3LW5J

Improved model of plant photosystem i
Total Genus 2
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
2
sequence length
42
structure length
42
Chain Sequence
MRDLKTYLSVAPVVSTLWFGALAGLLIEINRFFPDALIFPFF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structure determination and improved model of plant photosystem I
pubmed doi rcsb
molecule tags Photosynthesis
molecule keywords Photosystem I P700 chlorophyll a apoprotein A1
total genus 2
structure length 42
sequence length 42
ec nomenclature
pdb deposition date 2010-02-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01701 PSI_PsaJ Photosystem I reaction centre subunit IX / PsaJ
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.510 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single helix bin 3lw5J00
2D2CB 2FYNC 2WSEJ 2QSIA 4PV1B 2E75B 4KT0J 1ZRTE 4H0LB 2O01J 2K9YA 4H44B 2E74B 4IL6X 5KKZC 2QIWA 2E76B 4H13B 4I7ZB 2YIUC 3C8VA 2QJKC 2WPVB 2ZT9B 1S5LX 1VF5B 4OGQB 2WSCJ 1Q90D 3LW5J 2WSFJ 5L8RJ 2QJYC 5KLIC 4RKUJ 4Y28J 1JB0J 2QJPC
chains in the Genus database with same CATH superfamily
1R5SA 2IDBA 2WQYC 1LGHB 1QL1A 1HJBA 1SQBK 3L73G 1WT6A 3PH0A 4I6MC 3RBXA 1H88A 1SQBE 5KKZB 3BVHA 5EFWB 1KTMA 3GHGB 3OA7A 3QH9A 1NTKJ 1BGYG 1YQ3C 5KJ7A 4H13D 3SSUA 3VOPA 3G4SP 1RE4A 4UB6H 5BU5A 3HD7B 2V4HA 2KS1A 2IFMA 1RF1A 2YKPA 2FYUG 5GTIE 2WPVB 1GDTA 4EIJA 3IN6A 2FYZA 1D7MA 5KJ7D 1VQKP 5CJ4A 2I8DA 1P84E 1R5LA 3HE5A 2V7QJ 1NU1J 2OGUA 2QJYB 2UWJE 2ZAEB 2ZYGA 3AEFC 2A06G 3CX5E 3L70E 3O6QA 2XZRA 4LLHA 5APXA 1NWQA 2L5GB 1JY2O 1RE3A 2FY8A 2J59M 3CCUP 5CCGA 1N73B 2ZXEB 3AEBC 5AVVB 3TNUB 3FGAD 5APSA 1KORA 1MKMA 1OMIA 1L0LG 1NTME 1PP9J 1AA0A 1S1CX 4WY4D 1S9KE 3C9IA 2YXQB 1U7JA 3USSA 2PRRA 3K5BA 4IFMA 2P7JA 3AE6C 4NPDA 5AW4B 1SQXE 3S4RA 2I1JA 4L74A 2KIKA 1SQQG 1FE6A 1NOHA 2E76B 3CLQA 3CC2P 3AEEC 1J1DB 1W5CE 3G6EP 1T8ZA 3P7KA 4XE5B 5KAFE 1NJIQ 2CPBA 3RL0C 1QVFO 1S5LH 2R5DA 1VQ8P 3BCCE 4I7ZC 2BCCE 2OYOA 3V4QA 2WTYA 4AQRD 3NTNA 1RF0C 3VMYA 2IYOA 4C7NA 1NTZG 4DOJA 3A7OA 3HUSC 2IZ1A 1Y9BA 3RL0D 1HTLC 2YO3A 3FX0A 1EDIA 2M5AA 1AFOA 3H1HD 2Q7CA 3MP7B 1RE4C 1KYOD 1RQUA 1NTZK 2ZXXA 1DD4A 3CX5I 3EFFK 3F89A 2HR3A 1Q86Q 1BCCD 1VDFA 1P84D 1CI6A 2WSEJ 3L72G 5AW1B 1YI2P 1CW5A 1IFNA 2H89C 3H1KE 1JY3N 1SQXG 4U7JA 1G2CA 2Z5HA 1GL2A 2ZT9D 4KHXA 1JY2P 2R3SA 2E43A 2FYUK 1K04A 1NU1K 3E1RA 2XNDH 3EWKA 1X9VA 4H44B 3CWBE 1BDDA 2KYVA 4HKZH 4U3FG 2ZYAA 1RE3C 1P84I 2MJZA 1S3JA 3TDKA 3RK2B 2PAJA 1PIXA 3KPEA 3M9QA 3T97A 2LKMA 4AUWA 1JTHB 2ZT9B 5AVUB 5AVXB 5AW3B 5KLVJ 3M0AA 1KD1Q 2BCCG 2OTLP 2Q5UA 2FFDB 4L76A 2CPSA 1GD2E 3CWBD 5APQA 1ZR2A 1JNMA 2Q6QA 4Y28J 1HVVA 3G9RA 2V7QH 5BU8B 1E79H 1M56D 4WY4C 3D6ZA 2C0WA 2JEEA 1DH3A 2BEZF 1LTJB 3H1LJ 1Y8AA 4W7ZA 3RBZA 1VF5C 3FXDA 1EC5A 2HPCA 1XTGB 3PTZA 3RK3D 3BRVB 4D6TG 1X79B 3V2QA 3CXHH 1R8EA 3CX5D 2YKOA 1HUCA 1OX3A 2K9JA 1CSBA 4N78D 3JC22 3TYYA 3TGUE 1ZRTE 3GHGA 3Q2YA 2K37A 1KB9H 1OW8A 3M9BA 4Y99B 2KSJA 3HUSA 1SQBG 3IAOA 3RK3C 3VN0A 1IJDB 5C39A 4EYYQ 3CC7P 1H0TA 1PPJD 1IFMA 1GL2D 3O8ZA 4HJGH 3CCLP 3A0BE 1HGZA 1LP1A 1OXZA 3H1JJ 1URQD 2KS1B 1MZ9A 3CXHI 4RESB 4ZMDA 1FZFA 1DEEG 1YTZT 3M06A 2H7HA 1GL2C 1SQPG 3CWBJ 3L75E 1Q2NA 2WSFJ 4R4LA 2Z5IA 2Q9IA 3L71G 5B66H 1EDKA 1EZVD 2QRXA 1L0NJ 1URQC 5AVSB 2KI7B 1EXJA 3L73J 4M3LA 3H1KJ 1SVFA 1PGOA 3V2RA 3VP8A 4CPGA 2AXTH 1H0TB 3L73D 3A0HH 1EDLA 1J2JB 1L0ND 3MUDA 4DJGA 1H89A 2KK7A 1M1JC 1LTTC 4I1LA 4D6TD 1N73A 2C9LY 1Q81Q 2E42A 1NTMJ 1KFMA 1LTGC 3SWFA 2FYNB 2OARA 2XNXA 1IC2A 5KLVG 3CCJP 1SQQD 1YITP 4Y99C 1L0LK 3L75J 2WPRA 1VPCA 2OTJP 1BCCJ 1DX7A 3BCCJ 4BRYB 4UB8E 3CCQP 3L70J 3H6PA 3C8VA 5KLVD 5AVRB 2DW3A 2JR8A 3L74D 1NU1E 1ZP0C 2IFNA 4TLFA 5AW5B 3IR9A 5B66E 3HRNA 1X22A 4OGQB 4H13C 2RMZA 5GTHH 5KAIE 2E75D 5KAIH 3LW5J 5AW2B 3RK3B 3P8MC 3CXHE 4IFDK 3H32B 3IFMA 1KQGB 2M5AB 3CCRP 1IO4A 2WPSA 1L0LJ 2G8YA 3L74J 1PP9E 2A45G 3M91A 1SQXD 4L73A 2GUSA 1KB9E 5AVQB 1SS1A 1J1EB 3L75D 4B86A 1JCDA 3V6IA 1GL2B 1MUUA 3GG2A 1VQOP 3KQGA 3AE4C 1NTMD 3U59A 4PJ0H 1S72P 3Q3DA 3H1HG 1FOSF 4GOFA 1BSHA 1G2CB 3GLMA 1Y47A 3CD6P 1T3UA 2I1KA 5KKZC 3MD0A 3AE8C 1K05A 3EFGA 3D70A 5APTA 2SPZA 1LTSC 2YIUC 3B5ND 1J1DC 3H1KD 4WBAA 5B5EH 1JOCA 3AE5C 1HF9A 1LWUB 3MUDC 1VL2A 1KFNA 1ZRTD 2D2CD 4W7YA 4EDFA 5CMZA 5KLVE 3H25A 1VQNP 1VQ6P 3RL0g 1PFIA 2HODA 2WMMA 2OQQA 4JF7A 5TISE 1KN7A 2FFDA 2D2CC 2KZIA 1BE3J 2GM4A 2P10A 3WUUA 1SQXJ 3Q1MA 2HPCB 4D6TE 2JO1A 2XDJA 2HYNA 3BCCD 4JYBA 1M90Q 1LTJA 2K9JB 3CL3D 1M1KQ 1SQPE 2FXPA 2WITA 4ZKUA 2AXCA 2JWDA 1AVYA 2LXBA 3L37A 1G1JA 3KZIH 2YNYA 3GMAA 4O9BA 2E5YA 2P67A 1L4AD 1KB9I 2E74B 2QE7H 4IL6X 2WSFH 2E76D 3L4FA 2ZVOB 3CXHD 1GW4A 2IYPA 1YHQP 1L2PA 1S9KD 3SWKA 1X0TA 2WVRA 3TNUA 3W68A 1L4AA 1IK7A 1S5LX 2WSCJ 1LTBC 2E76C 1Q90D 2ZYDA 1Z56A 2B87A 2W83C 5CHXA 3RL0B 4GKGA 3QWOC 1FBMA 3G71P 1HGVA 3D6YA 4LC1A 1NTZD 1NU1G 4W80A 1LT9A 1NTKE 2J5UA 2Q1KA 1L0LD 3L72E 2W8ZA 5DJUB 4ASWA 4L75A 4PD4D 1VQ5P 3PLNA 2IX7C 2ZVNB 1S4XA 3ABVC 1W2BO 2FXOA 3L35A 2C9NY 1NTMK 1YJNP 1FOSE 1HBWA 1KV4A 3II6A 5GTHE 1J1EC 1DD3A 3HTKB 1T2KD 3NFQA 1PP9G 2GUVA 4NPEA 4Z1MH 3HE5B 2OTKE 3BRTB 2Y0CA 3FWNA 4K35A 1BE3E 1JEKA 2KLUA 1EZVI 3AE2C 3ITKA 5CCHA 4WY4B 1OVRA 3WUVA 1XTCC 4U3FE 1JY2N 1M57D 4YTPC 4H0LD 1BE3D 1LTJC 2Q3EA 1YJ9P 1YTZI 2IBZD 1T2KC 2IZ0A 1N86A 2WSCH 1CZQA 1SQQJ 1YJWP 2N9YB 2VRSA 1VQ9P 3VYIA 3L71E 2E74C 1JMBA 1S5LE 2XKMA 4HB1A 3CPWO 1ZV8A 5KAFH 2QJPB 2OYIB 4GOEA 2OYHC 3AECC 3H1LD 1NTZJ 1SQVE 1YBKA 5M1BA 1E5WA 4IL6E 1NTZE 1L4AC 2LXCB 5APWA 2QSIA 1Q82Q 1N8RQ 2KXPB 5AW9B 3L72J 4H0LB 1N7LA 2A45I 5H2FH 4K3AA 3M0DA 1FDIA 2KSEA 1SQPK 3S9OA 3WU2H 3CMEP 2W6AA 1LT9C 1KMIZ 3JCUE 2QG4A 2FYUE 1SP4A 1SFCA 1FJPA 3H1IG 3R4YA 3SFDC 4EI2A 1M1JA 1N73C 4OGQC 3L74G 4NPFX 3NXSA 3VMZA 5L8RJ 2B89A 1FZCB 1RQVA 3D71A 2HODB 3AE1C 4OGQD 1MFZA 3LIDA 2YMYA 2O3JA 2E75C 5AW6B 1VQPP 2QA4P 1YIJP 2ITAA 1NHLA 1ZR4A 4PV1B 3HE4A 2RH0A 3L74E 2PFXA 4KT0J 3CCSP 3H1IE 4H0LC 1GW3A 3VTPC 4XA4A 4D6TJ 1LJ2A 2KZJA 2M8RA 3A2AA 3AEGC 3E1IA 3FWLA 3GW6A 3VMXA 2AXTE 2OYHA 1KILE 3BATA 4RO0A 3W67A 3GF7A 2WT7A 1L4AB 1GK4A 2E74D 2N9BA 2RKLA 3L36A 3HE4B 1BE3G 2KB7P 2NZ2A 4ZKPA 2NRGA 1WRGA 2N1TD 3H1JE 3MHVA 3B5NA 4GDOA 3OW2O 1SFCD 3H1JG 4PD4I 3I55P 1H8AA 1JB0J 4UB8H 3V2NA 2MKVA 1KILB 4KJMA 1SQPJ 1KB9D 3CWBG 3TK1A 1FZGA 1JM0A 2LR2A 5K5GB 4MN4C 3E7KA 1SFCC 2WPQA 1NTKG 1BGYJ 1ZOYC 2YIUB 3B8EB 1K8AQ 3H1KG 1ZW0A 2H88C 2KNCA 1QX8A 3KHUA 1LWUC 1AV1A 3U1AA 1GU4A 1IFPA 1LP1B 4JYCA 3B71A 2IBZI 2FFDC 1FJKA 2A06D 2AEFA 2R3CA 2NPSD 1PGPA 1BSNA 1L0LE 1NTMG 1OFCX 1SLQA 1ZLLA 3L70D 4H44D 5DJTB 5APVA 4GT1A 2P1JA 1KYOI 5AVTB 3RGUA 3ZDMA 1JO5A 1VQ7P 2B88A 2R32A 1VQ4P 1VF5B 2NPSA 3H1ID 3BCCG 4PV1C 3TSIA 3WU2E 2W6BA 4H44C 5BVZA 3MZWB 2R44A 1FAVA 1HH0A 2A06E 2XV5A 3L70G 3CC4P 4RKUJ 2K1AA 3TGUJ 1GU5A 1VQMP 1NKNA 2QVAA 3PJSK 4N3YB 3V4WA 1ZN5A 1FZCC 1RF1B 2W90A 2D2CB 2J58A 3AEAC 4DCKA 3B4SA 2HFED 2QM7A 1DIPA 1GK6A 1KQLA 2NPSB 2E75B 2O1KA 2C0XA 2YO2A 4OVNF 1NH4A 1EZVE 1OZHA 2P2UA 1KC8Q 3I5CA 1USDA 3B5NC 3MTUE 5TJHA 2Q3IA 3HD7C 3O6QB 2K9YA 1KILC 1PGJA 1IFJA 3H1JD 3N4XA 3NMDA 4IL6H 1HWTC 1M8OB 2GA1A 3MIWA 2YXRB 4JPZB 3N7NA 1NKZB 5AVYB 3H1HJ 1JY3O 1SQVG 2O1JA 2XU6A 2ZFCA 2PP6A 3H32A 2HLOA 1EXIA 4YPCA 1KILD 2PGDA 3JSVC 1NTKD 1BCCE 5CCHD 2W6JH 1UIIA 1FDOA 3S1KA 2Z4EA 1SQVK 4GIFA 3A3YB 5KLIB 2N1TB 1IFDA 3H1HE 3JCUH 3OJAB 3SFEC 1PV3A 2BASA 4A7PA 4BXLA 2QJPC 2KLVA 3BASA 2OYIC 1L0NK 1X8YA 2HG5D 1BGYE 5CCHC 1JMMA 2Y9ZA 2B9BA 1RF1C 3Q5SA 2R5BA 3M9HA 4LGDE 2NPSC 3L73E 1L0NE 1URQB 2QM8A 4C7NB 2KOGA 1FC2C 1NYHA 3CX5H 1NAFA 4IFFA 2JJLA 2W27A 1SQBD 3IF4A 3P32A 4U3FD 3VP9A 2BCCJ 4PV1D 1OW6A 1LT1A 3TF5A 4I7ZB 2N1TA 5CCGC 4DZOA 1SQPD 1LT9B 1T3JA 3KYQA 5H2FE 2Y0EA 2WT7B 1A02J 1PGQA 2OYHB 1HJ0A 3G3ZA 3I56P 2FYUD 3MGNA 5CBOA 1DEBA 2O01N 4WVZA 2WSEH 3WMM0 1P84H 2POHA 1QEXA 5KLIC 3CCEP 1PPJE 1N7SD 1QGKB 2FYUJ 3KDPB 3KZIE 4GODA 4I2LC 1KILA 4IOIH 2KUBA 3CCVP 3M0DC 2A45H 5AVZB 1KQFB 1W2EA 2O01H 4XFJA 1VQLP 2AEJA 4DT0A 1N7SA 3HD7D 1ZMEC 1JUNA 4JBZA 1QLED 1SQBJ 3H1LE 3TGUD 4WWIA 2KP8A 4OH8B 1K73Q 4C7RA 3RK3E 1RF0A 3EQ2A 1VF5D 5AW8B 1NTKK 3AE9C 3Q5RA 4R4MA 2BEQD 2QJKB 2QEXP 1PL5A 2OYIA 3WUTA 1MV8A 2E5TA 1SQXK 2IBZE 1USEA 2CK3H 1BDCA 5B5EE 1IZNB 3L71J 2B87B 4HH2A 2JP3A 2WWWA 3V5BA 5AW0B 1L0NG 2G3AA 3OAKA 4YXDC 4YXWH 1OVUA 3HUSB 1PP9D 3RK2C 1TU3F 1EZVG 2RN0A 4TT3H 3AE3C 3P8CD 1AVOA 2ZT9C 5APUA 3A5TA 4AYCA 2N1TC 3HTKA 1PZQA 4PD4H 4PD4E 4WB4A 3KXDA 3PHLA 1AQTA 1U7MA 2H8PD 1SFCB 1YQ4C 1NAYA 1IK9A 2IBZG 3AE7C 1MFTA 3L75G 3RK2D 1BCCG 2P58A 2M3BA 1NU1D 3L72D 5E79H 5CCGD 1GZLA 1RH5B 4EOTA 1IFIA 3A0HE 2O01J 2Y9YA 1A02F 1KYOE 1AJYA 1JY3P 3LIEA 4WY4A 3PP5A 1S2EA 2L91A 1U57A 1WMKA 5AW7B 1QVGO 1AQ5A 3V2PA 2BCCD 1N7SC 2M0BA 4U3FJ 1FU1A 5CBNA 5TISH 1FDMA 2AEMA 1LNQA 3F5HA 1OW7A 1UIXA 1LTIC 3CI9A 3TGUG 1LWUA 2JKVA 2FBWC 3GHGC 1T6AA 1PPJG 1GMJA 3H1IJ 3Q5PA 2H43A 1EDJA 3LW5H 1NGMB 3UIAA 1OWAA 5GTIH 2YKQA 5KJ7C 1JCCA 3C1LA 3R2PA 4BRYA 1CI6B 4UB6E 5AVWB 2Y0DA 2K3RA 2FYNC 4OWFA 1YYCA 1EQ7A 1OVVA 3FXEA 1KYOH 4PJ0E 1N2DC 4ZNCA 2WZ7A 1RY3A 1ZXGA 2YMKA 4N6JA 4BWNA 3H1LG 4QMAA 2FKWB 1FZBA 2FXMA 5E79E 3B5NB 3GF3A 1SQVJ 3CMAP 1BGYD 2ZJSE 4HYTB 3CCMP 1URQA 1FS0E 1FZAA 1NVOA 2QIWA 5KTBA 4RJTA 1JTHA 4H13B 1K9MQ 2K88A 1M1JB 3PRJA 1LTAC 3T97B 2QJKC 1KZUB 5KLVK 1FZCA 4ASVA 2IPPA 1M7LA 4N78E 5CJ0A 1RHZB 2JWAA 2WSSH 4JQ0D 2JDIH 3U1CA 1SQVD 1SQQE 5APYA 1QL2A 2KNCB 1NO4A 1OIPA 4C46A 1SQQK 1KQSO 2QJYC 1G1IA 3AEDC 3HD7A 3P8CE 3A0BH 1Q7YQ 2M3EA 3L71D 3VMAA 1GTWA 1FZEA 1N7SB 3SWYA
chains in the Genus database with same CATH topology
2IDBA 5M1BA 3Q5SA 2WQYC 2QSIA 1KTMA 1NYHA 4H0LB 1YQ3C 1FDIA 4H13D 4PV1D 3S9OA 1OW6A 4I7ZB 3C8VA 1KMIZ 1ZP0C 2WPVB 3R4YA 3IN6A 3SFDC 1HJ0A 4OGQB 4OGQC 4H13C 2E75D 2V7QJ 3LW5J 5L8RJ 5KLIC 3AEFC 3O6QA 1RQVA 3D71A 1KQGB 3AE1C 4OGQD 2G8YA 1KQFB 2E75C 4XFJA 3AEBC 1ZMEC 3FGAD 1KORA 1MKMA 1OMIA 4PV1B 1S1CX 4KT0J 3RK3E 1VF5D 3AE4C 3Q3DA 3AE9C 3AE6C 3Q5RA 4H0LC 4R4MA 2BEQD 3GLMA 1PL5A 3AEGC 5KKZC 3AE8C 1K05A 3D70A 2E76B 1KILE 2YIUC 3AEEC 3GF7A 1HF9A 2E74D 3AE5C 2JP3A 1VL2A 2D2CD 2G3AA 3H25A 4I7ZC 2NZ2A 4YXDC 3RL0g 2OQQA 4GDOA 1Y9BA 2D2CC 1JB0J 1TU3F 4TT3H 2MKVA 2P10A 3AE3C 2ZT9C 1RQUA 3Q1MA 1DD4A 2JO1A 3AE7C 1YQ4C 2WSEJ 1ZOYC 2FXPA 2H89C 4U7JA 2H88C 2ZT9D 1K04A 3B71A 3GMAA 2O01J 3EWKA 2E74B 4H44B 1AJYA 4IL6X 2E76D 4H44D 1U57A 1WMKA 1PIXA 2ZT9B 1IK7A 1S5LX 1VF5B 1OW7A 1UIXA 2E76C 2WSCJ 1Q90D 4PV1C 4H44C 2FBWC 1GMJA 4RKUJ 4Y28J 3Q5PA 3G9RA 1NGMB 3D6ZA 3D6YA 2BEZF 1VF5C 2J5UA 2D2CB 3AEAC 2FYNC 1R8EA 1DIPA 2YMKA 2E75B 3ABVC 1ZRTE 3Q2YA 1OW8A 1DD3A 3GF3A 2K9YA 3IAOA 4Z1MH 2QIWA 3AE2C 4H13B 3T97B 2QJKC 4YTPC 4H0LD 1EXIA 1FDOA 2WSFJ 2QJYC 4R4LA 2E74C 3AEDC 3SFEC 1PV3A 2QJPC 1EXJA 3AECC
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2D2C B;  2FYN C;  2WSE J;  2QSI A;  4PV1 B;  2E75 B;  4KT0 J;  1ZRT E;  4H0L B;  2O01 J;  2K9Y A;  4H44 B;  2E74 B;  4IL6 X;  5KKZ C;  2QIW A;  2E76 B;  4H13 B;  4I7Z B;  2YIU C;  3C8V A;  2QJK C;  2WPV B;  2ZT9 B;  1S5L X;  1VF5 B;  4OGQ B;  2WSC J;  1Q90 D;  3LW5 J;  2WSF J;  5L8R J;  2QJY C;  5KLI C;  4RKU J;  4Y28 J;  1JB0 J;  2QJP C; 
#chains in the Genus database with same CATH topology
 1R5S A;  2IDB A;  2WQY C;  1LGH B;  1QL1 A;  1HJB A;  1SQB K;  3L73 G;  1WT6 A;  3PH0 A;  4I6M C;  3RBX A;  1H88 A;  1SQB E;  5KKZ B;  3BVH A;  5EFW B;  1KTM A;  3GHG B;  3OA7 A;  3QH9 A;  1NTK J;  1BGY G;  1YQ3 C;  5KJ7 A;  4H13 D;  3SSU A;  3VOP A;  3G4S P;  1RE4 A;  4UB6 H;  5BU5 A;  3HD7 B;  2V4H A;  2KS1 A;  2IFM A;  1RF1 A;  2YKP A;  2FYU G;  5GTI E;  2WPV B;  1GDT A;  4EIJ A;  3IN6 A;  2FYZ A;  1D7M A;  5KJ7 D;  1VQK P;  5CJ4 A;  2I8D A;  1P84 E;  1R5L A;  3HE5 A;  2V7Q J;  1NU1 J;  2OGU A;  2QJY B;  2UWJ E;  2ZAE B;  2ZYG A;  3AEF C;  2A06 G;  3CX5 E;  3L70 E;  3O6Q A;  2XZR A;  4LLH A;  5APX A;  1NWQ A;  2L5G B;  1JY2 O;  1RE3 A;  2FY8 A;  2J59 M;  3CCU P;  5CCG A;  1N73 B;  2ZXE B;  3AEB C;  5AVV B;  3TNU B;  3FGA D;  5APS A;  1KOR A;  1MKM A;  1OMI A;  1L0L G;  1NTM E;  1PP9 J;  1AA0 A;  1S1C X;  4WY4 D;  1S9K E;  3C9I A;  2YXQ B;  1U7J A;  3USS A;  2PRR A;  3K5B A;  4IFM A;  2P7J A;  3AE6 C;  4NPD A;  5AW4 B;  1SQX E;  3S4R A;  2I1J A;  4L74 A;  2KIK A;  1SQQ G;  1FE6 A;  1NOH A;  2E76 B;  3CLQ A;  3CC2 P;  3AEE C;  1J1D B;  1W5C E;  3G6E P;  1T8Z A;  3P7K A;  4XE5 B;  5KAF E;  1NJI Q;  2CPB A;  3RL0 C;  1QVF O;  1S5L H;  2R5D A;  1VQ8 P;  3BCC E;  4I7Z C;  2BCC E;  2OYO A;  3V4Q A;  2WTY A;  4AQR D;  3NTN A;  1RF0 C;  3VMY A;  2IYO A;  4C7N A;  1NTZ G;  4DOJ A;  3A7O A;  3HUS C;  2IZ1 A;  1Y9B A;  3RL0 D;  1HTL C;  2YO3 A;  3FX0 A;  1EDI A;  2M5A A;  1AFO A;  3H1H D;  2Q7C A;  3MP7 B;  1RE4 C;  1KYO D;  1RQU A;  1NTZ K;  2ZXX A;  1DD4 A;  3CX5 I;  3EFF K;  3F89 A;  2HR3 A;  1Q86 Q;  1BCC D;  1VDF A;  1P84 D;  1CI6 A;  2WSE J;  3L72 G;  5AW1 B;  1YI2 P;  1CW5 A;  1IFN A;  2H89 C;  3H1K E;  1JY3 N;  1SQX G;  4U7J A;  1G2C A;  2Z5H A;  1GL2 A;  2ZT9 D;  4KHX A;  1JY2 P;  2R3S A;  2E43 A;  2FYU K;  1K04 A;  1NU1 K;  3E1R A;  2XND H;  3EWK A;  1X9V A;  4H44 B;  3CWB E;  1BDD A;  2KYV A;  4HKZ H;  4U3F G;  2ZYA A;  1RE3 C;  1P84 I;  2MJZ A;  1S3J A;  3TDK A;  3RK2 B;  2PAJ A;  1PIX A;  3KPE A;  3M9Q A;  3T97 A;  2LKM A;  4AUW A;  1JTH B;  2ZT9 B;  5AVU B;  5AVX B;  5AW3 B;  5KLV J;  3M0A A;  1KD1 Q;  2BCC G;  2OTL P;  2Q5U A;  2FFD B;  4L76 A;  2CPS A;  1GD2 E;  3CWB D;  5APQ A;  1ZR2 A;  1JNM A;  2Q6Q A;  4Y28 J;  1HVV A;  3G9R A;  2V7Q H;  5BU8 B;  1E79 H;  1M56 D;  4WY4 C;  3D6Z A;  2C0W A;  2JEE A;  1DH3 A;  2BEZ F;  1LTJ B;  3H1L J;  1Y8A A;  4W7Z A;  3RBZ A;  1VF5 C;  3FXD A;  1EC5 A;  2HPC A;  1XTG B;  3PTZ A;  3RK3 D;  3BRV B;  4D6T G;  1X79 B;  3V2Q A;  3CXH H;  1R8E A;  3CX5 D;  2YKO A;  1HUC A;  1OX3 A;  2K9J A;  1CSB A;  4N78 D;  3JC2 2;  3TYY A;  3TGU E;  1ZRT E;  3GHG A;  3Q2Y A;  2K37 A;  1KB9 H;  1OW8 A;  3M9B A;  4Y99 B;  2KSJ A;  3HUS A;  1SQB G;  3IAO A;  3RK3 C;  3VN0 A;  1IJD B;  5C39 A;  4EYY Q;  3CC7 P;  1H0T A;  1PPJ D;  1IFM A;  1GL2 D;  3O8Z A;  4HJG H;  3CCL P;  3A0B E;  1HGZ A;  1LP1 A;  1OXZ A;  3H1J J;  1URQ D;  2KS1 B;  1MZ9 A;  3CXH I;  4RES B;  4ZMD A;  1FZF A;  1DEE G;  1YTZ T;  3M06 A;  2H7H A;  1GL2 C;  1SQP G;  3CWB J;  3L75 E;  1Q2N A;  2WSF J;  4R4L A;  2Z5I A;  2Q9I A;  3L71 G;  5B66 H;  1EDK A;  1EZV D;  2QRX A;  1L0N J;  1URQ C;  5AVS B;  2KI7 B;  1EXJ A;  3L73 J;  4M3L A;  3H1K J;  1SVF A;  1PGO A;  3V2R A;  3VP8 A;  4CPG A;  2AXT H;  1H0T B;  3L73 D;  3A0H H;  1EDL A;  1J2J B;  1L0N D;  3MUD A;  4DJG A;  1H89 A;  2KK7 A;  1M1J C;  1LTT C;  4I1L A;  4D6T D;  1N73 A;  2C9L Y;  1Q81 Q;  2E42 A;  1NTM J;  1KFM A;  1LTG C;  3SWF A;  2FYN B;  2OAR A;  2XNX A;  1IC2 A;  5KLV G;  3CCJ P;  1SQQ D;  1YIT P;  4Y99 C;  1L0L K;  3L75 J;  2WPR A;  1VPC A;  2OTJ P;  1BCC J;  1DX7 A;  3BCC J;  4BRY B;  4UB8 E;  3CCQ P;  3L70 J;  3H6P A;  3C8V A;  5KLV D;  5AVR B;  2DW3 A;  2JR8 A;  3L74 D;  1NU1 E;  1ZP0 C;  2IFN A;  4TLF A;  5AW5 B;  3IR9 A;  5B66 E;  3HRN A;  1X22 A;  4OGQ B;  4H13 C;  2RMZ A;  5GTH H;  5KAI E;  2E75 D;  5KAI H;  3LW5 J;  5AW2 B;  3RK3 B;  3P8M C;  3CXH E;  4IFD K;  3H32 B;  3IFM A;  1KQG B;  2M5A B;  3CCR P;  1IO4 A;  2WPS A;  1L0L J;  2G8Y A;  3L74 J;  1PP9 E;  2A45 G;  3M91 A;  1SQX D;  4L73 A;  2GUS A;  1KB9 E;  5AVQ B;  1SS1 A;  1J1E B;  3L75 D;  4B86 A;  1JCD A;  3V6I A;  1GL2 B;  1MUU A;  3GG2 A;  1VQO P;  3KQG A;  3AE4 C;  1NTM D;  3U59 A;  4PJ0 H;  1S72 P;  3Q3D A;  3H1H G;  1FOS F;  4GOF A;  1BSH A;  1G2C B;  3GLM A;  1Y47 A;  3CD6 P;  1T3U A;  2I1K A;  5KKZ C;  3MD0 A;  3AE8 C;  1K05 A;  3EFG A;  3D70 A;  5APT A;  2SPZ A;  1LTS C;  2YIU C;  3B5N D;  1J1D C;  3H1K D;  4WBA A;  5B5E H;  1JOC A;  3AE5 C;  1HF9 A;  1LWU B;  3MUD C;  1VL2 A;  1KFN A;  1ZRT D;  2D2C D;  4W7Y A;  4EDF A;  5CMZ A;  5KLV E;  3H25 A;  1VQN P;  1VQ6 P;  3RL0 g;  1PFI A;  2HOD A;  2WMM A;  2OQQ A;  4JF7 A;  5TIS E;  1KN7 A;  2FFD A;  2D2C C;  2KZI A;  1BE3 J;  2GM4 A;  2P10 A;  3WUU A;  1SQX J;  3Q1M A;  2HPC B;  4D6T E;  2JO1 A;  2XDJ A;  2HYN A;  3BCC D;  4JYB A;  1M90 Q;  1LTJ A;  2K9J B;  3CL3 D;  1M1K Q;  1SQP E;  2FXP A;  2WIT A;  4ZKU A;  2AXC A;  2JWD A;  1AVY A;  2LXB A;  3L37 A;  1G1J A;  3KZI H;  2YNY A;  3GMA A;  4O9B A;  2E5Y A;  2P67 A;  1L4A D;  1KB9 I;  2E74 B;  2QE7 H;  4IL6 X;  2WSF H;  2E76 D;  3L4F A;  2ZVO B;  3CXH D;  1GW4 A;  2IYP A;  1YHQ P;  1L2P A;  1S9K D;  3SWK A;  1X0T A;  2WVR A;  3TNU A;  3W68 A;  1L4A A;  1IK7 A;  1S5L X;  2WSC J;  1LTB C;  2E76 C;  1Q90 D;  2ZYD A;  1Z56 A;  2B87 A;  2W83 C;  5CHX A;  3RL0 B;  4GKG A;  3QWO C;  1FBM A;  3G71 P;  1HGV A;  3D6Y A;  4LC1 A;  1NTZ D;  1NU1 G;  4W80 A;  1LT9 A;  1NTK E;  2J5U A;  2Q1K A;  1L0L D;  3L72 E;  2W8Z A;  5DJU B;  4ASW A;  4L75 A;  4PD4 D;  1VQ5 P;  3PLN A;  2IX7 C;  2ZVN B;  1S4X A;  3ABV C;  1W2B O;  2FXO A;  3L35 A;  2C9N Y;  1NTM K;  1YJN P;  1FOS E;  1HBW A;  1KV4 A;  3II6 A;  5GTH E;  1J1E C;  1DD3 A;  3HTK B;  1T2K D;  3NFQ A;  1PP9 G;  2GUV A;  4NPE A;  4Z1M H;  3HE5 B;  2OTK E;  3BRT B;  2Y0C A;  3FWN A;  4K35 A;  1BE3 E;  1JEK A;  2KLU A;  1EZV I;  3AE2 C;  3ITK A;  5CCH A;  4WY4 B;  1OVR A;  3WUV A;  1XTC C;  4U3F E;  1JY2 N;  1M57 D;  4YTP C;  4H0L D;  1BE3 D;  1LTJ C;  2Q3E A;  1YJ9 P;  1YTZ I;  2IBZ D;  1T2K C;  2IZ0 A;  1N86 A;  2WSC H;  1CZQ A;  1SQQ J;  1YJW P;  2N9Y B;  2VRS A;  1VQ9 P;  3VYI A;  3L71 E;  2E74 C;  1JMB A;  1S5L E;  2XKM A;  4HB1 A;  3CPW O;  1ZV8 A;  5KAF H;  2QJP B;  2OYI B;  4GOE A;  2OYH C;  3AEC C;  3H1L D;  1NTZ J;  1SQV E;  1YBK A;  5M1B A;  1E5W A;  4IL6 E;  1NTZ E;  1L4A C;  2LXC B;  5APW A;  2QSI A;  1Q82 Q;  1N8R Q;  2KXP B;  5AW9 B;  3L72 J;  4H0L B;  1N7L A;  2A45 I;  5H2F H;  4K3A A;  3M0D A;  1FDI A;  2KSE A;  1SQP K;  3S9O A;  3WU2 H;  3CME P;  2W6A A;  1LT9 C;  1KMI Z;  3JCU E;  2QG4 A;  2FYU E;  1SP4 A;  1SFC A;  1FJP A;  3H1I G;  3R4Y A;  3SFD C;  4EI2 A;  1M1J A;  1N73 C;  4OGQ C;  3L74 G;  4NPF X;  3NXS A;  3VMZ A;  5L8R J;  2B89 A;  1FZC B;  1RQV A;  3D71 A;  2HOD B;  3AE1 C;  4OGQ D;  1MFZ A;  3LID A;  2YMY A;  2O3J A;  2E75 C;  5AW6 B;  1VQP P;  2QA4 P;  1YIJ P;  2ITA A;  1NHL A;  1ZR4 A;  4PV1 B;  3HE4 A;  2RH0 A;  3L74 E;  2PFX A;  4KT0 J;  3CCS P;  3H1I E;  4H0L C;  1GW3 A;  3VTP C;  4XA4 A;  4D6T J;  1LJ2 A;  2KZJ A;  2M8R A;  3A2A A;  3AEG C;  3E1I A;  3FWL A;  3GW6 A;  3VMX A;  2AXT E;  2OYH A;  1KIL E;  3BAT A;  4RO0 A;  3W67 A;  3GF7 A;  2WT7 A;  1L4A B;  1GK4 A;  2E74 D;  2N9B A;  2RKL A;  3L36 A;  3HE4 B;  1BE3 G;  2KB7 P;  2NZ2 A;  4ZKP A;  2NRG A;  1WRG A;  2N1T D;  3H1J E;  3MHV A;  3B5N A;  4GDO A;  3OW2 O;  1SFC D;  3H1J G;  4PD4 I;  3I55 P;  1H8A A;  1JB0 J;  4UB8 H;  3V2N A;  2MKV A;  1KIL B;  4KJM A;  1SQP J;  1KB9 D;  3CWB G;  3TK1 A;  1FZG A;  1JM0 A;  2LR2 A;  5K5G B;  4MN4 C;  3E7K A;  1SFC C;  2WPQ A;  1NTK G;  1BGY J;  1ZOY C;  2YIU B;  3B8E B;  1K8A Q;  3H1K G;  1ZW0 A;  2H88 C;  2KNC A;  1QX8 A;  3KHU A;  1LWU C;  1AV1 A;  3U1A A;  1GU4 A;  1IFP A;  1LP1 B;  4JYC A;  3B71 A;  2IBZ I;  2FFD C;  1FJK A;  2A06 D;  2AEF A;  2R3C A;  2NPS D;  1PGP A;  1BSN A;  1L0L E;  1NTM G;  1OFC X;  1SLQ A;  1ZLL A;  3L70 D;  4H44 D;  5DJT B;  5APV A;  4GT1 A;  2P1J A;  1KYO I;  5AVT B;  3RGU A;  3ZDM A;  1JO5 A;  1VQ7 P;  2B88 A;  2R32 A;  1VQ4 P;  1VF5 B;  2NPS A;  3H1I D;  3BCC G;  4PV1 C;  3TSI A;  3WU2 E;  2W6B A;  4H44 C;  5BVZ A;  3MZW B;  2R44 A;  1FAV A;  1HH0 A;  2A06 E;  2XV5 A;  3L70 G;  3CC4 P;  4RKU J;  2K1A A;  3TGU J;  1GU5 A;  1VQM P;  1NKN A;  2QVA A;  3PJS K;  4N3Y B;  3V4W A;  1ZN5 A;  1FZC C;  1RF1 B;  2W90 A;  2D2C B;  2J58 A;  3AEA C;  4DCK A;  3B4S A;  2HFE D;  2QM7 A;  1DIP A;  1GK6 A;  1KQL A;  2NPS B;  2E75 B;  2O1K A;  2C0X A;  2YO2 A;  4OVN F;  1NH4 A;  1EZV E;  1OZH A;  2P2U A;  1KC8 Q;  3I5C A;  1USD A;  3B5N C;  3MTU E;  5TJH A;  2Q3I A;  3HD7 C;  3O6Q B;  2K9Y A;  1KIL C;  1PGJ A;  1IFJ A;  3H1J D;  3N4X A;  3NMD A;  4IL6 H;  1HWT C;  1M8O B;  2GA1 A;  3MIW A;  2YXR B;  4JPZ B;  3N7N A;  1NKZ B;  5AVY B;  3H1H J;  1JY3 O;  1SQV G;  2O1J A;  2XU6 A;  2ZFC A;  2PP6 A;  3H32 A;  2HLO A;  1EXI A;  4YPC A;  1KIL D;  2PGD A;  3JSV C;  1NTK D;  1BCC E;  5CCH D;  2W6J H;  1UII A;  1FDO A;  3S1K A;  2Z4E A;  1SQV K;  4GIF A;  3A3Y B;  5KLI B;  2N1T B;  1IFD A;  3H1H E;  3JCU H;  3OJA B;  3SFE C;  1PV3 A;  2BAS A;  4A7P A;  4BXL A;  2QJP C;  2KLV A;  3BAS A;  2OYI C;  1L0N K;  1X8Y A;  2HG5 D;  1BGY E;  5CCH C;  1JMM A;  2Y9Z A;  2B9B A;  1RF1 C;  3Q5S A;  2R5B A;  3M9H A;  4LGD E;  2NPS C;  3L73 E;  1L0N E;  1URQ B;  2QM8 A;  4C7N B;  2KOG A;  1FC2 C;  1NYH A;  3CX5 H;  1NAF A;  4IFF A;  2JJL A;  2W27 A;  1SQB D;  3IF4 A;  3P32 A;  4U3F D;  3VP9 A;  2BCC J;  4PV1 D;  1OW6 A;  1LT1 A;  3TF5 A;  4I7Z B;  2N1T A;  5CCG C;  4DZO A;  1SQP D;  1LT9 B;  1T3J A;  3KYQ A;  5H2F E;  2Y0E A;  2WT7 B;  1A02 J;  1PGQ A;  2OYH B;  1HJ0 A;  3G3Z A;  3I56 P;  2FYU D;  3MGN A;  5CBO A;  1DEB A;  2O01 N;  4WVZ A;  2WSE H;  3WMM 0;  1P84 H;  2POH A;  1QEX A;  5KLI C;  3CCE P;  1PPJ E;  1N7S D;  1QGK B;  2FYU J;  3KDP B;  3KZI E;  4GOD A;  4I2L C;  1KIL A;  4IOI H;  2KUB A;  3CCV P;  3M0D C;  2A45 H;  5AVZ B;  1KQF B;  1W2E A;  2O01 H;  4XFJ A;  1VQL P;  2AEJ A;  4DT0 A;  1N7S A;  3HD7 D;  1ZME C;  1JUN A;  4JBZ A;  1QLE D;  1SQB J;  3H1L E;  3TGU D;  4WWI A;  2KP8 A;  4OH8 B;  1K73 Q;  4C7R A;  3RK3 E;  1RF0 A;  3EQ2 A;  1VF5 D;  5AW8 B;  1NTK K;  3AE9 C;  3Q5R A;  4R4M A;  2BEQ D;  2QJK B;  2QEX P;  1PL5 A;  2OYI A;  3WUT A;  1MV8 A;  2E5T A;  1SQX K;  2IBZ E;  1USE A;  2CK3 H;  1BDC A;  5B5E E;  1IZN B;  3L71 J;  2B87 B;  4HH2 A;  2JP3 A;  2WWW A;  3V5B A;  5AW0 B;  1L0N G;  2G3A A;  3OAK A;  4YXD C;  4YXW H;  1OVU A;  3HUS B;  1PP9 D;  3RK2 C;  1TU3 F;  1EZV G;  2RN0 A;  4TT3 H;  3AE3 C;  3P8C D;  1AVO A;  2ZT9 C;  5APU A;  3A5T A;  4AYC A;  2N1T C;  3HTK A;  1PZQ A;  4PD4 H;  4PD4 E;  4WB4 A;  3KXD A;  3PHL A;  1AQT A;  1U7M A;  2H8P D;  1SFC B;  1YQ4 C;  1NAY A;  1IK9 A;  2IBZ G;  3AE7 C;  1MFT A;  3L75 G;  3RK2 D;  1BCC G;  2P58 A;  2M3B A;  1NU1 D;  3L72 D;  5E79 H;  5CCG D;  1GZL A;  1RH5 B;  4EOT A;  1IFI A;  3A0H E;  2O01 J;  2Y9Y A;  1A02 F;  1KYO E;  1AJY A;  1JY3 P;  3LIE A;  4WY4 A;  3PP5 A;  1S2E A;  2L91 A;  1U57 A;  1WMK A;  5AW7 B;  1QVG O;  1AQ5 A;  3V2P A;  2BCC D;  1N7S C;  2M0B A;  4U3F J;  1FU1 A;  5CBN A;  5TIS H;  1FDM A;  2AEM A;  1LNQ A;  3F5H A;  1OW7 A;  1UIX A;  1LTI C;  3CI9 A;  3TGU G;  1LWU A;  2JKV A;  2FBW C;  3GHG C;  1T6A A;  1PPJ G;  1GMJ A;  3H1I J;  3Q5P A;  2H43 A;  1EDJ A;  3LW5 H;  1NGM B;  3UIA A;  1OWA A;  5GTI H;  2YKQ A;  5KJ7 C;  1JCC A;  3C1L A;  3R2P A;  4BRY A;  1CI6 B;  4UB6 E;  5AVW B;  2Y0D A;  2K3R A;  2FYN C;  4OWF A;  1YYC A;  1EQ7 A;  1OVV A;  3FXE A;  1KYO H;  4PJ0 E;  1N2D C;  4ZNC A;  2WZ7 A;  1RY3 A;  1ZXG A;  2YMK A;  4N6J A;  4BWN A;  3H1L G;  4QMA A;  2FKW B;  1FZB A;  2FXM A;  5E79 E;  3B5N B;  3GF3 A;  1SQV J;  3CMA P;  1BGY D;  2ZJS E;  4HYT B;  3CCM P;  1URQ A;  1FS0 E;  1FZA A;  1NVO A;  2QIW A;  5KTB A;  4RJT A;  1JTH A;  4H13 B;  1K9M Q;  2K88 A;  1M1J B;  3PRJ A;  1LTA C;  3T97 B;  2QJK C;  1KZU B;  5KLV K;  1FZC A;  4ASV A;  2IPP A;  1M7L A;  4N78 E;  5CJ0 A;  1RHZ B;  2JWA A;  2WSS H;  4JQ0 D;  2JDI H;  3U1C A;  1SQV D;  1SQQ E;  5APY A;  1QL2 A;  2KNC B;  1NO4 A;  1OIP A;  4C46 A;  1SQQ K;  1KQS O;  2QJY C;  1G1I A;  3AED C;  3HD7 A;  3P8C E;  3A0B H;  1Q7Y Q;  2M3E A;  3L71 D;  3VMA A;  1GTW A;  1FZE A;  1N7S B;  3SWY A; 
#chains in the Genus database with same CATH homology
 2IDB A;  5M1B A;  3Q5S A;  2WQY C;  2QSI A;  1KTM A;  1NYH A;  4H0L B;  1YQ3 C;  1FDI A;  4H13 D;  4PV1 D;  3S9O A;  1OW6 A;  4I7Z B;  3C8V A;  1KMI Z;  1ZP0 C;  2WPV B;  3R4Y A;  3IN6 A;  3SFD C;  1HJ0 A;  4OGQ B;  4OGQ C;  4H13 C;  2E75 D;  2V7Q J;  3LW5 J;  5L8R J;  5KLI C;  3AEF C;  3O6Q A;  1RQV A;  3D71 A;  1KQG B;  3AE1 C;  4OGQ D;  2G8Y A;  1KQF B;  2E75 C;  4XFJ A;  3AEB C;  1ZME C;  3FGA D;  1KOR A;  1MKM A;  1OMI A;  4PV1 B;  1S1C X;  4KT0 J;  3RK3 E;  1VF5 D;  3AE4 C;  3Q3D A;  3AE9 C;  3AE6 C;  3Q5R A;  4H0L C;  4R4M A;  2BEQ D;  3GLM A;  1PL5 A;  3AEG C;  5KKZ C;  3AE8 C;  1K05 A;  3D70 A;  2E76 B;  1KIL E;  2YIU C;  3AEE C;  3GF7 A;  1HF9 A;  2E74 D;  3AE5 C;  2JP3 A;  1VL2 A;  2D2C D;  2G3A A;  3H25 A;  4I7Z C;  2NZ2 A;  4YXD C;  3RL0 g;  2OQQ A;  4GDO A;  1Y9B A;  2D2C C;  1JB0 J;  1TU3 F;  4TT3 H;  2MKV A;  2P10 A;  3AE3 C;  2ZT9 C;  1RQU A;  3Q1M A;  1DD4 A;  2JO1 A;  3AE7 C;  1YQ4 C;  2WSE J;  1ZOY C;  2FXP A;  2H89 C;  4U7J A;  2H88 C;  2ZT9 D;  1K04 A;  3B71 A;  3GMA A;  2O01 J;  3EWK A;  2E74 B;  4H44 B;  1AJY A;  4IL6 X;  2E76 D;  4H44 D;  1U57 A;  1WMK A;  1PIX A;  2ZT9 B;  1IK7 A;  1S5L X;  1VF5 B;  1OW7 A;  1UIX A;  2E76 C;  2WSC J;  1Q90 D;  4PV1 C;  4H44 C;  2FBW C;  1GMJ A;  4RKU J;  4Y28 J;  3Q5P A;  3G9R A;  1NGM B;  3D6Z A;  3D6Y A;  2BEZ F;  1VF5 C;  2J5U A;  2D2C B;  3AEA C;  2FYN C;  1R8E A;  1DIP A;  2YMK A;  2E75 B;  3ABV C;  1ZRT E;  3Q2Y A;  1OW8 A;  1DD3 A;  3GF3 A;  2K9Y A;  3IAO A;  4Z1M H;  2QIW A;  3AE2 C;  4H13 B;  3T97 B;  2QJK C;  4YTP C;  4H0L D;  1EXI A;  1FDO A;  2WSF J;  2QJY C;  4R4L A;  2E74 C;  3AED C;  3SFE C;  1PV3 A;  2QJP C;  1EXJ A;  3AEC C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...