1UIIA

Crystal structure of geminin coiled-coil domain
Total Genus 28
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
28
sequence length
61
structure length
61
Chain Sequence
ENPSSQYWKEVAEKRRKALYEALKENEKLHKEIEQKDNEIARLKKENKELAEVAEHVQYMA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Cell cycle
molecule keywords Geminin
publication title A dimerized coiled-coil domain and an adjoining part of geminin interact with two sites on Cdt1 for replication inhibition
pubmed doi rcsb
source organism Homo sapiens
total genus 28
structure length 61
sequence length 61
chains with identical sequence B
ec nomenclature
pdb deposition date 2003-07-16
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.1180 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Geminin coiled-coil domain 1uiiA00
2ZXXA 3F5HA 2Q6QA 1UIIA 3WUVA 4BRYA 3E1RA 4BRYB 2WVRA 3WUTA 3WUUA
chains in the Genus database with same CATH superfamily
2QJKC 2E74C 1MFZA 1Q86Q 3CWBJ 2E42A 1LTBC 1NAYA 3CWBE 1EQ7A 2FY8A 1KILC 4JF7A 1RE3C 1M1JB 4GIFA 3RL0C 3FXDA 2IBZI 5CCHA 3U1AA 1YYCA 1NHLA 1QVGO 2ZAEB 4IFFA 3L74J 1JY2O 3L74E 5KLVG 3VYIA 4QMAA 1KORA 5AVSB 1YJNP 2ZYAA 5APVA 1L4AB 2OQQA 5AVYB 3GF7A 1RHZB 2J5UA 1FDIA 2SPZA 2V7QJ 1W2EA 1HGZA 2WT7A 1LJ2A 3MUDA 1BCCG 5AW4B 3L35A 1LT9C 3C9IA 3VMZA 2GM4A 2W6AA 4OGQD 2D2CD 3L73D 2M5AA 1VF5D 1ZXGA 1ZW0A 1DX7A 3BASA 4RKUJ 2WSFH 1KC8Q 4LC1A 1N73C 4IOIH 2IFNA 3A7OA 1GL2A 3V2QA 5KKZC 3HTKB 3M9QA 3E1RA 1NU1K 2YKOA 3HE4B 3A0BH 2QEXP 3JSVC 4IFDK 3BCCJ 3BCCE 4ASVA 1M1JC 1GU5A 2E43A 2OARA 1GD2E 2WWWA 4C7NB 3M0DA 3CWBG 2WTYA 3V2PA 4Y99B 4EOTA 1Q2NA 2KZIA 3D71A 1BGYD 3PHLA 2J59M 3RK3E 1ZRTD 2JKVA 4XE5B 2O01N 2A06D 3BATA 3V4QA 1KQFB 4UB6E 2KLUA 3M91A 2J58A 3L74G 1L4AC 3U59A 1RE4C 3I5CA 4C7RA 2WSFJ 2QA4P 5CCGC 1FS0E 3IR9A 2HODA 1EDKA 2LKMA 4MN4C 3WUUA 2QE7H 4D6TD 3CXHH 1EZVD 2E76B 2C0WA 1S5LX 4N6JA 1S9KD 4WVZA 1N7LA 1Q81Q 2NPSB 4GOFA 5APQA 4H44B 3A0BE 1XTCC 2Q3IA 1T8ZA 3NXSA 2OTLP 1PIXA 1UIIA 1ZV8A 1SQXK 1IK7A 2ZFCA 3VN0A 3V4WA 3C1LA 3PP5A 2Y0CA 5K5GB 3V5BA 1HJ0A 2OYOA 3CX5I 1RH5B 1CI6A 2FYUG 4PD4I 1FBMA 1PFIA 5DJUB 4W80A 2C9NY 3RL0g 2H43A 1GU4A 2WQYC 4HYTB 4TLFA 1GMJA 4Y99C 2G3AA 1PGOA 3BCCG 4ZKUA 3Q5SA 2FFDA 3LIEA 3CXHE 1S5LH 3GG2A 1KN7A 5AW8B 4Z1MH 2WSEH 1NTKK 2OTJP 3G71P 2O01J 1KILA 1RE3A 3SWKA 2YKPA 2B88A 2L5GB 3CL3D 5GTIE 5APYA 1RF0A 4GKGA 4EDFA 1SQXD 2E76C 2JR8A 3NMDA 2K1AA 4PV1B 2NPSC 2BEZF 1N7SB 2MJZA 4H44C 1URQD 3TNUA 1AVYA 1AJYA 1MUUA 3NFQA 2RMZA 2WVRA 3KHUA 1OX3A 1DD4A 4HH2A 4L73A 5CMZA 5CCHC 2Y9ZA 1T2KD 5M1BA 5DJTB 1LGHB 3WUTA 4DT0A 1S5LE 3CMEP 2IBZD 1K73Q 2FXOA 2RN0A 3UIAA 3L70G 1OIPA 3B5ND 2WSEJ 4YXWH 3GLMA 1BGYJ 1SQPK 2M0BA 1BGYE 3A0HH 1ZRTE 3H1JD 4CPGA 5H2FE 5AVXB 1MFTA 2WSSH 1NTKD 1N73A 2KI7B 1QGKB 2KLVA 1FDMA 1N8RQ 5CBOA 2B89A 3H1LE 1Y47A 3L72G 1CZQA 1VQ6P 1HJBA 2HFED 5AW7B 1M8OB 2FYNB 2KSEA 2QM8A 3SSUA 1IJDB 3EFFK 1N2DC 1EZVE 3TGUG 1Z56A 2ZXXA 3TYYA 4ASWA 1SQVJ 1SQVE 3AEAC 1JY2P 5AVTB 4JYBA 4C46A 2KUBA 1WMKA 2K88A 4PV1C 1CI6B 1N7SC 4PJ0H 2CK3H 1VQPP 1EDJA 5CJ4A 3M9HA 1RE4A 3A0HE 4EYYQ 1JUNA 2XNXA 1H8AA 3G4SP 2XNDH 3MGNA 1A02J 2P67A 3II6A 1MV8A 2FFDB 4H13B 2LXBA 1L4AD 1PGJA 2K37A 3AEGC 1VQOP 4IL6H 3RBZA 5CCGD 1PGPA 2YKQA 2IZ0A 3V2NA 1NTMJ 1K05A 1NTME 2O1JA 1SQBK 3A3YB 4HKZH 1BGYG 4ZNCA 5E79E 2Q1KA 3AE2C 1YTZT 1H0TB 2YNYA 2FYNC 1VDFA 2G8YA 3H1LG 1LNQA 1SQQK 2KSJA 3HE4A 1U57A 3B8EB 3W68A 4WWIA 4WY4B 2HPCA 2BCCD 2Q3EA 3TNUB 1VQ5P 4HJGH 3KXDA 1IFDA 2YIUC 2KIKA 1SQVG 2P1JA 1KZUB 3CCSP 2BEQD 3GMAA 1DEBA 4LGDE 2Z5HA 3CX5D 2IBZE 1GK6A 2N1TA 1S3JA 3AEFC 4PD4D 1Q82Q 3USSA 1KV4A 1IFNA 2I8DA 5KJ7C 3H1JJ 1SQBD 3H1JE 3JCUH 3L71G 4H13C 1NTKJ 1NTKE 1E5WA 1IFMA 5CBNA 1JEKA 1JY3N 3G6EP 1NGMB 2PRRA 2YXRB 1RF0C 1NTMG 4H0LB 5B5EH 3IN6A 5KAIE 3OAKA 1G1JA 1ZLLA 1L0NG 2QSIA 1NWQA 5APSA 2HLOA 4JBZA 2XV5A 4JPZB 3H25A 1X0TA 4WY4C 2R5DA 5CCHD 1NVOA 3PH0A 1NAFA 3H1KD 5APTA 5AVWB 3B71A 3P32A 5CJ0A 5AW2B 1IK9A 2UWJE 3D6YA 3JCUE 2L91A 1TU3F 1SS1A 2JWDA 4UB6H 1KYOH 1FU1A 1KTMA 3RK2B 5L8RJ 1X8YA 2W8ZA 1HH0A 1QL1A 3M9BA 3CCQP 2Z5IA 4R4LA 2E75B 3R2PA 2Q7CA 5B5EE 1NTZG 3L75J 2R32A 4PD4H 3L75E 2XZRA 1JOCA 1KMIZ 1P84I 1N7SA 1NTKG 2W27A 2FXPA 1AVOA 3WMM0 1R5LA 2KB7P 1L0LJ 2ZVOB 1L0LE 1GL2D 2HPCB 3RK3B 1SFCD 2E5TA 3IF4A 4PV1D 2H8PD 1YQ4C 4H0LC 4WBAA 3CCMP 1FE6A 1RY3A 3N4XA 3TK1A 3QWOC 2P58A 1BDDA 4I2LC 1QVFO 4I6MC 3MP7B 3E1IA 1Q90D 3H1ID 1KYOE 1OMIA 5APXA 3CCJP 1JM0A 2WPVB 2IFMA 4JYCA 4GODA 4L74A 2WZ7A 2N9BA 1J1DB 1FJPA 2N1TB 3CCEP 1T3UA 1FOSE 1JCCA 2JWAA 1MZ9A 4ZKPA 1S72P 1YHQP 1ZN5A 2I1JA 3V2RA 4L75A 3HD7B 4PD4E 3H1HD 1W2BO 1HBWA 4RO0A 3Q3DA 2JP3A 3RK2C 5B66E 4DJGA 1VQ7P 2O01H 1NU1D 1T3JA 2NRGA 1QLED 5GTIH 2KK7A 5KLVK 2E75C 1DD3A 3EWKA 1HVVA 5KAFH 1RF1B 2LR2A 1PPJD 2KYVA 1FZAA 3OJAB 3L75G 3R4YA 3EQ2A 5C39A 2AXTE 3RK3C 3CD6P 4YPCA 1ZMEC 4YTPC 3L4FA 2RH0A 2YXQB 4R4MA 1Y9BA 3O6QB 1L0LG 4Y28J 2OYIA 5KJ7A 2M8RA 3H1KJ 2DW3A 3H1KE 4OGQB 2D2CB 3C8VA 2AEFA 4L76A 1VF5B 3TDKA 1LTJB 3ZDMA 2ZVNB 3VMAA 1AFOA 4K35A 1VQ8P 3KZIH 3WUVA 4BRYA 1KQGB 3AE4C 3L73J 1J1DC 5H2FH 3L73E 2N1TC 4DOJA 2WSCH 4BWNA 5GTHH 3AE9C 1H0TA 1LTTC 5KLVD 2E74D 5AW3B 3HD7C 1GK4A 3KPEA 3CC7P 1SVFA 5KAFE 1X79B 2O1KA 5AW9B 3CI9A 1KILD 1URQA 3KDPB 1KB9I 3EFGA 1JNMA 2R3CA 3ITKA 4WY4A 3RL0D 4I1LA 4UB8H 2Q9IA 1L2PA 3JC22 1NKZB 3CCRP 2E5YA 2P7JA 1BCCD 3CXHI 1T6AA 2YMYA 1N86A 3GW6A 1JMMA 3D70A 2MKVA 1KFMA 1RF1C 1S4XA 3I55P 1YQ3C 2HYNA 2XKMA 1AQ5A 1EC5A 3KZIE 2RKLA 1OVVA 2A06E 3VMXA 3H1IJ 3H1IE 2WSCJ 3AE3C 5APUA 1NOHA 1BDCA 1IO4A 2ITAA 4AQRD 2W83C 5GTHE 3PJSK 1S2EA 4OVNF 5TISH 4OGQC 2D2CC 2Y0EA 1VF5C 2CPSA 1LTJC 2PAJA 2W6BA 3V6IA 4D6TJ 4D6TE 2XDJA 3Q5PA 1OVUA 4O9BA 4GT1A 3H1HJ 2WPRA 3H1HE 1BSNA 2GA1A 4UB8E 1S9KE 1CW5A 3CWBD 2WPQA 5E79H 3L73G 2YIUB 5TJHA 1NU1J 1NU1E 2JJLA 2FYUK 2AEJA 1KFNA 3MTUE 2OTKE 2QG4A 3ABVC 5EFWB 2PP6A 2K9JA 1OFCX 1LP1A 3H6PA 3S9OA 1UIXA 1JMBA 1P84D 1SQPD 1DH3A 1JB0J 3GHGB 4NPEA 2OYIB 1GTWA 5AVVB 1M57D 2PFXA 5TISE 1K9MQ 1WT6A 2XU6A 4NPFX 1ZR2A 3QH9A 4RESB 2H88C 4DCKA 4BRYB 2IZ1A 3T97B 2OYHB 3SWYA 1WRGA 1K8AQ 2A45I 1YJ9P 2A06G 1AQTA 4OWFA 3H1IG 5AVUB 3Q5RA 3RK2D 3OA7A 2AEMA 1PV3A 2WPSA 2FYUD 3FWLA 1JY2N 1JTHA 1SQXJ 1SQXE 1IZNB 1URQB 5KLVJ 5KLVE 4NPDA 3OW2O 1USDA 4D6TG 1EZVG 3HE5A 1JY3P 1KILE 1PGQA 1FZBA 3PLNA 3PTZA 5KAIH 3AE1C 3HRNA 2GUSA 4OH8B 1BCCJ 1NU1G 1BCCE 1PL5A 3RK3D 3B5NB 2H89C 5BU8B 3I56P 1OVRA 1K04A 1NKNA 3GHGC 2B87A 1H89A 1VQMP 2IYOA 2OYIC 3AECC 1P84H 1LWUB 3HD7A 1YBKA 2KNCA 1A02F 1LTSC 1SQQD 1SLQA 4IFMA 2OYHC 3HUSA 2E76D 2NPSD 2YO3A 2GUVA 1QL2A 3M06A 1RF1A 4H44D 3L70D 1LTIC 3CLQA 3G9RA 1USEA 1URQC 2K9JB 2KS1B 2O3JA 4K3AA 1LP1B 3MIWA 1FAVA 1NH4A 2Y9YA 1SQXG 1KB9D 3O6QA 1T2KC 3L72D 2ZJSE 1FZGA 4W7YA 1XTGB 1LTAC 1P84E 4I7ZB 1SQPJ 2KZJA 1SQPE 3WU2H 1VQ4P 2ZXEB 3W67A 1LTJA 2FKWB 3RBXA 1M1KQ 3CXHD 3BVHA 3B5NC 2P2UA 3TGUD 2K3RA 3BRVB 3A2AA 3VP8A 4U3FD 3VTPC 2JO1A 2C9LY 2IBZG 3CX5H 3LIDA 3CCUP 2HR3A 2ZYGA 2AXCA 1HUCA 1LWUC 1OW8A 1LTGC 2QJYB 1SP4A 3H1JG 2CPBA 5B66H 1JTHB 1EXJA 3TF5A 4GOEA 1SFCA 3O8ZA 1PP9D 1YI2P 2FYUJ 2FYUE 2QIWA 1JCDA 3HE5B 1SQVK 3AEDC 3L36A 2Y0DA 2BCCJ 1R8EA 2BCCE 1JY3O 4DZOA 2H7HA 1N7SD 1NO4A 3BRTB 5CHXA 1HF9A 3WU2E 4N3YB 1DEEG 1EDLA 2ZT9B 1J1EB 2PGDA 3AE6C 1MKMA 5AVQB 2KP8A 3AE8C 2N9YB 2AXTH 5KLIB 3AEEC 4EIJA 2B87B 3CX5E 3H32B 1IC2A 3KQGA 4I7ZC 1KB9H 3H1LD 2KOGA 2VRSA 1D7MA 2KNCB 4A7PA 1SQBJ 1SQBE 1SQPG 3F89A 4KHXA 2V4HA 3M0AA 2HG5D 1NTMK 1KQLA 1OXZA 2KXPB 2K9YA 3HUSB 2ZYDA 1SQQJ 1SQQE 1RQVA 4W7ZA 1L0NK 3E7KA 2IDBA 1SQVD 2QJYC 3D6ZA 4WB4A 1KYOI 1EDIA 1M90Q 5KTBA 3SFDC 5BVZA 1PZQA 2M3BA 2YMKA 1YTZI 4AUWA 3L70J 3L70E 2LXCB 3GHGA 3A5TA 1OWAA 5AW5B 1BE3D 4XA4A 3F5HA 3L71D 3AE7C 3SFEC 2BASA 2W90A 1KB9E 2FYZA 3L72J 2BCCG 2POHA 1AV1A 2ZT9C 3L72E 1J1EC 4KJMA 3VMYA 4KT0J 4LLHA 3T97A 2WT7B 2QM7A 1GDTA 1IFIA 2OYHA 5KJ7D 5KLIC 4H13D 1NTZK 3TGUJ 1G2CA 3TGUE 1NTMD 1FZCA 2M5AB 1NJIQ 4U3FJ 5AVZB 1HGVA 4U3FE 1Y8AA 3CC4P 1VQNP 1L0ND 3K5BA 1QX8A 2OGUA 1VPCA 1IFJA 5AW0B 2B9BA 3CPWO 1FOSF 5AW1B 1GL2B 1S1CX 1SFCB 1SQBG 1Q7YQ 3LW5H 3HUSC 1ZP0C 1GW4A 3FXEA 1PP9J 1PP9E 1GW3A 1OW7A 4WY4D 1SQQG 2IPPA 3B5NA 1CSBA 2JDIH 1OZHA 3IAOA 1FZEA 1HWTC 1OW6A 3P8CD 1YJWP 4GDOA 4JQ0D 1EXIA 2QRXA 1RQUA 2A45H 4RJTA 5APWA 1LT9A 3FWNA 4N78D 1NYHA 4HB1A 1NTZD 1LWUA 2M3EA 2R3SA 3FGAD 4M3LA 4BXLA 3P8MC 3L37A 1ZR4A 3Q1MA 3H1KG 1LT1A 1FZFA 3H1LJ 2HODB 2NZ2A 3IFMA 3MUDC 4TT3H 3B4SA 3LW5J 1QEXA 1FDOA 3S1KA 4YXDC 4IL6X 4U7JA 2IYPA 1M1JA 1M7LA 4U3FG 3L74D 2KS1A 1GL2C 2FXMA 2QJPB 1L0LK 1SFCC 4H0LD 1PPJE 3GF3A 2WMMA 1VQ9P 2I1KA 3AEBC 1X9VA 1E79H 1U7MA 3MHVA 1VQLP 3CCLP 1U7JA 1R5SA 2QVAA 1FC2C 1L4AA 2W6JH 2Z4EA 1BE3J 1BE3E 2FBWC 1AA0A 1JO5A 5CCGA 3L71J 1PP9G 1YIJP 3L71E 1EZVI 1ZOYC 3M0DC 3CCVP 2R44A 1X22A 1G2CB 3CMAP 5BU5A 1KQSO 1FZCB 2QJKB 3S4RA 2E74B 5AW6B 1YITP 3AE5C 1KILB 3L75D 1M56D 3RL0B 1IFPA 1L0NJ 3G3ZA 1L0NE 1GZLA 4B86A 2E75D 5AVRB 1DIPA 3HTKA 1L0LD 3H1HG 2Q5UA 3BCCD 2C0XA 3MZWB 4PJ0E 3NTNA 1G1IA 1VQKP 1HTLC 1H88A 1J2JB 3Q2YA 2YO2A 4C7NA 3N7NA 4EI2A 1FJKA 2R5BA 1W5CE 2QJPC 4ZMDA 1KYOD 3VP9A 4AYCA 4XFJA 1LT9B 3KYQA 3P8CE 2Q6QA 3H32A 2A45G 2ZT9D 1PPJG 4IL6E 3P7KA 3SWFA 3TSIA 4N78E 3MD0A 1KD1Q 2IX7C 2WITA 1NTZJ 2N1TD 1NTZE 2V7QH 1N73B 3FX0A 3PRJA 2JEEA 3CC2P 3VOPA 1BE3G 1VL2A 2FFDC 3U1CA 2P10A 3HD7D 1BSHA 3RGUA 5KKZB 2NPSA 1FZCC
chains in the Genus database with same CATH topology
2ZXXA 3F5HA 2Q6QA 1UIIA 3WUVA 4BRYA 3E1RA 4BRYB 2WVRA 3WUTA 3WUUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ZXX A;  3F5H A;  2Q6Q A;  1UII A;  3WUV A;  4BRY A;  3E1R A;  4BRY B;  2WVR A;  3WUT A;  3WUU A; 
#chains in the Genus database with same CATH topology
 2QJK C;  2E74 C;  1MFZ A;  1Q86 Q;  3CWB J;  2E42 A;  1LTB C;  1NAY A;  3CWB E;  1EQ7 A;  2FY8 A;  1KIL C;  4JF7 A;  1RE3 C;  1M1J B;  4GIF A;  3RL0 C;  3FXD A;  2IBZ I;  5CCH A;  3U1A A;  1YYC A;  1NHL A;  1QVG O;  2ZAE B;  4IFF A;  3L74 J;  1JY2 O;  3L74 E;  5KLV G;  3VYI A;  4QMA A;  1KOR A;  5AVS B;  1YJN P;  2ZYA A;  5APV A;  1L4A B;  2OQQ A;  5AVY B;  3GF7 A;  1RHZ B;  2J5U A;  1FDI A;  2SPZ A;  2V7Q J;  1W2E A;  1HGZ A;  2WT7 A;  1LJ2 A;  3MUD A;  1BCC G;  5AW4 B;  3L35 A;  1LT9 C;  3C9I A;  3VMZ A;  2GM4 A;  2W6A A;  4OGQ D;  2D2C D;  3L73 D;  2M5A A;  1VF5 D;  1ZXG A;  1ZW0 A;  1DX7 A;  3BAS A;  4RKU J;  2WSF H;  1KC8 Q;  4LC1 A;  1N73 C;  4IOI H;  2IFN A;  3A7O A;  1GL2 A;  3V2Q A;  5KKZ C;  3HTK B;  3M9Q A;  3E1R A;  1NU1 K;  2YKO A;  3HE4 B;  3A0B H;  2QEX P;  3JSV C;  4IFD K;  3BCC J;  3BCC E;  4ASV A;  1M1J C;  1GU5 A;  2E43 A;  2OAR A;  1GD2 E;  2WWW A;  4C7N B;  3M0D A;  3CWB G;  2WTY A;  3V2P A;  4Y99 B;  4EOT A;  1Q2N A;  2KZI A;  3D71 A;  1BGY D;  3PHL A;  2J59 M;  3RK3 E;  1ZRT D;  2JKV A;  4XE5 B;  2O01 N;  2A06 D;  3BAT A;  3V4Q A;  1KQF B;  4UB6 E;  2KLU A;  3M91 A;  2J58 A;  3L74 G;  1L4A C;  3U59 A;  1RE4 C;  3I5C A;  4C7R A;  2WSF J;  2QA4 P;  5CCG C;  1FS0 E;  3IR9 A;  2HOD A;  1EDK A;  2LKM A;  4MN4 C;  3WUU A;  2QE7 H;  4D6T D;  3CXH H;  1EZV D;  2E76 B;  2C0W A;  1S5L X;  4N6J A;  1S9K D;  4WVZ A;  1N7L A;  1Q81 Q;  2NPS B;  4GOF A;  5APQ A;  4H44 B;  3A0B E;  1XTC C;  2Q3I A;  1T8Z A;  3NXS A;  2OTL P;  1PIX A;  1UII A;  1ZV8 A;  1SQX K;  1IK7 A;  2ZFC A;  3VN0 A;  3V4W A;  3C1L A;  3PP5 A;  2Y0C A;  5K5G B;  3V5B A;  1HJ0 A;  2OYO A;  3CX5 I;  1RH5 B;  1CI6 A;  2FYU G;  4PD4 I;  1FBM A;  1PFI A;  5DJU B;  4W80 A;  2C9N Y;  3RL0 g;  2H43 A;  1GU4 A;  2WQY C;  4HYT B;  4TLF A;  1GMJ A;  4Y99 C;  2G3A A;  1PGO A;  3BCC G;  4ZKU A;  3Q5S A;  2FFD A;  3LIE A;  3CXH E;  1S5L H;  3GG2 A;  1KN7 A;  5AW8 B;  4Z1M H;  2WSE H;  1NTK K;  2OTJ P;  3G71 P;  2O01 J;  1KIL A;  1RE3 A;  3SWK A;  2YKP A;  2B88 A;  2L5G B;  3CL3 D;  5GTI E;  5APY A;  1RF0 A;  4GKG A;  4EDF A;  1SQX D;  2E76 C;  2JR8 A;  3NMD A;  2K1A A;  4PV1 B;  2NPS C;  2BEZ F;  1N7S B;  2MJZ A;  4H44 C;  1URQ D;  3TNU A;  1AVY A;  1AJY A;  1MUU A;  3NFQ A;  2RMZ A;  2WVR A;  3KHU A;  1OX3 A;  1DD4 A;  4HH2 A;  4L73 A;  5CMZ A;  5CCH C;  2Y9Z A;  1T2K D;  5M1B A;  5DJT B;  1LGH B;  3WUT A;  4DT0 A;  1S5L E;  3CME P;  2IBZ D;  1K73 Q;  2FXO A;  2RN0 A;  3UIA A;  3L70 G;  1OIP A;  3B5N D;  2WSE J;  4YXW H;  3GLM A;  1BGY J;  1SQP K;  2M0B A;  1BGY E;  3A0H H;  1ZRT E;  3H1J D;  4CPG A;  5H2F E;  5AVX B;  1MFT A;  2WSS H;  1NTK D;  1N73 A;  2KI7 B;  1QGK B;  2KLV A;  1FDM A;  1N8R Q;  5CBO A;  2B89 A;  3H1L E;  1Y47 A;  3L72 G;  1CZQ A;  1VQ6 P;  1HJB A;  2HFE D;  5AW7 B;  1M8O B;  2FYN B;  2KSE A;  2QM8 A;  3SSU A;  1IJD B;  3EFF K;  1N2D C;  1EZV E;  3TGU G;  1Z56 A;  2ZXX A;  3TYY A;  4ASW A;  1SQV J;  1SQV E;  3AEA C;  1JY2 P;  5AVT B;  4JYB A;  4C46 A;  2KUB A;  1WMK A;  2K88 A;  4PV1 C;  1CI6 B;  1N7S C;  4PJ0 H;  2CK3 H;  1VQP P;  1EDJ A;  5CJ4 A;  3M9H A;  1RE4 A;  3A0H E;  4EYY Q;  1JUN A;  2XNX A;  1H8A A;  3G4S P;  2XND H;  3MGN A;  1A02 J;  2P67 A;  3II6 A;  1MV8 A;  2FFD B;  4H13 B;  2LXB A;  1L4A D;  1PGJ A;  2K37 A;  3AEG C;  1VQO P;  4IL6 H;  3RBZ A;  5CCG D;  1PGP A;  2YKQ A;  2IZ0 A;  3V2N A;  1NTM J;  1K05 A;  1NTM E;  2O1J A;  1SQB K;  3A3Y B;  4HKZ H;  1BGY G;  4ZNC A;  5E79 E;  2Q1K A;  3AE2 C;  1YTZ T;  1H0T B;  2YNY A;  2FYN C;  1VDF A;  2G8Y A;  3H1L G;  1LNQ A;  1SQQ K;  2KSJ A;  3HE4 A;  1U57 A;  3B8E B;  3W68 A;  4WWI A;  4WY4 B;  2HPC A;  2BCC D;  2Q3E A;  3TNU B;  1VQ5 P;  4HJG H;  3KXD A;  1IFD A;  2YIU C;  2KIK A;  1SQV G;  2P1J A;  1KZU B;  3CCS P;  2BEQ D;  3GMA A;  1DEB A;  4LGD E;  2Z5H A;  3CX5 D;  2IBZ E;  1GK6 A;  2N1T A;  1S3J A;  3AEF C;  4PD4 D;  1Q82 Q;  3USS A;  1KV4 A;  1IFN A;  2I8D A;  5KJ7 C;  3H1J J;  1SQB D;  3H1J E;  3JCU H;  3L71 G;  4H13 C;  1NTK J;  1NTK E;  1E5W A;  1IFM A;  5CBN A;  1JEK A;  1JY3 N;  3G6E P;  1NGM B;  2PRR A;  2YXR B;  1RF0 C;  1NTM G;  4H0L B;  5B5E H;  3IN6 A;  5KAI E;  3OAK A;  1G1J A;  1ZLL A;  1L0N G;  2QSI A;  1NWQ A;  5APS A;  2HLO A;  4JBZ A;  2XV5 A;  4JPZ B;  3H25 A;  1X0T A;  4WY4 C;  2R5D A;  5CCH D;  1NVO A;  3PH0 A;  1NAF A;  3H1K D;  5APT A;  5AVW B;  3B71 A;  3P32 A;  5CJ0 A;  5AW2 B;  1IK9 A;  2UWJ E;  3D6Y A;  3JCU E;  2L91 A;  1TU3 F;  1SS1 A;  2JWD A;  4UB6 H;  1KYO H;  1FU1 A;  1KTM A;  3RK2 B;  5L8R J;  1X8Y A;  2W8Z A;  1HH0 A;  1QL1 A;  3M9B A;  3CCQ P;  2Z5I A;  4R4L A;  2E75 B;  3R2P A;  2Q7C A;  5B5E E;  1NTZ G;  3L75 J;  2R32 A;  4PD4 H;  3L75 E;  2XZR A;  1JOC A;  1KMI Z;  1P84 I;  1N7S A;  1NTK G;  2W27 A;  2FXP A;  1AVO A;  3WMM 0;  1R5L A;  2KB7 P;  1L0L J;  2ZVO B;  1L0L E;  1GL2 D;  2HPC B;  3RK3 B;  1SFC D;  2E5T A;  3IF4 A;  4PV1 D;  2H8P D;  1YQ4 C;  4H0L C;  4WBA A;  3CCM P;  1FE6 A;  1RY3 A;  3N4X A;  3TK1 A;  3QWO C;  2P58 A;  1BDD A;  4I2L C;  1QVF O;  4I6M C;  3MP7 B;  3E1I A;  1Q90 D;  3H1I D;  1KYO E;  1OMI A;  5APX A;  3CCJ P;  1JM0 A;  2WPV B;  2IFM A;  4JYC A;  4GOD A;  4L74 A;  2WZ7 A;  2N9B A;  1J1D B;  1FJP A;  2N1T B;  3CCE P;  1T3U A;  1FOS E;  1JCC A;  2JWA A;  1MZ9 A;  4ZKP A;  1S72 P;  1YHQ P;  1ZN5 A;  2I1J A;  3V2R A;  4L75 A;  3HD7 B;  4PD4 E;  3H1H D;  1W2B O;  1HBW A;  4RO0 A;  3Q3D A;  2JP3 A;  3RK2 C;  5B66 E;  4DJG A;  1VQ7 P;  2O01 H;  1NU1 D;  1T3J A;  2NRG A;  1QLE D;  5GTI H;  2KK7 A;  5KLV K;  2E75 C;  1DD3 A;  3EWK A;  1HVV A;  5KAF H;  1RF1 B;  2LR2 A;  1PPJ D;  2KYV A;  1FZA A;  3OJA B;  3L75 G;  3R4Y A;  3EQ2 A;  5C39 A;  2AXT E;  3RK3 C;  3CD6 P;  4YPC A;  1ZME C;  4YTP C;  3L4F A;  2RH0 A;  2YXQ B;  4R4M A;  1Y9B A;  3O6Q B;  1L0L G;  4Y28 J;  2OYI A;  5KJ7 A;  2M8R A;  3H1K J;  2DW3 A;  3H1K E;  4OGQ B;  2D2C B;  3C8V A;  2AEF A;  4L76 A;  1VF5 B;  3TDK A;  1LTJ B;  3ZDM A;  2ZVN B;  3VMA A;  1AFO A;  4K35 A;  1VQ8 P;  3KZI H;  3WUV A;  4BRY A;  1KQG B;  3AE4 C;  3L73 J;  1J1D C;  5H2F H;  3L73 E;  2N1T C;  4DOJ A;  2WSC H;  4BWN A;  5GTH H;  3AE9 C;  1H0T A;  1LTT C;  5KLV D;  2E74 D;  5AW3 B;  3HD7 C;  1GK4 A;  3KPE A;  3CC7 P;  1SVF A;  5KAF E;  1X79 B;  2O1K A;  5AW9 B;  3CI9 A;  1KIL D;  1URQ A;  3KDP B;  1KB9 I;  3EFG A;  1JNM A;  2R3C A;  3ITK A;  4WY4 A;  3RL0 D;  4I1L A;  4UB8 H;  2Q9I A;  1L2P A;  3JC2 2;  1NKZ B;  3CCR P;  2E5Y A;  2P7J A;  1BCC D;  3CXH I;  1T6A A;  2YMY A;  1N86 A;  3GW6 A;  1JMM A;  3D70 A;  2MKV A;  1KFM A;  1RF1 C;  1S4X A;  3I55 P;  1YQ3 C;  2HYN A;  2XKM A;  1AQ5 A;  1EC5 A;  3KZI E;  2RKL A;  1OVV A;  2A06 E;  3VMX A;  3H1I J;  3H1I E;  2WSC J;  3AE3 C;  5APU A;  1NOH A;  1BDC A;  1IO4 A;  2ITA A;  4AQR D;  2W83 C;  5GTH E;  3PJS K;  1S2E A;  4OVN F;  5TIS H;  4OGQ C;  2D2C C;  2Y0E A;  1VF5 C;  2CPS A;  1LTJ C;  2PAJ A;  2W6B A;  3V6I A;  4D6T J;  4D6T E;  2XDJ A;  3Q5P A;  1OVU A;  4O9B A;  4GT1 A;  3H1H J;  2WPR A;  3H1H E;  1BSN A;  2GA1 A;  4UB8 E;  1S9K E;  1CW5 A;  3CWB D;  2WPQ A;  5E79 H;  3L73 G;  2YIU B;  5TJH A;  1NU1 J;  1NU1 E;  2JJL A;  2FYU K;  2AEJ A;  1KFN A;  3MTU E;  2OTK E;  2QG4 A;  3ABV C;  5EFW B;  2PP6 A;  2K9J A;  1OFC X;  1LP1 A;  3H6P A;  3S9O A;  1UIX A;  1JMB A;  1P84 D;  1SQP D;  1DH3 A;  1JB0 J;  3GHG B;  4NPE A;  2OYI B;  1GTW A;  5AVV B;  1M57 D;  2PFX A;  5TIS E;  1K9M Q;  1WT6 A;  2XU6 A;  4NPF X;  1ZR2 A;  3QH9 A;  4RES B;  2H88 C;  4DCK A;  4BRY B;  2IZ1 A;  3T97 B;  2OYH B;  3SWY A;  1WRG A;  1K8A Q;  2A45 I;  1YJ9 P;  2A06 G;  1AQT A;  4OWF A;  3H1I G;  5AVU B;  3Q5R A;  3RK2 D;  3OA7 A;  2AEM A;  1PV3 A;  2WPS A;  2FYU D;  3FWL A;  1JY2 N;  1JTH A;  1SQX J;  1SQX E;  1IZN B;  1URQ B;  5KLV J;  5KLV E;  4NPD A;  3OW2 O;  1USD A;  4D6T G;  1EZV G;  3HE5 A;  1JY3 P;  1KIL E;  1PGQ A;  1FZB A;  3PLN A;  3PTZ A;  5KAI H;  3AE1 C;  3HRN A;  2GUS A;  4OH8 B;  1BCC J;  1NU1 G;  1BCC E;  1PL5 A;  3RK3 D;  3B5N B;  2H89 C;  5BU8 B;  3I56 P;  1OVR A;  1K04 A;  1NKN A;  3GHG C;  2B87 A;  1H89 A;  1VQM P;  2IYO A;  2OYI C;  3AEC C;  1P84 H;  1LWU B;  3HD7 A;  1YBK A;  2KNC A;  1A02 F;  1LTS C;  1SQQ D;  1SLQ A;  4IFM A;  2OYH C;  3HUS A;  2E76 D;  2NPS D;  2YO3 A;  2GUV A;  1QL2 A;  3M06 A;  1RF1 A;  4H44 D;  3L70 D;  1LTI C;  3CLQ A;  3G9R A;  1USE A;  1URQ C;  2K9J B;  2KS1 B;  2O3J A;  4K3A A;  1LP1 B;  3MIW A;  1FAV A;  1NH4 A;  2Y9Y A;  1SQX G;  1KB9 D;  3O6Q A;  1T2K C;  3L72 D;  2ZJS E;  1FZG A;  4W7Y A;  1XTG B;  1LTA C;  1P84 E;  4I7Z B;  1SQP J;  2KZJ A;  1SQP E;  3WU2 H;  1VQ4 P;  2ZXE B;  3W67 A;  1LTJ A;  2FKW B;  3RBX A;  1M1K Q;  3CXH D;  3BVH A;  3B5N C;  2P2U A;  3TGU D;  2K3R A;  3BRV B;  3A2A A;  3VP8 A;  4U3F D;  3VTP C;  2JO1 A;  2C9L Y;  2IBZ G;  3CX5 H;  3LID A;  3CCU P;  2HR3 A;  2ZYG A;  2AXC A;  1HUC A;  1LWU C;  1OW8 A;  1LTG C;  2QJY B;  1SP4 A;  3H1J G;  2CPB A;  5B66 H;  1JTH B;  1EXJ A;  3TF5 A;  4GOE A;  1SFC A;  3O8Z A;  1PP9 D;  1YI2 P;  2FYU J;  2FYU E;  2QIW A;  1JCD A;  3HE5 B;  1SQV K;  3AED C;  3L36 A;  2Y0D A;  2BCC J;  1R8E A;  2BCC E;  1JY3 O;  4DZO A;  2H7H A;  1N7S D;  1NO4 A;  3BRT B;  5CHX A;  1HF9 A;  3WU2 E;  4N3Y B;  1DEE G;  1EDL A;  2ZT9 B;  1J1E B;  2PGD A;  3AE6 C;  1MKM A;  5AVQ B;  2KP8 A;  3AE8 C;  2N9Y B;  2AXT H;  5KLI B;  3AEE C;  4EIJ A;  2B87 B;  3CX5 E;  3H32 B;  1IC2 A;  3KQG A;  4I7Z C;  1KB9 H;  3H1L D;  2KOG A;  2VRS A;  1D7M A;  2KNC B;  4A7P A;  1SQB J;  1SQB E;  1SQP G;  3F89 A;  4KHX A;  2V4H A;  3M0A A;  2HG5 D;  1NTM K;  1KQL A;  1OXZ A;  2KXP B;  2K9Y A;  3HUS B;  2ZYD A;  1SQQ J;  1SQQ E;  1RQV A;  4W7Z A;  1L0N K;  3E7K A;  2IDB A;  1SQV D;  2QJY C;  3D6Z A;  4WB4 A;  1KYO I;  1EDI A;  1M90 Q;  5KTB A;  3SFD C;  5BVZ A;  1PZQ A;  2M3B A;  2YMK A;  1YTZ I;  4AUW A;  3L70 J;  3L70 E;  2LXC B;  3GHG A;  3A5T A;  1OWA A;  5AW5 B;  1BE3 D;  4XA4 A;  3F5H A;  3L71 D;  3AE7 C;  3SFE C;  2BAS A;  2W90 A;  1KB9 E;  2FYZ A;  3L72 J;  2BCC G;  2POH A;  1AV1 A;  2ZT9 C;  3L72 E;  1J1E C;  4KJM A;  3VMY A;  4KT0 J;  4LLH A;  3T97 A;  2WT7 B;  2QM7 A;  1GDT A;  1IFI A;  2OYH A;  5KJ7 D;  5KLI C;  4H13 D;  1NTZ K;  3TGU J;  1G2C A;  3TGU E;  1NTM D;  1FZC A;  2M5A B;  1NJI Q;  4U3F J;  5AVZ B;  1HGV A;  4U3F E;  1Y8A A;  3CC4 P;  1VQN P;  1L0N D;  3K5B A;  1QX8 A;  2OGU A;  1VPC A;  1IFJ A;  5AW0 B;  2B9B A;  3CPW O;  1FOS F;  5AW1 B;  1GL2 B;  1S1C X;  1SFC B;  1SQB G;  1Q7Y Q;  3LW5 H;  3HUS C;  1ZP0 C;  1GW4 A;  3FXE A;  1PP9 J;  1PP9 E;  1GW3 A;  1OW7 A;  4WY4 D;  1SQQ G;  2IPP A;  3B5N A;  1CSB A;  2JDI H;  1OZH A;  3IAO A;  1FZE A;  1HWT C;  1OW6 A;  3P8C D;  1YJW P;  4GDO A;  4JQ0 D;  1EXI A;  2QRX A;  1RQU A;  2A45 H;  4RJT A;  5APW A;  1LT9 A;  3FWN A;  4N78 D;  1NYH A;  4HB1 A;  1NTZ D;  1LWU A;  2M3E A;  2R3S A;  3FGA D;  4M3L A;  4BXL A;  3P8M C;  3L37 A;  1ZR4 A;  3Q1M A;  3H1K G;  1LT1 A;  1FZF A;  3H1L J;  2HOD B;  2NZ2 A;  3IFM A;  3MUD C;  4TT3 H;  3B4S A;  3LW5 J;  1QEX A;  1FDO A;  3S1K A;  4YXD C;  4IL6 X;  4U7J A;  2IYP A;  1M1J A;  1M7L A;  4U3F G;  3L74 D;  2KS1 A;  1GL2 C;  2FXM A;  2QJP B;  1L0L K;  1SFC C;  4H0L D;  1PPJ E;  3GF3 A;  2WMM A;  1VQ9 P;  2I1K A;  3AEB C;  1X9V A;  1E79 H;  1U7M A;  3MHV A;  1VQL P;  3CCL P;  1U7J A;  1R5S A;  2QVA A;  1FC2 C;  1L4A A;  2W6J H;  2Z4E A;  1BE3 J;  1BE3 E;  2FBW C;  1AA0 A;  1JO5 A;  5CCG A;  3L71 J;  1PP9 G;  1YIJ P;  3L71 E;  1EZV I;  1ZOY C;  3M0D C;  3CCV P;  2R44 A;  1X22 A;  1G2C B;  3CMA P;  5BU5 A;  1KQS O;  1FZC B;  2QJK B;  3S4R A;  2E74 B;  5AW6 B;  1YIT P;  3AE5 C;  1KIL B;  3L75 D;  1M56 D;  3RL0 B;  1IFP A;  1L0N J;  3G3Z A;  1L0N E;  1GZL A;  4B86 A;  2E75 D;  5AVR B;  1DIP A;  3HTK A;  1L0L D;  3H1H G;  2Q5U A;  3BCC D;  2C0X A;  3MZW B;  4PJ0 E;  3NTN A;  1G1I A;  1VQK P;  1HTL C;  1H88 A;  1J2J B;  3Q2Y A;  2YO2 A;  4C7N A;  3N7N A;  4EI2 A;  1FJK A;  2R5B A;  1W5C E;  2QJP C;  4ZMD A;  1KYO D;  3VP9 A;  4AYC A;  4XFJ A;  1LT9 B;  3KYQ A;  3P8C E;  2Q6Q A;  3H32 A;  2A45 G;  2ZT9 D;  1PPJ G;  4IL6 E;  3P7K A;  3SWF A;  3TSI A;  4N78 E;  3MD0 A;  1KD1 Q;  2IX7 C;  2WIT A;  1NTZ J;  2N1T D;  1NTZ E;  2V7Q H;  1N73 B;  3FX0 A;  3PRJ A;  2JEE A;  3CC2 P;  3VOP A;  1BE3 G;  1VL2 A;  2FFD C;  3U1C A;  2P10 A;  3HD7 D;  1BSH A;  3RGU A;  5KKZ B;  2NPS A;  1FZC C; 
#chains in the Genus database with same CATH homology
 2ZXX A;  3F5H A;  2Q6Q A;  1UII A;  3WUV A;  4BRY A;  3E1R A;  4BRY B;  2WVR A;  3WUT A;  3WUU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...