2C9LY

Structure of the epstein-barr virus zebra protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
molecule keywords 5'-D(*AP*AP*GP*CP*AP*CP*TP*GP*AP*CP *TP*CP*AP*TP*GP*AP*AP*GP
total genus 26
structure length 63
sequence length 63
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9lY00
5AVYB 3KDPB 1FAVA 2XZRA 4GT1A 5APQA 5APUA 2Q7CA 1H8AA 1HJBA 5CMZA 1HBWA 3HE5A 1T2KC 5AVZB 2YO2A 5APTA 5AVWB 2W27A 3A2AA 3P7KA 1A02J 1IO4A 5AVXB 1YYCA 1J2JB 4C7NA 1HUCA 2Z5HA 3M0AA 2Z5IA 1DH3A 1NAFA 2C9LY 2H7HA 2YO3A 4AQRD 4C7NB 3LIEA 4XE5B 2R32A 2QM8A 5APYA 4B86A 4DZOA 5APXA 1GD2E 3L36A 1X8YA 3VTPC 5AW1B 4JYBA 5APVA 5AVQB 5AW4B 3SWFA 2XV5A 5APWA 3VMXA 2N9BA 2P2UA 5AW6B 1CI6A 1G2CB 2WWWA 5AW3B 5AW5B 2WPQA 3A5TA 3HE4B 1GTWA 4C46A 2R5BA 3V5BA 3KQGA 2WT7A 1HWTC 5AW7B 3VMZA 3HE4A 3NFQA 1KQLA 2XU6A 2WTYA 1CI6B 3HE5B 3V4WA 5AVSB 3MD0A 1OXZA 2WPSA 2C9NY 3V4QA 2P67A 3P32A 4GKGA 1GZLA 3O8ZA 3VMYA 1GU4A 1FOSE 1JNMA 1JUNA 3A3YB 4RESB 3TNUA 2JJLA 3L35A 1OWAA 5AVRB 3T97A 2WT7B 1MUUA 2R3CA 2KP8A 2ZFCA 5AW0B 1MV8A 5AW8B 1S9KD 3M0DA 4HYTB 1GK4A 2WPRA 5AVUB 2Q3IA 3OAKA 1MFZA 4M3LA 3B8EB 3NTNA 4KHXA 4LC1A 5AVVB 2E42A 2QM7A 1H88A 3P8MC 3MGNA 4AYCA 2W6AA 5AVTB 4I6MC 1CZQA 3I5CA 3TNUB 5AW2B 2ZXEB 2BASA 3A7OA 2E43A 4EOTA 3HTKA 3VN0A 3IR9A 1A02F 4AUWA 3M9BA 2P7JA 1GK6A 3M9HA 1CSBA 2R5DA 4I2LC 2YNYA 2IPPA 1GU5A 5APSA 1FOSF 1H89A 3M91A 3LIDA 1NWQA 3M06A 1T2KD 5AW9B 3NXSA 3TK1A 3UIAA 3VYIA 4JYCA 2Q5UA 3L37A 2VRSA 3TYYA 3NMDA 1S9KE 1SP4A 1SLQA
chains in the Genus database with same CATH superfamily
5AVYB 2KXPB 2L91A 1LTJA 2WITA 3CI9A 3GLMA 3KDPB 4U3FJ 1Q81Q 4U3FD 1HGVA 1X9VA 4N78D 1M7LA 1SQBE 2Q7CA 3KHUA 1QX8A 2A06G 3H6PA 3G3ZA 3HE5A 4NPFX 3H1LJ 4YXWH 1T2KC 5TISE 2DW3A 3L74G 3RL0C 1HTLC 1LGHB 1OX3A 1QLED 3MP7B 4UB8E 2D2CC 2C0XA 2FYUJ 2JP3A 3CC2P 1KILC 2K3RA 3S4RA 1Y8AA 5KJ7D 1FBMA 1RF0A 3FXEA 2XNDH 1JEKA 1DD3A 3I56P 4C7RA 1J2JB 1FZFA 1HUCA 1JMMA 2Z5IA 3L73D 3M0AA 4WY4C 2ZJSE 3ITKA 3RK3D 1URQA 2LXBA 1K8AQ 1BE3J 1E79H 1PV3A 4AQRD 3Q3DA 3L4FA 2MKVA 1JTHA 2XDJA 1JY3P 1NHLA 3H1ID 3LIEA 4GDOA 4C7NB 3EQ2A 2R32A 4K35A 1N2DC 1SQVJ 3H1LD 3PLNA 3H25A 3TGUE 3D71A 3CCJP 1GD2E 1OFCX 4PD4E 1JM0A 1KILB 3F5HA 1EZVG 1L0LD 3C1LA 3H1KJ 3KPEA 4HB1A 1KILA 1SFCD 4R4MA 2GUSA 3AEDC 3GF3A 1BE3G 3Q5PA 1FDMA 2RMZA 4IL6H 5KKZB 3CXHH 2XV5A 4N78E 3Q5RA 1IFMA 1EZVD 5E79E 4JBZA 2N9BA 1K9MQ 2O01H 1TU3F 1IO4A 5KAIE 3H1HD 2H43A 1URQB 2Y0EA 3TGUJ 3LW5H 2NPSB 1YBKA 2WVRA 3V2RA 1S5LX 2Z4EA 3GMAA 2OYIC 3CCVP 3BCCE 5AW3B 1FOSE 1AJYA 2WPQA 1NU1G 1M56D 1SFCB 1DD4A 1SQQD 2O3JA 3CX5H 3V5BA 1HWTC 4LLHA 3HE4A 1N73A 1FZCC 1M8OB 1U7MA 2QVAA 3NFQA 2PAJA 2E74C 4EI2A 2WTYA 2NPSA 3HE5B 3V4WA 3MD0A 3WUUA 1FZAA 1IFIA 1OXZA 2ZXXA 1RHZB 1JCCA 3U59A 4KT0J 4GKGA 4W7ZA 5KAFE 2ZVOB 1SQXE 1QL1A 2KSJA 3USSA 1KN7A 2W8ZA 2KZIA 2E74B 1QL2A 3B71A 3CL3D 2E76B 1NTMK 2O1JA 3A3YB 3B5NB 4HH2A 1KQGB 1BCCJ 1PP9J 4RESB 2E75C 2IZ1A 1YJNP 3T97A 4H0LB 3N4XA 4I1LA 2N1TB 3FWNA 1S72P 1JTHB 1Q2NA 2R3CA 2KP8A 3II6A 2IBZE 3H1JJ 1G1JA 2Q1KA 3L70E 3RL0D 1ZW0A 2HPCB 3D70A 4ASWA 1GK4A 2WPRA 1YI2P 3CC7P 3SFDC 2K1AA 1BGYJ 2E42A 2A06E 1PPJG 2QM7A 3AEAC 3L74D 4MN4C 1H88A 2PP6A 4AYCA 1NTKJ 3G4SP 3RK3C 1NTZE 1VF5B 3HD7D 2IZ0A 3I5CA 1WT6A 2NPSD 3TNUB 4YXDC 1FE6A 3FXDA 1SQQG 1ZLLA 2BASA 2ZVNB 3F89A 3H1LG 2WSCJ 3CCRP 1OW8A 3R4YA 5TJHA 1BGYG 1KTMA 1LTJB 2QJYC 3MZWB 4JF7A 5CJ4A 2KNCA 1IFJA 1L0NE 3HUSC 1SQPJ 2P7JA 2WSEH 2QG4A 3L73E 4W80A 2R5DA 2YNYA 5CBNA 3L72E 1ZOYC 1W5CE 3B4SA 3CWBD 2YMYA 3M91A 4ZKPA 5K5GB 5KJ7A 3L74E 2A45I 3T97B 3TK1A 3UIAA 4WWIA 4BRYA 1VQ6P 2LKMA 3CXHD 2FXMA 3H1HJ 1RF1B 3L37A 2PRRA 2BCCD 4KJMA 3TYYA 1J1DB 3RK2C 3CCUP 1VQNP 2I8DA 1JB0J 3IFMA 4U3FE 2HFED 1IK9A 2Y0CA 1BSNA 1ZMEC 3MIWA 2JDIH 4H13C 2ZYAA 3H32A 2Q6QA 4Y99C 5APUA 4I7ZB 1H8AA 1HJBA 3LW5J 5CMZA 2KZJA 2B87B 1AV1A 2E76D 1S5LE 5APTA 1S2EA 1EXIA 1ZR2A 1SQXK 2A45G 3P7KA 3AEBC 2E5TA 1SQVD 1X0TA 4BRYB 4BWNA 5KJ7C 5KTBA 1M1JA 3H1IJ 4IL6X 1DX7A 1N7SB 1OW6A 1QGKB 2YKQA 1LWUC 2N1TD 2WZ7A 4JPZB 4WY4D 1LTAC 3RL0g 1HH0A 1T8ZA 1YYCA 3AE4C 1ZXGA 3VP9A 1QVFO 1NYHA 3L73J 2Z5HA 2OTLP 1R5LA 4EDFA 1NAFA 1VF5C 1HJ0A 1Q86Q 2C9LY 2YO3A 3ABVC 3CD6P 2KNCB 1NAYA 2K9YA 1RF0C 1SQBK 2Q9IA 2SPZA 1USDA 4DZOA 3L71E 3L36A 1M1JB 4XFJA 3VTPC 1GW3A 3BVHA 5GTHH 1BSHA 2G8YA 4JYBA 1YIJP 1FDOA 3L70J 3RK3B 2OTKE 2ZYGA 1ZRTE 1IC2A 3SSUA 1SQPE 2H88C 1MFTA 4GIFA 1RH5B 5AVQB 1P84H 3H1KE 3SWKA 2E74D 1LT9C 1U57A 2E75B 3JCUE 1YQ3C 1GDTA 1NKZB 2A45H 4IOIH 1X22A 1BGYD 1JCDA 3L72J 1L0LE 1CI6A 1PPJE 1RE4C 3MUDC 3A0BH 1KORA 3V2PA 3TGUG 1PGOA 1SQXD 1DEBA 1G2CB 5CBOA 3AEFC 4H0LC 2K9JB 4D6TG 2KB7P 2PFXA 3M9QA 3CXHI 4EIJA 5B5EH 5BU8B 2B88A 2WT7A 1HGZA 2V7QJ 3EWKA 4L73A 1KQLA 1QVGO 2XU6A 4QMAA 1RY3A 2IDBA 1OIPA 1PPJD 4Y28J 2BEQD 5CJ0A 5APVA 5KLVD 5M1BA 3S9OA 1VQ7P 1T3JA 1EC5A 1AVYA 2Y9ZA 2C9NY 4IFMA 2P67A 1SVFA 1GZLA 3BRVB 4HJGH 3P8CE 3AEGC 2QRXA 1RE3C 1JNMA 1JY3N 3E1RA 3TNUA 1K05A 2FKWB 1OWAA 2FYZA 4DCKA 3U1AA 5AVRB 2LR2A 2YMKA 3SWYA 4R4LA 3TDKA 2WT7B 2BCCG 3BCCJ 3KXDA 2PGDA 4U3FG 2OYHA 1SQQJ 2ZFCA 3O6QB 1S9KD 4U7JA 1P84D 3B5ND 4HYTB 5AVUB 1CW5A 3O6QA 1KZUB 3G6EP 1L0NG 4OWFA 1MFZA 4M3LA 1LWUA 3NTNA 1JOCA 2AEFA 4KHXA 5KKZC 3L75G 3TGUD 1NTMJ 1GL2A 1L2PA 1VF5D 4L74A 4I6MC 1LT1A 4H44C 1AA0A 4IFFA 1NOHA 5KLVK 2FYUE 3PP5A 4CPGA 2ZXEB 3ZDMA 4NPEA 4IL6E 2OYIB 1KYOI 2FXOA 2E43A 4K3AA 3HTKA 2HR3A 4BXLA 3VN0A 1KMIZ 1YQ4C 3PRJA 1EDKA 4PV1D 5CCHA 1JO5A 1EDLA 4GOEA 2M3BA 1M57D 3M9HA 1DIPA 1LP1B 2WMMA 2WSFH 2IPPA 3GG2A 1GU5A 5APSA 1L0LK 1NU1J 2XNXA 4H13D 3Q1MA 1IFPA 2HODA 2QIWA 3LIDA 1KYOH 1N7SA 1EQ7A 3M06A 1T2KD 2N9YB 2JO1A 5KAIH 2HODB 2ZYDA 3JCUH 2Y0DA 5H2FE 3VYIA 1YJ9P 1G2CA 2Q5UA 3L72D 1GW4A 2FYUD 3H1IG 5KLVE 3KZIH 1ZV8A 1SP4A 3L70G 3H32B 1SLQA 1URQC 1LTIC 3GF7A 4UB8H 3C8VA 3OA7A 2YIUB 1FAVA 1L0LG 2XZRA 1M1JC 2W90A 4GT1A 1S5LH 3VMAA 5GTHE 3CMAP 3Q2YA 1A02J 4OH8B 2IBZI 1LTSC 2OYIA 5AVZB 1VQ9P 2M3EA 3L71G 4Y99B 1KC8Q 1GL2D 4NPDA 3A2AA 2WSFJ 2OARA 5BVZA 1WRGA 1M90Q 2D2CB 1VQ8P 2J5UA 5AVXB 1NO4A 4I7ZC 1SQQE 1NKNA 1Y9BA 2I1JA 3AE6C 2KIKA 1Q90D 2O1KA 1OW7A 3QH9A 3W68A 1NU1D 3AE1C 3EFFK 3L71J 5EFWB 1KB9I 1LTJC 2JR8A 4GOFA 4XE5B 2OYHB 2OYOA 1N7SD 3BRTB 5TISH 3I55P 2FFDA 2ZT9B 5APXA 2JWDA 2OGUA 1XTCC 1X8YA 2GUVA 3OJAB 5CCGD 4Z1MH 1PFIA 1N7SC 2OTJP 3HUSB 4OVNF 1IFNA 1XTGB 1VQOP 3H1JG 2HG5D 3VOPA 1BCCE 1L4AA 1PP9E 2H8PD 1FU1A 1FJKA 2JKVA 2M0BA 3BASA 3CWBG 3KZIE 4PD4D 2KLUA 5AW4B 3IF4A 3V2QA 5APWA 3VMXA 1ZR4A 4RO0A 1NTMD 5H2FH 1HF9A 4PJ0H 4WBAA 1YTZI 2V7QH 1S1CX 2JEEA 1LTGC 1UIIA 3BATA 1PGJA 3RK2B 3AE2C 3HD7B 1RF1A 3A5TA 4UB6H 1KILE 3AE5C 2KLVA 1VQ4P 3CWBJ 1LT9A 4C46A 2R5BA 3CCQP 1VQLP 4HKZH 2QJPC 4LGDE 2HLOA 3BCCD 1SQPD 1L4AC 3B5NA 3GHGB 1SQPK 2W6JH 1FDIA 1X79B 4PD4I 2FYUK 1BDCA 1SQQK 1SQBD 1AQTA 2WPSA 3A0HH 1GMJA 1MKMA 4L76A 4WB4A 1OZHA 2K88A 2WSSH 2Q3EA 2IX7C 1OVRA 2IYPA 3P32A 4OGQB 5DJTB 1AQ5A 2FFDC 1PGPA 3O8ZA 3VMYA 2E76C 4RKUJ 3WMM0 5KLIB 1L4AB 3EFGA 1L0NJ 1GU4A 1KYOD 2BEZF 4DOJA 3L35A 2QJPB 1NTKD 3L75J 1NH4A 3L74J 1K04A 5KLVJ 1SQVK 2QSIA 1FZCA 2FYUG 1N73C 1KILD 1MUUA 1S3JA 1SFCA 1SQPG 2R3SA 3H1IE 2FFDB 1SQVE 1W2BO 5KLIC 1IZNB 3CMEP 1GL2C 1WMKA 1MV8A 3H1KG 4OGQC 5AW8B 1LP1A 5B5EE 2KYVA 3RBXA 2P1JA 1JY2P 1NTME 4YPCA 2AEMA 1P84I 3OAKA 1SQBG 3B8EB 4PV1C 1PL5A 1JY3O 2E75D 3HTKB 2OYHC 3WU2H 1BCCD 1PP9D 2AEJA 4PJ0E 5AVTB 2B9BA 4D6TE 1EDJA 4WY4B 2BCCE 2YXRB 3CXHE 2AXTH 2B87A 1RE4A 3E7KA 1GL2B 3L70D 1S4XA 2J59M 3A7OA 3KYQA 3TSIA 4DT0A 2LXCB 3P8CD 1SQBJ 4L75A 3G71P 2QEXP 3CCEP 3IR9A 2L5GB 4AUWA 2KOGA 1GK6A 3IAOA 1FJPA 2J58A 1NTZK 1T3UA 1KFMA 5CCHD 2M5AA 3WUTA 4D6TJ 1H89A 4N3YB 2I1KA 3A0BE 3PH0A 2WQYC 3JSVC 5CCHC 4TLFA 1NWQA 1MZ9A 3AE3C 1BCCG 1PP9G 2KS1A 3K5BA 4JYCA 1BE3E 1KD1Q 1PZQA 1R8EA 2C0WA 1KB9E 2VRSA 3NMDA 3CC4P 2ZT9C 3CX5I 5BU5A 3FX0A 3CCLP 2FBWC 2JWAA 3N7NA 5CCGA 2A06D 5APQA 4PD4H 3H1KD 1HBWA 1L0LJ 3MTUE 3Q5SA 1NTKE 3U1CA 3L75E 5L8RJ 2YO2A 3MHVA 1RQVA 5AVWB 1ZRTD 1JY2N 2FYNB 2IBZD 2R44A 2W27A 2BCCJ 3M0DC 2YKPA 4WVZA 3RK2D 1YHQP 2B89A 1OVVA 1LNQA 2Y9YA 3L71D 1EDIA 1LWUB 2GM4A 1FC2C 2M5AB 4C7NA 1J1EC 3CX5D 1DH3A 2FY8A 1G1IA 1AVOA 4D6TD 2H7HA 1KQFB 3D6YA 2QJYB 5CCGC 2QA4P 1SQXG 2O01N 1VQPP 1IK7A 1R5SA 1U7JA 2N1TA 2P10A 2QE7H 2QM8A 1PIXA 5APYA 4A7PA 4B86A 3BCCG 1LTTC 4OGQD 4O9BA 4N6JA 5AW1B 4JQ0D 2P58A 1KQSO 1Y47A 2M8RA 3RGUA 1FZBA 3CCMP 3AE8C 4RJTA 3RL0B 3S1KA 1FZGA 2FXPA 1EZVI 1N7LA 1YTZT 5GTIE 1W2EA 2UWJE 2K37A 5B66E 3D6ZA 1KB9H 3SWFA 2IFMA 2RKLA 3W67A 4XA4A 5KLVG 1L4AD 1OMIA 2P2UA 3E1IA 1NTMG 2OQQA 3PTZA 3H1HG 4ASVA 2POHA 2KUBA 2ITAA 3VP8A 3CPWO 1H0TA 1KYOE 5AW6B 4W7YA 1ZP0C 1RE3A 4IFDK 2WWWA 2QJKC 3GW6A 2KS1B 1L0NK 1RQUA 3H1JD 3HE4B 5AW5B 1GTWA 2GA1A 1M1KQ 1N73B 1N86A 1EZVE 3KQGA 1VDFA 2IYOA 3G9RA 3JC22 3H1JE 1NJIQ 3IN6A 2K9JA 5AW7B 3VMZA 5KAFH 1FS0E 3H1LE 3AE7C 3CWBE 1Q82Q 4PV1B 4YTPC 1CI6B 1KFNA 3C9IA 1KV4A 3L75D 5AVSB 1SQVG 3AEEC 1Q7YQ 2AXTE 1NU1K 2IBZG 1L0ND 1LTBC 3FWLA 4H44B 3V4QA 2D2CD 1AFOA 3L73G 1RF1C 3HRNA 3B5NC 3CLQA 2N1TC 3QWOC 3WU2E 3GHGC 3OW2O 2CK3H 1JMBA 1JUNA 1KB9D 1NTKK 1UIXA 2JJLA 2WPVB 3RK3E 1URQD 4WY4A 1NTZG 1LJ2A 1NTZD 3FGAD 3V6IA 2KSEA 4ZNCA 1YJWP 3RBZA 2WSCH 1NGMB 3CCSP 1T6AA 3AE9C 4H44D 1E5WA 4ZMDA 5AW0B 1PGQA 1BGYE 2IFNA 2RH0A 3M0DA 1FZEA 2H89C 1IJDB 1VQMP 3CX5E 2Q3IA 2NZ2A 2NRGA 4UB6E 2W83C 1NVOA 1SFCC 4TT3H 5AVVB 4LC1A 1NTKG 1DEEG 1NTZJ 1ZN5A 2KK7A 2O01J 2YKOA 3L72G 3P8MC 3MGNA 3PHLA 3SFEC 1FZCB 3WUVA 5DJUB 1VPCA 2AXCA 4ZKUA 2W6AA 1NU1E 1CZQA 2RN0A 2W6BA 1VQ5P 3HUSA 5AW2B 1USEA 2KI7B 3A0HE 3HD7C 5CHXA 2E5YA 3AECC 4DJGA 2CPBA 4EYYQ 3V2NA 5B66H 1VQKP 2QJKB 4EOTA 3TF5A 1N8RQ 5C39A 1A02F 2FYNC 3M9BA 1H0TB 1K73Q 1JY2O 2WSEJ 1HVVA 2ZT9D 1J1EB 1CSBA 2HPCA 4I2LC 1VL2A 1YITP 1QEXA 3GHGA 1BE3D 1EXJA 1FOSF 1IFDA 4H0LD 2CPSA 2NPSC 3PJSK 2HYNA 2ZAEB 2YXQB 1D7MA 2G3AA 1SQXJ 1OVUA 1Z56A 1LT9B 3NXSA 3R2PA 4GODA 5AW9B 2XKMA 5GTIH 1J1DC 2MJZA 3MUDA 3HD7A 5E79H 1P84E 1S9KE 1BDDA 2V4HA 4H13B 1SS1A 2YIUC 3H1HE
chains in the Genus database with same CATH topology
5AVYB 3CI9A 1LTJA 2WITA 3KDPB 1HGVA 1X9VA 4N78D 1M7LA 2Q7CA 3HE5A 3H6PA 3G3ZA 1T2KC 3RL0C 1HTLC 1LGHB 2C0XA 1KILC 5KJ7D 1FBMA 1RF0A 4C7RA 1J2JB 1FZFA 1HUCA 1JMMA 2Z5IA 3M0AA 4WY4C 3RK3D 1URQA 4AQRD 3L4FA 4C7NB 1JTHA 2XDJA 1JY3P 1NHLA 3LIEA 1RF1C 3EQ2A 2R32A 1N2DC 1GD2E 1KILB 3KPEA 1KILA 1SFCD 2GUSA 1FDMA 2XV5A 4N78E 1IFMA 2N9BA 2O01H 2H43A 1URQB 3LW5H 2NPSB 3V2RA 2Z4EA 2OYIC 5AW3B 2WPQA 1SFCB 3V5BA 1HWTC 4LLHA 3HE4A 1N73A 1FZCC 3NFQA 2PAJA 2WTYA 2NPSA 3HE5B 3V4WA 3MD0A 1IFIA 1FZAA 1OXZA 1JCCA 3U59A 4GKGA 4W7ZA 2KSJA 1QL1A 1FOSE 1QL2A 3CL3D 4HH2A 2O1JA 1NTMK 3A3YB 3B5NB 4RESB 3T97A 3N4XA 4I1LA 2N1TB 1JTHB 2R3CA 2KP8A 3II6A 3RL0D 1G1JA 2HPCB 1GK4A 2WPRA 2E42A 2QM7A 1H88A 2PP6A 4AYCA 3RK3C 3HD7D 3I5CA 1WT6A 2NPSD 3TNUB 1ZLLA 2BASA 1LTJB 4JF7A 5CJ4A 1IFJA 3HUSC 2P7JA 2WSEH 4W80A 2R5DA 2YNYA 3M91A 2YMYA 4ZKPA 5KJ7A 2A45I 3TK1A 3UIAA 2LKMA 2FXMA 1RF1B 3L37A 3TYYA 1J1DB 3RK2C 3IFMA 2HFED 1IK9A 3MIWA 3H32A 4Y99C 5APUA 1HJBA 1H8AA 1PFIA 5CMZA 5APTA 1ZR2A 1SQXK 2A45G 3P7KA 5KJ7C 1A02J 5KTBA 1IO4A 1DX7A 1M1JA 1N7SB 2YKQA 1LWUC 2N1TD 2WZ7A 4WY4D 1LTAC 3VP9A 1HH0A 1T8ZA 1YYCA 2Z5HA 1NAFA 2C9LY 2YO3A 1RF0C 1SQBK 2Q9IA 4DZOA 3L36A 1M1JB 3VTPC 1GW3A 3BVHA 4JYBA 3RK3B 1IC2A 4GIFA 5AVQB 1LT9C 1GDTA 1NKZB 2A45H 1JCDA 1CI6A 1RE4C 3V2PA 1DEBA 1G2CB 2KB7P 3M9QA 4EIJA 5BU8B 2WT7A 1HGZA 1KQLA 2XU6A 5CJ0A 1RY3A 1T3JA 2C9NY 4IFMA 2P67A 1SVFA 1GZLA 3BRVB 3P8CE 1RE3C 1JNMA 1JY3N 3TNUA 2FKWB 1OWAA 2FYZA 3U1AA 5AVRB 3SWYA 2WT7B 2OYHA 2ZFCA 1S9KD 3B5ND 4HYTB 5AVUB 1CW5A 1KZUB 1MFZA 4M3LA 1LWUA 3NTNA 1JOCA 4KHXA 1GL2A 4I6MC 5KLVK 4IFFA 1NOHA 3PP5A 2ZXEB 2OYIB 2E43A 3HTKA 3VN0A 5CCHA 1JO5A 2M3BA 3M9HA 2WSFH 2IPPA 1GU5A 5APSA 1L0LK 2XNXA 2HODA 3LIDA 1N7SA 1EQ7A 3M06A 1T2KD 2HODB 3VYIA 1G2CA 2Q5UA 1GW4A 1ZV8A 1SP4A 3H32B 1SLQA 1URQC 1LTIC 3OA7A 1FAVA 2XZRA 1M1JC 4GT1A 4OH8B 1LTSC 2OYIA 5AVZB 4Y99B 1GL2D 3A2AA 2OARA 5BVZA 1WRGA 5AVXB 1NO4A 1NKNA 2I1JA 2O1KA 1LTJC 4XE5B 2OYHB 3BRTB 1N7SD 2FFDA 5APXA 5CCGD 1XTCC 1X8YA 2GUVA 3OJAB 1N7SC 3HUSB 1IFNA 1XTGB 2HG5D 3VOPA 5APVA 1L4AA 2H8PD 1FU1A 1FJKA 3BASA 3V2QA 5AW4B 5APWA 3VMXA 1ZR4A 4WBAA 1YTZI 2JEEA 1LTGC 3BATA 1RF1A 3RK2B 3HD7B 3A5TA 2KLVA 4C46A 1LT9A 2R5BA 4LGDE 2HLOA 1L4AC 3B5NA 3GHGB 1SQPK 1X79B 2FYUK 1SQQK 2WPSA 4WB4A 3P32A 2IX7C 1AQ5A 2FFDC 3O8ZA 3VMYA 3WMM0 1GU4A 3EFGA 1L4AB 4DOJA 3L35A 1NH4A 1SQVK 1FZCA 1N73C 1KILD 1MUUA 1SFCA 2FFDB 1GL2C 1MV8A 5AW8B 2KYVA 2P1JA 1JY2P 3OAKA 3B8EB 1JY3O 3HTKB 2OYHC 5AVTB 4WY4B 1RE4A 1GL2B 2J59M 3A7OA 3KYQA 3TSIA 3P8CD 3IR9A 2L5GB 4AUWA 2KOGA 1GK6A 1FJPA 2J58A 1NTZK 1T3UA 1KFMA 5CCHD 1H89A 4N3YB 2I1KA 5CCHC 1NWQA 1MZ9A 4JYCA 2C0WA 2VRSA 3NMDA 5BU5A 5CCGA 3N7NA 5APQA 1HBWA 3MTUE 3U1CA 2YO2A 5AVWB 1JY2N 2W27A 3M0DC 2YKPA 3RK2D 1LWUB 2GM4A 4C7NA 1J1EC 1DH3A 1G1IA 2H7HA 5CCGC 2N1TA 2QM8A 5APYA 4B86A 1LTTC 4O9BA 4N6JA 5AW1B 2M8RA 1FZBA 3RL0B 1FZGA 1N7LA 1YTZT 1W2EA 3SWFA 2IFMA 4XA4A 1L4AD 2P2UA 3E1IA 2POHA 3VP8A 5AW6B 4W7YA 1RE3A 4IFDK 2WWWA 5AW5B 1L0NK 3HE4B 1GTWA 1N73B 1N86A 3KQGA 1VDFA 5AW7B 3VMZA 1CI6B 1KFNA 3C9IA 5AVSB 1NU1K 1LTBC 1AFOA 3V4QA 3HRNA 3B5NC 3CLQA 2N1TC 3GHGC 1JUNA 1NTKK 2JJLA 1URQD 4WY4A 2WSCH 1E5WA 5AW0B 2IFNA 3M0DA 1FZEA 1IJDB 2Q3IA 5AVVB 1SFCC 4LC1A 1ZN5A 2YKOA 3P8MC 3MGNA 1FZCB 1VPCA 4ZKUA 2W6AA 1CZQA 2W6BA 3HUSA 5AW2B 3HD7C 5CHXA 2CPBA 3V2NA 4EOTA 1A02F 3M9BA 1JY2O 1HVVA 1J1EB 1CSBA 2HPCA 4I2LC 3GHGA 1FOSF 1IFDA 2CPSA 2NPSC 2HYNA 3R2PA 1Z56A 5AW9B 1LT9B 3NXSA 2XKMA 1J1DC 2MJZA 3MUDA 3HD7A 1S9KE
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AVY B;  3KDP B;  1FAV A;  2XZR A;  4GT1 A;  5APQ A;  5APU A;  2Q7C A;  1H8A A;  1HJB A;  5CMZ A;  1HBW A;  3HE5 A;  1T2K C;  5AVZ B;  2YO2 A;  5APT A;  5AVW B;  2W27 A;  3A2A A;  3P7K A;  1A02 J;  1IO4 A;  5AVX B;  1YYC A;  1J2J B;  4C7N A;  1HUC A;  2Z5H A;  3M0A A;  2Z5I A;  1DH3 A;  1NAF A;  2C9L Y;  2H7H A;  2YO3 A;  4AQR D;  4C7N B;  3LIE A;  4XE5 B;  2R32 A;  2QM8 A;  5APY A;  4B86 A;  4DZO A;  5APX A;  1GD2 E;  3L36 A;  1X8Y A;  3VTP C;  5AW1 B;  4JYB A;  5APV A;  5AVQ B;  5AW4 B;  3SWF A;  2XV5 A;  5APW A;  3VMX A;  2N9B A;  2P2U A;  5AW6 B;  1CI6 A;  1G2C B;  2WWW A;  5AW3 B;  5AW5 B;  2WPQ A;  3A5T A;  3HE4 B;  1GTW A;  4C46 A;  2R5B A;  3V5B A;  3KQG A;  2WT7 A;  1HWT C;  5AW7 B;  3VMZ A;  3HE4 A;  3NFQ A;  1KQL A;  2XU6 A;  2WTY A;  1CI6 B;  3HE5 B;  3V4W A;  5AVS B;  3MD0 A;  1OXZ A;  2WPS A;  2C9N Y;  3V4Q A;  2P67 A;  3P32 A;  4GKG A;  1GZL A;  3O8Z A;  3VMY A;  1GU4 A;  1FOS E;  1JNM A;  1JUN A;  3A3Y B;  4RES B;  3TNU A;  2JJL A;  3L35 A;  1OWA A;  5AVR B;  3T97 A;  2WT7 B;  1MUU A;  2R3C A;  2KP8 A;  2ZFC A;  5AW0 B;  1MV8 A;  5AW8 B;  1S9K D;  3M0D A;  4HYT B;  1GK4 A;  2WPR A;  5AVU B;  2Q3I A;  3OAK A;  1MFZ A;  4M3L A;  3B8E B;  3NTN A;  4KHX A;  4LC1 A;  5AVV B;  2E42 A;  2QM7 A;  1H88 A;  3P8M C;  3MGN A;  4AYC A;  2W6A A;  5AVT B;  4I6M C;  1CZQ A;  3I5C A;  3TNU B;  5AW2 B;  2ZXE B;  2BAS A;  3A7O A;  2E43 A;  4EOT A;  3HTK A;  3VN0 A;  3IR9 A;  1A02 F;  4AUW A;  3M9B A;  2P7J A;  1GK6 A;  3M9H A;  1CSB A;  2R5D A;  4I2L C;  2YNY A;  2IPP A;  1GU5 A;  5APS A;  1FOS F;  1H89 A;  3M91 A;  3LID A;  1NWQ A;  3M06 A;  1T2K D;  5AW9 B;  3NXS A;  3TK1 A;  3UIA A;  3VYI A;  4JYC A;  2Q5U A;  3L37 A;  2VRS A;  3TYY A;  3NMD A;  1S9K E;  1SP4 A;  1SLQ A; 
#chains in the Genus database with same CATH topology
 5AVY B;  2KXP B;  2L91 A;  1LTJ A;  2WIT A;  3CI9 A;  3GLM A;  3KDP B;  4U3F J;  1Q81 Q;  4U3F D;  1HGV A;  1X9V A;  4N78 D;  1M7L A;  1SQB E;  2Q7C A;  3KHU A;  1QX8 A;  2A06 G;  3H6P A;  3G3Z A;  3HE5 A;  4NPF X;  3H1L J;  4YXW H;  1T2K C;  5TIS E;  2DW3 A;  3L74 G;  3RL0 C;  1HTL C;  1LGH B;  1OX3 A;  1QLE D;  3MP7 B;  4UB8 E;  2D2C C;  2C0X A;  2FYU J;  2JP3 A;  3CC2 P;  1KIL C;  2K3R A;  3S4R A;  1Y8A A;  5KJ7 D;  1FBM A;  1RF0 A;  3FXE A;  2XND H;  1JEK A;  1DD3 A;  3I56 P;  4C7R A;  1J2J B;  1FZF A;  1HUC A;  1JMM A;  2Z5I A;  3L73 D;  3M0A A;  4WY4 C;  2ZJS E;  3ITK A;  3RK3 D;  1URQ A;  2LXB A;  1K8A Q;  1BE3 J;  1E79 H;  1PV3 A;  4AQR D;  3Q3D A;  3L4F A;  2MKV A;  1JTH A;  2XDJ A;  1JY3 P;  1NHL A;  3H1I D;  3LIE A;  4GDO A;  4C7N B;  3EQ2 A;  2R32 A;  4K35 A;  1N2D C;  1SQV J;  3H1L D;  3PLN A;  3H25 A;  3TGU E;  3D71 A;  3CCJ P;  1GD2 E;  1OFC X;  4PD4 E;  1JM0 A;  1KIL B;  3F5H A;  1EZV G;  1L0L D;  3C1L A;  3H1K J;  3KPE A;  4HB1 A;  1KIL A;  1SFC D;  4R4M A;  2GUS A;  3AED C;  3GF3 A;  1BE3 G;  3Q5P A;  1FDM A;  2RMZ A;  4IL6 H;  5KKZ B;  3CXH H;  2XV5 A;  4N78 E;  3Q5R A;  1IFM A;  1EZV D;  5E79 E;  4JBZ A;  2N9B A;  1K9M Q;  2O01 H;  1TU3 F;  1IO4 A;  5KAI E;  3H1H D;  2H43 A;  1URQ B;  2Y0E A;  3TGU J;  3LW5 H;  2NPS B;  1YBK A;  2WVR A;  3V2R A;  1S5L X;  2Z4E A;  3GMA A;  2OYI C;  3CCV P;  3BCC E;  5AW3 B;  1FOS E;  1AJY A;  2WPQ A;  1NU1 G;  1M56 D;  1SFC B;  1DD4 A;  1SQQ D;  2O3J A;  3CX5 H;  3V5B A;  1HWT C;  4LLH A;  3HE4 A;  1N73 A;  1FZC C;  1M8O B;  1U7M A;  2QVA A;  3NFQ A;  2PAJ A;  2E74 C;  4EI2 A;  2WTY A;  2NPS A;  3HE5 B;  3V4W A;  3MD0 A;  3WUU A;  1FZA A;  1IFI A;  1OXZ A;  2ZXX A;  1RHZ B;  1JCC A;  3U59 A;  4KT0 J;  4GKG A;  4W7Z A;  5KAF E;  2ZVO B;  1SQX E;  1QL1 A;  2KSJ A;  3USS A;  1KN7 A;  2W8Z A;  2KZI A;  2E74 B;  1QL2 A;  3B71 A;  3CL3 D;  2E76 B;  1NTM K;  2O1J A;  3A3Y B;  3B5N B;  4HH2 A;  1KQG B;  1BCC J;  1PP9 J;  4RES B;  2E75 C;  2IZ1 A;  1YJN P;  3T97 A;  4H0L B;  3N4X A;  4I1L A;  2N1T B;  3FWN A;  1S72 P;  1JTH B;  1Q2N A;  2R3C A;  2KP8 A;  3II6 A;  2IBZ E;  3H1J J;  1G1J A;  2Q1K A;  3L70 E;  3RL0 D;  1ZW0 A;  2HPC B;  3D70 A;  4ASW A;  1GK4 A;  2WPR A;  1YI2 P;  3CC7 P;  3SFD C;  2K1A A;  1BGY J;  2E42 A;  2A06 E;  1PPJ G;  2QM7 A;  3AEA C;  3L74 D;  4MN4 C;  1H88 A;  2PP6 A;  4AYC A;  1NTK J;  3G4S P;  3RK3 C;  1NTZ E;  1VF5 B;  3HD7 D;  2IZ0 A;  3I5C A;  1WT6 A;  2NPS D;  3TNU B;  4YXD C;  1FE6 A;  3FXD A;  1SQQ G;  1ZLL A;  2BAS A;  2ZVN B;  3F89 A;  3H1L G;  2WSC J;  3CCR P;  1OW8 A;  3R4Y A;  5TJH A;  1BGY G;  1KTM A;  1LTJ B;  2QJY C;  3MZW B;  4JF7 A;  5CJ4 A;  2KNC A;  1IFJ A;  1L0N E;  3HUS C;  1SQP J;  2P7J A;  2WSE H;  2QG4 A;  3L73 E;  4W80 A;  2R5D A;  2YNY A;  5CBN A;  3L72 E;  1ZOY C;  1W5C E;  3B4S A;  3CWB D;  2YMY A;  3M91 A;  4ZKP A;  5K5G B;  5KJ7 A;  3L74 E;  2A45 I;  3T97 B;  3TK1 A;  3UIA A;  4WWI A;  4BRY A;  1VQ6 P;  2LKM A;  3CXH D;  2FXM A;  3H1H J;  1RF1 B;  3L37 A;  2PRR A;  2BCC D;  4KJM A;  3TYY A;  1J1D B;  3RK2 C;  3CCU P;  1VQN P;  2I8D A;  1JB0 J;  3IFM A;  4U3F E;  2HFE D;  1IK9 A;  2Y0C A;  1BSN A;  1ZME C;  3MIW A;  2JDI H;  4H13 C;  2ZYA A;  3H32 A;  2Q6Q A;  4Y99 C;  5APU A;  4I7Z B;  1H8A A;  1HJB A;  3LW5 J;  5CMZ A;  2KZJ A;  2B87 B;  1AV1 A;  2E76 D;  1S5L E;  5APT A;  1S2E A;  1EXI A;  1ZR2 A;  1SQX K;  2A45 G;  3P7K A;  3AEB C;  2E5T A;  1SQV D;  1X0T A;  4BRY B;  4BWN A;  5KJ7 C;  5KTB A;  1M1J A;  3H1I J;  4IL6 X;  1DX7 A;  1N7S B;  1OW6 A;  1QGK B;  2YKQ A;  1LWU C;  2N1T D;  2WZ7 A;  4JPZ B;  4WY4 D;  1LTA C;  3RL0 g;  1HH0 A;  1T8Z A;  1YYC A;  3AE4 C;  1ZXG A;  3VP9 A;  1QVF O;  1NYH A;  3L73 J;  2Z5H A;  2OTL P;  1R5L A;  4EDF A;  1NAF A;  1VF5 C;  1HJ0 A;  1Q86 Q;  2C9L Y;  2YO3 A;  3ABV C;  3CD6 P;  2KNC B;  1NAY A;  2K9Y A;  1RF0 C;  1SQB K;  2Q9I A;  2SPZ A;  1USD A;  4DZO A;  3L71 E;  3L36 A;  1M1J B;  4XFJ A;  3VTP C;  1GW3 A;  3BVH A;  5GTH H;  1BSH A;  2G8Y A;  4JYB A;  1YIJ P;  1FDO A;  3L70 J;  3RK3 B;  2OTK E;  2ZYG A;  1ZRT E;  1IC2 A;  3SSU A;  1SQP E;  2H88 C;  1MFT A;  4GIF A;  1RH5 B;  5AVQ B;  1P84 H;  3H1K E;  3SWK A;  2E74 D;  1LT9 C;  1U57 A;  2E75 B;  3JCU E;  1YQ3 C;  1GDT A;  1NKZ B;  2A45 H;  4IOI H;  1X22 A;  1BGY D;  1JCD A;  3L72 J;  1L0L E;  1CI6 A;  1PPJ E;  1RE4 C;  3MUD C;  3A0B H;  1KOR A;  3V2P A;  3TGU G;  1PGO A;  1SQX D;  1DEB A;  1G2C B;  5CBO A;  3AEF C;  4H0L C;  2K9J B;  4D6T G;  2KB7 P;  2PFX A;  3M9Q A;  3CXH I;  4EIJ A;  5B5E H;  5BU8 B;  2B88 A;  2WT7 A;  1HGZ A;  2V7Q J;  3EWK A;  4L73 A;  1KQL A;  1QVG O;  2XU6 A;  4QMA A;  1RY3 A;  2IDB A;  1OIP A;  1PPJ D;  4Y28 J;  2BEQ D;  5CJ0 A;  5APV A;  5KLV D;  5M1B A;  3S9O A;  1VQ7 P;  1T3J A;  1EC5 A;  1AVY A;  2Y9Z A;  2C9N Y;  4IFM A;  2P67 A;  1SVF A;  1GZL A;  3BRV B;  4HJG H;  3P8C E;  3AEG C;  2QRX A;  1RE3 C;  1JNM A;  1JY3 N;  3E1R A;  3TNU A;  1K05 A;  2FKW B;  1OWA A;  2FYZ A;  4DCK A;  3U1A A;  5AVR B;  2LR2 A;  2YMK A;  3SWY A;  4R4L A;  3TDK A;  2WT7 B;  2BCC G;  3BCC J;  3KXD A;  2PGD A;  4U3F G;  2OYH A;  1SQQ J;  2ZFC A;  3O6Q B;  1S9K D;  4U7J A;  1P84 D;  3B5N D;  4HYT B;  5AVU B;  1CW5 A;  3O6Q A;  1KZU B;  3G6E P;  1L0N G;  4OWF A;  1MFZ A;  4M3L A;  1LWU A;  3NTN A;  1JOC A;  2AEF A;  4KHX A;  5KKZ C;  3L75 G;  3TGU D;  1NTM J;  1GL2 A;  1L2P A;  1VF5 D;  4L74 A;  4I6M C;  1LT1 A;  4H44 C;  1AA0 A;  4IFF A;  1NOH A;  5KLV K;  2FYU E;  3PP5 A;  4CPG A;  2ZXE B;  3ZDM A;  4NPE A;  4IL6 E;  2OYI B;  1KYO I;  2FXO A;  2E43 A;  4K3A A;  3HTK A;  2HR3 A;  4BXL A;  3VN0 A;  1KMI Z;  1YQ4 C;  3PRJ A;  1EDK A;  4PV1 D;  5CCH A;  1JO5 A;  1EDL A;  4GOE A;  2M3B A;  1M57 D;  3M9H A;  1DIP A;  1LP1 B;  2WMM A;  2WSF H;  2IPP A;  3GG2 A;  1GU5 A;  5APS A;  1L0L K;  1NU1 J;  2XNX A;  4H13 D;  3Q1M A;  1IFP A;  2HOD A;  2QIW A;  3LID A;  1KYO H;  1N7S A;  1EQ7 A;  3M06 A;  1T2K D;  2N9Y B;  2JO1 A;  5KAI H;  2HOD B;  2ZYD A;  3JCU H;  2Y0D A;  5H2F E;  3VYI A;  1YJ9 P;  1G2C A;  2Q5U A;  3L72 D;  1GW4 A;  2FYU D;  3H1I G;  5KLV E;  3KZI H;  1ZV8 A;  1SP4 A;  3L70 G;  3H32 B;  1SLQ A;  1URQ C;  1LTI C;  3GF7 A;  4UB8 H;  3C8V A;  3OA7 A;  2YIU B;  1FAV A;  1L0L G;  2XZR A;  1M1J C;  2W90 A;  4GT1 A;  1S5L H;  3VMA A;  5GTH E;  3CMA P;  3Q2Y A;  1A02 J;  4OH8 B;  2IBZ I;  1LTS C;  2OYI A;  5AVZ B;  1VQ9 P;  2M3E A;  3L71 G;  4Y99 B;  1KC8 Q;  1GL2 D;  4NPD A;  3A2A A;  2WSF J;  2OAR A;  5BVZ A;  1WRG A;  1M90 Q;  2D2C B;  1VQ8 P;  2J5U A;  5AVX B;  1NO4 A;  4I7Z C;  1SQQ E;  1NKN A;  1Y9B A;  2I1J A;  3AE6 C;  2KIK A;  1Q90 D;  2O1K A;  1OW7 A;  3QH9 A;  3W68 A;  1NU1 D;  3AE1 C;  3EFF K;  3L71 J;  5EFW B;  1KB9 I;  1LTJ C;  2JR8 A;  4GOF A;  4XE5 B;  2OYH B;  2OYO A;  1N7S D;  3BRT B;  5TIS H;  3I55 P;  2FFD A;  2ZT9 B;  5APX A;  2JWD A;  2OGU A;  1XTC C;  1X8Y A;  2GUV A;  3OJA B;  5CCG D;  4Z1M H;  1PFI A;  1N7S C;  2OTJ P;  3HUS B;  4OVN F;  1IFN A;  1XTG B;  1VQO P;  3H1J G;  2HG5 D;  3VOP A;  1BCC E;  1L4A A;  1PP9 E;  2H8P D;  1FU1 A;  1FJK A;  2JKV A;  2M0B A;  3BAS A;  3CWB G;  3KZI E;  4PD4 D;  2KLU A;  5AW4 B;  3IF4 A;  3V2Q A;  5APW A;  3VMX A;  1ZR4 A;  4RO0 A;  1NTM D;  5H2F H;  1HF9 A;  4PJ0 H;  4WBA A;  1YTZ I;  2V7Q H;  1S1C X;  2JEE A;  1LTG C;  1UII A;  3BAT A;  1PGJ A;  3RK2 B;  3AE2 C;  3HD7 B;  1RF1 A;  3A5T A;  4UB6 H;  1KIL E;  3AE5 C;  2KLV A;  1VQ4 P;  3CWB J;  1LT9 A;  4C46 A;  2R5B A;  3CCQ P;  1VQL P;  4HKZ H;  2QJP C;  4LGD E;  2HLO A;  3BCC D;  1SQP D;  1L4A C;  3B5N A;  3GHG B;  1SQP K;  2W6J H;  1FDI A;  1X79 B;  4PD4 I;  2FYU K;  1BDC A;  1SQQ K;  1SQB D;  1AQT A;  2WPS A;  3A0H H;  1GMJ A;  1MKM A;  4L76 A;  4WB4 A;  1OZH A;  2K88 A;  2WSS H;  2Q3E A;  2IX7 C;  1OVR A;  2IYP A;  3P32 A;  4OGQ B;  5DJT B;  1AQ5 A;  2FFD C;  1PGP A;  3O8Z A;  3VMY A;  2E76 C;  4RKU J;  3WMM 0;  5KLI B;  1L4A B;  3EFG A;  1L0N J;  1GU4 A;  1KYO D;  2BEZ F;  4DOJ A;  3L35 A;  2QJP B;  1NTK D;  3L75 J;  1NH4 A;  3L74 J;  1K04 A;  5KLV J;  1SQV K;  2QSI A;  1FZC A;  2FYU G;  1N73 C;  1KIL D;  1MUU A;  1S3J A;  1SFC A;  1SQP G;  2R3S A;  3H1I E;  2FFD B;  1SQV E;  1W2B O;  5KLI C;  1IZN B;  3CME P;  1GL2 C;  1WMK A;  1MV8 A;  3H1K G;  4OGQ C;  5AW8 B;  1LP1 A;  5B5E E;  2KYV A;  3RBX A;  2P1J A;  1JY2 P;  1NTM E;  4YPC A;  2AEM A;  1P84 I;  3OAK A;  1SQB G;  3B8E B;  4PV1 C;  1PL5 A;  1JY3 O;  2E75 D;  3HTK B;  2OYH C;  3WU2 H;  1BCC D;  1PP9 D;  2AEJ A;  4PJ0 E;  5AVT B;  2B9B A;  4D6T E;  1EDJ A;  4WY4 B;  2BCC E;  2YXR B;  3CXH E;  2AXT H;  2B87 A;  1RE4 A;  3E7K A;  1GL2 B;  3L70 D;  1S4X A;  2J59 M;  3A7O A;  3KYQ A;  3TSI A;  4DT0 A;  2LXC B;  3P8C D;  1SQB J;  4L75 A;  3G71 P;  2QEX P;  3CCE P;  3IR9 A;  2L5G B;  4AUW A;  2KOG A;  1GK6 A;  3IAO A;  1FJP A;  2J58 A;  1NTZ K;  1T3U A;  1KFM A;  5CCH D;  2M5A A;  3WUT A;  4D6T J;  1H89 A;  4N3Y B;  2I1K A;  3A0B E;  3PH0 A;  2WQY C;  3JSV C;  5CCH C;  4TLF A;  1NWQ A;  1MZ9 A;  3AE3 C;  1BCC G;  1PP9 G;  2KS1 A;  3K5B A;  4JYC A;  1BE3 E;  1KD1 Q;  1PZQ A;  1R8E A;  2C0W A;  1KB9 E;  2VRS A;  3NMD A;  3CC4 P;  2ZT9 C;  3CX5 I;  5BU5 A;  3FX0 A;  3CCL P;  2FBW C;  2JWA A;  3N7N A;  5CCG A;  2A06 D;  5APQ A;  4PD4 H;  3H1K D;  1HBW A;  1L0L J;  3MTU E;  3Q5S A;  1NTK E;  3U1C A;  3L75 E;  5L8R J;  2YO2 A;  3MHV A;  1RQV A;  5AVW B;  1ZRT D;  1JY2 N;  2FYN B;  2IBZ D;  2R44 A;  2W27 A;  2BCC J;  3M0D C;  2YKP A;  4WVZ A;  3RK2 D;  1YHQ P;  2B89 A;  1OVV A;  1LNQ A;  2Y9Y A;  3L71 D;  1EDI A;  1LWU B;  2GM4 A;  1FC2 C;  2M5A B;  4C7N A;  1J1E C;  3CX5 D;  1DH3 A;  2FY8 A;  1G1I A;  1AVO A;  4D6T D;  2H7H A;  1KQF B;  3D6Y A;  2QJY B;  5CCG C;  2QA4 P;  1SQX G;  2O01 N;  1VQP P;  1IK7 A;  1R5S A;  1U7J A;  2N1T A;  2P10 A;  2QE7 H;  2QM8 A;  1PIX A;  5APY A;  4A7P A;  4B86 A;  3BCC G;  1LTT C;  4OGQ D;  4O9B A;  4N6J A;  5AW1 B;  4JQ0 D;  2P58 A;  1KQS O;  1Y47 A;  2M8R A;  3RGU A;  1FZB A;  3CCM P;  3AE8 C;  4RJT A;  3RL0 B;  3S1K A;  1FZG A;  2FXP A;  1EZV I;  1N7L A;  1YTZ T;  5GTI E;  1W2E A;  2UWJ E;  2K37 A;  5B66 E;  3D6Z A;  1KB9 H;  3SWF A;  2IFM A;  2RKL A;  3W67 A;  4XA4 A;  5KLV G;  1L4A D;  1OMI A;  2P2U A;  3E1I A;  1NTM G;  2OQQ A;  3PTZ A;  3H1H G;  4ASV A;  2POH A;  2KUB A;  2ITA A;  3VP8 A;  3CPW O;  1H0T A;  1KYO E;  5AW6 B;  4W7Y A;  1ZP0 C;  1RE3 A;  4IFD K;  2WWW A;  2QJK C;  3GW6 A;  2KS1 B;  1L0N K;  1RQU A;  3H1J D;  3HE4 B;  5AW5 B;  1GTW A;  2GA1 A;  1M1K Q;  1N73 B;  1N86 A;  1EZV E;  3KQG A;  1VDF A;  2IYO A;  3G9R A;  3JC2 2;  3H1J E;  1NJI Q;  3IN6 A;  2K9J A;  5AW7 B;  3VMZ A;  5KAF H;  1FS0 E;  3H1L E;  3AE7 C;  3CWB E;  1Q82 Q;  4PV1 B;  4YTP C;  1CI6 B;  1KFN A;  3C9I A;  1KV4 A;  3L75 D;  5AVS B;  1SQV G;  3AEE C;  1Q7Y Q;  2AXT E;  1NU1 K;  2IBZ G;  1L0N D;  1LTB C;  3FWL A;  4H44 B;  3V4Q A;  2D2C D;  1AFO A;  3L73 G;  1RF1 C;  3HRN A;  3B5N C;  3CLQ A;  2N1T C;  3QWO C;  3WU2 E;  3GHG C;  3OW2 O;  2CK3 H;  1JMB A;  1JUN A;  1KB9 D;  1NTK K;  1UIX A;  2JJL A;  2WPV B;  3RK3 E;  1URQ D;  4WY4 A;  1NTZ G;  1LJ2 A;  1NTZ D;  3FGA D;  3V6I A;  2KSE A;  4ZNC A;  1YJW P;  3RBZ A;  2WSC H;  1NGM B;  3CCS P;  1T6A A;  3AE9 C;  4H44 D;  1E5W A;  4ZMD A;  5AW0 B;  1PGQ A;  1BGY E;  2IFN A;  2RH0 A;  3M0D A;  1FZE A;  2H89 C;  1IJD B;  1VQM P;  3CX5 E;  2Q3I A;  2NZ2 A;  2NRG A;  4UB6 E;  2W83 C;  1NVO A;  1SFC C;  4TT3 H;  5AVV B;  4LC1 A;  1NTK G;  1DEE G;  1NTZ J;  1ZN5 A;  2KK7 A;  2O01 J;  2YKO A;  3L72 G;  3P8M C;  3MGN A;  3PHL A;  3SFE C;  1FZC B;  3WUV A;  5DJU B;  1VPC A;  2AXC A;  4ZKU A;  2W6A A;  1NU1 E;  1CZQ A;  2RN0 A;  2W6B A;  1VQ5 P;  3HUS A;  5AW2 B;  1USE A;  2KI7 B;  3A0H E;  3HD7 C;  5CHX A;  2E5Y A;  3AEC C;  4DJG A;  2CPB A;  4EYY Q;  3V2N A;  5B66 H;  1VQK P;  2QJK B;  4EOT A;  3TF5 A;  1N8R Q;  5C39 A;  1A02 F;  2FYN C;  3M9B A;  1H0T B;  1K73 Q;  1JY2 O;  2WSE J;  1HVV A;  2ZT9 D;  1J1E B;  1CSB A;  2HPC A;  4I2L C;  1VL2 A;  1YIT P;  1QEX A;  3GHG A;  1BE3 D;  1EXJ A;  1FOS F;  1IFD A;  4H0L D;  2CPS A;  2NPS C;  3PJS K;  2HYN A;  2ZAE B;  2YXQ B;  1D7M A;  2G3A A;  1SQX J;  1OVU A;  1Z56 A;  1LT9 B;  3NXS A;  3R2P A;  4GOD A;  5AW9 B;  2XKM A;  5GTI H;  1J1D C;  2MJZ A;  3MUD A;  3HD7 A;  5E79 H;  1P84 E;  1S9K E;  1BDD A;  2V4H A;  4H13 B;  1SS1 A;  2YIU C;  3H1H E; 
#chains in the Genus database with same CATH homology
 5AVY B;  3CI9 A;  1LTJ A;  2WIT A;  3KDP B;  1HGV A;  1X9V A;  4N78 D;  1M7L A;  2Q7C A;  3HE5 A;  3H6P A;  3G3Z A;  1T2K C;  3RL0 C;  1HTL C;  1LGH B;  2C0X A;  1KIL C;  5KJ7 D;  1FBM A;  1RF0 A;  4C7R A;  1J2J B;  1FZF A;  1HUC A;  1JMM A;  2Z5I A;  3M0A A;  4WY4 C;  3RK3 D;  1URQ A;  4AQR D;  3L4F A;  4C7N B;  1JTH A;  2XDJ A;  1JY3 P;  1NHL A;  3LIE A;  1RF1 C;  3EQ2 A;  2R32 A;  1N2D C;  1GD2 E;  1KIL B;  3KPE A;  1KIL A;  1SFC D;  2GUS A;  1FDM A;  2XV5 A;  4N78 E;  1IFM A;  2N9B A;  2O01 H;  2H43 A;  1URQ B;  3LW5 H;  2NPS B;  3V2R A;  2Z4E A;  2OYI C;  5AW3 B;  2WPQ A;  1SFC B;  3V5B A;  1HWT C;  4LLH A;  3HE4 A;  1N73 A;  1FZC C;  3NFQ A;  2PAJ A;  2WTY A;  2NPS A;  3HE5 B;  3V4W A;  3MD0 A;  1IFI A;  1FZA A;  1OXZ A;  1JCC A;  3U59 A;  4GKG A;  4W7Z A;  2KSJ A;  1QL1 A;  1FOS E;  1QL2 A;  3CL3 D;  4HH2 A;  2O1J A;  1NTM K;  3A3Y B;  3B5N B;  4RES B;  3T97 A;  3N4X A;  4I1L A;  2N1T B;  1JTH B;  2R3C A;  2KP8 A;  3II6 A;  3RL0 D;  1G1J A;  2HPC B;  1GK4 A;  2WPR A;  2E42 A;  2QM7 A;  1H88 A;  2PP6 A;  4AYC A;  3RK3 C;  3HD7 D;  3I5C A;  1WT6 A;  2NPS D;  3TNU B;  1ZLL A;  2BAS A;  1LTJ B;  4JF7 A;  5CJ4 A;  1IFJ A;  3HUS C;  2P7J A;  2WSE H;  4W80 A;  2R5D A;  2YNY A;  3M91 A;  2YMY A;  4ZKP A;  5KJ7 A;  2A45 I;  3TK1 A;  3UIA A;  2LKM A;  2FXM A;  1RF1 B;  3L37 A;  3TYY A;  1J1D B;  3RK2 C;  3IFM A;  2HFE D;  1IK9 A;  3MIW A;  3H32 A;  4Y99 C;  5APU A;  1HJB A;  1H8A A;  1PFI A;  5CMZ A;  5APT A;  1ZR2 A;  1SQX K;  2A45 G;  3P7K A;  5KJ7 C;  1A02 J;  5KTB A;  1IO4 A;  1DX7 A;  1M1J A;  1N7S B;  2YKQ A;  1LWU C;  2N1T D;  2WZ7 A;  4WY4 D;  1LTA C;  3VP9 A;  1HH0 A;  1T8Z A;  1YYC A;  2Z5H A;  1NAF A;  2C9L Y;  2YO3 A;  1RF0 C;  1SQB K;  2Q9I A;  4DZO A;  3L36 A;  1M1J B;  3VTP C;  1GW3 A;  3BVH A;  4JYB A;  3RK3 B;  1IC2 A;  4GIF A;  5AVQ B;  1LT9 C;  1GDT A;  1NKZ B;  2A45 H;  1JCD A;  1CI6 A;  1RE4 C;  3V2P A;  1DEB A;  1G2C B;  2KB7 P;  3M9Q A;  4EIJ A;  5BU8 B;  2WT7 A;  1HGZ A;  1KQL A;  2XU6 A;  5CJ0 A;  1RY3 A;  1T3J A;  2C9N Y;  4IFM A;  2P67 A;  1SVF A;  1GZL A;  3BRV B;  3P8C E;  1RE3 C;  1JNM A;  1JY3 N;  3TNU A;  2FKW B;  1OWA A;  2FYZ A;  3U1A A;  5AVR B;  3SWY A;  2WT7 B;  2OYH A;  2ZFC A;  1S9K D;  3B5N D;  4HYT B;  5AVU B;  1CW5 A;  1KZU B;  1MFZ A;  4M3L A;  1LWU A;  3NTN A;  1JOC A;  4KHX A;  1GL2 A;  4I6M C;  5KLV K;  4IFF A;  1NOH A;  3PP5 A;  2ZXE B;  2OYI B;  2E43 A;  3HTK A;  3VN0 A;  5CCH A;  1JO5 A;  2M3B A;  3M9H A;  2WSF H;  2IPP A;  1GU5 A;  5APS A;  1L0L K;  2XNX A;  2HOD A;  3LID A;  1N7S A;  1EQ7 A;  3M06 A;  1T2K D;  2HOD B;  3VYI A;  1G2C A;  2Q5U A;  1GW4 A;  1ZV8 A;  1SP4 A;  3H32 B;  1SLQ A;  1URQ C;  1LTI C;  3OA7 A;  1FAV A;  2XZR A;  1M1J C;  4GT1 A;  4OH8 B;  1LTS C;  2OYI A;  5AVZ B;  4Y99 B;  1GL2 D;  3A2A A;  2OAR A;  5BVZ A;  1WRG A;  5AVX B;  1NO4 A;  1NKN A;  2I1J A;  2O1K A;  1LTJ C;  4XE5 B;  2OYH B;  3BRT B;  1N7S D;  2FFD A;  5APX A;  5CCG D;  1XTC C;  1X8Y A;  2GUV A;  3OJA B;  1N7S C;  3HUS B;  1IFN A;  1XTG B;  2HG5 D;  3VOP A;  5APV A;  1L4A A;  2H8P D;  1FU1 A;  1FJK A;  3BAS A;  3V2Q A;  5AW4 B;  5APW A;  3VMX A;  1ZR4 A;  4WBA A;  1YTZ I;  2JEE A;  1LTG C;  3BAT A;  1RF1 A;  3RK2 B;  3HD7 B;  3A5T A;  2KLV A;  4C46 A;  1LT9 A;  2R5B A;  4LGD E;  2HLO A;  1L4A C;  3B5N A;  3GHG B;  1SQP K;  1X79 B;  2FYU K;  1SQQ K;  2WPS A;  4WB4 A;  3P32 A;  2IX7 C;  1AQ5 A;  2FFD C;  3O8Z A;  3VMY A;  3WMM 0;  1GU4 A;  3EFG A;  1L4A B;  4DOJ A;  3L35 A;  1NH4 A;  1SQV K;  1FZC A;  1N73 C;  1KIL D;  1MUU A;  1SFC A;  2FFD B;  1GL2 C;  1MV8 A;  5AW8 B;  2KYV A;  2P1J A;  1JY2 P;  3OAK A;  3B8E B;  1JY3 O;  3HTK B;  2OYH C;  5AVT B;  4WY4 B;  1RE4 A;  1GL2 B;  2J59 M;  3A7O A;  3KYQ A;  3TSI A;  3P8C D;  3IR9 A;  2L5G B;  4AUW A;  2KOG A;  1GK6 A;  1FJP A;  2J58 A;  1NTZ K;  1T3U A;  1KFM A;  5CCH D;  1H89 A;  4N3Y B;  2I1K A;  5CCH C;  1NWQ A;  1MZ9 A;  4JYC A;  2C0W A;  2VRS A;  3NMD A;  5BU5 A;  5CCG A;  3N7N A;  5APQ A;  1HBW A;  3MTU E;  3U1C A;  2YO2 A;  5AVW B;  1JY2 N;  2W27 A;  3M0D C;  2YKP A;  3RK2 D;  1LWU B;  2GM4 A;  4C7N A;  1J1E C;  1DH3 A;  1G1I A;  2H7H A;  5CCG C;  2N1T A;  2QM8 A;  5APY A;  4B86 A;  1LTT C;  4O9B A;  4N6J A;  5AW1 B;  2M8R A;  1FZB A;  3RL0 B;  1FZG A;  1N7L A;  1YTZ T;  1W2E A;  3SWF A;  2IFM A;  4XA4 A;  1L4A D;  2P2U A;  3E1I A;  2POH A;  3VP8 A;  5AW6 B;  4W7Y A;  1RE3 A;  4IFD K;  2WWW A;  5AW5 B;  1L0N K;  3HE4 B;  1GTW A;  1N73 B;  1N86 A;  3KQG A;  1VDF A;  5AW7 B;  3VMZ A;  1CI6 B;  1KFN A;  3C9I A;  5AVS B;  1NU1 K;  1LTB C;  1AFO A;  3V4Q A;  3HRN A;  3B5N C;  3CLQ A;  2N1T C;  3GHG C;  1JUN A;  1NTK K;  2JJL A;  1URQ D;  4WY4 A;  2WSC H;  1E5W A;  5AW0 B;  2IFN A;  3M0D A;  1FZE A;  1IJD B;  2Q3I A;  5AVV B;  1SFC C;  4LC1 A;  1ZN5 A;  2YKO A;  3P8M C;  3MGN A;  1FZC B;  1VPC A;  4ZKU A;  2W6A A;  1CZQ A;  2W6B A;  3HUS A;  5AW2 B;  3HD7 C;  5CHX A;  2CPB A;  3V2N A;  4EOT A;  1A02 F;  3M9B A;  1JY2 O;  1HVV A;  1J1E B;  1CSB A;  2HPC A;  4I2L C;  3GHG A;  1FOS F;  1IFD A;  2CPS A;  2NPS C;  2HYN A;  3R2P A;  1Z56 A;  5AW9 B;  1LT9 B;  3NXS A;  2XKM A;  1J1D C;  2MJZ A;  3MUD A;  3HD7 A;  1S9K E; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...