3LW5J

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDLKTYLSVAPVVSTLWFGALAGLLIEINRFFPDALIFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3lw5J00
2D2CB 4I7ZB 2QJPC 2FYNC 5KKZC 2O01J 5KLIC 2E75B 2E74B 4H44B 2WPVB 2QJYC 2WSCJ 1ZRTE 2WSFJ 2QSIA 4KT0J 2YIUC 4H0LB 2K9YA 2QJKC 1VF5B 1JB0J 2ZT9B 1S5LX 2QIWA 4OGQB 4Y28J 2E76B 5L8RJ 3C8VA 4IL6X 2WSEJ 1Q90D 4PV1B 3LW5J 4RKUJ 4H13B
chains in the Genus database with same CATH superfamily
4B86A 2QJPC 1OWAA 3MUDA 1Q82Q 1M1JB 1PP9E 1FOSE 2KZIA 3A0HE 5APUA 5CCHA 2BCCG 2L91A 3RK2D 2WMMA 4UB6H 2M3BA 3V2RA 2HFED 4EOTA 2FFDB 4OH8B 5KLVD 2Q6QA 2JWDA 3HE4A 2KYVA 2E74D 2IPPA 1N7SA 1HTLC 1MKMA 1P84H 4L73A 1SQVJ 2E42A 2KS1B 1FZBA 2E76D 1NU1G 2WSSH 1SQPD 5CCGA 3M06A 2KNCA 4RKUJ 4UB6E 3NXSA 5KLIC 1JY2N 5GTHH 1RF1C 5KAFH 3S1KA 4D6TD 1AQTA 4WWIA 1P84E 1FJPA 1IJDB 1EXIA 3VMYA 4Y99C 1NTZD 1S5LH 5AVSB 2JO1A 1LTJC 4GKGA 1NTMJ 1HBWA 4WY4D 1A02F 3L75J 5KJ7C 1BSHA 1VQ6P 3E1IA 5KAFE 4YXDC 3Q3DA 2Q9IA 2JWAA 2WPRA 2JJLA 1KQLA 1FU1A 1S5LE 2WZ7A 1FDOA 4K3AA 4IFDK 1GD2E 1OVVA 1KORA 1BE3E 1N8RQ 1URQC 3T97A 1AVYA 2KI7B 2OTJP 1NJIQ 2AXTE 3H1HD 1SQQG 3GHGC 3ITKA 1NWQA 2N1TA 1X79B 2QJKC 2XKMA 2GUSA 3H32A 3L74E 3V5BA 4OGQD 4U3FG 3P8CD 3U59A 1L0LE 2QE7H 2YMKA 1SQVK 3S4RA 3II6A 1M1KQ 3IN6A 2P67A 1K73Q 2IFMA 3FGAD 1AFOA 1FZGA 2P58A 4WB4A 3L35A 1VQ5P 1Y47A 1VL2A 1RF1B 3MUDC 2NPSA 3WUUA 2B89A 3CMEP 2FBWC 1LJ2A 3CXHH 4LLHA 3HTKB 1M90Q 4EYYQ 4Y99B 3A3YB 3A2AA 3CCSP 2YKPA 1EZVE 3B4SA 3LW5H 5M1BA 2WWWA 1BE3J 1RE3C 4PD4E 1N7SC 2FYUE 1JTHB 1KD1Q 2KIKA 4DJGA 2O3JA 1ZW0A 3L74J 3CX5I 3USSA 3TNUA 1BCCE 1QVFO 5K5GB 4AQRD 4LGDE 1L0LJ 2QA4P 1OMIA 3L70E 1OIPA 3H1IE 4PV1C 1KILD 3JCUH 3JSVC 1X8YA 4HYTB 1XTGB 1URQB 2KP8A 3L36A 4LC1A 3GHGB 4R4MA 2RKLA 1M1JA 4JF7A 3OJAB 2QJKB 1KC8Q 3B5NA 4H44D 4DOJA 1NTMD 5AW8B 3SWKA 1FZCB 1SFCB 4UB8E 3L75D 2QIWA 1NGMB 3FXDA 1QVGO 5AW3B 4H13D 3KDPB 2FYUJ 4N78D 2E75D 3IR9A 2IX7C 1KN7A 3FX0A 1KFMA 3EFFK 4Y28J 1BCCJ 3H1LD 3GMAA 2E43A 2K9JA 3L72G 5KLVE 2O01H 1MZ9A 5APSA 1NKZB 2HPCA 1RQUA 1HF9A 3VMZA 3HE4B 1JCDA 3VMAA 1SQPE 1N7SB 4DZOA 3AEDC 4O9BA 1YHQP 4XA4A 4H0LC 4ZKUA 1VF5C 1LTIC 3CX5D 2KNCB 4D6TE 2J59M 2W6JH 3HD7C 1L0LK 3RK3D 1YJ9P 1EDLA 3E1RA 5BU5A 1NTKJ 1ZV8A 3VYIA 1NTZE 2OQQA 3M0DA 3VOPA 1LT1A 2YKQA 3D6YA 3CXHI 1PPJG 2M5AA 1SFCD 5AW2B 1QX8A 2H7HA 4CPGA 1JY3N 1VQOP 1ZXGA 5KLVJ 2JKVA 1L4AA 2V4HA 5APYA 1FBMA 1KMIZ 5AW4B 3U1CA 3D6ZA 2FYUK 1SQPJ 2FYNB 2QRXA 1YQ3C 3R4YA 5CCHD 1QGKB 3AE9C 3AE8C 2Y9ZA 1LWUC 3H1KJ 2O01J 2WPQA 3F5HA 4D6TJ 3T97B 1D7MA 2Y0CA 1RF1A 1VDFA 1GK6A 2FXMA 3P8CE 2MKVA 3KYQA 1L0NJ 2N1TB 3B8EB 2BASA 3H32B 1SQBJ 2AEJA 4AYCA 1S1CX 1LTJA 3G3ZA 5CCGD 2FXPA 2HYNA 2W90A 3WUTA 2XV5A 3PLNA 4RO0A 2NRGA 4H0LB 4L75A 1VF5B 4XE5B 2WTYA 2B9BA 1WRGA 3CCUP 3CCLP 3HE5A 3L71G 4NPEA 3HD7B 2ZAEB 1FE6A 3V2QA 2NPSB 2YXRB 2IZ0A 3CXHD 1EC5A 2ZJSE 1Q7YQ 3H1HJ 2OYOA 2IBZI 1VQ8P 1YIJP 3P32A 5KLVK 2FY8A 1PP9G 2FXOA 3I5CA 4JPZB 3TNUB 1KILE 1W2BO 1SQPK 5BU8B 2D2CC 4YTPC 4NPFX 2ZYGA 2Z4EA 4I2LC 1FAVA 3CWBJ 1Y8AA 2AXCA 1ZOYC 1G1IA 2O1KA 1N86A 2N1TD 4TT3H 1NTKD 1YQ4C 1NKNA 4ZMDA 3HRNA 1LTAC 1NTME 1VPCA 2RMZA 1NTZK 4IFFA 3L75E 1CW5A 3B5NB 3H1JG 1SQXG 2LXCB 4EI2A 1RQVA 3S9OA 1L4AC 1K9MQ 1E79H 1YJWP 3CC4P 2H43A 4N78E 3TGUJ 1VQNP 2XDJA 1RE3A 1RH5B 1VQPP 4WBAA 1KZUB 5AVXB 2R3SA 2K1AA 3H1LE 2R44A 3CX5H 2LXBA 2QEXP 3MHVA 2K37A 3FWNA 4MN4C 2K9JB 2PAJA 3H1KD 4TLFA 1T3UA 1X9VA 4I7ZC 2R32A 1IZNB 1YTZI 5KAIH 5B66H 1GL2D 2HPCB 1YBKA 1YYCA 2HR3A 2IBZD 2B87A 4L76A 3CX5E 1T3JA 1L0ND 1QLED 1LGHB 4OWFA 1YJNP 3VP8A 1SQBD 4ZNCA 4AUWA 3RK3E 3F89A 2Q5UA 1IFMA 2YO2A 4HJGH 1GW4A 2Q3IA 3PRJA 5GTHE 1GDTA 3G9RA 3K5BA 4GOFA 2KLUA 5KAIE 5B66E 1MUUA 5KKZC 1KYOH 1HH0A 2CPBA 3D70A 2JP3A 3RL0C 1CI6A 1H0TA 3H1LJ 3B5ND 2QJPB 1S72P 1A02J 2I1JA 2M5AB 2LKMA 3NTNA 1BGYJ 3M91A 2DW3A 2WSCH 3RBZA 3PP5A 3CMAP 1NAFA 3TSIA 2OGUA 1L4AB 1WMKA 3SWFA 2YIUC 3QH9A 2KXPB 3BRVB 3AE2C 2OYIC 3AE6C 1EZVG 2YNYA 3BCCG 1G2CA 3CCEP 1FDIA 3IF4A 3MGNA 1ZMEC 2CK3H 1NHLA 5DJUB 1NVOA 2BCCJ 5CMZA 1IFPA 1QL1A 2A45G 5EFWB 3HD7A 2Q7CA 1LT9C 3CWBD 5KLIB 1HGVA 4I7ZB 3V2PA 1USDA 1H88A 2E5YA 2IFNA 2Z5IA 3L70G 1OW8A 3H1IG 2WSFJ 1N73C 4HB1A 1NU1J 4EIJA 1LTJB 1NTMK 2PGDA 4L74A 4YXWH 1Q81Q 3Q5RA 1K05A 3RGUA 4DCKA 1USEA 3TGUD 1LTSC 1EXJA 3HE5B 3Q5PA 2JEEA 3CXHE 2W8ZA 5KKZB 1VQMP 1VQLP 3RL0B 4JYBA 4C7NA 1LWUA 2QJYC 3AECC 2WSCJ 2WT7A 3CCQP 2QM8A 1IO4A 3FXEA 1BDCA 1S3JA 3L71D 2YIUB 1U7MA 2P1JA 2WQYC 4R4LA 2OYIB 3UIAA 3JCUE 1LNQA 1NTKE 1ZR4A 3CCMP 4IL6X 1T2KC 1SQQJ 4IL6H 2P10A 5AVYB 2ZT9C 1VQ4P 1KYOI 1UIXA 3MP7B 1FS0E 2IYOA 1JEKA 1M57D 1OVUA 4D6TG 4U3FJ 1S4XA 3IAOA 5TJHA 1FZAA 2ZFCA 1NTZG 1RE4C 3A0BH 5KJ7D 2JR8A 1CSBA 1BGYD 4IL6E 2K3RA 3Q2YA 3SSUA 5AW1B 1GTWA 5CBNA 2KUBA 1SP4A 2IZ1A 1NO4A 3MZWB 4BXLA 3H1KE 3A0BE 3M9QA 3SFEC 2BCCD 3H1JD 1URQD 1SQXD 3RBXA 3H25A 2IBZE 3KHUA 2Q3EA 1IK7A 1KQSO 2A06G 2PP6A 1IK9A 2OARA 1L0NE 1MFZA 4PV1B 2QJYB 3RK2C 1JUNA 2HODA 3RL0g 2GA1A 1SQBE 3M9HA 2B87B 4BRYA 1IFIA 1OFCX 5B5EH 1J1DC 2WVRA 3FWLA 4HKZH 3NMDA 2CPSA 2E74C 2V7QH 1GZLA 4WVZA 5AW0B 1JMMA 1ZLLA 3AEAC 3CPWO 1NU1D 3QWOC 1N7LA 1ZR2A 1DIPA 4KHXA 2A45I 3CL3D 2E76C 4HH2A 2M0BA 3B71A 3Q5SA 2C0XA 3L73G 3SWYA 1UIIA 2RH0A 5B5EE 1KYOD 2ZT9B 1KILA 2H8PD 2I1KA 1CI6B 1H0TB 2C9NY 4XFJA 4QMAA 3H1HE 2LR2A 2H89C 3AE5C 2Z5HA 4WY4C 3BVHA 1N7SD 1FC2C 1G1JA 3C9IA 1IC2A 3N7NA 5BVZA 3VN0A 2PFXA 1OVRA 1VQ7P 3VMXA 2ZVNB 1G2CB 3OW2O 3L72J 1PGPA 3CWBE 1SQVG 1H8AA 4PV1D 1S9KD 1SQQD 5GTIH 1NTKK 5H2FH 2ZXEB 2N9BA 1LTTC 1DEEG 2W6AA 4U3FD 3V4QA 3TF5A 1EZVD 3BCCD 2GUVA 2V7QJ 1KB9I 3KXDA 1J1DB 3TGUE 2ZYDA 1FZEA 1HJBA 2MJZA 4OGQC 2KSJA 1NTMG 1RHZB 1J1EC 3GW6A 1JO5A 1N2DC 1ZRTD 5AVQB 3L75G 2E76B 3Q1MA 4ASWA 2OYIA 4KJMA 3E7KA 2AEMA 1AVOA 2W6BA 4GDOA 4C7NB 4JBZA 1LWUB 2WT7B 3AE3C 3L71E 2QM7A 2BEZF 2QVAA 1LT9A 1GU4A 3D71A 4JQ0D 1IFDA 1KTMA 1L0NK 3CCVP 4KT0J 4H0LD 4IFMA 1VF5D 1SQBK 4YPCA 1RF0C 2C0WA 3G71P 3PHLA 1N73A 4Z1MH 3CCJP 1JY2P 4ZKPA 1JOCA 3HD7D 4NPDA 1PFIA 5AVZB 2L5GB 3KZIH 2NPSD 1QEXA 1Q86Q 1JY2O 3GF3A 1KILC 1DD4A 4K35A 2POHA 1H89A 1FJKA 1BGYE 3SFDC 1T8ZA 1PL5A 3N4XA 1GW3A 3H6PA 2N9YB 3LIDA 1KB9D 3I55P 1BSNA 2VRSA 1BDDA 4H44C 3KZIE 3PTZA 1XTCC 4OGQB 1NYHA 2AEFA 2R5DA 3L71J 1J1EB 1FOSF 2ZYAA 1BE3G 2WSFH 1WT6A 5KTBA 4U7JA 4H13C 2BCCE 3H1JE 1L2PA 1SQXE 3BATA 3O6QA 4A7PA 2E75C 2M3EA 1S5LX 1S2EA 2E5TA 3L74G 5TISH 1Q90D 3L72D 2D2CB 2JDIH 5AW9B 1LTBC 3BASA 3MD0A 1L0LG 1R5SA 1PP9J 1M8OB 5AVTB 3AE7C 2HODB 2XZRA 3WUVA 4C7RA 1NU1E 3AEFC 4BRYB 4W80A 1PIXA 2AXTH 3TK1A 3GG2A 1E5WA 3CC2P 5AW7B 3PJSK 5TISE 1PGOA 1FDMA 1RE4A 2KLVA 2QSIA 1KYOE 1R8EA 1AV1A 1K04A 1RY3A 2UWJE 1SLQA 3HUSA 3A5TA 2A06D 3RK3C 1EDKA 3TDKA 1X22A 3V6IA 3OA7A 2Q1KA 1U7JA 5AVUB 2YO3A 1KILB 2FYUG 3KPEA 1PPJD 1Y9BA 2O1JA 2Y9YA 1Z56A 5AW6B 3H1JJ 1CZQA 1SQXJ 3WU2H 3VTPC 2OYHC 3V2NA 3EFGA 3MTUE 4PJ0H 3C8VA 1FZCC 1SFCC 3CC7P 1BCCG 4RJTA 2KK7A 2XNDH 2K88A 1VQ9P 4H44B 3L73D 3GLMA 4BWNA 3G6EP 1W2EA 2RN0A 2Y0EA 1K8AQ 1LP1B 2SPZA 2KSEA 2R3CA 4PD4H 3WU2E 2R5BA 1S9KE 1JNMA 4W7ZA 1HWTC 2D2CD 4H13B 4PJ0E 1SQQE 1ZP0C 2A45H 1GU5A 2E75B 4EDFA 3AE4C 5CCHC 1HJ0A 2WPVB 4GIFA 1SVFA 3L4FA 1DEBA 4GODA 4U3FE 3BCCE 3OAKA 2ZXXA 1NTKG 1T6AA 3NFQA 4M3LA 1R5LA 1GL2A 1ZN5A 5AW5B 1OX3A 1P84I 1ZRTE 1L4AD 2K9YA 1KV4A 2QG4A 5CCGC 4OVNF 1SQVD 4WY4A 5APQA 2OTKE 1EDIA 3C1LA 1OW7A 1NH4A 3M9BA 5APTA 5KLVG 3AE1C 3G4SP 4UB8H 5CBOA 3ZDMA 3W67A 2FKWB 1M56D 1MV8A 3RK3B 2YMYA 4GOEA 1VQKP 1SQPG 1SQXK 1YTZT 3ABVC 2HG5D 2OYHB 3AEBC 1J2JB 5E79H 3H1KG 4C46A 2C9LY 1LT9B 1AA0A 1PP9D 2I8DA 2FFDA 3BCCJ 1EQ7A 2IBZG 1KB9H 1L0NG 1LTGC 2FYNC 2W83C 1N73B 1NU1K 5CHXA 2KS1A 3LIEA 2J5UA 1SQBG 1M7LA 1IFJA 1DH3A 5DJTB 3HUSC 5E79E 2WSEH 2OTLP 3CLQA 3VP9A 1Q2NA 2FYZA 3LW5J 3M0AA 4N3YB 2ITAA 5AVRB 1AQ5A 3L70J 3RL0D 3H1IJ 2N1TC 1MFTA 1KB9E 1JY3P 2H88C 3CI9A 2P2UA 1EDJA 1YI2P 3L37A 1FZFA 2B88A 1P84D 5AVWB 1JY3O 4I1LA 2GM4A 4RESB 1GK4A 3AEEC 3H1HG 3BRTB 1KQFB 1PGJA 1EZVI 3V4WA 1PV3A 4ASVA 1YITP 2ZVOB 4PD4I 1OXZA 3W68A 3L72E 2NPSC 3EWKA 2G3AA 1RF0A 2YKOA 3O6QB 1JCCA 1OZHA 2BEQD 2O01N 3A7OA 1SQQK 2KOGA 5APVA 5CJ0A 2Y0DA 3CWBG 3O8ZA 4JYCA 3U1AA 1GL2C 4GT1A 1BE3D 2P7JA 5APXA 1HVVA 1PZQA 1QL2A 2J58A 3EQ2A 1NOHA 2HLOA 1HUCA 1DX7A 1W5CE 2A06E 1NAYA 3L74D 2WSEJ 1OW6A 4IOIH 1KFNA 1SS1A 3HUSB 3R2PA 1L0LD 1PPJE 3TGUG 3P8MC 1GMJA 3P7KA 3CCRP 1LP1A 2KB7P 1AJYA 2NZ2A 5APWA 1NTZJ 1JM0A 1U57A 5AVVB 1M1JC 2IDBA 2PRRA 3IFMA 1TU3F 1KQGB 3B5NC 3HTKA 3L73E 2FFDC 5C39A 3KQGA 3RK2B 3WMM0 1JB0J 5KJ7A 5CJ4A 1JTHA 1PGQA 3GF7A 2M8RA 3MIWA 4PD4D 4I6MC 4DT0A 2E74B 2FYUD 2KZJA 2IYPA 5GTIE 5H2FE 1T2KD 2ZT9D 3I56P 1JMBA 1BCCD 2WPSA 2W27A 2YXQB 1URQA 3L70D 3H1ID 3GHGA 1SQVE 1GL2B 3AEGC 1X0TA 2XNXA 5L8RJ 2OYHA 2WITA 3H1LG 2XU6A 3TYYA 1IFNA 3CD6P 1FZCA 1SFCA 3L73J 4N6JA 4WY4B 1BGYG 3JC22 3A0HH 4W7YA 2G8YA 3M0DC 1DD3A 1HGZA 3PH0A
chains in the Genus database with same CATH topology
4I7ZB 3AE9C 2QJPC 3AE8C 2P10A 1DIPA 2ZT9C 1OW7A 1KILE 1UIXA 4OGQC 2E76C 3AE1C 3SFDC 1PL5A 3B71A 2O01J 3AEEC 1KQFB 3Q5SA 2D2CC 1Y9BA 4YTPC 3RK3E 1OW8A 1RQUA 1HF9A 2WSFJ 1FDOA 3T97B 3IAOA 1JB0J 1PV3A 4H44C 2ZT9B 1ZOYC 3G9RA 4OGQB 3AEDC 2E76B 3C8VA 2MKVA 1NYHA 3EWKA 4TT3H 2G3AA 3Q1MA 4H0LC 1KORA 3Q5RA 1YQ4C 1K05A 3GF7A 1VF5C 4XFJA 3ABVC 1OMIA 5KKZC 2BEQD 2H89C 1S1CX 3AEBC 2E74D 2E74B 4H44B 4PV1C 1MKMA 1EXJA 4U7JA 2FXPA 3Q2YA 4H13C 3GLMA 3D70A 3AE5C 2JP3A 4GDOA 3Q5PA 4H0LB 2QJKC 1VF5B 3O6QA 2E75C 1S5LX 2ZT9D 2OQQA 4OGQD 1RQVA 2E76D 3S9OA 4R4MA 3AE3C 1Q90D 4RKUJ 2D2CD 4H13B 2D2CB 2FYNC 2BEZF 1ZP0C 2YMKA 3D71A 5KLIC 2E75B 3D6YA 3AE4C 4H44D 2J5UA 1HJ0A 2WPVB 2QJYC 3AECC 2WSCJ 1KTMA 3AE7C 1WMKA 4KT0J 3SFEC 2YIUC 3IN6A 4H0LD 1VF5D 3AEGC 3FGAD 3H25A 3AEFC 2QIWA 5L8RJ 3AE2C 4Z1MH 1IK7A 1NGMB 2WSEJ 1OW6A 1PIXA 3AE6C 1EXIA 4PV1D 4PV1B 3LW5J 1VL2A 2JO1A 4H13D 1FDIA 3RL0g 1ZMEC 2WQYC 1GMJA 4R4LA 2E75D 2FBWC 1KMIZ 2H88C 4I7ZC 1ZRTE 1AJYA 2QSIA 2NZ2A 1R8EA 2G8YA 1DD3A 1K04A 2K9YA 2E74C 3D6ZA 3GF3A 1U57A 3AEAC 2IDBA 4Y28J 1DD4A 3GMAA 4IL6X 1TU3F 5M1BA 1YQ3C 3R4YA 4YXDC 1KQGB 2V7QJ 3Q3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2C B;  4I7Z B;  2QJP C;  2FYN C;  5KKZ C;  2O01 J;  5KLI C;  2E75 B;  2E74 B;  4H44 B;  2WPV B;  2QJY C;  2WSC J;  1ZRT E;  2WSF J;  2QSI A;  4KT0 J;  2YIU C;  4H0L B;  2K9Y A;  2QJK C;  1VF5 B;  1JB0 J;  2ZT9 B;  1S5L X;  2QIW A;  4OGQ B;  4Y28 J;  2E76 B;  5L8R J;  3C8V A;  4IL6 X;  2WSE J;  1Q90 D;  4PV1 B;  3LW5 J;  4RKU J;  4H13 B; 
#chains in the Genus database with same CATH topology
 4B86 A;  2QJP C;  1OWA A;  3MUD A;  1Q82 Q;  1M1J B;  1PP9 E;  1FOS E;  2KZI A;  3A0H E;  5APU A;  5CCH A;  2BCC G;  2L91 A;  3RK2 D;  2WMM A;  4UB6 H;  2M3B A;  3V2R A;  2HFE D;  4EOT A;  2FFD B;  4OH8 B;  5KLV D;  2Q6Q A;  2JWD A;  3HE4 A;  2KYV A;  2E74 D;  2IPP A;  1N7S A;  1HTL C;  1MKM A;  1P84 H;  4L73 A;  1SQV J;  2E42 A;  2KS1 B;  1FZB A;  2E76 D;  1NU1 G;  2WSS H;  1SQP D;  5CCG A;  3M06 A;  2KNC A;  4RKU J;  4UB6 E;  3NXS A;  5KLI C;  1JY2 N;  5GTH H;  1RF1 C;  5KAF H;  3S1K A;  4D6T D;  1AQT A;  4WWI A;  1P84 E;  1FJP A;  1IJD B;  1EXI A;  3VMY A;  4Y99 C;  1NTZ D;  1S5L H;  5AVS B;  2JO1 A;  1LTJ C;  4GKG A;  1NTM J;  1HBW A;  4WY4 D;  1A02 F;  3L75 J;  5KJ7 C;  1BSH A;  1VQ6 P;  3E1I A;  5KAF E;  4YXD C;  3Q3D A;  2Q9I A;  2JWA A;  2WPR A;  2JJL A;  1KQL A;  1FU1 A;  1S5L E;  2WZ7 A;  1FDO A;  4K3A A;  4IFD K;  1GD2 E;  1OVV A;  1KOR A;  1BE3 E;  1N8R Q;  1URQ C;  3T97 A;  1AVY A;  2KI7 B;  2OTJ P;  1NJI Q;  2AXT E;  3H1H D;  1SQQ G;  3GHG C;  3ITK A;  1NWQ A;  2N1T A;  1X79 B;  2QJK C;  2XKM A;  2GUS A;  3H32 A;  3L74 E;  3V5B A;  4OGQ D;  4U3F G;  3P8C D;  3U59 A;  1L0L E;  2QE7 H;  2YMK A;  1SQV K;  3S4R A;  3II6 A;  1M1K Q;  3IN6 A;  2P67 A;  1K73 Q;  2IFM A;  3FGA D;  1AFO A;  1FZG A;  2P58 A;  4WB4 A;  3L35 A;  1VQ5 P;  1Y47 A;  1VL2 A;  1RF1 B;  3MUD C;  2NPS A;  3WUU A;  2B89 A;  3CME P;  2FBW C;  1LJ2 A;  3CXH H;  4LLH A;  3HTK B;  1M90 Q;  4EYY Q;  4Y99 B;  3A3Y B;  3A2A A;  3CCS P;  2YKP A;  1EZV E;  3B4S A;  3LW5 H;  5M1B A;  2WWW A;  1BE3 J;  1RE3 C;  4PD4 E;  1N7S C;  2FYU E;  1JTH B;  1KD1 Q;  2KIK A;  4DJG A;  2O3J A;  1ZW0 A;  3L74 J;  3CX5 I;  3USS A;  3TNU A;  1BCC E;  1QVF O;  5K5G B;  4AQR D;  4LGD E;  1L0L J;  2QA4 P;  1OMI A;  3L70 E;  1OIP A;  3H1I E;  4PV1 C;  1KIL D;  3JCU H;  3JSV C;  1X8Y A;  4HYT B;  1XTG B;  1URQ B;  2KP8 A;  3L36 A;  4LC1 A;  3GHG B;  4R4M A;  2RKL A;  1M1J A;  4JF7 A;  3OJA B;  2QJK B;  1KC8 Q;  3B5N A;  4H44 D;  4DOJ A;  1NTM D;  5AW8 B;  3SWK A;  1FZC B;  1SFC B;  4UB8 E;  3L75 D;  2QIW A;  1NGM B;  3FXD A;  1QVG O;  5AW3 B;  4H13 D;  3KDP B;  2FYU J;  4N78 D;  2E75 D;  3IR9 A;  2IX7 C;  1KN7 A;  3FX0 A;  1KFM A;  3EFF K;  4Y28 J;  1BCC J;  3H1L D;  3GMA A;  2E43 A;  2K9J A;  3L72 G;  5KLV E;  2O01 H;  1MZ9 A;  5APS A;  1NKZ B;  2HPC A;  1RQU A;  1HF9 A;  3VMZ A;  3HE4 B;  1JCD A;  3VMA A;  1SQP E;  1N7S B;  4DZO A;  3AED C;  4O9B A;  1YHQ P;  4XA4 A;  4H0L C;  4ZKU A;  1VF5 C;  1LTI C;  3CX5 D;  2KNC B;  4D6T E;  2J59 M;  2W6J H;  3HD7 C;  1L0L K;  3RK3 D;  1YJ9 P;  1EDL A;  3E1R A;  5BU5 A;  1NTK J;  1ZV8 A;  3VYI A;  1NTZ E;  2OQQ A;  3M0D A;  3VOP A;  1LT1 A;  2YKQ A;  3D6Y A;  3CXH I;  1PPJ G;  2M5A A;  1SFC D;  5AW2 B;  1QX8 A;  2H7H A;  4CPG A;  1JY3 N;  1VQO P;  1ZXG A;  5KLV J;  2JKV A;  1L4A A;  2V4H A;  5APY A;  1FBM A;  1KMI Z;  5AW4 B;  3U1C A;  3D6Z A;  2FYU K;  1SQP J;  2FYN B;  2QRX A;  1YQ3 C;  3R4Y A;  5CCH D;  1QGK B;  3AE9 C;  3AE8 C;  2Y9Z A;  1LWU C;  3H1K J;  2O01 J;  2WPQ A;  3F5H A;  4D6T J;  3T97 B;  1D7M A;  2Y0C A;  1RF1 A;  1VDF A;  1GK6 A;  2FXM A;  3P8C E;  2MKV A;  3KYQ A;  1L0N J;  2N1T B;  3B8E B;  2BAS A;  3H32 B;  1SQB J;  2AEJ A;  4AYC A;  1S1C X;  1LTJ A;  3G3Z A;  5CCG D;  2FXP A;  2HYN A;  2W90 A;  3WUT A;  2XV5 A;  3PLN A;  4RO0 A;  2NRG A;  4H0L B;  4L75 A;  1VF5 B;  4XE5 B;  2WTY A;  2B9B A;  1WRG A;  3CCU P;  3CCL P;  3HE5 A;  3L71 G;  4NPE A;  3HD7 B;  2ZAE B;  1FE6 A;  3V2Q A;  2NPS B;  2YXR B;  2IZ0 A;  3CXH D;  1EC5 A;  2ZJS E;  1Q7Y Q;  3H1H J;  2OYO A;  2IBZ I;  1VQ8 P;  1YIJ P;  3P32 A;  5KLV K;  2FY8 A;  1PP9 G;  2FXO A;  3I5C A;  4JPZ B;  3TNU B;  1KIL E;  1W2B O;  1SQP K;  5BU8 B;  2D2C C;  4YTP C;  4NPF X;  2ZYG A;  2Z4E A;  4I2L C;  1FAV A;  3CWB J;  1Y8A A;  2AXC A;  1ZOY C;  1G1I A;  2O1K A;  1N86 A;  2N1T D;  4TT3 H;  1NTK D;  1YQ4 C;  1NKN A;  4ZMD A;  3HRN A;  1LTA C;  1NTM E;  1VPC A;  2RMZ A;  1NTZ K;  4IFF A;  3L75 E;  1CW5 A;  3B5N B;  3H1J G;  1SQX G;  2LXC B;  4EI2 A;  1RQV A;  3S9O A;  1L4A C;  1K9M Q;  1E79 H;  1YJW P;  3CC4 P;  2H43 A;  4N78 E;  3TGU J;  1VQN P;  2XDJ A;  1RE3 A;  1RH5 B;  1VQP P;  4WBA A;  1KZU B;  5AVX B;  2R3S A;  2K1A A;  3H1L E;  2R44 A;  3CX5 H;  2LXB A;  2QEX P;  3MHV A;  2K37 A;  3FWN A;  4MN4 C;  2K9J B;  2PAJ A;  3H1K D;  4TLF A;  1T3U A;  1X9V A;  4I7Z C;  2R32 A;  1IZN B;  1YTZ I;  5KAI H;  5B66 H;  1GL2 D;  2HPC B;  1YBK A;  1YYC A;  2HR3 A;  2IBZ D;  2B87 A;  4L76 A;  3CX5 E;  1T3J A;  1L0N D;  1QLE D;  1LGH B;  4OWF A;  1YJN P;  3VP8 A;  1SQB D;  4ZNC A;  4AUW A;  3RK3 E;  3F89 A;  2Q5U A;  1IFM A;  2YO2 A;  4HJG H;  1GW4 A;  2Q3I A;  3PRJ A;  5GTH E;  1GDT A;  3G9R A;  3K5B A;  4GOF A;  2KLU A;  5KAI E;  5B66 E;  1MUU A;  5KKZ C;  1KYO H;  1HH0 A;  2CPB A;  3D70 A;  2JP3 A;  3RL0 C;  1CI6 A;  1H0T A;  3H1L J;  3B5N D;  2QJP B;  1S72 P;  1A02 J;  2I1J A;  2M5A B;  2LKM A;  3NTN A;  1BGY J;  3M91 A;  2DW3 A;  2WSC H;  3RBZ A;  3PP5 A;  3CMA P;  1NAF A;  3TSI A;  2OGU A;  1L4A B;  1WMK A;  3SWF A;  2YIU C;  3QH9 A;  2KXP B;  3BRV B;  3AE2 C;  2OYI C;  3AE6 C;  1EZV G;  2YNY A;  3BCC G;  1G2C A;  3CCE P;  1FDI A;  3IF4 A;  3MGN A;  1ZME C;  2CK3 H;  1NHL A;  5DJU B;  1NVO A;  2BCC J;  5CMZ A;  1IFP A;  1QL1 A;  2A45 G;  5EFW B;  3HD7 A;  2Q7C A;  1LT9 C;  3CWB D;  5KLI B;  1HGV A;  4I7Z B;  3V2P A;  1USD A;  1H88 A;  2E5Y A;  2IFN A;  2Z5I A;  3L70 G;  1OW8 A;  3H1I G;  2WSF J;  1N73 C;  4HB1 A;  1NU1 J;  4EIJ A;  1LTJ B;  1NTM K;  2PGD A;  4L74 A;  4YXW H;  1Q81 Q;  3Q5R A;  1K05 A;  3RGU A;  4DCK A;  1USE A;  3TGU D;  1LTS C;  1EXJ A;  3HE5 B;  3Q5P A;  2JEE A;  3CXH E;  2W8Z A;  5KKZ B;  1VQM P;  1VQL P;  3RL0 B;  4JYB A;  4C7N A;  1LWU A;  2QJY C;  3AEC C;  2WSC J;  2WT7 A;  3CCQ P;  2QM8 A;  1IO4 A;  3FXE A;  1BDC A;  1S3J A;  3L71 D;  2YIU B;  1U7M A;  2P1J A;  2WQY C;  4R4L A;  2OYI B;  3UIA A;  3JCU E;  1LNQ A;  1NTK E;  1ZR4 A;  3CCM P;  4IL6 X;  1T2K C;  1SQQ J;  4IL6 H;  2P10 A;  5AVY B;  2ZT9 C;  1VQ4 P;  1KYO I;  1UIX A;  3MP7 B;  1FS0 E;  2IYO A;  1JEK A;  1M57 D;  1OVU A;  4D6T G;  4U3F J;  1S4X A;  3IAO A;  5TJH A;  1FZA A;  2ZFC A;  1NTZ G;  1RE4 C;  3A0B H;  5KJ7 D;  2JR8 A;  1CSB A;  1BGY D;  4IL6 E;  2K3R A;  3Q2Y A;  3SSU A;  5AW1 B;  1GTW A;  5CBN A;  2KUB A;  1SP4 A;  2IZ1 A;  1NO4 A;  3MZW B;  4BXL A;  3H1K E;  3A0B E;  3M9Q A;  3SFE C;  2BCC D;  3H1J D;  1URQ D;  1SQX D;  3RBX A;  3H25 A;  2IBZ E;  3KHU A;  2Q3E A;  1IK7 A;  1KQS O;  2A06 G;  2PP6 A;  1IK9 A;  2OAR A;  1L0N E;  1MFZ A;  4PV1 B;  2QJY B;  3RK2 C;  1JUN A;  2HOD A;  3RL0 g;  2GA1 A;  1SQB E;  3M9H A;  2B87 B;  4BRY A;  1IFI A;  1OFC X;  5B5E H;  1J1D C;  2WVR A;  3FWL A;  4HKZ H;  3NMD A;  2CPS A;  2E74 C;  2V7Q H;  1GZL A;  4WVZ A;  5AW0 B;  1JMM A;  1ZLL A;  3AEA C;  3CPW O;  1NU1 D;  3QWO C;  1N7L A;  1ZR2 A;  1DIP A;  4KHX A;  2A45 I;  3CL3 D;  2E76 C;  4HH2 A;  2M0B A;  3B71 A;  3Q5S A;  2C0X A;  3L73 G;  3SWY A;  1UII A;  2RH0 A;  5B5E E;  1KYO D;  2ZT9 B;  1KIL A;  2H8P D;  2I1K A;  1CI6 B;  1H0T B;  2C9N Y;  4XFJ A;  4QMA A;  3H1H E;  2LR2 A;  2H89 C;  3AE5 C;  2Z5H A;  4WY4 C;  3BVH A;  1N7S D;  1FC2 C;  1G1J A;  3C9I A;  1IC2 A;  3N7N A;  5BVZ A;  3VN0 A;  2PFX A;  1OVR A;  1VQ7 P;  3VMX A;  2ZVN B;  1G2C B;  3OW2 O;  3L72 J;  1PGP A;  3CWB E;  1SQV G;  1H8A A;  4PV1 D;  1S9K D;  1SQQ D;  5GTI H;  1NTK K;  5H2F H;  2ZXE B;  2N9B A;  1LTT C;  1DEE G;  2W6A A;  4U3F D;  3V4Q A;  3TF5 A;  1EZV D;  3BCC D;  2GUV A;  2V7Q J;  1KB9 I;  3KXD A;  1J1D B;  3TGU E;  2ZYD A;  1FZE A;  1HJB A;  2MJZ A;  4OGQ C;  2KSJ A;  1NTM G;  1RHZ B;  1J1E C;  3GW6 A;  1JO5 A;  1N2D C;  1ZRT D;  5AVQ B;  3L75 G;  2E76 B;  3Q1M A;  4ASW A;  2OYI A;  4KJM A;  3E7K A;  2AEM A;  1AVO A;  2W6B A;  4GDO A;  4C7N B;  4JBZ A;  1LWU B;  2WT7 B;  3AE3 C;  3L71 E;  2QM7 A;  2BEZ F;  2QVA A;  1LT9 A;  1GU4 A;  3D71 A;  4JQ0 D;  1IFD A;  1KTM A;  1L0N K;  3CCV P;  4KT0 J;  4H0L D;  4IFM A;  1VF5 D;  1SQB K;  4YPC A;  1RF0 C;  2C0W A;  3G71 P;  3PHL A;  1N73 A;  4Z1M H;  3CCJ P;  1JY2 P;  4ZKP A;  1JOC A;  3HD7 D;  4NPD A;  1PFI A;  5AVZ B;  2L5G B;  3KZI H;  2NPS D;  1QEX A;  1Q86 Q;  1JY2 O;  3GF3 A;  1KIL C;  1DD4 A;  4K35 A;  2POH A;  1H89 A;  1FJK A;  1BGY E;  3SFD C;  1T8Z A;  1PL5 A;  3N4X A;  1GW3 A;  3H6P A;  2N9Y B;  3LID A;  1KB9 D;  3I55 P;  1BSN A;  2VRS A;  1BDD A;  4H44 C;  3KZI E;  3PTZ A;  1XTC C;  4OGQ B;  1NYH A;  2AEF A;  2R5D A;  3L71 J;  1J1E B;  1FOS F;  2ZYA A;  1BE3 G;  2WSF H;  1WT6 A;  5KTB A;  4U7J A;  4H13 C;  2BCC E;  3H1J E;  1L2P A;  1SQX E;  3BAT A;  3O6Q A;  4A7P A;  2E75 C;  2M3E A;  1S5L X;  1S2E A;  2E5T A;  3L74 G;  5TIS H;  1Q90 D;  3L72 D;  2D2C B;  2JDI H;  5AW9 B;  1LTB C;  3BAS A;  3MD0 A;  1L0L G;  1R5S A;  1PP9 J;  1M8O B;  5AVT B;  3AE7 C;  2HOD B;  2XZR A;  3WUV A;  4C7R A;  1NU1 E;  3AEF C;  4BRY B;  4W80 A;  1PIX A;  2AXT H;  3TK1 A;  3GG2 A;  1E5W A;  3CC2 P;  5AW7 B;  3PJS K;  5TIS E;  1PGO A;  1FDM A;  1RE4 A;  2KLV A;  2QSI A;  1KYO E;  1R8E A;  1AV1 A;  1K04 A;  1RY3 A;  2UWJ E;  1SLQ A;  3HUS A;  3A5T A;  2A06 D;  3RK3 C;  1EDK A;  3TDK A;  1X22 A;  3V6I A;  3OA7 A;  2Q1K A;  1U7J A;  5AVU B;  2YO3 A;  1KIL B;  2FYU G;  3KPE A;  1PPJ D;  1Y9B A;  2O1J A;  2Y9Y A;  1Z56 A;  5AW6 B;  3H1J J;  1CZQ A;  1SQX J;  3WU2 H;  3VTP C;  2OYH C;  3V2N A;  3EFG A;  3MTU E;  4PJ0 H;  3C8V A;  1FZC C;  1SFC C;  3CC7 P;  1BCC G;  4RJT A;  2KK7 A;  2XND H;  2K88 A;  1VQ9 P;  4H44 B;  3L73 D;  3GLM A;  4BWN A;  3G6E P;  1W2E A;  2RN0 A;  2Y0E A;  1K8A Q;  1LP1 B;  2SPZ A;  2KSE A;  2R3C A;  4PD4 H;  3WU2 E;  2R5B A;  1S9K E;  1JNM A;  4W7Z A;  1HWT C;  2D2C D;  4H13 B;  4PJ0 E;  1SQQ E;  1ZP0 C;  2A45 H;  1GU5 A;  2E75 B;  4EDF A;  3AE4 C;  5CCH C;  1HJ0 A;  2WPV B;  4GIF A;  1SVF A;  3L4F A;  1DEB A;  4GOD A;  4U3F E;  3BCC E;  3OAK A;  2ZXX A;  1NTK G;  1T6A A;  3NFQ A;  4M3L A;  1R5L A;  1GL2 A;  1ZN5 A;  5AW5 B;  1OX3 A;  1P84 I;  1ZRT E;  1L4A D;  2K9Y A;  1KV4 A;  2QG4 A;  5CCG C;  4OVN F;  1SQV D;  4WY4 A;  5APQ A;  2OTK E;  1EDI A;  3C1L A;  1OW7 A;  1NH4 A;  3M9B A;  5APT A;  5KLV G;  3AE1 C;  3G4S P;  4UB8 H;  5CBO A;  3ZDM A;  3W67 A;  2FKW B;  1M56 D;  1MV8 A;  3RK3 B;  2YMY A;  4GOE A;  1VQK P;  1SQP G;  1SQX K;  1YTZ T;  3ABV C;  2HG5 D;  2OYH B;  3AEB C;  1J2J B;  5E79 H;  3H1K G;  4C46 A;  2C9L Y;  1LT9 B;  1AA0 A;  1PP9 D;  2I8D A;  2FFD A;  3BCC J;  1EQ7 A;  2IBZ G;  1KB9 H;  1L0N G;  1LTG C;  2FYN C;  2W83 C;  1N73 B;  1NU1 K;  5CHX A;  2KS1 A;  3LIE A;  2J5U A;  1SQB G;  1M7L A;  1IFJ A;  1DH3 A;  5DJT B;  3HUS C;  5E79 E;  2WSE H;  2OTL P;  3CLQ A;  3VP9 A;  1Q2N A;  2FYZ A;  3LW5 J;  3M0A A;  4N3Y B;  2ITA A;  5AVR B;  1AQ5 A;  3L70 J;  3RL0 D;  3H1I J;  2N1T C;  1MFT A;  1KB9 E;  1JY3 P;  2H88 C;  3CI9 A;  2P2U A;  1EDJ A;  1YI2 P;  3L37 A;  1FZF A;  2B88 A;  1P84 D;  5AVW B;  1JY3 O;  4I1L A;  2GM4 A;  4RES B;  1GK4 A;  3AEE C;  3H1H G;  3BRT B;  1KQF B;  1PGJ A;  1EZV I;  3V4W A;  1PV3 A;  4ASV A;  1YIT P;  2ZVO B;  4PD4 I;  1OXZ A;  3W68 A;  3L72 E;  2NPS C;  3EWK A;  2G3A A;  1RF0 A;  2YKO A;  3O6Q B;  1JCC A;  1OZH A;  2BEQ D;  2O01 N;  3A7O A;  1SQQ K;  2KOG A;  5APV A;  5CJ0 A;  2Y0D A;  3CWB G;  3O8Z A;  4JYC A;  3U1A A;  1GL2 C;  4GT1 A;  1BE3 D;  2P7J A;  5APX A;  1HVV A;  1PZQ A;  1QL2 A;  2J58 A;  3EQ2 A;  1NOH A;  2HLO A;  1HUC A;  1DX7 A;  1W5C E;  2A06 E;  1NAY A;  3L74 D;  2WSE J;  1OW6 A;  4IOI H;  1KFN A;  1SS1 A;  3HUS B;  3R2P A;  1L0L D;  1PPJ E;  3TGU G;  3P8M C;  1GMJ A;  3P7K A;  3CCR P;  1LP1 A;  2KB7 P;  1AJY A;  2NZ2 A;  5APW A;  1NTZ J;  1JM0 A;  1U57 A;  5AVV B;  1M1J C;  2IDB A;  2PRR A;  3IFM A;  1TU3 F;  1KQG B;  3B5N C;  3HTK A;  3L73 E;  2FFD C;  5C39 A;  3KQG A;  3RK2 B;  3WMM 0;  1JB0 J;  5KJ7 A;  5CJ4 A;  1JTH A;  1PGQ A;  3GF7 A;  2M8R A;  3MIW A;  4PD4 D;  4I6M C;  4DT0 A;  2E74 B;  2FYU D;  2KZJ A;  2IYP A;  5GTI E;  5H2F E;  1T2K D;  2ZT9 D;  3I56 P;  1JMB A;  1BCC D;  2WPS A;  2W27 A;  2YXQ B;  1URQ A;  3L70 D;  3H1I D;  3GHG A;  1SQV E;  1GL2 B;  3AEG C;  1X0T A;  2XNX A;  5L8R J;  2OYH A;  2WIT A;  3H1L G;  2XU6 A;  3TYY A;  1IFN A;  3CD6 P;  1FZC A;  1SFC A;  3L73 J;  4N6J A;  4WY4 B;  1BGY G;  3JC2 2;  3A0H H;  4W7Y A;  2G8Y A;  3M0D C;  1DD3 A;  1HGZ A;  3PH0 A; 
#chains in the Genus database with same CATH homology
 4I7Z B;  3AE9 C;  2QJP C;  3AE8 C;  2P10 A;  1DIP A;  2ZT9 C;  1OW7 A;  1KIL E;  1UIX A;  4OGQ C;  2E76 C;  3AE1 C;  3SFD C;  1PL5 A;  3B71 A;  2O01 J;  3AEE C;  1KQF B;  3Q5S A;  2D2C C;  1Y9B A;  4YTP C;  3RK3 E;  1OW8 A;  1RQU A;  1HF9 A;  2WSF J;  1FDO A;  3T97 B;  3IAO A;  1JB0 J;  1PV3 A;  4H44 C;  2ZT9 B;  1ZOY C;  3G9R A;  4OGQ B;  3AED C;  2E76 B;  3C8V A;  2MKV A;  1NYH A;  3EWK A;  4TT3 H;  2G3A A;  3Q1M A;  4H0L C;  1KOR A;  3Q5R A;  1YQ4 C;  1K05 A;  3GF7 A;  1VF5 C;  4XFJ A;  3ABV C;  1OMI A;  5KKZ C;  2BEQ D;  2H89 C;  1S1C X;  3AEB C;  2E74 D;  2E74 B;  4H44 B;  4PV1 C;  1MKM A;  1EXJ A;  4U7J A;  2FXP A;  3Q2Y A;  4H13 C;  3GLM A;  3D70 A;  3AE5 C;  2JP3 A;  4GDO A;  3Q5P A;  4H0L B;  2QJK C;  1VF5 B;  3O6Q A;  2E75 C;  1S5L X;  2ZT9 D;  2OQQ A;  4OGQ D;  1RQV A;  2E76 D;  3S9O A;  4R4M A;  3AE3 C;  1Q90 D;  4RKU J;  2D2C D;  4H13 B;  2D2C B;  2FYN C;  2BEZ F;  1ZP0 C;  2YMK A;  3D71 A;  5KLI C;  2E75 B;  3D6Y A;  3AE4 C;  4H44 D;  2J5U A;  1HJ0 A;  2WPV B;  2QJY C;  3AEC C;  2WSC J;  1KTM A;  3AE7 C;  1WMK A;  4KT0 J;  3SFE C;  2YIU C;  3IN6 A;  4H0L D;  1VF5 D;  3AEG C;  3FGA D;  3H25 A;  3AEF C;  2QIW A;  5L8R J;  3AE2 C;  4Z1M H;  1IK7 A;  1NGM B;  2WSE J;  1OW6 A;  1PIX A;  3AE6 C;  1EXI A;  4PV1 D;  4PV1 B;  3LW5 J;  1VL2 A;  2JO1 A;  4H13 D;  1FDI A;  3RL0 g;  1ZME C;  2WQY C;  1GMJ A;  4R4L A;  2E75 D;  2FBW C;  1KMI Z;  2H88 C;  4I7Z C;  1ZRT E;  1AJY A;  2QSI A;  2NZ2 A;  1R8E A;  2G8Y A;  1DD3 A;  1K04 A;  2K9Y A;  2E74 C;  3D6Z A;  3GF3 A;  1U57 A;  3AEA C;  2IDB A;  4Y28 J;  1DD4 A;  3GMA A;  4IL6 X;  1TU3 F;  5M1B A;  1YQ3 C;  3R4Y A;  4YXD C;  1KQG B;  2V7Q J;  3Q3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...