2C9LY

Structure of the epstein-barr virus zebra protein
Total Genus 26
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
26
sequence length
63
structure length
63
Chain Sequence
MLEIKRYKNRVAARKSRAKFKQLLQHYREVAAAKSSENDRLRLLLKQMCPSLDVDSIIPRTPD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*AP*GP*CP*AP*CP*TP*GP*AP*CP *TP*CP*AP*TP*GP*AP*AP*GP
publication title Structural Basis of Lytic Cycle Activation by the Epstein-Barr Virus Zebra Protein
pubmed doi rcsb
source organism Human herpesvirus 4
molecule tags Viral protein
total genus 26
structure length 63
sequence length 63
chains with identical sequence Z
ec nomenclature
pdb deposition date 2005-12-13
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2c9lY00
5AW8B 5AW5B 2JJLA 5APSA 5CMZA 2WPQA 4EOTA 3L36A 1CI6A 1CSBA 2XZRA 1A02J 2YNYA 1CI6B 4I6MC 4HYTB 3MD0A 5AW1B 5APYA 3M9HA 2H7HA 4AQRD 2Q3IA 1JNMA 4XE5B 3VMXA 2R5DA 5AW9B 2QM8A 2Q5UA 2ZXEB 3I5CA 3M91A 1IO4A 4GT1A 5AVSB 2E42A 1G2CB 3VYIA 3B8EB 4B86A 1J2JB 1HUCA 1HBWA 4C7NA 1MV8A 4C7NB 3VTPC 1DH3A 3KDPB 3NMDA 2E43A 2YO3A 4RESB 1HJBA 1FOSE 3HTKA 2IPPA 1CZQA 2W6AA 1GD2E 5AVTB 3L37A 3OAKA 1T2KD 3TNUA 2WWWA 3L35A 3KQGA 3P8MC 3TNUB 1MFZA 3LIEA 1GK4A 1OXZA 3T97A 4LC1A 5AVXB 4AYCA 5AW2B 2P67A 4C46A 2XU6A 5APUA 2R3CA 2QM7A 2P2UA 2WT7A 5AW4B 2P7JA 3SWFA 3M0DA 2WT7B 2YO2A 2VRSA 2N9BA 3A3YB 3MGNA 5APXA 1JUNA 1KQLA 4JYCA 1SLQA 3HE4A 1S9KD 3NFQA 5AW7B 2WPSA 2Z5HA 1SP4A 4JYBA 3M06A 2WTYA 5AW6B 3HE4B 2Z5IA 3P7KA 1GU5A 3V4QA 2R32A 3TYYA 2R5BA 5AVRB 5APVA 3M9BA 1A02F 4AUWA 5APTA 1T2KC 3V4WA 3NTNA 1H89A 2W27A 1HWTC 2KP8A 3O8ZA 5APWA 4GKGA 1H88A 1GZLA 5APQA 2XV5A 5AW3B 1S9KE 3P32A 5AVZB 3TK1A 3UIAA 2ZFCA 3VMYA 1FOSF 3VN0A 3NXSA 1YYCA 5AVYB 2Q7CA 4M3LA 1OWAA 2BASA 5AVUB 1GU4A 1NWQA 5AW0B 3LIDA 2C9LY 3VMZA 1FAVA 5AVWB 1X8YA 2WPRA 2C9NY 5AVVB 1MUUA 3A7OA 3HE5A 4I2LC 4KHXA 1GTWA 3A2AA 1GK6A 3M0AA 3HE5B 4DZOA 3A5TA 3V5BA 1H8AA 3IR9A 1NAFA 5AVQB
chains in the Genus database with same CATH superfamily
2Q9IA 1S72P 1K8AQ 2XDJA 1L0LK 2AEMA 4CPGA 1RF1A 1L0ND 3CCSP 1DX7A 3SWYA 3Q3DA 1MZ9A 3L71E 1G1JA 2E5TA 1J2JB 1PGPA 2W6BA 1X79B 2B87A 1EDLA 2WQYC 4R4MA 3L71J 2W90A 3HTKA 1M7LA 3L73E 2OYOA 3PP5A 1Y47A 4GIFA 4IOIH 1RE4A 3F89A 1L0LG 1LJ2A 3L73J 5B66H 1YJWP 2FYUK 4R4LA 2E75D 2P2UA 1QVGO 1FE6A 2OYIA 1Z56A 2E75B 1S9KD 3NFQA 3PLNA 1N7SB 3OW2O 1BCCE 3JCUE 1A02F 1K04A 3V4WA 2W27A 2FY8A 1ZP0C 2YXRB 4ASVA 2A06D 3P32A 3MTUE 2GUSA 1BCCJ 4Y28J 3NXSA 3KPEA 4ZNCA 3B71A 1SQBE 2A45H 1X8YA 2Y0DA 1HJ0A 3RK3D 1SQQG 1SQBJ 1CI6A 4I6MC 3RK3B 3GF3A 2B88A 1LP1A 3V2RA 3PRJA 1M57D 2OTJP 1IFMA 2C0WA 1HGVA 1R5SA 3B5ND 3USSA 2OYHC 1KTMA 2PGDA 4BWNA 3B5NB 3PJSK 5L8RJ 1LTTC 1LWUA 3L35A 3V2QA 2FYNB 2FXMA 1KYOI 1PGJA 2P67A 4DT0A 1Q82Q 3AE1C 1LTAC 5APUA 3H1JG 3FWLA 1VQNP 4BRYB 1VPCA 3ITKA 2I1KA 5CCHC 2WT7B 4UB8H 3WUUA 3ABVC 5CBOA 1NKZB 1KQLA 4WY4D 1SFCA 5KKZC 4WY4B 1QL1A 3KZIH 1L0LE 1H0TA 3Q5RA 1T3UA 1L4AD 2OYHA 3L71D 1URQA 3TK1A 1ZV8A 3GF7A 3VMYA 1L4AB 1ZOYC 1L0LJ 4H0LC 1KB9H 2V4HA 2KI7B 3U59A 3L73D 4I2LC 2M0BA 4UB6H 3L70G 3QH9A 3L75E 5AW8B 1LTJC 4N3YB 4EOTA 1A02J 4HYTB 1AQTA 3CCUP 3CXHE 1RHZB 4W80A 4NPFX 5AW9B 2ZXEB 1RF1B 1W2EA 1IO4A 1RE3A 5KAFE 3IAOA 1MKMA 1BCCD 1QVFO 1AV1A 1SQQE 2B87B 1T6AA 3KDPB 3NMDA 3F5HA 3LW5H 2IPPA 2V7QH 1LT9C 1M8OB 3HTKB 2WITA 2HODA 1EZVD 1SQQJ 5BU5A 2IYOA 1SQBD 2NPSC 1IFJA 3CC4P 3V2PA 3AE2C 3JC22 3SWFA 2AXCA 1JCDA 2OYIB 3A0HH 5AW7B 2IBZI 5AW6B 3C8VA 5APVA 5CCGC 2J58A 1FDMA 4GOFA 1KV4A 2FBWC 1YI2P 1LT9A 2HR3A 1SQXG 4M3LA 1GU4A 1WT6A 1FAVA 4IL6E 1NKNA 2OQQA 2E74C 2ZYDA 2H89C 1JTHA 3RGUA 2HLOA 1CI6B 1GW3A 1X9VA 2K3RA 2Q3IA 1LP1B 1VL2A 3MZWB 3TSIA 2JDIH 2QJKB 1JOCA 2E42A 2ZYAA 1NOHA 2POHA 1BGYG 1L0LD 3VTPC 4LGDE 2FKWB 1FOSE 1AQ5A 1CZQA 2XKMA 3L70J 5CBNA 3CLQA 2WWWA 1LWUB 3CL3D 2N1TC 1OVVA 1ZRTE 1IFDA 2MJZA 4PV1D 1ZN5A 1VQOP 3Q5SA 5AW4B 2L5GB 2P7JA 4PV1B 2YKOA 1KFNA 1SFCD 2CPBA 1DIPA 3N7NA 1SFCB 4ASWA 3AEBC 3CXHD 1JY3P 1URQD 1BSHA 1IZNB 3HD7A 2HFED 1URQB 2J5UA 3M0DC 1SQQD 1FDIA 2E76D 5AVWB 2N1TA 2E76B 1R5LA 3IR9A 1T8ZA 1CSBA 1SQXE 1GL2A 1M1KQ 1FBMA 1JNMA 2ZAEB 1DEEG 3RL0D 1SQXJ 2YIUB 2KK7A 1HUCA 3D6ZA 1HBWA 2WSCH 3RL0B 4H0LD 1KILC 1NJIQ 4H0LB 2HPCB 2W6AA 1EZVI 1XTCC 1RF0A 2QSIA 5GTHE 3TF5A 2HODB 5AVXB 1FU1A 1JY2N 1BGYE 2M3EA 2XU6A 1Y9BA 1BE3E 5KLVK 2YO2A 3AE3C 4D6TE 1P84E 3WUTA 4I7ZB 2XNDH 1BGYJ 1U57A 2MKVA 1NU1K 2H8PD 2PRRA 5APTA 4RKUJ 3PH0A 1SQVK 1HWTC 3GLMA 3M9QA 3RK2C 5H2FE 1HVVA 2N9YB 3L70D 1FJPA 1SQPG 2ZFCA 4PJ0H 3KYQA 5KJ7C 5GTIE 1LTGC 3LIDA 1J1EC 2FXPA 1VQPP 2G8YA 1JMMA 1YJ9P 2D2CD 1IC2A 1GK6A 3RBZA 1H8AA 2D2CB 2IX7C 1ZRTD 4L74A 3P8CE 1FZAA 3CWBE 1JTHB 1N73A 1U7MA 2ZVNB 2QVAA 3M9HA 2YMKA 3R2PA 1OVUA 2Q5UA 5KAIE 3I5CA 1Q2NA 3CWBJ 5KLIC 2SPZA 3EQ2A 4Y99C 1NAYA 1JM0A 1IFIA 1W2BO 1HGZA 3FX0A 5AVTB 4L76A 1PGOA 3JCUH 2Y0CA 3H32A 1OXZA 1KQFB 1NTMK 2QJPB 4H44D 4RJTA 2LKMA 3GMAA 4HH2A 1VQMP 4W7YA 1M1JA 4H44B 1HH0A 3A3YB 2WZ7A 4OGQD 1TU3F 3AE7C 4L73A 4WBAA 1SQXD 4EDFA 2A45G 4OGQB 3HD7D 1S4XA 4WVZA 1KN7A 1N2DC 1USEA 1L2PA 3HD7B 1VF5C 4EIJA 5DJUB 2O01N 1NVOA 2Q7CA 2FFDC 1N7SD 5AVUB 1AVYA 1QX8A 2JEEA 1KB9I 1RH5B 4KHXA 4PD4I 3AE6C 1BDDA 5AW5B 1PPJG 1SQPE 1GL2D 3L75G 2WPQA 1J1DC 3CPWO 2NZ2A 1BGYD 3SSUA 2O1KA 1GL2B 2ZT9D 5KLVE 1P84D 2FYUG 3C9IA 1SQPJ 2ZT9B 2K9YA 3HUSC 1YTZT 3IFMA 1PL5A 1NU1E 5KLVJ 4H13D 2YO3A 1HJBA 1SQVE 2CPSA 2K88A 4H13B 2P10A 1N7LA 2WSEH 1T2KD 4KT0J 1KFMA 3GG2A 2WMMA 5B66E 3MHVA 2KLVA 1VQ9P 1JCCA 2QG4A 2K37A 2Q1KA 4OH8B 2N9BA 2ZVOB 3P8CD 3CWBD 2RMZA 3HUSA 3S1KA 4YXDC 2QE7H 3UIAA 1PFIA 3V2NA 3H1KE 5E79H 3CXHH 4IL6X 2P58A 2JJLA 2Q6QA 3BRVB 3H6PA 3L36A 1LTSC 1SS1A 3O6QA 1NTME 5BU8B 1N73B 3KHUA 1S2EA 1JY3O 3CX5I 1NH4A 2O01H 1KQGB 4PD4H 1ZR2A 4C7NA 1PPJE 1YITP 5CCHA 1FZFA 2BCCG 2YXQB 3CC2P 1G1IA 3AE8C 2FYUE 3L75J 1HTLC 5CJ4A 3CD6P 3H32B 1YJNP 2M8RA 2FYUJ 3AE4C 4UB8E 3L74E 2QRXA 2KB7P 1M1JB 1SQPD 3FXDA 2WTYA 1GU5A 4N78E 2Z5IA 2GUVA 5AVRB 3KZIE 1EQ7A 2WSFJ 1L0NK 4JQ0D 5KLVD 3L74J 3EWKA 3FXEA 1LTJA 2QA4P 2FYZA 1QEXA 2M5AA 3SWKA 4C7RA 2QIWA 1RQUA 2IFNA 2W6JH 3VMZA 2BEQD 3JSVC 3SFDC 3AE9C 1GTWA 4UB6E 1NAFA 5APSA 3B4SA 4U7JA 1FJKA 2XZRA 1W5CE 2J59M 3N4XA 1VQ8P 5TISH 5BVZA 3H1LE 2KIKA 1JEKA 2NPSA 1QLED 3VYIA 4A7PA 1LT1A 1S1CX 4OVNF 4WB4A 5CHXA 3H1LJ 3CX5H 1FC2C 3HRNA 5CCGA 3KQGA 1MFZA 3G3ZA 2ZXXA 3WU2H 1FZGA 1U7JA 3U1AA 1KQSO 1BE3G 2BCCE 4D6TG 2IBZG 1OVRA 2WPSA 1KYOE 3OJAB 5B5EE 4NPEA 3HUSB 3GHGC 2BCCJ 3H1HG 1GZLA 5APQA 2M3BA 1IK7A 2IYPA 3G9RA 4WWIA 1PPJD 3A0BH 3L75D 2E75C 2WSSH 2WPVB 1RY3A 1DD4A 1VQLP 2KZIA 3A7OA 2AXTH 3AECC 2FYUD 4GDOA 4DZOA 1H0TB 2KOGA 4K35A 1UIIA 4JF7A 2OYHB 3VP9A 1FS0E 5CJ0A 3CWBG 4U3FG 3O6QB 1AVOA 3Q2YA 4XE5B 3L74D 3VMXA 3GHGA 4N78D 2CK3H 3B8EB 5CCHD 4QMAA 2Z4EA 1Y8AA 4C7NB 1JO5A 1L0NE 1NTZK 3RK3C 3L37A 3OAKA 5KKZB 1EDKA 1MFTA 3VMAA 2R3CA 2R44A 5H2FH 4ZMDA 3M0DA 3B5NC 3II6A 1X0TA 5APXA 1JUNA 1OW8A 4JYCA 4XFJA 2Z5HA 1SP4A 2FYNC 1S5LE 2YKPA 2RN0A 2KSEA 5APWA 3WUVA 1S9KE 3G4SP 3H1LD 1PP9E 1LTJB 5AVZB 4BXLA 2M5AB 3VOPA 2BASA 3R4YA 2IBZE 2KNCA 3RL0g 4NPDA 3CCRP 3W68A 3L4FA 1PP9J 3MP7B 4WY4C 5KAIH 3FWNA 3HE5A 1BE3J 1K9MQ 1D7MA 3H1HE 3A5TA 4D6TJ 3V6IA 4L75A 1KILA 2QEXP 1S3JA 4N6JA 1SQBK 1L4AC 3MD0A 5DJTB 5APYA 1LT9B 3S9OA 1Q7YQ 1DD3A 3H1HJ 1OZHA 1EXJA 2BCCD 3CCLP 2NPSD 5KLVG 2JP3A 3RK3E 1K05A 3KXDA 1OIPA 1KYOD 2NPSB 1M90Q 2BEZF 2JKVA 2B89A 1NU1G 1YQ4C 1K73Q 4TT3H 1OW7A 1X22A 3I56P 4U3FE 1SQVG 5CCGD 1LTIC 1KILE 2IDBA 3P8MC 1Q81Q 4LC1A 4U3FJ 5AW2B 3CCJP 1KC8Q 4XA4A 2LXCB 5M1BA 3AEEC 5KJ7A 2JWAA 1E5WA 1SLQA 4YTPC 1ZR4A 2KXPB 2E74D 2JR8A 2R5BA 2E74B 1RE4C 4O9BA 1SVFA 2O1JA 4PJ0E 1DEBA 2OYIC 3H1KG 4GOEA 2WPRA 1NTZE 2FXOA 3CXHI 1JY2P 3A2AA 1BSNA 3E1RA 2OGUA 3BATA 1NYHA 2KLUA 3BCCG 1NTZJ 1NTMG 2H7HA 2N1TD 2KS1A 2R5DA 2IZ0A 3L72G 1G2CA 2N1TB 3GHGB 3MIWA 4B86A 1QGKB 2H88C 3H1IG 2ZYGA 3IF4A 3ZDMA 1PP9D 1BDCA 1BE3D 3TNUA 1SQQK 4D6TD 2IBZD 3LIEA 1GK4A 2QJKC 3WMM0 1FZEA 1KD1Q 3H1HD 2FFDA 1EZVE 2Y0EA 3L74G 3RBXA 1GMJA 1LWUC 1VDFA 1NU1J 1PGQA 2KP8A 1SQVJ 4GKGA 5AW3B 1FZBA 3G6EP 3Q1MA 4PV1C 2QJYC 5AW0B 3IN6A 4YXWH 2KNCB 1SFCC 1YIJP 4U3FD 5C39A 3HE5B 1ZMEC 1KILD 1AA0A 1FDOA 4GODA 2Q3EA 1PZQA 3AEGC 1KILB 1URQC 1M56D 1EDIA 2NRGA 4AQRD 2IZ1A 1ZXGA 2KYVA 1N86A 2E76C 1IK9A 3H1LG 5KAFH 2WVRA 2YKQA 3H1KJ 1YQ3C 1CW5A 3BCCE 2WSFH 4RESB 3Q5PA 3VP8A 3L72E 1WRGA 3BCCJ 2R3SA 3T97A 3RK2D 2YIUC 1NTMJ 1RE3C 3H1IE 1NTZD 3CMAP 3TGUG 2O3JA 2WSEJ 3RL0C 2IFMA 5KJ7D 3RK2B 2B9BA 3BRTB 3L72J 1LTBC 1IFNA 3GW6A 3HE4A 3H1IJ 1J1EB 2RH0A 3V4QA 2R32A 1LNQA 3EFGA 1FZCC 3PTZA 2HG5D 1NGMB 1EC5A 1NTKK 4DCKA 5K5GB 4HJGH 1PIXA 4EYYQ 1N8RQ 1FOSF 3AEDC 1JB0J 2I8DA 5E79E 2C0XA 4I7ZC 4JPZB 3PHLA 4HB1A 2OARA 4IL6H 5AVVB 3M0AA 2OTKE 3E1IA 2I1JA 5KLIB 4Y99B 5AVQB 3CI9A 4KJMA 2HPCA 2W83C 2YNYA 3CC7P 1NU1D 1VQ6P 3SFEC 1QL2A 1NTKG 1NHLA 1KB9E 1FZCA 1SQVD 2KS1B 4PD4E 1SQXK 1YHQP 2KUBA 1G2CB 5TJHA 3CCVP 2Y9YA 2D2CC 1JY3N 4Z1MH 3C1LA 1DH3A 2O01J 1AJYA 2XNXA 1L0NG 3CCMP 1P84I 1KYOH 3W67A 3TNUB 5B5EH 5KTBA 4YPCA 2E5YA 1VF5D 4AYCA 1IFPA 3CCEP 3H1JE 1Q90D 4ZKPA 4RO0A 2QM7A 1VF5B 1ZW0A 2K9JA 4MN4C 3U1CA 2VRSA 2FFDB 3BVHA 3H1JJ 3S4RA 1YBKA 3M06A 3MUDC 1S5LX 1HF9A 3H1KD 1OW6A 3E7KA 3LW5J 1USDA 5EFWB 2QJPC 2V7QJ 3I55P 3TGUE 1H88A 2LR2A 1J1DB 1PP9G 4H44C 3QWOC 1YYCA 5AVYB 2GM4A 2JWDA 3BCCD 3A0HE 1OX3A 1IJDB 3TGUJ 1NTMD 4OGQC 1MUUA 3L70E 2A06G 2DW3A 3L72D 3HD7C 1ZLLA 2H43A 4IFMA 3H1ID 3MUDA 5AW1B 2OTLP 5TISE 1N7SC 3M91A 4GT1A 2KZJA 2UWJE 1MV8A 2Y9ZA 1RQVA 2E43A 2ITAA 2QJYB 1GL2C 1JY2O 3CX5E 1NTKE 4DJGA 2G3AA 3TDKA 4DOJA 1S5LH 2ZT9C 2GA1A 3AEAC 5GTHH 1LGHB 1EDJA 3CCQP 1GW4A 2PP6A 1VQ5P 3T97B 3EFFK 1WMKA 4C46A 1JMBA 1KMIZ 1NTKJ 2ZJSE 4K3AA 3WU2E 3MGNA 1P84H 1OFCX 4H13C 1OMIA 1N7SA 2L91A 3HE4B 3D70A 3TYYA 3M9BA 1RF0C 1KORA 1YTZI 1T2KC 1KB9D 3NTNA 1H89A 1L0NJ 1VQ7P 4PD4D 2XV5A 2YMYA 1GDTA 3A0BE 2LXBA 5GTIH 2C9LY 1E79H 1KZUB 2PAJA 1PV3A 2AXTE 3L71G 1NTZG 3D6YA 2AEJA 3AE5C 4HKZH 5CMZA 1AFOA 3H1JD 4W7ZA 1VQ4P 2KSJA 3L73G 2PFXA 2JO1A 1SQPK 2QM8A 2A06E 1FZCB 2HYNA 5AVSB 4JBZA 3BASA 1NO4A 1R8EA 4EI2A 3B5NA 4ZKUA 1Q86Q 4LLHA 3TGUD 1VQKP 1N73C 1GD2E 3K5BA 1BCCG 3FGAD 1EXIA 2AEFA 4IFFA 4BRYA 2WT7A 2K9JB 3AEFC 2K1AA 1EZVG 4I1LA 4IFDK 4TLFA 4JYBA 3P7KA 4WY4A 2WSCJ 1SQBG 2A45I 1RF1C 4OWFA 4AUWA 1UIXA 3O8ZA 1L4AA 1T3JA 3OA7A 3G71P 3VN0A 3H25A 1M1JC 1OWAA 3CMEP 1NWQA 2C9NY 3CX5D 1NTKD 2P1JA 2W8ZA 3V5BA 3D71A 1XTGB 2RKLA
chains in the Genus database with same CATH topology
5APSA 2Q9IA 1KILB 1T8ZA 1URQC 1FJKA 1CSBA 2XZRA 2XDJA 1GL2A 2J59M 1L0LK 4AQRD 1FBMA 3N4XA 1JNMA 1RF1A 2KYVA 1DX7A 3SWYA 1N86A 1MZ9A 5BVZA 1G1JA 3RL0D 1IK9A 2NPSA 3VYIA 1J2JB 1HUCA 1HBWA 2YKQA 2W6BA 1X79B 4WB4A 2WSCH 3RL0B 1CW5A 1KILC 5CHXA 2WSFH 4RESB 3HTKA 1M7LA 2HPCB 2W6AA 3HRNA 3PP5A 1XTCC 4GIFA 1RF0A 3VP8A 3KQGA 5CCGA 1WRGA 1MFZA 1RE4A 3G3ZA 2HODB 3T97A 3RK2D 5AVXB 1FU1A 1JY2N 1RE3C 2XU6A 3RL0C 2IFMA 5KJ7D 2FYUK 3RK2B 1FZGA 2P2UA 5KLVK 3BRTB 3U1AA 1LTBC 2YO2A 1IFNA 2OYIA 1Z56A 1S9KD 3HE4A 3NFQA 2WPSA 1J1EB 1N7SB 3V4QA 2R32A 3OJAB 1NU1K 2H8PD 1A02F 3EFGA 1FZCC 5APTA 2HG5D 3V4WA 3HUSB 3GHGC 2W27A 1SQVK 1HWTC 3M9QA 1NTKK 1GZLA 5APQA 3RK2C 2M3BA 1HVVA 3P32A 3MTUE 1FJPA 2ZFCA 2GUSA 1FOSF 3KYQA 3NXSA 3KPEA 5KJ7C 2C0XA 1LTGC 3LIDA 1J1EC 2A45H 1RY3A 1X8YA 2OARA 5AVVB 1JMMA 3A7OA 1IC2A 1GK6A 3M0AA 3E1IA 2I1JA 4DZOA 2KOGA 1H8AA 4Y99B 5AVQB 2IX7C 3CI9A 3P8CE 3RK3D 4JF7A 1FZAA 2OYHB 3VP9A 1CI6A 2HPCA 5CJ0A 1JTHB 2YNYA 1N73A 4I6MC 3RK3B 1QL2A 3M9HA 3V2RA 1NHLA 3R2PA 4XE5B 3VMXA 1FZCA 1IFMA 2C0WA 2Q5UA 3GHGA 3I5CA 1SQXK 4N78D 1G2CB 1HGVA 3B8EB 5CCHD 3EQ2A 4Y99C 3B5ND 1JY3N 2Z4EA 4C7NB 2OYHC 1DH3A 1JO5A 1IFIA 1NTZK 3B5NB 3RK3C 2XNXA 1HGZA 1LTTC 1LWUA 5AVTB 3L37A 3OAKA 3L35A 3V2QA 3TNUB 5KTBA 2FXMA 3H32A 1OXZA 1NTMK 4AYCA 2P67A 1LTAC 5APUA 2LKMA 2R3CA 4ZKPA 4HH2A 2QM7A 1VPCA 2I1KA 5CCHC 4W7YA 3U1CA 3M0DA 2WT7B 1M1JA 3B5NC 3II6A 2VRSA 1HH0A 3A3YB 2WZ7A 2FFDB 1NKZB 5APXA 1KQLA 4WY4D 4JYCA 3BVHA 1JUNA 1SFCA 2Z5HA 1SP4A 4WBAA 3M06A 2A45G 4WY4B 1QL1A 2YKPA 3HD7D 1T3UA 5APWA 1N2DC 1L4AD 2OYHA 1H88A 3HD7B 1S9KE 1URQA 1LTJB 5AVZB 1ZV8A 3TK1A 4EIJA 1J1DB 3VMYA 1L4AB 1YYCA 5AVYB 2GM4A 2Q7CA 3VOPA 2FFDC 1N7SD 2BASA 5AVUB 1IJDB 2JEEA 3L4FA 3U59A 4WY4C 1MUUA 3HE5A 4I2LC 4KHXA 3A5TA 1KILA 3HD7C 5AW8B 5AW5B 1LTJC 4N6JA 4N3YB 1GL2D 1SQBK 2WPQA 1J1DC 1ZLLA 4EOTA 2H43A 1L4AC 4IFMA 1A02J 4HYTB 3MD0A 2O1KA 3MUDA 5AW1B 1GL2B 1LT9B 5APYA 1N7SC 4W80A 3C9IA 5AW9B 2NPSD 2ZXEB 1RF1B 1W2EA 3M91A 1IO4A 4GT1A 1RE3A 3HUSC 1YTZT 2NPSB 3IFMA 1MV8A 3KDPB 3NMDA 2E43A 2YO3A 3LW5H 1HJBA 2CPSA 2IPPA 1GL2C 1JY2O 1LT9C 3HTKB 5CCGD 1N7LA 2WSEH 1LTIC 2WITA 1T2KD 1KFMA 3P8MC 2HODA 4DOJA 5BU5A 1LGHB 1GW4A 4LC1A 2PP6A 5AW2B 2NPSC 4XA4A 4C46A 1IFJA 3V2PA 2KLVA 1JCCA 3SWFA 5KJ7A 4OH8B 2N9BA 1E5WA 3MGNA 3P8CD 1JCDA 2OYIB 1SLQA 1N7SA 5AW7B 1ZR4A 5AW6B 3HE4B 3TYYA 2R5BA 5APVA 3M9BA 1RF0C 2J58A 5CCGC 3HUSA 1FDMA 1YTZI 1T2KC 1RE4C 3NTNA 1H89A 4O9BA 2XV5A 1SVFA 2O1JA 3UIAA 2YMYA 1PFIA 1LT9A 1GDTA 4M3LA 1DEBA 3V2NA 2OYIC 1GU4A 1WT6A 2C9LY 1FAVA 2WPRA 1KZUB 2PAJA 1NKNA 1JY2P 3A2AA 3BATA 2JJLA 5CMZA 3BRVB 1JTHA 3H6PA 3L36A 1AFOA 1LTSC 2HLOA 1CI6B 4W7ZA 5BU8B 2KSJA 1N73B 2H7HA 2N1TD 1GW3A 1JY3O 1X9VA 2Q3IA 1NH4A 1SQPK 2O01H 2R5DA 2QM8A 1G2CA 1FZCB 2N1TB 2HYNA 3TSIA 1JOCA 3GHGB 5AVSB 2E42A 3BASA 1ZR2A 1NO4A 1NOHA 3MIWA 4B86A 4C7NA 2POHA 1FZFA 5CCHA 3VTPC 3B5NA 4LGDE 4ZKUA 4LLHA 2FKWB 1FOSE 1AQ5A 1CZQA 2XKMA 1N73C 1GD2E 1G1IA 3CLQA 2WWWA 1LWUB 3TNUA 1SQQK 3CL3D 3LIEA 1GK4A 2N1TC 1HTLC 3WMM0 5CJ4A 1FZEA 1IFDA 2MJZA 3H32B 4IFFA 1ZN5A 2M8RA 2WT7A 5AW4B 2L5GB 2P7JA 2FFDA 2YKOA 1KFNA 1SFCD 2KB7P 1M1JB 2CPBA 4I1LA 4IFDK 3N7NA 4JYBA 2WTYA 1GU5A 4N78E 2Z5IA 1LWUC 1SFCB 3P7KA 4WY4A 2GUVA 5AVRB 1VDFA 1EQ7A 2A45I 1RF1C 4AUWA 1L0NK 1JY3P 1URQD 2KP8A 3HD7A 3O8ZA 1LTJA 4GKGA 5AW3B 2HFED 1FZBA 2FYZA 1L4AA 1T3JA 1URQB 3OA7A 3VN0A 4C7RA 3M0DC 1M1JC 1OWAA 1NWQA 5AW0B 2IFNA 1SFCC 3VMZA 5AVWB 2N1TA 2C9NY 1GTWA 3HE5B 1KILD 2P1JA 3V5BA 1XTGB 3IR9A 1NAFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5AW8 B;  5AW5 B;  2JJL A;  5APS A;  5CMZ A;  2WPQ A;  4EOT A;  3L36 A;  1CI6 A;  1CSB A;  2XZR A;  1A02 J;  2YNY A;  1CI6 B;  4I6M C;  4HYT B;  3MD0 A;  5AW1 B;  5APY A;  3M9H A;  2H7H A;  4AQR D;  2Q3I A;  1JNM A;  4XE5 B;  3VMX A;  2R5D A;  5AW9 B;  2QM8 A;  2Q5U A;  2ZXE B;  3I5C A;  3M91 A;  1IO4 A;  4GT1 A;  5AVS B;  2E42 A;  1G2C B;  3VYI A;  3B8E B;  4B86 A;  1J2J B;  1HUC A;  1HBW A;  4C7N A;  1MV8 A;  4C7N B;  3VTP C;  1DH3 A;  3KDP B;  3NMD A;  2E43 A;  2YO3 A;  4RES B;  1HJB A;  1FOS E;  3HTK A;  2IPP A;  1CZQ A;  2W6A A;  1GD2 E;  5AVT B;  3L37 A;  3OAK A;  1T2K D;  3TNU A;  2WWW A;  3L35 A;  3KQG A;  3P8M C;  3TNU B;  1MFZ A;  3LIE A;  1GK4 A;  1OXZ A;  3T97 A;  4LC1 A;  5AVX B;  4AYC A;  5AW2 B;  2P67 A;  4C46 A;  2XU6 A;  5APU A;  2R3C A;  2QM7 A;  2P2U A;  2WT7 A;  5AW4 B;  2P7J A;  3SWF A;  3M0D A;  2WT7 B;  2YO2 A;  2VRS A;  2N9B A;  3A3Y B;  3MGN A;  5APX A;  1JUN A;  1KQL A;  4JYC A;  1SLQ A;  3HE4 A;  1S9K D;  3NFQ A;  5AW7 B;  2WPS A;  2Z5H A;  1SP4 A;  4JYB A;  3M06 A;  2WTY A;  5AW6 B;  3HE4 B;  2Z5I A;  3P7K A;  1GU5 A;  3V4Q A;  2R32 A;  3TYY A;  2R5B A;  5AVR B;  5APV A;  3M9B A;  1A02 F;  4AUW A;  5APT A;  1T2K C;  3V4W A;  3NTN A;  1H89 A;  2W27 A;  1HWT C;  2KP8 A;  3O8Z A;  5APW A;  4GKG A;  1H88 A;  1GZL A;  5APQ A;  2XV5 A;  5AW3 B;  1S9K E;  3P32 A;  5AVZ B;  3TK1 A;  3UIA A;  2ZFC A;  3VMY A;  1FOS F;  3VN0 A;  3NXS A;  1YYC A;  5AVY B;  2Q7C A;  4M3L A;  1OWA A;  2BAS A;  5AVU B;  1GU4 A;  1NWQ A;  5AW0 B;  3LID A;  2C9L Y;  3VMZ A;  1FAV A;  5AVW B;  1X8Y A;  2WPR A;  2C9N Y;  5AVV B;  1MUU A;  3A7O A;  3HE5 A;  4I2L C;  4KHX A;  1GTW A;  3A2A A;  1GK6 A;  3M0A A;  3HE5 B;  4DZO A;  3A5T A;  3V5B A;  1H8A A;  3IR9 A;  1NAF A;  5AVQ B; 
#chains in the Genus database with same CATH topology
 2Q9I A;  1S72 P;  1K8A Q;  2XDJ A;  1L0L K;  2AEM A;  4CPG A;  1RF1 A;  1L0N D;  3CCS P;  1DX7 A;  3SWY A;  3Q3D A;  1MZ9 A;  3L71 E;  1G1J A;  2E5T A;  1J2J B;  1PGP A;  2W6B A;  1X79 B;  2B87 A;  1EDL A;  2WQY C;  4R4M A;  3L71 J;  2W90 A;  3HTK A;  1M7L A;  3L73 E;  2OYO A;  3PP5 A;  1Y47 A;  4GIF A;  4IOI H;  1RE4 A;  3F89 A;  1L0L G;  1LJ2 A;  3L73 J;  5B66 H;  1YJW P;  2FYU K;  4R4L A;  2E75 D;  2P2U A;  1QVG O;  1FE6 A;  2OYI A;  1Z56 A;  2E75 B;  1S9K D;  3NFQ A;  3PLN A;  1N7S B;  3OW2 O;  1BCC E;  3JCU E;  1A02 F;  1K04 A;  3V4W A;  2W27 A;  2FY8 A;  1ZP0 C;  2YXR B;  4ASV A;  2A06 D;  3P32 A;  3MTU E;  2GUS A;  1BCC J;  4Y28 J;  3NXS A;  3KPE A;  4ZNC A;  3B71 A;  1SQB E;  2A45 H;  1X8Y A;  2Y0D A;  1HJ0 A;  3RK3 D;  1SQQ G;  1SQB J;  1CI6 A;  4I6M C;  3RK3 B;  3GF3 A;  2B88 A;  1LP1 A;  3V2R A;  3PRJ A;  1M57 D;  2OTJ P;  1IFM A;  2C0W A;  1HGV A;  1R5S A;  3B5N D;  3USS A;  2OYH C;  1KTM A;  2PGD A;  4BWN A;  3B5N B;  3PJS K;  5L8R J;  1LTT C;  1LWU A;  3L35 A;  3V2Q A;  2FYN B;  2FXM A;  1KYO I;  1PGJ A;  2P67 A;  4DT0 A;  1Q82 Q;  3AE1 C;  1LTA C;  5APU A;  3H1J G;  3FWL A;  1VQN P;  4BRY B;  1VPC A;  3ITK A;  2I1K A;  5CCH C;  2WT7 B;  4UB8 H;  3WUU A;  3ABV C;  5CBO A;  1NKZ B;  1KQL A;  4WY4 D;  1SFC A;  5KKZ C;  4WY4 B;  1QL1 A;  3KZI H;  1L0L E;  1H0T A;  3Q5R A;  1T3U A;  1L4A D;  2OYH A;  3L71 D;  1URQ A;  3TK1 A;  1ZV8 A;  3GF7 A;  3VMY A;  1L4A B;  1ZOY C;  1L0L J;  4H0L C;  1KB9 H;  2V4H A;  2KI7 B;  3U59 A;  3L73 D;  4I2L C;  2M0B A;  4UB6 H;  3L70 G;  3QH9 A;  3L75 E;  5AW8 B;  1LTJ C;  4N3Y B;  4EOT A;  1A02 J;  4HYT B;  1AQT A;  3CCU P;  3CXH E;  1RHZ B;  4W80 A;  4NPF X;  5AW9 B;  2ZXE B;  1RF1 B;  1W2E A;  1IO4 A;  1RE3 A;  5KAF E;  3IAO A;  1MKM A;  1BCC D;  1QVF O;  1AV1 A;  1SQQ E;  2B87 B;  1T6A A;  3KDP B;  3NMD A;  3F5H A;  3LW5 H;  2IPP A;  2V7Q H;  1LT9 C;  1M8O B;  3HTK B;  2WIT A;  2HOD A;  1EZV D;  1SQQ J;  5BU5 A;  2IYO A;  1SQB D;  2NPS C;  1IFJ A;  3CC4 P;  3V2P A;  3AE2 C;  3JC2 2;  3SWF A;  2AXC A;  1JCD A;  2OYI B;  3A0H H;  5AW7 B;  2IBZ I;  5AW6 B;  3C8V A;  5APV A;  5CCG C;  2J58 A;  1FDM A;  4GOF A;  1KV4 A;  2FBW C;  1YI2 P;  1LT9 A;  2HR3 A;  1SQX G;  4M3L A;  1GU4 A;  1WT6 A;  1FAV A;  4IL6 E;  1NKN A;  2OQQ A;  2E74 C;  2ZYD A;  2H89 C;  1JTH A;  3RGU A;  2HLO A;  1CI6 B;  1GW3 A;  1X9V A;  2K3R A;  2Q3I A;  1LP1 B;  1VL2 A;  3MZW B;  3TSI A;  2JDI H;  2QJK B;  1JOC A;  2E42 A;  2ZYA A;  1NOH A;  2POH A;  1BGY G;  1L0L D;  3VTP C;  4LGD E;  2FKW B;  1FOS E;  1AQ5 A;  1CZQ A;  2XKM A;  3L70 J;  5CBN A;  3CLQ A;  2WWW A;  1LWU B;  3CL3 D;  2N1T C;  1OVV A;  1ZRT E;  1IFD A;  2MJZ A;  4PV1 D;  1ZN5 A;  1VQO P;  3Q5S A;  5AW4 B;  2L5G B;  2P7J A;  4PV1 B;  2YKO A;  1KFN A;  1SFC D;  2CPB A;  1DIP A;  3N7N A;  1SFC B;  4ASW A;  3AEB C;  3CXH D;  1JY3 P;  1URQ D;  1BSH A;  1IZN B;  3HD7 A;  2HFE D;  1URQ B;  2J5U A;  3M0D C;  1SQQ D;  1FDI A;  2E76 D;  5AVW B;  2N1T A;  2E76 B;  1R5L A;  3IR9 A;  1T8Z A;  1CSB A;  1SQX E;  1GL2 A;  1M1K Q;  1FBM A;  1JNM A;  2ZAE B;  1DEE G;  3RL0 D;  1SQX J;  2YIU B;  2KK7 A;  1HUC A;  3D6Z A;  1HBW A;  2WSC H;  3RL0 B;  4H0L D;  1KIL C;  1NJI Q;  4H0L B;  2HPC B;  2W6A A;  1EZV I;  1XTC C;  1RF0 A;  2QSI A;  5GTH E;  3TF5 A;  2HOD B;  5AVX B;  1FU1 A;  1JY2 N;  1BGY E;  2M3E A;  2XU6 A;  1Y9B A;  1BE3 E;  5KLV K;  2YO2 A;  3AE3 C;  4D6T E;  1P84 E;  3WUT A;  4I7Z B;  2XND H;  1BGY J;  1U57 A;  2MKV A;  1NU1 K;  2H8P D;  2PRR A;  5APT A;  4RKU J;  3PH0 A;  1SQV K;  1HWT C;  3GLM A;  3M9Q A;  3RK2 C;  5H2F E;  1HVV A;  2N9Y B;  3L70 D;  1FJP A;  1SQP G;  2ZFC A;  4PJ0 H;  3KYQ A;  5KJ7 C;  5GTI E;  1LTG C;  3LID A;  1J1E C;  2FXP A;  1VQP P;  2G8Y A;  1JMM A;  1YJ9 P;  2D2C D;  1IC2 A;  1GK6 A;  3RBZ A;  1H8A A;  2D2C B;  2IX7 C;  1ZRT D;  4L74 A;  3P8C E;  1FZA A;  3CWB E;  1JTH B;  1N73 A;  1U7M A;  2ZVN B;  2QVA A;  3M9H A;  2YMK A;  3R2P A;  1OVU A;  2Q5U A;  5KAI E;  3I5C A;  1Q2N A;  3CWB J;  5KLI C;  2SPZ A;  3EQ2 A;  4Y99 C;  1NAY A;  1JM0 A;  1IFI A;  1W2B O;  1HGZ A;  3FX0 A;  5AVT B;  4L76 A;  1PGO A;  3JCU H;  2Y0C A;  3H32 A;  1OXZ A;  1KQF B;  1NTM K;  2QJP B;  4H44 D;  4RJT A;  2LKM A;  3GMA A;  4HH2 A;  1VQM P;  4W7Y A;  1M1J A;  4H44 B;  1HH0 A;  3A3Y B;  2WZ7 A;  4OGQ D;  1TU3 F;  3AE7 C;  4L73 A;  4WBA A;  1SQX D;  4EDF A;  2A45 G;  4OGQ B;  3HD7 D;  1S4X A;  4WVZ A;  1KN7 A;  1N2D C;  1USE A;  1L2P A;  3HD7 B;  1VF5 C;  4EIJ A;  5DJU B;  2O01 N;  1NVO A;  2Q7C A;  2FFD C;  1N7S D;  5AVU B;  1AVY A;  1QX8 A;  2JEE A;  1KB9 I;  1RH5 B;  4KHX A;  4PD4 I;  3AE6 C;  1BDD A;  5AW5 B;  1PPJ G;  1SQP E;  1GL2 D;  3L75 G;  2WPQ A;  1J1D C;  3CPW O;  2NZ2 A;  1BGY D;  3SSU A;  2O1K A;  1GL2 B;  2ZT9 D;  5KLV E;  1P84 D;  2FYU G;  3C9I A;  1SQP J;  2ZT9 B;  2K9Y A;  3HUS C;  1YTZ T;  3IFM A;  1PL5 A;  1NU1 E;  5KLV J;  4H13 D;  2YO3 A;  1HJB A;  1SQV E;  2CPS A;  2K88 A;  4H13 B;  2P10 A;  1N7L A;  2WSE H;  1T2K D;  4KT0 J;  1KFM A;  3GG2 A;  2WMM A;  5B66 E;  3MHV A;  2KLV A;  1VQ9 P;  1JCC A;  2QG4 A;  2K37 A;  2Q1K A;  4OH8 B;  2N9B A;  2ZVO B;  3P8C D;  3CWB D;  2RMZ A;  3HUS A;  3S1K A;  4YXD C;  2QE7 H;  3UIA A;  1PFI A;  3V2N A;  3H1K E;  5E79 H;  3CXH H;  4IL6 X;  2P58 A;  2JJL A;  2Q6Q A;  3BRV B;  3H6P A;  3L36 A;  1LTS C;  1SS1 A;  3O6Q A;  1NTM E;  5BU8 B;  1N73 B;  3KHU A;  1S2E A;  1JY3 O;  3CX5 I;  1NH4 A;  2O01 H;  1KQG B;  4PD4 H;  1ZR2 A;  4C7N A;  1PPJ E;  1YIT P;  5CCH A;  1FZF A;  2BCC G;  2YXQ B;  3CC2 P;  1G1I A;  3AE8 C;  2FYU E;  3L75 J;  1HTL C;  5CJ4 A;  3CD6 P;  3H32 B;  1YJN P;  2M8R A;  2FYU J;  3AE4 C;  4UB8 E;  3L74 E;  2QRX A;  2KB7 P;  1M1J B;  1SQP D;  3FXD A;  2WTY A;  1GU5 A;  4N78 E;  2Z5I A;  2GUV A;  5AVR B;  3KZI E;  1EQ7 A;  2WSF J;  1L0N K;  4JQ0 D;  5KLV D;  3L74 J;  3EWK A;  3FXE A;  1LTJ A;  2QA4 P;  2FYZ A;  1QEX A;  2M5A A;  3SWK A;  4C7R A;  2QIW A;  1RQU A;  2IFN A;  2W6J H;  3VMZ A;  2BEQ D;  3JSV C;  3SFD C;  3AE9 C;  1GTW A;  4UB6 E;  1NAF A;  5APS A;  3B4S A;  4U7J A;  1FJK A;  2XZR A;  1W5C E;  2J59 M;  3N4X A;  1VQ8 P;  5TIS H;  5BVZ A;  3H1L E;  2KIK A;  1JEK A;  2NPS A;  1QLE D;  3VYI A;  4A7P A;  1LT1 A;  1S1C X;  4OVN F;  4WB4 A;  5CHX A;  3H1L J;  3CX5 H;  1FC2 C;  3HRN A;  5CCG A;  3KQG A;  1MFZ A;  3G3Z A;  2ZXX A;  3WU2 H;  1FZG A;  1U7J A;  3U1A A;  1KQS O;  1BE3 G;  2BCC E;  4D6T G;  2IBZ G;  1OVR A;  2WPS A;  1KYO E;  3OJA B;  5B5E E;  4NPE A;  3HUS B;  3GHG C;  2BCC J;  3H1H G;  1GZL A;  5APQ A;  2M3B A;  1IK7 A;  2IYP A;  3G9R A;  4WWI A;  1PPJ D;  3A0B H;  3L75 D;  2E75 C;  2WSS H;  2WPV B;  1RY3 A;  1DD4 A;  1VQL P;  2KZI A;  3A7O A;  2AXT H;  3AEC C;  2FYU D;  4GDO A;  4DZO A;  1H0T B;  2KOG A;  4K35 A;  1UII A;  4JF7 A;  2OYH B;  3VP9 A;  1FS0 E;  5CJ0 A;  3CWB G;  4U3F G;  3O6Q B;  1AVO A;  3Q2Y A;  4XE5 B;  3L74 D;  3VMX A;  3GHG A;  4N78 D;  2CK3 H;  3B8E B;  5CCH D;  4QMA A;  2Z4E A;  1Y8A A;  4C7N B;  1JO5 A;  1L0N E;  1NTZ K;  3RK3 C;  3L37 A;  3OAK A;  5KKZ B;  1EDK A;  1MFT A;  3VMA A;  2R3C A;  2R44 A;  5H2F H;  4ZMD A;  3M0D A;  3B5N C;  3II6 A;  1X0T A;  5APX A;  1JUN A;  1OW8 A;  4JYC A;  4XFJ A;  2Z5H A;  1SP4 A;  2FYN C;  1S5L E;  2YKP A;  2RN0 A;  2KSE A;  5APW A;  3WUV A;  1S9K E;  3G4S P;  3H1L D;  1PP9 E;  1LTJ B;  5AVZ B;  4BXL A;  2M5A B;  3VOP A;  2BAS A;  3R4Y A;  2IBZ E;  2KNC A;  3RL0 g;  4NPD A;  3CCR P;  3W68 A;  3L4F A;  1PP9 J;  3MP7 B;  4WY4 C;  5KAI H;  3FWN A;  3HE5 A;  1BE3 J;  1K9M Q;  1D7M A;  3H1H E;  3A5T A;  4D6T J;  3V6I A;  4L75 A;  1KIL A;  2QEX P;  1S3J A;  4N6J A;  1SQB K;  1L4A C;  3MD0 A;  5DJT B;  5APY A;  1LT9 B;  3S9O A;  1Q7Y Q;  1DD3 A;  3H1H J;  1OZH A;  1EXJ A;  2BCC D;  3CCL P;  2NPS D;  5KLV G;  2JP3 A;  3RK3 E;  1K05 A;  3KXD A;  1OIP A;  1KYO D;  2NPS B;  1M90 Q;  2BEZ F;  2JKV A;  2B89 A;  1NU1 G;  1YQ4 C;  1K73 Q;  4TT3 H;  1OW7 A;  1X22 A;  3I56 P;  4U3F E;  1SQV G;  5CCG D;  1LTI C;  1KIL E;  2IDB A;  3P8M C;  1Q81 Q;  4LC1 A;  4U3F J;  5AW2 B;  3CCJ P;  1KC8 Q;  4XA4 A;  2LXC B;  5M1B A;  3AEE C;  5KJ7 A;  2JWA A;  1E5W A;  1SLQ A;  4YTP C;  1ZR4 A;  2KXP B;  2E74 D;  2JR8 A;  2R5B A;  2E74 B;  1RE4 C;  4O9B A;  1SVF A;  2O1J A;  4PJ0 E;  1DEB A;  2OYI C;  3H1K G;  4GOE A;  2WPR A;  1NTZ E;  2FXO A;  3CXH I;  1JY2 P;  3A2A A;  1BSN A;  3E1R A;  2OGU A;  3BAT A;  1NYH A;  2KLU A;  3BCC G;  1NTZ J;  1NTM G;  2H7H A;  2N1T D;  2KS1 A;  2R5D A;  2IZ0 A;  3L72 G;  1G2C A;  2N1T B;  3GHG B;  3MIW A;  4B86 A;  1QGK B;  2H88 C;  3H1I G;  2ZYG A;  3IF4 A;  3ZDM A;  1PP9 D;  1BDC A;  1BE3 D;  3TNU A;  1SQQ K;  4D6T D;  2IBZ D;  3LIE A;  1GK4 A;  2QJK C;  3WMM 0;  1FZE A;  1KD1 Q;  3H1H D;  2FFD A;  1EZV E;  2Y0E A;  3L74 G;  3RBX A;  1GMJ A;  1LWU C;  1VDF A;  1NU1 J;  1PGQ A;  2KP8 A;  1SQV J;  4GKG A;  5AW3 B;  1FZB A;  3G6E P;  3Q1M A;  4PV1 C;  2QJY C;  5AW0 B;  3IN6 A;  4YXW H;  2KNC B;  1SFC C;  1YIJ P;  4U3F D;  5C39 A;  3HE5 B;  1ZME C;  1KIL D;  1AA0 A;  1FDO A;  4GOD A;  2Q3E A;  1PZQ A;  3AEG C;  1KIL B;  1URQ C;  1M56 D;  1EDI A;  2NRG A;  4AQR D;  2IZ1 A;  1ZXG A;  2KYV A;  1N86 A;  2E76 C;  1IK9 A;  3H1L G;  5KAF H;  2WVR A;  2YKQ A;  3H1K J;  1YQ3 C;  1CW5 A;  3BCC E;  2WSF H;  4RES B;  3Q5P A;  3VP8 A;  3L72 E;  1WRG A;  3BCC J;  2R3S A;  3T97 A;  3RK2 D;  2YIU C;  1NTM J;  1RE3 C;  3H1I E;  1NTZ D;  3CMA P;  3TGU G;  2O3J A;  2WSE J;  3RL0 C;  2IFM A;  5KJ7 D;  3RK2 B;  2B9B A;  3BRT B;  3L72 J;  1LTB C;  1IFN A;  3GW6 A;  3HE4 A;  3H1I J;  1J1E B;  2RH0 A;  3V4Q A;  2R32 A;  1LNQ A;  3EFG A;  1FZC C;  3PTZ A;  2HG5 D;  1NGM B;  1EC5 A;  1NTK K;  4DCK A;  5K5G B;  4HJG H;  1PIX A;  4EYY Q;  1N8R Q;  1FOS F;  3AED C;  1JB0 J;  2I8D A;  5E79 E;  2C0X A;  4I7Z C;  4JPZ B;  3PHL A;  4HB1 A;  2OAR A;  4IL6 H;  5AVV B;  3M0A A;  2OTK E;  3E1I A;  2I1J A;  5KLI B;  4Y99 B;  5AVQ B;  3CI9 A;  4KJM A;  2HPC A;  2W83 C;  2YNY A;  3CC7 P;  1NU1 D;  1VQ6 P;  3SFE C;  1QL2 A;  1NTK G;  1NHL A;  1KB9 E;  1FZC A;  1SQV D;  2KS1 B;  4PD4 E;  1SQX K;  1YHQ P;  2KUB A;  1G2C B;  5TJH A;  3CCV P;  2Y9Y A;  2D2C C;  1JY3 N;  4Z1M H;  3C1L A;  1DH3 A;  2O01 J;  1AJY A;  2XNX A;  1L0N G;  3CCM P;  1P84 I;  1KYO H;  3W67 A;  3TNU B;  5B5E H;  5KTB A;  4YPC A;  2E5Y A;  1VF5 D;  4AYC A;  1IFP A;  3CCE P;  3H1J E;  1Q90 D;  4ZKP A;  4RO0 A;  2QM7 A;  1VF5 B;  1ZW0 A;  2K9J A;  4MN4 C;  3U1C A;  2VRS A;  2FFD B;  3BVH A;  3H1J J;  3S4R A;  1YBK A;  3M06 A;  3MUD C;  1S5L X;  1HF9 A;  3H1K D;  1OW6 A;  3E7K A;  3LW5 J;  1USD A;  5EFW B;  2QJP C;  2V7Q J;  3I55 P;  3TGU E;  1H88 A;  2LR2 A;  1J1D B;  1PP9 G;  4H44 C;  3QWO C;  1YYC A;  5AVY B;  2GM4 A;  2JWD A;  3BCC D;  3A0H E;  1OX3 A;  1IJD B;  3TGU J;  1NTM D;  4OGQ C;  1MUU A;  3L70 E;  2A06 G;  2DW3 A;  3L72 D;  3HD7 C;  1ZLL A;  2H43 A;  4IFM A;  3H1I D;  3MUD A;  5AW1 B;  2OTL P;  5TIS E;  1N7S C;  3M91 A;  4GT1 A;  2KZJ A;  2UWJ E;  1MV8 A;  2Y9Z A;  1RQV A;  2E43 A;  2ITA A;  2QJY B;  1GL2 C;  1JY2 O;  3CX5 E;  1NTK E;  4DJG A;  2G3A A;  3TDK A;  4DOJ A;  1S5L H;  2ZT9 C;  2GA1 A;  3AEA C;  5GTH H;  1LGH B;  1EDJ A;  3CCQ P;  1GW4 A;  2PP6 A;  1VQ5 P;  3T97 B;  3EFF K;  1WMK A;  4C46 A;  1JMB A;  1KMI Z;  1NTK J;  2ZJS E;  4K3A A;  3WU2 E;  3MGN A;  1P84 H;  1OFC X;  4H13 C;  1OMI A;  1N7S A;  2L91 A;  3HE4 B;  3D70 A;  3TYY A;  3M9B A;  1RF0 C;  1KOR A;  1YTZ I;  1T2K C;  1KB9 D;  3NTN A;  1H89 A;  1L0N J;  1VQ7 P;  4PD4 D;  2XV5 A;  2YMY A;  1GDT A;  3A0B E;  2LXB A;  5GTI H;  2C9L Y;  1E79 H;  1KZU B;  2PAJ A;  1PV3 A;  2AXT E;  3L71 G;  1NTZ G;  3D6Y A;  2AEJ A;  3AE5 C;  4HKZ H;  5CMZ A;  1AFO A;  3H1J D;  4W7Z A;  1VQ4 P;  2KSJ A;  3L73 G;  2PFX A;  2JO1 A;  1SQP K;  2QM8 A;  2A06 E;  1FZC B;  2HYN A;  5AVS B;  4JBZ A;  3BAS A;  1NO4 A;  1R8E A;  4EI2 A;  3B5N A;  4ZKU A;  1Q86 Q;  4LLH A;  3TGU D;  1VQK P;  1N73 C;  1GD2 E;  3K5B A;  1BCC G;  3FGA D;  1EXI A;  2AEF A;  4IFF A;  4BRY A;  2WT7 A;  2K9J B;  3AEF C;  2K1A A;  1EZV G;  4I1L A;  4IFD K;  4TLF A;  4JYB A;  3P7K A;  4WY4 A;  2WSC J;  1SQB G;  2A45 I;  1RF1 C;  4OWF A;  4AUW A;  1UIX A;  3O8Z A;  1L4A A;  1T3J A;  3OA7 A;  3G71 P;  3VN0 A;  3H25 A;  1M1J C;  1OWA A;  3CME P;  1NWQ A;  2C9N Y;  3CX5 D;  1NTK D;  2P1J A;  2W8Z A;  3V5B A;  3D71 A;  1XTG B;  2RKL A; 
#chains in the Genus database with same CATH homology
 5APS A;  2Q9I A;  1KIL B;  1T8Z A;  1URQ C;  1FJK A;  1CSB A;  2XZR A;  2XDJ A;  1GL2 A;  2J59 M;  1L0L K;  4AQR D;  1FBM A;  3N4X A;  1JNM A;  1RF1 A;  2KYV A;  1DX7 A;  3SWY A;  1N86 A;  1MZ9 A;  5BVZ A;  1G1J A;  3RL0 D;  1IK9 A;  2NPS A;  3VYI A;  1J2J B;  1HUC A;  1HBW A;  2YKQ A;  2W6B A;  1X79 B;  4WB4 A;  2WSC H;  3RL0 B;  1CW5 A;  1KIL C;  5CHX A;  2WSF H;  4RES B;  3HTK A;  1M7L A;  2HPC B;  2W6A A;  3HRN A;  3PP5 A;  1XTC C;  4GIF A;  1RF0 A;  3VP8 A;  3KQG A;  5CCG A;  1WRG A;  1MFZ A;  1RE4 A;  3G3Z A;  2HOD B;  3T97 A;  3RK2 D;  5AVX B;  1FU1 A;  1JY2 N;  1RE3 C;  2XU6 A;  3RL0 C;  2IFM A;  5KJ7 D;  2FYU K;  3RK2 B;  1FZG A;  2P2U A;  5KLV K;  3BRT B;  3U1A A;  1LTB C;  2YO2 A;  1IFN A;  2OYI A;  1Z56 A;  1S9K D;  3HE4 A;  3NFQ A;  2WPS A;  1J1E B;  1N7S B;  3V4Q A;  2R32 A;  3OJA B;  1NU1 K;  2H8P D;  1A02 F;  3EFG A;  1FZC C;  5APT A;  2HG5 D;  3V4W A;  3HUS B;  3GHG C;  2W27 A;  1SQV K;  1HWT C;  3M9Q A;  1NTK K;  1GZL A;  5APQ A;  3RK2 C;  2M3B A;  1HVV A;  3P32 A;  3MTU E;  1FJP A;  2ZFC A;  2GUS A;  1FOS F;  3KYQ A;  3NXS A;  3KPE A;  5KJ7 C;  2C0X A;  1LTG C;  3LID A;  1J1E C;  2A45 H;  1RY3 A;  1X8Y A;  2OAR A;  5AVV B;  1JMM A;  3A7O A;  1IC2 A;  1GK6 A;  3M0A A;  3E1I A;  2I1J A;  4DZO A;  2KOG A;  1H8A A;  4Y99 B;  5AVQ B;  2IX7 C;  3CI9 A;  3P8C E;  3RK3 D;  4JF7 A;  1FZA A;  2OYH B;  3VP9 A;  1CI6 A;  2HPC A;  5CJ0 A;  1JTH B;  2YNY A;  1N73 A;  4I6M C;  3RK3 B;  1QL2 A;  3M9H A;  3V2R A;  1NHL A;  3R2P A;  4XE5 B;  3VMX A;  1FZC A;  1IFM A;  2C0W A;  2Q5U A;  3GHG A;  3I5C A;  1SQX K;  4N78 D;  1G2C B;  1HGV A;  3B8E B;  5CCH D;  3EQ2 A;  4Y99 C;  3B5N D;  1JY3 N;  2Z4E A;  4C7N B;  2OYH C;  1DH3 A;  1JO5 A;  1IFI A;  1NTZ K;  3B5N B;  3RK3 C;  2XNX A;  1HGZ A;  1LTT C;  1LWU A;  5AVT B;  3L37 A;  3OAK A;  3L35 A;  3V2Q A;  3TNU B;  5KTB A;  2FXM A;  3H32 A;  1OXZ A;  1NTM K;  4AYC A;  2P67 A;  1LTA C;  5APU A;  2LKM A;  2R3C A;  4ZKP A;  4HH2 A;  2QM7 A;  1VPC A;  2I1K A;  5CCH C;  4W7Y A;  3U1C A;  3M0D A;  2WT7 B;  1M1J A;  3B5N C;  3II6 A;  2VRS A;  1HH0 A;  3A3Y B;  2WZ7 A;  2FFD B;  1NKZ B;  5APX A;  1KQL A;  4WY4 D;  4JYC A;  3BVH A;  1JUN A;  1SFC A;  2Z5H A;  1SP4 A;  4WBA A;  3M06 A;  2A45 G;  4WY4 B;  1QL1 A;  2YKP A;  3HD7 D;  1T3U A;  5APW A;  1N2D C;  1L4A D;  2OYH A;  1H88 A;  3HD7 B;  1S9K E;  1URQ A;  1LTJ B;  5AVZ B;  1ZV8 A;  3TK1 A;  4EIJ A;  1J1D B;  3VMY A;  1L4A B;  1YYC A;  5AVY B;  2GM4 A;  2Q7C A;  3VOP A;  2FFD C;  1N7S D;  2BAS A;  5AVU B;  1IJD B;  2JEE A;  3L4F A;  3U59 A;  4WY4 C;  1MUU A;  3HE5 A;  4I2L C;  4KHX A;  3A5T A;  1KIL A;  3HD7 C;  5AW8 B;  5AW5 B;  1LTJ C;  4N6J A;  4N3Y B;  1GL2 D;  1SQB K;  2WPQ A;  1J1D C;  1ZLL A;  4EOT A;  2H43 A;  1L4A C;  4IFM A;  1A02 J;  4HYT B;  3MD0 A;  2O1K A;  3MUD A;  5AW1 B;  1GL2 B;  1LT9 B;  5APY A;  1N7S C;  4W80 A;  3C9I A;  5AW9 B;  2NPS D;  2ZXE B;  1RF1 B;  1W2E A;  3M91 A;  1IO4 A;  4GT1 A;  1RE3 A;  3HUS C;  1YTZ T;  2NPS B;  3IFM A;  1MV8 A;  3KDP B;  3NMD A;  2E43 A;  2YO3 A;  3LW5 H;  1HJB A;  2CPS A;  2IPP A;  1GL2 C;  1JY2 O;  1LT9 C;  3HTK B;  5CCG D;  1N7L A;  2WSE H;  1LTI C;  2WIT A;  1T2K D;  1KFM A;  3P8M C;  2HOD A;  4DOJ A;  5BU5 A;  1LGH B;  1GW4 A;  4LC1 A;  2PP6 A;  5AW2 B;  2NPS C;  4XA4 A;  4C46 A;  1IFJ A;  3V2P A;  2KLV A;  1JCC A;  3SWF A;  5KJ7 A;  4OH8 B;  2N9B A;  1E5W A;  3MGN A;  3P8C D;  1JCD A;  2OYI B;  1SLQ A;  1N7S A;  5AW7 B;  1ZR4 A;  5AW6 B;  3HE4 B;  3TYY A;  2R5B A;  5APV A;  3M9B A;  1RF0 C;  2J58 A;  5CCG C;  3HUS A;  1FDM A;  1YTZ I;  1T2K C;  1RE4 C;  3NTN A;  1H89 A;  4O9B A;  2XV5 A;  1SVF A;  2O1J A;  3UIA A;  2YMY A;  1PFI A;  1LT9 A;  1GDT A;  4M3L A;  1DEB A;  3V2N A;  2OYI C;  1GU4 A;  1WT6 A;  2C9L Y;  1FAV A;  2WPR A;  1KZU B;  2PAJ A;  1NKN A;  1JY2 P;  3A2A A;  3BAT A;  2JJL A;  5CMZ A;  3BRV B;  1JTH A;  3H6P A;  3L36 A;  1AFO A;  1LTS C;  2HLO A;  1CI6 B;  4W7Z A;  5BU8 B;  2KSJ A;  1N73 B;  2H7H A;  2N1T D;  1GW3 A;  1JY3 O;  1X9V A;  2Q3I A;  1NH4 A;  1SQP K;  2O01 H;  2R5D A;  2QM8 A;  1G2C A;  1FZC B;  2N1T B;  2HYN A;  3TSI A;  1JOC A;  3GHG B;  5AVS B;  2E42 A;  3BAS A;  1ZR2 A;  1NO4 A;  1NOH A;  3MIW A;  4B86 A;  4C7N A;  2POH A;  1FZF A;  5CCH A;  3VTP C;  3B5N A;  4LGD E;  4ZKU A;  4LLH A;  2FKW B;  1FOS E;  1AQ5 A;  1CZQ A;  2XKM A;  1N73 C;  1GD2 E;  1G1I A;  3CLQ A;  2WWW A;  1LWU B;  3TNU A;  1SQQ K;  3CL3 D;  3LIE A;  1GK4 A;  2N1T C;  1HTL C;  3WMM 0;  5CJ4 A;  1FZE A;  1IFD A;  2MJZ A;  3H32 B;  4IFF A;  1ZN5 A;  2M8R A;  2WT7 A;  5AW4 B;  2L5G B;  2P7J A;  2FFD A;  2YKO A;  1KFN A;  1SFC D;  2KB7 P;  1M1J B;  2CPB A;  4I1L A;  4IFD K;  3N7N A;  4JYB A;  2WTY A;  1GU5 A;  4N78 E;  2Z5I A;  1LWU C;  1SFC B;  3P7K A;  4WY4 A;  2GUV A;  5AVR B;  1VDF A;  1EQ7 A;  2A45 I;  1RF1 C;  4AUW A;  1L0N K;  1JY3 P;  1URQ D;  2KP8 A;  3HD7 A;  3O8Z A;  1LTJ A;  4GKG A;  5AW3 B;  2HFE D;  1FZB A;  2FYZ A;  1L4A A;  1T3J A;  1URQ B;  3OA7 A;  3VN0 A;  4C7R A;  3M0D C;  1M1J C;  1OWA A;  1NWQ A;  5AW0 B;  2IFN A;  1SFC C;  3VMZ A;  5AVW B;  2N1T A;  2C9N Y;  1GTW A;  3HE5 B;  1KIL D;  2P1J A;  3V5B A;  1XTG B;  3IR9 A;  1NAF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...