2C9LY

Structure of the epstein-barr virus zebra protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Viral protein
molecule keywords 5'-D(*AP*AP*GP*CP*AP*CP*TP*GP*AP*CP *TP*CP*AP*TP*GP*AP*AP*GP
publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
total genus 26
structure length 63
sequence length 63
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9lY00
1S9KE 5AW3B 3A2AA 3T97A 4I6MC 1GZLA 4JYBA 1KQLA 5APXA 5AW2B 3HE5A 5CMZA 2YNYA 1GTWA 3HE5B 3M06A 2R5DA 3VN0A 3SWFA 5AVUB 1H88A 3M91A 3P32A 1CSBA 4JYCA 1GK6A 1YYCA 3MD0A 3A3YB 2E42A 3M0AA 3M9BA 1CZQA 3MGNA 2P7JA 2W6AA 2P67A 1HUCA 1FOSE 1H8AA 5AVXB 1OWAA 4AYCA 4B86A 2YO2A 1GK4A 3UIAA 3V4WA 3LIEA 2N9BA 5APSA 3NTNA 3L36A 5APVA 4C46A 1JUNA 2WPRA 5AW1B 4GKGA 2WT7A 1T2KD 2WWWA 2WPSA 1FOSF 5AVQB 2WT7B 3NFQA 1J2JB 4DZOA 3A7OA 5AW6B 5APUA 4GT1A 5AVWB 5AW5B 3OAKA 4C7NA 2ZXEB 3VTPC 2XU6A 4C7NB 2R32A 1SP4A 5AW7B 3B8EB 2Q7CA 3HTKA 2IPPA 3NMDA 3VMXA 3M9HA 2R5BA 3NXSA 1MFZA 5APYA 2E43A 2Z5HA 2W27A 5AVZB 2KP8A 3L35A 1NWQA 1JNMA 2BASA 4I2LC 2ZFCA 3LIDA 4HYTB 3TK1A 1S9KD 3L37A 4LC1A 1IO4A 4EOTA 5AVSB 2XZRA 3V4QA 2WTYA 4M3LA 3TYYA 2Q3IA 3O8ZA 5APWA 1FAVA 5AVRB 3VMYA 3I5CA 1CI6A 3A5TA 1X8YA 3P8MC 3VMZA 1CI6B 5AW8B 1NAFA 1A02J 2C9LY 1H89A 4AUWA 1GD2E 2VRSA 2Z5IA 5AW4B 2R3CA 2WPQA 3HE4A 5AVYB 1DH3A 3KDPB 3HE4B 3M0DA 4RESB 1OXZA 1A02F 2YO3A 5AW9B 4AQRD 1GU4A 2QM8A 4XE5B 3VYIA 3P7KA 4KHXA 1HBWA 3V5BA 2XV5A 3IR9A 1MV8A 5AVVB 3TNUA 2H7HA 3TNUB 5AW0B 2Q5UA 2QM7A 1G2CB 2C9NY 5APQA 1HWTC 1GU5A 1T2KC 1SLQA 2P2UA 5AVTB 2JJLA 5APTA 1HJBA 1MUUA 3KQGA
chains in the Genus database with same CATH superfamily
3ZDMA 3A2AA 2O1KA 3AE1C 3O6QA 2JKVA 3L75J 3L71D 1YI2P 2FYUE 3HUSC 1U7MA 1SQVJ 2AXCA 1JY3N 2OQQA 5KLIC 1WT6A 3HUSA 4UB8H 1H8AA 2KXPB 3QWOC 1H0TA 4D6TD 3UIAA 1NTMJ 4OGQC 3SFDC 2WSFH 1QVGO 1W2BO 3V2NA 1L4AC 3K5BA 5AVWB 5AW5B 2H89C 2AEMA 1L4AA 2M3BA 1NAYA 1BGYJ 2KLVA 3G9RA 1NWQA 2J59M 1JNMA 1KYOE 1BE3E 3TK1A 1S9KD 4LC1A 1LT9C 1L0LE 2YMYA 3F89A 1CI6A 4OGQD 1HJ0A 3P8MC 1YTZI 1FU1A 2VRSA 3MHVA 1SQPJ 2DW3A 1L0NK 1NU1D 1L4AD 3CWBD 1ZXGA 2ZVNB 4DT0A 2W6JH 1MV8A 2QJKC 3CMEP 1GMJA 1G2CA 2RKLA 4UB6E 3BVHA 2E74C 4PD4I 5CHXA 2OYIC 3AE5C 1BDDA 1OIPA 3H1HJ 5KLVK 3OW2O 4WY4B 3BCCD 4U3FJ 2LXBA 2D2CC 2OYIA 3AEDC 4JYBA 1VL2A 1M8OB 3IF4A 3CX5E 2CK3H 3GF7A 1NJIQ 2MKVA 2Y9YA 3L72G 1CZQA 1VQ8P 2RN0A 3PTZA 1OWAA 3L75E 2FFDB 3CXHE 3CI9A 1JY2P 2ZYAA 1VQOP 2WT7A 1FOSF 4DZOA 2FKWB 2QG4A 2OARA 2IBZE 3U1AA 3PHLA 3RGUA 4EIJA 3NMDA 2KK7A 1FZBA 3L71J 3TGUG 1JMMA 4EI2A 3L35A 2K9JB 2HPCB 5TISH 3L37A 4WB4A 1RF1C 3I55P 1KILE 4D6TJ 1SS1A 2QEXP 1DX7A 2QSIA 1BGYE 2FYNC 1KC8Q 2C9LY 1R5LA 1W2EA 3KXDA 2AEJA 2Q3EA 2WPQA 3HE4A 2FXMA 2V4HA 1RF0A 2YXRB 1EZVG 1KB9I 1T2KC 1LTJA 1P84E 4N6JA 1VQNP 1U7JA 4JQ0D 1Q2NA 1PPJG 3PP5A 3T97B 3Q5PA 2JWAA 2YKOA 1RE4C 5CMZA 3B71A 4YXDC 4TLFA 1VF5D 2ZYDA 1CSBA 1NO4A 3H1HE 3M0AA 1MFTA 1SQQD 2PP6A 3CWBJ 5M1BA 1DEBA 2NZ2A 1IFMA 2W6BA 1T2KD 2N1TC 1USDA 3R4YA 5AW6B 1PV3A 1ZR2A 1GW3A 2XU6A 3G71P 2Q7CA 1RE3A 3TSIA 2E43A 5DJTB 1NTKK 4HYTB 2FYZA 4EOTA 1VQ6P 2POHA 3L72E 5L8RJ 1X8YA 2FYUD 2G8YA 1JY3P 4AUWA 1GD2E 1OW8A 1N2DC 3V2PA 1DH3A 1OXZA 3ABVC 3KYQA 3CD6P 3VYIA 3AEFC 2QM7A 1SQBK 3AE4C 3WMM0 1G1JA 4EYYQ 4WY4A 3N4XA 3MUDC 2AEFA 3RL0g 4I7ZC 3TGUE 3D71A 2B89A 5AW2B 3MUDA 1S72P 2Q9IA 3M91A 1RY3A 3MD0A 1UIXA 1AVOA 2FFDC 5B5EH 1KYOD 2QIWA 3P8CE 5AVXB 2FFDA 1L0LD 4WY4D 3MZWB 5APVA 3FWLA 1NTZK 5AVQB 3GHGC 1N73B 2OTLP 1EZVE 2GM4A 4N78E 2E76C 1SQXK 1AV1A 2W90A 2JR8A 5AVZB 2K9JA 2HPCA 3FX0A 2A06E 2WZ7A 1JB0J 2HG5D 1DIPA 1SQQJ 1VQ9P 1JTHB 1YQ3C 2KYVA 3CCLP 1KYOH 2XV5A 3IR9A 3L75D 3CXHD 2Q5UA 3L74G 3B4SA 1SLQA 2C0XA 1PGQA 2YIUB 1OZHA 1JY2N 1JCDA 3T97A 2HFED 3IN6A 1PGPA 2IBZD 2OYHB 1L0NG 3HE5B 4PJ0E 4DJGA 3CC2P 1H88A 1FS0E 2FYUJ 4UB6H 1NU1K 5KLVG 4YXWH 3H1IG 5CCGC 4NPFX 1K04A 1OW7A 3II6A 1GK4A 1PIXA 5CCGA 3GLMA 4MN4C 3H1LG 2H8PD 1BGYD 2WPSA 1M1JC 3HD7B 4ASVA 3CX5H 2OTKE 5APUA 3PLNA 1NVOA 1IFJA 4W7ZA 1YTZT 1VPCA 2QE7H 2PFXA 5GTIH 3CXHH 1P84D 3USSA 3CCRP 1E5WA 4L75A 4R4LA 1SQPD 2LR2A 5CCGD 1BE3J 1MZ9A 1PGJA 1T8ZA 1J1DB 1L0LJ 1YJWP 1PL5A 2KSJA 2XNXA 1LTTC 1S3JA 3H1HD 3H1KG 1QL2A 1QX8A 1W5CE 2E75B 4R4MA 1RQUA 3Q2YA 1HGZA 2H88C 2A45I 1KFNA 1VF5B 2YKQA 1GTWA 3SWYA 4U7JA 4JYCA 3GG2A 3G3ZA 2W6AA 1P84I 1FZEA 3KHUA 1E79H 2QJPC 2W8ZA 1FZFA 4I1LA 1N73C 3OJAB 3L72D 2N9BA 5APSA 2IYOA 4Y99B 2WPRA 5GTHE 3CCVP 1KN7A 2WVRA 2Q1KA 2XDJA 3MP7B 1N73A 2WQYC 3L74E 2IX7C 3R2PA 1EDLA 5AW7B 1KZUB 1NYHA 3L4FA 3RL0B 4LGDE 1L0NE 3C1LA 2KZJA 1OMIA 2W83C 4XA4A 3TGUD 2RMZA 5CCHA 2HODB 4K3AA 3AEAC 1XTCC 5KLVE 3A5TA 1JTHA 3H1IE 2I1JA 1YITP 1H89A 1PP9G 2L91A 4O9BA 3H1LE 3A0BE 3P8CD 1KQGB 1NTKG 4KHXA 2H7HA 2YIUC 1BCCG 2K1AA 2OYHC 2ZJSE 5CCHD 1HJBA 3WU2E 1PP9J 4N78D 2N9YB 1VDFA 2OYHA 3HE5A 1IFDA 3MTUE 1VQKP 2WMMA 4WBAA 5DJUB 2KLUA 1M57D 5E79E 3L70G 1SQBG 3S1KA 2A06D 2P67A 1FOSE 5CJ0A 1X79B 3HD7C 1JMBA 4N3YB 3CCJP 1EDJA 1VQLP 2BEQD 3GW6A 3H32B 3HD7A 2HYNA 2KS1B 3NFQA 3H1JG 3PRJA 1CW5A 3W68A 2Y9ZA 1SQBJ 4DCKA 1N7SD 1WMKA 3VTPC 1GL2D 1PZQA 3RBZA 5GTIE 2Z5HA 2OTJP 3AEBC 3BRVB 1ZR4A 3LIDA 1NTZG 2XZRA 2PRRA 3TYYA 2Q3IA 1FAVA 3C8VA 3HD7D 3I5CA 2XNDH 3L72J 2E75C 1SQXG 4IOIH 1ZRTE 3FXDA 2YO3A 3L73G 3W67A 4KJMA 2E5YA 4H0LB 2C0WA 1OW6A 5APQA 4IFMA 5K5GB 1JCCA 1VF5C 3JC22 2ZXXA 3Q5SA 1LNQA 1S5LE 5TJHA 4HKZH 1RF0C 3TGUJ 1T6AA 1LJ2A 1ZMEC 3L73J 2R5DA 3SWFA 2E75D 2B9BA 1LTJC 5KAFH 2O01N 1IFNA 4Y99C 1M90Q 2Y0DA 1MKMA 1QGKB 4H13B 2HLOA 1PP9E 1KILB 3EQ2A 3V4WA 1OVRA 3SSUA 4W7YA 2I1KA 2V7QJ 3S9OA 4GKGA 1NTKE 3BASA 1SQVK 4PJ0H 1BCCE 4ZKUA 2Z4EA 1PGOA 2NRGA 1LT1A 1YJNP 2KOGA 3RL0C 1NU1G 1T3JA 4C7NB 1VQPP 1NTMK 2IPPA 3KZIE 2ZT9B 2W27A 4H44D 1OVVA 3D70A 4BRYB 1IO4A 3G4SP 3BATA 3BCCG 2HODA 1RE3C 1SQBE 5AVRB 3V2RA 3VMAA 1NAFA 2M8RA 1IFIA 1HGVA 3VP9A 2M0BA 3RL0D 2QM8A 2CPBA 3V5BA 3RK3E 1IK9A 1LGHB 2XKMA 3V6IA 5CBOA 2PAJA 2JJLA 3AE9C 2WSEJ 3L74D 4IFFA 1NTZE 4WY4C 5EFWB 3I56P 1YYCA 1AJYA 3A3YB 3RK3B 1SFCA 1SQXE 2LXCB 4JPZB 2O1JA 1LP1B 1YBKA 4K35A 3NTNA 1LTBC 3Q1MA 1DD4A 4ZKPA 1Q81Q 3H1ID 3L73E 3CCMP 4ZNCA 3H32A 2KS1A 2MJZA 3CCQP 3B5NB 2IFMA 4PD4E 2JO1A 4YTPC 1LTIC 1BE3D 3G6EP 3HTKB 1SFCD 3NXSA 5APYA 2WITA 2B88A 2JWDA 4L74A 2ZFCA 5GTHH 5AVSB 1FZCB 3V4QA 4IL6E 2AXTE 1G1IA 1A02J 1PPJE 2JP3A 2JDIH 4WVZA 4H0LC 2P58A 4GIFA 3IAOA 2O01H 2B87A 3WUTA 4NPEA 1Q7YQ 1NU1E 1K05A 3AE6C 3M9QA 1S2EA 1LWUB 1Q82Q 5AW3B 2BCCG 3CX5D 3AE2C 2I8DA 2YNYA 2WSSH 1Q90D 3A0BH 3BCCE 4XFJA 2G3AA 1KYOI 1KILC 1URQD 5KAFE 4YPCA 1VQ4P 2KNCB 3CPWO 3M9BA 4H0LD 5KJ7C 4BWNA 1BSNA 1KILA 1K73Q 2PGDA 1VQ7P 4B86A 2YO2A 2BCCJ 3AECC 3WU2H 1RQVA 5KJ7A 1BSHA 3A0HE 2QVAA 1ZRTD 1KB9E 1N7SB 1GL2B 5E79H 3L74J 4OWFA 4C7NA 2WPVB 1LT9B 2Q6QA 2NPSB 4H13D 3VP8A 1KILD 1NGMB 4BRYA 1L0NJ 5KJ7D 3Q3DA 2O01J 4M3LA 3CX5I 1FDMA 1JOCA 2ITAA 3CLQA 1FBMA 2QJYB 5KLVJ 3H1IJ 4C7RA 3CXHI 3EFGA 1VQMP 2ZT9D 2D2CB 1PP9D 1ZW0A 4XE5B 3U1CA 4ASWA 3H1LJ 5AVVB 4GODA 1JO5A 2OGUA 3MIWA 4KT0J 1HWTC 1NTKD 2ZYGA 2IBZI 4I6MC 1AFOA 4HB1A 1KMIZ 3GMAA 3P32A 3U59A 3D6ZA 4JF7A 1HUCA 1LP1A 5B66E 2BEZF 3B5NC 1SQBD 1S5LH 3H1KJ 3RK2D 1SVFA 4LLHA 3B5NA 1UIIA 3CC7P 2HR3A 1KD1Q 1JY3O 3D6YA 1P84H 2ZXEB 1SP4A 2BCCE 3HTKA 3RK3D 5H2FE 2R5BA 4H44B 1VQ5P 2QRXA 2JEEA 3CMAP 2FYNB 1RH5B 2CPSA 1FZCA 1SQVG 3S4RA 1HH0A 5APWA 3B5ND 3VMZA 1NTZD 5AW8B 2QA4P 4EDFA 1NTMG 3CCSP 4HH2A 4IFDK 3WUUA 1EC5A 3C9IA 3KZIH 5BU8B 3H25A 3KDPB 5CCHC 1SQXD 1LWUC 1DEEG 1SQQK 4HJGH 2FY8A 3Q5RA 3OA7A 3L73D 4NPDA 4Z1MH 3TDKA 1LWUA 2LKMA 1BDCA 3VOPA 2K3RA 2FXOA 5APTA 2A45G 1BGYG 4PD4D 5APXA 3FXEA 3VN0A 1JEKA 3AEGC 3PJSK 5AVUB 1Z56A 2KNCA 3H6PA 1LTAC 2N1TB 3GF3A 1SQPG 1EZVD 3FGAD 1S4XA 1EQ7A 4C46A 1N7SC 5AW1B 1GL2C 2FYUK 2H43A 1PPJD 1NTKJ 1FZAA 1N7SA 2Y0CA 2NPSC 1GL2A 3E7KA 1QL1A 1KFMA 3H1HG 3JSVC 1IFPA 1BCCJ 1FJKA 1R5SA 4U3FG 1LT9A 3JCUE 1SFCB 1R8EA 3B8EB 2NPSA 5KTBA 1Y47A 1MFZA 4ZMDA 3H1KE 4W80A 1NOHA 1NHLA 3CC4P 2K9YA 1Q86Q 2QJYC 1IJDB 4PD4H 2KB7P 3L70J 2M5AB 5KKZB 3ITKA 2V7QH 2NPSD 4RESB 4I7ZB 1J1DC 5AW9B 3AE3C 2WSFJ 4Y28J 1KTMA 4L73A 3H1JJ 2C9NY 1L0LK 1EZVI 4IL6H 4OH8B 2P2UA 2AXTH 1YJ9P 3L71G 1KB9D 1N7LA 4RKUJ 1X0TA 4PV1B 2E74D 1SQVE 1URQB 1ZV8A 4A7PA 1IZNB 1NTZJ 2B87B 4D6TG 1GDTA 2D2CD 2E42A 3N7NA 2P7JA 1IK7A 1ZOYC 3GHGB 1NTME 1M1KQ 1SQXJ 2E76B 4AYCA 1OFCX 4IL6X 3LIEA 2WWWA 1J2JB 1S1CX 5KAIE 1AVYA 1OX3A 1XTGB 4H44C 2IYPA 3IFMA 1RF1A 2Y0EA 2KSEA 2WSEH 2FBWC 1QVFO 3CCEP 3SWKA 5BVZA 2BASA 3A0HH 3AEEC 1OVUA 2IZ1A 4GDOA 1Y8AA 1KB9H 2RH0A 2J58A 2YMKA 3CWBG 1SQPE 3KPEA 1K8AQ 5AW4B 2R3CA 2IDBA 4DOJA 1FJPA 2A06G 2SPZA 1HBWA 1RE4A 1FDIA 1NKNA 4CPGA 3L70E 4U3FE 4UB8E 1NKZB 1TU3F 1NU1J 1Y9BA 3KQGA 2YXQB 5CJ4A 1X22A 2O3JA 2R44A 2BCCD 3M06A 3H1JE 2P1JA 1J1EB 1NH4A 3BCCJ 2KIKA 2N1TA 2J5UA 1M1JB 1YQ4C 1ZP0C 1SQPK 3E1IA 3RK2B 2ZAEB 3RBXA 1M7LA 1SFCC 3AE7C 1L0ND 1U57A 1KV4A 3OAKA 3L71E 3WUVA 3F5HA 1EDKA 2IFNA 3M9HA 2N1TD 5B66H 4RJTA 2KP8A 5KLVD 1D7MA 2R3SA 4D6TE 5KKZC 1FZGA 3V2QA 3VMYA 5BU5A 1QEXA 3H1LD 1FDOA 2M5AA 3M0DC 1LTGC 2Z5IA 5H2FH 3QH9A 3M0DA 4QMAA 3E1RA 4AQRD 1L2PA 4WWIA 1DD3A 4TT3H 3LW5H 3TNUB 4PV1C 1EDIA 2GUVA 1MUUA 2KI7B 1URQC 1WRGA 1S9KE 3O6QB 1URQA 2E5TA 4JBZA 2QJPB 1K9MQ 1KQSO 1SQQG 3H1KD 2KZIA 1AQTA 3MGNA 3CWBE 3GHGA 4BXLA 1USEA 3HUSB 1H0TB 1JY2O 5KLIB 3AE8C 4PV1D 5TISE 2GA1A 4OVNF 1AA0A 4H13C 4OGQB 1KQFB 4GT1A 2R32A 3VMXA 1L4AB 2IZ0A 2E76D 3FWNA 2K37A 2P10A 4I2LC 2YKPA 2FYUG 2WTYA 3O8ZA 3LW5J 2ZT9C 1CI6B 1SQVD 3JCUH 2KUBA 1EXIA 3TF5A 1NTMD 1GU4A 1FE6A 1LTSC 2ZVOB 1G2CB 4GOFA 4RO0A 1GU5A 1ZN5A 2WSCH 2QJKB 2E74B 1GZLA 1J1EC 2OYIB 1KQLA 1ZLLA 2L5GB 3BRTB 1EXJA 1X9VA 1BE3G 1GK6A 3RK2C 1L0LG 1YIJP 3CL3D 1M1JA 1HTLC 1BCCD 5CBNA 3L36A 1JUNA 1M56D 1GW4A 1KORA 3RK3C 3SFEC 2WT7B 4L76A 3A7OA 1HF9A 1IC2A 5C39A 1QLED 1RHZB 2M3EA 3EWKA 3L70D 2K88A 4U3FD 1N86A 1SQQE 1JM0A 1FC2C 5KAIH 3CCUP 2OYOA 1T3UA 3EFFK 1N8RQ 2WSCJ 2A45H 4GOEA 3H1JD 1RF1B 2GUSA 1FZCC 3PH0A 2UWJE 3L75G 5AVYB 1PFIA 3HE4B 1A02F 3P7KA 3TNUA 1S5LX 3HRNA 5AW0B 1AQ5A 2FXPA 5B5EE 2IBZG 1YHQP 1HVVA 5AVTB 1LTJB
chains in the Genus database with same CATH topology
1JY2N 1JCDA 3A2AA 1N7LA 2O1KA 3T97A 2HFED 2OYHB 3HE5B 4IFFA 1URQB 1ZV8A 1H88A 3HUSC 4WY4C 1GDTA 1YYCA 1JY3N 1WT6A 3A3YB 2E42A 1NU1K 3RK3B 1SFCA 3N7NA 2P7JA 3HUSA 1H8AA 3GHGB 5CCGC 2O1JA 3II6A 4AYCA 1GK4A 3UIAA 3LIEA 3NTNA 1LTBC 4ZKPA 5CCGA 3H32A 2H8PD 2WSFH 2WWWA 2MJZA 2WPSA 1M1JC 1J2JB 3B5NB 3HD7B 2IFMA 3V2NA 1L4AC 1XTGB 5APUA 5AVWB 5AW5B 1IFJA 3IFMA 1LTIC 1RF1A 4W7ZA 1L4AA 1YTZT 2M3BA 2WSEH 1VPCA 3HTKB 1SFCD 3NXSA 2KLVA 5APYA 2WITA 5BVZA 1NWQA 2J59M 1JNMA 2BASA 2ZFCA 1E5WA 3TK1A 1S9KD 4LC1A 5AVSB 1FZCB 3V4QA 5CCGD 1LT9C 1MZ9A 1T8ZA 2YMYA 1J1DB 1CI6A 3P8MC 2J58A 1G1IA 1YTZI 1A02J 1FU1A 2KSJA 3KPEA 2VRSA 2XNXA 5AW4B 2R3CA 1LTTC 4DOJA 1QL2A 1L0NK 1L4AD 1FJPA 4GIFA 2O01H 1HBWA 1MV8A 1RE4A 1G2CA 3BVHA 1NKNA 5CHXA 2OYIC 1HGZA 5KLVK 3M9QA 1LWUB 1NKZB 4WY4B 2A45I 3KQGA 5AW3B 1KFNA 2OYIA 4JYBA 5CJ4A 2YKQA 2YNYA 1GTWA 3SWYA 3M06A 2P1JA 1J1EB 1KILC 1URQD 4JYCA 1NH4A 3G3ZA 3M9BA 1CZQA 2N1TA 5KJ7C 2W6AA 1M1JB 1KILA 1FZEA 1OWAA 1SQPK 4B86A 1FZFA 2YO2A 4I1LA 1N73C 3OJAB 3E1IA 2FFDB 2N9BA 3CI9A 5APSA 3RK2B 5KJ7A 1JY2P 4Y99B 2WPRA 2WT7A 2XDJA 1N73A 1M7LA 1SFCC 1FOSF 4DZOA 2FKWB 2IX7C 1N7SB 3R2PA 1GL2B 2OARA 3U1AA 3OAKA 4C7NA 4EIJA 5AW7B 1KZUB 1LT9B 3NMDA 2IFNA 1FZBA 1JMMA 2NPSB 3M9HA 2N1TD 3L4FA 3VP8A 3RL0B 4LGDE 1KILD 2KP8A 3L35A 4XA4A 2HPCB 3L37A 5KJ7D 4WB4A 1RF1C 5CCHA 4M3LA 1FZGA 1FDMA 2HODB 3V2QA 3VMYA 5BU5A 1XTCC 3A5TA 1DX7A 1JTHA 1JOCA 2I1JA 3CLQA 1FBMA 3M0DC 2C9LY 1H89A 1LTGC 1W2EA 2Z5IA 4O9BA 2WPQA 3HE4A 4C7RA 2FXMA 3M0DA 3EFGA 3P8CD 4AQRD 3U1CA 4XE5B 1RF0A 4KHXA 2H7HA 5AVVB 1JO5A 3LW5H 3TNUB 3MIWA 1HWTC 2GUVA 1T2KC 2OYHC 1LTJA 5CCHD 4N6JA 1MUUA 1HJBA 1URQC 1WRGA 1S9KE 4I6MC 3PP5A 4N78D 1VDFA 2OYHA 2YKOA 3HE5A 1IFDA 1RE4C 5CMZA 1AFOA 3MTUE 1URQA 4WBAA 3P32A 1CSBA 1NO4A 3U59A 3M0AA 3MGNA 3GHGA 4JF7A 2P67A 1HUCA 1FOSE 5CJ0A 3HUSB 2PP6A 1JY2O 1X79B 3B5NC 3HD7C 1DEBA 1IFMA 4N3YB 2W6BA 3RK2D 1SVFA 1T2KD 4LLHA 3HD7A 3B5NA 3H32B 2HYNA 3NFQA 2N1TC 1CW5A 5AW6B 1ZR2A 1JY3O 4GT1A 1GW3A 1N7SD 2ZXEB 3VTPC 1GL2D 2XU6A 2R32A 1SP4A 2Q7CA 1RE3A 3HTKA 3RK3D 3TSIA 3VMXA 1L4AB 2R5BA 2E43A 2Z5HA 2JEEA 1NTKK 2CPSA 3BRVB 4I2LC 1ZR4A 3LIDA 4HYTB 1FZCA 2YKPA 2FYZA 4EOTA 2XZRA 2WTYA 3TYYA 2Q3IA 3O8ZA 1HH0A 2POHA 5APWA 1FAVA 3B5ND 3HD7D 3I5CA 1X8YA 3VMZA 1CI6B 5AW8B 1JY3P 4AUWA 1GD2E 1N2DC 4HH2A 4IFDK 3V2PA 3C9IA 5BU8B 1DH3A 3KDPB 5CCHC 1OXZA 3KYQA 2YO3A 1GU4A 1LWUC 3VYIA 1LTSC 1SQQK 2C0WA 3OA7A 2QM7A 1G2CB 1SQBK 5APQA 3WMM0 4IFMA 1GU5A 1LWUA 1G1JA 1ZN5A 1JCCA 2LKMA 2WSCH 3VOPA 4WY4A 3N4XA 5APTA 2A45G 1GZLA 1J1EC 2OYIB 1KQLA 1RF0C 1ZLLA 2L5GB 3BRTB 5APXA 5AW2B 3MUDA 1X9VA 2R5DA 3VN0A 2Q9IA 3SWFA 5AVUB 3M91A 1Z56A 1LTJC 1RY3A 3H6PA 1GK6A 3MD0A 1IFNA 1LTAC 2FFDC 3RK2C 3CL3D 1M1JA 1HTLC 4Y99C 3P8CE 2N1TB 2HLOA 5AVXB 1KILB 2FFDA 3EQ2A 3V4WA 4WY4D 4W7YA 1EQ7A 3L36A 5APVA 2I1KA 1N7SC 5AW1B 4C46A 1JUNA 1GL2C 4GKGA 1GW4A 3BASA 1NTZK 1SQVK 3RK3C 2FYUK 2H43A 5AVQB 2WT7B 1FZAA 3GHGC 1N73B 3A7OA 4ZKUA 1N7SA 2Z4EA 2GM4A 2NPSC 1GL2A 4N78E 1QL1A 1KFMA 2KOGA 3RL0C 1FJKA 1IC2A 1SQXK 1LT9A 1T3JA 4C7NB 1SFCB 3B8EB 1NTMK 2IPPA 2NPSA 5KTBA 1MFZA 2W27A 4W80A 1NOHA 5AVZB 1NHLA 2HPCA 1N86A 1IO4A 3BATA 2WZ7A 2HG5D 1IJDB 2HODA 1RE3C 5AVRB 2KB7P 1T3UA 3V2RA 1JTHB 1NAFA 2A45H 2KYVA 1RF1B 2GUSA 2M8RA 1FZCC 5AVYB 1PFIA 1IFIA 2NPSD 3HE4B 4RESB 1HGVA 3VP9A 1A02F 1J1DC 5AW9B 3RL0D 2QM8A 2CPBA 3P7KA 3V5BA 2XV5A 3IR9A 3TNUA 1IK9A 1LGHB 2XKMA 3HRNA 5AW0B 1AQ5A 2Q5UA 2C9NY 1L0LK 2PAJA 4OH8B 1SLQA 2P2UA 2C0XA 1HVVA 2JJLA 5AVTB 1LTJB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S9K E;  5AW3 B;  3A2A A;  3T97 A;  4I6M C;  1GZL A;  4JYB A;  1KQL A;  5APX A;  5AW2 B;  3HE5 A;  5CMZ A;  2YNY A;  1GTW A;  3HE5 B;  3M06 A;  2R5D A;  3VN0 A;  3SWF A;  5AVU B;  1H88 A;  3M91 A;  3P32 A;  1CSB A;  4JYC A;  1GK6 A;  1YYC A;  3MD0 A;  3A3Y B;  2E42 A;  3M0A A;  3M9B A;  1CZQ A;  3MGN A;  2P7J A;  2W6A A;  2P67 A;  1HUC A;  1FOS E;  1H8A A;  5AVX B;  1OWA A;  4AYC A;  4B86 A;  2YO2 A;  1GK4 A;  3UIA A;  3V4W A;  3LIE A;  2N9B A;  5APS A;  3NTN A;  3L36 A;  5APV A;  4C46 A;  1JUN A;  2WPR A;  5AW1 B;  4GKG A;  2WT7 A;  1T2K D;  2WWW A;  2WPS A;  1FOS F;  5AVQ B;  2WT7 B;  3NFQ A;  1J2J B;  4DZO A;  3A7O A;  5AW6 B;  5APU A;  4GT1 A;  5AVW B;  5AW5 B;  3OAK A;  4C7N A;  2ZXE B;  3VTP C;  2XU6 A;  4C7N B;  2R32 A;  1SP4 A;  5AW7 B;  3B8E B;  2Q7C A;  3HTK A;  2IPP A;  3NMD A;  3VMX A;  3M9H A;  2R5B A;  3NXS A;  1MFZ A;  5APY A;  2E43 A;  2Z5H A;  2W27 A;  5AVZ B;  2KP8 A;  3L35 A;  1NWQ A;  1JNM A;  2BAS A;  4I2L C;  2ZFC A;  3LID A;  4HYT B;  3TK1 A;  1S9K D;  3L37 A;  4LC1 A;  1IO4 A;  4EOT A;  5AVS B;  2XZR A;  3V4Q A;  2WTY A;  4M3L A;  3TYY A;  2Q3I A;  3O8Z A;  5APW A;  1FAV A;  5AVR B;  3VMY A;  3I5C A;  1CI6 A;  3A5T A;  1X8Y A;  3P8M C;  3VMZ A;  1CI6 B;  5AW8 B;  1NAF A;  1A02 J;  2C9L Y;  1H89 A;  4AUW A;  1GD2 E;  2VRS A;  2Z5I A;  5AW4 B;  2R3C A;  2WPQ A;  3HE4 A;  5AVY B;  1DH3 A;  3KDP B;  3HE4 B;  3M0D A;  4RES B;  1OXZ A;  1A02 F;  2YO3 A;  5AW9 B;  4AQR D;  1GU4 A;  2QM8 A;  4XE5 B;  3VYI A;  3P7K A;  4KHX A;  1HBW A;  3V5B A;  2XV5 A;  3IR9 A;  1MV8 A;  5AVV B;  3TNU A;  2H7H A;  3TNU B;  5AW0 B;  2Q5U A;  2QM7 A;  1G2C B;  2C9N Y;  5APQ A;  1HWT C;  1GU5 A;  1T2K C;  1SLQ A;  2P2U A;  5AVT B;  2JJL A;  5APT A;  1HJB A;  1MUU A;  3KQG A; 
#chains in the Genus database with same CATH topology
 3ZDM A;  3A2A A;  2O1K A;  3AE1 C;  3O6Q A;  2JKV A;  3L75 J;  3L71 D;  1YI2 P;  2FYU E;  3HUS C;  1U7M A;  1SQV J;  2AXC A;  1JY3 N;  2OQQ A;  5KLI C;  1WT6 A;  3HUS A;  4UB8 H;  1H8A A;  2KXP B;  3QWO C;  1H0T A;  4D6T D;  3UIA A;  1NTM J;  4OGQ C;  3SFD C;  2WSF H;  1QVG O;  1W2B O;  3V2N A;  1L4A C;  3K5B A;  5AVW B;  5AW5 B;  2H89 C;  2AEM A;  1L4A A;  2M3B A;  1NAY A;  1BGY J;  2KLV A;  3G9R A;  1NWQ A;  2J59 M;  1JNM A;  1KYO E;  1BE3 E;  3TK1 A;  1S9K D;  4LC1 A;  1LT9 C;  1L0L E;  2YMY A;  3F89 A;  1CI6 A;  4OGQ D;  1HJ0 A;  3P8M C;  1YTZ I;  1FU1 A;  2VRS A;  3MHV A;  1SQP J;  2DW3 A;  1L0N K;  1NU1 D;  1L4A D;  3CWB D;  1ZXG A;  2ZVN B;  4DT0 A;  2W6J H;  1MV8 A;  2QJK C;  3CME P;  1GMJ A;  1G2C A;  2RKL A;  4UB6 E;  3BVH A;  2E74 C;  4PD4 I;  5CHX A;  2OYI C;  3AE5 C;  1BDD A;  1OIP A;  3H1H J;  5KLV K;  3OW2 O;  4WY4 B;  3BCC D;  4U3F J;  2LXB A;  2D2C C;  2OYI A;  3AED C;  4JYB A;  1VL2 A;  1M8O B;  3IF4 A;  3CX5 E;  2CK3 H;  3GF7 A;  1NJI Q;  2MKV A;  2Y9Y A;  3L72 G;  1CZQ A;  1VQ8 P;  2RN0 A;  3PTZ A;  1OWA A;  3L75 E;  2FFD B;  3CXH E;  3CI9 A;  1JY2 P;  2ZYA A;  1VQO P;  2WT7 A;  1FOS F;  4DZO A;  2FKW B;  2QG4 A;  2OAR A;  2IBZ E;  3U1A A;  3PHL A;  3RGU A;  4EIJ A;  3NMD A;  2KK7 A;  1FZB A;  3L71 J;  3TGU G;  1JMM A;  4EI2 A;  3L35 A;  2K9J B;  2HPC B;  5TIS H;  3L37 A;  4WB4 A;  1RF1 C;  3I55 P;  1KIL E;  4D6T J;  1SS1 A;  2QEX P;  1DX7 A;  2QSI A;  1BGY E;  2FYN C;  1KC8 Q;  2C9L Y;  1R5L A;  1W2E A;  3KXD A;  2AEJ A;  2Q3E A;  2WPQ A;  3HE4 A;  2FXM A;  2V4H A;  1RF0 A;  2YXR B;  1EZV G;  1KB9 I;  1T2K C;  1LTJ A;  1P84 E;  4N6J A;  1VQN P;  1U7J A;  4JQ0 D;  1Q2N A;  1PPJ G;  3PP5 A;  3T97 B;  3Q5P A;  2JWA A;  2YKO A;  1RE4 C;  5CMZ A;  3B71 A;  4YXD C;  4TLF A;  1VF5 D;  2ZYD A;  1CSB A;  1NO4 A;  3H1H E;  3M0A A;  1MFT A;  1SQQ D;  2PP6 A;  3CWB J;  5M1B A;  1DEB A;  2NZ2 A;  1IFM A;  2W6B A;  1T2K D;  2N1T C;  1USD A;  3R4Y A;  5AW6 B;  1PV3 A;  1ZR2 A;  1GW3 A;  2XU6 A;  3G71 P;  2Q7C A;  1RE3 A;  3TSI A;  2E43 A;  5DJT B;  1NTK K;  4HYT B;  2FYZ A;  4EOT A;  1VQ6 P;  2POH A;  3L72 E;  5L8R J;  1X8Y A;  2FYU D;  2G8Y A;  1JY3 P;  4AUW A;  1GD2 E;  1OW8 A;  1N2D C;  3V2P A;  1DH3 A;  1OXZ A;  3ABV C;  3KYQ A;  3CD6 P;  3VYI A;  3AEF C;  2QM7 A;  1SQB K;  3AE4 C;  3WMM 0;  1G1J A;  4EYY Q;  4WY4 A;  3N4X A;  3MUD C;  2AEF A;  3RL0 g;  4I7Z C;  3TGU E;  3D71 A;  2B89 A;  5AW2 B;  3MUD A;  1S72 P;  2Q9I A;  3M91 A;  1RY3 A;  3MD0 A;  1UIX A;  1AVO A;  2FFD C;  5B5E H;  1KYO D;  2QIW A;  3P8C E;  5AVX B;  2FFD A;  1L0L D;  4WY4 D;  3MZW B;  5APV A;  3FWL A;  1NTZ K;  5AVQ B;  3GHG C;  1N73 B;  2OTL P;  1EZV E;  2GM4 A;  4N78 E;  2E76 C;  1SQX K;  1AV1 A;  2W90 A;  2JR8 A;  5AVZ B;  2K9J A;  2HPC A;  3FX0 A;  2A06 E;  2WZ7 A;  1JB0 J;  2HG5 D;  1DIP A;  1SQQ J;  1VQ9 P;  1JTH B;  1YQ3 C;  2KYV A;  3CCL P;  1KYO H;  2XV5 A;  3IR9 A;  3L75 D;  3CXH D;  2Q5U A;  3L74 G;  3B4S A;  1SLQ A;  2C0X A;  1PGQ A;  2YIU B;  1OZH A;  1JY2 N;  1JCD A;  3T97 A;  2HFE D;  3IN6 A;  1PGP A;  2IBZ D;  2OYH B;  1L0N G;  3HE5 B;  4PJ0 E;  4DJG A;  3CC2 P;  1H88 A;  1FS0 E;  2FYU J;  4UB6 H;  1NU1 K;  5KLV G;  4YXW H;  3H1I G;  5CCG C;  4NPF X;  1K04 A;  1OW7 A;  3II6 A;  1GK4 A;  1PIX A;  5CCG A;  3GLM A;  4MN4 C;  3H1L G;  2H8P D;  1BGY D;  2WPS A;  1M1J C;  3HD7 B;  4ASV A;  3CX5 H;  2OTK E;  5APU A;  3PLN A;  1NVO A;  1IFJ A;  4W7Z A;  1YTZ T;  1VPC A;  2QE7 H;  2PFX A;  5GTI H;  3CXH H;  1P84 D;  3USS A;  3CCR P;  1E5W A;  4L75 A;  4R4L A;  1SQP D;  2LR2 A;  5CCG D;  1BE3 J;  1MZ9 A;  1PGJ A;  1T8Z A;  1J1D B;  1L0L J;  1YJW P;  1PL5 A;  2KSJ A;  2XNX A;  1LTT C;  1S3J A;  3H1H D;  3H1K G;  1QL2 A;  1QX8 A;  1W5C E;  2E75 B;  4R4M A;  1RQU A;  3Q2Y A;  1HGZ A;  2H88 C;  2A45 I;  1KFN A;  1VF5 B;  2YKQ A;  1GTW A;  3SWY A;  4U7J A;  4JYC A;  3GG2 A;  3G3Z A;  2W6A A;  1P84 I;  1FZE A;  3KHU A;  1E79 H;  2QJP C;  2W8Z A;  1FZF A;  4I1L A;  1N73 C;  3OJA B;  3L72 D;  2N9B A;  5APS A;  2IYO A;  4Y99 B;  2WPR A;  5GTH E;  3CCV P;  1KN7 A;  2WVR A;  2Q1K A;  2XDJ A;  3MP7 B;  1N73 A;  2WQY C;  3L74 E;  2IX7 C;  3R2P A;  1EDL A;  5AW7 B;  1KZU B;  1NYH A;  3L4F A;  3RL0 B;  4LGD E;  1L0N E;  3C1L A;  2KZJ A;  1OMI A;  2W83 C;  4XA4 A;  3TGU D;  2RMZ A;  5CCH A;  2HOD B;  4K3A A;  3AEA C;  1XTC C;  5KLV E;  3A5T A;  1JTH A;  3H1I E;  2I1J A;  1YIT P;  1H89 A;  1PP9 G;  2L91 A;  4O9B A;  3H1L E;  3A0B E;  3P8C D;  1KQG B;  1NTK G;  4KHX A;  2H7H A;  2YIU C;  1BCC G;  2K1A A;  2OYH C;  2ZJS E;  5CCH D;  1HJB A;  3WU2 E;  1PP9 J;  4N78 D;  2N9Y B;  1VDF A;  2OYH A;  3HE5 A;  1IFD A;  3MTU E;  1VQK P;  2WMM A;  4WBA A;  5DJU B;  2KLU A;  1M57 D;  5E79 E;  3L70 G;  1SQB G;  3S1K A;  2A06 D;  2P67 A;  1FOS E;  5CJ0 A;  1X79 B;  3HD7 C;  1JMB A;  4N3Y B;  3CCJ P;  1EDJ A;  1VQL P;  2BEQ D;  3GW6 A;  3H32 B;  3HD7 A;  2HYN A;  2KS1 B;  3NFQ A;  3H1J G;  3PRJ A;  1CW5 A;  3W68 A;  2Y9Z A;  1SQB J;  4DCK A;  1N7S D;  1WMK A;  3VTP C;  1GL2 D;  1PZQ A;  3RBZ A;  5GTI E;  2Z5H A;  2OTJ P;  3AEB C;  3BRV B;  1ZR4 A;  3LID A;  1NTZ G;  2XZR A;  2PRR A;  3TYY A;  2Q3I A;  1FAV A;  3C8V A;  3HD7 D;  3I5C A;  2XND H;  3L72 J;  2E75 C;  1SQX G;  4IOI H;  1ZRT E;  3FXD A;  2YO3 A;  3L73 G;  3W67 A;  4KJM A;  2E5Y A;  4H0L B;  2C0W A;  1OW6 A;  5APQ A;  4IFM A;  5K5G B;  1JCC A;  1VF5 C;  3JC2 2;  2ZXX A;  3Q5S A;  1LNQ A;  1S5L E;  5TJH A;  4HKZ H;  1RF0 C;  3TGU J;  1T6A A;  1LJ2 A;  1ZME C;  3L73 J;  2R5D A;  3SWF A;  2E75 D;  2B9B A;  1LTJ C;  5KAF H;  2O01 N;  1IFN A;  4Y99 C;  1M90 Q;  2Y0D A;  1MKM A;  1QGK B;  4H13 B;  2HLO A;  1PP9 E;  1KIL B;  3EQ2 A;  3V4W A;  1OVR A;  3SSU A;  4W7Y A;  2I1K A;  2V7Q J;  3S9O A;  4GKG A;  1NTK E;  3BAS A;  1SQV K;  4PJ0 H;  1BCC E;  4ZKU A;  2Z4E A;  1PGO A;  2NRG A;  1LT1 A;  1YJN P;  2KOG A;  3RL0 C;  1NU1 G;  1T3J A;  4C7N B;  1VQP P;  1NTM K;  2IPP A;  3KZI E;  2ZT9 B;  2W27 A;  4H44 D;  1OVV A;  3D70 A;  4BRY B;  1IO4 A;  3G4S P;  3BAT A;  3BCC G;  2HOD A;  1RE3 C;  1SQB E;  5AVR B;  3V2R A;  3VMA A;  1NAF A;  2M8R A;  1IFI A;  1HGV A;  3VP9 A;  2M0B A;  3RL0 D;  2QM8 A;  2CPB A;  3V5B A;  3RK3 E;  1IK9 A;  1LGH B;  2XKM A;  3V6I A;  5CBO A;  2PAJ A;  2JJL A;  3AE9 C;  2WSE J;  3L74 D;  4IFF A;  1NTZ E;  4WY4 C;  5EFW B;  3I56 P;  1YYC A;  1AJY A;  3A3Y B;  3RK3 B;  1SFC A;  1SQX E;  2LXC B;  4JPZ B;  2O1J A;  1LP1 B;  1YBK A;  4K35 A;  3NTN A;  1LTB C;  3Q1M A;  1DD4 A;  4ZKP A;  1Q81 Q;  3H1I D;  3L73 E;  3CCM P;  4ZNC A;  3H32 A;  2KS1 A;  2MJZ A;  3CCQ P;  3B5N B;  2IFM A;  4PD4 E;  2JO1 A;  4YTP C;  1LTI C;  1BE3 D;  3G6E P;  3HTK B;  1SFC D;  3NXS A;  5APY A;  2WIT A;  2B88 A;  2JWD A;  4L74 A;  2ZFC A;  5GTH H;  5AVS B;  1FZC B;  3V4Q A;  4IL6 E;  2AXT E;  1G1I A;  1A02 J;  1PPJ E;  2JP3 A;  2JDI H;  4WVZ A;  4H0L C;  2P58 A;  4GIF A;  3IAO A;  2O01 H;  2B87 A;  3WUT A;  4NPE A;  1Q7Y Q;  1NU1 E;  1K05 A;  3AE6 C;  3M9Q A;  1S2E A;  1LWU B;  1Q82 Q;  5AW3 B;  2BCC G;  3CX5 D;  3AE2 C;  2I8D A;  2YNY A;  2WSS H;  1Q90 D;  3A0B H;  3BCC E;  4XFJ A;  2G3A A;  1KYO I;  1KIL C;  1URQ D;  5KAF E;  4YPC A;  1VQ4 P;  2KNC B;  3CPW O;  3M9B A;  4H0L D;  5KJ7 C;  4BWN A;  1BSN A;  1KIL A;  1K73 Q;  2PGD A;  1VQ7 P;  4B86 A;  2YO2 A;  2BCC J;  3AEC C;  3WU2 H;  1RQV A;  5KJ7 A;  1BSH A;  3A0H E;  2QVA A;  1ZRT D;  1KB9 E;  1N7S B;  1GL2 B;  5E79 H;  3L74 J;  4OWF A;  4C7N A;  2WPV B;  1LT9 B;  2Q6Q A;  2NPS B;  4H13 D;  3VP8 A;  1KIL D;  1NGM B;  4BRY A;  1L0N J;  5KJ7 D;  3Q3D A;  2O01 J;  4M3L A;  3CX5 I;  1FDM A;  1JOC A;  2ITA A;  3CLQ A;  1FBM A;  2QJY B;  5KLV J;  3H1I J;  4C7R A;  3CXH I;  3EFG A;  1VQM P;  2ZT9 D;  2D2C B;  1PP9 D;  1ZW0 A;  4XE5 B;  3U1C A;  4ASW A;  3H1L J;  5AVV B;  4GOD A;  1JO5 A;  2OGU A;  3MIW A;  4KT0 J;  1HWT C;  1NTK D;  2ZYG A;  2IBZ I;  4I6M C;  1AFO A;  4HB1 A;  1KMI Z;  3GMA A;  3P32 A;  3U59 A;  3D6Z A;  4JF7 A;  1HUC A;  1LP1 A;  5B66 E;  2BEZ F;  3B5N C;  1SQB D;  1S5L H;  3H1K J;  3RK2 D;  1SVF A;  4LLH A;  3B5N A;  1UII A;  3CC7 P;  2HR3 A;  1KD1 Q;  1JY3 O;  3D6Y A;  1P84 H;  2ZXE B;  1SP4 A;  2BCC E;  3HTK A;  3RK3 D;  5H2F E;  2R5B A;  4H44 B;  1VQ5 P;  2QRX A;  2JEE A;  3CMA P;  2FYN B;  1RH5 B;  2CPS A;  1FZC A;  1SQV G;  3S4R A;  1HH0 A;  5APW A;  3B5N D;  3VMZ A;  1NTZ D;  5AW8 B;  2QA4 P;  4EDF A;  1NTM G;  3CCS P;  4HH2 A;  4IFD K;  3WUU A;  1EC5 A;  3C9I A;  3KZI H;  5BU8 B;  3H25 A;  3KDP B;  5CCH C;  1SQX D;  1LWU C;  1DEE G;  1SQQ K;  4HJG H;  2FY8 A;  3Q5R A;  3OA7 A;  3L73 D;  4NPD A;  4Z1M H;  3TDK A;  1LWU A;  2LKM A;  1BDC A;  3VOP A;  2K3R A;  2FXO A;  5APT A;  2A45 G;  1BGY G;  4PD4 D;  5APX A;  3FXE A;  3VN0 A;  1JEK A;  3AEG C;  3PJS K;  5AVU B;  1Z56 A;  2KNC A;  3H6P A;  1LTA C;  2N1T B;  3GF3 A;  1SQP G;  1EZV D;  3FGA D;  1S4X A;  1EQ7 A;  4C46 A;  1N7S C;  5AW1 B;  1GL2 C;  2FYU K;  2H43 A;  1PPJ D;  1NTK J;  1FZA A;  1N7S A;  2Y0C A;  2NPS C;  1GL2 A;  3E7K A;  1QL1 A;  1KFM A;  3H1H G;  3JSV C;  1IFP A;  1BCC J;  1FJK A;  1R5S A;  4U3F G;  1LT9 A;  3JCU E;  1SFC B;  1R8E A;  3B8E B;  2NPS A;  5KTB A;  1Y47 A;  1MFZ A;  4ZMD A;  3H1K E;  4W80 A;  1NOH A;  1NHL A;  3CC4 P;  2K9Y A;  1Q86 Q;  2QJY C;  1IJD B;  4PD4 H;  2KB7 P;  3L70 J;  2M5A B;  5KKZ B;  3ITK A;  2V7Q H;  2NPS D;  4RES B;  4I7Z B;  1J1D C;  5AW9 B;  3AE3 C;  2WSF J;  4Y28 J;  1KTM A;  4L73 A;  3H1J J;  2C9N Y;  1L0L K;  1EZV I;  4IL6 H;  4OH8 B;  2P2U A;  2AXT H;  1YJ9 P;  3L71 G;  1KB9 D;  1N7L A;  4RKU J;  1X0T A;  4PV1 B;  2E74 D;  1SQV E;  1URQ B;  1ZV8 A;  4A7P A;  1IZN B;  1NTZ J;  2B87 B;  4D6T G;  1GDT A;  2D2C D;  2E42 A;  3N7N A;  2P7J A;  1IK7 A;  1ZOY C;  3GHG B;  1NTM E;  1M1K Q;  1SQX J;  2E76 B;  4AYC A;  1OFC X;  4IL6 X;  3LIE A;  2WWW A;  1J2J B;  1S1C X;  5KAI E;  1AVY A;  1OX3 A;  1XTG B;  4H44 C;  2IYP A;  3IFM A;  1RF1 A;  2Y0E A;  2KSE A;  2WSE H;  2FBW C;  1QVF O;  3CCE P;  3SWK A;  5BVZ A;  2BAS A;  3A0H H;  3AEE C;  1OVU A;  2IZ1 A;  4GDO A;  1Y8A A;  1KB9 H;  2RH0 A;  2J58 A;  2YMK A;  3CWB G;  1SQP E;  3KPE A;  1K8A Q;  5AW4 B;  2R3C A;  2IDB A;  4DOJ A;  1FJP A;  2A06 G;  2SPZ A;  1HBW A;  1RE4 A;  1FDI A;  1NKN A;  4CPG A;  3L70 E;  4U3F E;  4UB8 E;  1NKZ B;  1TU3 F;  1NU1 J;  1Y9B A;  3KQG A;  2YXQ B;  5CJ4 A;  1X22 A;  2O3J A;  2R44 A;  2BCC D;  3M06 A;  3H1J E;  2P1J A;  1J1E B;  1NH4 A;  3BCC J;  2KIK A;  2N1T A;  2J5U A;  1M1J B;  1YQ4 C;  1ZP0 C;  1SQP K;  3E1I A;  3RK2 B;  2ZAE B;  3RBX A;  1M7L A;  1SFC C;  3AE7 C;  1L0N D;  1U57 A;  1KV4 A;  3OAK A;  3L71 E;  3WUV A;  3F5H A;  1EDK A;  2IFN A;  3M9H A;  2N1T D;  5B66 H;  4RJT A;  2KP8 A;  5KLV D;  1D7M A;  2R3S A;  4D6T E;  5KKZ C;  1FZG A;  3V2Q A;  3VMY A;  5BU5 A;  1QEX A;  3H1L D;  1FDO A;  2M5A A;  3M0D C;  1LTG C;  2Z5I A;  5H2F H;  3QH9 A;  3M0D A;  4QMA A;  3E1R A;  4AQR D;  1L2P A;  4WWI A;  1DD3 A;  4TT3 H;  3LW5 H;  3TNU B;  4PV1 C;  1EDI A;  2GUV A;  1MUU A;  2KI7 B;  1URQ C;  1WRG A;  1S9K E;  3O6Q B;  1URQ A;  2E5T A;  4JBZ A;  2QJP B;  1K9M Q;  1KQS O;  1SQQ G;  3H1K D;  2KZI A;  1AQT A;  3MGN A;  3CWB E;  3GHG A;  4BXL A;  1USE A;  3HUS B;  1H0T B;  1JY2 O;  5KLI B;  3AE8 C;  4PV1 D;  5TIS E;  2GA1 A;  4OVN F;  1AA0 A;  4H13 C;  4OGQ B;  1KQF B;  4GT1 A;  2R32 A;  3VMX A;  1L4A B;  2IZ0 A;  2E76 D;  3FWN A;  2K37 A;  2P10 A;  4I2L C;  2YKP A;  2FYU G;  2WTY A;  3O8Z A;  3LW5 J;  2ZT9 C;  1CI6 B;  1SQV D;  3JCU H;  2KUB A;  1EXI A;  3TF5 A;  1NTM D;  1GU4 A;  1FE6 A;  1LTS C;  2ZVO B;  1G2C B;  4GOF A;  4RO0 A;  1GU5 A;  1ZN5 A;  2WSC H;  2QJK B;  2E74 B;  1GZL A;  1J1E C;  2OYI B;  1KQL A;  1ZLL A;  2L5G B;  3BRT B;  1EXJ A;  1X9V A;  1BE3 G;  1GK6 A;  3RK2 C;  1L0L G;  1YIJ P;  3CL3 D;  1M1J A;  1HTL C;  1BCC D;  5CBN A;  3L36 A;  1JUN A;  1M56 D;  1GW4 A;  1KOR A;  3RK3 C;  3SFE C;  2WT7 B;  4L76 A;  3A7O A;  1HF9 A;  1IC2 A;  5C39 A;  1QLE D;  1RHZ B;  2M3E A;  3EWK A;  3L70 D;  2K88 A;  4U3F D;  1N86 A;  1SQQ E;  1JM0 A;  1FC2 C;  5KAI H;  3CCU P;  2OYO A;  1T3U A;  3EFF K;  1N8R Q;  2WSC J;  2A45 H;  4GOE A;  3H1J D;  1RF1 B;  2GUS A;  1FZC C;  3PH0 A;  2UWJ E;  3L75 G;  5AVY B;  1PFI A;  3HE4 B;  1A02 F;  3P7K A;  3TNU A;  1S5L X;  3HRN A;  5AW0 B;  1AQ5 A;  2FXP A;  5B5E E;  2IBZ G;  1YHQ P;  1HVV A;  5AVT B;  1LTJ B; 
#chains in the Genus database with same CATH homology
 1JY2 N;  1JCD A;  3A2A A;  1N7L A;  2O1K A;  3T97 A;  2HFE D;  2OYH B;  3HE5 B;  4IFF A;  1URQ B;  1ZV8 A;  1H88 A;  3HUS C;  4WY4 C;  1GDT A;  1YYC A;  1JY3 N;  1WT6 A;  3A3Y B;  2E42 A;  1NU1 K;  3RK3 B;  1SFC A;  3N7N A;  2P7J A;  3HUS A;  1H8A A;  3GHG B;  5CCG C;  2O1J A;  3II6 A;  4AYC A;  1GK4 A;  3UIA A;  3LIE A;  3NTN A;  1LTB C;  4ZKP A;  5CCG A;  3H32 A;  2H8P D;  2WSF H;  2WWW A;  2MJZ A;  2WPS A;  1M1J C;  1J2J B;  3B5N B;  3HD7 B;  2IFM A;  3V2N A;  1L4A C;  1XTG B;  5APU A;  5AVW B;  5AW5 B;  1IFJ A;  3IFM A;  1LTI C;  1RF1 A;  4W7Z A;  1L4A A;  1YTZ T;  2M3B A;  2WSE H;  1VPC A;  3HTK B;  1SFC D;  3NXS A;  2KLV A;  5APY A;  2WIT A;  5BVZ A;  1NWQ A;  2J59 M;  1JNM A;  2BAS A;  2ZFC A;  1E5W A;  3TK1 A;  1S9K D;  4LC1 A;  5AVS B;  1FZC B;  3V4Q A;  5CCG D;  1LT9 C;  1MZ9 A;  1T8Z A;  2YMY A;  1J1D B;  1CI6 A;  3P8M C;  2J58 A;  1G1I A;  1YTZ I;  1A02 J;  1FU1 A;  2KSJ A;  3KPE A;  2VRS A;  2XNX A;  5AW4 B;  2R3C A;  1LTT C;  4DOJ A;  1QL2 A;  1L0N K;  1L4A D;  1FJP A;  4GIF A;  2O01 H;  1HBW A;  1MV8 A;  1RE4 A;  1G2C A;  3BVH A;  1NKN A;  5CHX A;  2OYI C;  1HGZ A;  5KLV K;  3M9Q A;  1LWU B;  1NKZ B;  4WY4 B;  2A45 I;  3KQG A;  5AW3 B;  1KFN A;  2OYI A;  4JYB A;  5CJ4 A;  2YKQ A;  2YNY A;  1GTW A;  3SWY A;  3M06 A;  2P1J A;  1J1E B;  1KIL C;  1URQ D;  4JYC A;  1NH4 A;  3G3Z A;  3M9B A;  1CZQ A;  2N1T A;  5KJ7 C;  2W6A A;  1M1J B;  1KIL A;  1FZE A;  1OWA A;  1SQP K;  4B86 A;  1FZF A;  2YO2 A;  4I1L A;  1N73 C;  3OJA B;  3E1I A;  2FFD B;  2N9B A;  3CI9 A;  5APS A;  3RK2 B;  5KJ7 A;  1JY2 P;  4Y99 B;  2WPR A;  2WT7 A;  2XDJ A;  1N73 A;  1M7L A;  1SFC C;  1FOS F;  4DZO A;  2FKW B;  2IX7 C;  1N7S B;  3R2P A;  1GL2 B;  2OAR A;  3U1A A;  3OAK A;  4C7N A;  4EIJ A;  5AW7 B;  1KZU B;  1LT9 B;  3NMD A;  2IFN A;  1FZB A;  1JMM A;  2NPS B;  3M9H A;  2N1T D;  3L4F A;  3VP8 A;  3RL0 B;  4LGD E;  1KIL D;  2KP8 A;  3L35 A;  4XA4 A;  2HPC B;  3L37 A;  5KJ7 D;  4WB4 A;  1RF1 C;  5CCH A;  4M3L A;  1FZG A;  1FDM A;  2HOD B;  3V2Q A;  3VMY A;  5BU5 A;  1XTC C;  3A5T A;  1DX7 A;  1JTH A;  1JOC A;  2I1J A;  3CLQ A;  1FBM A;  3M0D C;  2C9L Y;  1H89 A;  1LTG C;  1W2E A;  2Z5I A;  4O9B A;  2WPQ A;  3HE4 A;  4C7R A;  2FXM A;  3M0D A;  3EFG A;  3P8C D;  4AQR D;  3U1C A;  4XE5 B;  1RF0 A;  4KHX A;  2H7H A;  5AVV B;  1JO5 A;  3LW5 H;  3TNU B;  3MIW A;  1HWT C;  2GUV A;  1T2K C;  2OYH C;  1LTJ A;  5CCH D;  4N6J A;  1MUU A;  1HJB A;  1URQ C;  1WRG A;  1S9K E;  4I6M C;  3PP5 A;  4N78 D;  1VDF A;  2OYH A;  2YKO A;  3HE5 A;  1IFD A;  1RE4 C;  5CMZ A;  1AFO A;  3MTU E;  1URQ A;  4WBA A;  3P32 A;  1CSB A;  1NO4 A;  3U59 A;  3M0A A;  3MGN A;  3GHG A;  4JF7 A;  2P67 A;  1HUC A;  1FOS E;  5CJ0 A;  3HUS B;  2PP6 A;  1JY2 O;  1X79 B;  3B5N C;  3HD7 C;  1DEB A;  1IFM A;  4N3Y B;  2W6B A;  3RK2 D;  1SVF A;  1T2K D;  4LLH A;  3HD7 A;  3B5N A;  3H32 B;  2HYN A;  3NFQ A;  2N1T C;  1CW5 A;  5AW6 B;  1ZR2 A;  1JY3 O;  4GT1 A;  1GW3 A;  1N7S D;  2ZXE B;  3VTP C;  1GL2 D;  2XU6 A;  2R32 A;  1SP4 A;  2Q7C A;  1RE3 A;  3HTK A;  3RK3 D;  3TSI A;  3VMX A;  1L4A B;  2R5B A;  2E43 A;  2Z5H A;  2JEE A;  1NTK K;  2CPS A;  3BRV B;  4I2L C;  1ZR4 A;  3LID A;  4HYT B;  1FZC A;  2YKP A;  2FYZ A;  4EOT A;  2XZR A;  2WTY A;  3TYY A;  2Q3I A;  3O8Z A;  1HH0 A;  2POH A;  5APW A;  1FAV A;  3B5N D;  3HD7 D;  3I5C A;  1X8Y A;  3VMZ A;  1CI6 B;  5AW8 B;  1JY3 P;  4AUW A;  1GD2 E;  1N2D C;  4HH2 A;  4IFD K;  3V2P A;  3C9I A;  5BU8 B;  1DH3 A;  3KDP B;  5CCH C;  1OXZ A;  3KYQ A;  2YO3 A;  1GU4 A;  1LWU C;  3VYI A;  1LTS C;  1SQQ K;  2C0W A;  3OA7 A;  2QM7 A;  1G2C B;  1SQB K;  5APQ A;  3WMM 0;  4IFM A;  1GU5 A;  1LWU A;  1G1J A;  1ZN5 A;  1JCC A;  2LKM A;  2WSC H;  3VOP A;  4WY4 A;  3N4X A;  5APT A;  2A45 G;  1GZL A;  1J1E C;  2OYI B;  1KQL A;  1RF0 C;  1ZLL A;  2L5G B;  3BRT B;  5APX A;  5AW2 B;  3MUD A;  1X9V A;  2R5D A;  3VN0 A;  2Q9I A;  3SWF A;  5AVU B;  3M91 A;  1Z56 A;  1LTJ C;  1RY3 A;  3H6P A;  1GK6 A;  3MD0 A;  1IFN A;  1LTA C;  2FFD C;  3RK2 C;  3CL3 D;  1M1J A;  1HTL C;  4Y99 C;  3P8C E;  2N1T B;  2HLO A;  5AVX B;  1KIL B;  2FFD A;  3EQ2 A;  3V4W A;  4WY4 D;  4W7Y A;  1EQ7 A;  3L36 A;  5APV A;  2I1K A;  1N7S C;  5AW1 B;  4C46 A;  1JUN A;  1GL2 C;  4GKG A;  1GW4 A;  3BAS A;  1NTZ K;  1SQV K;  3RK3 C;  2FYU K;  2H43 A;  5AVQ B;  2WT7 B;  1FZA A;  3GHG C;  1N73 B;  3A7O A;  4ZKU A;  1N7S A;  2Z4E A;  2GM4 A;  2NPS C;  1GL2 A;  4N78 E;  1QL1 A;  1KFM A;  2KOG A;  3RL0 C;  1FJK A;  1IC2 A;  1SQX K;  1LT9 A;  1T3J A;  4C7N B;  1SFC B;  3B8E B;  1NTM K;  2IPP A;  2NPS A;  5KTB A;  1MFZ A;  2W27 A;  4W80 A;  1NOH A;  5AVZ B;  1NHL A;  2HPC A;  1N86 A;  1IO4 A;  3BAT A;  2WZ7 A;  2HG5 D;  1IJD B;  2HOD A;  1RE3 C;  5AVR B;  2KB7 P;  1T3U A;  3V2R A;  1JTH B;  1NAF A;  2A45 H;  2KYV A;  1RF1 B;  2GUS A;  2M8R A;  1FZC C;  5AVY B;  1PFI A;  1IFI A;  2NPS D;  3HE4 B;  4RES B;  1HGV A;  3VP9 A;  1A02 F;  1J1D C;  5AW9 B;  3RL0 D;  2QM8 A;  2CPB A;  3P7K A;  3V5B A;  2XV5 A;  3IR9 A;  3TNU A;  1IK9 A;  1LGH B;  2XKM A;  3HRN A;  5AW0 B;  1AQ5 A;  2Q5U A;  2C9N Y;  1L0L K;  2PAJ A;  4OH8 B;  1SLQ A;  2P2U A;  2C0X A;  1HVV A;  2JJL A;  5AVT B;  1LTJ B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...