2E42A

Crystal structure of c/ebpbeta bzip homodimer v285a mutant bound to a high affinity dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAARKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DTP*DAP*DGP*DGP*DAP*DTP*DTP*DGP*DCP*DGP*DCP*DAP*
total genus 31
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2e42A00
3M0DA 3TNUB 3KDPB 3HTKA 3A3YB 3V4WA 4AYCA 4I2LC 3VMYA 2E43A 2WWWA 2WPSA 4HYTB 4I6MC 1DH3A 3M0AA 5APUA 3NMDA 1T2KC 3P32A 3P8MC 5AVWB 1JNMA 2R3CA 4C46A 5APQA 1GD2E 2JJLA 3NXSA 3L35A 2WT7A 2WT7B 3TYYA 3LIDA 1GTWA 1OWAA 3M06A 5APYA 1GZLA 3HE5A 2P67A 2C9LY 5AW3B 2KP8A 4RESB 5AW5B 2Z5HA 2QM7A 2VRSA 3TK1A 3HE4B 2QM8A 1A02F 3P7KA 5APWA 4GT1A 3VMZA 5AVXB 2BASA 2P2UA 4JYCA 1H89A 3L36A 1H8AA 3LIEA 3MGNA 5APXA 3VN0A 5AW4B 5AW0B 1GK6A 5AVZB 2XV5A 5AW7B 1J2JB 1CI6B 3M9BA 5AVUB 4EOTA 1YYCA 1SLQA 2YO2A 3NFQA 4C7NA 1JUNA 1CZQA 5AVYB 1S9KD 5APVA 2ZXEB 1X8YA 1FOSF 1GK4A 1OXZA 3KQGA 3A2AA 2R5BA 5AW1B 3V4QA 4B86A 1HUCA 4LC1A 5AW8B 1MFZA 3IR9A 1IO4A 2P7JA 4AUWA 3UIAA 3A7OA 4GKGA 3VTPC 2YNYA 2W6AA 5AVVB 3V5BA 3O8ZA 2Q7CA 2R32A 3M9HA 1HJBA 2R5DA 1HBWA 5AVQB 1CSBA 2XZRA 3I5CA 1CI6A 1G2CB 4AQRD 1GU4A 1FOSE 2WTYA 4JYBA 2Q5UA 1T2KD 3SWFA 5AVRB 1SP4A 5AW9B 4KHXA 3L37A 1KQLA 3HE5B 2W27A 1FAVA 2N9BA 2Z5IA 2C9NY 5APTA 2ZFCA 3HE4A 1MUUA 3OAKA 1A02J 1HWTC 1H88A 4DZOA 1MV8A 3B8EB 2WPRA 5AVTB 3T97A 2H7HA 1GU5A 1NWQA 3M91A 5AVSB 3VYIA 3VMXA 2YO3A 2Q3IA 1NAFA 5CMZA 1S9KE 3MD0A 4C7NB 3A5TA 2WPQA 3TNUA 4XE5B 4M3LA 5APSA 5AW2B 2E42A 2IPPA 5AW6B 2XU6A 3NTNA
chains in the Genus database with same CATH superfamily
3M0DA 3PRJA 4NPFX 3SSUA 2KB7P 3HTKA 1PGQA 3A3YB 1XTCC 3N4XA 5AVTB 1SQXD 2BEQD 2FYUG 3WUVA 3AEGC 2RN0A 4KJMA 1ZP0C 3U1CA 3CMEP 1JY2N 3RL0D 1LNQA 1N86A 3FWLA 3MTUE 3OJAB 2P58A 1NJIQ 2HPCA 3P8MC 3AEBC 1LTSC 2R3CA 1LTJB 3L72G 1EZVG 2JJLA 2QJYB 3D70A 2R3SA 2WT7A 2I1KA 3L74J 3L75E 5KKZC 5CHXA 2L5GB 3LIDA 1GTWA 3L70E 5M1BA 2IZ0A 1OWAA 2MKVA 1QVGO 1KZUB 1GZLA 2D2CB 3H1HE 1USDA 2GUVA 3HE5A 3KPEA 3Q1MA 3L4FA 1AV1A 1ZW0A 3LW5H 1OVUA 4OGQC 3OA7A 2IFNA 2FY8A 1PFIA 4H13C 3CWBG 1H0TB 3VOPA 3P7KA 2YIUB 2KXPB 1LT1A 2QEXP 2FXMA 1OMIA 1S5LX 2GUSA 3TGUE 1BCCE 2QG4A 4ASWA 1URQA 1HTLC 5DJUB 4XA4A 1L0NE 4Y99C 1T6AA 4ASVA 5AVZB 2XV5A 2ZT9C 1N7SC 2WSFJ 1J2JB 4HKZH 4EOTA 1HF9A 5H2FE 5CBNA 1BGYD 2YO2A 3CCEP 1ZN5A 3TSIA 2QA4P 1JY3N 3BCCD 3VMAA 1KYOI 4EI2A 2A06E 2CK3H 2KOGA 2V7QJ 3GF3A 4WB4A 1KYOD 1M7LA 1SQPG 3AE4C 3V4QA 1HUCA 4N78D 3E1IA 4B86A 2FYNB 2JO1A 3IR9A 4LLHA 4WY4B 5B5EH 3RK3C 4OH8B 1NOHA 4AUWA 1NTMJ 2YMKA 4RJTA 4K35A 2K88A 4C7RA 1KFNA 2Q3EA 1RY3A 3IFMA 3V5BA 2E5YA 3GHGA 1L0LE 4PD4D 2Q7CA 3AEEC 1RF0C 3CX5I 2E75C 5KLVD 2R5DA 1HBWA 5AVQB 1CSBA 1URQD 2N1TB 3H1LD 2HFED 1EDIA 1NTKE 3VP8A 1EC5A 1KORA 2WSFH 2M5AA 3H1ID 3PLNA 3G3ZA 1L0ND 3PTZA 4TLFA 2O1JA 2K1AA 2W6BA 1EDJA 4AQRD 1KFMA 1PPJE 1M1JB 3AEAC 3L72J 4LGDE 1GU4A 1KB9H 3E7KA 1FOSE 4JYBA 2FYNC 2KK7A 2N1TA 3TGUD 1VQ5P 1BGYJ 2E5TA 1OW6A 2ZAEB 3E1RA 1NTZJ 1QL1A 1YQ4C 2JR8A 4PJ0H 2W27A 2HODB 1NTMG 4W7ZA 1OZHA 2ZFCA 3CCJP 1T3UA 2CPBA 3FGAD 1E79H 3D6YA 1FDOA 1IFDA 3WUTA 2NRGA 3AEDC 4L75A 2POHA 1SQPJ 3WU2E 3B8EB 1RE4A 1IFJA 2C0XA 1NTZE 2KLUA 2E74C 4WY4A 3H1HD 3GLMA 3CC7P 3N7NA 1FZBA 3SFEC 4BRYA 3GMAA 5C39A 3U59A 4D6TJ 1QLED 1VQPP 3L75D 1EXIA 1HJ0A 3B5NA 3QH9A 1VQOP 1BSHA 3H1LG 2K3RA 1UIXA 1L0NK 3RK3D 2WSCJ 3MD0A 4C7NB 2O01J 1FZCA 1LWUC 2WMMA 1PV3A 2D2CD 4XE5B 2B87B 1GDTA 1KQGB 1NU1D 1SQVG 3IN6A 5TJHA 3H1JE 1G1IA 5BVZA 1YJ9P 1SQQE 3KZIH 1YIJP 1PGJA 1M90Q 1KB9E 1DEEG 3L71E 3TNUB 1MKMA 3KDPB 5KLIC 4W80A 1FZFA 1RE3A 3JC22 4IFFA 3A0BH 4I2LC 3FX0A 3HUSB 3EQ2A 4PV1D 2R44A 4XFJA 4Y28J 1H0TA 1L0LK 3H1JD 3Q5PA 2WPSA 3Q5SA 1L0NJ 2G8YA 3O6QA 2B87A 2FFDA 1PGOA 3MZWB 2J58A 2YIUC 2QJPC 3BATA 2BEZF 5APUA 5CCGA 1T2KC 2QJKB 3P32A 2H43A 4HB1A 2HLOA 1P84E 3CCRP 4H44C 1CW5A 2M8RA 3AE6C 3B5ND 3HUSC 4C46A 1GD2E 1PGPA 4D6TD 1NVOA 3NXSA 3L70J 1VQ8P 1SQPK 4R4LA 3HD7B 5BU8B 1SFCD 2A45G 2B88A 3TYYA 3GG2A 1L0LD 4PD4E 5APYA 2E75B 4I1LA 2JP3A 3CXHI 1NYHA 2NZ2A 4YXWH 1S3JA 1SQBE 1OW7A 2A45H 2P67A 1WT6A 3AE3C 5KJ7D 3V2QA 5GTIH 2ZJSE 2NPSD 2LR2A 2OTLP 2Z5HA 1ZR4A 2E76C 1KILD 1OVRA 2QM7A 4W7YA 4DT0A 1JY2P 1K73Q 2HODA 2Y0DA 4GT1A 1KYOE 2W90A 4U3FG 3TGUJ 3VMZA 3D6ZA 1FZAA 3L73D 1PZQA 2N1TC 1PPJG 3A0HE 5KAIE 3L36A 3CX5D 2FBWC 1H8AA 1N73B 2OYIB 2YKPA 1YHQP 1M1JA 1EZVD 1OX3A 4H0LC 1JEKA 1GK6A 1HH0A 1NTME 2W83C 3KXDA 1LT9B 3H1IG 5AW7B 2PRRA 1CI6B 4WWIA 2J5UA 5AVUB 1D7MA 2YKOA 1W2BO 1SLQA 4C7NA 2KIKA 1GW4A 1L0LJ 2JWDA 1KILB 2OTKE 3W67A 5KLVE 1RF0A 1GL2B 1SQVD 3MUDA 1P84D 2ZXEB 3GHGC 4YXDC 2IZ1A 2OYIC 1OXZA 2JDIH 3KQGA 2C9LY 2R5BA 2IBZE 5AW1B 1FZCB 4L74A 3I55P 3CCVP 4Z1MH 3ZDMA 1NTKK 4WY4D 2QRXA 3B5NB 3UIAA 1Q7YQ 2QVAA 2MJZA 3A7OA 1X79B 2ZYDA 3VTPC 1LTTC 1SQVJ 2FFDC 3L74D 4UB6E 5AVVB 2A06D 4Y99B 1KB9D 3L71D 5DJTB 1HGVA 2HYNA 1FJKA 1GW3A 3M9HA 2C0WA 3RBZA 1E5WA 4IFMA 3SWKA 4ZKPA 1RF1C 1LWUB 3A0HH 1SQQG 3I5CA 1CI6A 4I7ZC 1SQPE 1SQQJ 3F5HA 1QX8A 2Z4EA 2WSCH 2KUBA 2O01N 2W6JH 1N73C 1Q2NA 3WUUA 2WTYA 1IFNA 2ZVNB 1RF1A 5AVRB 1PP9D 5AW9B 3Q2YA 5GTIE 3HE5B 3OW2O 3JCUH 1EDKA 2N9BA 3AE7C 2O1KA 3L71G 1KD1Q 1AFOA 1L0NG 2IBZG 2KZJA 3H6PA 3HE4A 4GOFA 5APTA 3F89A 2N9YB 5EFWB 1R8EA 2BCCJ 3G4SP 4GDOA 5KKZB 4N3YB 1LP1B 1OIPA 1K9MQ 3H1HJ 1JCDA 5KLVG 3T97A 1RHZB 2YMYA 1SQQK 3PH0A 2WSEJ 4RKUJ 4EDFA 2H7HA 3ABVC 3L70D 1NWQA 1KB9I 2FFDB 3L72E 1J1DC 3V2NA 2B9BA 1PP9E 3VYIA 2ZT9D 3VMXA 2DW3A 1W5CE 2YO3A 2Q3IA 4GOEA 1S9KE 5CMZA 1FS0E 1RE4C 4WY4C 5CJ0A 3H1KJ 3L73J 1SFCC 2AEMA 1SQPD 3TNUA 3KHUA 1LT9A 3IAOA 3CMAP 5KJ7A 4IL6E 5AW2B 1EZVE 1FDMA 1KYOH 3M9QA 1SQXG 2KNCA 1KILA 3AE8C 3NTNA 1X22A 3AE9C 4IL6X 2O3JA 3CPWO 5KTBA 1LTGC 2AXTH 1YBKA 1JMBA 2KS1A 4AYCA 1R5LA 3AE2C 1LTJC 1AQ5A 2Q6QA 1HVVA 3MHVA 3AECC 3RK2C 2RKLA 3MP7B 2LKMA 3R4YA 1YJNP 2E43A 1KILE 3CC4P 2M3EA 1X9VA 1EZVI 1URQB 1IJDB 1M56D 2QE7H 4HYTB 1T3JA 4N78E 2KYVA 4U7JA 2E74D 2IBZD 3NMDA 1VF5D 2V7QH 2E74B 1KQFB 1LGHB 1KTMA 3H1IE 1Q82Q 1JB0J 2H88C 3HD7D 1NTKD 1PP9G 2RH0A 1SVFA 1OVVA 3CI9A 3USSA 2WT7B 3L35A 3PHLA 4WBAA 2OYOA 5TISE 1Q86Q 1VQLP 1IK7A 4EIJA 4UB8E 2I8DA 3M06A 1NTMD 4U3FE 2P1JA 3C9IA 3ITKA 3CCSP 2OYHB 3CC2P 4MN4C 3BRTB 4NPEA 5CCGC 4DJGA 3CX5E 1BDDA 1BCCD 1JY3O 1LP1A 1QEXA 3EFGA 4JBZA 1DEBA 3H1JG 4PV1B 2VRSA 2A06G 1L2PA 2QM8A 2Y9YA 3P8CE 3PP5A 1A02F 1VQNP 1JY2O 3BCCJ 1FZGA 2BCCG 3JCUE 2Q1KA 5B66E 5AVXB 2K9JA 3EWKA 1R5SA 4JYCA 4UB6H 1H89A 1EDLA 2WQYC 2IX7C 1L4AA 3BCCE 3GF7A 1U7MA 1SQBD 2NPSB 3FXEA 3BASA 3MGNA 3RK2B 1G2CA 3VN0A 5AW4B 2Q9IA 1KN7A 3FWNA 3L75J 4OWFA 5CCHC 3H25A 2P10A 1AA0A 3H1LJ 1FJPA 3HTKB 1LWUA 3M9BA 1DIPA 1YYCA 3NFQA 3HRNA 3RK3B 1N2DC 3TF5A 1JUNA 1S9KD 1ZV8A 3H1KE 1EXJA 5APVA 1BE3J 1NKNA 1P84H 1X8YA 3L75G 1ZRTE 3CWBE 4JPZB 1RQVA 2ZXXA 3RL0C 3U1AA 4EYYQ 4DCKA 1MZ9A 1L4AC 2LXBA 1ZMEC 1OW8A 1SQBJ 4LC1A 1VL2A 2Y9ZA 1IO4A 4I7ZB 1H88A 1KILC 1IC2A 2W8ZA 2B89A 1N8RQ 3CWBJ 1VQ6P 1FZEA 1IK9A 2YNYA 3RL0B 1HGZA 1FBMA 1XTGB 2A45I 2O01H 3H1JJ 5KAFH 4IFDK 3O8ZA 1LT9C 1SQQD 2R32A 3H1KD 4BXLA 1HJBA 1EQ7A 2I1JA 1DH3A 1Q81Q 1L0LG 2UWJE 3L74G 4H0LB 2PFXA 1BE3D 2Y0EA 1WRGA 1FE6A 1S2EA 3RK3E 1YITP 3H1IJ 1N73A 2Q5UA 1T2KD 1NTKJ 2WITA 1SP4A 1NTMK 2K9JB 4KHXA 4K3AA 1KQLA 2XDJA 3C8VA 1IFIA 1LJ2A 2K9YA 2Z5IA 4L76A 1Z56A 2NPSC 4R4MA 2C9NY 1MUUA 2J59M 1GL2D 1PIXA 3OAKA 5E79H 2AXTE 1SQBG 4H13D 5CCHA 3H32B 3IF4A 1LTJA 1VDFA 4RO0A 2CPSA 1MV8A 2WPRA 1ZLLA 2HPCB 3CXHE 3FXDA 1GMJA 1BE3G 1GU5A 4H44B 4PD4I 3M91A 2M3BA 3HD7A 3TDKA 1SQBK 5AVSB 2Y0CA 5KJ7C 5B66H 1SQVE 1Y8AA 3II6A 1LTAC 4L73A 1PPJD 1NAFA 5H2FH 1NTZK 1SFCA 2PP6A 3L73G 5GTHH 3H1KG 2YKQA 3B71A 1BGYE 1VQ7P 3Q3DA 1JMMA 3JSVC 2OYHC 2WPQA 5APSA 3CCMP 3H1LE 2FYZA 2LXCB 2N1TD 2ZYGA 2E42A 5AW6B 2IYOA 2PAJA 2XU6A 1AJYA 2HG5D 2E75D 1AVYA 1M8OB 4JF7A 2XKMA 1JM0A 5KLVJ 3V4WA 3H1HG 1SFCB 3VMYA 2BCCE 3BVHA 1S72P 2IFMA 3RL0g 2QIWA 2WWWA 4PV1C 1LTIC 1YTZI 2XNDH 2OYIA 5BU5A 1ZR2A 4I6MC 2WVRA 3M0AA 4BRYB 1N7SD 1WMKA 1YI2P 1NH4A 1ZXGA 3QWOC 1K05A 4CPGA 4OGQD 3T97B 5AVWB 1JNMA 1DD3A 1PP9J 1JOCA 1GL2C 1FU1A 5APQA 3D71A 1QGKB 1NKZB 2FXPA 3L72D 4NPDA 4OVNF 2ZVOB 1VQ9P 1Q90D 2G3AA 3CL3D 2OYHA 4N6JA 3G6EP 1RQUA 2JKVA 2OGUA 2WPVB 3AEFC 1RH5B 2FYUJ 3CXHD 5K5GB 3I56P 1BSNA 2E76D 1Y47A 2FXOA 2KP8A 4YPCA 4RESB 3H32A 4IOIH 5AW3B 1G1JA 5AW5B 3V2RA 3K5BA 3W68A 1NU1G 1JY3P 2QJYC 2V4HA 1NU1J 2ZT9B 3TK1A 3HE4B 4O9BA 3KZIE 1SQXJ 5APWA 5TISH 5CBOA 2JEEA 1K04A 2BASA 2P2UA 3M0DC 2QSIA 4JQ0D 1RF1B 1W2EA 1U57A 2KNCB 3LIEA 3O6QB 4GODA 1VQMP 2KSJA 5APXA 3V2PA 1NU1E 1NTKG 5AW0B 2KSEA 1MFTA 3KYQA 3V6IA 2GM4A 4H0LD 3CCQP 5GTHE 2FYUK 2PGDA 2WSEH 3C1LA 2YXRB 1J1EC 4TT3H 1CZQA 5AVYB 1YJWP 1IZNB 1KV4A 1OFCX 2ZYAA 3PJSK 1NU1K 2AEJA 5KAIH 1FOSF 1T8ZA 1GK4A 2E76B 2H8PD 3L74E 3WMM0 1J1DB 1KMIZ 3A2AA 1VQ4P 1M1JC 1P84I 1QL2A 2QJPB 1BCCJ 1IFMA 1AVOA 1YQ3C 1DD4A 1GL2A 5CCHD 2HR3A 1TU3F 5L8RJ 5AW8B 1MFZA 1NTZD 1KQSO 1QVFO 3RGUA 2K37A 1SQXE 2OQQA 2P7JA 3A0BE 4KT0J 4U3FJ 5E79E 4YTPC 3TGUG 3L71J 4OGQB 1BDCA 4GKGA 3S1KA 3Q5RA 3CX5H 2W6AA 3MIWA 1NAYA 1SS1A 2SPZA 1ZRTD 3CWBD 1M1KQ 1VPCA 1JTHB 1N7SB 2AEFA 1S5LE 5CJ4A 3CCLP 1FZCC 1L4AD 3G71P 1J1EB 2XZRA 2JWAA 1K8AQ 1DX7A 2ITAA 1VF5B 3B5NC 4GIFA 1NO4A 3S4RA 1SQXK 3L70G 3WU2H 1G2CB 2M5AB 1VQKP 3R2PA 3AE5C 1L4AB 3MUDC 2OTJP 2YXQB 1AQTA 3RK2D 3SWFA 1N7LA 1S5LH 2L91A 3L73E 5KLIB 3L37A 4HJGH 4HH2A 2M0BA 1FAVA 2BCCD 1JCCA 1FDIA 2WSSH 3RBXA 3GHGB 3SWYA 3P8CD 3VP9A 3CCUP 1VF5C 2KZIA 3CLQA 3EFFK 1A02J 1HWTC 1X0TA 3BCCG 2FYUE 2FYUD 1BCCG 1NHLA 2KLVA 3HD7C 4DZOA 3SFDC 1RE3C 4WVZA 1NTZG 2RMZA 1YTZT 2GA1A 1BGYG 2D2CC 3GW6A 5KAFE 4U3FD 5CCGD 2KI7B 1JTHA 1N7SA 1M57D 1UIIA 2IBZI 2OARA 4IL6H 5KLVK 1ZOYC 3G9RA 4PJ0E 4H44D 2H89C 3CD6P 1JO5A 2IDBA 1URQC 3CXHH 4D6TE 4PD4H 4A7PA 4ZMDA 4H13B 3LW5J 4UB8H 1KC8Q 1IFPA 1S4XA 3AE1C 1BE3E 2QJKC 4ZNCA 4DOJA 2KS1B 3A5TA 3S9OA 4ZKUA 1SQVK 4M3LA 2XNXA 1U7JA 2AXCA 4QMAA 1S1CX 5B5EE 2WZ7A 4BWNA 1LTBC 3B4SA 1FC2C 3BRVB 1PL5A 2NPSA 4D6TG 1NGMB 1Y9BA 2IPPA 1USEA 3HUSA 2IYPA 2FKWB
chains in the Genus database with same CATH topology
3M0DA 2KB7P 3HTKA 3A3YB 1XTCC 3N4XA 3U1CA 1JY2N 3RL0D 1N86A 3MTUE 3OJAB 2HPCA 3P8MC 1LTSC 2R3CA 1LTJB 2JJLA 2WT7A 2I1KA 5CHXA 2L5GB 3LIDA 1GTWA 1OWAA 1KZUB 1GZLA 3HE5A 3KPEA 2GUVA 3L4FA 3LW5H 3OA7A 2IFNA 1PFIA 3VOPA 3P7KA 2FXMA 2GUSA 1URQA 1HTLC 4XA4A 4Y99C 5AVZB 2XV5A 1N7SC 1J2JB 4EOTA 2YO2A 1ZN5A 3TSIA 1JY3N 2KOGA 4WB4A 1M7LA 3V4QA 4B86A 1HUCA 4N78D 3E1IA 3IR9A 4LLHA 4WY4B 3RK3C 4OH8B 1NOHA 4AUWA 4C7RA 1KFNA 1RY3A 3IFMA 3V5BA 3GHGA 2Q7CA 1RF0C 2R5DA 1HBWA 5AVQB 1CSBA 1URQD 2N1TB 2HFED 3VP8A 2WSFH 3G3ZA 2O1JA 2W6BA 4AQRD 1KFMA 1GU4A 1M1JB 4LGDE 1FOSE 4JYBA 2N1TA 1QL1A 2W27A 2HODB 4W7ZA 2ZFCA 1T3UA 2CPBA 1IFDA 2POHA 3B8EB 1RE4A 1IFJA 2C0XA 4WY4A 5AVTB 3N7NA 1FZBA 3U59A 3B5NA 3RK3D 1L0NK 3MD0A 4C7NB 1FZCA 1LWUC 4XE5B 1GDTA 1G1IA 5BVZA 3TNUB 3KDPB 4W80A 1FZFA 1RE3A 4IFFA 4I2LC 3HUSB 3EQ2A 1L0LK 2WPSA 2FFDA 1DH3A 2J58A 3BATA 5CCGA 5APUA 1T2KC 3P32A 2H43A 2HLOA 2M8RA 3HUSC 3B5ND 4C46A 1GD2E 3NXSA 1SQPK 3HD7B 5BU8B 1SFCD 2A45G 3TYYA 5APYA 4I1LA 2A45H 2P67A 5KJ7D 3BVHA 2C9LY 1WT6A 3V2QA 2NPSD 2Z5HA 1ZR4A 1KILD 2QM7A 4W7YA 1JY2P 2HODA 4GT1A 3VMZA 1FZAA 2N1TC 2OYHC 3L36A 1N73B 1H8AA 2OYIB 2YKPA 1M1JA 1GK6A 1HH0A 5AW7B 1LT9B 1CI6B 5AVUB 2YKOA 1SLQA 4C7NA 1GW4A 1KILB 1RF0A 1GL2B 3MUDA 2ZXEB 3GHGC 2OYIC 1OXZA 3KQGA 2R5BA 5AW1B 1FZCB 1NTKK 4WY4D 3B5NB 3UIAA 3A7OA 2MJZA 1X79B 3VTPC 2FFDC 1LTTC 5AVVB 4Y99B 1HGVA 2HYNA 1FJKA 1GW3A 3M9HA 2C0WA 1E5WA 4IFMA 4ZKPA 1RF1C 1LWUB 3I5CA 1CI6A 2Z4EA 2WSCH 2WTYA 1IFNA 1RF1A 5AVRB 5AW9B 3HE5B 1AFOA 2N9BA 2O1KA 3H6PA 5APTA 3HE4A 4N3YB 1JCDA 3T97A 2YMYA 1SQQK 2H7HA 1NWQA 2FFDB 3V2NA 1J1DC 3VYIA 3VMXA 2YO3A 2Q3IA 1S9KE 5CMZA 1RE4C 4WY4C 5CJ0A 1SFCC 3TNUA 1LT9A 5KJ7A 5AW2B 1FDMA 3M9QA 1KILA 3NTNA 5KTBA 1LTGC 4AYCA 1LTJC 1AQ5A 1HVVA 3RK2C 2LKMA 2E43A 1X9VA 1URQB 1IJDB 4HYTB 1T3JA 4N78E 2KYVA 3NMDA 1LGHB 3HD7D 1SVFA 3CI9A 2WT7B 3L35A 4WBAA 4EIJA 3M06A 2P1JA 3C9IA 2OYHB 3BRTB 5CCGC 1JY3O 3EFGA 1DEBA 2VRSA 2QM8A 3P8CE 3PP5A 1A02F 1JY2O 1FZGA 5AVXB 1H89A 4JYCA 2IX7C 1L4AA 3RK2B 2NPSB 3MGNA 3BASA 3VN0A 1G2CA 5AW4B 2Q9IA 5CCHC 1FJPA 3HTKB 1LWUA 3M9BA 1YYCA 3NFQA 3HRNA 3RK3B 1N2DC 1JUNA 1S9KD 1ZV8A 5APVA 1N73C 1NKNA 1X8YA 3RL0C 3U1AA 1MZ9A 1L4AC 4LC1A 1IO4A 1KILC 1IC2A 1FZEA 1IK9A 2YNYA 3RL0B 1HGZA 1FBMA 1XTGB 2A45I 2O01H 4IFDK 3O8ZA 1LT9C 2R32A 1HJBA 1EQ7A 2I1JA 1WRGA 1N73A 2Q5UA 1T2KD 2WITA 1SP4A 1NTMK 4KHXA 1KQLA 2XDJA 1IFIA 2Z5IA 1Z56A 2NPSC 2C9NY 1MUUA 2J59M 1GL2D 3OAKA 5CCHA 3H32B 1LTJA 1VDFA 2CPSA 1MV8A 2WPRA 1ZLLA 2HPCB 1GU5A 3M91A 2M3BA 3HD7A 1SQBK 5AVSB 5KJ7C 3II6A 1LTAC 1NAFA 1NTZK 1SFCA 2PP6A 2YKQA 1JMMA 2WPQA 5APSA 2FYZA 2N1TD 2E42A 5AW6B 2PAJA 2XU6A 2HG5D 4JF7A 2XKMA 3V4WA 1SFCB 3VMYA 2IFMA 2WWWA 1LTIC 1YTZI 2OYIA 5BU5A 1ZR2A 4I6MC 3M0AA 1N7SD 1NH4A 5AVWB 1JNMA 1JOCA 1GL2C 1FU1A 5APQA 1NKZB 3CL3D 2OYHA 4N6JA 5AW3B 2KP8A 4RESB 3H32A 3V2RA 5AW5B 1G1JA 1JY3P 3TK1A 3HE4B 4O9BA 5APWA 2JEEA 2BASA 2P2UA 3M0DC 1RF1B 1W2EA 3LIEA 2KSJA 5APXA 3V2PA 5AW0B 3KYQA 2GM4A 2FYUK 2WSEH 1J1EC 1CZQA 5AVYB 1NU1K 1FOSF 1T8ZA 1GK4A 2H8PD 3WMM0 1J1DB 3A2AA 1M1JC 1QL2A 1IFMA 5CCHD 1GL2A 5AW8B 1MFZA 2P7JA 4GKGA 3MIWA 2W6AA 1VPCA 1JTHB 1N7SB 5CJ4A 1FZCC 1L4AD 1J1EB 2XZRA 1DX7A 3B5NC 4GIFA 1NO4A 1SQXK 1G2CB 3R2PA 1L4AB 3RK2D 3SWFA 1N7LA 3L37A 4HH2A 1FAVA 1JCCA 3SWYA 3VP9A 3GHGB 3P8CD 3CLQA 1A02J 1HWTC 3HD7C 1H88A 1CW5A 2KLVA 1NHLA 4DZOA 1RE3C 1YTZT 5CCGD 1JTHA 1N7SA 2OARA 5KLVK 1JO5A 1URQC 4DOJA 3A5TA 4ZKUA 1SQVK 4M3LA 2XNXA 2WZ7A 1LTBC 3BRVB 2NPSA 2IPPA 3HUSA 2FKWB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3M0D A;  3TNU B;  3KDP B;  3HTK A;  3A3Y B;  3V4W A;  4AYC A;  4I2L C;  3VMY A;  2E43 A;  2WWW A;  2WPS A;  4HYT B;  4I6M C;  1DH3 A;  3M0A A;  5APU A;  3NMD A;  1T2K C;  3P32 A;  3P8M C;  5AVW B;  1JNM A;  2R3C A;  4C46 A;  5APQ A;  1GD2 E;  2JJL A;  3NXS A;  3L35 A;  2WT7 A;  2WT7 B;  3TYY A;  3LID A;  1GTW A;  1OWA A;  3M06 A;  5APY A;  1GZL A;  3HE5 A;  2P67 A;  2C9L Y;  5AW3 B;  2KP8 A;  4RES B;  5AW5 B;  2Z5H A;  2QM7 A;  2VRS A;  3TK1 A;  3HE4 B;  2QM8 A;  1A02 F;  3P7K A;  5APW A;  4GT1 A;  3VMZ A;  5AVX B;  2BAS A;  2P2U A;  4JYC A;  1H89 A;  3L36 A;  1H8A A;  3LIE A;  3MGN A;  5APX A;  3VN0 A;  5AW4 B;  5AW0 B;  1GK6 A;  5AVZ B;  2XV5 A;  5AW7 B;  1J2J B;  1CI6 B;  3M9B A;  5AVU B;  4EOT A;  1YYC A;  1SLQ A;  2YO2 A;  3NFQ A;  4C7N A;  1JUN A;  1CZQ A;  5AVY B;  1S9K D;  5APV A;  2ZXE B;  1X8Y A;  1FOS F;  1GK4 A;  1OXZ A;  3KQG A;  3A2A A;  2R5B A;  5AW1 B;  3V4Q A;  4B86 A;  1HUC A;  4LC1 A;  5AW8 B;  1MFZ A;  3IR9 A;  1IO4 A;  2P7J A;  4AUW A;  3UIA A;  3A7O A;  4GKG A;  3VTP C;  2YNY A;  2W6A A;  5AVV B;  3V5B A;  3O8Z A;  2Q7C A;  2R32 A;  3M9H A;  1HJB A;  2R5D A;  1HBW A;  5AVQ B;  1CSB A;  2XZR A;  3I5C A;  1CI6 A;  1G2C B;  4AQR D;  1GU4 A;  1FOS E;  2WTY A;  4JYB A;  2Q5U A;  1T2K D;  3SWF A;  5AVR B;  1SP4 A;  5AW9 B;  4KHX A;  3L37 A;  1KQL A;  3HE5 B;  2W27 A;  1FAV A;  2N9B A;  2Z5I A;  2C9N Y;  5APT A;  2ZFC A;  3HE4 A;  1MUU A;  3OAK A;  1A02 J;  1HWT C;  1H88 A;  4DZO A;  1MV8 A;  3B8E B;  2WPR A;  5AVT B;  3T97 A;  2H7H A;  1GU5 A;  1NWQ A;  3M91 A;  5AVS B;  3VYI A;  3VMX A;  2YO3 A;  2Q3I A;  1NAF A;  5CMZ A;  1S9K E;  3MD0 A;  4C7N B;  3A5T A;  2WPQ A;  3TNU A;  4XE5 B;  4M3L A;  5APS A;  5AW2 B;  2E42 A;  2IPP A;  5AW6 B;  2XU6 A;  3NTN A; 
#chains in the Genus database with same CATH topology
 3M0D A;  3PRJ A;  4NPF X;  3SSU A;  2KB7 P;  3HTK A;  1PGQ A;  3A3Y B;  1XTC C;  3N4X A;  5AVT B;  1SQX D;  2BEQ D;  2FYU G;  3WUV A;  3AEG C;  2RN0 A;  4KJM A;  1ZP0 C;  3U1C A;  3CME P;  1JY2 N;  3RL0 D;  1LNQ A;  1N86 A;  3FWL A;  3MTU E;  3OJA B;  2P58 A;  1NJI Q;  2HPC A;  3P8M C;  3AEB C;  1LTS C;  2R3C A;  1LTJ B;  3L72 G;  1EZV G;  2JJL A;  2QJY B;  3D70 A;  2R3S A;  2WT7 A;  2I1K A;  3L74 J;  3L75 E;  5KKZ C;  5CHX A;  2L5G B;  3LID A;  1GTW A;  3L70 E;  5M1B A;  2IZ0 A;  1OWA A;  2MKV A;  1QVG O;  1KZU B;  1GZL A;  2D2C B;  3H1H E;  1USD A;  2GUV A;  3HE5 A;  3KPE A;  3Q1M A;  3L4F A;  1AV1 A;  1ZW0 A;  3LW5 H;  1OVU A;  4OGQ C;  3OA7 A;  2IFN A;  2FY8 A;  1PFI A;  4H13 C;  3CWB G;  1H0T B;  3VOP A;  3P7K A;  2YIU B;  2KXP B;  1LT1 A;  2QEX P;  2FXM A;  1OMI A;  1S5L X;  2GUS A;  3TGU E;  1BCC E;  2QG4 A;  4ASW A;  1URQ A;  1HTL C;  5DJU B;  4XA4 A;  1L0N E;  4Y99 C;  1T6A A;  4ASV A;  5AVZ B;  2XV5 A;  2ZT9 C;  1N7S C;  2WSF J;  1J2J B;  4HKZ H;  4EOT A;  1HF9 A;  5H2F E;  5CBN A;  1BGY D;  2YO2 A;  3CCE P;  1ZN5 A;  3TSI A;  2QA4 P;  1JY3 N;  3BCC D;  3VMA A;  1KYO I;  4EI2 A;  2A06 E;  2CK3 H;  2KOG A;  2V7Q J;  3GF3 A;  4WB4 A;  1KYO D;  1M7L A;  1SQP G;  3AE4 C;  3V4Q A;  1HUC A;  4N78 D;  3E1I A;  4B86 A;  2FYN B;  2JO1 A;  3IR9 A;  4LLH A;  4WY4 B;  5B5E H;  3RK3 C;  4OH8 B;  1NOH A;  4AUW A;  1NTM J;  2YMK A;  4RJT A;  4K35 A;  2K88 A;  4C7R A;  1KFN A;  2Q3E A;  1RY3 A;  3IFM A;  3V5B A;  2E5Y A;  3GHG A;  1L0L E;  4PD4 D;  2Q7C A;  3AEE C;  1RF0 C;  3CX5 I;  2E75 C;  5KLV D;  2R5D A;  1HBW A;  5AVQ B;  1CSB A;  1URQ D;  2N1T B;  3H1L D;  2HFE D;  1EDI A;  1NTK E;  3VP8 A;  1EC5 A;  1KOR A;  2WSF H;  2M5A A;  3H1I D;  3PLN A;  3G3Z A;  1L0N D;  3PTZ A;  4TLF A;  2O1J A;  2K1A A;  2W6B A;  1EDJ A;  4AQR D;  1KFM A;  1PPJ E;  1M1J B;  3AEA C;  3L72 J;  4LGD E;  1GU4 A;  1KB9 H;  3E7K A;  1FOS E;  4JYB A;  2FYN C;  2KK7 A;  2N1T A;  3TGU D;  1VQ5 P;  1BGY J;  2E5T A;  1OW6 A;  2ZAE B;  3E1R A;  1NTZ J;  1QL1 A;  1YQ4 C;  2JR8 A;  4PJ0 H;  2W27 A;  2HOD B;  1NTM G;  4W7Z A;  1OZH A;  2ZFC A;  3CCJ P;  1T3U A;  2CPB A;  3FGA D;  1E79 H;  3D6Y A;  1FDO A;  1IFD A;  3WUT A;  2NRG A;  3AED C;  4L75 A;  2POH A;  1SQP J;  3WU2 E;  3B8E B;  1RE4 A;  1IFJ A;  2C0X A;  1NTZ E;  2KLU A;  2E74 C;  4WY4 A;  3H1H D;  3GLM A;  3CC7 P;  3N7N A;  1FZB A;  3SFE C;  4BRY A;  3GMA A;  5C39 A;  3U59 A;  4D6T J;  1QLE D;  1VQP P;  3L75 D;  1EXI A;  1HJ0 A;  3B5N A;  3QH9 A;  1VQO P;  1BSH A;  3H1L G;  2K3R A;  1UIX A;  1L0N K;  3RK3 D;  2WSC J;  3MD0 A;  4C7N B;  2O01 J;  1FZC A;  1LWU C;  2WMM A;  1PV3 A;  2D2C D;  4XE5 B;  2B87 B;  1GDT A;  1KQG B;  1NU1 D;  1SQV G;  3IN6 A;  5TJH A;  3H1J E;  1G1I A;  5BVZ A;  1YJ9 P;  1SQQ E;  3KZI H;  1YIJ P;  1PGJ A;  1M90 Q;  1KB9 E;  1DEE G;  3L71 E;  3TNU B;  1MKM A;  3KDP B;  5KLI C;  4W80 A;  1FZF A;  1RE3 A;  3JC2 2;  4IFF A;  3A0B H;  4I2L C;  3FX0 A;  3HUS B;  3EQ2 A;  4PV1 D;  2R44 A;  4XFJ A;  4Y28 J;  1H0T A;  1L0L K;  3H1J D;  3Q5P A;  2WPS A;  3Q5S A;  1L0N J;  2G8Y A;  3O6Q A;  2B87 A;  2FFD A;  1PGO A;  3MZW B;  2J58 A;  2YIU C;  2QJP C;  3BAT A;  2BEZ F;  5APU A;  5CCG A;  1T2K C;  2QJK B;  3P32 A;  2H43 A;  4HB1 A;  2HLO A;  1P84 E;  3CCR P;  4H44 C;  1CW5 A;  2M8R A;  3AE6 C;  3B5N D;  3HUS C;  4C46 A;  1GD2 E;  1PGP A;  4D6T D;  1NVO A;  3NXS A;  3L70 J;  1VQ8 P;  1SQP K;  4R4L A;  3HD7 B;  5BU8 B;  1SFC D;  2A45 G;  2B88 A;  3TYY A;  3GG2 A;  1L0L D;  4PD4 E;  5APY A;  2E75 B;  4I1L A;  2JP3 A;  3CXH I;  1NYH A;  2NZ2 A;  4YXW H;  1S3J A;  1SQB E;  1OW7 A;  2A45 H;  2P67 A;  1WT6 A;  3AE3 C;  5KJ7 D;  3V2Q A;  5GTI H;  2ZJS E;  2NPS D;  2LR2 A;  2OTL P;  2Z5H A;  1ZR4 A;  2E76 C;  1KIL D;  1OVR A;  2QM7 A;  4W7Y A;  4DT0 A;  1JY2 P;  1K73 Q;  2HOD A;  2Y0D A;  4GT1 A;  1KYO E;  2W90 A;  4U3F G;  3TGU J;  3VMZ A;  3D6Z A;  1FZA A;  3L73 D;  1PZQ A;  2N1T C;  1PPJ G;  3A0H E;  5KAI E;  3L36 A;  3CX5 D;  2FBW C;  1H8A A;  1N73 B;  2OYI B;  2YKP A;  1YHQ P;  1M1J A;  1EZV D;  1OX3 A;  4H0L C;  1JEK A;  1GK6 A;  1HH0 A;  1NTM E;  2W83 C;  3KXD A;  1LT9 B;  3H1I G;  5AW7 B;  2PRR A;  1CI6 B;  4WWI A;  2J5U A;  5AVU B;  1D7M A;  2YKO A;  1W2B O;  1SLQ A;  4C7N A;  2KIK A;  1GW4 A;  1L0L J;  2JWD A;  1KIL B;  2OTK E;  3W67 A;  5KLV E;  1RF0 A;  1GL2 B;  1SQV D;  3MUD A;  1P84 D;  2ZXE B;  3GHG C;  4YXD C;  2IZ1 A;  2OYI C;  1OXZ A;  2JDI H;  3KQG A;  2C9L Y;  2R5B A;  2IBZ E;  5AW1 B;  1FZC B;  4L74 A;  3I55 P;  3CCV P;  4Z1M H;  3ZDM A;  1NTK K;  4WY4 D;  2QRX A;  3B5N B;  3UIA A;  1Q7Y Q;  2QVA A;  2MJZ A;  3A7O A;  1X79 B;  2ZYD A;  3VTP C;  1LTT C;  1SQV J;  2FFD C;  3L74 D;  4UB6 E;  5AVV B;  2A06 D;  4Y99 B;  1KB9 D;  3L71 D;  5DJT B;  1HGV A;  2HYN A;  1FJK A;  1GW3 A;  3M9H A;  2C0W A;  3RBZ A;  1E5W A;  4IFM A;  3SWK A;  4ZKP A;  1RF1 C;  1LWU B;  3A0H H;  1SQQ G;  3I5C A;  1CI6 A;  4I7Z C;  1SQP E;  1SQQ J;  3F5H A;  1QX8 A;  2Z4E A;  2WSC H;  2KUB A;  2O01 N;  2W6J H;  1N73 C;  1Q2N A;  3WUU A;  2WTY A;  1IFN A;  2ZVN B;  1RF1 A;  5AVR B;  1PP9 D;  5AW9 B;  3Q2Y A;  5GTI E;  3HE5 B;  3OW2 O;  3JCU H;  1EDK A;  2N9B A;  3AE7 C;  2O1K A;  3L71 G;  1KD1 Q;  1AFO A;  1L0N G;  2IBZ G;  2KZJ A;  3H6P A;  3HE4 A;  4GOF A;  5APT A;  3F89 A;  2N9Y B;  5EFW B;  1R8E A;  2BCC J;  3G4S P;  4GDO A;  5KKZ B;  4N3Y B;  1LP1 B;  1OIP A;  1K9M Q;  3H1H J;  1JCD A;  5KLV G;  3T97 A;  1RHZ B;  2YMY A;  1SQQ K;  3PH0 A;  2WSE J;  4RKU J;  4EDF A;  2H7H A;  3ABV C;  3L70 D;  1NWQ A;  1KB9 I;  2FFD B;  3L72 E;  1J1D C;  3V2N A;  2B9B A;  1PP9 E;  3VYI A;  2ZT9 D;  3VMX A;  2DW3 A;  1W5C E;  2YO3 A;  2Q3I A;  4GOE A;  1S9K E;  5CMZ A;  1FS0 E;  1RE4 C;  4WY4 C;  5CJ0 A;  3H1K J;  3L73 J;  1SFC C;  2AEM A;  1SQP D;  3TNU A;  3KHU A;  1LT9 A;  3IAO A;  3CMA P;  5KJ7 A;  4IL6 E;  5AW2 B;  1EZV E;  1FDM A;  1KYO H;  3M9Q A;  1SQX G;  2KNC A;  1KIL A;  3AE8 C;  3NTN A;  1X22 A;  3AE9 C;  4IL6 X;  2O3J A;  3CPW O;  5KTB A;  1LTG C;  2AXT H;  1YBK A;  1JMB A;  2KS1 A;  4AYC A;  1R5L A;  3AE2 C;  1LTJ C;  1AQ5 A;  2Q6Q A;  1HVV A;  3MHV A;  3AEC C;  3RK2 C;  2RKL A;  3MP7 B;  2LKM A;  3R4Y A;  1YJN P;  2E43 A;  1KIL E;  3CC4 P;  2M3E A;  1X9V A;  1EZV I;  1URQ B;  1IJD B;  1M56 D;  2QE7 H;  4HYT B;  1T3J A;  4N78 E;  2KYV A;  4U7J A;  2E74 D;  2IBZ D;  3NMD A;  1VF5 D;  2V7Q H;  2E74 B;  1KQF B;  1LGH B;  1KTM A;  3H1I E;  1Q82 Q;  1JB0 J;  2H88 C;  3HD7 D;  1NTK D;  1PP9 G;  2RH0 A;  1SVF A;  1OVV A;  3CI9 A;  3USS A;  2WT7 B;  3L35 A;  3PHL A;  4WBA A;  2OYO A;  5TIS E;  1Q86 Q;  1VQL P;  1IK7 A;  4EIJ A;  4UB8 E;  2I8D A;  3M06 A;  1NTM D;  4U3F E;  2P1J A;  3C9I A;  3ITK A;  3CCS P;  2OYH B;  3CC2 P;  4MN4 C;  3BRT B;  4NPE A;  5CCG C;  4DJG A;  3CX5 E;  1BDD A;  1BCC D;  1JY3 O;  1LP1 A;  1QEX A;  3EFG A;  4JBZ A;  1DEB A;  3H1J G;  4PV1 B;  2VRS A;  2A06 G;  1L2P A;  2QM8 A;  2Y9Y A;  3P8C E;  3PP5 A;  1A02 F;  1VQN P;  1JY2 O;  3BCC J;  1FZG A;  2BCC G;  3JCU E;  2Q1K A;  5B66 E;  5AVX B;  2K9J A;  3EWK A;  1R5S A;  4JYC A;  4UB6 H;  1H89 A;  1EDL A;  2WQY C;  2IX7 C;  1L4A A;  3BCC E;  3GF7 A;  1U7M A;  1SQB D;  2NPS B;  3FXE A;  3BAS A;  3MGN A;  3RK2 B;  1G2C A;  3VN0 A;  5AW4 B;  2Q9I A;  1KN7 A;  3FWN A;  3L75 J;  4OWF A;  5CCH C;  3H25 A;  2P10 A;  1AA0 A;  3H1L J;  1FJP A;  3HTK B;  1LWU A;  3M9B A;  1DIP A;  1YYC A;  3NFQ A;  3HRN A;  3RK3 B;  1N2D C;  3TF5 A;  1JUN A;  1S9K D;  1ZV8 A;  3H1K E;  1EXJ A;  5APV A;  1BE3 J;  1NKN A;  1P84 H;  1X8Y A;  3L75 G;  1ZRT E;  3CWB E;  4JPZ B;  1RQV A;  2ZXX A;  3RL0 C;  3U1A A;  4EYY Q;  4DCK A;  1MZ9 A;  1L4A C;  2LXB A;  1ZME C;  1OW8 A;  1SQB J;  4LC1 A;  1VL2 A;  2Y9Z A;  1IO4 A;  4I7Z B;  1H88 A;  1KIL C;  1IC2 A;  2W8Z A;  2B89 A;  1N8R Q;  3CWB J;  1VQ6 P;  1FZE A;  1IK9 A;  2YNY A;  3RL0 B;  1HGZ A;  1FBM A;  1XTG B;  2A45 I;  2O01 H;  3H1J J;  5KAF H;  4IFD K;  3O8Z A;  1LT9 C;  1SQQ D;  2R32 A;  3H1K D;  4BXL A;  1HJB A;  1EQ7 A;  2I1J A;  1DH3 A;  1Q81 Q;  1L0L G;  2UWJ E;  3L74 G;  4H0L B;  2PFX A;  1BE3 D;  2Y0E A;  1WRG A;  1FE6 A;  1S2E A;  3RK3 E;  1YIT P;  3H1I J;  1N73 A;  2Q5U A;  1T2K D;  1NTK J;  2WIT A;  1SP4 A;  1NTM K;  2K9J B;  4KHX A;  4K3A A;  1KQL A;  2XDJ A;  3C8V A;  1IFI A;  1LJ2 A;  2K9Y A;  2Z5I A;  4L76 A;  1Z56 A;  2NPS C;  4R4M A;  2C9N Y;  1MUU A;  2J59 M;  1GL2 D;  1PIX A;  3OAK A;  5E79 H;  2AXT E;  1SQB G;  4H13 D;  5CCH A;  3H32 B;  3IF4 A;  1LTJ A;  1VDF A;  4RO0 A;  2CPS A;  1MV8 A;  2WPR A;  1ZLL A;  2HPC B;  3CXH E;  3FXD A;  1GMJ A;  1BE3 G;  1GU5 A;  4H44 B;  4PD4 I;  3M91 A;  2M3B A;  3HD7 A;  3TDK A;  1SQB K;  5AVS B;  2Y0C A;  5KJ7 C;  5B66 H;  1SQV E;  1Y8A A;  3II6 A;  1LTA C;  4L73 A;  1PPJ D;  1NAF A;  5H2F H;  1NTZ K;  1SFC A;  2PP6 A;  3L73 G;  5GTH H;  3H1K G;  2YKQ A;  3B71 A;  1BGY E;  1VQ7 P;  3Q3D A;  1JMM A;  3JSV C;  2OYH C;  2WPQ A;  5APS A;  3CCM P;  3H1L E;  2FYZ A;  2LXC B;  2N1T D;  2ZYG A;  2E42 A;  5AW6 B;  2IYO A;  2PAJ A;  2XU6 A;  1AJY A;  2HG5 D;  2E75 D;  1AVY A;  1M8O B;  4JF7 A;  2XKM A;  1JM0 A;  5KLV J;  3V4W A;  3H1H G;  1SFC B;  3VMY A;  2BCC E;  3BVH A;  1S72 P;  2IFM A;  3RL0 g;  2QIW A;  2WWW A;  4PV1 C;  1LTI C;  1YTZ I;  2XND H;  2OYI A;  5BU5 A;  1ZR2 A;  4I6M C;  2WVR A;  3M0A A;  4BRY B;  1N7S D;  1WMK A;  1YI2 P;  1NH4 A;  1ZXG A;  3QWO C;  1K05 A;  4CPG A;  4OGQ D;  3T97 B;  5AVW B;  1JNM A;  1DD3 A;  1PP9 J;  1JOC A;  1GL2 C;  1FU1 A;  5APQ A;  3D71 A;  1QGK B;  1NKZ B;  2FXP A;  3L72 D;  4NPD A;  4OVN F;  2ZVO B;  1VQ9 P;  1Q90 D;  2G3A A;  3CL3 D;  2OYH A;  4N6J A;  3G6E P;  1RQU A;  2JKV A;  2OGU A;  2WPV B;  3AEF C;  1RH5 B;  2FYU J;  3CXH D;  5K5G B;  3I56 P;  1BSN A;  2E76 D;  1Y47 A;  2FXO A;  2KP8 A;  4YPC A;  4RES B;  3H32 A;  4IOI H;  5AW3 B;  1G1J A;  5AW5 B;  3V2R A;  3K5B A;  3W68 A;  1NU1 G;  1JY3 P;  2QJY C;  2V4H A;  1NU1 J;  2ZT9 B;  3TK1 A;  3HE4 B;  4O9B A;  3KZI E;  1SQX J;  5APW A;  5TIS H;  5CBO A;  2JEE A;  1K04 A;  2BAS A;  2P2U A;  3M0D C;  2QSI A;  4JQ0 D;  1RF1 B;  1W2E A;  1U57 A;  2KNC B;  3LIE A;  3O6Q B;  4GOD A;  1VQM P;  2KSJ A;  5APX A;  3V2P A;  1NU1 E;  1NTK G;  5AW0 B;  2KSE A;  1MFT A;  3KYQ A;  3V6I A;  2GM4 A;  4H0L D;  3CCQ P;  5GTH E;  2FYU K;  2PGD A;  2WSE H;  3C1L A;  2YXR B;  1J1E C;  4TT3 H;  1CZQ A;  5AVY B;  1YJW P;  1IZN B;  1KV4 A;  1OFC X;  2ZYA A;  3PJS K;  1NU1 K;  2AEJ A;  5KAI H;  1FOS F;  1T8Z A;  1GK4 A;  2E76 B;  2H8P D;  3L74 E;  3WMM 0;  1J1D B;  1KMI Z;  3A2A A;  1VQ4 P;  1M1J C;  1P84 I;  1QL2 A;  2QJP B;  1BCC J;  1IFM A;  1AVO A;  1YQ3 C;  1DD4 A;  1GL2 A;  5CCH D;  2HR3 A;  1TU3 F;  5L8R J;  5AW8 B;  1MFZ A;  1NTZ D;  1KQS O;  1QVF O;  3RGU A;  2K37 A;  1SQX E;  2OQQ A;  2P7J A;  3A0B E;  4KT0 J;  4U3F J;  5E79 E;  4YTP C;  3TGU G;  3L71 J;  4OGQ B;  1BDC A;  4GKG A;  3S1K A;  3Q5R A;  3CX5 H;  2W6A A;  3MIW A;  1NAY A;  1SS1 A;  2SPZ A;  1ZRT D;  3CWB D;  1M1K Q;  1VPC A;  1JTH B;  1N7S B;  2AEF A;  1S5L E;  5CJ4 A;  3CCL P;  1FZC C;  1L4A D;  3G71 P;  1J1E B;  2XZR A;  2JWA A;  1K8A Q;  1DX7 A;  2ITA A;  1VF5 B;  3B5N C;  4GIF A;  1NO4 A;  3S4R A;  1SQX K;  3L70 G;  3WU2 H;  1G2C B;  2M5A B;  1VQK P;  3R2P A;  3AE5 C;  1L4A B;  3MUD C;  2OTJ P;  2YXQ B;  1AQT A;  3RK2 D;  3SWF A;  1N7L A;  1S5L H;  2L91 A;  3L73 E;  5KLI B;  3L37 A;  4HJG H;  4HH2 A;  2M0B A;  1FAV A;  2BCC D;  1JCC A;  1FDI A;  2WSS H;  3RBX A;  3GHG B;  3SWY A;  3P8C D;  3VP9 A;  3CCU P;  1VF5 C;  2KZI A;  3CLQ A;  3EFF K;  1A02 J;  1HWT C;  1X0T A;  3BCC G;  2FYU E;  2FYU D;  1BCC G;  1NHL A;  2KLV A;  3HD7 C;  4DZO A;  3SFD C;  1RE3 C;  4WVZ A;  1NTZ G;  2RMZ A;  1YTZ T;  2GA1 A;  1BGY G;  2D2C C;  3GW6 A;  5KAF E;  4U3F D;  5CCG D;  2KI7 B;  1JTH A;  1N7S A;  1M57 D;  1UII A;  2IBZ I;  2OAR A;  4IL6 H;  5KLV K;  1ZOY C;  3G9R A;  4PJ0 E;  4H44 D;  2H89 C;  3CD6 P;  1JO5 A;  2IDB A;  1URQ C;  3CXH H;  4D6T E;  4PD4 H;  4A7P A;  4ZMD A;  4H13 B;  3LW5 J;  4UB8 H;  1KC8 Q;  1IFP A;  1S4X A;  3AE1 C;  1BE3 E;  2QJK C;  4ZNC A;  4DOJ A;  2KS1 B;  3A5T A;  3S9O A;  4ZKU A;  1SQV K;  4M3L A;  2XNX A;  1U7J A;  2AXC A;  4QMA A;  1S1C X;  5B5E E;  2WZ7 A;  4BWN A;  1LTB C;  3B4S A;  1FC2 C;  3BRV B;  1PL5 A;  2NPS A;  4D6T G;  1NGM B;  1Y9B A;  2IPP A;  1USE A;  3HUS A;  2IYP A;  2FKW B; 
#chains in the Genus database with same CATH homology
 3M0D A;  2KB7 P;  3HTK A;  3A3Y B;  1XTC C;  3N4X A;  3U1C A;  1JY2 N;  3RL0 D;  1N86 A;  3MTU E;  3OJA B;  2HPC A;  3P8M C;  1LTS C;  2R3C A;  1LTJ B;  2JJL A;  2WT7 A;  2I1K A;  5CHX A;  2L5G B;  3LID A;  1GTW A;  1OWA A;  1KZU B;  1GZL A;  3HE5 A;  3KPE A;  2GUV A;  3L4F A;  3LW5 H;  3OA7 A;  2IFN A;  1PFI A;  3VOP A;  3P7K A;  2FXM A;  2GUS A;  1URQ A;  1HTL C;  4XA4 A;  4Y99 C;  5AVZ B;  2XV5 A;  1N7S C;  1J2J B;  4EOT A;  2YO2 A;  1ZN5 A;  3TSI A;  1JY3 N;  2KOG A;  4WB4 A;  1M7L A;  3V4Q A;  4B86 A;  1HUC A;  4N78 D;  3E1I A;  3IR9 A;  4LLH A;  4WY4 B;  3RK3 C;  4OH8 B;  1NOH A;  4AUW A;  4C7R A;  1KFN A;  1RY3 A;  3IFM A;  3V5B A;  3GHG A;  2Q7C A;  1RF0 C;  2R5D A;  1HBW A;  5AVQ B;  1CSB A;  1URQ D;  2N1T B;  2HFE D;  3VP8 A;  2WSF H;  3G3Z A;  2O1J A;  2W6B A;  4AQR D;  1KFM A;  1GU4 A;  1M1J B;  4LGD E;  1FOS E;  4JYB A;  2N1T A;  1QL1 A;  2W27 A;  2HOD B;  4W7Z A;  2ZFC A;  1T3U A;  2CPB A;  1IFD A;  2POH A;  3B8E B;  1RE4 A;  1IFJ A;  2C0X A;  4WY4 A;  5AVT B;  3N7N A;  1FZB A;  3U59 A;  3B5N A;  3RK3 D;  1L0N K;  3MD0 A;  4C7N B;  1FZC A;  1LWU C;  4XE5 B;  1GDT A;  1G1I A;  5BVZ A;  3TNU B;  3KDP B;  4W80 A;  1FZF A;  1RE3 A;  4IFF A;  4I2L C;  3HUS B;  3EQ2 A;  1L0L K;  2WPS A;  2FFD A;  1DH3 A;  2J58 A;  3BAT A;  5CCG A;  5APU A;  1T2K C;  3P32 A;  2H43 A;  2HLO A;  2M8R A;  3HUS C;  3B5N D;  4C46 A;  1GD2 E;  3NXS A;  1SQP K;  3HD7 B;  5BU8 B;  1SFC D;  2A45 G;  3TYY A;  5APY A;  4I1L A;  2A45 H;  2P67 A;  5KJ7 D;  3BVH A;  2C9L Y;  1WT6 A;  3V2Q A;  2NPS D;  2Z5H A;  1ZR4 A;  1KIL D;  2QM7 A;  4W7Y A;  1JY2 P;  2HOD A;  4GT1 A;  3VMZ A;  1FZA A;  2N1T C;  2OYH C;  3L36 A;  1N73 B;  1H8A A;  2OYI B;  2YKP A;  1M1J A;  1GK6 A;  1HH0 A;  5AW7 B;  1LT9 B;  1CI6 B;  5AVU B;  2YKO A;  1SLQ A;  4C7N A;  1GW4 A;  1KIL B;  1RF0 A;  1GL2 B;  3MUD A;  2ZXE B;  3GHG C;  2OYI C;  1OXZ A;  3KQG A;  2R5B A;  5AW1 B;  1FZC B;  1NTK K;  4WY4 D;  3B5N B;  3UIA A;  3A7O A;  2MJZ A;  1X79 B;  3VTP C;  2FFD C;  1LTT C;  5AVV B;  4Y99 B;  1HGV A;  2HYN A;  1FJK A;  1GW3 A;  3M9H A;  2C0W A;  1E5W A;  4IFM A;  4ZKP A;  1RF1 C;  1LWU B;  3I5C A;  1CI6 A;  2Z4E A;  2WSC H;  2WTY A;  1IFN A;  1RF1 A;  5AVR B;  5AW9 B;  3HE5 B;  1AFO A;  2N9B A;  2O1K A;  3H6P A;  5APT A;  3HE4 A;  4N3Y B;  1JCD A;  3T97 A;  2YMY A;  1SQQ K;  2H7H A;  1NWQ A;  2FFD B;  3V2N A;  1J1D C;  3VYI A;  3VMX A;  2YO3 A;  2Q3I A;  1S9K E;  5CMZ A;  1RE4 C;  4WY4 C;  5CJ0 A;  1SFC C;  3TNU A;  1LT9 A;  5KJ7 A;  5AW2 B;  1FDM A;  3M9Q A;  1KIL A;  3NTN A;  5KTB A;  1LTG C;  4AYC A;  1LTJ C;  1AQ5 A;  1HVV A;  3RK2 C;  2LKM A;  2E43 A;  1X9V A;  1URQ B;  1IJD B;  4HYT B;  1T3J A;  4N78 E;  2KYV A;  3NMD A;  1LGH B;  3HD7 D;  1SVF A;  3CI9 A;  2WT7 B;  3L35 A;  4WBA A;  4EIJ A;  3M06 A;  2P1J A;  3C9I A;  2OYH B;  3BRT B;  5CCG C;  1JY3 O;  3EFG A;  1DEB A;  2VRS A;  2QM8 A;  3P8C E;  3PP5 A;  1A02 F;  1JY2 O;  1FZG A;  5AVX B;  1H89 A;  4JYC A;  2IX7 C;  1L4A A;  3RK2 B;  2NPS B;  3MGN A;  3BAS A;  3VN0 A;  1G2C A;  5AW4 B;  2Q9I A;  5CCH C;  1FJP A;  3HTK B;  1LWU A;  3M9B A;  1YYC A;  3NFQ A;  3HRN A;  3RK3 B;  1N2D C;  1JUN A;  1S9K D;  1ZV8 A;  5APV A;  1N73 C;  1NKN A;  1X8Y A;  3RL0 C;  3U1A A;  1MZ9 A;  1L4A C;  4LC1 A;  1IO4 A;  1KIL C;  1IC2 A;  1FZE A;  1IK9 A;  2YNY A;  3RL0 B;  1HGZ A;  1FBM A;  1XTG B;  2A45 I;  2O01 H;  4IFD K;  3O8Z A;  1LT9 C;  2R32 A;  1HJB A;  1EQ7 A;  2I1J A;  1WRG A;  1N73 A;  2Q5U A;  1T2K D;  2WIT A;  1SP4 A;  1NTM K;  4KHX A;  1KQL A;  2XDJ A;  1IFI A;  2Z5I A;  1Z56 A;  2NPS C;  2C9N Y;  1MUU A;  2J59 M;  1GL2 D;  3OAK A;  5CCH A;  3H32 B;  1LTJ A;  1VDF A;  2CPS A;  1MV8 A;  2WPR A;  1ZLL A;  2HPC B;  1GU5 A;  3M91 A;  2M3B A;  3HD7 A;  1SQB K;  5AVS B;  5KJ7 C;  3II6 A;  1LTA C;  1NAF A;  1NTZ K;  1SFC A;  2PP6 A;  2YKQ A;  1JMM A;  2WPQ A;  5APS A;  2FYZ A;  2N1T D;  2E42 A;  5AW6 B;  2PAJ A;  2XU6 A;  2HG5 D;  4JF7 A;  2XKM A;  3V4W A;  1SFC B;  3VMY A;  2IFM A;  2WWW A;  1LTI C;  1YTZ I;  2OYI A;  5BU5 A;  1ZR2 A;  4I6M C;  3M0A A;  1N7S D;  1NH4 A;  5AVW B;  1JNM A;  1JOC A;  1GL2 C;  1FU1 A;  5APQ A;  1NKZ B;  3CL3 D;  2OYH A;  4N6J A;  5AW3 B;  2KP8 A;  4RES B;  3H32 A;  3V2R A;  5AW5 B;  1G1J A;  1JY3 P;  3TK1 A;  3HE4 B;  4O9B A;  5APW A;  2JEE A;  2BAS A;  2P2U A;  3M0D C;  1RF1 B;  1W2E A;  3LIE A;  2KSJ A;  5APX A;  3V2P A;  5AW0 B;  3KYQ A;  2GM4 A;  2FYU K;  2WSE H;  1J1E C;  1CZQ A;  5AVY B;  1NU1 K;  1FOS F;  1T8Z A;  1GK4 A;  2H8P D;  3WMM 0;  1J1D B;  3A2A A;  1M1J C;  1QL2 A;  1IFM A;  5CCH D;  1GL2 A;  5AW8 B;  1MFZ A;  2P7J A;  4GKG A;  3MIW A;  2W6A A;  1VPC A;  1JTH B;  1N7S B;  5CJ4 A;  1FZC C;  1L4A D;  1J1E B;  2XZR A;  1DX7 A;  3B5N C;  4GIF A;  1NO4 A;  1SQX K;  1G2C B;  3R2P A;  1L4A B;  3RK2 D;  3SWF A;  1N7L A;  3L37 A;  4HH2 A;  1FAV A;  1JCC A;  3SWY A;  3VP9 A;  3GHG B;  3P8C D;  3CLQ A;  1A02 J;  1HWT C;  3HD7 C;  1H88 A;  1CW5 A;  2KLV A;  1NHL A;  4DZO A;  1RE3 C;  1YTZ T;  5CCG D;  1JTH A;  1N7S A;  2OAR A;  5KLV K;  1JO5 A;  1URQ C;  4DOJ A;  3A5T A;  4ZKU A;  1SQV K;  4M3L A;  2XNX A;  2WZ7 A;  1LTB C;  3BRV B;  2NPS A;  2IPP A;  3HUS A;  2FKW B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...