3 A;  2CPB A;  1M1J A;  1N7L A;  2WSE J;  1S3J A;  1YIT P;  1SQP J;  3HD7 B;  4UB6 H;  1J2J B;  4QMA A;  5DJU B;  2Y9Y A;  3PLN A;  4H13 B;  3L71 E;  2IBZ I;  1P84 I;  1JNM A;  1KQF B;  2E74 D;  1AJY A;  1W5C E;  1HWT C;  2KOG A;  1NU1 E;  3H1J E;  5KLV G;  4HH2 A;  5CHX A;  2YIU C;  4GDO A;  5CCH A;  3OW2 O;  1KIL B;  2M3B A;  1KQS O;  1OXZ A;  4GOF A;  5KLV J;  3PHL A;  3WUT A;  1OFC X;  3BCC D;  1ZRT D;  1L0L J;  3LW5 H;  3NFQ A;  3H25 A;  2Z5H A;  1N2D C;  2OYI A;  1H8A A;  3TNU B;  2YKP A;  2WPR A;  1ZP0 C;  3V4Q A;  1NU1 K;  1GL2 C;  1VQ7 P;  2D2C D;  3BCC E;  3S4R A;  1YHQ P;  1ZRT E;  4PJ0 E;  4W80 A;  2FYU E;  3T97 A;  2A06 G;  2IPP A;  3ABV C;  4U3F G;  1AVY A;  1SQB D;  1URQ C;  3AE4 C;  1MFZ A;  2QJP C;  1LT1 A;  1NGM B;  4PJ0 H;  1HBW A;  3OA7 A;  4C46 A;  2WSF J;  3H1L G;  1LJ2 A;  3CWB J;  1AQ5 A;  4U3F J;  2AEJ A;  5AVZ B;  1KIL A;  1FOS F;  4AQR D;  4WBA A;  2ZJS E;  3L73 D;  4IFM A;  1N7S B;  3RBX A;  1VQM P;  3M0D C;  4B86 A;  1VQ4 P;  2YO2 A;  4KT0 J;  3V5B A;  3CCQ P;  3LID A;  1Q90 D;  3AE3 C;  1JOC A;  4A7P A;  2PFX A;  3F89 A;  1VQN P;  1MKM A;  1WMK A;  1OZH A;  2FYU K;  1SQB E;  2QG4 A;  3AEC C;  1FZF A;  4I1L A;  1Q82 Q;  3CX5 I;  3TF5 A;  1NTM G;  1RE3 A;  1VQ6 P;  3VP8 A;  3L73 E;  5AW5 B;  4BXL A;  2R32 A;  3M0A A;  1G2C A;  3MP7 B;  3HD7 D;  2IBZ D;  4IL6 E;  1P84 D;  1U7J A;  3HUS B;  1NTM J;  2YIU B;  2C0W A;  3TYY A;  3NXS A;  4HB1 A;  1YJ9 P;  1TU3 F;  4DJG A;  4KJM A;  4YXW H;  4M3L A;  3H32 A;  4JF7 A;  3CXH E;  4IL6 H;  2Q6Q A;  1LTJ C;  2IZ0 A;  2HG5 D;  2BCC G;  1GZL A;  3H6P A;  2M0B A;  4L76 A;  1PIX A;  1SQB K;  2W83 C;  2ZAE B;  3CXH H;  1KIL D;  1ZR4 A;  3M9B A;  1RE4 A;  4CPG A;  2E75 D;  2YO3 A;  1FJK A;  3E1I A;  3SFD C;  2IBZ E;  3GHG C;  3RK2 B;  3H1K D;  1JB0 J;  1W2E A;  2WWW A;  1GL2 B;  1ZOY C;  2QSI A;  5AVV B;  2H43 A;  4L75 A;  1E5W A;  1PL5 A;  2FKW B;  4N3Y B;  3L75 D;  1RF0 C;  4WY4 C;  1S5L E;  1NKN A;  1IK7 A;  1H0T B;  4OGQ C;  1T2K C;  1SFC C;  2YMK A;  1GU4 A;  4C7N A;  3H1L D;  1KIL E;  2OAR A;  2HPC B;  3CCL P;  2QJP B;  2OTJ P;  1S5L H;  3GMA A;  4EYY Q;  3B5N C;  4NPF X;  1NAY A;  3TK1 A;  2WSC J;  3C1L A;  1Q7Y Q;  1QL1 A;  3A2A A;  2Q9I A;  3KPE A;  3H1K E;  4DOJ A;  3L70 J;  1HGZ A;  1PP9 G;  2E76 D;  1T8Z A;  2Y0E A;  2AEF A;  1RF1 B;  3P8C D;  3L75 E;  2I1J A;  3GF3 A;  1PP9 J;  3G4S P;  2ZVO B;  4L73 A;  2ZXX A;  4EDF A;  3H1L E;  1N7S D;  1LTA C;  2G8Y A;  1X0T A;  3V2P A;  3CC4 P;  2NPS C;  2MKV A;  3VMA A;  1DEB A;  4HJG H;  2OYO A;  2YNY A;  1R5S A;  1EDI A;  2KSJ A;  4RES B;  2YKQ A;  3L71 J;  2M8R A;  1NU1 G;  3H1J G;  1NHL A;  2O01 H;  2WSS H;  4JBZ A;  4EOT A;  2E5T A;  2WVR A;  3P8C E;  4LC1 A;  3CCM P;  4W7Z A;  1H0T A;  1KC8 Q;  1X9V A;  1NU1 J;  3H1J J;  3MUD C;  1URQ A;  4H13 C;  2FBW C;  1ZW0 A;  3IR9 A;  1L4A A;  1LTS C;  3LW5 J;  4Y28 J;  1FAV A;  4PV1 C;  1IZN B;  2W8Z A;  3W68 A;  1S1C X;  1VDF A;  3M0D A;  2QIW A;  2A45 I;  3GHG B;  3Q5P A;  1H88 A;  2FXP A;  1DX7 A;  1HF9 A;  3L72 G;  4Z1M H;  2XDJ A;  1FZA A;  1IK9 A;  3BCC G;  1KFM A;  4WY4 B;  1GD2 E;  3AEA C;  1N73 A;  1EDL A;  2GUV A;  1SFC B;  3L35 A;  2Q7C A;  3HTK B;  1JCC A;  1GL2 D;  3WUU A;  2BEQ D;  3B5N B;  2FYU J;  5APS A;  3CC7 P;  1Q81 Q;  2PAJ A;  1L2P A;  2LXB A;  3MIW A;  2GM4 A;  3AE1 C;  3V2Q A;  4GOE A;  2HOD B;  4OVN F;  5TJH A;  1LT9 B;  3CPW O;  1ZV8 A;  1Z56 A;  1LTJ A;  1FZC A;  3KZI E;  3AE9 C;  1URQ D;  1AA0 A;  1M90 Q;  3MHV A;  2B87 A;  2KI7 B;  3KZI H;  2P2U A;  1BDD A;  1U57 A;  2K88 A;  1SQB G;  4H0L C;  1E79 H;  2NPS B;  3M9Q A;  4N78 D;  4PD4 D;  1NWQ A;  1NVO A;  3JC2 2;  1BDC A;  1JM0 A;  1SQB J;  2UWJ E;  3L73 G;  2IDB A;  1FDM A;  2G3A A;  2JDI H;  1SLQ A;  2R3S A;  1YYC A;  1RH5 B;  2K9J A;  3G6E P;  5APY A;  3FWL A;  1GW4 A;  2KS1 A;  2E42 A;  1M7L A;  3L73 J;  2JWA A;  2AEM A;  2AXC A;  1KFN A;  2XV5 A;  3C9I A;  3U1C A;  5AVT B;  4PV1 B;  4N78 E;  1AQT A;  4PD4 E;  4KHX A;  1PGJ A;  4ZKP A;  1FDI A;  2KK7 A;  3HUS C;  1BE3 D;  3GW6 A;  3L72 D;  3ZDM A;  5KTB A;  4PD4 H;  2IBZ G;  3CCR P;  4K35 A;  1MZ9 A;  3AE8 C;  1Y8A A;  1ZN5 A;  5APQ A;  5C39 A;  1XTC C;  1JTH B;  1SS1 A;  4BWN A;  2WT7 A;  2BAS A;  3G3Z A;  3UIA A;  1BCC D;  3TSI A;  3P7K A;  2WPS A;  2FYZ A;  3S1K A;  2YXQ B;  1FZB A;  1GMJ A;  3CC2 P;  3BAS A;  2V7Q H;  2M5A B;  2W6A A;  1OW7 A;  1YJN P;  1BE3 E;  3RK2 C;  3L72 E;  2RN0 A;  4WY4 D;  5CBN A;  3HD7 A;  1JMM A;  1JCD A;  4K3A A;  3H1K G;  4XE5 B;  4JYB A;  4OGQ D;  1YIJ P;  3HE4 B;  1JEK A;  1T2K D;  1SFC D;  1X22 A;  4LLH A;  4U7J A;  1DEE G;  1HH0 A;  4IFF A;  3H1K J;  2FY8 A;  3AEB C;  3B5N D;  3L75 G;  3WUV A;  1LGH B;  4GIF A;  5K5G B;  2QE7 H;  2VRS A;  1BCC E;  3MTU E;  1SQX G;  4H0L B;  3PJS K;  3Q2Y A;  3L75 J;  1BSN A;  3L74 G;  1LTI C;  1RQV A;  4DT0 A;  5AVW B;  1RY3 A;  3B71 A;  3H1L J;  3O6Q B;  2SPZ A;  1CSB A;  1YQ4 C;  3KQG A;  3BRT B;  5CCG C;  2KP8 A;  1ZXG A;  5CMZ A;  1RF1 C;  2O01 J;  1X8Y A;  2WMM A;  3CMA P;  3IF4 A;  2HFE D;  1QX8 A;  2NPS D;  3D6Y A;  4R4L A;  3V2N A;  1IFM A;  1UII A;  1QVF O;  1K8A Q;  2RH0 A;  3A3Y B;  3TNU A;  1FBM A;  4MN4 C;  1JY3 N;  2ZYG A;  1USD A;  4RKU J;  2I8D A;  1HUC A;  3CCS P;  4YPC A;  3Q5R A;  1WRG A;  5M1B A;  2C0X A;  5KAF E;  3RL0 g;  2XND H;  5AW0 B;  4ZNC A;  4OH8 B;  4H13 D;  3FGA D;  1YJW P;  4EIJ A;  2N1T C;  2P10 A;  1L0L D;  4PV1 D;  1HTL C;  3CLQ A;  3PH0 A;  1HJB A;  3SFE C;  1NTK D;  5KAF H;  5KJ7 C;  4GOD A;  1EZV I; 
#chains in the Genus database with same CATH homology
 3WUU A;  2ZXX A;  3F5H A;  3WUV A;  4BRY B;  1UII A;  3E1R A;  3WUT A;  2Q6Q A;  4BRY A;  2WVR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...