2C9LY

Structure of the epstein-barr virus zebra protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
molecule keywords 5'-D(*AP*AP*GP*CP*AP*CP*TP*GP*AP*CP *TP*CP*AP*TP*GP*AP*AP*GP
total genus 26
structure length 63
sequence length 63
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9lY00
5AVYB 2BASA 3LIEA 2QM8A 2YO3A 1G2CB 1T2KD 3P32A 4HYTB 5AW8B 5APYA 3TNUB 1NWQA 1S9KE 5AVSB 5AW7B 3VTPC 3A5TA 1J2JB 3VYIA 3LIDA 1CI6A 1YYCA 2WT7B 5AVRB 2VRSA 2R32A 5AW3B 3TYYA 3A2AA 5AVXB 2WWWA 3I5CA 2WT7A 2E43A 4M3LA 1GU5A 1GK6A 4GT1A 3P7KA 4I6MC 5APVA 3MD0A 2P7JA 4AQRD 1IO4A 3B8EB 4I2LC 2C9LY 3NMDA 1MUUA 3P8MC 1GD2E 3M91A 1CZQA 4GKGA 5AVVB 3KDPB 1HJBA 3SWFA 3NFQA 5AVZB 4C7NA 3L37A 3M06A 2W27A 2Q7CA 3OAKA 1JNMA 1S9KD 5AW1B 1NAFA 5AW0B 3NTNA 1OWAA 2YNYA 2XV5A 2XU6A 1FAVA 2R5BA 4AUWA 3V4WA 1A02F 3M0AA 3TNUA 2ZXEB 2QM7A 3L36A 2P67A 2C9NY 2YO2A 5AW9B 4AYCA 4KHXA 4DZOA 1HBWA 2W6AA 1KQLA 1MFZA 3MGNA 2WPQA 2ZFCA 3M0DA 3HE5B 3V4QA 5AVWB 3VMZA 3HE4B 4B86A 4LC1A 2H7HA 2Q5UA 2WTYA 5AVUB 1X8YA 2R5DA 5APWA 4JYBA 5AW2B 1FOSE 5AW6B 1DH3A 1HUCA 3VN0A 4JYCA 2R3CA 2E42A 2Z5HA 5AW5B 1GU4A 5APTA 4C7NB 3HE4A 5APXA 5AW4B 1JUNA 3M9BA 2KP8A 3VMYA 3A7OA 3IR9A 4EOTA 2N9BA 3TK1A 3A3YB 4XE5B 1T2KC 3T97A 3V5BA 1MV8A 2Q3IA 3M9HA 1A02J 1SLQA 1GK4A 1SP4A 3L35A 4C46A 5AVTB 2XZRA 2WPSA 1GTWA 5APSA 1FOSF 1GZLA 5APUA 1HWTC 2IPPA 5AVQB 1CI6B 1CSBA 4RESB 1OXZA 1H8AA 2P2UA 3NXSA 5APQA 5CMZA 2WPRA 3O8ZA 1H89A 3UIAA 1H88A 3KQGA 3HE5A 2Z5IA 3VMXA 2JJLA 3HTKA
chains in the Genus database with same CATH superfamily
4IFFA 1DD3A 3CMEP 3LIEA 1GW3A 3ABVC 5CCGD 1G2CB 2O01H 2NPSD 2N1TA 2M3BA 2LXCB 4L75A 4ZMDA 2E75D 3CCJP 3D6YA 2V7QH 3SSUA 1NWQA 1FU1A 1BGYE 4YXDC 1QGKB 1RF0A 2A45H 5AW7B 3H1JE 4RJTA 1CW5A 4WVZA 1LTJA 4IL6E 2ZVNB 3CCRP 1YHQP 2ZYDA 1P84D 1ZW0A 3LIDA 1YYCA 3AE5C 4JPZB 3H1IE 3II6A 1QX8A 4WY4C 1K9MQ 2R32A 4DT0A 2E74D 5AW3B 3TYYA 3H32B 1QL1A 3L73G 3PH0A 1L0LG 5AVXB 1VQLP 2Y0EA 2KZJA 3I5CA 2WT7A 1KB9H 2YMKA 4N6JA 4M3LA 2KZIA 2H88C 3RL0D 3P7KA 3PLNA 2H8PD 2O1JA 1OMIA 2P7JA 3CMAP 1JM0A 2R44A 4NPEA 3T97B 1N73C 3L74D 2IX7C 3B71A 5EFWB 2QJPB 3ITKA 1PP9D 1KMIZ 3I55P 3M91A 1L0ND 2QJYC 3PJSK 3AEBC 5AVVB 3KDPB 3H6PA 1JTHA 4ZKUA 2K9YA 3SWFA 3G9RA 1OW8A 2WSCJ 3NFQA 2V7QJ 3U1CA 3Q5RA 3VMAA 2FYUJ 1SQXE 1SQVE 2LR2A 2ZT9C 3M06A 1FJKA 2D2CC 2RH0A 2W27A 3GW6A 3L74G 3MUDA 1PPJE 3VP9A 1FZGA 1URQB 4Y99C 4HJGH 1JNMA 3H32A 1S9KD 3W67A 1YITP 2H89C 2Q3EA 4H13D 1VQ7P 1LTJB 1AVYA 5KLVJ 1JMMA 1NTMG 1KYOI 1IJDB 3V4WA 4BRYA 1J1DB 2QIWA 3FWNA 5KLVD 5H2FE 5GTHE 2ZYAA 2PAJA 3M0AA 1RF1C 2ZXEB 3CCEP 2IBZD 2P67A 2FXOA 1OW6A 1EZVD 1XTCC 2HR3A 3L75E 3RK3B 1NTKJ 3HD7A 2O01N 3TSIA 5KKZC 4IFMA 1VQPP 1RF0C 2FYNC 1JTHB 2FBWC 1KQLA 3RGUA 1MFZA 1K8AQ 3IN6A 2Y9ZA 2UWJE 1T6AA 3HE5B 4U7JA 3RK2B 2A06D 3WUTA 2WQYC 2LXBA 1VL2A 3KZIE 1DD4A 3L75D 2AXTH 4L74A 5BVZA 1DEBA 1X79B 1EZVG 2CPBA 2KIKA 2FFDB 1N7LA 2Q5UA 1SQQG 3FXEA 3BCCE 2N9YB 2KOGA 3R2PA 2YKPA 2WTYA 1NU1G 1M1JA 3GMAA 1GL2D 4LGDE 5TJHA 3USSA 2Q1KA 1ZMEC 1EC5A 1UIXA 2QJKC 3H1KG 3QH9A 5CBOA 2FFDC 5K5GB 1DH3A 1S5LX 1ZXGA 1H0TB 1PP9G 2E42A 3H1HJ 5AW5B 2OTLP 2AXTE 1PL5A 1U7JA 3HE4A 4N78E 5KTBA 5GTIH 1DIPA 2G3AA 1ZLLA 1LT9A 2NPSB 3RK3C 3VMYA 1M8OB 4EOTA 1M56D 3MUDC 3RBXA 1NTZJ 3VTPC 3WUUA 1Q82Q 1SFCD 1YIJP 3L72G 1YTZI 2KSEA 1VF5B 1IFMA 1EDIA 1AQTA 1SVFA 2O3JA 2JKVA 2A45G 3V5BA 3HUSC 1LWUC 1M57D 1NOHA 3WMM0 1RE3A 5B5EE 4TT3H 2IZ1A 2E74B 3L35A 3G4SP 1URQC 5KAFH 4L76A 1RHZB 4PV1D 1GTWA 1FZCA 1X0TA 4EIJA 1Q7YQ 1NTZG 3F89A 1JB0J 1LJ2A 1R5LA 1N7SC 4K35A 2P2UA 3HD7C 1BCCE 1KFNA 2RKLA 3CX5D 3N7NA 2CK3H 2XDJA 3G3ZA 2KB7P 4LLHA 1S2EA 2BCCJ 2L91A 1JY2P 1S1CX 2E76C 2ZT9D 3V2RA 1H88A 2Y0DA 2FYUE 1VPCA 4O9BA 1SQPD 1HGVA 1BCCJ 3VOPA 2OYHA 1PP9J 1LTIC 5AVYB 3L75G 4HH2A 1L4AD 1YJNP 2E76B 2AXCA 2YO3A 4H13C 2HLOA 3H1KJ 4KT0J 1NU1J 2M5AA 4ASWA 1SQQJ 1S9KE 1SQPK 3OA7A 3PP5A 1NH4A 2P1JA 2GUVA 1L4AA 3C9IA 4OWFA 4H13B 1JY2O 1KB9E 2PP6A 4K3AA 3TDKA 3EFGA 1KILA 1T3UA 1QEXA 2QE7H 1K04A 1NTZE 2BEQD 4UB8E 4OGQD 4PD4E 1PIXA 2YIUC 3A2AA 4BXLA 3FWLA 4I1LA 1VF5C 1IZNB 2WSFJ 4GT1A 4EI2A 1SQXJ 1GMJA 1SQVJ 3WU2H 1K05A 3L72D 1N7SB 3VP8A 4AQRD 4DOJA 1QVGO 2Y0CA 4I2LC 1FZFA 4L73A 1IO4A 1M1KQ 5DJUB 1T8ZA 2AEJA 3S1KA 1R8EA 2E5YA 2ZAEB 3BCCD 1GD2E 1AFOA 2IBZG 2JP3A 3CXHD 1W2BO 4HB1A 3CCLP 1LTAC 1YI2P 1LT9B 2NPSA 4U3FE 2KLUA 5AVZB 3HUSB 1GL2B 3AE8C 3SWYA 3JCUE 1ZR4A 1EZVE 1NO4A 2BEZF 1KB9D 1D7MA 2Q7CA 2OYIC 1E5WA 2E75B 3AE6C 1PGJA 1LP1A 3GHGA 3N4XA 3TGUJ 2OGUA 3AEAC 5AW0B 5TISH 2JO1A 1OWAA 1SFCC 1M1JB 2YNYA 2XV5A 3GF3A 1KQSO 2XU6A 1VQ8P 2R5BA 1SQBE 2G8YA 3L70D 1BE3D 3L75J 3L73E 3SFDC 4ZNCA 1KC8Q 4WY4D 1MKMA 1SQPJ 1ZOYC 2WSFH 3V6IA 1S5LE 2HPCB 1SQPG 3QWOC 3TNUA 1OW7A 1SFCB 1SS1A 2BCCG 1IFIA 4OH8B 1U7MA 3KXDA 3CPWO 2RN0A 1RH5B 2Q6QA 3CD6P 3MGNA 3HD7B 3CWBE 1OVUA 3M0DA 3V4QA 1PV3A 1GL2C 2WSCH 3A0BE 3CI9A 4PJ0H 4YTPC 3RK2C 3CL3D 1M7LA 2PFXA 1OFCX 1RQUA 2K3RA 4B86A 4BRYB 5BU8B 5AVUB 2QSIA 3H1LJ 5CJ0A 5CBNA 5KLVK 2FXMA 3ZDMA 4HKZH 2R5DA 2HODA 2YKOA 2B87A 2ZT9B 2WPVB 1HUCA 1OVVA 1BSNA 1W2EA 2B87B 2HODB 3CCQP 2FYUD 3JSVC 3BRVB 2A06G 2WITA 1U57A 2Z5HA 1SQVG 1LTBC 1SQXG 1P84E 1X22A 2IBZI 2ZJSE 3C1LA 3C8VA 1SQQD 5APXA 5B66E 2V4HA 1L0NJ 3M9BA 3H1JD 1RE4C 1KYOE 3H1HG 1W5CE 3A7OA 3CWBG 3FX0A 3KYQA 3AE2C 3H1IJ 2OYIA 2SPZA 3GG2A 1T2KC 1L0NK 3T97A 3Q1MA 3H1JJ 3AE1C 2I1JA 2KS1A 3I56P 3B5ND 4D6TD 3H1JG 3S4RA 1RQVA 5DJTB 2WSSH 2XZRA 2W6JH 4H44B 1R5SA 3RK2D 1ZR2A 1FJPA 1ZN5A 2QRXA 4NPFX 3CWBJ 1FOSF 5APUA 1H89A 4GOFA 1FZAA 3L71D 5KJ7C 1NGMB 1BCCG 1L0NG 4OVNF 3H1ID 1NTKG 1LP1B 2MJZA 2FYNB 2JWDA 2WPRA 3FGAD 3GF7A 5CMZA 1KN7A 3AEFC 1M1JC 3L4FA 4W7YA 3L71E 3UIAA 3KQGA 5KKZB 1S72P 2KYVA 3M0DC 1GL2A 5KJ7D 3VMXA 2JJLA 3HUSA 4JF7A 4QMAA 4RKUJ 3IF4A 1G2CA 1J1DC 1VQMP 3E7KA 1JO5A 1FS0E 2NRGA 1LTJC 2WSEH 2WZ7A 1L0LK 3HTKB 1WRGA 3E1RA 3H1LG 3P32A 5AW8B 1N86A 5E79H 1KD1Q 3L72E 1LWUB 1LT9C 3O6QA 4WY4A 3Q2YA 2K37A 1N7SA 3KPEA 2M3EA 3MP7B 3RL0g 1EDKA 1PPJD 1VF5D 3A5TA 1J2JB 1LTSC 2K88A 2K9JB 3VYIA 1CI6A 1SQVD 1SQXD 2ZYGA 1S4XA 1VQ4P 1EDLA 1IC2A 2AEMA 4GOEA 3Q3DA 4U3FD 3G71P 2E43A 3CCSP 2M0BA 4PV1B 3D70A 1GU5A 3LW5J 1Q86Q 2W8ZA 1GK6A 2C0WA 2FYUK 4R4MA 3MD0A 3B8EB 3HD7D 4H0LD 3Q5PA 4H44C 1TU3F 1NU1K 2C9LY 1NVOA 3NMDA 4UB6E 1SQBD 3L70E 1N73A 1L4AC 2FKWB 2IFNA 1CZQA 1BE3J 3B5NA 3TGUG 3PHLA 3H1KD 4H0LC 3P8CD 1PGOA 1M90Q 2OYHC 1Y8AA 3L37A 1FBMA 2DW3A 1OX3A 1Y47A 2XKMA 1P84H 4IL6X 3G6EP 3L71G 1HH0A 1YJWP 1DX7A 3EQ2A 4TLFA 4KJMA 2HFED 4EDFA 5KAIH 4NPDA 2XNXA 1KILD 1IFDA 5AW1B 1MFTA 3H1KE 1NTMD 1BSHA 5L8RJ 1KB9I 4UB6H 1L0LE 2NZ2A 4ASVA 2OARA 2W6BA 1YQ3C 3SWKA 1JY3N 3LW5H 2GM4A 1KILC 2ZVOB 1A02F 2M8RA 2D2CD 3BVHA 4BWNA 3WU2E 2NPSC 3AEGC 1NTMJ 2QM7A 1VQ6P 2FY8A 3A0BH 5KLVG 2C9NY 2PRRA 5AW9B 4AYCA 2A45I 4KHXA 1HBWA 1YTZT 2W6AA 1JMBA 1NTZK 1N7SD 3B5NB 2WPQA 3CX5H 3EWKA 4IOIH 4UB8H 2YXQB 3GHGC 3Q5SA 1VQKP 2ZFCA 1HF9A 5AVWB 1FZBA 5CCHA 1YJ9P 3VMZA 2W83C 3HE4B 2GA1A 2B89A 2BCCD 2IDBA 3L74E 4YXWH 4Y28J 1SQBJ 3AEDC 1Y9BA 1X8YA 1NKNA 2QJPC 2RMZA 4JYBA 1OZHA 5AW6B 2JR8A 1EZVI 2P10A 3L70J 4EYYQ 3V2PA 2POHA 4W80A 3VN0A 2R3CA 1S3JA 2OYOA 1WT6A 4C7NB 2N1TC 3TGUD 1BCCD 2FFDA 2KP8A 2QG4A 1BDDA 3U59A 1LWUA 3O6QB 4R4LA 3IR9A 4WY4B 2WMMA 2OYIB 5CCGC 3RBZA 1ZRTD 2FXPA 3CXHE 3A3YB 2O01J 4XE5B 3TF5A 1IFJA 3AE7C 1PP9E 3H1LE 1E79H 4GIFA 3A0HH 1LT1A 1A02J 1SLQA 3A0HE 1GK4A 5B5EH 1VDFA 1PZQA 2MKVA 3H1LD 3CXHI 3L72J 1ZRTE 2O1KA 3CXHH 5APSA 1N8RQ 1HTLC 1VQ9P 3H25A 1RF1B 5AVQB 1CSBA 4RESB 1RE3C 1FDOA 2IYPA 1OXZA 2R3SA 5C39A 1NAYA 4A7PA 4H0LB 5CCHD 1NTZD 5KAIE 1KYOH 1LTTC 5APQA 1AVOA 1URQA 1DEEG 2HG5D 2JDIH 3O8ZA 1BGYG 4N3YB 3RL0C 2P58A 2YIUB 1FZEA 2B88A 3E1IA 1K73Q 3CC7P 1QVFO 3W68A 2QA4P 2KS1B 2KNCA 4DCKA 4Y99B 1JUNA 5CCHC 1NJIQ 1JCDA 1FE6A 3U1AA 5KLVE 1IFNA 2BASA 2JEEA 2KUBA 2AEFA 2B9BA 1FDIA 2IBZE 3OJAB 2QM8A 4GODA 1Z56A 4MN4C 1T2KD 3L73D 1T3JA 1FC2C 2KNCB 4HYTB 1JY3O 1NTMK 4WBAA 1NTME 1X9VA 4PD4I 1SQBG 1RE4A 1G1IA 3HRNA 1GW4A 5APYA 3TNUB 1KILE 1IK9A 1QL2A 2KXPB 5AVSB 3AE4C 4PJ0E 3H1HE 4GDOA 2K1AA 3AECC 3FXDA 2FYZA 4N78D 1N73B 2WT7B 3CX5E 3JC22 5AVRB 2VRSA 1KQFB 1IK7A 1RF1A 3BRTB 1AV1A 3CCMP 2H43A 1N2DC 2WWWA 1J1EB 4H44D 4JBZA 1YBKA 1NYHA 3AE3C 1SQBK 3BCCJ 4WB4A 4ZKPA 5CCGA 4CPGA 1XTGB 1VQ5P 1EDJA 4I6MC 5APVA 3CX5I 1EXIA 5GTHH 2J5UA 1PPJG 1JCCA 2J58A 2Y9YA 3D6ZA 2OQQA 3BCCG 5KJ7A 2IZ0A 1MUUA 2C0XA 2N1TB 2XNDH 2E74C 3P8MC 3R4YA 1YQ4C 5TISE 4GKGA 2WSEJ 1J1EC 4U3FG 3B4SA 1HJBA 2IYOA 1LNQA 1NTKK 3GLMA 4IFDK 3L74J 2CPSA 4C7NA 2WVRA 3MIWA 1SFCA 1PGQA 1SQVK 1SQXK 2FYUG 1UIIA 1Q2NA 1SQQE 2IFMA 1NHLA 3L71J 1KTMA 1Q90D 1JOCA 3IFMA 2GUSA 2I1KA 2ZXXA 3BASA 1KZUB 3OAKA 5BU5A 1BGYD 5CJ4A 1HVVA 1NAFA 2ITAA 3PTZA 4XA4A 3NTNA 1BE3G 1PFIA 4WWIA 2Q9IA 1FAVA 1L0LD 3KHUA 3GHGB 2KK7A 4AUWA 1IFPA 3B5NC 1HGZA 1VQNP 2QJKB 2BCCE 2M5AB 3CLQA 2W90A 3KZIH 2OTJP 1SQPE 3L36A 1JY2N 5KLIB 5CHXA 1L0LJ 3F5HA 2JWAA 2YO2A 3L73J 4DZOA 4PD4D 4DJGA 3PRJA 3RL0B 1JY3P 4OGQC 1ZP0C 1VQOP 3OW2O 1KFMA 3TGUE 4YPCA 1AA0A 1LGHB 1L0NE 2L5GB 4W7ZA 5B66H 1BDCA 4I7ZC 1AJYA 5H2FH 4LC1A 2H7HA 1LTGC 1S5LH 4RO0A 2PGDA 5E79E 1WMKA 4U3FJ 4I7ZB 3WUVA 5APWA 4D6TE 1BE3E 1P84I 1RY3A 3AE9C 5AW2B 1FOSE 3S9OA 2QVAA 2KI7B 3M9QA 3V2NA 1FZCB 3AEEC 1URQD 4JYCA 3SFEC 1KILB 3D71A 1GU4A 1USDA 5APTA 1L4AB 2A06E 1Q81Q 1FZCC 2E76D 5AW4B 4XFJA 1SQQK 1KV4A 3CWBD 4C7RA 1EXJA 1EQ7A 1AQ5A 2YXRB 1OIPA 2N9BA 3P8CE 3TK1A 1MZ9A 2D2CB 3H1HD 3L70G 3MZWB 3CC2P 1ZV8A 2YKQA 2J59M 1G1JA 5KAFE 4D6TJ 3RK3D 2HPCA 3IAOA 1MV8A 1KQGB 1KORA 2OYHB 1NU1D 2Q3IA 1QLED 3M9HA 3CC4P 3K5BA 2E5TA 4OGQB 2QJYB 1SP4A 3V2QA 3RK3E 1H0TA 4C46A 5AVTB 2E75C 4D6TG 1NU1E 2WPSA 1NKZB 5KLIC 1USEA 1GZLA 1HJ0A 3MHVA 2IPPA 2HYNA 3H1IG 1CI6B 3EFFK 4PD4H 1HWTC 2K9JA 1JEKA 1NTKE 3NXSA 3CCUP 1H8AA 2LKMA 2I8DA 2KSJA 5M1BA 4Z1MH 2OTKE 3BATA 1OVRA 4IL6H 4JQ0D 5GTIE 1KYOD 4PV1C 3MTUE 1BGYJ 2N1TD 3JCUH 1NTKD 2Z4EA 2YMYA 2QEXP 3CCVP 1GDTA 3HE5A 2Z5IA 2KLVA 1PGPA 1FDMA 3HTKA 1L2PA
chains in the Genus database with same CATH topology
4IFFA 3LIEA 1GW3A 5CCGD 1G2CB 2O01H 2NPSD 2N1TA 2M3BA 1NWQA 1FU1A 1RF0A 2A45H 5AW7B 1CW5A 1LTJA 3LIDA 1YYCA 3II6A 4WY4C 2R32A 5AW3B 3TYYA 3H32B 1QL1A 5AVXB 3I5CA 2WT7A 4N6JA 4M3LA 3RL0D 3P7KA 2H8PD 2O1JA 2P7JA 1N73C 2IX7C 3M91A 5AVVB 3KDPB 3H6PA 1JTHA 4ZKUA 3SWFA 3NFQA 3U1CA 3M06A 1FJKA 1FZGA 2W27A 3MUDA 1AQ5A 3VP9A 1URQB 4Y99C 1JNMA 3H32A 1S9KD 1LTJB 1JMMA 1IJDB 3V4WA 1J1DB 2PAJA 3M0AA 1RF1C 2ZXEB 2P67A 1XTCC 3RK3B 3TSIA 3HD7A 4IFMA 1RF0C 1JTHB 1KQLA 1MFZA 3HE5B 3RK2B 5BVZA 2HPCA 2FFDB 2GM4A 1DEBA 1X79B 2CPBA 1N7LA 2Q5UA 2WTYA 3R2PA 2KOGA 2YKPA 1M1JA 4LGDE 1GL2D 2FFDC 1DH3A 2E42A 5AW5B 4N78E 3HE4A 5KTBA 1ZLLA 1LT9A 2NPSB 3RK3C 3VMYA 4EOTA 1SFCD 1YTZI 3V5BA 1IFMA 1SVFA 2A45G 3HUSC 1LWUC 1NOHA 3WMM0 1RE3A 3L35A 1URQC 1GTWA 1FZCA 4EIJA 1N7SC 2P2UA 3HD7C 1KFNA 3N7NA 2XDJA 3G3ZA 4LLHA 2KB7P 3V2RA 1H89A 1JY2P 1H88A 4O9BA 1VPCA 3VOPA 1HGVA 2OYHA 1LTIC 5AVYB 4HH2A 1L4AD 2YO3A 2HLOA 1S9KE 1SQPK 3OA7A 3PP5A 1NH4A 2P1JA 2GUVA 1L4AA 3C9IA 3VTPC 1JY2O 2PP6A 3EFGA 1KILA 1T3UA 3A2AA 4I1LA 4GT1A 1N7SB 3VP8A 4AQRD 4DOJA 1FZFA 1IO4A 4I2LC 1T8ZA 1GD2E 1AFOA 1LTAC 1LT9B 2NPSA 5AVZB 3HUSB 1GL2B 3SWYA 1ZR4A 1NO4A 2Q7CA 2OYIC 1E5WA 3N4XA 3GHGA 5AW0B 1OWAA 1SFCC 1M1JB 2YNYA 2XV5A 2XU6A 2R5BA 4WY4D 2WSFH 2HPCB 3TNUA 1SFCB 4OH8B 1IFIA 3MGNA 3HD7B 3M0DA 3V4QA 3CI9A 1GL2C 2WSCH 3RK2C 3CL3D 1M7LA 4B86A 5BU8B 5AVUB 5KLVK 5CJ0A 2FXMA 2R5DA 2HODA 2YKOA 1HUCA 1W2EA 2HODB 3BRVB 2WITA 2Z5HA 1LTBC 5APXA 1JUNA 3M9BA 1RE4C 3A7OA 3KYQA 2OYIA 1T2KC 1L0NK 3T97A 2I1JA 3B5ND 2XZRA 3RK2D 1ZR2A 1FJPA 1ZN5A 1FOSF 5APUA 1FZAA 5KJ7C 2MJZA 5CMZA 2WPRA 1DX7A 1M1JC 3L4FA 4W7YA 3UIAA 3KQGA 2KYVA 3M0DC 1GL2A 5KJ7D 3VMXA 2JJLA 3HUSA 4JF7A 1G2CA 1J1DC 1JO5A 2WSEH 1LTJC 2WZ7A 1L0LK 3HTKB 1WRGA 3P32A 5AW8B 1N86A 4WY4A 1LWUB 1LT9C 1N7SA 3KPEA 3A5TA 1J2JB 1LTSC 3VYIA 1CI6A 1IC2A 2E43A 1GU5A 1GK6A 2C0WA 2FYUK 3MD0A 3B8EB 3HD7D 1NU1K 2C9LY 3NMDA 1L4AC 2FKWB 2IFNA 1CZQA 3B5NA 3P8CD 2OYHC 3L37A 1FBMA 2XKMA 1HH0A 3EQ2A 2HFED 2XNXA 1KILD 1IFDA 5AW1B 2OARA 2W6BA 1JY3N 3LW5H 1KILC 1A02F 2M8RA 3BVHA 2NPSC 2QM7A 2C9NY 5AW9B 4AYCA 2A45I 4KHXA 1HBWA 1YTZT 2W6AA 1NTZK 1N7SD 3B5NB 2WPQA 3GHGC 2ZFCA 5AVWB 1FZBA 5CCHA 3VMZA 3HE4B 1X8YA 1NKNA 4JYBA 5AW6B 3V2PA 2POHA 4W80A 3VN0A 2R3CA 1WT6A 4C7NB 2N1TC 2FFDA 2KP8A 3U59A 1LWUA 4WY4B 2OYIB 3IR9A 5CCGC 3A3YB 4XE5B 1IFJA 4GIFA 1A02J 1SLQA 1GK4A 1VDFA 2O1KA 5APSA 1HTLC 1RF1B 5AVQB 1CSBA 4RESB 1RE3C 1N73A 1OXZA 5CCHD 1LTTC 5APQA 1URQA 2HG5D 3O8ZA 4N3YB 3RL0C 1FZEA 3E1IA 4Y99B 5CCHC 1JCDA 1IFNA 2BASA 2JEEA 3OJAB 2QM8A 1Z56A 1T2KD 1T3JA 4HYTB 1JY3O 1NTMK 4WBAA 1X9VA 5APYA 3TNUB 3HRNA 1RE4A 1G1IA 1GW4A 1IK9A 1QL2A 5AVSB 2FYZA 4N78D 1N73B 2WT7B 5AVRB 2VRSA 1RF1A 3BRTB 2H43A 1N2DC 2WWWA 1J1EB 1SQBK 4WB4A 5CCGA 4ZKPA 1XTGB 4I6MC 5APVA 1JCCA 2J58A 5KJ7A 1MUUA 2C0XA 2N1TB 3P8MC 4GKGA 1J1EC 1HJBA 1NTKK 4IFDK 2CPSA 4C7NA 3MIWA 1SFCA 1SQVK 1SQXK 3U1AA 2IFMA 1NHLA 1JOCA 3OAKA 2GUSA 2I1KA 3IFMA 3BASA 1KZUB 5BU5A 5CJ4A 1HVVA 1NAFA 4XA4A 3NTNA 1PFIA 2Q9IA 1FAVA 3GHGB 4AUWA 3B5NC 1HGZA 3CLQA 3L36A 1JY2N 5CHXA 2YO2A 4DZOA 3RL0B 1JY3P 1KFMA 1LGHB 2L5GB 4W7ZA 4LC1A 2H7HA 1LTGC 5APWA 1RY3A 5AW2B 1FOSE 1FZCB 3V2NA 3M9QA 1URQD 4JYCA 1KILB 1GU4A 5APTA 1L4AB 1FZCC 5AW4B 1SQQK 4C7RA 1EQ7A 2N9BA 3P8CE 3TK1A 1MZ9A 1ZV8A 2YKQA 2J59M 1G1JA 3RK3D 1MV8A 2OYHB 2Q3IA 3M9HA 1SP4A 3V2QA 4C46A 5AVTB 2WPSA 1NKZB 1GZLA 1HWTC 2IPPA 2HYNA 1CI6B 1H8AA 3NXSA 2LKMA 2KSJA 3BATA 3MTUE 2Z4EA 2N1TD 1GDTA 2YMYA 3HE5A 2Z5IA 2KLVA 1FDMA 3HTKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVY B;  2BAS A;  3LIE A;  2QM8 A;  2YO3 A;  1G2C B;  1T2K D;  3P32 A;  4HYT B;  5AW8 B;  5APY A;  3TNU B;  1NWQ A;  1S9K E;  5AVS B;  5AW7 B;  3VTP C;  3A5T A;  1J2J B;  3VYI A;  3LID A;  1CI6 A;  1YYC A;  2WT7 B;  5AVR B;  2VRS A;  2R32 A;  5AW3 B;  3TYY A;  3A2A A;  5AVX B;  2WWW A;  3I5C A;  2WT7 A;  2E43 A;  4M3L A;  1GU5 A;  1GK6 A;  4GT1 A;  3P7K A;  4I6M C;  5APV A;  3MD0 A;  2P7J A;  4AQR D;  1IO4 A;  3B8E B;  4I2L C;  2C9L Y;  3NMD A;  1MUU A;  3P8M C;  1GD2 E;  3M91 A;  1CZQ A;  4GKG A;  5AVV B;  3KDP B;  1HJB A;  3SWF A;  3NFQ A;  5AVZ B;  4C7N A;  3L37 A;  3M06 A;  2W27 A;  2Q7C A;  3OAK A;  1JNM A;  1S9K D;  5AW1 B;  1NAF A;  5AW0 B;  3NTN A;  1OWA A;  2YNY A;  2XV5 A;  2XU6 A;  1FAV A;  2R5B A;  4AUW A;  3V4W A;  1A02 F;  3M0A A;  3TNU A;  2ZXE B;  2QM7 A;  3L36 A;  2P67 A;  2C9N Y;  2YO2 A;  5AW9 B;  4AYC A;  4KHX A;  4DZO A;  1HBW A;  2W6A A;  1KQL A;  1MFZ A;  3MGN A;  2WPQ A;  2ZFC A;  3M0D A;  3HE5 B;  3V4Q A;  5AVW B;  3VMZ A;  3HE4 B;  4B86 A;  4LC1 A;  2H7H A;  2Q5U A;  2WTY A;  5AVU B;  1X8Y A;  2R5D A;  5APW A;  4JYB A;  5AW2 B;  1FOS E;  5AW6 B;  1DH3 A;  1HUC A;  3VN0 A;  4JYC A;  2R3C A;  2E42 A;  2Z5H A;  5AW5 B;  1GU4 A;  5APT A;  4C7N B;  3HE4 A;  5APX A;  5AW4 B;  1JUN A;  3M9B A;  2KP8 A;  3VMY A;  3A7O A;  3IR9 A;  4EOT A;  2N9B A;  3TK1 A;  3A3Y B;  4XE5 B;  1T2K C;  3T97 A;  3V5B A;  1MV8 A;  2Q3I A;  3M9H A;  1A02 J;  1SLQ A;  1GK4 A;  1SP4 A;  3L35 A;  4C46 A;  5AVT B;  2XZR A;  2WPS A;  1GTW A;  5APS A;  1FOS F;  1GZL A;  5APU A;  1HWT C;  2IPP A;  5AVQ B;  1CI6 B;  1CSB A;  4RES B;  1OXZ A;  1H8A A;  2P2U A;  3NXS A;  5APQ A;  5CMZ A;  2WPR A;  3O8Z A;  1H89 A;  3UIA A;  1H88 A;  3KQG A;  3HE5 A;  2Z5I A;  3VMX A;  2JJL A;  3HTK A; 
#chains in the Genus database with same CATH topology
 4IFF A;  1DD3 A;  3CME P;  3LIE A;  1GW3 A;  3ABV C;  5CCG D;  1G2C B;  2O01 H;  2NPS D;  2N1T A;  2M3B A;  2LXC B;  4L75 A;  4ZMD A;  2E75 D;  3CCJ P;  3D6Y A;  2V7Q H;  3SSU A;  1NWQ A;  1FU1 A;  1BGY E;  4YXD C;  1QGK B;  1RF0 A;  2A45 H;  5AW7 B;  3H1J E;  4RJT A;  1CW5 A;  4WVZ A;  1LTJ A;  4IL6 E;  2ZVN B;  3CCR P;  1YHQ P;  2ZYD A;  1P84 D;  1ZW0 A;  3LID A;  1YYC A;  3AE5 C;  4JPZ B;  3H1I E;  3II6 A;  1QX8 A;  4WY4 C;  1K9M Q;  2R32 A;  4DT0 A;  2E74 D;  5AW3 B;  3TYY A;  3H32 B;  1QL1 A;  3L73 G;  3PH0 A;  1L0L G;  5AVX B;  1VQL P;  2Y0E A;  2KZJ A;  3I5C A;  2WT7 A;  1KB9 H;  2YMK A;  4N6J A;  4M3L A;  2KZI A;  2H88 C;  3RL0 D;  3P7K A;  3PLN A;  2H8P D;  2O1J A;  1OMI A;  2P7J A;  3CMA P;  1JM0 A;  2R44 A;  4NPE A;  3T97 B;  1N73 C;  3L74 D;  2IX7 C;  3B71 A;  5EFW B;  2QJP B;  3ITK A;  1PP9 D;  1KMI Z;  3I55 P;  3M91 A;  1L0N D;  2QJY C;  3PJS K;  3AEB C;  5AVV B;  3KDP B;  3H6P A;  1JTH A;  4ZKU A;  2K9Y A;  3SWF A;  3G9R A;  1OW8 A;  2WSC J;  3NFQ A;  2V7Q J;  3U1C A;  3Q5R A;  3VMA A;  2FYU J;  1SQX E;  1SQV E;  2LR2 A;  2ZT9 C;  3M06 A;  1FJK A;  2D2C C;  2RH0 A;  2W27 A;  3GW6 A;  3L74 G;  3MUD A;  1PPJ E;  3VP9 A;  1FZG A;  1URQ B;  4Y99 C;  4HJG H;  1JNM A;  3H32 A;  1S9K D;  3W67 A;  1YIT P;  2H89 C;  2Q3E A;  4H13 D;  1VQ7 P;  1LTJ B;  1AVY A;  5KLV J;  1JMM A;  1NTM G;  1KYO I;  1IJD B;  3V4W A;  4BRY A;  1J1D B;  2QIW A;  3FWN A;  5KLV D;  5H2F E;  5GTH E;  2ZYA A;  2PAJ A;  3M0A A;  1RF1 C;  2ZXE B;  3CCE P;  2IBZ D;  2P67 A;  2FXO A;  1OW6 A;  1EZV D;  1XTC C;  2HR3 A;  3L75 E;  3RK3 B;  1NTK J;  3HD7 A;  2O01 N;  3TSI A;  5KKZ C;  4IFM A;  1VQP P;  1RF0 C;  2FYN C;  1JTH B;  2FBW C;  1KQL A;  3RGU A;  1MFZ A;  1K8A Q;  3IN6 A;  2Y9Z A;  2UWJ E;  1T6A A;  3HE5 B;  4U7J A;  3RK2 B;  2A06 D;  3WUT A;  2WQY C;  2LXB A;  1VL2 A;  3KZI E;  1DD4 A;  3L75 D;  2AXT H;  4L74 A;  5BVZ A;  1DEB A;  1X79 B;  1EZV G;  2CPB A;  2KIK A;  2FFD B;  1N7L A;  2Q5U A;  1SQQ G;  3FXE A;  3BCC E;  2N9Y B;  2KOG A;  3R2P A;  2YKP A;  2WTY A;  1NU1 G;  1M1J A;  3GMA A;  1GL2 D;  4LGD E;  5TJH A;  3USS A;  2Q1K A;  1ZME C;  1EC5 A;  1UIX A;  2QJK C;  3H1K G;  3QH9 A;  5CBO A;  2FFD C;  5K5G B;  1DH3 A;  1S5L X;  1ZXG A;  1H0T B;  1PP9 G;  2E42 A;  3H1H J;  5AW5 B;  2OTL P;  2AXT E;  1PL5 A;  1U7J A;  3HE4 A;  4N78 E;  5KTB A;  5GTI H;  1DIP A;  2G3A A;  1ZLL A;  1LT9 A;  2NPS B;  3RK3 C;  3VMY A;  1M8O B;  4EOT A;  1M56 D;  3MUD C;  3RBX A;  1NTZ J;  3VTP C;  3WUU A;  1Q82 Q;  1SFC D;  1YIJ P;  3L72 G;  1YTZ I;  2KSE A;  1VF5 B;  1IFM A;  1EDI A;  1AQT A;  1SVF A;  2O3J A;  2JKV A;  2A45 G;  3V5B A;  3HUS C;  1LWU C;  1M57 D;  1NOH A;  3WMM 0;  1RE3 A;  5B5E E;  4TT3 H;  2IZ1 A;  2E74 B;  3L35 A;  3G4S P;  1URQ C;  5KAF H;  4L76 A;  1RHZ B;  4PV1 D;  1GTW A;  1FZC A;  1X0T A;  4EIJ A;  1Q7Y Q;  1NTZ G;  3F89 A;  1JB0 J;  1LJ2 A;  1R5L A;  1N7S C;  4K35 A;  2P2U A;  3HD7 C;  1BCC E;  1KFN A;  2RKL A;  3CX5 D;  3N7N A;  2CK3 H;  2XDJ A;  3G3Z A;  2KB7 P;  4LLH A;  1S2E A;  2BCC J;  2L91 A;  1JY2 P;  1S1C X;  2E76 C;  2ZT9 D;  3V2R A;  1H88 A;  2Y0D A;  2FYU E;  1VPC A;  4O9B A;  1SQP D;  1HGV A;  1BCC J;  3VOP A;  2OYH A;  1PP9 J;  1LTI C;  5AVY B;  3L75 G;  4HH2 A;  1L4A D;  1YJN P;  2E76 B;  2AXC A;  2YO3 A;  4H13 C;  2HLO A;  3H1K J;  4KT0 J;  1NU1 J;  2M5A A;  4ASW A;  1SQQ J;  1S9K E;  1SQP K;  3OA7 A;  3PP5 A;  1NH4 A;  2P1J A;  2GUV A;  1L4A A;  3C9I A;  4OWF A;  4H13 B;  1JY2 O;  1KB9 E;  2PP6 A;  4K3A A;  3TDK A;  3EFG A;  1KIL A;  1T3U A;  1QEX A;  2QE7 H;  1K04 A;  1NTZ E;  2BEQ D;  4UB8 E;  4OGQ D;  4PD4 E;  1PIX A;  2YIU C;  3A2A A;  4BXL A;  3FWL A;  4I1L A;  1VF5 C;  1IZN B;  2WSF J;  4GT1 A;  4EI2 A;  1SQX J;  1GMJ A;  1SQV J;  3WU2 H;  1K05 A;  3L72 D;  1N7S B;  3VP8 A;  4AQR D;  4DOJ A;  1QVG O;  2Y0C A;  4I2L C;  1FZF A;  4L73 A;  1IO4 A;  1M1K Q;  5DJU B;  1T8Z A;  2AEJ A;  3S1K A;  1R8E A;  2E5Y A;  2ZAE B;  3BCC D;  1GD2 E;  1AFO A;  2IBZ G;  2JP3 A;  3CXH D;  1W2B O;  4HB1 A;  3CCL P;  1LTA C;  1YI2 P;  1LT9 B;  2NPS A;  4U3F E;  2KLU A;  5AVZ B;  3HUS B;  1GL2 B;  3AE8 C;  3SWY A;  3JCU E;  1ZR4 A;  1EZV E;  1NO4 A;  2BEZ F;  1KB9 D;  1D7M A;  2Q7C A;  2OYI C;  1E5W A;  2E75 B;  3AE6 C;  1PGJ A;  1LP1 A;  3GHG A;  3N4X A;  3TGU J;  2OGU A;  3AEA C;  5AW0 B;  5TIS H;  2JO1 A;  1OWA A;  1SFC C;  1M1J B;  2YNY A;  2XV5 A;  3GF3 A;  1KQS O;  2XU6 A;  1VQ8 P;  2R5B A;  1SQB E;  2G8Y A;  3L70 D;  1BE3 D;  3L75 J;  3L73 E;  3SFD C;  4ZNC A;  1KC8 Q;  4WY4 D;  1MKM A;  1SQP J;  1ZOY C;  2WSF H;  3V6I A;  1S5L E;  2HPC B;  1SQP G;  3QWO C;  3TNU A;  1OW7 A;  1SFC B;  1SS1 A;  2BCC G;  1IFI A;  4OH8 B;  1U7M A;  3KXD A;  3CPW O;  2RN0 A;  1RH5 B;  2Q6Q A;  3CD6 P;  3MGN A;  3HD7 B;  3CWB E;  1OVU A;  3M0D A;  3V4Q A;  1PV3 A;  1GL2 C;  2WSC H;  3A0B E;  3CI9 A;  4PJ0 H;  4YTP C;  3RK2 C;  3CL3 D;  1M7L A;  2PFX A;  1OFC X;  1RQU A;  2K3R A;  4B86 A;  4BRY B;  5BU8 B;  5AVU B;  2QSI A;  3H1L J;  5CJ0 A;  5CBN A;  5KLV K;  2FXM A;  3ZDM A;  4HKZ H;  2R5D A;  2HOD A;  2YKO A;  2B87 A;  2ZT9 B;  2WPV B;  1HUC A;  1OVV A;  1BSN A;  1W2E A;  2B87 B;  2HOD B;  3CCQ P;  2FYU D;  3JSV C;  3BRV B;  2A06 G;  2WIT A;  1U57 A;  2Z5H A;  1SQV G;  1LTB C;  1SQX G;  1P84 E;  1X22 A;  2IBZ I;  2ZJS E;  3C1L A;  3C8V A;  1SQQ D;  5APX A;  5B66 E;  2V4H A;  1L0N J;  3M9B A;  3H1J D;  1RE4 C;  1KYO E;  3H1H G;  1W5C E;  3A7O A;  3CWB G;  3FX0 A;  3KYQ A;  3AE2 C;  3H1I J;  2OYI A;  2SPZ A;  3GG2 A;  1T2K C;  1L0N K;  3T97 A;  3Q1M A;  3H1J J;  3AE1 C;  2I1J A;  2KS1 A;  3I56 P;  3B5N D;  4D6T D;  3H1J G;  3S4R A;  1RQV A;  5DJT B;  2WSS H;  2XZR A;  2W6J H;  4H44 B;  1R5S A;  3RK2 D;  1ZR2 A;  1FJP A;  1ZN5 A;  2QRX A;  4NPF X;  3CWB J;  1FOS F;  5APU A;  1H89 A;  4GOF A;  1FZA A;  3L71 D;  5KJ7 C;  1NGM B;  1BCC G;  1L0N G;  4OVN F;  3H1I D;  1NTK G;  1LP1 B;  2MJZ A;  2FYN B;  2JWD A;  2WPR A;  3FGA D;  3GF7 A;  5CMZ A;  1KN7 A;  3AEF C;  1M1J C;  3L4F A;  4W7Y A;  3L71 E;  3UIA A;  3KQG A;  5KKZ B;  1S72 P;  2KYV A;  3M0D C;  1GL2 A;  5KJ7 D;  3VMX A;  2JJL A;  3HUS A;  4JF7 A;  4QMA A;  4RKU J;  3IF4 A;  1G2C A;  1J1D C;  1VQM P;  3E7K A;  1JO5 A;  1FS0 E;  2NRG A;  1LTJ C;  2WSE H;  2WZ7 A;  1L0L K;  3HTK B;  1WRG A;  3E1R A;  3H1L G;  3P32 A;  5AW8 B;  1N86 A;  5E79 H;  1KD1 Q;  3L72 E;  1LWU B;  1LT9 C;  3O6Q A;  4WY4 A;  3Q2Y A;  2K37 A;  1N7S A;  3KPE A;  2M3E A;  3MP7 B;  3RL0 g;  1EDK A;  1PPJ D;  1VF5 D;  3A5T A;  1J2J B;  1LTS C;  2K88 A;  2K9J B;  3VYI A;  1CI6 A;  1SQV D;  1SQX D;  2ZYG A;  1S4X A;  1VQ4 P;  1EDL A;  1IC2 A;  2AEM A;  4GOE A;  3Q3D A;  4U3F D;  3G71 P;  2E43 A;  3CCS P;  2M0B A;  4PV1 B;  3D70 A;  1GU5 A;  3LW5 J;  1Q86 Q;  2W8Z A;  1GK6 A;  2C0W A;  2FYU K;  4R4M A;  3MD0 A;  3B8E B;  3HD7 D;  4H0L D;  3Q5P A;  4H44 C;  1TU3 F;  1NU1 K;  2C9L Y;  1NVO A;  3NMD A;  4UB6 E;  1SQB D;  3L70 E;  1N73 A;  1L4A C;  2FKW B;  2IFN A;  1CZQ A;  1BE3 J;  3B5N A;  3TGU G;  3PHL A;  3H1K D;  4H0L C;  3P8C D;  1PGO A;  1M90 Q;  2OYH C;  1Y8A A;  3L37 A;  1FBM A;  2DW3 A;  1OX3 A;  1Y47 A;  2XKM A;  1P84 H;  4IL6 X;  3G6E P;  3L71 G;  1HH0 A;  1YJW P;  1DX7 A;  3EQ2 A;  4TLF A;  4KJM A;  2HFE D;  4EDF A;  5KAI H;  4NPD A;  2XNX A;  1KIL D;  1IFD A;  5AW1 B;  1MFT A;  3H1K E;  1NTM D;  1BSH A;  5L8R J;  1KB9 I;  4UB6 H;  1L0L E;  2NZ2 A;  4ASV A;  2OAR A;  2W6B A;  1YQ3 C;  3SWK A;  1JY3 N;  3LW5 H;  2GM4 A;  1KIL C;  2ZVO B;  1A02 F;  2M8R A;  2D2C D;  3BVH A;  4BWN A;  3WU2 E;  2NPS C;  3AEG C;  1NTM J;  2QM7 A;  1VQ6 P;  2FY8 A;  3A0B H;  5KLV G;  2C9N Y;  2PRR A;  5AW9 B;  4AYC A;  2A45 I;  4KHX A;  1HBW A;  1YTZ T;  2W6A A;  1JMB A;  1NTZ K;  1N7S D;  3B5N B;  2WPQ A;  3CX5 H;  3EWK A;  4IOI H;  4UB8 H;  2YXQ B;  3GHG C;  3Q5S A;  1VQK P;  2ZFC A;  1HF9 A;  5AVW B;  1FZB A;  5CCH A;  1YJ9 P;  3VMZ A;  2W83 C;  3HE4 B;  2GA1 A;  2B89 A;  2BCC D;  2IDB A;  3L74 E;  4YXW H;  4Y28 J;  1SQB J;  3AED C;  1Y9B A;  1X8Y A;  1NKN A;  2QJP C;  2RMZ A;  4JYB A;  1OZH A;  5AW6 B;  2JR8 A;  1EZV I;  2P10 A;  3L70 J;  4EYY Q;  3V2P A;  2POH A;  4W80 A;  3VN0 A;  2R3C A;  1S3J A;  2OYO A;  1WT6 A;  4C7N B;  2N1T C;  3TGU D;  1BCC D;  2FFD A;  2KP8 A;  2QG4 A;  1BDD A;  3U59 A;  1LWU A;  3O6Q B;  4R4L A;  3IR9 A;  4WY4 B;  2WMM A;  2OYI B;  5CCG C;  3RBZ A;  1ZRT D;  2FXP A;  3CXH E;  3A3Y B;  2O01 J;  4XE5 B;  3TF5 A;  1IFJ A;  3AE7 C;  1PP9 E;  3H1L E;  1E79 H;  4GIF A;  3A0H H;  1LT1 A;  1A02 J;  1SLQ A;  3A0H E;  1GK4 A;  5B5E H;  1VDF A;  1PZQ A;  2MKV A;  3H1L D;  3CXH I;  3L72 J;  1ZRT E;  2O1K A;  3CXH H;  5APS A;  1N8R Q;  1HTL C;  1VQ9 P;  3H25 A;  1RF1 B;  5AVQ B;  1CSB A;  4RES B;  1RE3 C;  1FDO A;  2IYP A;  1OXZ A;  2R3S A;  5C39 A;  1NAY A;  4A7P A;  4H0L B;  5CCH D;  1NTZ D;  5KAI E;  1KYO H;  1LTT C;  5APQ A;  1AVO A;  1URQ A;  1DEE G;  2HG5 D;  2JDI H;  3O8Z A;  1BGY G;  4N3Y B;  3RL0 C;  2P58 A;  2YIU B;  1FZE A;  2B88 A;  3E1I A;  1K73 Q;  3CC7 P;  1QVF O;  3W68 A;  2QA4 P;  2KS1 B;  2KNC A;  4DCK A;  4Y99 B;  1JUN A;  5CCH C;  1NJI Q;  1JCD A;  1FE6 A;  3U1A A;  5KLV E;  1IFN A;  2BAS A;  2JEE A;  2KUB A;  2AEF A;  2B9B A;  1FDI A;  2IBZ E;  3OJA B;  2QM8 A;  4GOD A;  1Z56 A;  4MN4 C;  1T2K D;  3L73 D;  1T3J A;  1FC2 C;  2KNC B;  4HYT B;  1JY3 O;  1NTM K;  4WBA A;  1NTM E;  1X9V A;  4PD4 I;  1SQB G;  1RE4 A;  1G1I A;  3HRN A;  1GW4 A;  5APY A;  3TNU B;  1KIL E;  1IK9 A;  1QL2 A;  2KXP B;  5AVS B;  3AE4 C;  4PJ0 E;  3H1H E;  4GDO A;  2K1A A;  3AEC C;  3FXD A;  2FYZ A;  4N78 D;  1N73 B;  2WT7 B;  3CX5 E;  3JC2 2;  5AVR B;  2VRS A;  1KQF B;  1IK7 A;  1RF1 A;  3BRT B;  1AV1 A;  3CCM P;  2H43 A;  1N2D C;  2WWW A;  1J1E B;  4H44 D;  4JBZ A;  1YBK A;  1NYH A;  3AE3 C;  1SQB K;  3BCC J;  4WB4 A;  4ZKP A;  5CCG A;  4CPG A;  1XTG B;  1VQ5 P;  1EDJ A;  4I6M C;  5APV A;  3CX5 I;  1EXI A;  5GTH H;  2J5U A;  1PPJ G;  1JCC A;  2J58 A;  2Y9Y A;  3D6Z A;  2OQQ A;  3BCC G;  5KJ7 A;  2IZ0 A;  1MUU A;  2C0X A;  2N1T B;  2XND H;  2E74 C;  3P8M C;  3R4Y A;  1YQ4 C;  5TIS E;  4GKG A;  2WSE J;  1J1E C;  4U3F G;  3B4S A;  1HJB A;  2IYO A;  1LNQ A;  1NTK K;  3GLM A;  4IFD K;  3L74 J;  2CPS A;  4C7N A;  2WVR A;  3MIW A;  1SFC A;  1PGQ A;  1SQV K;  1SQX K;  2FYU G;  1UII A;  1Q2N A;  1SQQ E;  2IFM A;  1NHL A;  3L71 J;  1KTM A;  1Q90 D;  1JOC A;  3IFM A;  2GUS A;  2I1K A;  2ZXX A;  3BAS A;  1KZU B;  3OAK A;  5BU5 A;  1BGY D;  5CJ4 A;  1HVV A;  1NAF A;  2ITA A;  3PTZ A;  4XA4 A;  3NTN A;  1BE3 G;  1PFI A;  4WWI A;  2Q9I A;  1FAV A;  1L0L D;  3KHU A;  3GHG B;  2KK7 A;  4AUW A;  1IFP A;  3B5N C;  1HGZ A;  1VQN P;  2QJK B;  2BCC E;  2M5A B;  3CLQ A;  2W90 A;  3KZI H;  2OTJ P;  1SQP E;  3L36 A;  1JY2 N;  5KLI B;  5CHX A;  1L0L J;  3F5H A;  2JWA A;  2YO2 A;  3L73 J;  4DZO A;  4PD4 D;  4DJG A;  3PRJ A;  3RL0 B;  1JY3 P;  4OGQ C;  1ZP0 C;  1VQO P;  3OW2 O;  1KFM A;  3TGU E;  4YPC A;  1AA0 A;  1LGH B;  1L0N E;  2L5G B;  4W7Z A;  5B66 H;  1BDC A;  4I7Z C;  1AJY A;  5H2F H;  4LC1 A;  2H7H A;  1LTG C;  1S5L H;  4RO0 A;  2PGD A;  5E79 E;  1WMK A;  4U3F J;  4I7Z B;  3WUV A;  5APW A;  4D6T E;  1BE3 E;  1P84 I;  1RY3 A;  3AE9 C;  5AW2 B;  1FOS E;  3S9O A;  2QVA A;  2KI7 B;  3M9Q A;  3V2N A;  1FZC B;  3AEE C;  1URQ D;  4JYC A;  3SFE C;  1KIL B;  3D71 A;  1GU4 A;  1USD A;  5APT A;  1L4A B;  2A06 E;  1Q81 Q;  1FZC C;  2E76 D;  5AW4 B;  4XFJ A;  1SQQ K;  1KV4 A;  3CWB D;  4C7R A;  1EXJ A;  1EQ7 A;  1AQ5 A;  2YXR B;  1OIP A;  2N9B A;  3P8C E;  3TK1 A;  1MZ9 A;  2D2C B;  3H1H D;  3L70 G;  3MZW B;  3CC2 P;  1ZV8 A;  2YKQ A;  2J59 M;  1G1J A;  5KAF E;  4D6T J;  3RK3 D;  2HPC A;  3IAO A;  1MV8 A;  1KQG B;  1KOR A;  2OYH B;  1NU1 D;  2Q3I A;  1QLE D;  3M9H A;  3CC4 P;  3K5B A;  2E5T A;  4OGQ B;  2QJY B;  1SP4 A;  3V2Q A;  3RK3 E;  1H0T A;  4C46 A;  5AVT B;  2E75 C;  4D6T G;  1NU1 E;  2WPS A;  1NKZ B;  5KLI C;  1USE A;  1GZL A;  1HJ0 A;  3MHV A;  2IPP A;  2HYN A;  3H1I G;  1CI6 B;  3EFF K;  4PD4 H;  1HWT C;  2K9J A;  1JEK A;  1NTK E;  3NXS A;  3CCU P;  1H8A A;  2LKM A;  2I8D A;  2KSJ A;  5M1B A;  4Z1M H;  2OTK E;  3BAT A;  1OVR A;  4IL6 H;  4JQ0 D;  5GTI E;  1KYO D;  4PV1 C;  3MTU E;  1BGY J;  2N1T D;  3JCU H;  1NTK D;  2Z4E A;  2YMY A;  2QEX P;  3CCV P;  1GDT A;  3HE5 A;  2Z5I A;  2KLV A;  1PGP A;  1FDM A;  3HTK A;  1L2P A; 
#chains in the Genus database with same CATH homology
 4IFF A;  3LIE A;  1GW3 A;  5CCG D;  1G2C B;  2O01 H;  2NPS D;  2N1T A;  2M3B A;  1NWQ A;  1FU1 A;  1RF0 A;  2A45 H;  5AW7 B;  1CW5 A;  1LTJ A;  3LID A;  1YYC A;  3II6 A;  4WY4 C;  2R32 A;  5AW3 B;  3TYY A;  3H32 B;  1QL1 A;  5AVX B;  3I5C A;  2WT7 A;  4N6J A;  4M3L A;  3RL0 D;  3P7K A;  2H8P D;  2O1J A;  2P7J A;  1N73 C;  2IX7 C;  3M91 A;  5AVV B;  3KDP B;  3H6P A;  1JTH A;  4ZKU A;  3SWF A;  3NFQ A;  3U1C A;  3M06 A;  1FJK A;  1FZG A;  2W27 A;  3MUD A;  1AQ5 A;  3VP9 A;  1URQ B;  4Y99 C;  1JNM A;  3H32 A;  1S9K D;  1LTJ B;  1JMM A;  1IJD B;  3V4W A;  1J1D B;  2PAJ A;  3M0A A;  1RF1 C;  2ZXE B;  2P67 A;  1XTC C;  3RK3 B;  3TSI A;  3HD7 A;  4IFM A;  1RF0 C;  1JTH B;  1KQL A;  1MFZ A;  3HE5 B;  3RK2 B;  5BVZ A;  2HPC A;  2FFD B;  2GM4 A;  1DEB A;  1X79 B;  2CPB A;  1N7L A;  2Q5U A;  2WTY A;  3R2P A;  2KOG A;  2YKP A;  1M1J A;  4LGD E;  1GL2 D;  2FFD C;  1DH3 A;  2E42 A;  5AW5 B;  4N78 E;  3HE4 A;  5KTB A;  1ZLL A;  1LT9 A;  2NPS B;  3RK3 C;  3VMY A;  4EOT A;  1SFC D;  1YTZ I;  3V5B A;  1IFM A;  1SVF A;  2A45 G;  3HUS C;  1LWU C;  1NOH A;  3WMM 0;  1RE3 A;  3L35 A;  1URQ C;  1GTW A;  1FZC A;  4EIJ A;  1N7S C;  2P2U A;  3HD7 C;  1KFN A;  3N7N A;  2XDJ A;  3G3Z A;  4LLH A;  2KB7 P;  3V2R A;  1H89 A;  1JY2 P;  1H88 A;  4O9B A;  1VPC A;  3VOP A;  1HGV A;  2OYH A;  1LTI C;  5AVY B;  4HH2 A;  1L4A D;  2YO3 A;  2HLO A;  1S9K E;  1SQP K;  3OA7 A;  3PP5 A;  1NH4 A;  2P1J A;  2GUV A;  1L4A A;  3C9I A;  3VTP C;  1JY2 O;  2PP6 A;  3EFG A;  1KIL A;  1T3U A;  3A2A A;  4I1L A;  4GT1 A;  1N7S B;  3VP8 A;  4AQR D;  4DOJ A;  1FZF A;  1IO4 A;  4I2L C;  1T8Z A;  1GD2 E;  1AFO A;  1LTA C;  1LT9 B;  2NPS A;  5AVZ B;  3HUS B;  1GL2 B;  3SWY A;  1ZR4 A;  1NO4 A;  2Q7C A;  2OYI C;  1E5W A;  3N4X A;  3GHG A;  5AW0 B;  1OWA A;  1SFC C;  1M1J B;  2YNY A;  2XV5 A;  2XU6 A;  2R5B A;  4WY4 D;  2WSF H;  2HPC B;  3TNU A;  1SFC B;  4OH8 B;  1IFI A;  3MGN A;  3HD7 B;  3M0D A;  3V4Q A;  3CI9 A;  1GL2 C;  2WSC H;  3RK2 C;  3CL3 D;  1M7L A;  4B86 A;  5BU8 B;  5AVU B;  5KLV K;  5CJ0 A;  2FXM A;  2R5D A;  2HOD A;  2YKO A;  1HUC A;  1W2E A;  2HOD B;  3BRV B;  2WIT A;  2Z5H A;  1LTB C;  5APX A;  1JUN A;  3M9B A;  1RE4 C;  3A7O A;  3KYQ A;  2OYI A;  1T2K C;  1L0N K;  3T97 A;  2I1J A;  3B5N D;  2XZR A;  3RK2 D;  1ZR2 A;  1FJP A;  1ZN5 A;  1FOS F;  5APU A;  1FZA A;  5KJ7 C;  2MJZ A;  5CMZ A;  2WPR A;  1DX7 A;  1M1J C;  3L4F A;  4W7Y A;  3UIA A;  3KQG A;  2KYV A;  3M0D C;  1GL2 A;  5KJ7 D;  3VMX A;  2JJL A;  3HUS A;  4JF7 A;  1G2C A;  1J1D C;  1JO5 A;  2WSE H;  1LTJ C;  2WZ7 A;  1L0L K;  3HTK B;  1WRG A;  3P32 A;  5AW8 B;  1N86 A;  4WY4 A;  1LWU B;  1LT9 C;  1N7S A;  3KPE A;  3A5T A;  1J2J B;  1LTS C;  3VYI A;  1CI6 A;  1IC2 A;  2E43 A;  1GU5 A;  1GK6 A;  2C0W A;  2FYU K;  3MD0 A;  3B8E B;  3HD7 D;  1NU1 K;  2C9L Y;  3NMD A;  1L4A C;  2FKW B;  2IFN A;  1CZQ A;  3B5N A;  3P8C D;  2OYH C;  3L37 A;  1FBM A;  2XKM A;  1HH0 A;  3EQ2 A;  2HFE D;  2XNX A;  1KIL D;  1IFD A;  5AW1 B;  2OAR A;  2W6B A;  1JY3 N;  3LW5 H;  1KIL C;  1A02 F;  2M8R A;  3BVH A;  2NPS C;  2QM7 A;  2C9N Y;  5AW9 B;  4AYC A;  2A45 I;  4KHX A;  1HBW A;  1YTZ T;  2W6A A;  1NTZ K;  1N7S D;  3B5N B;  2WPQ A;  3GHG C;  2ZFC A;  5AVW B;  1FZB A;  5CCH A;  3VMZ A;  3HE4 B;  1X8Y A;  1NKN A;  4JYB A;  5AW6 B;  3V2P A;  2POH A;  4W80 A;  3VN0 A;  2R3C A;  1WT6 A;  4C7N B;  2N1T C;  2FFD A;  2KP8 A;  3U59 A;  1LWU A;  4WY4 B;  2OYI B;  3IR9 A;  5CCG C;  3A3Y B;  4XE5 B;  1IFJ A;  4GIF A;  1A02 J;  1SLQ A;  1GK4 A;  1VDF A;  2O1K A;  5APS A;  1HTL C;  1RF1 B;  5AVQ B;  1CSB A;  4RES B;  1RE3 C;  1N73 A;  1OXZ A;  5CCH D;  1LTT C;  5APQ A;  1URQ A;  2HG5 D;  3O8Z A;  4N3Y B;  3RL0 C;  1FZE A;  3E1I A;  4Y99 B;  5CCH C;  1JCD A;  1IFN A;  2BAS A;  2JEE A;  3OJA B;  2QM8 A;  1Z56 A;  1T2K D;  1T3J A;  4HYT B;  1JY3 O;  1NTM K;  4WBA A;  1X9V A;  5APY A;  3TNU B;  3HRN A;  1RE4 A;  1G1I A;  1GW4 A;  1IK9 A;  1QL2 A;  5AVS B;  2FYZ A;  4N78 D;  1N73 B;  2WT7 B;  5AVR B;  2VRS A;  1RF1 A;  3BRT B;  2H43 A;  1N2D C;  2WWW A;  1J1E B;  1SQB K;  4WB4 A;  5CCG A;  4ZKP A;  1XTG B;  4I6M C;  5APV A;  1JCC A;  2J58 A;  5KJ7 A;  1MUU A;  2C0X A;  2N1T B;  3P8M C;  4GKG A;  1J1E C;  1HJB A;  1NTK K;  4IFD K;  2CPS A;  4C7N A;  3MIW A;  1SFC A;  1SQV K;  1SQX K;  3U1A A;  2IFM A;  1NHL A;  1JOC A;  3OAK A;  2GUS A;  2I1K A;  3IFM A;  3BAS A;  1KZU B;  5BU5 A;  5CJ4 A;  1HVV A;  1NAF A;  4XA4 A;  3NTN A;  1PFI A;  2Q9I A;  1FAV A;  3GHG B;  4AUW A;  3B5N C;  1HGZ A;  3CLQ A;  3L36 A;  1JY2 N;  5CHX A;  2YO2 A;  4DZO A;  3RL0 B;  1JY3 P;  1KFM A;  1LGH B;  2L5G B;  4W7Z A;  4LC1 A;  2H7H A;  1LTG C;  5APW A;  1RY3 A;  5AW2 B;  1FOS E;  1FZC B;  3V2N A;  3M9Q A;  1URQ D;  4JYC A;  1KIL B;  1GU4 A;  5APT A;  1L4A B;  1FZC C;  5AW4 B;  1SQQ K;  4C7R A;  1EQ7 A;  2N9B A;  3P8C E;  3TK1 A;  1MZ9 A;  1ZV8 A;  2YKQ A;  2J59 M;  1G1J A;  3RK3 D;  1MV8 A;  2OYH B;  2Q3I A;  3M9H A;  1SP4 A;  3V2Q A;  4C46 A;  5AVT B;  2WPS A;  1NKZ B;  1GZL A;  1HWT C;  2IPP A;  2HYN A;  1CI6 B;  1H8A A;  3NXS A;  2LKM A;  2KSJ A;  3BAT A;  3MTU E;  2Z4E A;  2N1T D;  1GDT A;  2YMY A;  3HE5 A;  2Z5I A;  2KLV A;  1FDM A;  3HTK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...