2HFED

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
DLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 18
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hfeD00
2WZ7A 1GL2B 1SFCA 3HD7A 4JF7A 3RK2C 5KJ7C 5CCGA 4WY4A 3B5NA 3HD7C 1L4AA 2KOGA 4W80A 1URQB 2N1TA 3KYQA 3HD7D 1NHLA 3RL0B 2M8RA 1N7SA 1SFCB 3HD7B 4LGDE 2H8PD 3B5ND 2N1TC 1URQC 2HFED 1L4AD 4W7YA 4WY4B 2N1TD 3B5NB 5CCHA 1N7SC 3RL0C 1URQD 1L4AB 1SFCC 2N1TB 1N7SD 1T3JA 3RL0D 2NPSA 4N78E 1SFCD 1N7SB 2XDJA 5CCGC 4WY4C 3VOPA 3B5NC 5CCHD 2PP6A 1L4AC 5CCGD 4WY4D 3M0DC 1HVVA 3RK3C 2NPSD 1JTHB 3RK3D 1JTHA 2NPSB 3P8CE 4W7ZA 3RK3B 3PP5A 5KJ7A 1KILA 5CCHC 1GL2A 3HTKB 1XTGB 3TSIA 4OH8B 2YMYA 2NPSC 1KILC 3RK2D 1GL2C 5KJ7D 2HG5D 1KILD 1GL2D 1URQA 3RK2B 1KILB
chains in the Genus database with same CATH superfamily
3GHGA 2V4HA 1NTKG 3NMDA 3L72J 1RF1C 1RH5B 3A5TA 2YO2A 1A02J 4O9BA 3CX5H 3MP7B 4H44D 5AVXB 5H2FH 3AEBC 1QX8A 1BE3D 5B5EE 3B5NB 1HJ0A 3GHGC 4I7ZB 4XA4A 1T3JA 4N78D 4PD4D 4YXWH 1AQ5A 1JUNA 4NPFX 2QJYC 1NU1G 2P58A 2Q3IA 3SSUA 2ZFCA 5AW3B 3I56P 2E75B 3L71E 1VQ9P 3AE8C 1FE6A 1KYOI 3AEGC 3H1JG 3C8VA 1Q2NA 3L72E 1R5SA 5KAFH 4ZMDA 5AVRB 5APQA 1L0ND 1EZVG 2FXPA 1IJDB 2FYUK 2QJKB 4JYCA 3I55P 2IYPA 1GTWA 1NU1D 2FYNC 1VF5C 1SQVD 1LTAC 1S5LH 1JCDA 3AECC 1FJKA 1NTKK 2LKMA 3IAOA 5APWA 3A0HE 2QM7A 1LP1B 1SQPJ 1OVRA 1QLED 3N4XA 2ZVOB 2O1KA 1BCCE 5APTA 3OA7A 2LXBA 3EFGA 1DD3A 1OVUA 1M1JA 3BCCE 3AE3C 4MN4C 1L0LG 1KD1Q 4OVNF 3H1HE 4HH2A 1SQXJ 4H0LC 3PTZA 1G1IA 5CCHD 1W2EA 3AE1C 1L0NK 2MKVA 1HJBA 4ZNCA 3T97A 2HLOA 5KLVJ 1KYOD 1HGVA 3HE4A 3RK3D 1ZXGA 1NU1K 1CI6A 1JTHA 1NTZD 3P8CE 1M1JC 1SQVK 2M3BA 3A0BH 1E79H 4XE5B 5KKZC 2W83C 3R2PA 1KILA 2BCCJ 4L74A 4GDOA 1IFDA 2Y0CA 3HTKB 2I1JA 2N9YB 2CPBA 3IFMA 5AVQB 1NJIQ 3HE5A 4U3FD 2ZXXA 1P84I 2Z5IA 3TDKA 3VMZA 3M0DA 3WMM0 3HD7D 2M5AA 4RESB 4IFMA 2W6JH 2Q6QA 1RQVA 3CCUP 1JM0A 5KLIB 2P67A 4Y28J 2R44A 4WWIA 5KLVE 2GA1A 1LTJC 3FGAD 2Z5HA 1ZOYC 2YKOA 2E76B 5AW4B 3LW5H 4IFDK 3WU2E 3H1IE 3JC22 4Z1MH 2WTYA 2N1TB 2K9YA 2G8YA 1H0TA 3M9QA 2VRSA 2KXPB 1L0LK 2YXQB 3F5HA 3VP8A 1MZ9A 2XU6A 3IR9A 4BRYA 1VQPP 3M0DC 2OTLP 3L75D 2KP8A 2WSCJ 3OAKA 1JTHB 1KB9I 2I8DA 2NPSB 1KYOH 5AW1B 4L76A 1IFNA 2PRRA 1NGMB 5KJ7A 1AVYA 1U57A 3AE4C 4JPZB 1IC2A 1FDOA 1NOHA 3CX5E 2YKQA 2FY8A 3PLNA 5H2FE 1FS0E 2J5UA 2K9JB 3CXHI 2Y0EA 1GL2D 5KTBA 3Q5PA 3L35A 1P84D 2ZYAA 1J1EC 1YBKA 4TT3H 3TF5A 1EDIA 1SQPG 2K3RA 3O6QB 3G6EP 3CCRP 2L91A 1LWUB 5KJ7C 3IF4A 4PV1B 3L4FA 4EOTA 2FYUJ 1W5CE 1NHLA 4H44B 1EXJA 1X9VA 1UIIA 1BE3J 1M8OB 3W68A 2WSEH 1IO4A 3NTNA 3SWYA 1IK9A 1NTKJ 1XTCC 1SQXG 3RL0g 1KQFB 3Q1MA 4WBAA 3AE9C 1RQUA 5KAFE 4BXLA 1KB9D 5TISH 3KZIH 3VOPA 2IBZI 1KFMA 1NH4A 3IN6A 2CPSA 1U7MA 1S5LE 2BCCG 2KS1A 1PPJG 1GZLA 4GOFA 4W7ZA 3A0HH 1RY3A 3VTPC 3CXHD 1VDFA 3CCQP 1Y9BA 2O3JA 1X22A 1VQ5P 3TSIA 1HH0A 1L0NJ 1QL1A 1EDJA 2NZ2A 1JY2O 4D6TD 1FOSE 2FYUE 1URQA 1NU1J 4C7NA 1JEKA 1SQVJ 1BE3E 2WZ7A 3MUDA 1PP9E 2E74C 1SFCA 3AE7C 1RE4A 4KJMA 1P84H 2PFXA 1G1JA 3W67A 1Q86Q 1Y8AA 5AW8B 3C9IA 2E42A 1NTKE 1NKNA 1N7LA 3H1JJ 2WT7B 5APYA 3PRJA 2POHA 3MD0A 5AVSB 2M8RA 5KAIH 1N7SA 2C9NY 4LLHA 3MIWA 4H0LD 4LGDE 4OGQC 2H88C 2OYIC 2QSIA 3S1KA 1K04A 1URQC 3A0BE 1FZCA 5APUA 3MUDC 2IBZD 1SFCC 3G9RA 3RGUA 5E79H 1NTMG 1FU1A 2WSSH 1RE4C 2OYHB 1SQXK 1K9MQ 1DEBA 3B71A 3RBZA 2OQQA 3CCVP 5CCGD 3V2RA 4I1LA 2Q3EA 3GF7A 4EIJA 2V7QH 1NU1E 3BRVB 3RK3B 5BU8B 3V4QA 2E43A 2WITA 2RKLA 1FZCC 1L0LJ 1SQBG 3HUSB 5CHXA 1NTMD 2ITAA 2R3CA 3CXHH 1EQ7A 3H1JE 3VP9A 1LTBC 1KILD 5AW5B 1NAFA 1VQNP 1EZVE 2O01N 2JWAA 3AEAC 3P8MC 3M91A 3TNUB 3WUVA 4K3AA 5AW0B 5AW2B 1SQBD 1VQ6P 1L4AA 1JMBA 1ZLLA 3SWKA 2WSEJ 3SWFA 1SQQD 4K35A 2KLUA 4GOEA 4R4LA 4UB8H 2NRGA 3HD7B 3E1RA 3AE6C 4AYCA 4I7ZC 1VQKP 1KYOE 2AXCA 4PV1D 1YQ4C 4AUWA 5AVWB 3ABVC 1KORA 1NTMK 1IK7A 3MHVA 1L0LE 1BGYD 1L4AC 1GMJA 5M1BA 3PH0A 3MTUE 3FWLA 3V2PA 2GUSA 3H1LD 1JY3O 1N73B 1NVOA 1BDCA 1L0NG 2XV5A 2AEJA 2QJKC 1S9KE 1QL2A 2WQYC 3SFDC 1SQBK 1SQVG 2UWJE 3P7KA 5KJ7D 2J59M 1RF1B 1S5LX 1PGJA 2WSCH 2H43A 4YPCA 2M0BA 2IX7C 2QVAA 3TK1A 1GL2B 1Q90D 3II6A 3Q5SA 2D2CD 1JB0J 1MUUA 4JQ0D 4WY4A 1YJ9P 1R5LA 5TISE 1OW6A 3KZIE 3O8ZA 1T6AA 2FYZA 3GHGB 1GU4A 4HYTB 2QJPB 1GK6A 3LIEA 3FXDA 1SLQA 2QJYB 1KV4A 1YYCA 2ZT9D 2K1AA 3D71A 2FFDA 3CMEP 3AEDC 4JBZA 2HPCA 1VQ4P 4WY4C 1PGPA 2V7QJ 3H32A 4Y99C 1NTZG 1YTZT 2JWDA 3A2AA 3CWBD 2KLVA 2KI7B 2Y0DA 2YNYA 5CBNA 1SVFA 3GW6A 1P84E 2R5BA 1HF9A 3L37A 1ZRTD 1JOCA 4PD4H 4XFJA 2FFDC 2B87A 4U3FG 5KAIE 2M3EA 5L8RJ 2P7JA 1S72P 5EFWB 1YITP 4GODA 5AVZB 3BVHA 2JKVA 2XZRA 3E7KA 5E79E 1HTLC 2W6BA 3RK2C 3CC2P 3E1IA 4B86A 1FDIA 1J2JB 3D6YA 1SQPE 1Q7YQ 4H13C 1LTJA 3UIAA 1KC8Q 1H88A 1KZUB 2E76C 3GMAA 3VYIA 2H8PD 1HBWA 1M57D 1IFIA 2N1TC 2KZJA 1JO5A 1T3UA 4H0LB 4W7YA 1FJPA 1OXZA 3RL0C 1YQ3C 1JY2N 1N7SD 2B88A 1AVOA 5DJUB 3L75G 2G3AA 1SQXE 3CXHE 1M1JB 1GK4A 1KQGB 2WPVB 2PP6A 5KKZB 3L74G 3BATA 1DX7A 4IFFA 2HODA 1NTZK 3SFEC 3CCEP 1QVFO 3OJAB 3GG2A 3L71D 2KK7A 3CC4P 2BCCE 1PPJE 2A45I 1NTMJ 3KPEA 3V4WA 3L72D 2IDBA 2LXCB 3MZWB 3T97B 1YHQP 3LIDA 2E5TA 1EDLA 2B89A 2KSJA 2W8ZA 1IZNB 3HE4B 1CI6B 1FAVA 4UB8E 1T2KC 1S1CX 3L74D 2BASA 1KILB 2R3SA 1GU5A 1JCCA 4DT0A 3CI9A 1SQBJ 3HE5B 4W80A 4GKGA 3KQGA 3KYQA 1YIJP 1SQQJ 1BCCD 2A45G 1KTMA 3BCCD 3G71P 1WT6A 3WUTA 1L4AD 1G2CA 4EYYQ 2IFMA 1M7LA 2FKWB 2M5AB 1K73Q 1LTSC 3H1HD 2FBWC 4IL6H 3CLQA 2Q9IA 1CZQA 2WMMA 2KNCA 1NTME 1BGYJ 3MGNA 2H89C 3G4SP 1LTIC 4ZKUA 1H0TB 3H1LJ 1N86A 2A06G 1YTZI 4D6TG 1H89A 2KYVA 4BRYB 3A7OA 2OTKE 1J1EB 1NYHA 2GM4A 1SQBE 4WB4A 1S3JA 3QWOC 2K37A 1J1DC 1VF5D 2IZ1A 2JO1A 1N8RQ 2MJZA 1FZEA 3KHUA 3AEFC 1AV1A 5AW6B 1Q82Q 3CCLP 2JDIH 2A06D 4WVZA 2D2CB 2KIKA 2C0XA 3GLMA 2OYIA 3L73G 3M0AA 4RKUJ 4DCKA 1JY3N 2HR3A 1K05A 2IBZG 3TYYA 2C9LY 1G2CB 5KLVD 1OW8A 1S2EA 1LT9A 1ZP0C 3H1ID 3TGUD 2WWWA 4N78E 3H1KG 4PD4E 3KDPB 2ZT9B 3M06A 3QH9A 4HB1A 3CD6P 1A02F 3CWBJ 1HVVA 3RK3C 3L73D 5GTHE 4KT0J 4QMAA 1IFMA 1NO4A 4A7PA 1NAYA 4OWFA 3F89A 1OVVA 2A45H 3PP5A 5CMZA 1RHZB 2YIUB 1E5WA 1LT9C 1AJYA 3CX5D 3H1KD 1KB9H 1KMIZ 1L0NE 2P1JA 2OGUA 2KS1B 2W27A 4N6JA 3RK2D 1QEXA 4UB6H 2XKMA 1QVGO 1NTZJ 3V5BA 2ZAEB 4H13D 1SQVE 5APVA 3M9BA 3EQ2A 5K5GB 1NKZB 1FZGA 3G3ZA 3VMAA 1SQQG 3L70D 3B5NA 5BU5A 4RJTA 3HD7C 2JR8A 2KOGA 1URQB 4C7NB 2YMKA 4NPDA 4U3FJ 1SFCB 2Z4EA 5BVZA 1CSBA 1M90Q 2W90A 5AVUB 5AVVB 1JMMA 2WSFH 4DOJA 2LR2A 1BGYG 5AVYB 1N7SB 3CCMP 3Q5RA 2XDJA 3VMYA 3B5NC 1L2PA 2DW3A 1IFPA 3H1LG 2QA4P 1FZCB 2P2UA 3H25A 3RK3E 1NTZE 2Q5UA 1T2KD 3L71J 1FZFA 2QM8A 5TJHA 4AQRD 1N2DC 5APSA 4C46A 1KN7A 3P32A 4L73A 5B66H 3L75J 3JCUH 2E75C 2WPQA 1GL2C 5GTIH 1LP1A 2IZ0A 3L74J 2FYUD 4NPEA 1JY2P 2SPZA 4U3FE 3I5CA 1PP9D 4JF7A 3CMAP 3VN0A 1BDDA 2ZYGA 1YJWP 1NTKD 4HKZH 1EZVI 4IL6E 5DJTB 1SQQK 3M9HA 1SP4A 1BCCJ 4PJ0H 2QJPC 3BCCJ 3R4YA 2HFED 1RE3A 4GT1A 1L4AB 4EI2A 3OW2O 1YJNP 2P10A 3CWBG 3H1HJ 1IFJA 1VQ8P 3N7NA 3HTKA 1CW5A 3L75E 1LGHB 2OARA 3CCSP 2AEFA 3L74E 2C0WA 1OMIA 1JNMA 4IOIH 1Z56A 2YO3A 2PAJA 3ITKA 1RE3C 1LJ2A 2WPRA 3BRTB 3AEEC 2JJLA 4OH8B 3A3YB 1YI2P 3H1JD 3Q2YA 2FXOA 1EZVD 2QG4A 2ZYDA 3GF3A 2FXMA 1FDMA 2FYNB 1H8AA 2E74D 1VF5B 1USDA 1GD2E 3Q3DA 5CCGA 3V6IA 3B8EB 4D6TJ 4TLFA 4I6MC 1X0TA 2N1TA 5GTHH 1VQMP 4RO0A 2Q7CA 2WVRA 5AW9B 2WSFJ 4OGQD 1U7JA 2OTJP 1BSNA 4WY4B 1URQD 4Y99B 3H1IJ 3S9OA 1LT1A 3TGUJ 2NPSA 1SFCD 5KLIC 1HGZA 1KB9E 2YKPA 5CCGC 1BSHA 1L0LD 1VQLP 2Y9ZA 4UB6E 3L73J 3L36A 2IYOA 3L71G 1OIPA 1FOSF 1FZAA 2FFDB 2IFNA 1AA0A 2K9JA 4DZOA 2HPCB 1WRGA 3L72G 4M3LA 5APXA 3S4RA 2YXRB 1FZBA 2AXTH 1JY3P 3H32B 1AFOA 1S9KD 1DIPA 3H1KJ 3D6ZA 4EDFA 2YMYA 2NPSC 1DD4A 2K88A 2A06E 3O6QA 1LWUA 1ZN5A 1KILC 4D6TE 3U1AA 4YXDC 1TU3F 2HG5D 4KHXA 3RK2B 1LNQA 5CJ0A 4H13B 2I1KA 1LTTC 1DH3A 1QGKB 4HJGH 1BCCG 2B87B 2BEQD 1KFNA 3L70J 4YTPC 1SS1A 3TGUE 1UIXA 3ZDMA 2HYNA 3BCCG 1HWTC 1VL2A 1MKMA 2B9BA 3RL0B 1ZR4A 1LWUC 3K5BA 2QEXP 4PV1C 3B5ND 1X8YA 4I2LC 3L73E 2XNDH 2R32A 3NFQA 1FBMA 4H44C 3H1HG 3V2NA 2QRXA 1M56D 2IBZE 2QIWA 1VQOP 1PV3A 4IL6X 1LTJB 2O01H 5B66E 2N9BA 3JCUE 1WMKA 3H1KE 5GTIE 1PGQA 1ZV8A 3PHLA 1GW3A 2OYOA 1VPCA 3AE5C 2E75D 1EDKA 1MV8A 5B5EH 2XNXA 1KQSO 1Y47A 1M1KQ 2KB7P 2RMZA 2CK3H 1ZMEC 3NXSA 2HODB 4ASVA 3L70E 4PJ0E 2WT7A 1KILE 3B4SA 3P8CD 1T8ZA 1PP9J 2D2CC 3U59A 3CC7P 3H6PA 1W2BO 1SQPD 4DJGA 2PGDA 5AW7B 2OYHA 1SQQE 3CX5I 5KLVG 4BWNA 3USSA 2O1JA 3H1IG 3TGUG 3CCJP 1NWQA 5CCHA 1GW4A 2ZT9C 1USEA 2GUVA 3EWKA 4R4MA 3WUUA 1SQXD 1RF0A 1BGYE 3V2QA 2L5GB 3HUSA 4WY4D 2OYHC 2E5YA 1FC2C 2YIUC 4LC1A 1S4XA 3AE2C 3H1LE 3FX0A 2KNCB 5CCHC 5C39A 2BCCD 4JYBA 1PPJD 1XTGB 4ZKPA 1PZQA 1J1DB 3TNUA 1SQPK 3HRNA 2W6AA 2H7HA 3U1CA 1MFTA 1OWAA 2J58A 1RF0C 3FXEA 3BASA 1K8AQ 3HUSC 3FWNA 1X79B 1PIXA 2Y9YA 1GDTA 3L70G 3HD7A 3LW5J 1AQTA 1OX3A 5CBOA 1EXIA 1PFIA 3C1LA 1EC5A 1OW7A 2E74B 1DEEG 2IPPA 2KSEA 1OZHA 4C7RA 3D70A 3VMXA 2R5DA 2QE7H 1HUCA 5KLVK 1D7MA 2E76D 2ZXEB 3RBXA 2N1TD 2O01J 1N7SC 4OGQB 4ASWA 1VQ7P 4L75A 2OYIB 2KUBA 3RL0D 1ZR2A 2AXTE 2WPSA 2RH0A 2JEEA 4CPGA 1R8EA 1N73A 3PJSK 1PL5A 2RN0A 2KZIA 2Q1KA 3CWBE 2ZJSE 4PD4I 2JP3A 2NPSD 1LT9B 2AEMA 4GIFA 5AVTB 3CL3D 3EFFK 4N3YB 1KQLA 1RF1A 4U7JA 3WU2H 1Q81Q 1GL2A 1ZRTE 1PGOA 1MFZA 2FYUG 1LTGC 3JSVC 5CJ4A 2BEZF 1OFCX 1BE3G 1N73C 1PP9G 1ZW0A 3CPWO 2ZVNB 3KXDA
chains in the Genus database with same CATH topology
3MUDA 2WZ7A 3GHGA 1SFCA 2FXMA 1GU5A 1RE4A 1FDMA 3NMDA 1JCCA 1H8AA 1RF1C 1G1JA 3CI9A 1GD2E 3A5TA 2YO2A 1A02J 5AW8B 3C9IA 2E42A 4O9BA 5CCGA 1NKNA 1N7LA 3B8EB 2WT7B 4I6MC 3HE5B 5APYA 4W80A 2POHA 4GKGA 3KQGA 2N1TA 5AVXB 3KYQA 3MD0A 5AVSB 2M8RA 1N7SA 2C9NY 2A45G 4LLHA 3MIWA 4LGDE 2Q7CA 2OYIC 5AW9B 1WT6A 1URQC 1L4AD 1G2CA 4WY4B 3B5NB 1FZCA 5APUA 1URQD 3GHGC 4Y99B 1SFCC 2IFMA 1M7LA 4XA4A 1T3JA 1FU1A 2FKWB 1RE4C 2NPSA 2OYHB 4N78D 1SFCD 1SQXK 1HGZA 1LTSC 1DEBA 3CLQA 2Q9IA 1AQ5A 1CZQA 2YKPA 5CCGC 1JUNA 5CCGD 3V2RA 3MGNA 4I1LA 3L36A 1FOSF 1LTIC 2Q3IA 1FZAA 4EIJA 4ZKUA 2FFDB 2IFNA 2ZFCA 4DZOA 3BRVB 3RK3B 5BU8B 5AW3B 1WRGA 2HPCB 3V4QA 2E43A 4M3LA 5APXA 2WITA 1N86A 1YTZI 1FZBA 1FZCC 1JY3P 3H32B 1AFOA 3HUSB 5CHXA 1S9KD 1H89A 2KYVA 3A7OA 2YMYA 2NPSC 1J1EB 2R3CA 5AVRB 1EQ7A 5APQA 1LWUA 1ZN5A 1KILC 3VP9A 2GM4A 2FYUK 1IJDB 4JYCA 3U1AA 4WB4A 1LTBC 2HG5D 1KILD 5AW5B 1NAFA 4KHXA 3RK2B 1GTWA 1LTAC 1J1DC 5CJ0A 1JCDA 2I1KA 1LTTC 1DH3A 3P8MC 3M91A 2MJZA 1FZEA 3TNUB 1FJKA 5AW6B 1NTKK 2LKMA 5APWA 5AW0B 1KFNA 5AW2B 2QM7A 2C0XA 1L4AA 2OYIA 2HYNA 3N4XA 1ZLLA 2O1KA 1HWTC 5APTA 3RL0B 3SWFA 1ZR4A 3M0AA 3OA7A 1JY3N 3HD7B 1LWUC 3EFGA 1M1JA 4AYCA 3B5ND 1X8YA 4I2LC 3TYYA 2C9LY 1G2CB 2R32A 3NFQA 1FBMA 3V2NA 1LT9A 4AUWA 2WWWA 4N78E 1LTJB 2O01H 5AVWB 3KDPB 3M06A 4HH2A 1NTMK 2N9BA 1G1IA 5CCHD 1W2EA 1L0NK 1L4AC 1A02F 1HJBA 1HVVA 1ZV8A 3RK3C 3T97A 1GW3A 2HLOA 1HGVA 3MTUE 3HE4A 3RK3D 1IFMA 1VPCA 1NO4A 1NU1K 1CI6A 3V2PA 1JTHA 2GUSA 3P8CE 1M1JC 1SQVK 1MV8A 2M3BA 2A45H 2XNXA 4XE5B 3PP5A 1JY3O 3R2PA 1N73B 5CMZA 2XV5A 1KILA 1IFDA 1E5WA 2KB7P 1S9KE 1LT9C 3HTKB 2I1JA 1QL2A 3NXSA 2HODB 1SQBK 2P1JA 2CPBA 3IFMA 5AVQB 3RK2D 2W27A 3P7KA 4N6JA 5KJ7D 2WT7A 2J59M 2XKMA 1RF1B 3V5BA 3HE5A 3P8CD 2WSCH 2H43A 2IX7C 1T8ZA 5APVA 3M9BA 3TK1A 1GL2B 3II6A 3EQ2A 1NKZB 1FZGA 3U59A 3G3ZA 3H6PA 1MUUA 4WY4A 3B5NA 2Z5IA 5BU5A 3HD7C 2KOGA 3VMZA 3O8ZA 1URQB 4C7NB 3M0DA 5AW7B 3WMM0 3HD7D 2OYHA 2FYZA 4RESB 4IFMA 3GHGB 1SFCB 2Z4EA 1GU4A 4HYTB 5BVZA 2O1JA 1CSBA 2P67A 1GK6A 3LIEA 1LTJC 1NWQA 5AVUB 2Z5HA 5AVVB 5CCHA 2YKOA 1GW4A 1JMMA 5AW4B 1SLQA 3LW5H 2WSFH 4IFDK 4DOJA 2WTYA 1YYCA 2N1TB 2GUVA 2FFDA 5AVYB 3M9QA 2VRSA 2HPCA 1N7SB 1L0LK 2XDJA 1RF0A 3VP8A 3VMYA 4WY4C 1MZ9A 3B5NC 2XU6A 3H32A 3IR9A 4Y99C 1YTZT 2L5GB 3HUSA 3V2QA 4WY4D 3M0DC 3A2AA 2KP8A 2OYHC 2KLVA 1FZCB 2P2UA 3OAKA 1JTHB 2YNYA 1SVFA 4LC1A 2NPSB 5AW1B 2Q5UA 1T2KD 1IFNA 1FZFA 5KJ7A 2R5BA 2QM8A 3L37A 4AQRD 5CCHC 4JYBA 1N2DC 1IC2A 1NOHA 5APSA 1JOCA 4C46A 1XTGB 4ZKPA 2YKQA 3P32A 2FFDC 1J1DB 3TNUA 1SQPK 3HRNA 2W6AA 2WPQA 2H7HA 3U1CA 1OWAA 2J58A 1GL2C 1RF0C 1JY2P 3BASA 1GL2D 2P7JA 3HUSC 5KTBA 1X79B 3L35A 1J1EC 3I5CA 1GDTA 5AVZB 3HD7A 3BVHA 4JF7A 3VN0A 2XZRA 1HTLC 2W6BA 1LWUB 3RK2C 1PFIA 5KJ7C 3E1IA 2IPPA 4B86A 1J2JB 3L4FA 4EOTA 1SQQK 4C7RA 3M9HA 1SP4A 1NHLA 1LTJA 3UIAA 3VMXA 1X9VA 2R5DA 1H88A 1HUCA 1KZUB 3VYIA 2H8PD 2WSEH 1IO4A 1HBWA 3NTNA 3SWYA 5KLVK 1IFIA 2N1TC 1JO5A 1IK9A 1T3UA 2HFED 2ZXEB 4W7YA 1FJPA 1RE3A 2N1TD 4GT1A 1N7SC 1OXZA 3RL0C 1XTCC 1L4AB 2OYIB 1JY2N 1N7SD 3RL0D 1ZR2A 2WPSA 4WBAA 2JEEA 1IFJA 1N73A 1M1JB 1GK4A 3VOPA 3N7NA 2PP6A 3HTKA 3BATA 1DX7A 1KFMA 1CW5A 4IFFA 2HODA 1NH4A 2NPSD 1LT9B 1NTZK 2CPSA 1LGHB 2OARA 4GIFA 5AVTB 3CL3D 3OJAB 4N3YB 1KQLA 2C0WA 1GZLA 1JNMA 4W7ZA 1RF1A 1Z56A 2YO3A 2PAJA 1RE3C 1RY3A 3VTPC 2WPRA 1GL2A 1VDFA 2A45I 3KPEA 3V4WA 1MFZA 3BRTB 3TSIA 1LTGC 2JJLA 4OH8B 3A3YB 3LIDA 1HH0A 2KSJA 5CJ4A 1QL1A 3HE4B 1JY2O 1FOSE 1CI6B 1FAVA 1N73C 1T2KC 1URQA 4C7NA 2BASA 1KILB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2WZ7 A;  1GL2 B;  1SFC A;  3HD7 A;  4JF7 A;  3RK2 C;  5KJ7 C;  5CCG A;  4WY4 A;  3B5N A;  3HD7 C;  1L4A A;  2KOG A;  4W80 A;  1URQ B;  2N1T A;  3KYQ A;  3HD7 D;  1NHL A;  3RL0 B;  2M8R A;  1N7S A;  1SFC B;  3HD7 B;  4LGD E;  2H8P D;  3B5N D;  2N1T C;  1URQ C;  2HFE D;  1L4A D;  4W7Y A;  4WY4 B;  2N1T D;  3B5N B;  5CCH A;  1N7S C;  3RL0 C;  1URQ D;  1L4A B;  1SFC C;  2N1T B;  1N7S D;  1T3J A;  3RL0 D;  2NPS A;  4N78 E;  1SFC D;  1N7S B;  2XDJ A;  5CCG C;  4WY4 C;  3VOP A;  3B5N C;  5CCH D;  2PP6 A;  1L4A C;  5CCG D;  4WY4 D;  3M0D C;  1HVV A;  3RK3 C;  2NPS D;  1JTH B;  3RK3 D;  1JTH A;  2NPS B;  3P8C E;  4W7Z A;  3RK3 B;  3PP5 A;  5KJ7 A;  1KIL A;  5CCH C;  1GL2 A;  3HTK B;  1XTG B;  3TSI A;  4OH8 B;  2YMY A;  2NPS C;  1KIL C;  3RK2 D;  1GL2 C;  5KJ7 D;  2HG5 D;  1KIL D;  1GL2 D;  1URQ A;  3RK2 B;  1KIL B; 
#chains in the Genus database with same CATH topology
 3GHG A;  2V4H A;  1NTK G;  3NMD A;  3L72 J;  1RF1 C;  1RH5 B;  3A5T A;  2YO2 A;  1A02 J;  4O9B A;  3CX5 H;  3MP7 B;  4H44 D;  5AVX B;  5H2F H;  3AEB C;  1QX8 A;  1BE3 D;  5B5E E;  3B5N B;  1HJ0 A;  3GHG C;  4I7Z B;  4XA4 A;  1T3J A;  4N78 D;  4PD4 D;  4YXW H;  1AQ5 A;  1JUN A;  4NPF X;  2QJY C;  1NU1 G;  2P58 A;  2Q3I A;  3SSU A;  2ZFC A;  5AW3 B;  3I56 P;  2E75 B;  3L71 E;  1VQ9 P;  3AE8 C;  1FE6 A;  1KYO I;  3AEG C;  3H1J G;  3C8V A;  1Q2N A;  3L72 E;  1R5S A;  5KAF H;  4ZMD A;  5AVR B;  5APQ A;  1L0N D;  1EZV G;  2FXP A;  1IJD B;  2FYU K;  2QJK B;  4JYC A;  3I55 P;  2IYP A;  1GTW A;  1NU1 D;  2FYN C;  1VF5 C;  1SQV D;  1LTA C;  1S5L H;  1JCD A;  3AEC C;  1FJK A;  1NTK K;  2LKM A;  3IAO A;  5APW A;  3A0H E;  2QM7 A;  1LP1 B;  1SQP J;  1OVR A;  1QLE D;  3N4X A;  2ZVO B;  2O1K A;  1BCC E;  5APT A;  3OA7 A;  2LXB A;  3EFG A;  1DD3 A;  1OVU A;  1M1J A;  3BCC E;  3AE3 C;  4MN4 C;  1L0L G;  1KD1 Q;  4OVN F;  3H1H E;  4HH2 A;  1SQX J;  4H0L C;  3PTZ A;  1G1I A;  5CCH D;  1W2E A;  3AE1 C;  1L0N K;  2MKV A;  1HJB A;  4ZNC A;  3T97 A;  2HLO A;  5KLV J;  1KYO D;  1HGV A;  3HE4 A;  3RK3 D;  1ZXG A;  1NU1 K;  1CI6 A;  1JTH A;  1NTZ D;  3P8C E;  1M1J C;  1SQV K;  2M3B A;  3A0B H;  1E79 H;  4XE5 B;  5KKZ C;  2W83 C;  3R2P A;  1KIL A;  2BCC J;  4L74 A;  4GDO A;  1IFD A;  2Y0C A;  3HTK B;  2I1J A;  2N9Y B;  2CPB A;  3IFM A;  5AVQ B;  1NJI Q;  3HE5 A;  4U3F D;  2ZXX A;  1P84 I;  2Z5I A;  3TDK A;  3VMZ A;  3M0D A;  3WMM 0;  3HD7 D;  2M5A A;  4RES B;  4IFM A;  2W6J H;  2Q6Q A;  1RQV A;  3CCU P;  1JM0 A;  5KLI B;  2P67 A;  4Y28 J;  2R44 A;  4WWI A;  5KLV E;  2GA1 A;  1LTJ C;  3FGA D;  2Z5H A;  1ZOY C;  2YKO A;  2E76 B;  5AW4 B;  3LW5 H;  4IFD K;  3WU2 E;  3H1I E;  3JC2 2;  4Z1M H;  2WTY A;  2N1T B;  2K9Y A;  2G8Y A;  1H0T A;  3M9Q A;  2VRS A;  2KXP B;  1L0L K;  2YXQ B;  3F5H A;  3VP8 A;  1MZ9 A;  2XU6 A;  3IR9 A;  4BRY A;  1VQP P;  3M0D C;  2OTL P;  3L75 D;  2KP8 A;  2WSC J;  3OAK A;  1JTH B;  1KB9 I;  2I8D A;  2NPS B;  1KYO H;  5AW1 B;  4L76 A;  1IFN A;  2PRR A;  1NGM B;  5KJ7 A;  1AVY A;  1U57 A;  3AE4 C;  4JPZ B;  1IC2 A;  1FDO A;  1NOH A;  3CX5 E;  2YKQ A;  2FY8 A;  3PLN A;  5H2F E;  1FS0 E;  2J5U A;  2K9J B;  3CXH I;  2Y0E A;  1GL2 D;  5KTB A;  3Q5P A;  3L35 A;  1P84 D;  2ZYA A;  1J1E C;  1YBK A;  4TT3 H;  3TF5 A;  1EDI A;  1SQP G;  2K3R A;  3O6Q B;  3G6E P;  3CCR P;  2L91 A;  1LWU B;  5KJ7 C;  3IF4 A;  4PV1 B;  3L4F A;  4EOT A;  2FYU J;  1W5C E;  1NHL A;  4H44 B;  1EXJ A;  1X9V A;  1UII A;  1BE3 J;  1M8O B;  3W68 A;  2WSE H;  1IO4 A;  3NTN A;  3SWY A;  1IK9 A;  1NTK J;  1XTC C;  1SQX G;  3RL0 g;  1KQF B;  3Q1M A;  4WBA A;  3AE9 C;  1RQU A;  5KAF E;  4BXL A;  1KB9 D;  5TIS H;  3KZI H;  3VOP A;  2IBZ I;  1KFM A;  1NH4 A;  3IN6 A;  2CPS A;  1U7M A;  1S5L E;  2BCC G;  2KS1 A;  1PPJ G;  1GZL A;  4GOF A;  4W7Z A;  3A0H H;  1RY3 A;  3VTP C;  3CXH D;  1VDF A;  3CCQ P;  1Y9B A;  2O3J A;  1X22 A;  1VQ5 P;  3TSI A;  1HH0 A;  1L0N J;  1QL1 A;  1EDJ A;  2NZ2 A;  1JY2 O;  4D6T D;  1FOS E;  2FYU E;  1URQ A;  1NU1 J;  4C7N A;  1JEK A;  1SQV J;  1BE3 E;  2WZ7 A;  3MUD A;  1PP9 E;  2E74 C;  1SFC A;  3AE7 C;  1RE4 A;  4KJM A;  1P84 H;  2PFX A;  1G1J A;  3W67 A;  1Q86 Q;  1Y8A A;  5AW8 B;  3C9I A;  2E42 A;  1NTK E;  1NKN A;  1N7L A;  3H1J J;  2WT7 B;  5APY A;  3PRJ A;  2POH A;  3MD0 A;  5AVS B;  2M8R A;  5KAI H;  1N7S A;  2C9N Y;  4LLH A;  3MIW A;  4H0L D;  4LGD E;  4OGQ C;  2H88 C;  2OYI C;  2QSI A;  3S1K A;  1K04 A;  1URQ C;  3A0B E;  1FZC A;  5APU A;  3MUD C;  2IBZ D;  1SFC C;  3G9R A;  3RGU A;  5E79 H;  1NTM G;  1FU1 A;  2WSS H;  1RE4 C;  2OYH B;  1SQX K;  1K9M Q;  1DEB A;  3B71 A;  3RBZ A;  2OQQ A;  3CCV P;  5CCG D;  3V2R A;  4I1L A;  2Q3E A;  3GF7 A;  4EIJ A;  2V7Q H;  1NU1 E;  3BRV B;  3RK3 B;  5BU8 B;  3V4Q A;  2E43 A;  2WIT A;  2RKL A;  1FZC C;  1L0L J;  1SQB G;  3HUS B;  5CHX A;  1NTM D;  2ITA A;  2R3C A;  3CXH H;  1EQ7 A;  3H1J E;  3VP9 A;  1LTB C;  1KIL D;  5AW5 B;  1NAF A;  1VQN P;  1EZV E;  2O01 N;  2JWA A;  3AEA C;  3P8M C;  3M91 A;  3TNU B;  3WUV A;  4K3A A;  5AW0 B;  5AW2 B;  1SQB D;  1VQ6 P;  1L4A A;  1JMB A;  1ZLL A;  3SWK A;  2WSE J;  3SWF A;  1SQQ D;  4K35 A;  2KLU A;  4GOE A;  4R4L A;  4UB8 H;  2NRG A;  3HD7 B;  3E1R A;  3AE6 C;  4AYC A;  4I7Z C;  1VQK P;  1KYO E;  2AXC A;  4PV1 D;  1YQ4 C;  4AUW A;  5AVW B;  3ABV C;  1KOR A;  1NTM K;  1IK7 A;  3MHV A;  1L0L E;  1BGY D;  1L4A C;  1GMJ A;  5M1B A;  3PH0 A;  3MTU E;  3FWL A;  3V2P A;  2GUS A;  3H1L D;  1JY3 O;  1N73 B;  1NVO A;  1BDC A;  1L0N G;  2XV5 A;  2AEJ A;  2QJK C;  1S9K E;  1QL2 A;  2WQY C;  3SFD C;  1SQB K;  1SQV G;  2UWJ E;  3P7K A;  5KJ7 D;  2J59 M;  1RF1 B;  1S5L X;  1PGJ A;  2WSC H;  2H43 A;  4YPC A;  2M0B A;  2IX7 C;  2QVA A;  3TK1 A;  1GL2 B;  1Q90 D;  3II6 A;  3Q5S A;  2D2C D;  1JB0 J;  1MUU A;  4JQ0 D;  4WY4 A;  1YJ9 P;  1R5L A;  5TIS E;  1OW6 A;  3KZI E;  3O8Z A;  1T6A A;  2FYZ A;  3GHG B;  1GU4 A;  4HYT B;  2QJP B;  1GK6 A;  3LIE A;  3FXD A;  1SLQ A;  2QJY B;  1KV4 A;  1YYC A;  2ZT9 D;  2K1A A;  3D71 A;  2FFD A;  3CME P;  3AED C;  4JBZ A;  2HPC A;  1VQ4 P;  4WY4 C;  1PGP A;  2V7Q J;  3H32 A;  4Y99 C;  1NTZ G;  1YTZ T;  2JWD A;  3A2A A;  3CWB D;  2KLV A;  2KI7 B;  2Y0D A;  2YNY A;  5CBN A;  1SVF A;  3GW6 A;  1P84 E;  2R5B A;  1HF9 A;  3L37 A;  1ZRT D;  1JOC A;  4PD4 H;  4XFJ A;  2FFD C;  2B87 A;  4U3F G;  5KAI E;  2M3E A;  5L8R J;  2P7J A;  1S72 P;  5EFW B;  1YIT P;  4GOD A;  5AVZ B;  3BVH A;  2JKV A;  2XZR A;  3E7K A;  5E79 E;  1HTL C;  2W6B A;  3RK2 C;  3CC2 P;  3E1I A;  4B86 A;  1FDI A;  1J2J B;  3D6Y A;  1SQP E;  1Q7Y Q;  4H13 C;  1LTJ A;  3UIA A;  1KC8 Q;  1H88 A;  1KZU B;  2E76 C;  3GMA A;  3VYI A;  2H8P D;  1HBW A;  1M57 D;  1IFI A;  2N1T C;  2KZJ A;  1JO5 A;  1T3U A;  4H0L B;  4W7Y A;  1FJP A;  1OXZ A;  3RL0 C;  1YQ3 C;  1JY2 N;  1N7S D;  2B88 A;  1AVO A;  5DJU B;  3L75 G;  2G3A A;  1SQX E;  3CXH E;  1M1J B;  1GK4 A;  1KQG B;  2WPV B;  2PP6 A;  5KKZ B;  3L74 G;  3BAT A;  1DX7 A;  4IFF A;  2HOD A;  1NTZ K;  3SFE C;  3CCE P;  1QVF O;  3OJA B;  3GG2 A;  3L71 D;  2KK7 A;  3CC4 P;  2BCC E;  1PPJ E;  2A45 I;  1NTM J;  3KPE A;  3V4W A;  3L72 D;  2IDB A;  2LXC B;  3MZW B;  3T97 B;  1YHQ P;  3LID A;  2E5T A;  1EDL A;  2B89 A;  2KSJ A;  2W8Z A;  1IZN B;  3HE4 B;  1CI6 B;  1FAV A;  4UB8 E;  1T2K C;  1S1C X;  3L74 D;  2BAS A;  1KIL B;  2R3S A;  1GU5 A;  1JCC A;  4DT0 A;  3CI9 A;  1SQB J;  3HE5 B;  4W80 A;  4GKG A;  3KQG A;  3KYQ A;  1YIJ P;  1SQQ J;  1BCC D;  2A45 G;  1KTM A;  3BCC D;  3G71 P;  1WT6 A;  3WUT A;  1L4A D;  1G2C A;  4EYY Q;  2IFM A;  1M7L A;  2FKW B;  2M5A B;  1K73 Q;  1LTS C;  3H1H D;  2FBW C;  4IL6 H;  3CLQ A;  2Q9I A;  1CZQ A;  2WMM A;  2KNC A;  1NTM E;  1BGY J;  3MGN A;  2H89 C;  3G4S P;  1LTI C;  4ZKU A;  1H0T B;  3H1L J;  1N86 A;  2A06 G;  1YTZ I;  4D6T G;  1H89 A;  2KYV A;  4BRY B;  3A7O A;  2OTK E;  1J1E B;  1NYH A;  2GM4 A;  1SQB E;  4WB4 A;  1S3J A;  3QWO C;  2K37 A;  1J1D C;  1VF5 D;  2IZ1 A;  2JO1 A;  1N8R Q;  2MJZ A;  1FZE A;  3KHU A;  3AEF C;  1AV1 A;  5AW6 B;  1Q82 Q;  3CCL P;  2JDI H;  2A06 D;  4WVZ A;  2D2C B;  2KIK A;  2C0X A;  3GLM A;  2OYI A;  3L73 G;  3M0A A;  4RKU J;  4DCK A;  1JY3 N;  2HR3 A;  1K05 A;  2IBZ G;  3TYY A;  2C9L Y;  1G2C B;  5KLV D;  1OW8 A;  1S2E A;  1LT9 A;  1ZP0 C;  3H1I D;  3TGU D;  2WWW A;  4N78 E;  3H1K G;  4PD4 E;  3KDP B;  2ZT9 B;  3M06 A;  3QH9 A;  4HB1 A;  3CD6 P;  1A02 F;  3CWB J;  1HVV A;  3RK3 C;  3L73 D;  5GTH E;  4KT0 J;  4QMA A;  1IFM A;  1NO4 A;  4A7P A;  1NAY A;  4OWF A;  3F89 A;  1OVV A;  2A45 H;  3PP5 A;  5CMZ A;  1RHZ B;  2YIU B;  1E5W A;  1LT9 C;  1AJY A;  3CX5 D;  3H1K D;  1KB9 H;  1KMI Z;  1L0N E;  2P1J A;  2OGU A;  2KS1 B;  2W27 A;  4N6J A;  3RK2 D;  1QEX A;  4UB6 H;  2XKM A;  1QVG O;  1NTZ J;  3V5B A;  2ZAE B;  4H13 D;  1SQV E;  5APV A;  3M9B A;  3EQ2 A;  5K5G B;  1NKZ B;  1FZG A;  3G3Z A;  3VMA A;  1SQQ G;  3L70 D;  3B5N A;  5BU5 A;  4RJT A;  3HD7 C;  2JR8 A;  2KOG A;  1URQ B;  4C7N B;  2YMK A;  4NPD A;  4U3F J;  1SFC B;  2Z4E A;  5BVZ A;  1CSB A;  1M90 Q;  2W90 A;  5AVU B;  5AVV B;  1JMM A;  2WSF H;  4DOJ A;  2LR2 A;  1BGY G;  5AVY B;  1N7S B;  3CCM P;  3Q5R A;  2XDJ A;  3VMY A;  3B5N C;  1L2P A;  2DW3 A;  1IFP A;  3H1L G;  2QA4 P;  1FZC B;  2P2U A;  3H25 A;  3RK3 E;  1NTZ E;  2Q5U A;  1T2K D;  3L71 J;  1FZF A;  2QM8 A;  5TJH A;  4AQR D;  1N2D C;  5APS A;  4C46 A;  1KN7 A;  3P32 A;  4L73 A;  5B66 H;  3L75 J;  3JCU H;  2E75 C;  2WPQ A;  1GL2 C;  5GTI H;  1LP1 A;  2IZ0 A;  3L74 J;  2FYU D;  4NPE A;  1JY2 P;  2SPZ A;  4U3F E;  3I5C A;  1PP9 D;  4JF7 A;  3CMA P;  3VN0 A;  1BDD A;  2ZYG A;  1YJW P;  1NTK D;  4HKZ H;  1EZV I;  4IL6 E;  5DJT B;  1SQQ K;  3M9H A;  1SP4 A;  1BCC J;  4PJ0 H;  2QJP C;  3BCC J;  3R4Y A;  2HFE D;  1RE3 A;  4GT1 A;  1L4A B;  4EI2 A;  3OW2 O;  1YJN P;  2P10 A;  3CWB G;  3H1H J;  1IFJ A;  1VQ8 P;  3N7N A;  3HTK A;  1CW5 A;  3L75 E;  1LGH B;  2OAR A;  3CCS P;  2AEF A;  3L74 E;  2C0W A;  1OMI A;  1JNM A;  4IOI H;  1Z56 A;  2YO3 A;  2PAJ A;  3ITK A;  1RE3 C;  1LJ2 A;  2WPR A;  3BRT B;  3AEE C;  2JJL A;  4OH8 B;  3A3Y B;  1YI2 P;  3H1J D;  3Q2Y A;  2FXO A;  1EZV D;  2QG4 A;  2ZYD A;  3GF3 A;  2FXM A;  1FDM A;  2FYN B;  1H8A A;  2E74 D;  1VF5 B;  1USD A;  1GD2 E;  3Q3D A;  5CCG A;  3V6I A;  3B8E B;  4D6T J;  4TLF A;  4I6M C;  1X0T A;  2N1T A;  5GTH H;  1VQM P;  4RO0 A;  2Q7C A;  2WVR A;  5AW9 B;  2WSF J;  4OGQ D;  1U7J A;  2OTJ P;  1BSN A;  4WY4 B;  1URQ D;  4Y99 B;  3H1I J;  3S9O A;  1LT1 A;  3TGU J;  2NPS A;  1SFC D;  5KLI C;  1HGZ A;  1KB9 E;  2YKP A;  5CCG C;  1BSH A;  1L0L D;  1VQL P;  2Y9Z A;  4UB6 E;  3L73 J;  3L36 A;  2IYO A;  3L71 G;  1OIP A;  1FOS F;  1FZA A;  2FFD B;  2IFN A;  1AA0 A;  2K9J A;  4DZO A;  2HPC B;  1WRG A;  3L72 G;  4M3L A;  5APX A;  3S4R A;  2YXR B;  1FZB A;  2AXT H;  1JY3 P;  3H32 B;  1AFO A;  1S9K D;  1DIP A;  3H1K J;  3D6Z A;  4EDF A;  2YMY A;  2NPS C;  1DD4 A;  2K88 A;  2A06 E;  3O6Q A;  1LWU A;  1ZN5 A;  1KIL C;  4D6T E;  3U1A A;  4YXD C;  1TU3 F;  2HG5 D;  4KHX A;  3RK2 B;  1LNQ A;  5CJ0 A;  4H13 B;  2I1K A;  1LTT C;  1DH3 A;  1QGK B;  4HJG H;  1BCC G;  2B87 B;  2BEQ D;  1KFN A;  3L70 J;  4YTP C;  1SS1 A;  3TGU E;  1UIX A;  3ZDM A;  2HYN A;  3BCC G;  1HWT C;  1VL2 A;  1MKM A;  2B9B A;  3RL0 B;  1ZR4 A;  1LWU C;  3K5B A;  2QEX P;  4PV1 C;  3B5N D;  1X8Y A;  4I2L C;  3L73 E;  2XND H;  2R32 A;  3NFQ A;  1FBM A;  4H44 C;  3H1H G;  3V2N A;  2QRX A;  1M56 D;  2IBZ E;  2QIW A;  1VQO P;  1PV3 A;  4IL6 X;  1LTJ B;  2O01 H;  5B66 E;  2N9B A;  3JCU E;  1WMK A;  3H1K E;  5GTI E;  1PGQ A;  1ZV8 A;  3PHL A;  1GW3 A;  2OYO A;  1VPC A;  3AE5 C;  2E75 D;  1EDK A;  1MV8 A;  5B5E H;  2XNX A;  1KQS O;  1Y47 A;  1M1K Q;  2KB7 P;  2RMZ A;  2CK3 H;  1ZME C;  3NXS A;  2HOD B;  4ASV A;  3L70 E;  4PJ0 E;  2WT7 A;  1KIL E;  3B4S A;  3P8C D;  1T8Z A;  1PP9 J;  2D2C C;  3U59 A;  3CC7 P;  3H6P A;  1W2B O;  1SQP D;  4DJG A;  2PGD A;  5AW7 B;  2OYH A;  1SQQ E;  3CX5 I;  5KLV G;  4BWN A;  3USS A;  2O1J A;  3H1I G;  3TGU G;  3CCJ P;  1NWQ A;  5CCH A;  1GW4 A;  2ZT9 C;  1USE A;  2GUV A;  3EWK A;  4R4M A;  3WUU A;  1SQX D;  1RF0 A;  1BGY E;  3V2Q A;  2L5G B;  3HUS A;  4WY4 D;  2OYH C;  2E5Y A;  1FC2 C;  2YIU C;  4LC1 A;  1S4X A;  3AE2 C;  3H1L E;  3FX0 A;  2KNC B;  5CCH C;  5C39 A;  2BCC D;  4JYB A;  1PPJ D;  1XTG B;  4ZKP A;  1PZQ A;  1J1D B;  3TNU A;  1SQP K;  3HRN A;  2W6A A;  2H7H A;  3U1C A;  1MFT A;  1OWA A;  2J58 A;  1RF0 C;  3FXE A;  3BAS A;  1K8A Q;  3HUS C;  3FWN A;  1X79 B;  1PIX A;  2Y9Y A;  1GDT A;  3L70 G;  3HD7 A;  3LW5 J;  1AQT A;  1OX3 A;  5CBO A;  1EXI A;  1PFI A;  3C1L A;  1EC5 A;  1OW7 A;  2E74 B;  1DEE G;  2IPP A;  2KSE A;  1OZH A;  4C7R A;  3D70 A;  3VMX A;  2R5D A;  2QE7 H;  1HUC A;  5KLV K;  1D7M A;  2E76 D;  2ZXE B;  3RBX A;  2N1T D;  2O01 J;  1N7S C;  4OGQ B;  4ASW A;  1VQ7 P;  4L75 A;  2OYI B;  2KUB A;  3RL0 D;  1ZR2 A;  2AXT E;  2WPS A;  2RH0 A;  2JEE A;  4CPG A;  1R8E A;  1N73 A;  3PJS K;  1PL5 A;  2RN0 A;  2KZI A;  2Q1K A;  3CWB E;  2ZJS E;  4PD4 I;  2JP3 A;  2NPS D;  1LT9 B;  2AEM A;  4GIF A;  5AVT B;  3CL3 D;  3EFF K;  4N3Y B;  1KQL A;  1RF1 A;  4U7J A;  3WU2 H;  1Q81 Q;  1GL2 A;  1ZRT E;  1PGO A;  1MFZ A;  2FYU G;  1LTG C;  3JSV C;  5CJ4 A;  2BEZ F;  1OFC X;  1BE3 G;  1N73 C;  1PP9 G;  1ZW0 A;  3CPW O;  2ZVN B;  3KXD A; 
#chains in the Genus database with same CATH homology
 3MUD A;  2WZ7 A;  3GHG A;  1SFC A;  2FXM A;  1GU5 A;  1RE4 A;  1FDM A;  3NMD A;  1JCC A;  1H8A A;  1RF1 C;  1G1J A;  3CI9 A;  1GD2 E;  3A5T A;  2YO2 A;  1A02 J;  5AW8 B;  3C9I A;  2E42 A;  4O9B A;  5CCG A;  1NKN A;  1N7L A;  3B8E B;  2WT7 B;  4I6M C;  3HE5 B;  5APY A;  4W80 A;  2POH A;  4GKG A;  3KQG A;  2N1T A;  5AVX B;  3KYQ A;  3MD0 A;  5AVS B;  2M8R A;  1N7S A;  2C9N Y;  2A45 G;  4LLH A;  3MIW A;  4LGD E;  2Q7C A;  2OYI C;  5AW9 B;  1WT6 A;  1URQ C;  1L4A D;  1G2C A;  4WY4 B;  3B5N B;  1FZC A;  5APU A;  1URQ D;  3GHG C;  4Y99 B;  1SFC C;  2IFM A;  1M7L A;  4XA4 A;  1T3J A;  1FU1 A;  2FKW B;  1RE4 C;  2NPS A;  2OYH B;  4N78 D;  1SFC D;  1SQX K;  1HGZ A;  1LTS C;  1DEB A;  3CLQ A;  2Q9I A;  1AQ5 A;  1CZQ A;  2YKP A;  5CCG C;  1JUN A;  5CCG D;  3V2R A;  3MGN A;  4I1L A;  3L36 A;  1FOS F;  1LTI C;  2Q3I A;  1FZA A;  4EIJ A;  4ZKU A;  2FFD B;  2IFN A;  2ZFC A;  4DZO A;  3BRV B;  3RK3 B;  5BU8 B;  5AW3 B;  1WRG A;  2HPC B;  3V4Q A;  2E43 A;  4M3L A;  5APX A;  2WIT A;  1N86 A;  1YTZ I;  1FZB A;  1FZC C;  1JY3 P;  3H32 B;  1AFO A;  3HUS B;  5CHX A;  1S9K D;  1H89 A;  2KYV A;  3A7O A;  2YMY A;  2NPS C;  1J1E B;  2R3C A;  5AVR B;  1EQ7 A;  5APQ A;  1LWU A;  1ZN5 A;  1KIL C;  3VP9 A;  2GM4 A;  2FYU K;  1IJD B;  4JYC A;  3U1A A;  4WB4 A;  1LTB C;  2HG5 D;  1KIL D;  5AW5 B;  1NAF A;  4KHX A;  3RK2 B;  1GTW A;  1LTA C;  1J1D C;  5CJ0 A;  1JCD A;  2I1K A;  1LTT C;  1DH3 A;  3P8M C;  3M91 A;  2MJZ A;  1FZE A;  3TNU B;  1FJK A;  5AW6 B;  1NTK K;  2LKM A;  5APW A;  5AW0 B;  1KFN A;  5AW2 B;  2QM7 A;  2C0X A;  1L4A A;  2OYI A;  2HYN A;  3N4X A;  1ZLL A;  2O1K A;  1HWT C;  5APT A;  3RL0 B;  3SWF A;  1ZR4 A;  3M0A A;  3OA7 A;  1JY3 N;  3HD7 B;  1LWU C;  3EFG A;  1M1J A;  4AYC A;  3B5N D;  1X8Y A;  4I2L C;  3TYY A;  2C9L Y;  1G2C B;  2R32 A;  3NFQ A;  1FBM A;  3V2N A;  1LT9 A;  4AUW A;  2WWW A;  4N78 E;  1LTJ B;  2O01 H;  5AVW B;  3KDP B;  3M06 A;  4HH2 A;  1NTM K;  2N9B A;  1G1I A;  5CCH D;  1W2E A;  1L0N K;  1L4A C;  1A02 F;  1HJB A;  1HVV A;  1ZV8 A;  3RK3 C;  3T97 A;  1GW3 A;  2HLO A;  1HGV A;  3MTU E;  3HE4 A;  3RK3 D;  1IFM A;  1VPC A;  1NO4 A;  1NU1 K;  1CI6 A;  3V2P A;  1JTH A;  2GUS A;  3P8C E;  1M1J C;  1SQV K;  1MV8 A;  2M3B A;  2A45 H;  2XNX A;  4XE5 B;  3PP5 A;  1JY3 O;  3R2P A;  1N73 B;  5CMZ A;  2XV5 A;  1KIL A;  1IFD A;  1E5W A;  2KB7 P;  1S9K E;  1LT9 C;  3HTK B;  2I1J A;  1QL2 A;  3NXS A;  2HOD B;  1SQB K;  2P1J A;  2CPB A;  3IFM A;  5AVQ B;  3RK2 D;  2W27 A;  3P7K A;  4N6J A;  5KJ7 D;  2WT7 A;  2J59 M;  2XKM A;  1RF1 B;  3V5B A;  3HE5 A;  3P8C D;  2WSC H;  2H43 A;  2IX7 C;  1T8Z A;  5APV A;  3M9B A;  3TK1 A;  1GL2 B;  3II6 A;  3EQ2 A;  1NKZ B;  1FZG A;  3U59 A;  3G3Z A;  3H6P A;  1MUU A;  4WY4 A;  3B5N A;  2Z5I A;  5BU5 A;  3HD7 C;  2KOG A;  3VMZ A;  3O8Z A;  1URQ B;  4C7N B;  3M0D A;  5AW7 B;  3WMM 0;  3HD7 D;  2OYH A;  2FYZ A;  4RES B;  4IFM A;  3GHG B;  1SFC B;  2Z4E A;  1GU4 A;  4HYT B;  5BVZ A;  2O1J A;  1CSB A;  2P67 A;  1GK6 A;  3LIE A;  1LTJ C;  1NWQ A;  5AVU B;  2Z5H A;  5AVV B;  5CCH A;  2YKO A;  1GW4 A;  1JMM A;  5AW4 B;  1SLQ A;  3LW5 H;  2WSF H;  4IFD K;  4DOJ A;  2WTY A;  1YYC A;  2N1T B;  2GUV A;  2FFD A;  5AVY B;  3M9Q A;  2VRS A;  2HPC A;  1N7S B;  1L0L K;  2XDJ A;  1RF0 A;  3VP8 A;  3VMY A;  4WY4 C;  1MZ9 A;  3B5N C;  2XU6 A;  3H32 A;  3IR9 A;  4Y99 C;  1YTZ T;  2L5G B;  3HUS A;  3V2Q A;  4WY4 D;  3M0D C;  3A2A A;  2KP8 A;  2OYH C;  2KLV A;  1FZC B;  2P2U A;  3OAK A;  1JTH B;  2YNY A;  1SVF A;  4LC1 A;  2NPS B;  5AW1 B;  2Q5U A;  1T2K D;  1IFN A;  1FZF A;  5KJ7 A;  2R5B A;  2QM8 A;  3L37 A;  4AQR D;  5CCH C;  4JYB A;  1N2D C;  1IC2 A;  1NOH A;  5APS A;  1JOC A;  4C46 A;  1XTG B;  4ZKP A;  2YKQ A;  3P32 A;  2FFD C;  1J1D B;  3TNU A;  1SQP K;  3HRN A;  2W6A A;  2WPQ A;  2H7H A;  3U1C A;  1OWA A;  2J58 A;  1GL2 C;  1RF0 C;  1JY2 P;  3BAS A;  1GL2 D;  2P7J A;  3HUS C;  5KTB A;  1X79 B;  3L35 A;  1J1E C;  3I5C A;  1GDT A;  5AVZ B;  3HD7 A;  3BVH A;  4JF7 A;  3VN0 A;  2XZR A;  1HTL C;  2W6B A;  1LWU B;  3RK2 C;  1PFI A;  5KJ7 C;  3E1I A;  2IPP A;  4B86 A;  1J2J B;  3L4F A;  4EOT A;  1SQQ K;  4C7R A;  3M9H A;  1SP4 A;  1NHL A;  1LTJ A;  3UIA A;  3VMX A;  1X9V A;  2R5D A;  1H88 A;  1HUC A;  1KZU B;  3VYI A;  2H8P D;  2WSE H;  1IO4 A;  1HBW A;  3NTN A;  3SWY A;  5KLV K;  1IFI A;  2N1T C;  1JO5 A;  1IK9 A;  1T3U A;  2HFE D;  2ZXE B;  4W7Y A;  1FJP A;  1RE3 A;  2N1T D;  4GT1 A;  1N7S C;  1OXZ A;  3RL0 C;  1XTC C;  1L4A B;  2OYI B;  1JY2 N;  1N7S D;  3RL0 D;  1ZR2 A;  2WPS A;  4WBA A;  2JEE A;  1IFJ A;  1N73 A;  1M1J B;  1GK4 A;  3VOP A;  3N7N A;  2PP6 A;  3HTK A;  3BAT A;  1DX7 A;  1KFM A;  1CW5 A;  4IFF A;  2HOD A;  1NH4 A;  2NPS D;  1LT9 B;  1NTZ K;  2CPS A;  1LGH B;  2OAR A;  4GIF A;  5AVT B;  3CL3 D;  3OJA B;  4N3Y B;  1KQL A;  2C0W A;  1GZL A;  1JNM A;  4W7Z A;  1RF1 A;  1Z56 A;  2YO3 A;  2PAJ A;  1RE3 C;  1RY3 A;  3VTP C;  2WPR A;  1GL2 A;  1VDF A;  2A45 I;  3KPE A;  3V4W A;  1MFZ A;  3BRT B;  3TSI A;  1LTG C;  2JJL A;  4OH8 B;  3A3Y B;  3LID A;  1HH0 A;  2KSJ A;  5CJ4 A;  1QL1 A;  3HE4 B;  1JY2 O;  1FOS E;  1CI6 B;  1FAV A;  1N73 C;  1T2K C;  1URQ A;  4C7N A;  2BAS A;  1KIL B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...