2E42A

Crystal structure of c/ebpbeta bzip homodimer v285a mutant bound to a high affinity dna fragment
Total Genus 31
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
31
sequence length
65
structure length
65
Chain Sequence
DKHSDEYKIRRERNNIAARKSRDKAKMRNLETQHKVLELTAENERLQKKVEQLSRELSTLRNLFK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(P*DTP*DAP*DGP*DGP*DAP*DTP*DTP*DGP*DCP*DGP*DCP*DAP*
publication title Structural Basis for Flexible Base Recognition by C/Ebpbeta
rcsb
source organism Homo sapiens
total genus 31
structure length 65
sequence length 65
chains with identical sequence B
ec nomenclature
pdb deposition date 2006-12-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF07716 bZIP_2 Basic region leucine zipper
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2e42A00
3V4QA 1J2JB 3M06A 1GD2E 1G2CB 1GU4A 4DZOA 2WT7A 2ZXEB 2YNYA 5APTA 4AYCA 4EOTA 3M91A 1H88A 5AVTB 3L35A 2E42A 1NAFA 2E43A 2WPRA 5AW3B 2C9NY 5APWA 3T97A 4AQRD 1HWTC 4GKGA 1CI6B 1GK6A 5AW8B 3IR9A 5AVVB 3KQGA 3LIDA 5APYA 1GU5A 1HBWA 3VN0A 1T2KD 2QM7A 5AVUB 1MUUA 3V5BA 3TK1A 2R5DA 1FAVA 3A2AA 2H7HA 4I2LC 1MV8A 1T2KC 2WWWA 4KHXA 4C46A 3SWFA 2WTYA 1JNMA 1SP4A 2Z5IA 3P32A 5APSA 3VMZA 5AW1B 1MFZA 2R5BA 2W27A 4C7NB 2YO2A 2QM8A 2VRSA 2P7JA 3B8EB 5AVWB 3OAKA 1A02F 1OWAA 1CI6A 1X8YA 2IPPA 3NXSA 2P2UA 3M9HA 4JYBA 1CZQA 3VMYA 5AW9B 3TYYA 2XZRA 2XU6A 3MD0A 3O8ZA 5APQA 5AVRB 1IO4A 3NTNA 2KP8A 2WPSA 5APVA 5AVQB 3A3YB 1S9KD 1GZLA 1HJBA 3LIEA 2P67A 5AW5B 5AW6B 3VYIA 1JUNA 5AW0B 3M0AA 2Q7CA 2BASA 5AVSB 3KDPB 3L37A 4HYTB 2ZFCA 3HTKA 1OXZA 4JYCA 5AW2B 5AVZB 4C7NA 1YYCA 1FOSE 3M0DA 3MGNA 4GT1A 3NFQA 1S9KE 3P7KA 1KQLA 5AVXB 3HE4B 1A02J 4B86A 5AVYB 3V4WA 3I5CA 1SLQA 1FOSF 3M9BA 4AUWA 1CSBA 2N9BA 3A5TA 2Z5HA 4LC1A 1H89A 1DH3A 1GK4A 2W6AA 2WT7B 5APXA 3TNUA 3L36A 3TNUB 2Q5UA 1HUCA 2JJLA 5CMZA 5AW4B 2C9LY 3HE5A 5APUA 3HE5B 4M3LA 2YO3A 2Q3IA 4RESB 3UIAA 3VTPC 4XE5B 2R32A 5AW7B 3A7OA 2XV5A 3P8MC 3VMXA 4I6MC 3HE4A 3NMDA 1H8AA 2R3CA 1GTWA 1NWQA 2WPQA
chains in the Genus database with same CATH superfamily
1PGPA 4H13C 2QE7H 2FYNC 2Y0DA 4UB6E 1AV1A 5AVTB 2L5GB 2LKMA 2H8PD 2E43A 1M7LA 3PRJA 3MHVA 2O1KA 2WITA 1LTSC 3KQGA 1NTZJ 1T2KD 4W7YA 1N8RQ 2K9JB 4Y99B 1S5LE 1JB0J 3HD7C 4IFFA 4C46A 3C8VA 3KYQA 2QIWA 2KOGA 3L70D 2KB7P 1HF9A 3H32A 5B66E 3Q5SA 2WSCJ 4H44B 3GW6A 1EC5A 2KP8A 1S9KD 2QJKC 1L0NE 3QWOC 1VQ5P 4PV1D 1JCDA 2ZYDA 3NFQA 3AEDC 3FXDA 1NTZD 3M9BA 5GTIE 4HH2A 1L4AB 2Y0EA 1W2BO 3BRVB 1FZCC 3L73E 3HE5B 1NTMJ 2M0BA 1L2PA 3RL0B 3VMXA 1HJ0A 1H8AA 2H89C 3AE9C 1N2DC 1N7SD 3L72J 1GU4A 1L4AA 4DOJA 3H1IG 4W80A 2C9NY 5KLVG 2Y0CA 4ZKUA 1OZHA 3IR9A 3CI9A 2WPVB 2Z5IA 1KMIZ 3U59A 1NTMD 2J58A 1ZXGA 3PLNA 3H1HJ 2PAJA 1SQBE 1PFIA 1QEXA 1T6AA 3NTNA 1L0LE 4UB8H 1G1IA 3L72D 2ZT9D 4R4LA 5AVSB 3II6A 1BCCE 5AVZB 3L71G 1SQVK 3PJSK 1KQLA 4BXLA 2G3AA 1M1JC 3H1LG 1KB9I 2E75C 1SQXG 1FJPA 1VQ8P 1NU1G 1LTTC 2Q3IA 3G4SP 1FZGA 3AE4C 3MIWA 1VF5D 3H1HD 4JF7A 2JWAA 2HPCB 1NJIQ 1ZOYC 3M0DC 4GDOA 1G2CB 1NTKJ 1M8OB 1DEEG 1EZVD 1SQBJ 1YQ3C 3MUDA 1L0LJ 4GIFA 2QSIA 3BCCJ 1X9VA 2OTJP 1BE3E 1GU5A 2ZVOB 2HPCA 3S1KA 3IFMA 5KKZC 1G2CA 4PJ0E 1HGZA 3B5ND 1N86A 2YO2A 4WVZA 3CXHD 3D6YA 3BVHA 2IPPA 1P84I 3M9HA 2FYUJ 1RY3A 4UB8E 1LT1A 3Q3DA 2N1TC 1NTKD 3VYIA 1IJDB 3U1CA 5CBNA 2BASA 1SQBD 2IFNA 4IFDK 1LP1A 1L0LD 5CJ0A 2QJYC 4L76A 1LTBC 3BCCD 4DT0A 1SQQE 5GTHE 2IYOA 1CSBA 2B89A 1PP9G 3WUUA 1VQNP 3RK2B 1S3JA 1KB9E 1HUCA 2MKVA 4BWNA 3CLQA 2YO3A 4OWFA 1KN7A 3NMDA 1M90Q 2FYUD 2O01N 2RH0A 4ZKPA 4OGQD 2N9YB 2P10A 3QH9A 1H88A 2UWJE 2IFMA 3RK3D 3CX5I 1NAFA 1ZP0C 2YIUC 4AQRD 5CCHD 1MKMA 2Y9YA 1GL2D 2GA1A 3CC4P 3ITKA 3VN0A 2NPSD 1BDCA 3V5BA 1KILB 1UIXA 3L73G 1M1KQ 4GOEA 1YBKA 2QM8A 1N73C 1NVOA 3AE8C 1OFCX 1RF1B 5AVQB 1P84E 1KILA 1RF0A 1URQA 1JUNA 2Q7CA 1IFMA 1IC2A 4IL6H 2OYIC 2Q9IA 4TLFA 1Q86Q 3I5CA 3SFEC 1RF1A 1LT9C 2Z5HA 4LC1A 1T8ZA 3L74E 1DH3A 1ZLLA 3Q5RA 3G71P 1AQ5A 4GODA 3A0BH 1Y47A 5APUA 3GMAA 4RESB 3CCMP 2KUBA 1HTLC 5B5EH 2Q3EA 2FXOA 5CCGD 1YTZT 1FZEA 1BCCG 2AXTH 3TGUE 4WB4A 4WY4D 3M91A 3WU2H 2WSCH 4JQ0D 1IFIA 1KZUB 4D6TJ 3CCRP 3AEFC 1JY2P 1HWTC 1BDDA 3SWKA 3JSVC 3L75J 5L8RJ 1AVYA 1WT6A 1PGOA 1RHZB 3AE5C 3FX0A 1IFNA 4UB6H 1LTJC 2Z4EA 3W67A 5AVWB 1OW7A 2FYNB 5TISE 2QA4P 4JYBA 5KJ7A 2XU6A 2PRRA 1EDJA 3AECC 4XA4A 3CPWO 3L70E 1S5LH 1SQPK 2HODB 2Y9ZA 2FXPA 1BE3G 1YYCA 4D6TD 4GT1A 1S9KE 1SS1A 1P84D 2OQQA 5AVXB 1LJ2A 3L75D 4B86A 2GUVA 2K37A 3HD7B 1VQ7P 5KLIC 4DCKA 2QJPC 1N7SC 3IN6A 3L36A 3TNUB 4U7JA 5CBOA 2HODA 5M1BA 3A0BE 1YITP 2R3SA 1NTZE 2W6BA 3H25A 4RO0A 4LLHA 1Y8AA 4I6MC 3HD7A 2MJZA 1VQPP 3G9RA 1J2JB 2O01J 3E7KA 5GTIH 3R2PA 1YJNP 4DZOA 1OVRA 2YNYA 2ZXEB 3Q1MA 3WU2E 5APWA 1SQQG 3T97A 1FZAA 1D7MA 2NZ2A 1QVGO 3C9IA 2DW3A 1FZCB 2H7HA 1JTHA 1Q82Q 3CX5D 1FBMA 2IYPA 3L71J 1JY2N 3V2QA 2OYHC 3C1LA 1BGYJ 1JMBA 1PGJA 2VRSA 2ZT9C 3CCJP 1A02F 3H32B 1X8YA 4I7ZC 3U1AA 3GG2A 3CXHI 2E74D 2IX7C 2M3EA 1EDLA 1DX7A 3AEAC 1FZCA 1NTME 3CXHH 4O9BA 2NRGA 2CPSA 5H2FH 1HH0A 3KXDA 3L72E 3HE4B 1A02J 1OIPA 2QEXP 3WUVA 1VF5C 5KLVK 1T3JA 1KILD 2YMYA 1LGHB 1KV4A 3RL0g 3VMAA 3L71D 3EFGA 3CCLP 2IBZD 2PGDA 2OTLP 1BGYD 4KJMA 3UIAA 3CCQP 1NOHA 1RH5B 4BRYB 3HE4A 2V7QH 2R44A 1IFPA 1SQVJ 3F5HA 5KAIE 2PP6A 2LR2A 1H0TB 1AJYA 2JEEA 2XNXA 3H1HE 2WSFJ 1IK7A 2W6JH 1M1JB 2WPRA 3B5NC 3TDKA 1EZVE 3L74G 1JMMA 4BRYA 1NKNA 2P58A 1H0TA 3RBXA 1TU3F 3HRNA 1M1JA 2M3BA 2P7JA 2FFDC 3E1RA 1YQ4C 1SQXK 3OW2O 1NU1K 2RN0A 3TGUG 2JR8A 1SQVD 4PD4D 1IO4A 4IL6X 2KSJA 3CXHE 1GZLA 3D70A 5AW0B 4PJ0H 1U57A 5H2FE 3M0DA 2YXQB 5KKZB 1NTKE 4K3AA 2K9YA 1VQLP 4Z1MH 1SLQA 4L73A 1K8AQ 3D6ZA 3VOPA 1FE6A 1Q2NA 3BCCE 4OGQC 2AEJA 2XNDH 1FDOA 3RK3C 2R32A 1JO5A 2N1TB 3L70G 2WVRA 5CCHC 5GTHH 1GL2C 2NPSC 2QJYB 3GLMA 1KB9H 2FYUE 5AW3B 1MZ9A 3AE2C 4RJTA 2N1TA 3H1JJ 3RK3E 2FY8A 2R5DA 1NTZG 4QMAA 5APSA 5KAFH 5K5GB 2YKOA 3HUSC 4EYYQ 4U3FJ 2D2CD 2BEQD 2E76D 2KIKA 2G8YA 3TYYA 4W7ZA 1RE3C 3F89A 2OYOA 4RKUJ 3AE7C 2YIUB 1L0NK 4GOFA 1EXIA 5AW2B 1R5LA 1LP1B 1UIIA 1S2EA 2OTKE 1IZNB 1ZN5A 3H1JD 4DJGA 1AFOA 3B71A 1P84H 1N73B 2ZYAA 2JWDA 3AEBC 5CCGC 2WSEJ 1X79B 4WY4C 4N78D 4U3FD 4XE5B 2W8ZA 5AW7B 3A7OA 1NTMG 1GTWA 1M57D 1ZV8A 3PHLA 4KT0J 3V4QA 1S4XA 1VQKP 3B4SA 3CWBJ 1N73A 5CJ4A 3L72G 2E42A 1ZW0A 3D71A 1LT9B 3MUDC 3LIDA 1L0NG 4H44D 2WZ7A 2M8RA 1JNMA 4MN4C 1DEBA 1EDIA 2OYIA 5KAFE 3GF3A 2W27A 2KI7B 3M9QA 1LT9A 1VPCA 3CX5H 5AW9B 3AE1C 1SQBK 2KS1A 2XZRA 3H1HG 5APQA 3AEEC 1HJBA 1URQB 3CWBD 1L4AD 1JY3P 4Y28J 2BCCJ 1RQVA 1EZVG 4L75A 1QLED 2KZIA 1SFCC 3H1KJ 3A0HH 2O01H 1DD4A 1J1EC 3RL0D 3V4WA 2RMZA 5TISH 1PL5A 1ZRTD 1RQUA 2YKQA 5EFWB 1H89A 1LTJB 2YMKA 1OVUA 4D6TE 3BATA 3L75E 4NPDA 1W2EA 3EFFK 1SQPJ 5BVZA 2IBZI 1NHLA 2A06D 1QVFO 4WWIA 1LTJA 3USSA 4ASWA 2H43A 3I56P 2ZJSE 1NTKG 3V6IA 2BCCD 1SQBG 3H1KD 2M5AB 5KLIB 2QJPB 1L0LG 1N7SB 3BCCG 2Q1KA 5AVUB 4I2LC 2E74C 4HJGH 3TF5A 3N7NA 1MV8A 1T2KC 3KZIH 1MFZA 3K5BA 1PPJD 5DJUB 2GUSA 1SQPD 2YKPA 3OAKA 2M5AA 2HLOA 3CX5E 1N7SA 4JBZA 2I1JA 1PZQA 2SPZA 5AW5B 2FYUG 5AW6B 4PD4I 1VQ9P 4CPGA 1KILC 2K1AA 4HYTB 2ZFCA 1OXZA 4PD4H 1Q81Q 2C0WA 4H0LB 3A0HE 4H13B 4PV1C 3Q5PA 1BSNA 3G3ZA 3EWKA 1FOSF 2WSFH 1SQQK 2OYHB 1JY3N 2IZ1A 1Z56A 3LW5J 5DJTB 3VP9A 1T3UA 2Q5UA 4I7ZB 3VP8A 2JO1A 2QRXA 1KILE 2XV5A 5KTBA 3L71E 3SSUA 3R4YA 2IBZE 1BGYE 3H1IJ 2OYHA 1GD2E 1ZR4A 3CCEP 4A7PA 2IDBA 5KLVJ 1OMIA 3EQ2A 4YTPC 1K73Q 1SQXE 1QGKB 4L74A 3T97B 4R4MA 1VF5B 2A45I 2QJKB 5AVVB 1HGVA 5KAIH 4OVNF 1JTHB 1U7JA 3KZIE 1KFNA 2KLVA 3VMZA 5AW1B 4C7NB 1CW5A 2IZ0A 3NXSA 1GMJA 1OW6A 2ZVNB 5APVA 3H1ID 3LIEA 3MZWB 5KLVD 3B5NB 1J1DC 3KDPB 1QL1A 3RK2D 4PD4E 1SQVE 3FXEA 4C7NA 1EXJA 1U7MA 3H1LJ 2CK3H 1JY3O 1MFTA 4ASVA 1RE4C 3WUTA 2N9BA 3JCUE 1SQXJ 1NU1J 1NAYA 2FFDB 1JM0A 4NPEA 3CCVP 3B5NA 1KTMA 2JDIH 2L91A 3GHGC 3P8CD 3P8MC 3FWNA 2KLUA 1IFJA 2LXBA 1NWQA 1HVVA 3M06A 1XTGB 1LWUC 1WRGA 1URQD 2FFDA 1LTAC 2B88A 2OARA 1PP9E 1EDKA 3IF4A 1LNQA 3H1LD 1VQOP 1XTCC 1FS0E 1GK6A 1Q7YQ 4D6TG 3AEGC 2QM7A 2D2CC 3L75G 4OGQB 2E76C 1AQTA 2K9JA 1SQXD 1NU1D 2WWWA 2WTYA 3I55P 3OA7A 3CCSP 3RK3B 1KYOD 1EQ7A 1GL2B 2FBWC 3G6EP 2P2UA 2NPSB 3VMYA 2WSEH 2E75B 3O8ZA 3TSIA 1JY2O 1M56D 1NGMB 2E5TA 2POHA 2Q6QA 5CCHA 3P7KA 1GL2A 1S1CX 3AE3C 2NPSA 1NO4A 1PP9J 1AVOA 1USDA 3A5TA 2ZYGA 1YIJP 3HUSB 1ZR2A 2W6AA 4EI2A 1NKZB 2HFED 2B9BA 5CMZA 3H1JE 2KK7A 3FGAD 4OH8B 2C9LY 4Y99C 3HE5A 3L4FA 1L0NJ 1NTZK 1VQ4P 1AA0A 3O6QB 2WQYC 3CC2P 4TT3H 5KJ7D 2XKMA 4N78E 3HUSA 4LGDE 4U3FE 1OX3A 4H44C 1K05A 2CPBA 1JCCA 1Y9BA 3L35A 3V2NA 2J5UA 4H0LD 1OVVA 1RE3A 1JOCA 4JPZB 5AW8B 4H13D 5APYA 2AEMA 2KYVA 3O6QA 4WBAA 3L73J 4EIJA 1PP9D 2QG4A 3TK1A 4WY4B 4YXDC 3PP5A 3HTKB 1L4AC 3ZDMA 1L0ND 1OWAA 2IBZG 1YHQP 4IOIH 1KQSO 1BGYG 1CZQA 5CCGA 3HD7D 5AVRB 3MD0A 3RL0C 4WY4A 1NTMK 2I8DA 3L37A 1DD3A 2JP3A 3HTKA 4JYCA 4IFMA 3MGNA 1S5LX 3RBZA 3CWBE 2W83C 1PIXA 1PGQA 1VQMP 3L73D 2LXCB 2C0XA 3W68A 3CCUP 3GF7A 1GK4A 5APXA 1FZFA 1YTZI 1G1JA 2FKWB 1ZRTE 5AW4B 1LTIC 2J59M 1BCCJ 4C7RA 1R8EA 1X22A 1SQVG 2QVAA 1SFCB 2V7QJ 1J1EB 2A06E 2OGUA 2XDJA 1Q90D 4GKGA 4K35A 2BCCE 3PTZA 2GM4A 1FAVA 3S9OA 3A2AA 3H1KE 1N7LA 1SFCA 3SWFA 2PFXA 1SP4A 3P32A 2OYIB 2HR3A 3B8EB 3CC7P 3LW5H 5E79H 1DIPA 1KC8Q 2YXRB 3V2PA 1BCCD 3S4RA 2KS1B 1PPJE 4I1LA 1GW4A 1SQPE 3A3YB 1KD1Q 2P67A 2KSEA 1USEA 1BE3J 1R5SA 1E5WA 3SWYA 2E5YA 1GW3A 2A45G 4N6JA 5AVYB 2E74B 1NTKK 1YJ9P 5TJHA 1L0LK 2JJLA 2HG5D 2WMMA 3CL3D 2AXCA 1NH4A 1OW8A 1FDIA 2K88A 3MP7B 4NPFX 2WPQA 1IK9A 2E75D 5C39A 1KQFB 4YPCA 1BE3D 4PV1B 1SQQJ 3AE6C 1FU1A 2O3JA 2FYUK 1VDFA 2P1JA 2O1JA 3CMAP 2RKLA 3E1IA 3H1JG 3KHUA 3ABVC 4KHXA 5CHXA 1S72P 2ITAA 1FZBA 3H6PA 3RK2C 1KYOI 5E79E 1LTGC 3WMM0 4U3FG 2H88C 1KYOH 4YXWH 2WPSA 3PH0A 3MTUE 1IFDA 3FWLA 3BRTB 1SQQD 1E79H 1FOSE 3SFDC 3CD6P 3H1IE 4EDFA 2FYZA 1KB9D 5KLVE 2N1TD 3N4XA 4AUWA 1FDMA 2W90A 2WT7B 3IAOA 4ZMDA 1RF0C 1URQC 1KORA 4N3YB 1JEKA 4HKZH 3BASA 1FJKA 3KPEA 1J1DB 3JCUH 1QX8A 3P8CE 2WT7A 2ZT9B 4AYCA 5APTA 4EOTA 1RF1C 3CWBG 3L74J 1CI6B 2BEZF 1HBWA 1K9MQ 1MUUA 2JKVA 1SVFA 3H1LE 1VL2A 1QL2A 1K04A 3GHGB 1X0TA 3JC22 1KFMA 2R5BA 1ZMEC 1WMKA 2ZAEB 3TGUJ 4IL6E 1RE4A 1CI6A 1NU1E 5B66H 3CMEP 1LWUB 1BSHA 5BU8B 3Q2YA 1KYOE 2A45H 2A06G 3OJAB 2B87B 3RGUA 1YI2P 1W5CE 1SFCD 3GHGA 3M0AA 4HB1A 2I1KA 2D2CB 4XFJA 3L74D 4ZNCA 2KXPB 2E76B 2KNCB 2BCCG 1YJWP 2KZJA 3H1KG 5B5EE 1LWUA 1NYHA 2AEFA 1KQGB 1VQ6P 2HYNA 5BU5A 1GDTA 2FXMA 2AXTE 2B87A 2V4HA 1PV3A 3TNUA 5KJ7C 1EZVI 2K3RA 4M3LA 3L70J 3VTPC 3TGUD 1FC2C 2KNCA 1PPJG 3V2RA 1SQPG 2R3CA 4H0LC 2ZXXA 2WSSH
chains in the Genus database with same CATH topology
5KJ7D 3V4QA 1YTZT 1FZEA 2XKMA 4N78E 3HUSA 4LGDE 4WB4A 4WY4D 1N73A 3M91A 2CPBA 5CJ4A 1JCCA 5AVTB 2WSCH 2L5GB 2LKMA 1IFIA 1KZUB 3L35A 2E42A 2H8PD 3V2NA 2E43A 1M7LA 1JY2P 1HWTC 1RE3A 1LT9B 2O1KA 2WITA 1JOCA 5AW8B 1LTSC 1WT6A 3KQGA 2KYVA 3LIDA 5APYA 4WBAA 1T2KD 4EIJA 4W7YA 3TK1A 2WZ7A 2M8RA 4Y99B 4WY4B 3HD7C 1IFNA 4IFFA 4C46A 1JNMA 3KYQA 1DEBA 2OYIA 3PP5A 1LTJC 3HTKB 2Z4EA 2W27A 1L4AC 3M9QA 2KOGA 5AVWB 1OWAA 1LT9A 2KB7P 3H32A 1VPCA 4JYBA 1CZQA 5CCGA 5AW9B 3HD7D 5KJ7A 1SQBK 2XU6A 2XZRA 3MD0A 5APQA 5AVRB 3RL0C 4XA4A 2KP8A 1S9KD 1HJBA 4WY4A 1NTMK 1URQB 1SQPK 2HODB 1L4AD 1JY3P 3L37A 3HTKA 4JYCA 1JCDA 1SFCC 1YYCA 4IFMA 3MGNA 4GT1A 3NFQA 2O01H 1S9KE 1J1EC 5AVXB 3RL0D 4B86A 3V4WA 2GUVA 3HD7B 3M9BA 2YKQA 2C0XA 1H89A 1LTJB 1GK4A 4HH2A 1L4AB 1N7SC 3BATA 5APXA 1FZFA 3L36A 3TNUB 1YTZI 2HODA 1G1JA 2FKWB 3BRVB 1FZCC 5AW4B 1W2EA 2W6BA 3HE5B 5BVZA 1LTIC 4LLHA 3RL0B 2J59M 3VMXA 4I6MC 1H8AA 1NHLA 3HD7A 1N2DC 2MJZA 1N7SD 4C7RA 1J2JB 1LTJA 2H43A 1SFCB 3R2PA 1GU4A 1L4AA 4DZOA 4DOJA 2ZXEB 2YNYA 1J1EB 4W80A 2XDJA 2C9NY 5APWA 3T97A 1FZAA 4GKGA 3C9IA 4ZKUA 3IR9A 1N7SB 5AVUB 2GM4A 1FZCB 1FAVA 3A2AA 3CI9A 2H7HA 4I2LC 1JTHA 1N7LA 3N7NA 1MV8A 1T2KC 1SFCA 3SWFA 1FBMA 1JY2N 1SP4A 2Z5IA 3P32A 3V2QA 2OYIB 1MFZA 2OYHC 3U59A 2GUSA 2J58A 2VRSA 3B8EB 2YKPA 3OAKA 1A02F 2HLOA 3LW5H 2PAJA 3H32B 1X8YA 3U1AA 3V2PA 1N7SA 1PFIA 2IX7C 1DX7A 3NTNA 4I1LA 2I1JA 1GW4A 1FZCA 3A3YB 4O9BA 5AW5B 2P67A 1G1IA 5AW6B 2CPSA 5AVSB 1E5WA 3SWYA 3II6A 1KILC 4HYTB 2ZFCA 1OXZA 1GW3A 2C0WA 5AVZB 2A45G 1SQVK 1HH0A 1KQLA 4N6JA 3HE4B 3G3ZA 1A02J 5AVYB 1M1JC 1NTKK 1FOSF 2WSFH 1SQQK 5KLVK 2OYHB 1JY3N 1T3JA 1Z56A 3VP9A 1KILD 1L0LK 2YMYA 1LGHB 1FJPA 1T3UA 2Q5UA 3EFGA 2JJLA 2HG5D 3VP8A 3CL3D 1LTTC 2Q3IA 1NH4A 1FZGA 3UIAA 1NOHA 3MIWA 2XV5A 4JF7A 3HE4A 5KTBA 2HPCB 3M0DC 2WPQA 1IK9A 2PP6A 2OYHA 1GD2E 1G2CB 2JEEA 2XNXA 1ZR4A 3EQ2A 1M1JB 3MUDA 1FU1A 4GIFA 2WPRA 2FYUK 2A45I 3B5NC 1X9VA 1VDFA 2P1JA 1JMMA 5AVVB 1GU5A 1NKNA 2O1JA 2HPCA 1HGVA 3IFMA 3E1IA 1G2CA 1JTHB 4KHXA 1KFNA 5CHXA 2KLVA 3VMZA 5AW1B 1HGZA 3B5ND 3HRNA 1M1JA 1N86A 2YO2A 1FZBA 2M3BA 3H6PA 4C7NB 1CW5A 2P7JA 2FFDC 3RK2C 3BVHA 2IPPA 1SQXK 3NXSA 1LTGC 3WMM0 3M9HA 1NU1K 1RY3A 1IO4A 2KSJA 2WPSA 5APVA 1GZLA 3LIEA 2N1TC 3MTUE 3VYIA 1IJDB 3U1CA 1IFDA 5AW0B 2BASA 3BRTB 3B5NB 1J1DC 3KDPB 1QL1A 3RK2D 2IFNA 4IFDK 4C7NA 5CJ0A 1FOSE 3M0DA 1LTBC 1JY3O 2FYZA 1SLQA 2N1TD 3N4XA 4AUWA 1FDMA 1CSBA 1RE4C 2N9BA 3VOPA 2WT7B 2FFDB 3RK2B 1HUCA 3B5NA 3CLQA 2YO3A 1RF0C 1URQC 3GHGC 3P8CD 3RK3C 2R32A 3P8MC 4N3YB 1JO5A 2N1TB 1IFJA 3NMDA 3BASA 5CCHC 1NWQA 1FJKA 3KPEA 1HVVA 1GL2C 1J1DB 4ZKPA 3M06A 1XTGB 1LWUC 3P8CE 2NPSC 1WRGA 2WT7A 1URQD 5APTA 4AYCA 4EOTA 1H88A 1RF1C 2FFDA 2IFMA 1LTAC 2OARA 3RK3D 1NAFA 5AW3B 4AQRD 1MZ9A 5CCHD 1CI6B 1XTCC 1GK6A 1GL2D 2N1TA 1HBWA 3VN0A 2QM7A 2NPSD 1MUUA 3V5BA 2R5DA 1KILB 1SVFA 1QL2A 2WWWA 3GHGB 2WTYA 3OA7A 3RK3B 1KFMA 5APSA 2YKOA 1EQ7A 2R5BA 3HUSC 2QM8A 1N73C 1GL2B 1RE4A 1CI6A 2P2UA 1LWUB 2NPSB 3VMYA 2WSEH 3TYYA 5BU8B 4W7ZA 1RF1B 1RE3C 3O8ZA 2A45H 3TSIA 3OJAB 1JY2O 5AVQB 1KILA 2POHA 1RF0A 1URQA 1SFCD 1L0NK 3GHGA 1JUNA 3M0AA 2Q7CA 1IFMA 5AW2B 2I1KA 1IC2A 5CCHA 3P7KA 1GL2A 2OYIC 2Q9IA 1LWUA 3I5CA 2NPSA 1NO4A 1ZN5A 1RF1A 1AFOA 1LT9C 3A5TA 2Z5HA 4LC1A 2HYNA 1T8ZA 5BU5A 2FXMA 3HUSB 1ZR2A 1DH3A 1GDTA 2W6AA 1ZLLA 1N73B 1NKZB 5CCGC 3TNUA 5KJ7C 1AQ5A 2HFED 5CMZA 2C9LY 1X79B 4OH8B 4Y99C 3HE5A 4WY4C 4M3LA 5APUA 3L4FA 1NTZK 4RESB 4N78D 3VTPC 4XE5B 5AW7B 3A7OA 3V2RA 1HTLC 2R3CA 1GTWA 1ZV8A 5CCGD
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3V4Q A;  1J2J B;  3M06 A;  1GD2 E;  1G2C B;  1GU4 A;  4DZO A;  2WT7 A;  2ZXE B;  2YNY A;  5APT A;  4AYC A;  4EOT A;  3M91 A;  1H88 A;  5AVT B;  3L35 A;  2E42 A;  1NAF A;  2E43 A;  2WPR A;  5AW3 B;  2C9N Y;  5APW A;  3T97 A;  4AQR D;  1HWT C;  4GKG A;  1CI6 B;  1GK6 A;  5AW8 B;  3IR9 A;  5AVV B;  3KQG A;  3LID A;  5APY A;  1GU5 A;  1HBW A;  3VN0 A;  1T2K D;  2QM7 A;  5AVU B;  1MUU A;  3V5B A;  3TK1 A;  2R5D A;  1FAV A;  3A2A A;  2H7H A;  4I2L C;  1MV8 A;  1T2K C;  2WWW A;  4KHX A;  4C46 A;  3SWF A;  2WTY A;  1JNM A;  1SP4 A;  2Z5I A;  3P32 A;  5APS A;  3VMZ A;  5AW1 B;  1MFZ A;  2R5B A;  2W27 A;  4C7N B;  2YO2 A;  2QM8 A;  2VRS A;  2P7J A;  3B8E B;  5AVW B;  3OAK A;  1A02 F;  1OWA A;  1CI6 A;  1X8Y A;  2IPP A;  3NXS A;  2P2U A;  3M9H A;  4JYB A;  1CZQ A;  3VMY A;  5AW9 B;  3TYY A;  2XZR A;  2XU6 A;  3MD0 A;  3O8Z A;  5APQ A;  5AVR B;  1IO4 A;  3NTN A;  2KP8 A;  2WPS A;  5APV A;  5AVQ B;  3A3Y B;  1S9K D;  1GZL A;  1HJB A;  3LIE A;  2P67 A;  5AW5 B;  5AW6 B;  3VYI A;  1JUN A;  5AW0 B;  3M0A A;  2Q7C A;  2BAS A;  5AVS B;  3KDP B;  3L37 A;  4HYT B;  2ZFC A;  3HTK A;  1OXZ A;  4JYC A;  5AW2 B;  5AVZ B;  4C7N A;  1YYC A;  1FOS E;  3M0D A;  3MGN A;  4GT1 A;  3NFQ A;  1S9K E;  3P7K A;  1KQL A;  5AVX B;  3HE4 B;  1A02 J;  4B86 A;  5AVY B;  3V4W A;  3I5C A;  1SLQ A;  1FOS F;  3M9B A;  4AUW A;  1CSB A;  2N9B A;  3A5T A;  2Z5H A;  4LC1 A;  1H89 A;  1DH3 A;  1GK4 A;  2W6A A;  2WT7 B;  5APX A;  3TNU A;  3L36 A;  3TNU B;  2Q5U A;  1HUC A;  2JJL A;  5CMZ A;  5AW4 B;  2C9L Y;  3HE5 A;  5APU A;  3HE5 B;  4M3L A;  2YO3 A;  2Q3I A;  4RES B;  3UIA A;  3VTP C;  4XE5 B;  2R32 A;  5AW7 B;  3A7O A;  2XV5 A;  3P8M C;  3VMX A;  4I6M C;  3HE4 A;  3NMD A;  1H8A A;  2R3C A;  1GTW A;  1NWQ A;  2WPQ A; 
#chains in the Genus database with same CATH topology
 1PGP A;  4H13 C;  2QE7 H;  2FYN C;  2Y0D A;  4UB6 E;  1AV1 A;  5AVT B;  2L5G B;  2LKM A;  2H8P D;  2E43 A;  1M7L A;  3PRJ A;  3MHV A;  2O1K A;  2WIT A;  1LTS C;  3KQG A;  1NTZ J;  1T2K D;  4W7Y A;  1N8R Q;  2K9J B;  4Y99 B;  1S5L E;  1JB0 J;  3HD7 C;  4IFF A;  4C46 A;  3C8V A;  3KYQ A;  2QIW A;  2KOG A;  3L70 D;  2KB7 P;  1HF9 A;  3H32 A;  5B66 E;  3Q5S A;  2WSC J;  4H44 B;  3GW6 A;  1EC5 A;  2KP8 A;  1S9K D;  2QJK C;  1L0N E;  3QWO C;  1VQ5 P;  4PV1 D;  1JCD A;  2ZYD A;  3NFQ A;  3AED C;  3FXD A;  1NTZ D;  3M9B A;  5GTI E;  4HH2 A;  1L4A B;  2Y0E A;  1W2B O;  3BRV B;  1FZC C;  3L73 E;  3HE5 B;  1NTM J;  2M0B A;  1L2P A;  3RL0 B;  3VMX A;  1HJ0 A;  1H8A A;  2H89 C;  3AE9 C;  1N2D C;  1N7S D;  3L72 J;  1GU4 A;  1L4A A;  4DOJ A;  3H1I G;  4W80 A;  2C9N Y;  5KLV G;  2Y0C A;  4ZKU A;  1OZH A;  3IR9 A;  3CI9 A;  2WPV B;  2Z5I A;  1KMI Z;  3U59 A;  1NTM D;  2J58 A;  1ZXG A;  3PLN A;  3H1H J;  2PAJ A;  1SQB E;  1PFI A;  1QEX A;  1T6A A;  3NTN A;  1L0L E;  4UB8 H;  1G1I A;  3L72 D;  2ZT9 D;  4R4L A;  5AVS B;  3II6 A;  1BCC E;  5AVZ B;  3L71 G;  1SQV K;  3PJS K;  1KQL A;  4BXL A;  2G3A A;  1M1J C;  3H1L G;  1KB9 I;  2E75 C;  1SQX G;  1FJP A;  1VQ8 P;  1NU1 G;  1LTT C;  2Q3I A;  3G4S P;  1FZG A;  3AE4 C;  3MIW A;  1VF5 D;  3H1H D;  4JF7 A;  2JWA A;  2HPC B;  1NJI Q;  1ZOY C;  3M0D C;  4GDO A;  1G2C B;  1NTK J;  1M8O B;  1DEE G;  1EZV D;  1SQB J;  1YQ3 C;  3MUD A;  1L0L J;  4GIF A;  2QSI A;  3BCC J;  1X9V A;  2OTJ P;  1BE3 E;  1GU5 A;  2ZVO B;  2HPC A;  3S1K A;  3IFM A;  5KKZ C;  1G2C A;  4PJ0 E;  1HGZ A;  3B5N D;  1N86 A;  2YO2 A;  4WVZ A;  3CXH D;  3D6Y A;  3BVH A;  2IPP A;  1P84 I;  3M9H A;  2FYU J;  1RY3 A;  4UB8 E;  1LT1 A;  3Q3D A;  2N1T C;  1NTK D;  3VYI A;  1IJD B;  3U1C A;  5CBN A;  2BAS A;  1SQB D;  2IFN A;  4IFD K;  1LP1 A;  1L0L D;  5CJ0 A;  2QJY C;  4L76 A;  1LTB C;  3BCC D;  4DT0 A;  1SQQ E;  5GTH E;  2IYO A;  1CSB A;  2B89 A;  1PP9 G;  3WUU A;  1VQN P;  3RK2 B;  1S3J A;  1KB9 E;  1HUC A;  2MKV A;  4BWN A;  3CLQ A;  2YO3 A;  4OWF A;  1KN7 A;  3NMD A;  1M90 Q;  2FYU D;  2O01 N;  2RH0 A;  4ZKP A;  4OGQ D;  2N9Y B;  2P10 A;  3QH9 A;  1H88 A;  2UWJ E;  2IFM A;  3RK3 D;  3CX5 I;  1NAF A;  1ZP0 C;  2YIU C;  4AQR D;  5CCH D;  1MKM A;  2Y9Y A;  1GL2 D;  2GA1 A;  3CC4 P;  3ITK A;  3VN0 A;  2NPS D;  1BDC A;  3V5B A;  1KIL B;  1UIX A;  3L73 G;  1M1K Q;  4GOE A;  1YBK A;  2QM8 A;  1N73 C;  1NVO A;  3AE8 C;  1OFC X;  1RF1 B;  5AVQ B;  1P84 E;  1KIL A;  1RF0 A;  1URQ A;  1JUN A;  2Q7C A;  1IFM A;  1IC2 A;  4IL6 H;  2OYI C;  2Q9I A;  4TLF A;  1Q86 Q;  3I5C A;  3SFE C;  1RF1 A;  1LT9 C;  2Z5H A;  4LC1 A;  1T8Z A;  3L74 E;  1DH3 A;  1ZLL A;  3Q5R A;  3G71 P;  1AQ5 A;  4GOD A;  3A0B H;  1Y47 A;  5APU A;  3GMA A;  4RES B;  3CCM P;  2KUB A;  1HTL C;  5B5E H;  2Q3E A;  2FXO A;  5CCG D;  1YTZ T;  1FZE A;  1BCC G;  2AXT H;  3TGU E;  4WB4 A;  4WY4 D;  3M91 A;  3WU2 H;  2WSC H;  4JQ0 D;  1IFI A;  1KZU B;  4D6T J;  3CCR P;  3AEF C;  1JY2 P;  1HWT C;  1BDD A;  3SWK A;  3JSV C;  3L75 J;  5L8R J;  1AVY A;  1WT6 A;  1PGO A;  1RHZ B;  3AE5 C;  3FX0 A;  1IFN A;  4UB6 H;  1LTJ C;  2Z4E A;  3W67 A;  5AVW B;  1OW7 A;  2FYN B;  5TIS E;  2QA4 P;  4JYB A;  5KJ7 A;  2XU6 A;  2PRR A;  1EDJ A;  3AEC C;  4XA4 A;  3CPW O;  3L70 E;  1S5L H;  1SQP K;  2HOD B;  2Y9Z A;  2FXP A;  1BE3 G;  1YYC A;  4D6T D;  4GT1 A;  1S9K E;  1SS1 A;  1P84 D;  2OQQ A;  5AVX B;  1LJ2 A;  3L75 D;  4B86 A;  2GUV A;  2K37 A;  3HD7 B;  1VQ7 P;  5KLI C;  4DCK A;  2QJP C;  1N7S C;  3IN6 A;  3L36 A;  3TNU B;  4U7J A;  5CBO A;  2HOD A;  5M1B A;  3A0B E;  1YIT P;  2R3S A;  1NTZ E;  2W6B A;  3H25 A;  4RO0 A;  4LLH A;  1Y8A A;  4I6M C;  3HD7 A;  2MJZ A;  1VQP P;  3G9R A;  1J2J B;  2O01 J;  3E7K A;  5GTI H;  3R2P A;  1YJN P;  4DZO A;  1OVR A;  2YNY A;  2ZXE B;  3Q1M A;  3WU2 E;  5APW A;  1SQQ G;  3T97 A;  1FZA A;  1D7M A;  2NZ2 A;  1QVG O;  3C9I A;  2DW3 A;  1FZC B;  2H7H A;  1JTH A;  1Q82 Q;  3CX5 D;  1FBM A;  2IYP A;  3L71 J;  1JY2 N;  3V2Q A;  2OYH C;  3C1L A;  1BGY J;  1JMB A;  1PGJ A;  2VRS A;  2ZT9 C;  3CCJ P;  1A02 F;  3H32 B;  1X8Y A;  4I7Z C;  3U1A A;  3GG2 A;  3CXH I;  2E74 D;  2IX7 C;  2M3E A;  1EDL A;  1DX7 A;  3AEA C;  1FZC A;  1NTM E;  3CXH H;  4O9B A;  2NRG A;  2CPS A;  5H2F H;  1HH0 A;  3KXD A;  3L72 E;  3HE4 B;  1A02 J;  1OIP A;  2QEX P;  3WUV A;  1VF5 C;  5KLV K;  1T3J A;  1KIL D;  2YMY A;  1LGH B;  1KV4 A;  3RL0 g;  3VMA A;  3L71 D;  3EFG A;  3CCL P;  2IBZ D;  2PGD A;  2OTL P;  1BGY D;  4KJM A;  3UIA A;  3CCQ P;  1NOH A;  1RH5 B;  4BRY B;  3HE4 A;  2V7Q H;  2R44 A;  1IFP A;  1SQV J;  3F5H A;  5KAI E;  2PP6 A;  2LR2 A;  1H0T B;  1AJY A;  2JEE A;  2XNX A;  3H1H E;  2WSF J;  1IK7 A;  2W6J H;  1M1J B;  2WPR A;  3B5N C;  3TDK A;  1EZV E;  3L74 G;  1JMM A;  4BRY A;  1NKN A;  2P58 A;  1H0T A;  3RBX A;  1TU3 F;  3HRN A;  1M1J A;  2M3B A;  2P7J A;  2FFD C;  3E1R A;  1YQ4 C;  1SQX K;  3OW2 O;  1NU1 K;  2RN0 A;  3TGU G;  2JR8 A;  1SQV D;  4PD4 D;  1IO4 A;  4IL6 X;  2KSJ A;  3CXH E;  1GZL A;  3D70 A;  5AW0 B;  4PJ0 H;  1U57 A;  5H2F E;  3M0D A;  2YXQ B;  5KKZ B;  1NTK E;  4K3A A;  2K9Y A;  1VQL P;  4Z1M H;  1SLQ A;  4L73 A;  1K8A Q;  3D6Z A;  3VOP A;  1FE6 A;  1Q2N A;  3BCC E;  4OGQ C;  2AEJ A;  2XND H;  1FDO A;  3RK3 C;  2R32 A;  1JO5 A;  2N1T B;  3L70 G;  2WVR A;  5CCH C;  5GTH H;  1GL2 C;  2NPS C;  2QJY B;  3GLM A;  1KB9 H;  2FYU E;  5AW3 B;  1MZ9 A;  3AE2 C;  4RJT A;  2N1T A;  3H1J J;  3RK3 E;  2FY8 A;  2R5D A;  1NTZ G;  4QMA A;  5APS A;  5KAF H;  5K5G B;  2YKO A;  3HUS C;  4EYY Q;  4U3F J;  2D2C D;  2BEQ D;  2E76 D;  2KIK A;  2G8Y A;  3TYY A;  4W7Z A;  1RE3 C;  3F89 A;  2OYO A;  4RKU J;  3AE7 C;  2YIU B;  1L0N K;  4GOF A;  1EXI A;  5AW2 B;  1R5L A;  1LP1 B;  1UII A;  1S2E A;  2OTK E;  1IZN B;  1ZN5 A;  3H1J D;  4DJG A;  1AFO A;  3B71 A;  1P84 H;  1N73 B;  2ZYA A;  2JWD A;  3AEB C;  5CCG C;  2WSE J;  1X79 B;  4WY4 C;  4N78 D;  4U3F D;  4XE5 B;  2W8Z A;  5AW7 B;  3A7O A;  1NTM G;  1GTW A;  1M57 D;  1ZV8 A;  3PHL A;  4KT0 J;  3V4Q A;  1S4X A;  1VQK P;  3B4S A;  3CWB J;  1N73 A;  5CJ4 A;  3L72 G;  2E42 A;  1ZW0 A;  3D71 A;  1LT9 B;  3MUD C;  3LID A;  1L0N G;  4H44 D;  2WZ7 A;  2M8R A;  1JNM A;  4MN4 C;  1DEB A;  1EDI A;  2OYI A;  5KAF E;  3GF3 A;  2W27 A;  2KI7 B;  3M9Q A;  1LT9 A;  1VPC A;  3CX5 H;  5AW9 B;  3AE1 C;  1SQB K;  2KS1 A;  2XZR A;  3H1H G;  5APQ A;  3AEE C;  1HJB A;  1URQ B;  3CWB D;  1L4A D;  1JY3 P;  4Y28 J;  2BCC J;  1RQV A;  1EZV G;  4L75 A;  1QLE D;  2KZI A;  1SFC C;  3H1K J;  3A0H H;  2O01 H;  1DD4 A;  1J1E C;  3RL0 D;  3V4W A;  2RMZ A;  5TIS H;  1PL5 A;  1ZRT D;  1RQU A;  2YKQ A;  5EFW B;  1H89 A;  1LTJ B;  2YMK A;  1OVU A;  4D6T E;  3BAT A;  3L75 E;  4NPD A;  1W2E A;  3EFF K;  1SQP J;  5BVZ A;  2IBZ I;  1NHL A;  2A06 D;  1QVF O;  4WWI A;  1LTJ A;  3USS A;  4ASW A;  2H43 A;  3I56 P;  2ZJS E;  1NTK G;  3V6I A;  2BCC D;  1SQB G;  3H1K D;  2M5A B;  5KLI B;  2QJP B;  1L0L G;  1N7S B;  3BCC G;  2Q1K A;  5AVU B;  4I2L C;  2E74 C;  4HJG H;  3TF5 A;  3N7N A;  1MV8 A;  1T2K C;  3KZI H;  1MFZ A;  3K5B A;  1PPJ D;  5DJU B;  2GUS A;  1SQP D;  2YKP A;  3OAK A;  2M5A A;  2HLO A;  3CX5 E;  1N7S A;  4JBZ A;  2I1J A;  1PZQ A;  2SPZ A;  5AW5 B;  2FYU G;  5AW6 B;  4PD4 I;  1VQ9 P;  4CPG A;  1KIL C;  2K1A A;  4HYT B;  2ZFC A;  1OXZ A;  4PD4 H;  1Q81 Q;  2C0W A;  4H0L B;  3A0H E;  4H13 B;  4PV1 C;  3Q5P A;  1BSN A;  3G3Z A;  3EWK A;  1FOS F;  2WSF H;  1SQQ K;  2OYH B;  1JY3 N;  2IZ1 A;  1Z56 A;  3LW5 J;  5DJT B;  3VP9 A;  1T3U A;  2Q5U A;  4I7Z B;  3VP8 A;  2JO1 A;  2QRX A;  1KIL E;  2XV5 A;  5KTB A;  3L71 E;  3SSU A;  3R4Y A;  2IBZ E;  1BGY E;  3H1I J;  2OYH A;  1GD2 E;  1ZR4 A;  3CCE P;  4A7P A;  2IDB A;  5KLV J;  1OMI A;  3EQ2 A;  4YTP C;  1K73 Q;  1SQX E;  1QGK B;  4L74 A;  3T97 B;  4R4M A;  1VF5 B;  2A45 I;  2QJK B;  5AVV B;  1HGV A;  5KAI H;  4OVN F;  1JTH B;  1U7J A;  3KZI E;  1KFN A;  2KLV A;  3VMZ A;  5AW1 B;  4C7N B;  1CW5 A;  2IZ0 A;  3NXS A;  1GMJ A;  1OW6 A;  2ZVN B;  5APV A;  3H1I D;  3LIE A;  3MZW B;  5KLV D;  3B5N B;  1J1D C;  3KDP B;  1QL1 A;  3RK2 D;  4PD4 E;  1SQV E;  3FXE A;  4C7N A;  1EXJ A;  1U7M A;  3H1L J;  2CK3 H;  1JY3 O;  1MFT A;  4ASV A;  1RE4 C;  3WUT A;  2N9B A;  3JCU E;  1SQX J;  1NU1 J;  1NAY A;  2FFD B;  1JM0 A;  4NPE A;  3CCV P;  3B5N A;  1KTM A;  2JDI H;  2L91 A;  3GHG C;  3P8C D;  3P8M C;  3FWN A;  2KLU A;  1IFJ A;  2LXB A;  1NWQ A;  1HVV A;  3M06 A;  1XTG B;  1LWU C;  1WRG A;  1URQ D;  2FFD A;  1LTA C;  2B88 A;  2OAR A;  1PP9 E;  1EDK A;  3IF4 A;  1LNQ A;  3H1L D;  1VQO P;  1XTC C;  1FS0 E;  1GK6 A;  1Q7Y Q;  4D6T G;  3AEG C;  2QM7 A;  2D2C C;  3L75 G;  4OGQ B;  2E76 C;  1AQT A;  2K9J A;  1SQX D;  1NU1 D;  2WWW A;  2WTY A;  3I55 P;  3OA7 A;  3CCS P;  3RK3 B;  1KYO D;  1EQ7 A;  1GL2 B;  2FBW C;  3G6E P;  2P2U A;  2NPS B;  3VMY A;  2WSE H;  2E75 B;  3O8Z A;  3TSI A;  1JY2 O;  1M56 D;  1NGM B;  2E5T A;  2POH A;  2Q6Q A;  5CCH A;  3P7K A;  1GL2 A;  1S1C X;  3AE3 C;  2NPS A;  1NO4 A;  1PP9 J;  1AVO A;  1USD A;  3A5T A;  2ZYG A;  1YIJ P;  3HUS B;  1ZR2 A;  2W6A A;  4EI2 A;  1NKZ B;  2HFE D;  2B9B A;  5CMZ A;  3H1J E;  2KK7 A;  3FGA D;  4OH8 B;  2C9L Y;  4Y99 C;  3HE5 A;  3L4F A;  1L0N J;  1NTZ K;  1VQ4 P;  1AA0 A;  3O6Q B;  2WQY C;  3CC2 P;  4TT3 H;  5KJ7 D;  2XKM A;  4N78 E;  3HUS A;  4LGD E;  4U3F E;  1OX3 A;  4H44 C;  1K05 A;  2CPB A;  1JCC A;  1Y9B A;  3L35 A;  3V2N A;  2J5U A;  4H0L D;  1OVV A;  1RE3 A;  1JOC A;  4JPZ B;  5AW8 B;  4H13 D;  5APY A;  2AEM A;  2KYV A;  3O6Q A;  4WBA A;  3L73 J;  4EIJ A;  1PP9 D;  2QG4 A;  3TK1 A;  4WY4 B;  4YXD C;  3PP5 A;  3HTK B;  1L4A C;  3ZDM A;  1L0N D;  1OWA A;  2IBZ G;  1YHQ P;  4IOI H;  1KQS O;  1BGY G;  1CZQ A;  5CCG A;  3HD7 D;  5AVR B;  3MD0 A;  3RL0 C;  4WY4 A;  1NTM K;  2I8D A;  3L37 A;  1DD3 A;  2JP3 A;  3HTK A;  4JYC A;  4IFM A;  3MGN A;  1S5L X;  3RBZ A;  3CWB E;  2W83 C;  1PIX A;  1PGQ A;  1VQM P;  3L73 D;  2LXC B;  2C0X A;  3W68 A;  3CCU P;  3GF7 A;  1GK4 A;  5APX A;  1FZF A;  1YTZ I;  1G1J A;  2FKW B;  1ZRT E;  5AW4 B;  1LTI C;  2J59 M;  1BCC J;  4C7R A;  1R8E A;  1X22 A;  1SQV G;  2QVA A;  1SFC B;  2V7Q J;  1J1E B;  2A06 E;  2OGU A;  2XDJ A;  1Q90 D;  4GKG A;  4K35 A;  2BCC E;  3PTZ A;  2GM4 A;  1FAV A;  3S9O A;  3A2A A;  3H1K E;  1N7L A;  1SFC A;  3SWF A;  2PFX A;  1SP4 A;  3P32 A;  2OYI B;  2HR3 A;  3B8E B;  3CC7 P;  3LW5 H;  5E79 H;  1DIP A;  1KC8 Q;  2YXR B;  3V2P A;  1BCC D;  3S4R A;  2KS1 B;  1PPJ E;  4I1L A;  1GW4 A;  1SQP E;  3A3Y B;  1KD1 Q;  2P67 A;  2KSE A;  1USE A;  1BE3 J;  1R5S A;  1E5W A;  3SWY A;  2E5Y A;  1GW3 A;  2A45 G;  4N6J A;  5AVY B;  2E74 B;  1NTK K;  1YJ9 P;  5TJH A;  1L0L K;  2JJL A;  2HG5 D;  2WMM A;  3CL3 D;  2AXC A;  1NH4 A;  1OW8 A;  1FDI A;  2K88 A;  3MP7 B;  4NPF X;  2WPQ A;  1IK9 A;  2E75 D;  5C39 A;  1KQF B;  4YPC A;  1BE3 D;  4PV1 B;  1SQQ J;  3AE6 C;  1FU1 A;  2O3J A;  2FYU K;  1VDF A;  2P1J A;  2O1J A;  3CMA P;  2RKL A;  3E1I A;  3H1J G;  3KHU A;  3ABV C;  4KHX A;  5CHX A;  1S72 P;  2ITA A;  1FZB A;  3H6P A;  3RK2 C;  1KYO I;  5E79 E;  1LTG C;  3WMM 0;  4U3F G;  2H88 C;  1KYO H;  4YXW H;  2WPS A;  3PH0 A;  3MTU E;  1IFD A;  3FWL A;  3BRT B;  1SQQ D;  1E79 H;  1FOS E;  3SFD C;  3CD6 P;  3H1I E;  4EDF A;  2FYZ A;  1KB9 D;  5KLV E;  2N1T D;  3N4X A;  4AUW A;  1FDM A;  2W90 A;  2WT7 B;  3IAO A;  4ZMD A;  1RF0 C;  1URQ C;  1KOR A;  4N3Y B;  1JEK A;  4HKZ H;  3BAS A;  1FJK A;  3KPE A;  1J1D B;  3JCU H;  1QX8 A;  3P8C E;  2WT7 A;  2ZT9 B;  4AYC A;  5APT A;  4EOT A;  1RF1 C;  3CWB G;  3L74 J;  1CI6 B;  2BEZ F;  1HBW A;  1K9M Q;  1MUU A;  2JKV A;  1SVF A;  3H1L E;  1VL2 A;  1QL2 A;  1K04 A;  3GHG B;  1X0T A;  3JC2 2;  1KFM A;  2R5B A;  1ZME C;  1WMK A;  2ZAE B;  3TGU J;  4IL6 E;  1RE4 A;  1CI6 A;  1NU1 E;  5B66 H;  3CME P;  1LWU B;  1BSH A;  5BU8 B;  3Q2Y A;  1KYO E;  2A45 H;  2A06 G;  3OJA B;  2B87 B;  3RGU A;  1YI2 P;  1W5C E;  1SFC D;  3GHG A;  3M0A A;  4HB1 A;  2I1K A;  2D2C B;  4XFJ A;  3L74 D;  4ZNC A;  2KXP B;  2E76 B;  2KNC B;  2BCC G;  1YJW P;  2KZJ A;  3H1K G;  5B5E E;  1LWU A;  1NYH A;  2AEF A;  1KQG B;  1VQ6 P;  2HYN A;  5BU5 A;  1GDT A;  2FXM A;  2AXT E;  2B87 A;  2V4H A;  1PV3 A;  3TNU A;  5KJ7 C;  1EZV I;  2K3R A;  4M3L A;  3L70 J;  3VTP C;  3TGU D;  1FC2 C;  2KNC A;  1PPJ G;  3V2R A;  1SQP G;  2R3C A;  4H0L C;  2ZXX A;  2WSS H; 
#chains in the Genus database with same CATH homology
 5KJ7 D;  3V4Q A;  1YTZ T;  1FZE A;  2XKM A;  4N78 E;  3HUS A;  4LGD E;  4WB4 A;  4WY4 D;  1N73 A;  3M91 A;  2CPB A;  5CJ4 A;  1JCC A;  5AVT B;  2WSC H;  2L5G B;  2LKM A;  1IFI A;  1KZU B;  3L35 A;  2E42 A;  2H8P D;  3V2N A;  2E43 A;  1M7L A;  1JY2 P;  1HWT C;  1RE3 A;  1LT9 B;  2O1K A;  2WIT A;  1JOC A;  5AW8 B;  1LTS C;  1WT6 A;  3KQG A;  2KYV A;  3LID A;  5APY A;  4WBA A;  1T2K D;  4EIJ A;  4W7Y A;  3TK1 A;  2WZ7 A;  2M8R A;  4Y99 B;  4WY4 B;  3HD7 C;  1IFN A;  4IFF A;  4C46 A;  1JNM A;  3KYQ A;  1DEB A;  2OYI A;  3PP5 A;  1LTJ C;  3HTK B;  2Z4E A;  2W27 A;  1L4A C;  3M9Q A;  2KOG A;  5AVW B;  1OWA A;  1LT9 A;  2KB7 P;  3H32 A;  1VPC A;  4JYB A;  1CZQ A;  5CCG A;  5AW9 B;  3HD7 D;  5KJ7 A;  1SQB K;  2XU6 A;  2XZR A;  3MD0 A;  5APQ A;  5AVR B;  3RL0 C;  4XA4 A;  2KP8 A;  1S9K D;  1HJB A;  4WY4 A;  1NTM K;  1URQ B;  1SQP K;  2HOD B;  1L4A D;  1JY3 P;  3L37 A;  3HTK A;  4JYC A;  1JCD A;  1SFC C;  1YYC A;  4IFM A;  3MGN A;  4GT1 A;  3NFQ A;  2O01 H;  1S9K E;  1J1E C;  5AVX B;  3RL0 D;  4B86 A;  3V4W A;  2GUV A;  3HD7 B;  3M9B A;  2YKQ A;  2C0X A;  1H89 A;  1LTJ B;  1GK4 A;  4HH2 A;  1L4A B;  1N7S C;  3BAT A;  5APX A;  1FZF A;  3L36 A;  3TNU B;  1YTZ I;  2HOD A;  1G1J A;  2FKW B;  3BRV B;  1FZC C;  5AW4 B;  1W2E A;  2W6B A;  3HE5 B;  5BVZ A;  1LTI C;  4LLH A;  3RL0 B;  2J59 M;  3VMX A;  4I6M C;  1H8A A;  1NHL A;  3HD7 A;  1N2D C;  2MJZ A;  1N7S D;  4C7R A;  1J2J B;  1LTJ A;  2H43 A;  1SFC B;  3R2P A;  1GU4 A;  1L4A A;  4DZO A;  4DOJ A;  2ZXE B;  2YNY A;  1J1E B;  4W80 A;  2XDJ A;  2C9N Y;  5APW A;  3T97 A;  1FZA A;  4GKG A;  3C9I A;  4ZKU A;  3IR9 A;  1N7S B;  5AVU B;  2GM4 A;  1FZC B;  1FAV A;  3A2A A;  3CI9 A;  2H7H A;  4I2L C;  1JTH A;  1N7L A;  3N7N A;  1MV8 A;  1T2K C;  1SFC A;  3SWF A;  1FBM A;  1JY2 N;  1SP4 A;  2Z5I A;  3P32 A;  3V2Q A;  2OYI B;  1MFZ A;  2OYH C;  3U59 A;  2GUS A;  2J58 A;  2VRS A;  3B8E B;  2YKP A;  3OAK A;  1A02 F;  2HLO A;  3LW5 H;  2PAJ A;  3H32 B;  1X8Y A;  3U1A A;  3V2P A;  1N7S A;  1PFI A;  2IX7 C;  1DX7 A;  3NTN A;  4I1L A;  2I1J A;  1GW4 A;  1FZC A;  3A3Y B;  4O9B A;  5AW5 B;  2P67 A;  1G1I A;  5AW6 B;  2CPS A;  5AVS B;  1E5W A;  3SWY A;  3II6 A;  1KIL C;  4HYT B;  2ZFC A;  1OXZ A;  1GW3 A;  2C0W A;  5AVZ B;  2A45 G;  1SQV K;  1HH0 A;  1KQL A;  4N6J A;  3HE4 B;  3G3Z A;  1A02 J;  5AVY B;  1M1J C;  1NTK K;  1FOS F;  2WSF H;  1SQQ K;  5KLV K;  2OYH B;  1JY3 N;  1T3J A;  1Z56 A;  3VP9 A;  1KIL D;  1L0L K;  2YMY A;  1LGH B;  1FJP A;  1T3U A;  2Q5U A;  3EFG A;  2JJL A;  2HG5 D;  3VP8 A;  3CL3 D;  1LTT C;  2Q3I A;  1NH4 A;  1FZG A;  3UIA A;  1NOH A;  3MIW A;  2XV5 A;  4JF7 A;  3HE4 A;  5KTB A;  2HPC B;  3M0D C;  2WPQ A;  1IK9 A;  2PP6 A;  2OYH A;  1GD2 E;  1G2C B;  2JEE A;  2XNX A;  1ZR4 A;  3EQ2 A;  1M1J B;  3MUD A;  1FU1 A;  4GIF A;  2WPR A;  2FYU K;  2A45 I;  3B5N C;  1X9V A;  1VDF A;  2P1J A;  1JMM A;  5AVV B;  1GU5 A;  1NKN A;  2O1J A;  2HPC A;  1HGV A;  3IFM A;  3E1I A;  1G2C A;  1JTH B;  4KHX A;  1KFN A;  5CHX A;  2KLV A;  3VMZ A;  5AW1 B;  1HGZ A;  3B5N D;  3HRN A;  1M1J A;  1N86 A;  2YO2 A;  1FZB A;  2M3B A;  3H6P A;  4C7N B;  1CW5 A;  2P7J A;  2FFD C;  3RK2 C;  3BVH A;  2IPP A;  1SQX K;  3NXS A;  1LTG C;  3WMM 0;  3M9H A;  1NU1 K;  1RY3 A;  1IO4 A;  2KSJ A;  2WPS A;  5APV A;  1GZL A;  3LIE A;  2N1T C;  3MTU E;  3VYI A;  1IJD B;  3U1C A;  1IFD A;  5AW0 B;  2BAS A;  3BRT B;  3B5N B;  1J1D C;  3KDP B;  1QL1 A;  3RK2 D;  2IFN A;  4IFD K;  4C7N A;  5CJ0 A;  1FOS E;  3M0D A;  1LTB C;  1JY3 O;  2FYZ A;  1SLQ A;  2N1T D;  3N4X A;  4AUW A;  1FDM A;  1CSB A;  1RE4 C;  2N9B A;  3VOP A;  2WT7 B;  2FFD B;  3RK2 B;  1HUC A;  3B5N A;  3CLQ A;  2YO3 A;  1RF0 C;  1URQ C;  3GHG C;  3P8C D;  3RK3 C;  2R32 A;  3P8M C;  4N3Y B;  1JO5 A;  2N1T B;  1IFJ A;  3NMD A;  3BAS A;  5CCH C;  1NWQ A;  1FJK A;  3KPE A;  1HVV A;  1GL2 C;  1J1D B;  4ZKP A;  3M06 A;  1XTG B;  1LWU C;  3P8C E;  2NPS C;  1WRG A;  2WT7 A;  1URQ D;  5APT A;  4AYC A;  4EOT A;  1H88 A;  1RF1 C;  2FFD A;  2IFM A;  1LTA C;  2OAR A;  3RK3 D;  1NAF A;  5AW3 B;  4AQR D;  1MZ9 A;  5CCH D;  1CI6 B;  1XTC C;  1GK6 A;  1GL2 D;  2N1T A;  1HBW A;  3VN0 A;  2QM7 A;  2NPS D;  1MUU A;  3V5B A;  2R5D A;  1KIL B;  1SVF A;  1QL2 A;  2WWW A;  3GHG B;  2WTY A;  3OA7 A;  3RK3 B;  1KFM A;  5APS A;  2YKO A;  1EQ7 A;  2R5B A;  3HUS C;  2QM8 A;  1N73 C;  1GL2 B;  1RE4 A;  1CI6 A;  2P2U A;  1LWU B;  2NPS B;  3VMY A;  2WSE H;  3TYY A;  5BU8 B;  4W7Z A;  1RF1 B;  1RE3 C;  3O8Z A;  2A45 H;  3TSI A;  3OJA B;  1JY2 O;  5AVQ B;  1KIL A;  2POH A;  1RF0 A;  1URQ A;  1SFC D;  1L0N K;  3GHG A;  1JUN A;  3M0A A;  2Q7C A;  1IFM A;  5AW2 B;  2I1K A;  1IC2 A;  5CCH A;  3P7K A;  1GL2 A;  2OYI C;  2Q9I A;  1LWU A;  3I5C A;  2NPS A;  1NO4 A;  1ZN5 A;  1RF1 A;  1AFO A;  1LT9 C;  3A5T A;  2Z5H A;  4LC1 A;  2HYN A;  1T8Z A;  5BU5 A;  2FXM A;  3HUS B;  1ZR2 A;  1DH3 A;  1GDT A;  2W6A A;  1ZLL A;  1N73 B;  1NKZ B;  5CCG C;  3TNU A;  5KJ7 C;  1AQ5 A;  2HFE D;  5CMZ A;  2C9L Y;  1X79 B;  4OH8 B;  4Y99 C;  3HE5 A;  4WY4 C;  4M3L A;  5APU A;  3L4F A;  1NTZ K;  4RES B;  4N78 D;  3VTP C;  4XE5 B;  5AW7 B;  3A7O A;  3V2R A;  1HTL C;  2R3C A;  1GTW A;  1ZV8 A;  5CCG D; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...