2E42A

Crystal structure of c/ebpbeta bzip homodimer v285a mutant bound to a high affinity dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAARKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DTP*DAP*DGP*DGP*DAP*DTP*DTP*DGP*DCP*DGP*DCP*DAP*
total genus 31
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2e42A00
4C46A 2Q3IA 3LIDA 4GT1A 3OAKA 1CI6A 3P32A 3A5TA 4I6MC 2JJLA 1GZLA 3TNUA 1NAFA 5AVQB 3VN0A 1T2KD 3VMXA 4HYTB 1GK6A 1HUCA 3NXSA 1FOSE 5APSA 3MGNA 3P8MC 5APTA 5APXA 2YNYA 4KHXA 3LIEA 3M0AA 1GU5A 2WT7B 5AVWB 3VYIA 2KP8A 1GK4A 1FAVA 1HBWA 1G2CB 2WT7A 1HWTC 5APUA 1IO4A 3NTNA 5APYA 3V4WA 2H7HA 1MFZA 5APVA 2P67A 5APQA 4DZOA 5AVTB 2W6AA 1X8YA 2ZFCA 3HTKA 3NFQA 1GU4A 5AW3B 1JUNA 2R3CA 3M91A 5AW4B 2WPQA 1OXZA 5AW8B 2WTYA 1T2KC 3TNUB 2BASA 3O8ZA 4EOTA 2WPRA 3TYYA 3KQGA 1H8AA 2N9BA 4JYCA 5AW7B 3SWFA 3VMZA 5CMZA 1J2JB 4JYBA 1OWAA 1A02F 2WPSA 2XZRA 2Q5UA 5AVRB 3L37A 2E43A 3UIAA 4B86A 5AW0B 1SLQA 3M9HA 2W27A 5AVYB 3M9BA 3P7KA 1H88A 3HE4B 3IR9A 5AW9B 2P7JA 4AQRD 2E42A 3T97A 1GTWA 3HE4A 2R5DA 4I2LC 2IPPA 4XE5B 2XV5A 4GKGA 2C9LY 1MV8A 5AW5B 2Z5HA 2P2UA 1CI6B 1CZQA 4C7NB 3A3YB 1S9KD 2ZXEB 5AW1B 5AVUB 2Q7CA 4C7NA 1NWQA 1HJBA 2QM7A 4M3LA 1KQLA 2WWWA 3L35A 3M06A 3I5CA 3M0DA 1A02J 2YO3A 5AW2B 5AW6B 3V5BA 1MUUA 2YO2A 1JNMA 3VTPC 3NMDA 5APWA 3KDPB 3V4QA 1GD2E 1FOSF 5AVSB 4AYCA 5AVVB 1YYCA 2R32A 2QM8A 2Z5IA 1SP4A 3B8EB 2C9NY 3HE5B 5AVXB 1DH3A 2R5BA 3A7OA 4AUWA 1CSBA 2XU6A 3A2AA 3HE5A 3L36A 4RESB 3MD0A 3TK1A 4LC1A 1S9KE 5AVZB 2VRSA 1H89A 3VMYA
chains in the Genus database with same CATH superfamily
2H88C 3SWKA 3LIDA 4GT1A 2Q9IA 3H1KE 3FXEA 3QWOC 2W90A 1CI6A 5KLVJ 1BCCJ 1IZNB 4I6MC 2JJLA 4PD4D 4ZNCA 1Z56A 1IK7A 1PIXA 4GIFA 5AVQB 3TNUA 3V6IA 5K5GB 1T2KD 2QJYC 4WWIA 3GHGB 1EDJA 2D2CC 2YKPA 3BATA 1NHLA 1PPJE 3CCEP 1S2EA 4I1LA 2QIWA 2XDJA 3WU2H 1NYHA 2GUSA 2OYIA 1BGYJ 1NU1J 3HD7A 2BCCJ 3L73G 1X22A 1YITP 2JWAA 2E75D 1VQ7P 1PPJG 1VQ9P 2CPSA 2O01J 1RHZB 3L75E 4IFFA 2OYIC 1SQBK 1FS0E 1FZEA 1IFDA 1GK4A 2KP8A 3ABVC 3PRJA 4D6TJ 1FAVA 2FFDB 2AEFA 2H43A 1HWTC 1RQVA 1NTME 2N1TA 1NTZJ 1GL2D 2N9YB 3A0BE 3V4WA 5CCGA 3V2PA 1BE3G 2C0XA 3RK2B 4DT0A 1XTGB 3B5NB 2PGDA 1MFZA 2K9JB 1FZBA 3H1LG 1SQQK 5APVA 2IYOA 3L70G 1R5LA 4QMAA 4DZOA 1LP1A 2IBZG 2IDBA 3G6EP 1VQMP 2WQYC 1VF5D 2R44A 1PPJD 3CI9A 3TF5A 2QJYB 1KORA 3G9RA 1QX8A 1FC2C 2KNCB 3GW6A 1SVFA 3H32B 3L71E 3I56P 1S3JA 3D71A 1GU4A 3BVHA 1PL5A 2R3CA 1P84I 1T3UA 3M91A 1N2DC 1FJKA 4IFMA 2OGUA 1YJNP 2E5YA 1JY2P 2L5GB 2KB7P 3H1JD 2E75C 3H1JG 4IFDK 3U1CA 2JDIH 1VQ4P 1OX3A 3WUTA 1Q7YQ 1LT9C 1HGZA 2E76D 5L8RJ 5DJUB 3HTKB 3L4FA 1SQPD 4JYCA 4OVNF 5AW7B 1GL2C 1G1IA 4HJGH 3CCLP 1P84E 1J2JB 1XTCC 3M0DC 4JYBA 1OWAA 1VPCA 1SS1A 1K04A 1LTTC 2AEMA 2Q5UA 1FDOA 5KAFE 3UIAA 1NKZB 2JO1A 3CD6P 1BCCD 1ZRTD 4H44D 4N6JA 2FXMA 5AVYB 1KYOH 2A06D 3LW5J 4ASVA 3MZWB 1N7SC 1RE3C 3MP7B 5CHXA 3U1AA 1URQA 1KILA 1NTKJ 3B71A 5CCHC 1H88A 3ITKA 5AW9B 3C9IA 3PJSK 4W7ZA 1EQ7A 1FBMA 2YIUC 2GM4A 1L4AB 1USEA 2NPSD 2NZ2A 1BGYD 1WRGA 1AA0A 1PGOA 2P58A 3II6A 1LGHB 2B9BA 2E5TA 5AW5B 1SFCA 4YXWH 1YTZT 1VQOP 1SQXJ 1NJIQ 1CI6B 2FYUK 1N8RQ 3A3YB 1GL2A 3H32A 1K8AQ 3L71G 5AW1B 3B4SA 3AE2C 2O3JA 4D6TE 3IAOA 2QJPB 3RBZA 1HJBA 1NWQA 1JMMA 1EDIA 4PV1B 1JEKA 2OTLP 3P8CD 4NPDA 1KQLA 1UIIA 1DD3A 2B87B 2KOGA 1NTZG 2HG5D 4RKUJ 3L72E 5CBOA 1SQQG 2BCCE 2OARA 3H1IJ 4IL6X 1M1JB 4R4MA 5AW2B 4PD4I 5AW6B 3V5BA 5GTIE 2MKVA 5CBNA 1JNMA 1SFCB 1J1DC 4LGDE 3L71J 5GTHE 1YHQP 2E74B 1BSHA 2QJPC 3KDPB 1FDIA 1ZOYC 3V4QA 3SFDC 1PP9D 3AECC 2E74D 5AVSB 2ZYGA 4L74A 2M0BA 1LTIC 2IFMA 4H0LD 4ZKPA 2OTKE 3Q5SA 1LTJC 1L4AC 1ZR2A 3OW2O 1FZCB 1EDKA 1NTMJ 2C0WA 3L74G 2W83C 3H6PA 3H25A 3V2RA 5CCGC 1SQVD 2Q3EA 3L70J 2V4HA 2WSEH 3CX5E 3TK1A 1AFOA 3KPEA 2QVAA 2VRSA 1URQC 2KIKA 4WY4A 1VF5B 1H89A 1SQPJ 1KQSO 1N73A 2Y0EA 1M7LA 4C46A 3AEFC 1BGYE 1YTZI 3FWNA 1EZVE 1SQQD 1KQGB 1FZCC 2IBZI 1IFNA 1GMJA 1LNQA 2HLOA 3LW5H 2A45G 3OAKA 3IFMA 1RF1A 1GL2B 1JOCA 2YKQA 1NAFA 4YPCA 3Q5RA 2A45I 2H89C 1H0TB 2WSCH 4IL6H 1NTKD 3KZIH 1NAYA 1RF1C 1U7MA 1HUCA 3CCQP 2N1TB 3G4SP 1P84H 2XKMA 4UB6H 5H2FE 1M1JC 1UIXA 3USSA 1RQUA 1JY3P 3P8MC 5B5EH 1AJYA 3AE3C 2UWJE 1BSNA 2ZT9D 4IL6E 2FYUG 1SQPE 1VF5C 4WY4C 2PFXA 1SQXD 4PV1C 3VP9A 1EZVI 3TGUD 5BU5A 3CCRP 2OYOA 4N78E 2ZT9B 4BRYB 1HBWA 1J1EB 3HD7D 4JPZB 3H1HG 1N7SD 3H1JE 2OYHB 4JF7A 1NU1E 4Y28J 2K88A 5KTBA 3B5NC 3CXHD 5KKZB 3G71P 3RGUA 3H1ID 3RK2C 5BU8B 3Q3DA 2Y9YA 2WSSH 1YJWP 1NGMB 2KI7B 3CX5H 1PGJA 3AE8C 3CXHI 2E76C 3L71D 2W6AA 1MZ9A 4TT3H 5B66E 1EXJA 2WPVB 4BXLA 2KZIA 2M5AB 3QH9A 1PP9J 4L73A 1LTBC 1Q90D 2FY8A 2IYPA 3TDKA 1PFIA 1NTZK 2IZ1A 5AW3B 5KLIB 1OVRA 3JCUH 1JUNA 3H1LE 1M57D 1WMKA 1E79H 1OXZA 3G3ZA 2WTYA 2O01H 2N1TC 1BE3E 1NTMD 3TNUB 3H1IG 2O1KA 1LP1B 1SQVJ 3H1HE 4EIJA 3L70D 3O8ZA 2FXOA 1L2PA 4N3YB 4EI2A 1QL1A 2WPRA 1SFCD 5C39A 1KILB 5M1BA 2RKLA 3AE6C 5KAFH 1H8AA 2ZJSE 1VL2A 5TISE 5BVZA 2P10A 4CPGA 3PP5A 1L0LD 2NPSC 2J5UA 3CWBD 5CJ4A 5CMZA 3AEBC 1BDCA 3GF3A 1VQ6P 1SQQJ 1JO5A 2XZRA 2L91A 3ZDMA 2E43A 2IX7C 4EYYQ 1W5CE 2QG4A 1SLQA 3F5HA 5KLVG 2NPSA 1KC8Q 1N7SA 4BRYA 2IZ0A 4NPFX 3HE4B 4PD4E 4AQRD 1NO4A 1RE3A 1RE4A 1LT9A 2P7JA 4HB1A 1GTWA 3WMM0 3HE4A 3H1KD 4I2LC 3C1LA 1PGPA 3OJAB 3PH0A 4XE5B 1KFNA 3H1KG 2JP3A 1MV8A 1FJPA 2ITAA 2P1JA 1RE4C 1KYOE 1OW7A 2I8DA 1CZQA 2KZJA 3TGUJ 1KB9H 3AE9C 4H44C 3R4YA 1BDDA 2ZXEB 3O6QA 4WVZA 5AVUB 1VQ5P 3CC2P 2E74C 2K1AA 1M90Q 2BEZF 1IK9A 2SPZA 2QJKC 3F89A 4EDFA 2B88A 1KTMA 4H0LC 3T97B 1RF0A 2WWWA 3L74E 1YJ9P 3CX5I 4UB8E 3CC7P 1A02J 1JTHB 1PV3A 1JY3N 3AEGC 1EC5A 3BCCJ 2B87A 1L0NK 2QE7H 3EQ2A 4WBAA 3HRNA 5APWA 1RF0C 1DIPA 5KLIC 2MJZA 1FU1A 2JEEA 2JKVA 1E5WA 5KAIH 3E1RA 3CMEP 2WMMA 1HGVA 1KILE 1MFTA 3MTUE 4AYCA 2AXCA 1Y47A 4YXDC 1GW3A 1YYCA 2QM8A 2Y9ZA 1SP4A 3B8EB 3L73E 1OW8A 3HD7B 3KXDA 4XFJA 3HD7C 5TJHA 1NTZE 3RL0C 3BCCG 1Y8AA 3L72G 3TSIA 2ZAEB 2R5BA 3A7OA 3WUUA 1S1CX 5CCHD 3B5ND 5KKZC 1NH4A 1FZFA 3L36A 3GMAA 4RESB 3MD0A 2LXCB 4UB8H 1VDFA 2YXRB 4LC1A 3GHGA 4W80A 5B5EE 2NRGA 4Y99B 2A45H 1ZP0C 1K9MQ 1L0LK 1L0LJ 3CWBJ 1LWUC 2Q3IA 3AE4C 4U3FE 3CCVP 1L0NJ 2WSCJ 1NU1K 3RL0g 1BGYG 2D2CD 3P32A 3A5TA 3D70A 1IFIA 4MN4C 1VQPP 3VN0A 1OVVA 1DEEG 3E7KA 2QJKB 1S5LE 3VMXA 4HYTB 2KNCA 1KZUB 4RJTA 2Z4EA 1GK6A 1IFMA 2O1JA 2RMZA 1L0LG 2GUVA 2W6JH 3M9QA 4I7ZB 4R4LA 2E76B 3MUDA 3SFEC 3KYQA 3NXSA 5KLVE 1X79B 2QA4P 2R3SA 2KLUA 1KB9I 3H1KJ 3CMAP 5APTA 1TU3F 2WSEJ 4WB4A 1EXIA 2FYUD 2CPBA 2YNYA 2YIUB 1NVOA 3VOPA 1L0LE 1VQ8P 4KHXA 1GU5A 2XNDH 3M0AA 1VQNP 5AVWB 2K9YA 1PGQA 2QRXA 3PTZA 2M5AA 2OTJP 4OGQC 1LTSC 2ZYAA 3BRTB 3W67A 1N73C 1IO4A 1N7LA 3OA7A 3NTNA 5APYA 3CPWO 3BRVB 3JCUE 2H7HA 3FWLA 5CCGD 2IFNA 4OGQD 3RBXA 3BCCD 3R2PA 2NPSB 3D6YA 4PJ0H 1KB9E 2FFDC 2W6BA 3HUSB 1ZW0A 2ZFCA 3AE1C 1QVFO 3HTKA 1OZHA 1Q81Q 4H44B 4YTPC 2I1KA 3NFQA 2KS1B 3RK3D 1FZAA 2IBZE 4JBZA 2Y0DA 5E79E 5AW4B 2WPQA 1L0NE 4C7RA 1K73Q 1JCDA 1U7JA 2FXPA 4TLFA 3RK3B 1HTLC 3FGAD 3L72J 4OWFA 1VQKP 1H0TA 4Y99C 1NTMK 2BASA 2KYVA 3GF7A 1SQBE 1SQBD 4EOTA 3TYYA 1NTKG 1S5LX 5EFWB 3KQGA 1Q2NA 3GG2A 2POHA 1NOHA 3H1HJ 4UB6E 5H2FH 3MHVA 1YI2P 1EDLA 1L0ND 2YXQB 2Q1KA 2WPSA 5AVRB 1A02F 2I1JA 2YMKA 3L37A 1X0TA 1R5SA 3L73D 4KJMA 2J59M 4B86A 5AW0B 3H1LJ 3M9HA 1NTKK 3M9BA 2ZVOB 3P7KA 3WUVA 3C8VA 1AQTA 2HYNA 1NTKE 2BEQD 2HODB 1KB9D 2LR2A 1LTAC 3IR9A 3CC4P 2LKMA 3HUSC 2E42A 1GDTA 2M8RA 1DX7A 4WY4B 2HFED 2K9JA 2IPPA 2ZYDA 2XV5A 1LWUB 3Q5PA 1FZCA 2C9LY 3A0HH 1KV4A 2FYUJ 3MUDC 2KXPB 2Z5HA 1QGKB 2K37A 3E1IA 1W2EA 2Y0CA 3HUSA 3L74D 4HH2A 4C7NB 1S9KD 1PP9G 3IF4A 3MIWA 1OW6A 2HPCB 3FXDA 4C7NA 3S1KA 2J58A 2QM7A 2JR8A 1LT9B 2G3AA 3CWBG 4M3LA 1SQVE 3RL0D 3FX0A 3SSUA 4DJGA 2B89A 3S4RA 3EFGA 1JCCA 2ZVNB 3GLMA 3M0DA 2E75B 5KJ7D 1Q82Q 1AQ5A 1AVYA 2RN0A 1BCCG 3RL0B 2YO2A 1IFPA 3AE7C 1RH5B 3NMDA 2AXTH 1YQ3C 5KJ7C 1M8OB 2ZXXA 2PP6A 1PZQA 2KLVA 1L4AD 2HR3A 4GOEA 1N86A 1YBKA 1AV1A 2R32A 3CCSP 2PAJA 3D6ZA 1LTJB 1WT6A 3HE5B 1QLED 1GW4A 5AVXB 4HKZH 1URQD 3L72D 1CSBA 3A2AA 1SQXK 3CWBE 5B66H 4PV1D 3HE5A 4ASWA 3CL3D 1SQBJ 3IN6A 2CK3H 4H13D 2FYZA 1S9KE 1R8EA 4D6TG 1VQLP 3CXHH 3N4XA 3L70E 1Q86Q 1J1DB 3H1HD 1SQPK 4GDOA 3B5NA 1M1KQ 1S5LH 1BE3D 2QEXP 1IC2A 3V2QA 1JMBA 1NU1G 3L73J 3Q1MA 4U3FG 1ZR4A 3H1LD 3A0HE 1QL2A 1GZLA 2M3BA 1Y9BA 3VMAA 1JY3O 3VP8A 2D2CB 1KN7A 3GHGC 1YQ4C 4LLHA 1FDMA 2H8PD 2A06E 1SQPG 3EWKA 2DW3A 1W2BO 1FOSE 2QSIA 5APSA 3V2NA 3MGNA 3KZIE 4U3FJ 1DEBA 4K3AA 1U57A 5APXA 2KK7A 1HF9A 1NKNA 1ZLLA 4O9BA 2O01N 3L74J 2RH0A 3LIEA 3I55P 1G2CA 3N7NA 4I7ZC 2WT7B 3Q2YA 1ZMEC 3VYIA 2ZT9C 5GTIH 2WITA 3RK2D 1G2CB 4N78D 2WT7A 5KJ7A 5APUA 1N73B 4W7YA 1KMIZ 5E79H 1LTJA 1HJ0A 5KAIE 4OH8B 4ZKUA 1L0NG 3KHUA 1EZVG 4U7JA 1JB0J 4NPEA 2KSJA 2YMYA 1L4AA 2P67A 2IBZD 3K5BA 4H0LB 5APQA 3RK3E 1SQVG 5AVTB 1RF1B 3AE5C 1X8YA 1SQXG 1S72P 2FFDA 2XNXA 2WSFH 1KFMA 2FYNB 4KT0J 1G1JA 4L75A 3PLNA 4ZMDA 1JM0A 2OYHA 3A0BH 3BCCE 4A7PA 3CCMP 5AW8B 2WZ7A 1T2KC 1EZVD 1NTMG 4WY4D 2AXTE 4Z1MH 2AEJA 5GTHH 2WVRA 1T3JA 2Q6QA 3AEEC 2FYNC 2N1TD 2HODA 1M56D 2W8ZA 2N9BA 3SWYA 3L75D 2KS1A 1IJDB 3CX5D 1JY2N 1RY3A 1USDA 2FYUE 4PD4H 3VMZA 1AVOA 1KQFB 3RK3C 1SFCC 3WU2E 3SWFA 1BE3J 1FE6A 1M1JA 3AEDC 2OQQA 5KLVD 1ZN5A 4DCKA 4K35A 2FBWC 1MKMA 1KD1Q 1KILC 2W27A 1OVUA 2PRRA 1PP9E 2KSEA 5CCHA 1SQBG 3S9OA 1OIPA 3AEAC 1OMIA 3JSVC 1LJ2A 3PHLA 4H13B 3T97A 3EFFK 4IOIH 2R5DA 3H1IE 1JTHA 3CXHE 4GOFA 4GKGA 4U3FD 4BWNA 1NU1D 1QEXA 2BCCD 4XA4A 3O6QB 2P2UA 3CCUP 2YKOA 4DOJA 3P8CE 1S4XA 3CCJP 1ZXGA 2Q7CA 1KYOI 1URQB 5DJTB 3TGUE 4D6TD 1SQXE 2LXBA 1D7MA 1NTZD 2WSFJ 3L35A 3M06A 3I5CA 1K05A 1T6AA 2YO3A 4GODA 2JWDA 1LWUA 2OYHC 1J1EC 1LT1A 1MUUA 4JQ0D 4L76A 1QVGO 3VTPC 1DD4A 1KILD 1HH0A 1JY2O 4H13C 4RO0A 2GA1A 1ZV8A 1IFJA 2K3RA 2KUBA 2HPCA 1N7SB 1GD2E 1LTGC 2OYIB 1FOSF 1T8ZA 2V7QJ 3L75G 5TISH 1OFCX 3U59A 5AVVB 1X9VA 3CLQA 1CW5A 1BCCE 1ZRTE 2Z5IA 1SQQE 2BCCG 3JC22 1YIJP 2C9NY 3W68A 1SQVK 3H1JJ 5CJ0A 1DH3A 4AUWA 1P84D 1HVVA 2XU6A 4OGQB 2V7QH 2A06G 3BASA 4PJ0E 1FZGA 5KLVK 3TGUG 2FKWB 5AVZB 2G8YA 3L75J 1KYOD 2M3EA 3VMYA
chains in the Genus database with same CATH topology
3LIDA 4GT1A 2Q9IA 1CI6A 4I6MC 2JJLA 1FZGA 1Z56A 3TNUA 4GIFA 5AVQB 1T2KD 3GHGB 2YKPA 3BATA 1NHLA 4I1LA 2XDJA 2GUSA 3HD7A 2CPSA 2OYIC 4IFFA 1SQBK 2KP8A 1FZEA 1IFDA 1GK4A 2FFDB 1FAVA 1HWTC 2H43A 2N1TA 3V4WA 1GL2D 5CCGA 3V2PA 2C0XA 3RK2B 1XTGB 3B5NB 1MFZA 1FZBA 1SQQK 5APVA 4DZOA 3CI9A 3H32B 1SVFA 1GU4A 3BVHA 2R3CA 3M91A 1T3UA 1N2DC 1FJKA 4IFMA 2L5GB 1JY2P 2KB7P 4IFDK 3U1CA 1LT9C 1HGZA 3HTKB 3L4FA 4JYCA 5AW7B 1GL2C 1G1IA 1J2JB 1XTCC 3M0DC 4JYBA 1OWAA 1VPCA 1LTTC 2Q5UA 3UIAA 1NKZB 4N6JA 2FXMA 5AVYB 1N7SC 1RE3C 5CHXA 3U1AA 1URQA 1KILA 5CCHC 1H88A 5AW9B 3C9IA 4W7ZA 1EQ7A 1FBMA 2GM4A 1L4AB 2NPSD 1WRGA 3II6A 5AW5B 1LGHB 1FDMA 1SFCA 1YTZT 1CI6B 2FYUK 3A3YB 1GL2A 3H32A 5AW1B 1HJBA 1NWQA 1JMMA 3P8CD 1KQLA 2KOGA 2HG5D 5AW2B 2OARA 5AW6B 3V5BA 1M1JB 1N73C 1JNMA 1SFCB 1J1DC 4LGDE 3KDPB 3V4QA 5AVSB 1LTIC 2IFMA 4ZKPA 1ZR2A 1LTJC 1L4AC 1FZCB 2C0WA 3H6PA 3V2RA 5CCGC 2WSEH 1AFOA 3TK1A 3KPEA 2VRSA 1URQC 1H89A 4WY4A 1N73A 1M7LA 4C46A 1YTZI 1FZCC 1IFNA 2HLOA 3LW5H 2A45G 3OAKA 3IFMA 1RF1A 1GL2B 1JOCA 2YKQA 1NAFA 2A45I 2WSCH 1RF1C 1HUCA 2N1TB 2XKMA 1M1JC 1JY3P 3P8MC 3VP9A 4WY4C 5BU5A 4N78E 1HBWA 1J1EB 3HD7D 1N7SD 2OYHB 4JF7A 5KTBA 3B5NC 3RK2C 5BU8B 2W6AA 1MZ9A 1LTBC 1PFIA 1NTZK 5AW3B 1JUNA 1OXZA 3G3ZA 2WTYA 2O01H 2N1TC 3TNUB 2O1KA 4EIJA 3O8ZA 4N3YB 1QL1A 2WPRA 1SFCD 1KILB 1H8AA 5BVZA 3PP5A 2NPSC 5CJ4A 5CMZA 1JO5A 2XZRA 2E43A 2IX7C 1SLQA 2NPSA 1N7SA 3HE4B 4AQRD 1NO4A 1RE3A 1RE4A 1LT9A 2P7JA 1GTWA 3WMM0 3HE4A 4I2LC 3OJAB 1FJPA 4XE5B 1KFNA 1MV8A 2P1JA 1RE4C 1CZQA 2ZXEB 5AVUB 1IK9A 1RF0A 2WWWA 1A02J 1JTHB 1JY3N 1L0NK 3EQ2A 4WBAA 3HRNA 5APWA 1RF0C 2MJZA 1FU1A 2JEEA 1E5WA 1HGVA 3MTUE 4AYCA 1GW3A 1YYCA 2QM8A 1SP4A 3B8EB 3RL0C 3HD7B 3HD7C 3TSIA 2R5BA 3A7OA 5CCHD 3B5ND 1FZFA 1NH4A 3L36A 4RESB 3MD0A 1VDFA 4LC1A 3GHGA 4W80A 4Y99B 2A45H 1L0LK 1LWUC 2Q3IA 1NU1K 3P32A 3A5TA 1IFIA 3VN0A 3VMXA 4HYTB 1KZUB 2Z4EA 1GK6A 1IFMA 2O1JA 2GUVA 3M9QA 3MUDA 3KYQA 3NXSA 1X79B 5APTA 4WB4A 2CPBA 2YNYA 3VOPA 4KHXA 1GU5A 3M0AA 5AVWB 1LTSC 3BRTB 1IO4A 1N7LA 3OA7A 3NTNA 5APYA 2H7HA 3BRVB 5CCGD 2IFNA 3R2PA 2NPSB 2FFDC 2W6BA 3HUSB 2ZFCA 3HTKA 2I1KA 3NFQA 3RK3D 1FZAA 5AW4B 2WPQA 4C7RA 1JCDA 3RK3B 1HTLC 4Y99C 1NTMK 2BASA 2KYVA 4EOTA 3TYYA 3KQGA 2POHA 1NOHA 1A02F 2WPSA 5AVRB 2I1JA 3L37A 2J59M 4B86A 5AW0B 3M9HA 1NTKK 3M9BA 3P7KA 2OYIA 2HYNA 2HODB 3IR9A 1LTAC 2LKMA 3HUSC 2E42A 1GDTA 2M8RA 1DX7A 4WY4B 2HFED 2IPPA 1FZCA 2XV5A 1LWUB 2C9LY 3E1IA 2Z5HA 3HUSA 4HH2A 1W2EA 4C7NB 1S9KD 2HPCB 3MIWA 4C7NA 2J58A 2QM7A 1LT9B 4M3LA 3RL0D 3EFGA 1JCCA 3M0DA 5KJ7D 1AQ5A 3RL0B 2YO2A 3NMDA 5KJ7C 2PP6A 2KLVA 1L4AD 1N86A 2R32A 2PAJA 1LTJB 1WT6A 3HE5B 1GW4A 5AVXB 1URQD 1CSBA 3A2AA 1SQXK 3HE5A 3CL3D 1S9KE 2FYZA 3N4XA 1J1DB 1SQPK 3B5NA 1IC2A 3V2QA 1ZR4A 1QL2A 1GZLA 2M3BA 1JY3O 3VP8A 3GHGC 4LLHA 2H8PD 1FOSE 5APSA 3V2NA 3MGNA 5APXA 1DEBA 1NKNA 1ZLLA 4O9BA 3LIEA 1G2CA 3N7NA 2WT7B 3VYIA 2WITA 3RK2D 1G2CB 4N78D 2WT7A 5KJ7A 5APUA 1N73B 4W7YA 1LTJA 4OH8B 4ZKUA 2KSJA 2YMYA 1L4AA 2P67A 5APQA 1RF1B 5AVTB 1X8YA 2FFDA 2XNXA 2WSFH 1KFMA 1G1JA 2OYHA 5AW8B 2WZ7A 1T2KC 4WY4D 1T3JA 2N1TD 2HODA 2N9BA 3SWYA 1IJDB 1JY2N 1RY3A 3SWFA 3VMZA 3RK3C 1SFCC 1M1JA 1ZN5A 1KILC 2W27A 5CCHA 3T97A 2R5DA 1JTHA 4GKGA 4XA4A 2P2UA 2YKOA 4DOJA 3P8CE 2Q7CA 1URQB 3L35A 3M06A 3I5CA 2YO3A 1LWUA 2OYHC 1J1EC 1MUUA 3VTPC 1KILD 1HH0A 1JY2O 1ZV8A 1IFJA 2HPCA 1N7SB 1GD2E 1LTGC 2OYIB 1FOSF 1T8ZA 3U59A 5AVVB 3CLQA 1X9VA 1CW5A 2Z5IA 2C9NY 1SQVK 5CJ0A 1DH3A 4AUWA 2XU6A 1HVVA 3BASA 5KLVK 2FKWB 5AVZB 3VMYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4C46 A;  2Q3I A;  3LID A;  4GT1 A;  3OAK A;  1CI6 A;  3P32 A;  3A5T A;  4I6M C;  2JJL A;  1GZL A;  3TNU A;  1NAF A;  5AVQ B;  3VN0 A;  1T2K D;  3VMX A;  4HYT B;  1GK6 A;  1HUC A;  3NXS A;  1FOS E;  5APS A;  3MGN A;  3P8M C;  5APT A;  5APX A;  2YNY A;  4KHX A;  3LIE A;  3M0A A;  1GU5 A;  2WT7 B;  5AVW B;  3VYI A;  2KP8 A;  1GK4 A;  1FAV A;  1HBW A;  1G2C B;  2WT7 A;  1HWT C;  5APU A;  1IO4 A;  3NTN A;  5APY A;  3V4W A;  2H7H A;  1MFZ A;  5APV A;  2P67 A;  5APQ A;  4DZO A;  5AVT B;  2W6A A;  1X8Y A;  2ZFC A;  3HTK A;  3NFQ A;  1GU4 A;  5AW3 B;  1JUN A;  2R3C A;  3M91 A;  5AW4 B;  2WPQ A;  1OXZ A;  5AW8 B;  2WTY A;  1T2K C;  3TNU B;  2BAS A;  3O8Z A;  4EOT A;  2WPR A;  3TYY A;  3KQG A;  1H8A A;  2N9B A;  4JYC A;  5AW7 B;  3SWF A;  3VMZ A;  5CMZ A;  1J2J B;  4JYB A;  1OWA A;  1A02 F;  2WPS A;  2XZR A;  2Q5U A;  5AVR B;  3L37 A;  2E43 A;  3UIA A;  4B86 A;  5AW0 B;  1SLQ A;  3M9H A;  2W27 A;  5AVY B;  3M9B A;  3P7K A;  1H88 A;  3HE4 B;  3IR9 A;  5AW9 B;  2P7J A;  4AQR D;  2E42 A;  3T97 A;  1GTW A;  3HE4 A;  2R5D A;  4I2L C;  2IPP A;  4XE5 B;  2XV5 A;  4GKG A;  2C9L Y;  1MV8 A;  5AW5 B;  2Z5H A;  2P2U A;  1CI6 B;  1CZQ A;  4C7N B;  3A3Y B;  1S9K D;  2ZXE B;  5AW1 B;  5AVU B;  2Q7C A;  4C7N A;  1NWQ A;  1HJB A;  2QM7 A;  4M3L A;  1KQL A;  2WWW A;  3L35 A;  3M06 A;  3I5C A;  3M0D A;  1A02 J;  2YO3 A;  5AW2 B;  5AW6 B;  3V5B A;  1MUU A;  2YO2 A;  1JNM A;  3VTP C;  3NMD A;  5APW A;  3KDP B;  3V4Q A;  1GD2 E;  1FOS F;  5AVS B;  4AYC A;  5AVV B;  1YYC A;  2R32 A;  2QM8 A;  2Z5I A;  1SP4 A;  3B8E B;  2C9N Y;  3HE5 B;  5AVX B;  1DH3 A;  2R5B A;  3A7O A;  4AUW A;  1CSB A;  2XU6 A;  3A2A A;  3HE5 A;  3L36 A;  4RES B;  3MD0 A;  3TK1 A;  4LC1 A;  1S9K E;  5AVZ B;  2VRS A;  1H89 A;  3VMY A; 
#chains in the Genus database with same CATH topology
 2H88 C;  3SWK A;  3LID A;  4GT1 A;  2Q9I A;  3H1K E;  3FXE A;  3QWO C;  2W90 A;  1CI6 A;  5KLV J;  1BCC J;  1IZN B;  4I6M C;  2JJL A;  4PD4 D;  4ZNC A;  1Z56 A;  1IK7 A;  1PIX A;  4GIF A;  5AVQ B;  3TNU A;  3V6I A;  5K5G B;  1T2K D;  2QJY C;  4WWI A;  3GHG B;  1EDJ A;  2D2C C;  2YKP A;  3BAT A;  1NHL A;  1PPJ E;  3CCE P;  1S2E A;  4I1L A;  2QIW A;  2XDJ A;  3WU2 H;  1NYH A;  2GUS A;  2OYI A;  1BGY J;  1NU1 J;  3HD7 A;  2BCC J;  3L73 G;  1X22 A;  1YIT P;  2JWA A;  2E75 D;  1VQ7 P;  1PPJ G;  1VQ9 P;  2CPS A;  2O01 J;  1RHZ B;  3L75 E;  4IFF A;  2OYI C;  1SQB K;  1FS0 E;  1FZE A;  1IFD A;  1GK4 A;  2KP8 A;  3ABV C;  3PRJ A;  4D6T J;  1FAV A;  2FFD B;  2AEF A;  2H43 A;  1HWT C;  1RQV A;  1NTM E;  2N1T A;  1NTZ J;  1GL2 D;  2N9Y B;  3A0B E;  3V4W A;  5CCG A;  3V2P A;  1BE3 G;  2C0X A;  3RK2 B;  4DT0 A;  1XTG B;  3B5N B;  2PGD A;  1MFZ A;  2K9J B;  1FZB A;  3H1L G;  1SQQ K;  5APV A;  2IYO A;  3L70 G;  1R5L A;  4QMA A;  4DZO A;  1LP1 A;  2IBZ G;  2IDB A;  3G6E P;  1VQM P;  2WQY C;  1VF5 D;  2R44 A;  1PPJ D;  3CI9 A;  3TF5 A;  2QJY B;  1KOR A;  3G9R A;  1QX8 A;  1FC2 C;  2KNC B;  3GW6 A;  1SVF A;  3H32 B;  3L71 E;  3I56 P;  1S3J A;  3D71 A;  1GU4 A;  3BVH A;  1PL5 A;  2R3C A;  1P84 I;  1T3U A;  3M91 A;  1N2D C;  1FJK A;  4IFM A;  2OGU A;  1YJN P;  2E5Y A;  1JY2 P;  2L5G B;  2KB7 P;  3H1J D;  2E75 C;  3H1J G;  4IFD K;  3U1C A;  2JDI H;  1VQ4 P;  1OX3 A;  3WUT A;  1Q7Y Q;  1LT9 C;  1HGZ A;  2E76 D;  5L8R J;  5DJU B;  3HTK B;  3L4F A;  1SQP D;  4JYC A;  4OVN F;  5AW7 B;  1GL2 C;  1G1I A;  4HJG H;  3CCL P;  1P84 E;  1J2J B;  1XTC C;  3M0D C;  4JYB A;  1OWA A;  1VPC A;  1SS1 A;  1K04 A;  1LTT C;  2AEM A;  2Q5U A;  1FDO A;  5KAF E;  3UIA A;  1NKZ B;  2JO1 A;  3CD6 P;  1BCC D;  1ZRT D;  4H44 D;  4N6J A;  2FXM A;  5AVY B;  1KYO H;  2A06 D;  3LW5 J;  4ASV A;  3MZW B;  1N7S C;  1RE3 C;  3MP7 B;  5CHX A;  3U1A A;  1URQ A;  1KIL A;  1NTK J;  3B71 A;  5CCH C;  1H88 A;  3ITK A;  5AW9 B;  3C9I A;  3PJS K;  4W7Z A;  1EQ7 A;  1FBM A;  2YIU C;  2GM4 A;  1L4A B;  1USE A;  2NPS D;  2NZ2 A;  1BGY D;  1WRG A;  1AA0 A;  1PGO A;  2P58 A;  3II6 A;  1LGH B;  2B9B A;  2E5T A;  5AW5 B;  1SFC A;  4YXW H;  1YTZ T;  1VQO P;  1SQX J;  1NJI Q;  1CI6 B;  2FYU K;  1N8R Q;  3A3Y B;  1GL2 A;  3H32 A;  1K8A Q;  3L71 G;  5AW1 B;  3B4S A;  3AE2 C;  2O3J A;  4D6T E;  3IAO A;  2QJP B;  3RBZ A;  1HJB A;  1NWQ A;  1JMM A;  1EDI A;  4PV1 B;  1JEK A;  2OTL P;  3P8C D;  4NPD A;  1KQL A;  1UII A;  1DD3 A;  2B87 B;  2KOG A;  1NTZ G;  2HG5 D;  4RKU J;  3L72 E;  5CBO A;  1SQQ G;  2BCC E;  2OAR A;  3H1I J;  4IL6 X;  1M1J B;  4R4M A;  5AW2 B;  4PD4 I;  5AW6 B;  3V5B A;  5GTI E;  2MKV A;  5CBN A;  1JNM A;  1SFC B;  1J1D C;  4LGD E;  3L71 J;  5GTH E;  1YHQ P;  2E74 B;  1BSH A;  2QJP C;  3KDP B;  1FDI A;  1ZOY C;  3V4Q A;  3SFD C;  1PP9 D;  3AEC C;  2E74 D;  5AVS B;  2ZYG A;  4L74 A;  2M0B A;  1LTI C;  2IFM A;  4H0L D;  4ZKP A;  2OTK E;  3Q5S A;  1LTJ C;  1L4A C;  1ZR2 A;  3OW2 O;  1FZC B;  1EDK A;  1NTM J;  2C0W A;  3L74 G;  2W83 C;  3H6P A;  3H25 A;  3V2R A;  5CCG C;  1SQV D;  2Q3E A;  3L70 J;  2V4H A;  2WSE H;  3CX5 E;  3TK1 A;  1AFO A;  3KPE A;  2QVA A;  2VRS A;  1URQ C;  2KIK A;  4WY4 A;  1VF5 B;  1H89 A;  1SQP J;  1KQS O;  1N73 A;  2Y0E A;  1M7L A;  4C46 A;  3AEF C;  1BGY E;  1YTZ I;  3FWN A;  1EZV E;  1SQQ D;  1KQG B;  1FZC C;  2IBZ I;  1IFN A;  1GMJ A;  1LNQ A;  2HLO A;  3LW5 H;  2A45 G;  3OAK A;  3IFM A;  1RF1 A;  1GL2 B;  1JOC A;  2YKQ A;  1NAF A;  4YPC A;  3Q5R A;  2A45 I;  2H89 C;  1H0T B;  2WSC H;  4IL6 H;  1NTK D;  3KZI H;  1NAY A;  1RF1 C;  1U7M A;  1HUC A;  3CCQ P;  2N1T B;  3G4S P;  1P84 H;  2XKM A;  4UB6 H;  5H2F E;  1M1J C;  1UIX A;  3USS A;  1RQU A;  1JY3 P;  3P8M C;  5B5E H;  1AJY A;  3AE3 C;  2UWJ E;  1BSN A;  2ZT9 D;  4IL6 E;  2FYU G;  1SQP E;  1VF5 C;  4WY4 C;  2PFX A;  1SQX D;  4PV1 C;  3VP9 A;  1EZV I;  3TGU D;  5BU5 A;  3CCR P;  2OYO A;  4N78 E;  2ZT9 B;  4BRY B;  1HBW A;  1J1E B;  3HD7 D;  4JPZ B;  3H1H G;  1N7S D;  3H1J E;  2OYH B;  4JF7 A;  1NU1 E;  4Y28 J;  2K88 A;  5KTB A;  3B5N C;  3CXH D;  5KKZ B;  3G71 P;  3RGU A;  3H1I D;  3RK2 C;  5BU8 B;  3Q3D A;  2Y9Y A;  2WSS H;  1YJW P;  1NGM B;  2KI7 B;  3CX5 H;  1PGJ A;  3AE8 C;  3CXH I;  2E76 C;  3L71 D;  2W6A A;  1MZ9 A;  4TT3 H;  5B66 E;  1EXJ A;  2WPV B;  4BXL A;  2KZI A;  2M5A B;  3QH9 A;  1PP9 J;  4L73 A;  1LTB C;  1Q90 D;  2FY8 A;  2IYP A;  3TDK A;  1PFI A;  1NTZ K;  2IZ1 A;  5AW3 B;  5KLI B;  1OVR A;  3JCU H;  1JUN A;  3H1L E;  1M57 D;  1WMK A;  1E79 H;  1OXZ A;  3G3Z A;  2WTY A;  2O01 H;  2N1T C;  1BE3 E;  1NTM D;  3TNU B;  3H1I G;  2O1K A;  1LP1 B;  1SQV J;  3H1H E;  4EIJ A;  3L70 D;  3O8Z A;  2FXO A;  1L2P A;  4N3Y B;  4EI2 A;  1QL1 A;  2WPR A;  1SFC D;  5C39 A;  1KIL B;  5M1B A;  2RKL A;  3AE6 C;  5KAF H;  1H8A A;  2ZJS E;  1VL2 A;  5TIS E;  5BVZ A;  2P10 A;  4CPG A;  3PP5 A;  1L0L D;  2NPS C;  2J5U A;  3CWB D;  5CJ4 A;  5CMZ A;  3AEB C;  1BDC A;  3GF3 A;  1VQ6 P;  1SQQ J;  1JO5 A;  2XZR A;  2L91 A;  3ZDM A;  2E43 A;  2IX7 C;  4EYY Q;  1W5C E;  2QG4 A;  1SLQ A;  3F5H A;  5KLV G;  2NPS A;  1KC8 Q;  1N7S A;  4BRY A;  2IZ0 A;  4NPF X;  3HE4 B;  4PD4 E;  4AQR D;  1NO4 A;  1RE3 A;  1RE4 A;  1LT9 A;  2P7J A;  4HB1 A;  1GTW A;  3WMM 0;  3HE4 A;  3H1K D;  4I2L C;  3C1L A;  1PGP A;  3OJA B;  3PH0 A;  4XE5 B;  1KFN A;  3H1K G;  2JP3 A;  1MV8 A;  1FJP A;  2ITA A;  2P1J A;  1RE4 C;  1KYO E;  1OW7 A;  2I8D A;  1CZQ A;  2KZJ A;  3TGU J;  1KB9 H;  3AE9 C;  4H44 C;  3R4Y A;  1BDD A;  2ZXE B;  3O6Q A;  4WVZ A;  5AVU B;  1VQ5 P;  3CC2 P;  2E74 C;  2K1A A;  1M90 Q;  2BEZ F;  1IK9 A;  2SPZ A;  2QJK C;  3F89 A;  4EDF A;  2B88 A;  1KTM A;  4H0L C;  3T97 B;  1RF0 A;  2WWW A;  3L74 E;  1YJ9 P;  3CX5 I;  4UB8 E;  3CC7 P;  1A02 J;  1JTH B;  1PV3 A;  1JY3 N;  3AEG C;  1EC5 A;  3BCC J;  2B87 A;  1L0N K;  2QE7 H;  3EQ2 A;  4WBA A;  3HRN A;  5APW A;  1RF0 C;  1DIP A;  5KLI C;  2MJZ A;  1FU1 A;  2JEE A;  2JKV A;  1E5W A;  5KAI H;  3E1R A;  3CME P;  2WMM A;  1HGV A;  1KIL E;  1MFT A;  3MTU E;  4AYC A;  2AXC A;  1Y47 A;  4YXD C;  1GW3 A;  1YYC A;  2QM8 A;  2Y9Z A;  1SP4 A;  3B8E B;  3L73 E;  1OW8 A;  3HD7 B;  3KXD A;  4XFJ A;  3HD7 C;  5TJH A;  1NTZ E;  3RL0 C;  3BCC G;  1Y8A A;  3L72 G;  3TSI A;  2ZAE B;  2R5B A;  3A7O A;  3WUU A;  1S1C X;  5CCH D;  3B5N D;  5KKZ C;  1NH4 A;  1FZF A;  3L36 A;  3GMA A;  4RES B;  3MD0 A;  2LXC B;  4UB8 H;  1VDF A;  2YXR B;  4LC1 A;  3GHG A;  4W80 A;  5B5E E;  2NRG A;  4Y99 B;  2A45 H;  1ZP0 C;  1K9M Q;  1L0L K;  1L0L J;  3CWB J;  1LWU C;  2Q3I A;  3AE4 C;  4U3F E;  3CCV P;  1L0N J;  2WSC J;  1NU1 K;  3RL0 g;  1BGY G;  2D2C D;  3P32 A;  3A5T A;  3D70 A;  1IFI A;  4MN4 C;  1VQP P;  3VN0 A;  1OVV A;  1DEE G;  3E7K A;  2QJK B;  1S5L E;  3VMX A;  4HYT B;  2KNC A;  1KZU B;  4RJT A;  2Z4E A;  1GK6 A;  1IFM A;  2O1J A;  2RMZ A;  1L0L G;  2GUV A;  2W6J H;  3M9Q A;  4I7Z B;  4R4L A;  2E76 B;  3MUD A;  3SFE C;  3KYQ A;  3NXS A;  5KLV E;  1X79 B;  2QA4 P;  2R3S A;  2KLU A;  1KB9 I;  3H1K J;  3CMA P;  5APT A;  1TU3 F;  2WSE J;  4WB4 A;  1EXI A;  2FYU D;  2CPB A;  2YNY A;  2YIU B;  1NVO A;  3VOP A;  1L0L E;  1VQ8 P;  4KHX A;  1GU5 A;  2XND H;  3M0A A;  1VQN P;  5AVW B;  2K9Y A;  1PGQ A;  2QRX A;  3PTZ A;  2M5A A;  2OTJ P;  4OGQ C;  1LTS C;  2ZYA A;  3BRT B;  3W67 A;  1N73 C;  1IO4 A;  1N7L A;  3OA7 A;  3NTN A;  5APY A;  3CPW O;  3BRV B;  3JCU E;  2H7H A;  3FWL A;  5CCG D;  2IFN A;  4OGQ D;  3RBX A;  3BCC D;  3R2P A;  2NPS B;  3D6Y A;  4PJ0 H;  1KB9 E;  2FFD C;  2W6B A;  3HUS B;  1ZW0 A;  2ZFC A;  3AE1 C;  1QVF O;  3HTK A;  1OZH A;  1Q81 Q;  4H44 B;  4YTP C;  2I1K A;  3NFQ A;  2KS1 B;  3RK3 D;  1FZA A;  2IBZ E;  4JBZ A;  2Y0D A;  5E79 E;  5AW4 B;  2WPQ A;  1L0N E;  4C7R A;  1K73 Q;  1JCD A;  1U7J A;  2FXP A;  4TLF A;  3RK3 B;  1HTL C;  3FGA D;  3L72 J;  4OWF A;  1VQK P;  1H0T A;  4Y99 C;  1NTM K;  2BAS A;  2KYV A;  3GF7 A;  1SQB E;  1SQB D;  4EOT A;  3TYY A;  1NTK G;  1S5L X;  5EFW B;  3KQG A;  1Q2N A;  3GG2 A;  2POH A;  1NOH A;  3H1H J;  4UB6 E;  5H2F H;  3MHV A;  1YI2 P;  1EDL A;  1L0N D;  2YXQ B;  2Q1K A;  2WPS A;  5AVR B;  1A02 F;  2I1J A;  2YMK A;  3L37 A;  1X0T A;  1R5S A;  3L73 D;  4KJM A;  2J59 M;  4B86 A;  5AW0 B;  3H1L J;  3M9H A;  1NTK K;  3M9B A;  2ZVO B;  3P7K A;  3WUV A;  3C8V A;  1AQT A;  2HYN A;  1NTK E;  2BEQ D;  2HOD B;  1KB9 D;  2LR2 A;  1LTA C;  3IR9 A;  3CC4 P;  2LKM A;  3HUS C;  2E42 A;  1GDT A;  2M8R A;  1DX7 A;  4WY4 B;  2HFE D;  2K9J A;  2IPP A;  2ZYD A;  2XV5 A;  1LWU B;  3Q5P A;  1FZC A;  2C9L Y;  3A0H H;  1KV4 A;  2FYU J;  3MUD C;  2KXP B;  2Z5H A;  1QGK B;  2K37 A;  3E1I A;  1W2E A;  2Y0C A;  3HUS A;  3L74 D;  4HH2 A;  4C7N B;  1S9K D;  1PP9 G;  3IF4 A;  3MIW A;  1OW6 A;  2HPC B;  3FXD A;  4C7N A;  3S1K A;  2J58 A;  2QM7 A;  2JR8 A;  1LT9 B;  2G3A A;  3CWB G;  4M3L A;  1SQV E;  3RL0 D;  3FX0 A;  3SSU A;  4DJG A;  2B89 A;  3S4R A;  3EFG A;  1JCC A;  2ZVN B;  3GLM A;  3M0D A;  2E75 B;  5KJ7 D;  1Q82 Q;  1AQ5 A;  1AVY A;  2RN0 A;  1BCC G;  3RL0 B;  2YO2 A;  1IFP A;  3AE7 C;  1RH5 B;  3NMD A;  2AXT H;  1YQ3 C;  5KJ7 C;  1M8O B;  2ZXX A;  2PP6 A;  1PZQ A;  2KLV A;  1L4A D;  2HR3 A;  4GOE A;  1N86 A;  1YBK A;  1AV1 A;  2R32 A;  3CCS P;  2PAJ A;  3D6Z A;  1LTJ B;  1WT6 A;  3HE5 B;  1QLE D;  1GW4 A;  5AVX B;  4HKZ H;  1URQ D;  3L72 D;  1CSB A;  3A2A A;  1SQX K;  3CWB E;  5B66 H;  4PV1 D;  3HE5 A;  4ASW A;  3CL3 D;  1SQB J;  3IN6 A;  2CK3 H;  4H13 D;  2FYZ A;  1S9K E;  1R8E A;  4D6T G;  1VQL P;  3CXH H;  3N4X A;  3L70 E;  1Q86 Q;  1J1D B;  3H1H D;  1SQP K;  4GDO A;  3B5N A;  1M1K Q;  1S5L H;  1BE3 D;  2QEX P;  1IC2 A;  3V2Q A;  1JMB A;  1NU1 G;  3L73 J;  3Q1M A;  4U3F G;  1ZR4 A;  3H1L D;  3A0H E;  1QL2 A;  1GZL A;  2M3B A;  1Y9B A;  3VMA A;  1JY3 O;  3VP8 A;  2D2C B;  1KN7 A;  3GHG C;  1YQ4 C;  4LLH A;  1FDM A;  2H8P D;  2A06 E;  1SQP G;  3EWK A;  2DW3 A;  1W2B O;  1FOS E;  2QSI A;  5APS A;  3V2N A;  3MGN A;  3KZI E;  4U3F J;  1DEB A;  4K3A A;  1U57 A;  5APX A;  2KK7 A;  1HF9 A;  1NKN A;  1ZLL A;  4O9B A;  2O01 N;  3L74 J;  2RH0 A;  3LIE A;  3I55 P;  1G2C A;  3N7N A;  4I7Z C;  2WT7 B;  3Q2Y A;  1ZME C;  3VYI A;  2ZT9 C;  5GTI H;  2WIT A;  3RK2 D;  1G2C B;  4N78 D;  2WT7 A;  5KJ7 A;  5APU A;  1N73 B;  4W7Y A;  1KMI Z;  5E79 H;  1LTJ A;  1HJ0 A;  5KAI E;  4OH8 B;  4ZKU A;  1L0N G;  3KHU A;  1EZV G;  4U7J A;  1JB0 J;  4NPE A;  2KSJ A;  2YMY A;  1L4A A;  2P67 A;  2IBZ D;  3K5B A;  4H0L B;  5APQ A;  3RK3 E;  1SQV G;  5AVT B;  1RF1 B;  3AE5 C;  1X8Y A;  1SQX G;  1S72 P;  2FFD A;  2XNX A;  2WSF H;  1KFM A;  2FYN B;  4KT0 J;  1G1J A;  4L75 A;  3PLN A;  4ZMD A;  1JM0 A;  2OYH A;  3A0B H;  3BCC E;  4A7P A;  3CCM P;  5AW8 B;  2WZ7 A;  1T2K C;  1EZV D;  1NTM G;  4WY4 D;  2AXT E;  4Z1M H;  2AEJ A;  5GTH H;  2WVR A;  1T3J A;  2Q6Q A;  3AEE C;  2FYN C;  2N1T D;  2HOD A;  1M56 D;  2W8Z A;  2N9B A;  3SWY A;  3L75 D;  2KS1 A;  1IJD B;  3CX5 D;  1JY2 N;  1RY3 A;  1USD A;  2FYU E;  4PD4 H;  3VMZ A;  1AVO A;  1KQF B;  3RK3 C;  1SFC C;  3WU2 E;  3SWF A;  1BE3 J;  1FE6 A;  1M1J A;  3AED C;  2OQQ A;  5KLV D;  1ZN5 A;  4DCK A;  4K35 A;  2FBW C;  1MKM A;  1KD1 Q;  1KIL C;  2W27 A;  1OVU A;  2PRR A;  1PP9 E;  2KSE A;  5CCH A;  1SQB G;  3S9O A;  1OIP A;  3AEA C;  1OMI A;  3JSV C;  1LJ2 A;  3PHL A;  4H13 B;  3T97 A;  3EFF K;  4IOI H;  2R5D A;  3H1I E;  1JTH A;  3CXH E;  4GOF A;  4GKG A;  4U3F D;  4BWN A;  1NU1 D;  1QEX A;  2BCC D;  4XA4 A;  3O6Q B;  2P2U A;  3CCU P;  2YKO A;  4DOJ A;  3P8C E;  1S4X A;  3CCJ P;  1ZXG A;  2Q7C A;  1KYO I;  1URQ B;  5DJT B;  3TGU E;  4D6T D;  1SQX E;  2LXB A;  1D7M A;  1NTZ D;  2WSF J;  3L35 A;  3M06 A;  3I5C A;  1K05 A;  1T6A A;  2YO3 A;  4GOD A;  2JWD A;  1LWU A;  2OYH C;  1J1E C;  1LT1 A;  1MUU A;  4JQ0 D;  4L76 A;  1QVG O;  3VTP C;  1DD4 A;  1KIL D;  1HH0 A;  1JY2 O;  4H13 C;  4RO0 A;  2GA1 A;  1ZV8 A;  1IFJ A;  2K3R A;  2KUB A;  2HPC A;  1N7S B;  1GD2 E;  1LTG C;  2OYI B;  1FOS F;  1T8Z A;  2V7Q J;  3L75 G;  5TIS H;  1OFC X;  3U59 A;  5AVV B;  1X9V A;  3CLQ A;  1CW5 A;  1BCC E;  1ZRT E;  2Z5I A;  1SQQ E;  2BCC G;  3JC2 2;  1YIJ P;  2C9N Y;  3W68 A;  1SQV K;  3H1J J;  5CJ0 A;  1DH3 A;  4AUW A;  1P84 D;  1HVV A;  2XU6 A;  4OGQ B;  2V7Q H;  2A06 G;  3BAS A;  4PJ0 E;  1FZG A;  5KLV K;  3TGU G;  2FKW B;  5AVZ B;  2G8Y A;  3L75 J;  1KYO D;  2M3E A;  3VMY A; 
#chains in the Genus database with same CATH homology
 3LID A;  4GT1 A;  2Q9I A;  1CI6 A;  4I6M C;  2JJL A;  1FZG A;  1Z56 A;  3TNU A;  4GIF A;  5AVQ B;  1T2K D;  3GHG B;  2YKP A;  3BAT A;  1NHL A;  4I1L A;  2XDJ A;  2GUS A;  3HD7 A;  2CPS A;  2OYI C;  4IFF A;  1SQB K;  2KP8 A;  1FZE A;  1IFD A;  1GK4 A;  2FFD B;  1FAV A;  1HWT C;  2H43 A;  2N1T A;  3V4W A;  1GL2 D;  5CCG A;  3V2P A;  2C0X A;  3RK2 B;  1XTG B;  3B5N B;  1MFZ A;  1FZB A;  1SQQ K;  5APV A;  4DZO A;  3CI9 A;  3H32 B;  1SVF A;  1GU4 A;  3BVH A;  2R3C A;  3M91 A;  1T3U A;  1N2D C;  1FJK A;  4IFM A;  2L5G B;  1JY2 P;  2KB7 P;  4IFD K;  3U1C A;  1LT9 C;  1HGZ A;  3HTK B;  3L4F A;  4JYC A;  5AW7 B;  1GL2 C;  1G1I A;  1J2J B;  1XTC C;  3M0D C;  4JYB A;  1OWA A;  1VPC A;  1LTT C;  2Q5U A;  3UIA A;  1NKZ B;  4N6J A;  2FXM A;  5AVY B;  1N7S C;  1RE3 C;  5CHX A;  3U1A A;  1URQ A;  1KIL A;  5CCH C;  1H88 A;  5AW9 B;  3C9I A;  4W7Z A;  1EQ7 A;  1FBM A;  2GM4 A;  1L4A B;  2NPS D;  1WRG A;  3II6 A;  5AW5 B;  1LGH B;  1FDM A;  1SFC A;  1YTZ T;  1CI6 B;  2FYU K;  3A3Y B;  1GL2 A;  3H32 A;  5AW1 B;  1HJB A;  1NWQ A;  1JMM A;  3P8C D;  1KQL A;  2KOG A;  2HG5 D;  5AW2 B;  2OAR A;  5AW6 B;  3V5B A;  1M1J B;  1N73 C;  1JNM A;  1SFC B;  1J1D C;  4LGD E;  3KDP B;  3V4Q A;  5AVS B;  1LTI C;  2IFM A;  4ZKP A;  1ZR2 A;  1LTJ C;  1L4A C;  1FZC B;  2C0W A;  3H6P A;  3V2R A;  5CCG C;  2WSE H;  1AFO A;  3TK1 A;  3KPE A;  2VRS A;  1URQ C;  1H89 A;  4WY4 A;  1N73 A;  1M7L A;  4C46 A;  1YTZ I;  1FZC C;  1IFN A;  2HLO A;  3LW5 H;  2A45 G;  3OAK A;  3IFM A;  1RF1 A;  1GL2 B;  1JOC A;  2YKQ A;  1NAF A;  2A45 I;  2WSC H;  1RF1 C;  1HUC A;  2N1T B;  2XKM A;  1M1J C;  1JY3 P;  3P8M C;  3VP9 A;  4WY4 C;  5BU5 A;  4N78 E;  1HBW A;  1J1E B;  3HD7 D;  1N7S D;  2OYH B;  4JF7 A;  5KTB A;  3B5N C;  3RK2 C;  5BU8 B;  2W6A A;  1MZ9 A;  1LTB C;  1PFI A;  1NTZ K;  5AW3 B;  1JUN A;  1OXZ A;  3G3Z A;  2WTY A;  2O01 H;  2N1T C;  3TNU B;  2O1K A;  4EIJ A;  3O8Z A;  4N3Y B;  1QL1 A;  2WPR A;  1SFC D;  1KIL B;  1H8A A;  5BVZ A;  3PP5 A;  2NPS C;  5CJ4 A;  5CMZ A;  1JO5 A;  2XZR A;  2E43 A;  2IX7 C;  1SLQ A;  2NPS A;  1N7S A;  3HE4 B;  4AQR D;  1NO4 A;  1RE3 A;  1RE4 A;  1LT9 A;  2P7J A;  1GTW A;  3WMM 0;  3HE4 A;  4I2L C;  3OJA B;  1FJP A;  4XE5 B;  1KFN A;  1MV8 A;  2P1J A;  1RE4 C;  1CZQ A;  2ZXE B;  5AVU B;  1IK9 A;  1RF0 A;  2WWW A;  1A02 J;  1JTH B;  1JY3 N;  1L0N K;  3EQ2 A;  4WBA A;  3HRN A;  5APW A;  1RF0 C;  2MJZ A;  1FU1 A;  2JEE A;  1E5W A;  1HGV A;  3MTU E;  4AYC A;  1GW3 A;  1YYC A;  2QM8 A;  1SP4 A;  3B8E B;  3RL0 C;  3HD7 B;  3HD7 C;  3TSI A;  2R5B A;  3A7O A;  5CCH D;  3B5N D;  1FZF A;  1NH4 A;  3L36 A;  4RES B;  3MD0 A;  1VDF A;  4LC1 A;  3GHG A;  4W80 A;  4Y99 B;  2A45 H;  1L0L K;  1LWU C;  2Q3I A;  1NU1 K;  3P32 A;  3A5T A;  1IFI A;  3VN0 A;  3VMX A;  4HYT B;  1KZU B;  2Z4E A;  1GK6 A;  1IFM A;  2O1J A;  2GUV A;  3M9Q A;  3MUD A;  3KYQ A;  3NXS A;  1X79 B;  5APT A;  4WB4 A;  2CPB A;  2YNY A;  3VOP A;  4KHX A;  1GU5 A;  3M0A A;  5AVW B;  1LTS C;  3BRT B;  1IO4 A;  1N7L A;  3OA7 A;  3NTN A;  5APY A;  2H7H A;  3BRV B;  5CCG D;  2IFN A;  3R2P A;  2NPS B;  2FFD C;  2W6B A;  3HUS B;  2ZFC A;  3HTK A;  2I1K A;  3NFQ A;  3RK3 D;  1FZA A;  5AW4 B;  2WPQ A;  4C7R A;  1JCD A;  3RK3 B;  1HTL C;  4Y99 C;  1NTM K;  2BAS A;  2KYV A;  4EOT A;  3TYY A;  3KQG A;  2POH A;  1NOH A;  1A02 F;  2WPS A;  5AVR B;  2I1J A;  3L37 A;  2J59 M;  4B86 A;  5AW0 B;  3M9H A;  1NTK K;  3M9B A;  3P7K A;  2OYI A;  2HYN A;  2HOD B;  3IR9 A;  1LTA C;  2LKM A;  3HUS C;  2E42 A;  1GDT A;  2M8R A;  1DX7 A;  4WY4 B;  2HFE D;  2IPP A;  1FZC A;  2XV5 A;  1LWU B;  2C9L Y;  3E1I A;  2Z5H A;  3HUS A;  4HH2 A;  1W2E A;  4C7N B;  1S9K D;  2HPC B;  3MIW A;  4C7N A;  2J58 A;  2QM7 A;  1LT9 B;  4M3L A;  3RL0 D;  3EFG A;  1JCC A;  3M0D A;  5KJ7 D;  1AQ5 A;  3RL0 B;  2YO2 A;  3NMD A;  5KJ7 C;  2PP6 A;  2KLV A;  1L4A D;  1N86 A;  2R32 A;  2PAJ A;  1LTJ B;  1WT6 A;  3HE5 B;  1GW4 A;  5AVX B;  1URQ D;  1CSB A;  3A2A A;  1SQX K;  3HE5 A;  3CL3 D;  1S9K E;  2FYZ A;  3N4X A;  1J1D B;  1SQP K;  3B5N A;  1IC2 A;  3V2Q A;  1ZR4 A;  1QL2 A;  1GZL A;  2M3B A;  1JY3 O;  3VP8 A;  3GHG C;  4LLH A;  2H8P D;  1FOS E;  5APS A;  3V2N A;  3MGN A;  5APX A;  1DEB A;  1NKN A;  1ZLL A;  4O9B A;  3LIE A;  1G2C A;  3N7N A;  2WT7 B;  3VYI A;  2WIT A;  3RK2 D;  1G2C B;  4N78 D;  2WT7 A;  5KJ7 A;  5APU A;  1N73 B;  4W7Y A;  1LTJ A;  4OH8 B;  4ZKU A;  2KSJ A;  2YMY A;  1L4A A;  2P67 A;  5APQ A;  1RF1 B;  5AVT B;  1X8Y A;  2FFD A;  2XNX A;  2WSF H;  1KFM A;  1G1J A;  2OYH A;  5AW8 B;  2WZ7 A;  1T2K C;  4WY4 D;  1T3J A;  2N1T D;  2HOD A;  2N9B A;  3SWY A;  1IJD B;  1JY2 N;  1RY3 A;  3SWF A;  3VMZ A;  3RK3 C;  1SFC C;  1M1J A;  1ZN5 A;  1KIL C;  2W27 A;  5CCH A;  3T97 A;  2R5D A;  1JTH A;  4GKG A;  4XA4 A;  2P2U A;  2YKO A;  4DOJ A;  3P8C E;  2Q7C A;  1URQ B;  3L35 A;  3M06 A;  3I5C A;  2YO3 A;  1LWU A;  2OYH C;  1J1E C;  1MUU A;  3VTP C;  1KIL D;  1HH0 A;  1JY2 O;  1ZV8 A;  1IFJ A;  2HPC A;  1N7S B;  1GD2 E;  1LTG C;  2OYI B;  1FOS F;  1T8Z A;  3U59 A;  5AVV B;  3CLQ A;  1X9V A;  1CW5 A;  2Z5I A;  2C9N Y;  1SQV K;  5CJ0 A;  1DH3 A;  4AUW A;  2XU6 A;  1HVV A;  3BAS A;  5KLV K;  2FKW B;  5AVZ B;  3VMY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...