2C9LY

Structure of the epstein-barr virus zebra protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
b'MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*AP*GP*CP*AP*CP*TP*GP*AP*CP *TP*CP*AP*TP*GP*AP*AP*GP
publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
total genus 26
structure length 63
sequence length 63
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9lY00
2WPQA 4JYBA 3HE5B 2XV5A 2Q7CA 4C7NB 3UIAA 1T2KC 1GK4A 3M06A 3P8MC 5AW5B 1JUNA 2Z5HA 1MFZA 4XE5B 4M3LA 4AYCA 1IO4A 2WTYA 1J2JB 4C46A 3L35A 2N9BA 5AVUB 3O8ZA 2BASA 5AVYB 5AW9B 3V4QA 2WT7B 2E43A 5APXA 3NMDA 2YNYA 4B86A 3KQGA 4I6MC 5APQA 5AVWB 2E42A 3V4WA 1CSBA 3A3YB 1JNMA 2C9NY 3SWFA 4AUWA 1H8AA 1GZLA 2W27A 1CI6A 1HUCA 4GKGA 2P67A 4KHXA 1GU5A 5AW4B 1GD2E 1FOSE 3M0DA 4JYCA 1A02J 2WPSA 2IPPA 3KDPB 3M9BA 3HE4B 1SP4A 3M91A 5AW0B 2W6AA 1NAFA 2Q5UA 5APTA 1GTWA 2KP8A 3TNUB 4LC1A 2R32A 3VTPC 2R3CA 3A5TA 2P7JA 3I5CA 3M0AA 3TK1A 1GU4A 3VMXA 5APSA 5APUA 4AQRD 3A7OA 1HWTC 1X8YA 2ZFCA 3IR9A 2Q3IA 2ZXEB 5AW3B 1HBWA 1HJBA 5AVZB 1FAVA 2YO3A 1G2CB 1CI6B 1OWAA 5AVTB 3VMZA 3VYIA 5AW1B 4EOTA 2VRSA 5APWA 1H88A 3L37A 3LIEA 2WWWA 3HE5A 3VMYA 5AW6B 4C7NA 1NWQA 1MV8A 5AW7B 2XZRA 5AVVB 5AVQB 3HE4A 4GT1A 3L36A 3NFQA 5CMZA 2Z5IA 5AW2B 3P32A 4HYTB 5APVA 1KQLA 3TNUA 2QM7A 2WT7A 2R5BA 3VN0A 5AVXB 1S9KE 3NTNA 5AW8B 1A02F 3TYYA 4RESB 5AVRB 2QM8A 2JJLA 3T97A 2C9LY 1GK6A 1YYCA 2R5DA 3V5BA 3P7KA 2WPRA 2P2UA 2XU6A 4I2LC 1H89A 2H7HA 1SLQA 5AVSB 1T2KD 3OAKA 3M9HA 3HTKA 3MD0A 4DZOA 3A2AA 3MGNA 3NXSA 3B8EB 1OXZA 1MUUA 1CZQA 5APYA 1S9KD 2YO2A 3LIDA 1DH3A 1FOSF
chains in the Genus database with same CATH superfamily
1BDDA 2FXOA 1LT9C 5AW5B 1HVVA 3V2NA 2D2CB 1IO4A 4U3FG 2W90A 4IOIH 5APQA 1MZ9A 1LTGC 3H6PA 2OYHC 1JOCA 2Y0EA 4GKGA 1FZCB 1VQ8P 4EDFA 1HGVA 3CCVP 4R4MA 3M91A 1NAFA 4L76A 3TGUJ 3VMXA 1ZOYC 4H0LC 1DX7A 1EDLA 1VPCA 2FYUG 3RK2B 2WMMA 3M0DC 1LTTC 1N7LA 3VYIA 2GM4A 3TGUD 2D2CD 1ZW0A 4GODA 1LTJA 5APVA 1FC2C 2OYIC 3NTNA 4RO0A 2KK7A 2C0WA 3SSUA 1OZHA 1YJ9P 2YKOA 4WVZA 2LXCB 2Z4EA 3V2QA 2KXPB 3L74D 3MP7B 3EQ2A 3RBZA 4ZKPA 2WSEJ 2IZ1A 1D7MA 2ZVOB 3RK2D 4M3LA 3H1KD 1Q90D 4AYCA 2KSEA 3A0HE 5AVYB 1LWUA 5AVWB 1NKNA 1CSBA 2WSFJ 1LNQA 2DW3A 1VQMP 1FS0E 1RE4A 1GD2E 4RJTA 4H0LD 2Q5UA 3AEEC 4MN4C 2HODA 1VQPP 1PGOA 1ZMEC 2P58A 4K3AA 4DT0A 5CBNA 1N73B 1ZP0C 2R44A 1K04A 3L74E 1IC2A 2YMYA 3CI9A 1NTZJ 1Q7YQ 1NTKG 1L0LD 2Q3EA 1SQVG 3H1KE 3W68A 3CX5H 3LIEA 3FXEA 1MV8A 4PD4D 3CC2P 1KQLA 2FYZA 3B5NB 4JF7A 1SQPJ 1NTZD 1Q2NA 4HB1A 2KOGA 1SFCB 1FZCA 1EQ7A 1AQ5A 1KYOI 3HD7C 1KC8Q 4H44C 3L72D 2M3EA 1OXZA 2OTKE 4NPFX 2QEXP 1NTMJ 1QEXA 1N2DC 2HYNA 2H43A 1KILB 5KKZC 1SQPD 1L0LK 1S1CX 3H1IJ 2N9BA 2PAJA 5B5EH 2WPVB 1L0LE 3KZIH 3BATA 2AEJA 5CJ0A 2Q1KA 3MUDA 4PD4E 1NTMD 2P1JA 2M3BA 2G3AA 4U3FD 5CCHC 3WUUA 4UB8E 2A45H 4ZKUA 3L70J 3L75J 5BU5A 5B66E 2ZYDA 1YTZI 1SFCD 3L72E 4DOJA 2PP6A 3H32B 5KLIB 1S5LX 2XDJA 4EIJA 3BRTB 1LTAC 1KILD 3V2PA 4WBAA 2QE7H 5APWA 3L37A 4C7RA 3L75D 4KJMA 2KZIA 2I8DA 2QJYB 1ZR4A 1HGZA 1KB9E 2QM8A 2J58A 1Y47A 2ZVNB 1L0NK 2IYOA 4U3FE 1L4AB 1S2EA 1SVFA 5C39A 2HR3A 4OGQC 3NXSA 1L0NE 2BEQD 3L73G 3P8CE 1USDA 2K88A 3PP5A 2K9JB 3G3ZA 1JUNA 3C9IA 1MFZA 1EDIA 2AXTH 3CD6P 1PPJE 1N73A 3HUSC 2WT7B 3VMAA 1NJIQ 2FYUK 3SWFA 4TT3H 3OJAB 4OGQB 5CCHD 2FYUE 1RF1C 2PGDA 1URQC 5KTBA 2WQYC 4PJ0E 3BASA 2KUBA 1NVOA 3ZDMA 3CXHE 1NH4A 3A5TA 3B5NA 1GU4A 3WU2E 2N1TB 3A7OA 1HBWA 3KXDA 1VQ6P 2FKWB 1NTKJ 3SFDC 2JEEA 1PGPA 3GF3A 1QL1A 1QVFO 4ZNCA 4PV1B 1JTHA 1NWQA 1IFJA 1KYOD 2QG4A 4HYTB 3I55P 2XNDH 1YITP 2MJZA 2RH0A 1NTKD 4OGQD 2Y0CA 4W80A 1SQVD 4I2LC 2O1KA 2C0XA 2PFXA 3HTKA 3H1HJ 2QIWA 3A2AA 4DZOA 2NZ2A 3OW2O 2BCCJ 3G9RA 4IL6X 1OFCX 1S9KD 1FOSF 1BCCJ 1JEKA 3CMAP 3P8MC 2N1TD 1LTJC 2KS1B 1T6AA 4XE5B 3AE5C 2YXRB 1URQD 3H1HD 2JP3A 1LTBC 4Z1MH 2ZJSE 1H0TA 1J1EB 2QVAA 5M1BA 3H1JE 2JR8A 2FFDC 5GTIE 2J5UA 3S9OA 1LTJB 3SWKA 1SQVE 4BRYA 3GG2A 1LWUC 3TK1A 3AE6C 1FZFA 1S3JA 1TU3F 2Q3IA 5AW3B 4R4LA 1RE4C 1L4AA 1FAVA 1GL2B 2V7QH 2YMKA 4LGDE 5CJ4A 2K9JA 1LP1B 3A0HH 2PRRA 1FZEA 1LWUB 1SQBG 3JCUE 2WT7A 5AVXB 1BE3J 2C9LY 2R5DA 4QMAA 4W7ZA 3U59A 5E79E 3GF7A 2QJPC 3Q5RA 1P84H 1CZQA 3LIDA 2HODB 1T3JA 2D2CC 5DJUB 2IBZG 1RE3C 1S5LE 4L75A 3GLMA 2L5GB 1NKZB 3A3YB 4AUWA 1FZCC 2W27A 3KYQA 1DEBA 3LW5J 2WPSA 1NTMG 1LT1A 4CPGA 3W67A 2KP8A 1JMMA 1VF5B 3H1IG 2MKVA 3I5CA 2IBZI 3RK2C 2IFNA 3MUDC 2UWJE 1AVOA 2YO3A 1G1IA 5DJTB 5GTHH 1CI6B 4DCKA 3GHGA 3AE9C 1IFPA 4XA4A 2QSIA 5AW1B 1LTSC 1EZVG 1U57A 3JC22 1KV4A 2R3SA 3L73E 3FWLA 2KS1A 1FZGA 2Q9IA 3L70G 3L75G 1BDCA 1EDJA 5AW8B 1PFIA 4PD4H 4N6JA 2P2UA 1NU1G 1OMIA 3I56P 2JO1A 1AVYA 3M9HA 1PIXA 1JY2O 4UB8H 2QA4P 1GK4A 5B66H 1EZVI 2E43A 1ZN5A 2YNYA 3KQGA 4KT0J 5EFWB 3CMEP 1QGKB 1GL2A 1VQ4P 3RK3B 2M0BA 2HFED 1ZLLA 3FWNA 1U7MA 2WZ7A 3KDPB 1DIPA 2W6BA 1S72P 2O3JA 1JY3O 1X0TA 1LP1A 3CWBG 1KQGB 1KB9H 1N73C 2OTLP 4W7YA 3G4SP 1W2BO 3TGUE 1KTMA 3IR9A 2HG5D 4RKUJ 3GW6A 2NPSA 2OTJP 3TDKA 1VQKP 1X79B 2FXPA 2VRSA 4U7JA 3AEGC 5AW6B 2XKMA 2K1AA 1SQBJ 2B87B 3B5NC 4ASVA 5AW2B 2JWAA 2BEZF 3Q3DA 3RK3D 1VQ5P 3H1LG 1IZNB 1N86A 3BRVB 1SFCC 3CCEP 1E5WA 1SQQG 4PJ0H 2WSCH 1QVGO 3N7NA 1OX3A 1M1JA 3RL0g 1SQBD 1Q81Q 1M90Q 3CXHH 1JCCA 1KILC 3RL0C 4TLFA 3WU2H 1IJDB 2Z5HA 3E1RA 2GUSA 4WWIA 3EWKA 3MTUE 4BWNA 3CCJP 3V4QA 1AV1A 4WY4A 4B86A 5H2FE 1VQ7P 1MFTA 1CI6A 1HUCA 2IBZD 3H1HG 4HKZH 4D6TJ 1NOHA 1JTHB 2BCCG 3RL0B 2OGUA 1BCCG 2R32A 3MIWA 1W2EA 1PV3A 4N78D 2RN0A 3PLNA 4L74A 1ZV8A 1SQXG 3VP9A 2ZFCA 2JWDA 1Z56A 2H88C 5KLIC 1SQBE 3HTKB 2E5YA 5KAFE 1NTZK 1RH5B 3H1ID 3B5ND 1FBMA 1NTZE 2KNCB 1S4XA 2XZRA 2Y9YA 3HE4A 4YXWH 2QJYC 5CCGD 3TNUA 3Q5PA 1K9MQ 2IBZE 1SQPK 1NU1J 3AEBC 1L4AC 1UIXA 1H0TB 1QX8A 1EZVD 2WPRA 1SQPE 1ZXGA 3RL0D 2B89A 1VQLP 5GTIH 3L70D 1KD1Q 2Y9ZA 3CL3D 2FY8A 1NTMK 1QLED 4N78E 4BRYB 4L73A 2Q7CA 1WRGA 2OQQA 4JPZB 3AECC 1NU1D 3A0BE 1WT6A 1NTME 3G6EP 2K37A 4EI2A 1BE3G 3VP8A 1YQ4C 2E42A 3H1IE 1N7SA 2C9NY 1GZLA 2OYIA 3N4XA 1GU5A 2E76B 1A02J 3O6QA 3GMAA 3CWBJ 5APTA 3JCUH 2B87A 3AEFC 1AA0A 1EZVE 3CC7P 1AQTA 2N1TC 2O1JA 1KILE 5E79H 3L70E 3L75E 3PHLA 1JB0J 3CWBD 4PV1C 2IZ0A 1EC5A 1NU1E 1HH0A 2I1KA 1KFMA 1Q82Q 3AE1C 5CHXA 1L4AD 5AVQB 2W6JH 2QJKB 5CMZA 2Z5IA 2QM7A 3H1LJ 1NYHA 1X9VA 1KFNA 2YIUB 1SQQJ 1GK6A 2E76D 2AEMA 5CCGA 4IFDK 3F89A 3PJSK 2LKMA 3GHGC 3G71P 3MD0A 1MUUA 2SPZA 2O01H 2WPQA 3CC4P 1LTIC 3H1LD 4NPDA 4ASWA 1G1JA 1JY2P 1SQQD 1WMKA 2QRXA 3L35A 3S1KA 1IFNA 5APXA 3CWBE 3GHGB 1H8AA 1J1EC 5AW4B 1ZRTD 2K9YA 4YTPC 2KNCA 1SP4A 2E75B 3QWOC 2ZXXA 5BU8B 3D6YA 3PRJA 1SQXJ 3TSIA 2E5TA 1DEEG 4PV1D 2BCCD 4O9BA 1USEA 3L71G 2YKPA 1BCCD 1NTKK 1GL2C 1KYOE 1SQVK 3AEDC 2E74B 3H1LE 5AVTB 1NTKE 2OARA 1SQXD 1PP9J 5AW7B 1FDOA 1P84I 4GT1A 3TF5A 2M5AA 3ABVC 2H89C 3S4RA 4IFMA 2G8YA 1S9KE 1PGJA 3PTZA 1ZRTE 3IN6A 3V5BA 4UB6E 1H89A 2NPSC 4H13B 5KLVJ 1PP9D 3M9QA 3B8EB 5TISE 1NAYA 5APYA 3R4YA 1NHLA 3H1HE 4JYBA 3D71A 3KHUA 1VQ9P 2BCCE 2WSSH 1BCCE 1VL2A 1K73Q 2BASA 5AW9B 5KLVD 2WVRA 1R8EA 5KJ7A 2E74D 1GW3A 2NPSB 1XTCC 1J1DB 1BGYG 2GUVA 3MHVA 3Q5SA 1JY2N 3CCRP 1BE3D 4GDOA 2CK3H 1GTWA 1VF5C 5K5GB 2R3CA 3WUTA 4I7ZC 1GL2D 4LLHA 2P7JA 3M0AA 4WY4C 2Q6QA 4Y99B 3AE2C 2KB7P 1M1JB 3HUSA 4EYYQ 4D6TG 2LR2A 1JY3N 4GOEA 3AEAC 2WSEH 4I7ZB 1ZR2A 3ITKA 1IFIA 1DD4A 2W8ZA 3NFQA 2IFMA 4K35A 4WY4B 2NPSD 2FYNB 5H2FH 3AE7C 1OIPA 2R5BA 1QL2A 4RESB 5AVRB 3B71A 1JO5A 2WSFH 3SWYA 4GIFA 4I1LA 1BE3E 1RQUA 1OVUA 2V7QJ 1L0NG 3C8VA 3WUVA 2HLOA 1FZBA 1M7LA 1FE6A 3BCCG 1OW7A 3HE5B 3Q1MA 1VQNP 1IFDA 1CW5A 4ZMDA 1LT9B 1J2JB 4BXLA 1PPJG 5AVUB 1HJ0A 1GMJA 5KAFH 1KB9I 1YHQP 3RK3C 1VF5D 4KHXA 2AEFA 5KAIE 2OYHB 4JYCA 4JBZA 3Q2YA 4WY4D 3HE4B 5L8RJ 3TNUB 1NO4A 1W5CE 1IK7A 1E79H 3L74J 2YKQA 3L71J 2YXQB 5APSA 1PZQA 1N7SC 4H0LB 1HWTC 1HJBA 1P84D 2N9YB 3H1KJ 1Y8AA 2ZAEB 1HTLC 2ITAA 3C1LA 2RMZA 1RF0A 4YPCA 3A0BH 3L71D 1RHZB 3CX5I 1KQFB 1R5SA 1MKMA 4IL6E 4WB4A 3CXHI 2FFDA 1N7SB 4DJGA 2JJLA 2OYIB 2ZT9C 2AXCA 2CPBA 5AVSB 3O6QB 1G2CA 1LJ2A 4OVNF 2XV5A 1T2KC 2A45G 1N8RQ 2J59M 1P84E 1L0LJ 2M8RA 1KZUB 1HF9A 5CCGC 1FDIA 3NMDA 2ZT9B 1BGYJ 3V4WA 3L71E 3D6ZA 2KIKA 2WITA 3L4FA 1IFMA 2IPPA 2Y0DA 3H1JG 3M9BA 1N7SD 4LC1A 3HRNA 1GW4A 4XFJA 1BGYD 3L72J 2A45I 4AQRD 1RE3A 1M56D 1T3UA 1KN7A 2KI7B 2OYOA 3VMZA 4EOTA 3RK3E 2LXBA 2WWWA 3HE5A 1DD3A 2CPSA 1SQBK 5GTHE 2ZT9D 1LT9A 1FU1A 4D6TD 4U3FJ 3EFGA 3P7KA 1VDFA 2XU6A 4NPEA 1AFOA 1L0NJ 1SLQA 2W83C 1T2KD 2OYHA 3MGNA 3BCCJ 1YIJP 3HD7B 4H44B 1BGYE 1KB9D 1PP9G 3FX0A 2A06G 4C7NB 4HJGH 5KKZB 1L0ND 1Y9BA 2IX7C 1KYOH 3V6IA 1UIIA 3P8CD 1K05A 2FYUJ 3BCCD 1X22A 2E76C 5KLVG 2P67A 2WSCJ 1U7JA 1FOSE 3M0DA 2KLVA 1VQOP 1PPJD 1YBKA 3D70A 4D6TE 5AW0B 2M5AB 2HPCB 1OVRA 2KYVA 2FYUD 1RY3A 1YJNP 4UB6H 5KJ7C 2P10A 1M8OB 3CX5D 2ZXEB 3IAOA 2ZYAA 3HD7D 4H44D 5BVZA 5TISH 3CCMP 3CXHD 3R2PA 1FZAA 3KPEA 3B4SA 4A7PA 1OW6A 1H88A 1YI2P 3CCSP 3SFEC 1EDKA 2QJKC 1OW8A 3RGUA 1JM0A 3P32A 3BCCE 1EXJA 2YIUC 1NU1K 4Y28J 1YQ3C 2GA1A 4IFFA 2H8PD 4HH2A 1S5LH 3U1AA 1PGQA 1YTZT 3AE3C 3CPWO 3FGAD 2FBWC 3MZWB 2B88A 3CCLP 2KSJA 3UIAA 3BVHA 3CX5E 1KQSO 1R5LA 4N3YB 1RQVA 2WTYA 4C46A 1JMBA 3O8ZA 3CCQP 3HUSB 3USSA 1L2PA 3T97B 1IK9A 3H1JJ 3JSVC 2XNXA 1RF1B 2JDIH 2POHA 3V2RA 1FDMA 1URQB 1SFCA 1SQVJ 2E75C 3U1CA 2W6AA 5KJ7D 2IDBA 3VTPC 1KILA 3TGUG 5APUA 3AE4C 3H1JD 1YJWP 2IYPA 3F5HA 2E74C 3AE8C 5B5EE 3KZIE 1OWAA 2JKVA 3HD7A 3IF4A 3VMYA 4C7NA 4OWFA 1JY3P 1OVVA 4OH8B 3IFMA 1GDTA 1FJPA 3VOPA 3L74G 3VN0A 3TYYA 1M1KQ 1SQQK 5KAIH 4H13C 1M57D 2H7HA 2ZYGA 3H1KG 1SQQE 1NGMB 1JCDA 3H32A 3LW5H 1RF0C 2NRGA 3E7KA 2YO2A 1KMIZ 2HPCA 1KORA 3WMM0 3M06A 5CCHA 1K8AQ 1SS1A 3CCUP 3OA7A 3FXDA 1J1DC 4I6MC 2E75D 1JNMA 2A06D 2V4HA 5CBOA 1PL5A 4JQ0D 3H25A 2O01J 2KZJA 4IL6H 3CLQA 3EFFK 2FFDB 1SQXK 1L0LG 4Y99C 2L91A 2AXTE 1SQXE 1X8YA 1M1JC 1BSHA 5AVZB 4GOFA 1G2CB 3II6A 2KLUA 3E1IA 2RKLA 1XTGB 1NTZG 2K3RA 3L73J 1FJKA 2O01N 5AVVB 2FYNC 2B9BA 3PH0A 4H13D 3L36A 1EXIA 1PP9E 2A06E 3L72G 2FXMA 1A02F 1Q86Q 3QH9A 3RBXA 3T97A 4YXDC 1YYCA 1LGHB 1AJYA 5TJHA 2N1TA 1SQPG 5KLVK 4PD4I 3L73D 3OAKA 3K5BA 2QJPB 1RF1A 1T8ZA 1BSNA 1URQA 5KLVE 1DH3A 2I1JA
chains in the Genus database with same CATH topology
4N78E 2XV5A 2Q7CA 1T2KC 1WRGA 1LT9C 3P8MC 2A45G 2N1TD 1HVVA 5AW5B 1LTJC 3V2NA 2J59M 1WT6A 4XE5B 1IO4A 2M8RA 1KZUB 1URQD 5CCGC 3VP8A 3NMDA 5APQA 2E42A 3V4WA 1N7SA 1MZ9A 2C9NY 1LTGC 1GZLA 3H6PA 2OYHC 1LTBC 1JOCA 2OYIA 4GKGA 3N4XA 1GU5A 1FZCB 2WITA 3L4FA 1IFMA 1A02J 2IPPA 1J1EB 1HGVA 3M9BA 3M91A 2FFDC 1N7SD 1NAFA 5APTA 1LTJB 4LC1A 3HRNA 1GW4A 3TK1A 1LWUC 2A45I 2N1TC 2O1JA 3VMXA 4AQRD 1DX7A 1VPCA 1FZFA 1RE3A 3RK2B 2Q3IA 5AW3B 1RE4C 1L4AA 1FAVA 1T3UA 3M0DC 1GL2B 1LTTC 1N7LA 1HH0A 3VMZA 3VYIA 4EOTA 2I1KA 2GM4A 1KFMA 4LGDE 2WWWA 3HE5A 5CJ4A 2CPSA 5CHXA 1SQBK 1L4AD 5AVQB 1FZEA 1LWUB 1LT9A 5CMZA 2Z5IA 1LTJA 5APVA 2QM7A 1FU1A 2WT7A 5AVXB 2OYIC 3NTNA 1X9VA 1KFNA 2C9LY 1GK6A 2R5DA 5CCGA 2C0WA 4W7ZA 3U59A 4IFDK 3EFGA 3P7KA 1VDFA 2XU6A 2YKOA 1AFOA 2LKMA 3GHGC 1SLQA 1T2KD 2Z4EA 2OYHA 3V2QA 3MD0A 3MGNA 3HD7B 1MUUA 1CZQA 3EQ2A 3LIDA 2O01H 2HODB 2WPQA 1T3JA 4ZKPA 4C7NB 1LTIC 1G1JA 1JY2P 1RE3C 3RK2D 4M3LA 4AYCA 3L35A 5AVYB 1IFNA 1LWUA 5APXA 2IX7C 3P8CD 5AVWB 1NKNA 2L5GB 1CSBA 1NKZB 3A3YB 3GHGB 4AUWA 1H8AA 1FZCC 1RE4A 2W27A 3KYQA 1DEBA 2P67A 1J1EC 5AW4B 1GD2E 1FOSE 3M0DA 2KLVA 2WPSA 1SP4A 5AW0B 2HPCB 2KYVA 2Q5UA 2KP8A 5BU8B 1JMMA 2HODA 3TSIA 3I5CA 1RY3A 1N73B 3RK2C 5KJ7C 4O9BA 2IFNA 2ZXEB 2YKPA 1IC2A 1NTKK 1GL2C 3HD7D 2YO3A 1G1IA 2YMYA 5BVZA 1SQVK 3R2PA 3CI9A 1CI6B 1FZAA 3GHGA 3KPEA 4XA4A 5AVTB 5AW1B 1LTSC 1H88A 3LIEA 2OARA 1MV8A 5AW7B 4GT1A 1FZGA 2Q9IA 3P32A 1KQLA 4IFMA 2FYZA 3B5NB 1NU1K 1S9KE 5AW8B 4JF7A 1PFIA 3V5BA 4N6JA 1H89A 2P2UA 2NPSC 4IFFA 2KOGA 3M9HA 1SFCB 1FZCA 1EQ7A 2H8PD 4HH2A 1AQ5A 3U1AA 3HD7C 1YTZT 3M9QA 3B8EB 1OXZA 1JY2O 5APYA 1NHLA 4JYBA 1N2DC 2HYNA 2KSJA 2H43A 3UIAA 1GK4A 1KILB 3BVHA 4N3YB 1L0LK 2WTYA 4C46A 2N9BA 3O8ZA 2BASA 5AW9B 2E43A 1ZN5A 2YNYA 3HUSB 2PAJA 3KQGA 5KJ7A 1GW3A 2NPSB 3BATA 1XTCC 1J1DB 5CJ0A 3MUDA 1IK9A 1GL2A 2GUVA 3RK3B 2HFED 1ZLLA 2P1JA 2XNXA 1RF1B 1JY2N 2POHA 3V2RA 2M3BA 1FDMA 2WZ7A 1URQB 1SFCA 3KDPB 2W6BA 3U1CA 1JY3O 2W6AA 5KJ7D 1GTWA 5CCHC 3VTPC 2R3CA 2A45H 4ZKUA 1GL2D 4LLHA 1N73C 2P7JA 3M0AA 4W7YA 4WY4C 5BU5A 1KILA 5APUA 1YTZI 1SFCD 4Y99B 3IR9A 2HG5D 4DOJA 2PP6A 3H32B 2KB7P 1M1JB 3HUSA 2NPSA 2XDJA 1OWAA 1X79B 4EIJA 3BRTB 1LTAC 1KILD 3HD7A 4WBAA 3V2PA 2VRSA 5APWA 1JY3N 3L37A 3VMYA 5AW6B 4C7NA 4C7RA 1JY3P 2WSEH 2XKMA 1ZR2A 1IFIA 4OH8B 3IFMA 1GDTA 3NFQA 2IFMA 4WY4B 3B5NC 1FJPA 2NPSD 5AW2B 3VOPA 2R5BA 3VN0A 1ZR4A 1HGZA 3TYYA 1QL2A 1SQQK 4RESB 5AVRB 2QM8A 2J58A 3RK3D 1JO5A 2WSFH 3SWYA 4GIFA 4I1LA 1N86A 3BRVB 1L0NK 2H7HA 1L4AB 1SFCC 1E5WA 1SVFA 2WSCH 1JCDA 3N7NA 3H32A 3LW5H 1M1JA 3NXSA 1RF0C 2YO2A 3P8CE 2HLOA 1FZBA 1M7LA 1JCCA 2HPCA 3HE5B 1KILC 3PP5A 3RL0C 3WMM0 3G3ZA 1IFDA 3M06A 1CW5A 1IJDB 1JUNA 3C9IA 5CCHA 2Z5HA 1MFZA 1LT9B 2GUSA 1J2JB 3MTUE 5AVUB 1N73A 3HUSC 3V4QA 2WT7B 3OA7A 4WY4A 4B86A 1J1DC 2FYUK 4I6MC 1JNMA 3SWFA 3OJAB 3RK3C 1CI6A 1HUCA 4KHXA 5CCHD 1RF1C 2OYHB 1NOHA 1JTHB 1URQC 4JYCA 5KTBA 4WY4D 3RL0B 3HE4B 3CLQA 3BASA 3TNUB 1NO4A 2R32A 2FFDB 3MIWA 1NH4A 1SQXK 3A5TA 1W2EA 2YKQA 3B5NA 1GU4A 4N78D 4Y99C 5APSA 1ZV8A 1N7SC 2N1TB 3VP9A 3A7OA 1HWTC 1X8YA 2ZFCA 1Z56A 1M1JC 1HBWA 1HJBA 3HTKB 5AVZB 2FKWB 1G2CB 2JEEA 3II6A 1NTZK 1QL1A 1HTLC 3E1IA 3B5ND 1XTGB 1FBMA 1RF0A 1JTHA 1FJKA 1NWQA 2XZRA 5AVVB 3HE4A 1IFJA 3L36A 4WB4A 4HYTB 5CCGD 3TNUA 2FFDA 1N7SB 2FXMA 2MJZA 1A02F 1SQPK 2JJLA 4W80A 3T97A 1L4AC 1YYCA 1LGHB 2OYIB 2WPRA 4I2LC 2N1TA 5KLVK 2O1KA 3RL0D 2C0XA 2CPBA 5AVSB 3OAKA 3HTKA 4DZOA 3A2AA 1RF1A 1G2CA 1T8ZA 1URQA 3CL3D 1S9KD 1DH3A 1FOSF 2I1JA 1NTMK
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WPQ A;  4JYB A;  3HE5 B;  2XV5 A;  2Q7C A;  4C7N B;  3UIA A;  1T2K C;  1GK4 A;  3M06 A;  3P8M C;  5AW5 B;  1JUN A;  2Z5H A;  1MFZ A;  4XE5 B;  4M3L A;  4AYC A;  1IO4 A;  2WTY A;  1J2J B;  4C46 A;  3L35 A;  2N9B A;  5AVU B;  3O8Z A;  2BAS A;  5AVY B;  5AW9 B;  3V4Q A;  2WT7 B;  2E43 A;  5APX A;  3NMD A;  2YNY A;  4B86 A;  3KQG A;  4I6M C;  5APQ A;  5AVW B;  2E42 A;  3V4W A;  1CSB A;  3A3Y B;  1JNM A;  2C9N Y;  3SWF A;  4AUW A;  1H8A A;  1GZL A;  2W27 A;  1CI6 A;  1HUC A;  4GKG A;  2P67 A;  4KHX A;  1GU5 A;  5AW4 B;  1GD2 E;  1FOS E;  3M0D A;  4JYC A;  1A02 J;  2WPS A;  2IPP A;  3KDP B;  3M9B A;  3HE4 B;  1SP4 A;  3M91 A;  5AW0 B;  2W6A A;  1NAF A;  2Q5U A;  5APT A;  1GTW A;  2KP8 A;  3TNU B;  4LC1 A;  2R32 A;  3VTP C;  2R3C A;  3A5T A;  2P7J A;  3I5C A;  3M0A A;  3TK1 A;  1GU4 A;  3VMX A;  5APS A;  5APU A;  4AQR D;  3A7O A;  1HWT C;  1X8Y A;  2ZFC A;  3IR9 A;  2Q3I A;  2ZXE B;  5AW3 B;  1HBW A;  1HJB A;  5AVZ B;  1FAV A;  2YO3 A;  1G2C B;  1CI6 B;  1OWA A;  5AVT B;  3VMZ A;  3VYI A;  5AW1 B;  4EOT A;  2VRS A;  5APW A;  1H88 A;  3L37 A;  3LIE A;  2WWW A;  3HE5 A;  3VMY A;  5AW6 B;  4C7N A;  1NWQ A;  1MV8 A;  5AW7 B;  2XZR A;  5AVV B;  5AVQ B;  3HE4 A;  4GT1 A;  3L36 A;  3NFQ A;  5CMZ A;  2Z5I A;  5AW2 B;  3P32 A;  4HYT B;  5APV A;  1KQL A;  3TNU A;  2QM7 A;  2WT7 A;  2R5B A;  3VN0 A;  5AVX B;  1S9K E;  3NTN A;  5AW8 B;  1A02 F;  3TYY A;  4RES B;  5AVR B;  2QM8 A;  2JJL A;  3T97 A;  2C9L Y;  1GK6 A;  1YYC A;  2R5D A;  3V5B A;  3P7K A;  2WPR A;  2P2U A;  2XU6 A;  4I2L C;  1H89 A;  2H7H A;  1SLQ A;  5AVS B;  1T2K D;  3OAK A;  3M9H A;  3HTK A;  3MD0 A;  4DZO A;  3A2A A;  3MGN A;  3NXS A;  3B8E B;  1OXZ A;  1MUU A;  1CZQ A;  5APY A;  1S9K D;  2YO2 A;  3LID A;  1DH3 A;  1FOS F; 
#chains in the Genus database with same CATH topology
 1BDD A;  2FXO A;  1LT9 C;  5AW5 B;  1HVV A;  3V2N A;  2D2C B;  1IO4 A;  4U3F G;  2W90 A;  4IOI H;  5APQ A;  1MZ9 A;  1LTG C;  3H6P A;  2OYH C;  1JOC A;  2Y0E A;  4GKG A;  1FZC B;  1VQ8 P;  4EDF A;  1HGV A;  3CCV P;  4R4M A;  3M91 A;  1NAF A;  4L76 A;  3TGU J;  3VMX A;  1ZOY C;  4H0L C;  1DX7 A;  1EDL A;  1VPC A;  2FYU G;  3RK2 B;  2WMM A;  3M0D C;  1LTT C;  1N7L A;  3VYI A;  2GM4 A;  3TGU D;  2D2C D;  1ZW0 A;  4GOD A;  1LTJ A;  5APV A;  1FC2 C;  2OYI C;  3NTN A;  4RO0 A;  2KK7 A;  2C0W A;  3SSU A;  1OZH A;  1YJ9 P;  2YKO A;  4WVZ A;  2LXC B;  2Z4E A;  3V2Q A;  2KXP B;  3L74 D;  3MP7 B;  3EQ2 A;  3RBZ A;  4ZKP A;  2WSE J;  2IZ1 A;  1D7M A;  2ZVO B;  3RK2 D;  4M3L A;  3H1K D;  1Q90 D;  4AYC A;  2KSE A;  3A0H E;  5AVY B;  1LWU A;  5AVW B;  1NKN A;  1CSB A;  2WSF J;  1LNQ A;  2DW3 A;  1VQM P;  1FS0 E;  1RE4 A;  1GD2 E;  4RJT A;  4H0L D;  2Q5U A;  3AEE C;  4MN4 C;  2HOD A;  1VQP P;  1PGO A;  1ZME C;  2P58 A;  4K3A A;  4DT0 A;  5CBN A;  1N73 B;  1ZP0 C;  2R44 A;  1K04 A;  3L74 E;  1IC2 A;  2YMY A;  3CI9 A;  1NTZ J;  1Q7Y Q;  1NTK G;  1L0L D;  2Q3E A;  1SQV G;  3H1K E;  3W68 A;  3CX5 H;  3LIE A;  3FXE A;  1MV8 A;  4PD4 D;  3CC2 P;  1KQL A;  2FYZ A;  3B5N B;  4JF7 A;  1SQP J;  1NTZ D;  1Q2N A;  4HB1 A;  2KOG A;  1SFC B;  1FZC A;  1EQ7 A;  1AQ5 A;  1KYO I;  3HD7 C;  1KC8 Q;  4H44 C;  3L72 D;  2M3E A;  1OXZ A;  2OTK E;  4NPF X;  2QEX P;  1NTM J;  1QEX A;  1N2D C;  2HYN A;  2H43 A;  1KIL B;  5KKZ C;  1SQP D;  1L0L K;  1S1C X;  3H1I J;  2N9B A;  2PAJ A;  5B5E H;  2WPV B;  1L0L E;  3KZI H;  3BAT A;  2AEJ A;  5CJ0 A;  2Q1K A;  3MUD A;  4PD4 E;  1NTM D;  2P1J A;  2M3B A;  2G3A A;  4U3F D;  5CCH C;  3WUU A;  4UB8 E;  2A45 H;  4ZKU A;  3L70 J;  3L75 J;  5BU5 A;  5B66 E;  2ZYD A;  1YTZ I;  1SFC D;  3L72 E;  4DOJ A;  2PP6 A;  3H32 B;  5KLI B;  1S5L X;  2XDJ A;  4EIJ A;  3BRT B;  1LTA C;  1KIL D;  3V2P A;  4WBA A;  2QE7 H;  5APW A;  3L37 A;  4C7R A;  3L75 D;  4KJM A;  2KZI A;  2I8D A;  2QJY B;  1ZR4 A;  1HGZ A;  1KB9 E;  2QM8 A;  2J58 A;  1Y47 A;  2ZVN B;  1L0N K;  2IYO A;  4U3F E;  1L4A B;  1S2E A;  1SVF A;  5C39 A;  2HR3 A;  4OGQ C;  3NXS A;  1L0N E;  2BEQ D;  3L73 G;  3P8C E;  1USD A;  2K88 A;  3PP5 A;  2K9J B;  3G3Z A;  1JUN A;  3C9I A;  1MFZ A;  1EDI A;  2AXT H;  3CD6 P;  1PPJ E;  1N73 A;  3HUS C;  2WT7 B;  3VMA A;  1NJI Q;  2FYU K;  3SWF A;  4TT3 H;  3OJA B;  4OGQ B;  5CCH D;  2FYU E;  1RF1 C;  2PGD A;  1URQ C;  5KTB A;  2WQY C;  4PJ0 E;  3BAS A;  2KUB A;  1NVO A;  3ZDM A;  3CXH E;  1NH4 A;  3A5T A;  3B5N A;  1GU4 A;  3WU2 E;  2N1T B;  3A7O A;  1HBW A;  3KXD A;  1VQ6 P;  2FKW B;  1NTK J;  3SFD C;  2JEE A;  1PGP A;  3GF3 A;  1QL1 A;  1QVF O;  4ZNC A;  4PV1 B;  1JTH A;  1NWQ A;  1IFJ A;  1KYO D;  2QG4 A;  4HYT B;  3I55 P;  2XND H;  1YIT P;  2MJZ A;  2RH0 A;  1NTK D;  4OGQ D;  2Y0C A;  4W80 A;  1SQV D;  4I2L C;  2O1K A;  2C0X A;  2PFX A;  3HTK A;  3H1H J;  2QIW A;  3A2A A;  4DZO A;  2NZ2 A;  3OW2 O;  2BCC J;  3G9R A;  4IL6 X;  1OFC X;  1S9K D;  1FOS F;  1BCC J;  1JEK A;  3CMA P;  3P8M C;  2N1T D;  1LTJ C;  2KS1 B;  1T6A A;  4XE5 B;  3AE5 C;  2YXR B;  1URQ D;  3H1H D;  2JP3 A;  1LTB C;  4Z1M H;  2ZJS E;  1H0T A;  1J1E B;  2QVA A;  5M1B A;  3H1J E;  2JR8 A;  2FFD C;  5GTI E;  2J5U A;  3S9O A;  1LTJ B;  3SWK A;  1SQV E;  4BRY A;  3GG2 A;  1LWU C;  3TK1 A;  3AE6 C;  1FZF A;  1S3J A;  1TU3 F;  2Q3I A;  5AW3 B;  4R4L A;  1RE4 C;  1L4A A;  1FAV A;  1GL2 B;  2V7Q H;  2YMK A;  4LGD E;  5CJ4 A;  2K9J A;  1LP1 B;  3A0H H;  2PRR A;  1FZE A;  1LWU B;  1SQB G;  3JCU E;  2WT7 A;  5AVX B;  1BE3 J;  2C9L Y;  2R5D A;  4QMA A;  4W7Z A;  3U59 A;  5E79 E;  3GF7 A;  2QJP C;  3Q5R A;  1P84 H;  1CZQ A;  3LID A;  2HOD B;  1T3J A;  2D2C C;  5DJU B;  2IBZ G;  1RE3 C;  1S5L E;  4L75 A;  3GLM A;  2L5G B;  1NKZ B;  3A3Y B;  4AUW A;  1FZC C;  2W27 A;  3KYQ A;  1DEB A;  3LW5 J;  2WPS A;  1NTM G;  1LT1 A;  4CPG A;  3W67 A;  2KP8 A;  1JMM A;  1VF5 B;  3H1I G;  2MKV A;  3I5C A;  2IBZ I;  3RK2 C;  2IFN A;  3MUD C;  2UWJ E;  1AVO A;  2YO3 A;  1G1I A;  5DJT B;  5GTH H;  1CI6 B;  4DCK A;  3GHG A;  3AE9 C;  1IFP A;  4XA4 A;  2QSI A;  5AW1 B;  1LTS C;  1EZV G;  1U57 A;  3JC2 2;  1KV4 A;  2R3S A;  3L73 E;  3FWL A;  2KS1 A;  1FZG A;  2Q9I A;  3L70 G;  3L75 G;  1BDC A;  1EDJ A;  5AW8 B;  1PFI A;  4PD4 H;  4N6J A;  2P2U A;  1NU1 G;  1OMI A;  3I56 P;  2JO1 A;  1AVY A;  3M9H A;  1PIX A;  1JY2 O;  4UB8 H;  2QA4 P;  1GK4 A;  5B66 H;  1EZV I;  2E43 A;  1ZN5 A;  2YNY A;  3KQG A;  4KT0 J;  5EFW B;  3CME P;  1QGK B;  1GL2 A;  1VQ4 P;  3RK3 B;  2M0B A;  2HFE D;  1ZLL A;  3FWN A;  1U7M A;  2WZ7 A;  3KDP B;  1DIP A;  2W6B A;  1S72 P;  2O3J A;  1JY3 O;  1X0T A;  1LP1 A;  3CWB G;  1KQG B;  1KB9 H;  1N73 C;  2OTL P;  4W7Y A;  3G4S P;  1W2B O;  3TGU E;  1KTM A;  3IR9 A;  2HG5 D;  4RKU J;  3GW6 A;  2NPS A;  2OTJ P;  3TDK A;  1VQK P;  1X79 B;  2FXP A;  2VRS A;  4U7J A;  3AEG C;  5AW6 B;  2XKM A;  2K1A A;  1SQB J;  2B87 B;  3B5N C;  4ASV A;  5AW2 B;  2JWA A;  2BEZ F;  3Q3D A;  3RK3 D;  1VQ5 P;  3H1L G;  1IZN B;  1N86 A;  3BRV B;  1SFC C;  3CCE P;  1E5W A;  1SQQ G;  4PJ0 H;  2WSC H;  1QVG O;  3N7N A;  1OX3 A;  1M1J A;  3RL0 g;  1SQB D;  1Q81 Q;  1M90 Q;  3CXH H;  1JCC A;  1KIL C;  3RL0 C;  4TLF A;  3WU2 H;  1IJD B;  2Z5H A;  3E1R A;  2GUS A;  4WWI A;  3EWK A;  3MTU E;  4BWN A;  3CCJ P;  3V4Q A;  1AV1 A;  4WY4 A;  4B86 A;  5H2F E;  1VQ7 P;  1MFT A;  1CI6 A;  1HUC A;  2IBZ D;  3H1H G;  4HKZ H;  4D6T J;  1NOH A;  1JTH B;  2BCC G;  3RL0 B;  2OGU A;  1BCC G;  2R32 A;  3MIW A;  1W2E A;  1PV3 A;  4N78 D;  2RN0 A;  3PLN A;  4L74 A;  1ZV8 A;  1SQX G;  3VP9 A;  2ZFC A;  2JWD A;  1Z56 A;  2H88 C;  5KLI C;  1SQB E;  3HTK B;  2E5Y A;  5KAF E;  1NTZ K;  1RH5 B;  3H1I D;  3B5N D;  1FBM A;  1NTZ E;  2KNC B;  1S4X A;  2XZR A;  2Y9Y A;  3HE4 A;  4YXW H;  2QJY C;  5CCG D;  3TNU A;  3Q5P A;  1K9M Q;  2IBZ E;  1SQP K;  1NU1 J;  3AEB C;  1L4A C;  1UIX A;  1H0T B;  1QX8 A;  1EZV D;  2WPR A;  1SQP E;  1ZXG A;  3RL0 D;  2B89 A;  1VQL P;  5GTI H;  3L70 D;  1KD1 Q;  2Y9Z A;  3CL3 D;  2FY8 A;  1NTM K;  1QLE D;  4N78 E;  4BRY B;  4L73 A;  2Q7C A;  1WRG A;  2OQQ A;  4JPZ B;  3AEC C;  1NU1 D;  3A0B E;  1WT6 A;  1NTM E;  3G6E P;  2K37 A;  4EI2 A;  1BE3 G;  3VP8 A;  1YQ4 C;  2E42 A;  3H1I E;  1N7S A;  2C9N Y;  1GZL A;  2OYI A;  3N4X A;  1GU5 A;  2E76 B;  1A02 J;  3O6Q A;  3GMA A;  3CWB J;  5APT A;  3JCU H;  2B87 A;  3AEF C;  1AA0 A;  1EZV E;  3CC7 P;  1AQT A;  2N1T C;  2O1J A;  1KIL E;  5E79 H;  3L70 E;  3L75 E;  3PHL A;  1JB0 J;  3CWB D;  4PV1 C;  2IZ0 A;  1EC5 A;  1NU1 E;  1HH0 A;  2I1K A;  1KFM A;  1Q82 Q;  3AE1 C;  5CHX A;  1L4A D;  5AVQ B;  2W6J H;  2QJK B;  5CMZ A;  2Z5I A;  2QM7 A;  3H1L J;  1NYH A;  1X9V A;  1KFN A;  2YIU B;  1SQQ J;  1GK6 A;  2E76 D;  2AEM A;  5CCG A;  4IFD K;  3F89 A;  3PJS K;  2LKM A;  3GHG C;  3G71 P;  3MD0 A;  1MUU A;  2SPZ A;  2O01 H;  2WPQ A;  3CC4 P;  1LTI C;  3H1L D;  4NPD A;  4ASW A;  1G1J A;  1JY2 P;  1SQQ D;  1WMK A;  2QRX A;  3L35 A;  3S1K A;  1IFN A;  5APX A;  3CWB E;  3GHG B;  1H8A A;  1J1E C;  5AW4 B;  1ZRT D;  2K9Y A;  4YTP C;  2KNC A;  1SP4 A;  2E75 B;  3QWO C;  2ZXX A;  5BU8 B;  3D6Y A;  3PRJ A;  1SQX J;  3TSI A;  2E5T A;  1DEE G;  4PV1 D;  2BCC D;  4O9B A;  1USE A;  3L71 G;  2YKP A;  1BCC D;  1NTK K;  1GL2 C;  1KYO E;  1SQV K;  3AED C;  2E74 B;  3H1L E;  5AVT B;  1NTK E;  2OAR A;  1SQX D;  1PP9 J;  5AW7 B;  1FDO A;  1P84 I;  4GT1 A;  3TF5 A;  2M5A A;  3ABV C;  2H89 C;  3S4R A;  4IFM A;  2G8Y A;  1S9K E;  1PGJ A;  3PTZ A;  1ZRT E;  3IN6 A;  3V5B A;  4UB6 E;  1H89 A;  2NPS C;  4H13 B;  5KLV J;  1PP9 D;  3M9Q A;  3B8E B;  5TIS E;  1NAY A;  5APY A;  3R4Y A;  1NHL A;  3H1H E;  4JYB A;  3D71 A;  3KHU A;  1VQ9 P;  2BCC E;  2WSS H;  1BCC E;  1VL2 A;  1K73 Q;  2BAS A;  5AW9 B;  5KLV D;  2WVR A;  1R8E A;  5KJ7 A;  2E74 D;  1GW3 A;  2NPS B;  1XTC C;  1J1D B;  1BGY G;  2GUV A;  3MHV A;  3Q5S A;  1JY2 N;  3CCR P;  1BE3 D;  4GDO A;  2CK3 H;  1GTW A;  1VF5 C;  5K5G B;  2R3C A;  3WUT A;  4I7Z C;  1GL2 D;  4LLH A;  2P7J A;  3M0A A;  4WY4 C;  2Q6Q A;  4Y99 B;  3AE2 C;  2KB7 P;  1M1J B;  3HUS A;  4EYY Q;  4D6T G;  2LR2 A;  1JY3 N;  4GOE A;  3AEA C;  2WSE H;  4I7Z B;  1ZR2 A;  3ITK A;  1IFI A;  1DD4 A;  2W8Z A;  3NFQ A;  2IFM A;  4K35 A;  4WY4 B;  2NPS D;  2FYN B;  5H2F H;  3AE7 C;  1OIP A;  2R5B A;  1QL2 A;  4RES B;  5AVR B;  3B71 A;  1JO5 A;  2WSF H;  3SWY A;  4GIF A;  4I1L A;  1BE3 E;  1RQU A;  1OVU A;  2V7Q J;  1L0N G;  3C8V A;  3WUV A;  2HLO A;  1FZB A;  1M7L A;  1FE6 A;  3BCC G;  1OW7 A;  3HE5 B;  3Q1M A;  1VQN P;  1IFD A;  1CW5 A;  4ZMD A;  1LT9 B;  1J2J B;  4BXL A;  1PPJ G;  5AVU B;  1HJ0 A;  1GMJ A;  5KAF H;  1KB9 I;  1YHQ P;  3RK3 C;  1VF5 D;  4KHX A;  2AEF A;  5KAI E;  2OYH B;  4JYC A;  4JBZ A;  3Q2Y A;  4WY4 D;  3HE4 B;  5L8R J;  3TNU B;  1NO4 A;  1W5C E;  1IK7 A;  1E79 H;  3L74 J;  2YKQ A;  3L71 J;  2YXQ B;  5APS A;  1PZQ A;  1N7S C;  4H0L B;  1HWT C;  1HJB A;  1P84 D;  2N9Y B;  3H1K J;  1Y8A A;  2ZAE B;  1HTL C;  2ITA A;  3C1L A;  2RMZ A;  1RF0 A;  4YPC A;  3A0B H;  3L71 D;  1RHZ B;  3CX5 I;  1KQF B;  1R5S A;  1MKM A;  4IL6 E;  4WB4 A;  3CXH I;  2FFD A;  1N7S B;  4DJG A;  2JJL A;  2OYI B;  2ZT9 C;  2AXC A;  2CPB A;  5AVS B;  3O6Q B;  1G2C A;  1LJ2 A;  4OVN F;  2XV5 A;  1T2K C;  2A45 G;  1N8R Q;  2J59 M;  1P84 E;  1L0L J;  2M8R A;  1KZU B;  1HF9 A;  5CCG C;  1FDI A;  3NMD A;  2ZT9 B;  1BGY J;  3V4W A;  3L71 E;  3D6Z A;  2KIK A;  2WIT A;  3L4F A;  1IFM A;  2IPP A;  2Y0D A;  3H1J G;  3M9B A;  1N7S D;  4LC1 A;  3HRN A;  1GW4 A;  4XFJ A;  1BGY D;  3L72 J;  2A45 I;  4AQR D;  1RE3 A;  1M56 D;  1T3U A;  1KN7 A;  2KI7 B;  2OYO A;  3VMZ A;  4EOT A;  3RK3 E;  2LXB A;  2WWW A;  3HE5 A;  1DD3 A;  2CPS A;  1SQB K;  5GTH E;  2ZT9 D;  1LT9 A;  1FU1 A;  4D6T D;  4U3F J;  3EFG A;  3P7K A;  1VDF A;  2XU6 A;  4NPE A;  1AFO A;  1L0N J;  1SLQ A;  2W83 C;  1T2K D;  2OYH A;  3MGN A;  3BCC J;  1YIJ P;  3HD7 B;  4H44 B;  1BGY E;  1KB9 D;  1PP9 G;  3FX0 A;  2A06 G;  4C7N B;  4HJG H;  5KKZ B;  1L0N D;  1Y9B A;  2IX7 C;  1KYO H;  3V6I A;  1UII A;  3P8C D;  1K05 A;  2FYU J;  3BCC D;  1X22 A;  2E76 C;  5KLV G;  2P67 A;  2WSC J;  1U7J A;  1FOS E;  3M0D A;  2KLV A;  1VQO P;  1PPJ D;  1YBK A;  3D70 A;  4D6T E;  5AW0 B;  2M5A B;  2HPC B;  1OVR A;  2KYV A;  2FYU D;  1RY3 A;  1YJN P;  4UB6 H;  5KJ7 C;  2P10 A;  1M8O B;  3CX5 D;  2ZXE B;  3IAO A;  2ZYA A;  3HD7 D;  4H44 D;  5BVZ A;  5TIS H;  3CCM P;  3CXH D;  3R2P A;  1FZA A;  3KPE A;  3B4S A;  4A7P A;  1OW6 A;  1H88 A;  1YI2 P;  3CCS P;  3SFE C;  1EDK A;  2QJK C;  1OW8 A;  3RGU A;  1JM0 A;  3P32 A;  3BCC E;  1EXJ A;  2YIU C;  1NU1 K;  4Y28 J;  1YQ3 C;  2GA1 A;  4IFF A;  2H8P D;  4HH2 A;  1S5L H;  3U1A A;  1PGQ A;  1YTZ T;  3AE3 C;  3CPW O;  3FGA D;  2FBW C;  3MZW B;  2B88 A;  3CCL P;  2KSJ A;  3UIA A;  3BVH A;  3CX5 E;  1KQS O;  1R5L A;  4N3Y B;  1RQV A;  2WTY A;  4C46 A;  1JMB A;  3O8Z A;  3CCQ P;  3HUS B;  3USS A;  1L2P A;  3T97 B;  1IK9 A;  3H1J J;  3JSV C;  2XNX A;  1RF1 B;  2JDI H;  2POH A;  3V2R A;  1FDM A;  1URQ B;  1SFC A;  1SQV J;  2E75 C;  3U1C A;  2W6A A;  5KJ7 D;  2IDB A;  3VTP C;  1KIL A;  3TGU G;  5APU A;  3AE4 C;  3H1J D;  1YJW P;  2IYP A;  3F5H A;  2E74 C;  3AE8 C;  5B5E E;  3KZI E;  1OWA A;  2JKV A;  3HD7 A;  3IF4 A;  3VMY A;  4C7N A;  4OWF A;  1JY3 P;  1OVV A;  4OH8 B;  3IFM A;  1GDT A;  1FJP A;  3VOP A;  3L74 G;  3VN0 A;  3TYY A;  1M1K Q;  1SQQ K;  5KAI H;  4H13 C;  1M57 D;  2H7H A;  2ZYG A;  3H1K G;  1SQQ E;  1NGM B;  1JCD A;  3H32 A;  3LW5 H;  1RF0 C;  2NRG A;  3E7K A;  2YO2 A;  1KMI Z;  2HPC A;  1KOR A;  3WMM 0;  3M06 A;  5CCH A;  1K8A Q;  1SS1 A;  3CCU P;  3OA7 A;  3FXD A;  1J1D C;  4I6M C;  2E75 D;  1JNM A;  2A06 D;  2V4H A;  5CBO A;  1PL5 A;  4JQ0 D;  3H25 A;  2O01 J;  2KZJ A;  4IL6 H;  3CLQ A;  3EFF K;  2FFD B;  1SQX K;  1L0L G;  4Y99 C;  2L91 A;  2AXT E;  1SQX E;  1X8Y A;  1M1J C;  1BSH A;  5AVZ B;  4GOF A;  1G2C B;  3II6 A;  2KLU A;  3E1I A;  2RKL A;  1XTG B;  1NTZ G;  2K3R A;  3L73 J;  1FJK A;  2O01 N;  5AVV B;  2FYN C;  2B9B A;  3PH0 A;  4H13 D;  3L36 A;  1EXI A;  1PP9 E;  2A06 E;  3L72 G;  2FXM A;  1A02 F;  1Q86 Q;  3QH9 A;  3RBX A;  3T97 A;  4YXD C;  1YYC A;  1LGH B;  1AJY A;  5TJH A;  2N1T A;  1SQP G;  5KLV K;  4PD4 I;  3L73 D;  3OAK A;  3K5B A;  2QJP B;  1RF1 A;  1T8Z A;  1BSN A;  1URQ A;  5KLV E;  1DH3 A;  2I1J A; 
#chains in the Genus database with same CATH homology
 4N78 E;  2XV5 A;  2Q7C A;  1T2K C;  1WRG A;  1LT9 C;  3P8M C;  2A45 G;  2N1T D;  1HVV A;  5AW5 B;  1LTJ C;  3V2N A;  2J59 M;  1WT6 A;  4XE5 B;  1IO4 A;  2M8R A;  1KZU B;  1URQ D;  5CCG C;  3VP8 A;  3NMD A;  5APQ A;  2E42 A;  3V4W A;  1N7S A;  1MZ9 A;  2C9N Y;  1LTG C;  1GZL A;  3H6P A;  2OYH C;  1LTB C;  1JOC A;  2OYI A;  4GKG A;  3N4X A;  1GU5 A;  1FZC B;  2WIT A;  3L4F A;  1IFM A;  1A02 J;  2IPP A;  1J1E B;  1HGV A;  3M9B A;  3M91 A;  2FFD C;  1N7S D;  1NAF A;  5APT A;  1LTJ B;  4LC1 A;  3HRN A;  1GW4 A;  3TK1 A;  1LWU C;  2A45 I;  2N1T C;  2O1J A;  3VMX A;  4AQR D;  1DX7 A;  1VPC A;  1FZF A;  1RE3 A;  3RK2 B;  2Q3I A;  5AW3 B;  1RE4 C;  1L4A A;  1FAV A;  1T3U A;  3M0D C;  1GL2 B;  1LTT C;  1N7L A;  1HH0 A;  3VMZ A;  3VYI A;  4EOT A;  2I1K A;  2GM4 A;  1KFM A;  4LGD E;  2WWW A;  3HE5 A;  5CJ4 A;  2CPS A;  5CHX A;  1SQB K;  1L4A D;  5AVQ B;  1FZE A;  1LWU B;  1LT9 A;  5CMZ A;  2Z5I A;  1LTJ A;  5APV A;  2QM7 A;  1FU1 A;  2WT7 A;  5AVX B;  2OYI C;  3NTN A;  1X9V A;  1KFN A;  2C9L Y;  1GK6 A;  2R5D A;  5CCG A;  2C0W A;  4W7Z A;  3U59 A;  4IFD K;  3EFG A;  3P7K A;  1VDF A;  2XU6 A;  2YKO A;  1AFO A;  2LKM A;  3GHG C;  1SLQ A;  1T2K D;  2Z4E A;  2OYH A;  3V2Q A;  3MD0 A;  3MGN A;  3HD7 B;  1MUU A;  1CZQ A;  3EQ2 A;  3LID A;  2O01 H;  2HOD B;  2WPQ A;  1T3J A;  4ZKP A;  4C7N B;  1LTI C;  1G1J A;  1JY2 P;  1RE3 C;  3RK2 D;  4M3L A;  4AYC A;  3L35 A;  5AVY B;  1IFN A;  1LWU A;  5APX A;  2IX7 C;  3P8C D;  5AVW B;  1NKN A;  2L5G B;  1CSB A;  1NKZ B;  3A3Y B;  3GHG B;  4AUW A;  1H8A A;  1FZC C;  1RE4 A;  2W27 A;  3KYQ A;  1DEB A;  2P67 A;  1J1E C;  5AW4 B;  1GD2 E;  1FOS E;  3M0D A;  2KLV A;  2WPS A;  1SP4 A;  5AW0 B;  2HPC B;  2KYV A;  2Q5U A;  2KP8 A;  5BU8 B;  1JMM A;  2HOD A;  3TSI A;  3I5C A;  1RY3 A;  1N73 B;  3RK2 C;  5KJ7 C;  4O9B A;  2IFN A;  2ZXE B;  2YKP A;  1IC2 A;  1NTK K;  1GL2 C;  3HD7 D;  2YO3 A;  1G1I A;  2YMY A;  5BVZ A;  1SQV K;  3R2P A;  3CI9 A;  1CI6 B;  1FZA A;  3GHG A;  3KPE A;  4XA4 A;  5AVT B;  5AW1 B;  1LTS C;  1H88 A;  3LIE A;  2OAR A;  1MV8 A;  5AW7 B;  4GT1 A;  1FZG A;  2Q9I A;  3P32 A;  1KQL A;  4IFM A;  2FYZ A;  3B5N B;  1NU1 K;  1S9K E;  5AW8 B;  4JF7 A;  1PFI A;  3V5B A;  4N6J A;  1H89 A;  2P2U A;  2NPS C;  4IFF A;  2KOG A;  3M9H A;  1SFC B;  1FZC A;  1EQ7 A;  2H8P D;  4HH2 A;  1AQ5 A;  3U1A A;  3HD7 C;  1YTZ T;  3M9Q A;  3B8E B;  1OXZ A;  1JY2 O;  5APY A;  1NHL A;  4JYB A;  1N2D C;  2HYN A;  2KSJ A;  2H43 A;  3UIA A;  1GK4 A;  1KIL B;  3BVH A;  4N3Y B;  1L0L K;  2WTY A;  4C46 A;  2N9B A;  3O8Z A;  2BAS A;  5AW9 B;  2E43 A;  1ZN5 A;  2YNY A;  3HUS B;  2PAJ A;  3KQG A;  5KJ7 A;  1GW3 A;  2NPS B;  3BAT A;  1XTC C;  1J1D B;  5CJ0 A;  3MUD A;  1IK9 A;  1GL2 A;  2GUV A;  3RK3 B;  2HFE D;  1ZLL A;  2P1J A;  2XNX A;  1RF1 B;  1JY2 N;  2POH A;  3V2R A;  2M3B A;  1FDM A;  2WZ7 A;  1URQ B;  1SFC A;  3KDP B;  2W6B A;  3U1C A;  1JY3 O;  2W6A A;  5KJ7 D;  1GTW A;  5CCH C;  3VTP C;  2R3C A;  2A45 H;  4ZKU A;  1GL2 D;  4LLH A;  1N73 C;  2P7J A;  3M0A A;  4W7Y A;  4WY4 C;  5BU5 A;  1KIL A;  5APU A;  1YTZ I;  1SFC D;  4Y99 B;  3IR9 A;  2HG5 D;  4DOJ A;  2PP6 A;  3H32 B;  2KB7 P;  1M1J B;  3HUS A;  2NPS A;  2XDJ A;  1OWA A;  1X79 B;  4EIJ A;  3BRT B;  1LTA C;  1KIL D;  3HD7 A;  4WBA A;  3V2P A;  2VRS A;  5APW A;  1JY3 N;  3L37 A;  3VMY A;  5AW6 B;  4C7N A;  4C7R A;  1JY3 P;  2WSE H;  2XKM A;  1ZR2 A;  1IFI A;  4OH8 B;  3IFM A;  1GDT A;  3NFQ A;  2IFM A;  4WY4 B;  3B5N C;  1FJP A;  2NPS D;  5AW2 B;  3VOP A;  2R5B A;  3VN0 A;  1ZR4 A;  1HGZ A;  3TYY A;  1QL2 A;  1SQQ K;  4RES B;  5AVR B;  2QM8 A;  2J58 A;  3RK3 D;  1JO5 A;  2WSF H;  3SWY A;  4GIF A;  4I1L A;  1N86 A;  3BRV B;  1L0N K;  2H7H A;  1L4A B;  1SFC C;  1E5W A;  1SVF A;  2WSC H;  1JCD A;  3N7N A;  3H32 A;  3LW5 H;  1M1J A;  3NXS A;  1RF0 C;  2YO2 A;  3P8C E;  2HLO A;  1FZB A;  1M7L A;  1JCC A;  2HPC A;  3HE5 B;  1KIL C;  3PP5 A;  3RL0 C;  3WMM 0;  3G3Z A;  1IFD A;  3M06 A;  1CW5 A;  1IJD B;  1JUN A;  3C9I A;  5CCH A;  2Z5H A;  1MFZ A;  1LT9 B;  2GUS A;  1J2J B;  3MTU E;  5AVU B;  1N73 A;  3HUS C;  3V4Q A;  2WT7 B;  3OA7 A;  4WY4 A;  4B86 A;  1J1D C;  2FYU K;  4I6M C;  1JNM A;  3SWF A;  3OJA B;  3RK3 C;  1CI6 A;  1HUC A;  4KHX A;  5CCH D;  1RF1 C;  2OYH B;  1NOH A;  1JTH B;  1URQ C;  4JYC A;  5KTB A;  4WY4 D;  3RL0 B;  3HE4 B;  3CLQ A;  3BAS A;  3TNU B;  1NO4 A;  2R32 A;  2FFD B;  3MIW A;  1NH4 A;  1SQX K;  3A5T A;  1W2E A;  2YKQ A;  3B5N A;  1GU4 A;  4N78 D;  4Y99 C;  5APS A;  1ZV8 A;  1N7S C;  2N1T B;  3VP9 A;  3A7O A;  1HWT C;  1X8Y A;  2ZFC A;  1Z56 A;  1M1J C;  1HBW A;  1HJB A;  3HTK B;  5AVZ B;  2FKW B;  1G2C B;  2JEE A;  3II6 A;  1NTZ K;  1QL1 A;  1HTL C;  3E1I A;  3B5N D;  1XTG B;  1FBM A;  1RF0 A;  1JTH A;  1FJK A;  1NWQ A;  2XZR A;  5AVV B;  3HE4 A;  1IFJ A;  3L36 A;  4WB4 A;  4HYT B;  5CCG D;  3TNU A;  2FFD A;  1N7S B;  2FXM A;  2MJZ A;  1A02 F;  1SQP K;  2JJL A;  4W80 A;  3T97 A;  1L4A C;  1YYC A;  1LGH B;  2OYI B;  2WPR A;  4I2L C;  2N1T A;  5KLV K;  2O1K A;  3RL0 D;  2C0X A;  2CPB A;  5AVS B;  3OAK A;  3HTK A;  4DZO A;  3A2A A;  1RF1 A;  1G2C A;  1T8Z A;  1URQ A;  3CL3 D;  1S9K D;  1DH3 A;  1FOS F;  2I1J A;  1NTM K; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...