2HFED

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
DLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 18
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hfeD00
2N1TB 4LGDE 3KYQA 1L4AB 1GL2C 3B5NA 1SFCD 5CCHD 4WY4C 3HD7A 2NPSC 3RK3C 2HFED 1KILB 4W7ZA 1XTGB 1URQB 3PP5A 3RK2D 1GL2D 3TSIA 2NPSD 3RK3D 4OH8B 1N7SC 3VOPA 3M0DC 2KOGA 4JF7A 3HD7C 5CCGC 1JTHB 5KJ7A 1KILA 3RK2B 2XDJA 1N7SD 3P8CE 3RK3B 1NHLA 3B5NC 2N1TA 2H8PD 3HD7D 4WY4D 1T3JA 5CCGD 4W7YA 3RL0C 2PP6A 2HG5D 5CCHA 1L4AA 1SFCB 4N78E 1HVVA 1JTHA 2N1TC 3B5ND 1N7SB 1URQA 1L4AC 1GL2B 3RL0D 2WZ7A 4WY4B 3HD7B 2NPSB 5KJ7C 1KILC 2N1TD 3RK2C 1URQC 1SFCA 3HTKB 2M8RA 1L4AD 3B5NB 3RL0B 1N7SA 2YMYA 1GL2A 1SFCC 5KJ7D 5CCHC 1KILD 1URQD 4WY4A 4W80A 2NPSA 5CCGA
chains in the Genus database with same CATH superfamily
2R5DA 2K3RA 1BSNA 1BE3D 1GU5A 1EC5A 1QX8A 1KQFB 1L4AB 3U59A 1AVYA 1X79B 4YXDC 1T3UA 1CSBA 2BASA 1IK7A 4XA4A 2H43A 1HUCA 1KB9D 4I7ZC 1YJWP 3L72D 3CXHI 1U7MA 1OX3A 2ZFCA 4JYCA 1H88A 3H1KJ 1RF1C 5CBOA 3JCUE 1S4XA 3RK2B 4AQRD 1NTZD 2KI7B 2H8PD 2O01J 1T3JA 3RL0C 1BE3J 3C9IA 1VF5D 3AE2C 3K5BA 1H0TB 2WSFH 1N7LA 1JMMA 3CCQP 3L74E 2E76B 1N73C 2P2UA 1SQBD 1URQA 2QA4P 3HUSA 1LT9A 3AEBC 4XFJA 1KD1Q 3P8MC 3L72J 1LTIC 1SQQK 3U1CA 1LNQA 1K8AQ 5B66E 1DD4A 2YIUC 2KXPB 1NTZG 5AW6B 3V2NA 1RF1A 1NTZJ 1PGOA 3EQ2A 2WPSA 1M56D 4GDOA 5AW5B 2E75C 5KLIB 2GA1A 1BSHA 1BGYE 2QJYB 1BCCG 2NPSC 1LP1B 2DW3A 1JB0J 1JY3O 3FX0A 3RL0g 1VQ4P 2KP8A 1SQBJ 4ZMDA 3EWKA 1NTKD 3G71P 4I1LA 1AFOA 3G6EP 1M1JB 1S5LX 3CX5I 3V2PA 1MZ9A 2OGUA 4KJMA 2G3AA 3GLMA 2HLOA 2QRXA 3LIEA 4PV1C 3B5NC 5KAIE 1J1EC 2XV5A 2KS1A 1JY2P 3N7NA 4YXWH 1IO4A 3Q5SA 1FZCC 1Q86Q 4Y99C 1NTKG 3RL0D 1OZHA 1D7MA 1NTKJ 1MFTA 4L74A 5APTA 1EDKA 3TK1A 2ITAA 3L4FA 3NXSA 4DOJA 3LIDA 2WITA 2C0XA 1LGHB 2KSEA 1IFNA 2QVAA 3CMEP 2KLUA 1CI6B 4LGDE 1T8ZA 3H1JE 2B88A 1QLED 5AW9B 2UWJE 1FC2C 1L0ND 4BXLA 3B5NA 5CBNA 1QL2A 3BVHA 1EXJA 3NFQA 4AYCA 3Q5PA 2E75D 3L36A 5APVA 1PP9E 1NTME 1FZCA 1KN7A 2NPSD 1Y47A 1RQUA 1S5LE 3TYYA 2WQYC 3MP7B 5CCGC 3RGUA 3MHVA 2RKLA 5KLVG 3H1ID 2MKVA 4WWIA 2J58A 1L0NG 4L75A 1L4AA 3L74G 3Q3DA 4BRYA 4PV1D 1QGKB 1PZQA 3H1HE 2N1TC 3B5ND 2FYUE 4DZOA 4IFMA 4PJ0H 2WSFJ 3PHLA 1SQPE 3VMAA 3RBXA 3T97A 2D2CB 5KJ7C 1VF5B 2O1KA 1QVGO 1FJKA 2GUSA 2C9NY 1LWUC 1SQXE 3BRVB 2RMZA 3L71G 1ZW0A 4UB6E 1YIJP 1SFCC 2IFMA 2NRGA 5CCGA 1R8EA 2BCCD 3H1IJ 3A0BE 5AVTB 1PPJD 3L35A 3D6YA 2E5TA 1VQ8P 3L70E 2SPZA 1NO4A 3TGUE 1OVUA 1USEA 3MZWB 1NU1G 3AE7C 1KTMA 2WSEJ 2YXQB 3CXHD 1JCCA 2R44A 2CPBA 1IK9A 5AW3B 4KHXA 5KLVK 2HODA 2XZRA 4C7NB 1N2DC 5AVSB 1NAYA 3WU2E 5KJ7A 2JEEA 1CZQA 3HUSB 1SQVG 3L73G 1PPJG 4ASVA 1KYOE 5CCGD 2YXRB 1FE6A 2BCCJ 1RE4C 2KNCA 1KZUB 1ZN5A 5H2FE 2A06D 1HJBA 1ZXGA 3GHGC 1KV4A 4I7ZB 3V4QA 2XNDH 2W6JH 1RF0C 2O01H 5DJTB 2Q1KA 1SLQA 1RE3C 1T2KC 1S1CX 3OAKA 1A02J 2YNYA 1RF1B 1G1JA 5AW4B 1M1JA 3V5BA 1K04A 4YPCA 2N1TD 3P32A 1HWTC 1JMBA 3SSUA 3H1KE 2JR8A 3KZIH 2IX7C 2ZXEB 4UB8H 3FXEA 3RL0B 5KJ7D 1KB9H 2E74D 3E7KA 2LR2A 5KAFE 2Q7CA 2IZ0A 1NYHA 1BE3E 3HE5B 1NU1K 2OARA 2LKMA 1SFCD 1YQ4C 2M3BA 2WSCJ 4EIJA 1VQPP 5B5EE 1VQKP 1HGVA 3GHGA 3TSIA 3L37A 1GW3A 1KB9E 4OH8B 3SFDC 2FFDA 3L72E 1PGPA 1GW4A 3U1AA 5AVWB 2KS1B 1OMIA 2WMMA 1ZV8A 2E75B 1OWAA 5TJHA 1PGJA 1S9KE 1NJIQ 1M7LA 5K5GB 3A2AA 2PP6A 1UIIA 4XE5B 5GTHH 1GK6A 4I6MC 1Y9BA 2M3EA 1H8AA 3BCCD 1ZOYC 3VP9A 3EFGA 1SQBE 1X0TA 5BVZA 2Q3EA 3A7OA 1S3JA 1SQXG 1SQQD 4PV1B 2Z5IA 2K9YA 1NGMB 2P1JA 1EXIA 3B5NB 1T2KD 1M8OB 3H1LE 1OW7A 4OGQC 2P67A 1U7JA 1ZRTD 1MFZA 2JO1A 3B71A 4EOTA 1FZCB 4Y99B 4QMAA 1DIPA 4EYYQ 3SWYA 3CC2P 4PD4E 1GL2C 1L2PA 2Y9ZA 4D6TE 4RJTA 3AEDC 3BCCJ 1YYCA 1AV1A 3O8ZA 4L76A 1SVFA 1X22A 3M91A 2QM7A 1SQQJ 2H7HA 3KQGA 1VL2A 2VRSA 4BRYB 3HD7C 2R3SA 1P84D 5GTIE 1GK4A 1Y8AA 3H6PA 3P8CD 5CJ4A 1SQPK 3T97B 4W7YA 2ZYDA 4WBAA 3UIAA 1SQXK 2QG4A 1VQ7P 1W2BO 3E1IA 1EDIA 1UIXA 1OFCX 1M1KQ 3LW5J 5CHXA 3D6ZA 4IFDK 4C7NA 3C8VA 1BCCD 1QEXA 2QJPC 3H32A 4EDFA 3HD7A 3QWOC 1DX7A 2Y0CA 2QSIA 1QVFO 2N1TB 3KYQA 4RESB 4JQ0D 4OGQD 2Y9YA 4H13C 2HODB 4WY4C 2J5UA 1SP4A 2YMKA 2E74B 3N4XA 4K3AA 1NOHA 2A45I 1GL2D 4C7RA 1KQGB 3TNUA 2KNCB 4H44B 5CMZA 1FOSF 1L0LE 4JYBA 2WSEH 4U7JA 2OQQA 1BCCJ 4GOEA 3WUUA 2Q9IA 2GUVA 4KT0J 2K37A 2ZT9B 3HD7D 1N73A 1J1DB 3HE5A 3RK3E 4R4LA 3CCMP 3HRNA 1IFIA 4HJGH 3ZDMA 5DJUB 3KXDA 1LTBC 1FZBA 3CWBG 3D71A 4U3FE 2OYIC 1JCDA 1JY3P 2OYHC 2GM4A 3AE3C 2KIKA 2R32A 2AXTH 3CXHH 3FWNA 2NPSA 3GHGB 1M90Q 3CMAP 1BDCA 2BCCE 2FFDB 3MTUE 5AVUB 1E5WA 4IL6X 5AW1B 4D6TG 2K9JA 2WWWA 1LTAC 1XTGB 3PP5A 3GF7A 1IFPA 4DT0A 1KYOI 4H13D 5KLVD 1N86A 2WSCH 3L75E 1JM0A 3L74D 2OYIA 2QIWA 2W27A 5TISH 3S9OA 3JC22 4L73A 3I55P 1SS1A 5AW7B 2R3CA 2V7QH 2A06E 2XU6A 3ABVC 2P10A 3WMM0 1JOCA 3L71D 1R5LA 5TISE 1ZR2A 1OVRA 1JO5A 4IL6H 2IYPA 3RK2C 5KLVJ 3CI9A 1BGYD 2KB7P 4Y28J 1K05A 3QH9A 2KZIA 1L0NJ 3L74J 4HKZH 2YMYA 1U57A 1NU1D 2IPPA 1KB9I 2E76C 3CX5H 4IL6E 2XNXA 1GTWA 3V4WA 5APQA 2QJKB 3S1KA 3L71J 2OTLP 4PJ0E 1BGYG 3IAOA 1YITP 1SQVD 4JPZB 3L73D 1L0LG 3W68A 1PIXA 1FDIA 1M57D 2E43A 3BASA 1LTJC 1OIPA 1GMJA 3RBZA 3IF4A 2B9BA 2QJYC 1LJ2A 3VYIA 4RKUJ 4R4MA 2WPQA 1NU1J 2N1TA 1RH5B 1JUNA 1LTSC 4EI2A 2W90A 3MUDC 3M9QA 1KQSO 2QEXP 2K88A 2W6AA 3GMAA 1EZVE 4U3FG 3H32B 1LWUA 2WZ7A 1A02F 1GZLA 2XKMA 5BU5A 3HD7B 3H1JD 2OYOA 1KILC 4PD4I 1SFCA 3CCEP 2KK7A 2W83C 1SQVJ 3L73J 4OWFA 3OW2O 1KMIZ 4DCKA 3O6QA 1OW8A 2IBZE 1LTJA 3LW5H 1ZLLA 3TNUB 2C9LY 1OVVA 1TU3F 4LC1A 3Q5RA 2HYNA 2N9BA 1P84H 2HFED 3MUDA 4HH2A 2E76D 1L0LK 3VMXA 4AUWA 3H1JG 5L8RJ 3AE8C 2HPCA 1YTZT 2FBWC 2QJPB 3AEGC 4ZKPA 1N73B 2AEFA 2BEQD 1YI2P 1YJ9P 3VOPA 3PTZA 3CCRP 3H1HD 3M0DC 5EFWB 1KILA 2CK3H 3KZIE 1PP9G 5KTBA 1SQPD 1RE4A 4UB8E 1NTMG 2XDJA 1DH3A 1FS0E 4K35A 3P8CE 1YQ3C 1DEBA 4OVNF 2YIUB 2KZJA 1RF0A 4N78D 2RN0A 1RE3A 1SQXD 3CLQA 3CX5D 2BEZF 2FYZA 3CC7P 3VMYA 3BRTB 3CCUP 2A45G 2LXBA 2V7QJ 3KHUA 2NPSB 1NTZE 4CPGA 5BU8B 5AW0B 3IN6A 4NPDA 3R2PA 3H1HG 2FYUG 3A3YB 2K9JB 2Q5UA 3AE5C 3G4SP 2B87A 2FXPA 2W8ZA 2R5BA 1SQPG 3H1HJ 3PLNA 4LLHA 3CL3D 5CCHC 1KILD 4M3LA 1SQPJ 1DEEG 3P7KA 3HTKA 1AJYA 3MD0A 1SQXJ 2KLVA 3PRJA 2OYIB 2WVRA 2D2CC 1FOSE 3G9RA 4B86A 4W7ZA 5GTHE 1J1EB 2I1KA 1VQOP 3H25A 1FU1A 3CCJP 2Y0DA 1HH0A 1KYOD 2OYHB 1IFDA 1NTMK 3L70G 3TGUG 4ZNCA 2KSJA 1FAVA 2W6BA 4O9BA 1VDFA 1GDTA 1HJ0A 4Z1MH 1Q81Q 1NTKE 1Q90D 2RH0A 5CCHA 3VP8A 1NVOA 2JP3A 1USDA 3AEAC 1EZVG 1NWQA 1EQ7A 2V4HA 1HF9A 1YHQP 2FYUK 2K1AA 3AEFC 4WB4A 5APXA 1KQLA 1URQC 3HUSC 1IFMA 2M8RA 1LT9C 3JCUH 4GT1A 2JWDA 4GODA 5CJ0A 2IBZG 1PV3A 1GL2A 3NMDA 3R4YA 2O3JA 2WTYA 1G2CB 4TLFA 3H1KG 2WPVB 5APYA 3CC4P 2AEMA 1HBWA 1K9MQ 5CCHD 1HGZA 4H0LC 1X8YA 3Q1MA 1IFJA 3SWKA 1IJDB 2G8YA 1HTLC 2Z5HA 2YO2A 1BE3G 1S9KD 2N9YB 5KLVE 2FKWB 2D2CD 5B66H 1KORA 1KFNA 1L0NE 1GU4A 3PH0A 3GW6A 1PGQA 1FBMA 3B8EB 1LWUB 3GF3A 1NHLA 3L72G 3CWBD 2KUBA 2HG5D 1SFCB 3CCVP 3M9HA 1LTTC 1LTGC 3H1LD 3EFFK 1JTHA 1MKMA 3AE9C 2P58A 2WT7A 3O6QB 3L71E 2B89A 1LTJB 2J59M 3H1IE 5KKZC 4PD4D 1N8RQ 1J2JB 1PFIA 1WT6A 1BDDA 1JY2O 2H89C 3SFEC 1SQBG 3JSVC 2O1JA 2Q6QA 4D6TD 1Q82Q 3F89A 1K73Q 1VQ5P 3A5TA 1X9VA 1FZAA 5KAIH 1URQD 1OW6A 4WY4A 1NU1E 2HPCB 4HYTB 3FGAD 3I56P 3D70A 3MGNA 3CWBJ 4A7PA 3H1LG 1KFMA 3RK3C 3H1LJ 2AEJA 1KILB 5AVRB 1ZR4A 4H0LD 1ZP0C 3A0HH 2L91A 1N7SC 1SQVE 3L73E 1PPJE 2Q3IA 2JKVA 2PRRA 1EZVI 4D6TJ 2I1JA 3AE4C 2YKOA 4I2LC 1NKZB 1VQMP 2AXTE 4WY4D 5AVQB 3ITKA 4ZKUA 1NTZK 1VPCA 2FYNC 3CXHE 3FXDA 3MIWA 3B4SA 3A0HE 1S2EA 2B87B 1MUUA 3W67A 3CCSP 1L4AC 2IBZI 2ZXXA 1AQ5A 2IYOA 2M5AA 2PAJA 1SQBK 1S5LH 2OYHA 1JNMA 3KDPB 3HTKB 1S72P 1FDOA 3AE6C 1YBKA 1RY3A 5C39A 3AECC 2YKPA 2WSSH 1N7SA 2A45H 4C46A 1G1IA 4GOFA 4W80A 2OTJP 1Q2NA 3V6IA 3WUVA 3HE4A 1MV8A 3C1LA 5AVZB 1L0LD 5AVYB 1P84I 1EDJA 2M0BA 2ZVNB 2FXOA 4ASWA 3RK3D 1IZNB 1NTKK 1WRGA 4UB6H 2AXCA 1EDLA 3E1RA 1W2EA 2PFXA 3Q2YA 4MN4C 1FZEA 1N7SD 3A0BH 4U3FD 4GIFA 2FY8A 3BATA 3NTNA 3S4RA 3WUTA 1NKNA 5AVVB 1G2CA 4N3YB 4OGQB 3USSA 2E74C 4N78E 3AE1C 3CX5E 1BGYJ 5APSA 4DJGA 5AW8B 1FZGA 1T6AA 1L0LJ 3CPWO 2YKQA 3H1IG 3CCLP 1GL2B 5KLIC 4H44C 3VN0A 3KPEA 1IC2A 3WU2H 1H89A 1H0TA 1L4AD 1R5SA 2ZT9C 1M1JC 1J1DC 1Q7YQ 3BCCE 1KYOH 1KILE 2Y0EA 3F5HA 4U3FJ 1DD3A 1FDMA 5H2FH 3L75D 1SQQE 3AEEC 1JY2N 1JY3N 2E42A 1VQ6P 5AVXB 1L0NK 2FXMA 3SWFA 1URQB 3TDKA 1LT9B 2BCCG 1E79H 1PP9D 1ZRTE 3RK2D 1NTMD 3FWLA 4TT3H 4HB1A 2JDIH 3PJSK 1GD2E 4JBZA 1LP1A 2KOGA 4JF7A 1FZFA 2POHA 2JWAA 5M1BA 2IDBA 1JTHB 1JEKA 2ZYAA 2HR3A 2FFDC 2WT7B 5AW2B 5KAFH 4H0LB 3L75G 1CW5A 3H1JJ 1NH4A 3M9BA 2CPSA 3L75J 4IOIH 2E5YA 1XTCC 5B5EH 2FYUD 1P84E 2QE7H 4NPEA 3VTPC 2I8DA 4H13B 4WY4B 1YJNP 2WPRA 1PP9J 1W5CE 1NTMJ 2A06G 2P7JA 1VQNP 3G3ZA 3CD6P 4H44D 2OTKE 5APWA 4RO0A 1PL5A 2C0WA 1OXZA 1YTZI 2PGDA 5E79H 1Z56A 2YO3A 3M06A 1WMKA 4GKGA 2LXCB 2ZT9D 2IZ1A 3M0AA 1SQVK 3L70D 1RHZB 3TGUD 2O01N 5KKZB 3V2QA 1BCCE 2FYUJ 2L5GB 2KYVA 3M0DA 2IFNA 1CI6A 1ZMEC 4YTPC 1AQTA 4BWNA 5E79E 2Z4EA 1NAFA 1RQVA 1VQLP 3V2RA 3VMZA 3IFMA 1LT1A 2MJZA 1EZVD 4IFFA 1VF5C 3I5CA 3RK3B 4PD4H 2M5AB 1VQ9P 3OJAB 2JJLA 4N6JA 3IR9A 3CWBE 2QJKC 1FJPA 1HVVA 2H88C 2QM8A 3TF5A 3L70J 2ZYGA 3OA7A 3TGUJ 1N7SB 2IBZD 1AVOA 4NPFX 3GG2A 3H1KD 2ZAEB 1QL1A 3HE4B 1AA0A 5GTIH 3BCCG 5APUA 1KC8Q 2FYNB 4WVZA 2NZ2A 2ZJSE 3II6A 1SQQG 2ZVOB
chains in the Genus database with same CATH topology
2R5DA 4HYTB 2Q7CA 1GU5A 3HE5B 1NU1K 1L4AB 2OARA 3MGNA 1KFMA 2XNXA 1GTWA 2LKMA 1SFCD 3U59A 2M3BA 3RK3C 1X79B 1T3UA 1CSBA 3V4WA 2BASA 1KILB 4EIJA 5AVRB 5APQA 4XA4A 2H43A 1HUCA 1HGVA 1ZR4A 3GHGA 3TSIA 3L37A 1GW3A 4OH8B 2FFDA 1N7SC 1GW4A 3U1AA 5AVWB 2Q3IA 3BASA 2ZFCA 2E43A 4JYCA 1H88A 1LTJC 1RF1C 1ZV8A 2I1JA 3RK2B 4AQRD 1OWAA 3VYIA 2WPQA 2YKOA 4I2LC 2N1TA 1JUNA 1NKZB 2H8PD 1S9KE 4WY4D 5AVQB 1T3JA 1LTSC 1M7LA 4ZKUA 3A2AA 1NTZK 1VPCA 3RL0C 2PP6A 3C9IA 3MIWA 3M9QA 4XE5B 1GK6A 1N7LA 2WSFH 1JMMA 4I6MC 1H8AA 1MUUA 1N73C 2W6AA 2P2UA 3VP9A 1URQA 3EFGA 1L4AC 3H32B 3HUSA 1AQ5A 1LWUA 2WZ7A 5BVZA 1GZLA 1A02F 1LT9A 2XKMA 5BU5A 2PAJA 3HD7B 1SQBK 3A7OA 2OYHA 1JNMA 1KILC 3KDPB 3P8MC 1SFCA 2Z5IA 3HTKB 2P1JA 1LTIC 3B5NB 1SQQK 1T2KD 3U1CA 1RY3A 2YKPA 2P67A 1N7SA 2A45H 5AW6B 4C46A 1G1IA 3V2NA 1LTJA 1MFZA 3LW5H 1RF1A 4W80A 4EOTA 1ZLLA 1FZCB 4Y99B 3EQ2A 2WPSA 3SWYA 3TNUB 2C9LY 5AW5B 1GL2C 4LC1A 2HYNA 3HE4A 1MV8A 2N9BA 2NPSC 5AVZB 5AVYB 1JY3O 2HFED 3MUDA 4HH2A 2KP8A 1L0LK 3VMXA 4AUWA 1YYCA 2HPCA 1YTZT 3O8ZA 1SVFA 4I1LA 1AFOA 3RK3D 1M1JB 4ZKPA 3M91A 1N73B 2QM7A 1NTKK 3VOPA 2H7HA 3V2PA 1WRGA 3KQGA 2VRSA 3M0DC 3HD7C 1MZ9A 1W2EA 1KILA 5KTBA 1RE4A 2XDJA 1GK4A 1DH3A 2HLOA 3LIEA 3H6PA 3P8CD 1FZEA 1N7SD 3P8CE 5CJ4A 4GIFA 3B5NC 3BATA 3NTNA 1SQPK 1NKNA 5AVVB 1DEBA 1G2CA 4N3YB 4W7YA 1J1EC 1RF0A 4N78D 1RE3A 4N78E 3CLQA 2XV5A 4WBAA 5APSA 1JY2P 3UIAA 2FYZA 3N7NA 5AW8B 1IO4A 3VMYA 1FZGA 1FZCC 1SQXK 3BRTB 4Y99C 2A45G 2YKQA 1GL2B 3RL0D 2NPSB 3E1IA 5BU8B 5AW0B 3VN0A 3KPEA 1IC2A 5CHXA 3R2PA 5APTA 1H89A 3A3YB 1L4AD 4IFDK 3TK1A 2Q5UA 3L4FA 3NXSA 4C7NA 4DOJA 2R5BA 1M1JC 1J1DC 2WITA 3LIDA 2C0XA 4LLHA 3CL3D 3H32A 5CCHC 1KILD 1LGHB 4M3LA 1IFNA 3HD7A 1DX7A 1CI6B 2N1TB 4LGDE 1T8ZA 3KYQA 1FDMA 4RESB 5AW9B 3P7KA 3HTKA 1JY2N 3B5NA 3MD0A 1QL2A 1JY3N 2HODB 4WY4C 2KLVA 2E42A 2OYIB 3BVHA 5AVXB 1SP4A 1FOSE 1L0NK 4B86A 2FXMA 4W7ZA 3SWFA 1J1EB 1URQB 3NFQA 4AYCA 2I1KA 3N4XA 1NOHA 1LT9B 2A45I 3L36A 3RK2D 1GL2D 5APVA 1FU1A 1HH0A 1FZCA 2OYHB 2NPSD 1IFDA 4C7RA 3TNUA 1NTMK 5CMZA 1GD2E 3TYYA 2KSJA 2KOGA 4JF7A 1FZFA 2POHA 5CCGC 1FAVA 1FOSF 1JTHB 4JYBA 2W6BA 4O9BA 2WSEH 1VDFA 2FFDC 2WT7B 5AW2B 1GDTA 2Q9IA 2GUVA 1CW5A 2J58A 3HD7D 1N73A 1J1DB 3HE5A 1NH4A 5CCHA 3VP8A 1L4AA 3M9BA 2CPSA 3HRNA 1NWQA 1EQ7A 1IFIA 1XTCC 2N1TC 3B5ND 4DZOA 4IFMA 1LTBC 3VTPC 2FYUK 1FZBA 4WY4B 2WPRA 4WB4A 2OYIC 3T97A 5APXA 5KJ7C 2O1KA 1KQLA 2P7JA 1URQC 1JCDA 3HUSC 1FJKA 1IFMA 2GUSA 1LWUC 2C9NY 2M8RA 1LT9C 3G3ZA 4GT1A 3BRVB 5APWA 5CJ0A 1JY3P 2OYHC 2GM4A 2C0WA 1GL2A 1OXZA 1SFCC 2R32A 3NMDA 1YTZI 2IFMA 2YO3A 1Z56A 2NPSA 3GHGB 3M06A 5CCGA 2WTYA 4GKGA 1G2CB 5APYA 2FFDB 5AVTB 3MTUE 3L35A 1E5WA 5AVUB 1HBWA 5AW1B 5CCHD 3M0AA 1HGZA 1SQVK 1X8YA 2WWWA 1LTAC 1NO4A 1IFJA 1XTGB 1IJDB 3V2QA 2L5GB 3PP5A 2KYVA 1HTLC 2Z5HA 2YO2A 3M0DA 2IFNA 1CI6A 1S9KD 1JCCA 2Z4EA 1N86A 1NAFA 2FKWB 2CPBA 2WSCH 1IK9A 5AW3B 4KHXA 3V2RA 1KFNA 5KLVK 2HODA 2XZRA 3VMZA 4C7NB 1GU4A 2OYIA 3IFMA 1N2DC 5AVSB 2MJZA 2W27A 5KJ7A 2JEEA 4IFFA 1FBMA 1CZQA 3B8EB 3I5CA 3HUSB 1LWUB 1NHLA 3RK3B 3OJAB 2JJLA 4N6JA 5CCGD 3IR9A 5AW7B 2HG5D 2R3CA 1RE4C 1SFCB 1KZUB 1ZN5A 1FJPA 3M9HA 1LTTC 1LTGC 1HVVA 2QM8A 1HJBA 3GHGC 1JTHA 2XU6A 3V4QA 3WMM0 1JOCA 3OA7A 2WT7A 1N7SB 1RF0C 2O01H 1SLQA 1RE3C 1T2KC 1ZR2A 3OAKA 1LTJB 1A02J 2YNYA 1RF1B 1G1JA 2J59M 1JO5A 5AW4B 1M1JA 3V5BA 1HWTC 2N1TD 3P32A 3RK2C 3CI9A 2KB7P 1J2JB 1QL1A 1PFIA 3HE4B 1WT6A 2IX7C 2ZXEB 1JY2O 5APUA 2O1JA 3RL0B 3A5TA 2YMYA 1X9VA 5KJ7D 1FZAA 1URQD 3II6A 2IPPA 4WY4A 2HPCB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2N1T B;  4LGD E;  3KYQ A;  1L4A B;  1GL2 C;  3B5N A;  1SFC D;  5CCH D;  4WY4 C;  3HD7 A;  2NPS C;  3RK3 C;  2HFE D;  1KIL B;  4W7Z A;  1XTG B;  1URQ B;  3PP5 A;  3RK2 D;  1GL2 D;  3TSI A;  2NPS D;  3RK3 D;  4OH8 B;  1N7S C;  3VOP A;  3M0D C;  2KOG A;  4JF7 A;  3HD7 C;  5CCG C;  1JTH B;  5KJ7 A;  1KIL A;  3RK2 B;  2XDJ A;  1N7S D;  3P8C E;  3RK3 B;  1NHL A;  3B5N C;  2N1T A;  2H8P D;  3HD7 D;  4WY4 D;  1T3J A;  5CCG D;  4W7Y A;  3RL0 C;  2PP6 A;  2HG5 D;  5CCH A;  1L4A A;  1SFC B;  4N78 E;  1HVV A;  1JTH A;  2N1T C;  3B5N D;  1N7S B;  1URQ A;  1L4A C;  1GL2 B;  3RL0 D;  2WZ7 A;  4WY4 B;  3HD7 B;  2NPS B;  5KJ7 C;  1KIL C;  2N1T D;  3RK2 C;  1URQ C;  1SFC A;  3HTK B;  2M8R A;  1L4A D;  3B5N B;  3RL0 B;  1N7S A;  2YMY A;  1GL2 A;  1SFC C;  5KJ7 D;  5CCH C;  1KIL D;  1URQ D;  4WY4 A;  4W80 A;  2NPS A;  5CCG A; 
#chains in the Genus database with same CATH topology
 2R5D A;  2K3R A;  1BSN A;  1BE3 D;  1GU5 A;  1EC5 A;  1QX8 A;  1KQF B;  1L4A B;  3U59 A;  1AVY A;  1X79 B;  4YXD C;  1T3U A;  1CSB A;  2BAS A;  1IK7 A;  4XA4 A;  2H43 A;  1HUC A;  1KB9 D;  4I7Z C;  1YJW P;  3L72 D;  3CXH I;  1U7M A;  1OX3 A;  2ZFC A;  4JYC A;  1H88 A;  3H1K J;  1RF1 C;  5CBO A;  3JCU E;  1S4X A;  3RK2 B;  4AQR D;  1NTZ D;  2KI7 B;  2H8P D;  2O01 J;  1T3J A;  3RL0 C;  1BE3 J;  3C9I A;  1VF5 D;  3AE2 C;  3K5B A;  1H0T B;  2WSF H;  1N7L A;  1JMM A;  3CCQ P;  3L74 E;  2E76 B;  1N73 C;  2P2U A;  1SQB D;  1URQ A;  2QA4 P;  3HUS A;  1LT9 A;  3AEB C;  4XFJ A;  1KD1 Q;  3P8M C;  3L72 J;  1LTI C;  1SQQ K;  3U1C A;  1LNQ A;  1K8A Q;  5B66 E;  1DD4 A;  2YIU C;  2KXP B;  1NTZ G;  5AW6 B;  3V2N A;  1RF1 A;  1NTZ J;  1PGO A;  3EQ2 A;  2WPS A;  1M56 D;  4GDO A;  5AW5 B;  2E75 C;  5KLI B;  2GA1 A;  1BSH A;  1BGY E;  2QJY B;  1BCC G;  2NPS C;  1LP1 B;  2DW3 A;  1JB0 J;  1JY3 O;  3FX0 A;  3RL0 g;  1VQ4 P;  2KP8 A;  1SQB J;  4ZMD A;  3EWK A;  1NTK D;  3G71 P;  4I1L A;  1AFO A;  3G6E P;  1M1J B;  1S5L X;  3CX5 I;  3V2P A;  1MZ9 A;  2OGU A;  4KJM A;  2G3A A;  3GLM A;  2HLO A;  2QRX A;  3LIE A;  4PV1 C;  3B5N C;  5KAI E;  1J1E C;  2XV5 A;  2KS1 A;  1JY2 P;  3N7N A;  4YXW H;  1IO4 A;  3Q5S A;  1FZC C;  1Q86 Q;  4Y99 C;  1NTK G;  3RL0 D;  1OZH A;  1D7M A;  1NTK J;  1MFT A;  4L74 A;  5APT A;  1EDK A;  3TK1 A;  2ITA A;  3L4F A;  3NXS A;  4DOJ A;  3LID A;  2WIT A;  2C0X A;  1LGH B;  2KSE A;  1IFN A;  2QVA A;  3CME P;  2KLU A;  1CI6 B;  4LGD E;  1T8Z A;  3H1J E;  2B88 A;  1QLE D;  5AW9 B;  2UWJ E;  1FC2 C;  1L0N D;  4BXL A;  3B5N A;  5CBN A;  1QL2 A;  3BVH A;  1EXJ A;  3NFQ A;  4AYC A;  3Q5P A;  2E75 D;  3L36 A;  5APV A;  1PP9 E;  1NTM E;  1FZC A;  1KN7 A;  2NPS D;  1Y47 A;  1RQU A;  1S5L E;  3TYY A;  2WQY C;  3MP7 B;  5CCG C;  3RGU A;  3MHV A;  2RKL A;  5KLV G;  3H1I D;  2MKV A;  4WWI A;  2J58 A;  1L0N G;  4L75 A;  1L4A A;  3L74 G;  3Q3D A;  4BRY A;  4PV1 D;  1QGK B;  1PZQ A;  3H1H E;  2N1T C;  3B5N D;  2FYU E;  4DZO A;  4IFM A;  4PJ0 H;  2WSF J;  3PHL A;  1SQP E;  3VMA A;  3RBX A;  3T97 A;  2D2C B;  5KJ7 C;  1VF5 B;  2O1K A;  1QVG O;  1FJK A;  2GUS A;  2C9N Y;  1LWU C;  1SQX E;  3BRV B;  2RMZ A;  3L71 G;  1ZW0 A;  4UB6 E;  1YIJ P;  1SFC C;  2IFM A;  2NRG A;  5CCG A;  1R8E A;  2BCC D;  3H1I J;  3A0B E;  5AVT B;  1PPJ D;  3L35 A;  3D6Y A;  2E5T A;  1VQ8 P;  3L70 E;  2SPZ A;  1NO4 A;  3TGU E;  1OVU A;  1USE A;  3MZW B;  1NU1 G;  3AE7 C;  1KTM A;  2WSE J;  2YXQ B;  3CXH D;  1JCC A;  2R44 A;  2CPB A;  1IK9 A;  5AW3 B;  4KHX A;  5KLV K;  2HOD A;  2XZR A;  4C7N B;  1N2D C;  5AVS B;  1NAY A;  3WU2 E;  5KJ7 A;  2JEE A;  1CZQ A;  3HUS B;  1SQV G;  3L73 G;  1PPJ G;  4ASV A;  1KYO E;  5CCG D;  2YXR B;  1FE6 A;  2BCC J;  1RE4 C;  2KNC A;  1KZU B;  1ZN5 A;  5H2F E;  2A06 D;  1HJB A;  1ZXG A;  3GHG C;  1KV4 A;  4I7Z B;  3V4Q A;  2XND H;  2W6J H;  1RF0 C;  2O01 H;  5DJT B;  2Q1K A;  1SLQ A;  1RE3 C;  1T2K C;  1S1C X;  3OAK A;  1A02 J;  2YNY A;  1RF1 B;  1G1J A;  5AW4 B;  1M1J A;  3V5B A;  1K04 A;  4YPC A;  2N1T D;  3P32 A;  1HWT C;  1JMB A;  3SSU A;  3H1K E;  2JR8 A;  3KZI H;  2IX7 C;  2ZXE B;  4UB8 H;  3FXE A;  3RL0 B;  5KJ7 D;  1KB9 H;  2E74 D;  3E7K A;  2LR2 A;  5KAF E;  2Q7C A;  2IZ0 A;  1NYH A;  1BE3 E;  3HE5 B;  1NU1 K;  2OAR A;  2LKM A;  1SFC D;  1YQ4 C;  2M3B A;  2WSC J;  4EIJ A;  1VQP P;  5B5E E;  1VQK P;  1HGV A;  3GHG A;  3TSI A;  3L37 A;  1GW3 A;  1KB9 E;  4OH8 B;  3SFD C;  2FFD A;  3L72 E;  1PGP A;  1GW4 A;  3U1A A;  5AVW B;  2KS1 B;  1OMI A;  2WMM A;  1ZV8 A;  2E75 B;  1OWA A;  5TJH A;  1PGJ A;  1S9K E;  1NJI Q;  1M7L A;  5K5G B;  3A2A A;  2PP6 A;  1UII A;  4XE5 B;  5GTH H;  1GK6 A;  4I6M C;  1Y9B A;  2M3E A;  1H8A A;  3BCC D;  1ZOY C;  3VP9 A;  3EFG A;  1SQB E;  1X0T A;  5BVZ A;  2Q3E A;  3A7O A;  1S3J A;  1SQX G;  1SQQ D;  4PV1 B;  2Z5I A;  2K9Y A;  1NGM B;  2P1J A;  1EXI A;  3B5N B;  1T2K D;  1M8O B;  3H1L E;  1OW7 A;  4OGQ C;  2P67 A;  1U7J A;  1ZRT D;  1MFZ A;  2JO1 A;  3B71 A;  4EOT A;  1FZC B;  4Y99 B;  4QMA A;  1DIP A;  4EYY Q;  3SWY A;  3CC2 P;  4PD4 E;  1GL2 C;  1L2P A;  2Y9Z A;  4D6T E;  4RJT A;  3AED C;  3BCC J;  1YYC A;  1AV1 A;  3O8Z A;  4L76 A;  1SVF A;  1X22 A;  3M91 A;  2QM7 A;  1SQQ J;  2H7H A;  3KQG A;  1VL2 A;  2VRS A;  4BRY B;  3HD7 C;  2R3S A;  1P84 D;  5GTI E;  1GK4 A;  1Y8A A;  3H6P A;  3P8C D;  5CJ4 A;  1SQP K;  3T97 B;  4W7Y A;  2ZYD A;  4WBA A;  3UIA A;  1SQX K;  2QG4 A;  1VQ7 P;  1W2B O;  3E1I A;  1EDI A;  1UIX A;  1OFC X;  1M1K Q;  3LW5 J;  5CHX A;  3D6Z A;  4IFD K;  4C7N A;  3C8V A;  1BCC D;  1QEX A;  2QJP C;  3H32 A;  4EDF A;  3HD7 A;  3QWO C;  1DX7 A;  2Y0C A;  2QSI A;  1QVF O;  2N1T B;  3KYQ A;  4RES B;  4JQ0 D;  4OGQ D;  2Y9Y A;  4H13 C;  2HOD B;  4WY4 C;  2J5U A;  1SP4 A;  2YMK A;  2E74 B;  3N4X A;  4K3A A;  1NOH A;  2A45 I;  1GL2 D;  4C7R A;  1KQG B;  3TNU A;  2KNC B;  4H44 B;  5CMZ A;  1FOS F;  1L0L E;  4JYB A;  2WSE H;  4U7J A;  2OQQ A;  1BCC J;  4GOE A;  3WUU A;  2Q9I A;  2GUV A;  4KT0 J;  2K37 A;  2ZT9 B;  3HD7 D;  1N73 A;  1J1D B;  3HE5 A;  3RK3 E;  4R4L A;  3CCM P;  3HRN A;  1IFI A;  4HJG H;  3ZDM A;  5DJU B;  3KXD A;  1LTB C;  1FZB A;  3CWB G;  3D71 A;  4U3F E;  2OYI C;  1JCD A;  1JY3 P;  2OYH C;  2GM4 A;  3AE3 C;  2KIK A;  2R32 A;  2AXT H;  3CXH H;  3FWN A;  2NPS A;  3GHG B;  1M90 Q;  3CMA P;  1BDC A;  2BCC E;  2FFD B;  3MTU E;  5AVU B;  1E5W A;  4IL6 X;  5AW1 B;  4D6T G;  2K9J A;  2WWW A;  1LTA C;  1XTG B;  3PP5 A;  3GF7 A;  1IFP A;  4DT0 A;  1KYO I;  4H13 D;  5KLV D;  1N86 A;  2WSC H;  3L75 E;  1JM0 A;  3L74 D;  2OYI A;  2QIW A;  2W27 A;  5TIS H;  3S9O A;  3JC2 2;  4L73 A;  3I55 P;  1SS1 A;  5AW7 B;  2R3C A;  2V7Q H;  2A06 E;  2XU6 A;  3ABV C;  2P10 A;  3WMM 0;  1JOC A;  3L71 D;  1R5L A;  5TIS E;  1ZR2 A;  1OVR A;  1JO5 A;  4IL6 H;  2IYP A;  3RK2 C;  5KLV J;  3CI9 A;  1BGY D;  2KB7 P;  4Y28 J;  1K05 A;  3QH9 A;  2KZI A;  1L0N J;  3L74 J;  4HKZ H;  2YMY A;  1U57 A;  1NU1 D;  2IPP A;  1KB9 I;  2E76 C;  3CX5 H;  4IL6 E;  2XNX A;  1GTW A;  3V4W A;  5APQ A;  2QJK B;  3S1K A;  3L71 J;  2OTL P;  4PJ0 E;  1BGY G;  3IAO A;  1YIT P;  1SQV D;  4JPZ B;  3L73 D;  1L0L G;  3W68 A;  1PIX A;  1FDI A;  1M57 D;  2E43 A;  3BAS A;  1LTJ C;  1OIP A;  1GMJ A;  3RBZ A;  3IF4 A;  2B9B A;  2QJY C;  1LJ2 A;  3VYI A;  4RKU J;  4R4M A;  2WPQ A;  1NU1 J;  2N1T A;  1RH5 B;  1JUN A;  1LTS C;  4EI2 A;  2W90 A;  3MUD C;  3M9Q A;  1KQS O;  2QEX P;  2K88 A;  2W6A A;  3GMA A;  1EZV E;  4U3F G;  3H32 B;  1LWU A;  2WZ7 A;  1A02 F;  1GZL A;  2XKM A;  5BU5 A;  3HD7 B;  3H1J D;  2OYO A;  1KIL C;  4PD4 I;  1SFC A;  3CCE P;  2KK7 A;  2W83 C;  1SQV J;  3L73 J;  4OWF A;  3OW2 O;  1KMI Z;  4DCK A;  3O6Q A;  1OW8 A;  2IBZ E;  1LTJ A;  3LW5 H;  1ZLL A;  3TNU B;  2C9L Y;  1OVV A;  1TU3 F;  4LC1 A;  3Q5R A;  2HYN A;  2N9B A;  1P84 H;  2HFE D;  3MUD A;  4HH2 A;  2E76 D;  1L0L K;  3VMX A;  4AUW A;  3H1J G;  5L8R J;  3AE8 C;  2HPC A;  1YTZ T;  2FBW C;  2QJP B;  3AEG C;  4ZKP A;  1N73 B;  2AEF A;  2BEQ D;  1YI2 P;  1YJ9 P;  3VOP A;  3PTZ A;  3CCR P;  3H1H D;  3M0D C;  5EFW B;  1KIL A;  2CK3 H;  3KZI E;  1PP9 G;  5KTB A;  1SQP D;  1RE4 A;  4UB8 E;  1NTM G;  2XDJ A;  1DH3 A;  1FS0 E;  4K35 A;  3P8C E;  1YQ3 C;  1DEB A;  4OVN F;  2YIU B;  2KZJ A;  1RF0 A;  4N78 D;  2RN0 A;  1RE3 A;  1SQX D;  3CLQ A;  3CX5 D;  2BEZ F;  2FYZ A;  3CC7 P;  3VMY A;  3BRT B;  3CCU P;  2A45 G;  2LXB A;  2V7Q J;  3KHU A;  2NPS B;  1NTZ E;  4CPG A;  5BU8 B;  5AW0 B;  3IN6 A;  4NPD A;  3R2P A;  3H1H G;  2FYU G;  3A3Y B;  2K9J B;  2Q5U A;  3AE5 C;  3G4S P;  2B87 A;  2FXP A;  2W8Z A;  2R5B A;  1SQP G;  3H1H J;  3PLN A;  4LLH A;  3CL3 D;  5CCH C;  1KIL D;  4M3L A;  1SQP J;  1DEE G;  3P7K A;  3HTK A;  1AJY A;  3MD0 A;  1SQX J;  2KLV A;  3PRJ A;  2OYI B;  2WVR A;  2D2C C;  1FOS E;  3G9R A;  4B86 A;  4W7Z A;  5GTH E;  1J1E B;  2I1K A;  1VQO P;  3H25 A;  1FU1 A;  3CCJ P;  2Y0D A;  1HH0 A;  1KYO D;  2OYH B;  1IFD A;  1NTM K;  3L70 G;  3TGU G;  4ZNC A;  2KSJ A;  1FAV A;  2W6B A;  4O9B A;  1VDF A;  1GDT A;  1HJ0 A;  4Z1M H;  1Q81 Q;  1NTK E;  1Q90 D;  2RH0 A;  5CCH A;  3VP8 A;  1NVO A;  2JP3 A;  1USD A;  3AEA C;  1EZV G;  1NWQ A;  1EQ7 A;  2V4H A;  1HF9 A;  1YHQ P;  2FYU K;  2K1A A;  3AEF C;  4WB4 A;  5APX A;  1KQL A;  1URQ C;  3HUS C;  1IFM A;  2M8R A;  1LT9 C;  3JCU H;  4GT1 A;  2JWD A;  4GOD A;  5CJ0 A;  2IBZ G;  1PV3 A;  1GL2 A;  3NMD A;  3R4Y A;  2O3J A;  2WTY A;  1G2C B;  4TLF A;  3H1K G;  2WPV B;  5APY A;  3CC4 P;  2AEM A;  1HBW A;  1K9M Q;  5CCH D;  1HGZ A;  4H0L C;  1X8Y A;  3Q1M A;  1IFJ A;  3SWK A;  1IJD B;  2G8Y A;  1HTL C;  2Z5H A;  2YO2 A;  1BE3 G;  1S9K D;  2N9Y B;  5KLV E;  2FKW B;  2D2C D;  5B66 H;  1KOR A;  1KFN A;  1L0N E;  1GU4 A;  3PH0 A;  3GW6 A;  1PGQ A;  1FBM A;  3B8E B;  1LWU B;  3GF3 A;  1NHL A;  3L72 G;  3CWB D;  2KUB A;  2HG5 D;  1SFC B;  3CCV P;  3M9H A;  1LTT C;  1LTG C;  3H1L D;  3EFF K;  1JTH A;  1MKM A;  3AE9 C;  2P58 A;  2WT7 A;  3O6Q B;  3L71 E;  2B89 A;  1LTJ B;  2J59 M;  3H1I E;  5KKZ C;  4PD4 D;  1N8R Q;  1J2J B;  1PFI A;  1WT6 A;  1BDD A;  1JY2 O;  2H89 C;  3SFE C;  1SQB G;  3JSV C;  2O1J A;  2Q6Q A;  4D6T D;  1Q82 Q;  3F89 A;  1K73 Q;  1VQ5 P;  3A5T A;  1X9V A;  1FZA A;  5KAI H;  1URQ D;  1OW6 A;  4WY4 A;  1NU1 E;  2HPC B;  4HYT B;  3FGA D;  3I56 P;  3D70 A;  3MGN A;  3CWB J;  4A7P A;  3H1L G;  1KFM A;  3RK3 C;  3H1L J;  2AEJ A;  1KIL B;  5AVR B;  1ZR4 A;  4H0L D;  1ZP0 C;  3A0H H;  2L91 A;  1N7S C;  1SQV E;  3L73 E;  1PPJ E;  2Q3I A;  2JKV A;  2PRR A;  1EZV I;  4D6T J;  2I1J A;  3AE4 C;  2YKO A;  4I2L C;  1NKZ B;  1VQM P;  2AXT E;  4WY4 D;  5AVQ B;  3ITK A;  4ZKU A;  1NTZ K;  1VPC A;  2FYN C;  3CXH E;  3FXD A;  3MIW A;  3B4S A;  3A0H E;  1S2E A;  2B87 B;  1MUU A;  3W67 A;  3CCS P;  1L4A C;  2IBZ I;  2ZXX A;  1AQ5 A;  2IYO A;  2M5A A;  2PAJ A;  1SQB K;  1S5L H;  2OYH A;  1JNM A;  3KDP B;  3HTK B;  1S72 P;  1FDO A;  3AE6 C;  1YBK A;  1RY3 A;  5C39 A;  3AEC C;  2YKP A;  2WSS H;  1N7S A;  2A45 H;  4C46 A;  1G1I A;  4GOF A;  4W80 A;  2OTJ P;  1Q2N A;  3V6I A;  3WUV A;  3HE4 A;  1MV8 A;  3C1L A;  5AVZ B;  1L0L D;  5AVY B;  1P84 I;  1EDJ A;  2M0B A;  2ZVN B;  2FXO A;  4ASW A;  3RK3 D;  1IZN B;  1NTK K;  1WRG A;  4UB6 H;  2AXC A;  1EDL A;  3E1R A;  1W2E A;  2PFX A;  3Q2Y A;  4MN4 C;  1FZE A;  1N7S D;  3A0B H;  4U3F D;  4GIF A;  2FY8 A;  3BAT A;  3NTN A;  3S4R A;  3WUT A;  1NKN A;  5AVV B;  1G2C A;  4N3Y B;  4OGQ B;  3USS A;  2E74 C;  4N78 E;  3AE1 C;  3CX5 E;  1BGY J;  5APS A;  4DJG A;  5AW8 B;  1FZG A;  1T6A A;  1L0L J;  3CPW O;  2YKQ A;  3H1I G;  3CCL P;  1GL2 B;  5KLI C;  4H44 C;  3VN0 A;  3KPE A;  1IC2 A;  3WU2 H;  1H89 A;  1H0T A;  1L4A D;  1R5S A;  2ZT9 C;  1M1J C;  1J1D C;  1Q7Y Q;  3BCC E;  1KYO H;  1KIL E;  2Y0E A;  3F5H A;  4U3F J;  1DD3 A;  1FDM A;  5H2F H;  3L75 D;  1SQQ E;  3AEE C;  1JY2 N;  1JY3 N;  2E42 A;  1VQ6 P;  5AVX B;  1L0N K;  2FXM A;  3SWF A;  1URQ B;  3TDK A;  1LT9 B;  2BCC G;  1E79 H;  1PP9 D;  1ZRT E;  3RK2 D;  1NTM D;  3FWL A;  4TT3 H;  4HB1 A;  2JDI H;  3PJS K;  1GD2 E;  4JBZ A;  1LP1 A;  2KOG A;  4JF7 A;  1FZF A;  2POH A;  2JWA A;  5M1B A;  2IDB A;  1JTH B;  1JEK A;  2ZYA A;  2HR3 A;  2FFD C;  2WT7 B;  5AW2 B;  5KAF H;  4H0L B;  3L75 G;  1CW5 A;  3H1J J;  1NH4 A;  3M9B A;  2CPS A;  3L75 J;  4IOI H;  2E5Y A;  1XTC C;  5B5E H;  2FYU D;  1P84 E;  2QE7 H;  4NPE A;  3VTP C;  2I8D A;  4H13 B;  4WY4 B;  1YJN P;  2WPR A;  1PP9 J;  1W5C E;  1NTM J;  2A06 G;  2P7J A;  1VQN P;  3G3Z A;  3CD6 P;  4H44 D;  2OTK E;  5APW A;  4RO0 A;  1PL5 A;  2C0W A;  1OXZ A;  1YTZ I;  2PGD A;  5E79 H;  1Z56 A;  2YO3 A;  3M06 A;  1WMK A;  4GKG A;  2LXC B;  2ZT9 D;  2IZ1 A;  3M0A A;  1SQV K;  3L70 D;  1RHZ B;  3TGU D;  2O01 N;  5KKZ B;  3V2Q A;  1BCC E;  2FYU J;  2L5G B;  2KYV A;  3M0D A;  2IFN A;  1CI6 A;  1ZME C;  4YTP C;  1AQT A;  4BWN A;  5E79 E;  2Z4E A;  1NAF A;  1RQV A;  1VQL P;  3V2R A;  3VMZ A;  3IFM A;  1LT1 A;  2MJZ A;  1EZV D;  4IFF A;  1VF5 C;  3I5C A;  3RK3 B;  4PD4 H;  2M5A B;  1VQ9 P;  3OJA B;  2JJL A;  4N6J A;  3IR9 A;  3CWB E;  2QJK C;  1FJP A;  1HVV A;  2H88 C;  2QM8 A;  3TF5 A;  3L70 J;  2ZYG A;  3OA7 A;  3TGU J;  1N7S B;  2IBZ D;  1AVO A;  4NPF X;  3GG2 A;  3H1K D;  2ZAE B;  1QL1 A;  3HE4 B;  1AA0 A;  5GTI H;  3BCC G;  5APU A;  1KC8 Q;  2FYN B;  4WVZ A;  2NZ2 A;  2ZJS E;  3II6 A;  1SQQ G;  2ZVO B; 
#chains in the Genus database with same CATH homology
 2R5D A;  4HYT B;  2Q7C A;  1GU5 A;  3HE5 B;  1NU1 K;  1L4A B;  2OAR A;  3MGN A;  1KFM A;  2XNX A;  1GTW A;  2LKM A;  1SFC D;  3U59 A;  2M3B A;  3RK3 C;  1X79 B;  1T3U A;  1CSB A;  3V4W A;  2BAS A;  1KIL B;  4EIJ A;  5AVR B;  5APQ A;  4XA4 A;  2H43 A;  1HUC A;  1HGV A;  1ZR4 A;  3GHG A;  3TSI A;  3L37 A;  1GW3 A;  4OH8 B;  2FFD A;  1N7S C;  1GW4 A;  3U1A A;  5AVW B;  2Q3I A;  3BAS A;  2ZFC A;  2E43 A;  4JYC A;  1H88 A;  1LTJ C;  1RF1 C;  1ZV8 A;  2I1J A;  3RK2 B;  4AQR D;  1OWA A;  3VYI A;  2WPQ A;  2YKO A;  4I2L C;  2N1T A;  1JUN A;  1NKZ B;  2H8P D;  1S9K E;  4WY4 D;  5AVQ B;  1T3J A;  1LTS C;  1M7L A;  4ZKU A;  3A2A A;  1NTZ K;  1VPC A;  3RL0 C;  2PP6 A;  3C9I A;  3MIW A;  3M9Q A;  4XE5 B;  1GK6 A;  1N7L A;  2WSF H;  1JMM A;  4I6M C;  1H8A A;  1MUU A;  1N73 C;  2W6A A;  2P2U A;  3VP9 A;  1URQ A;  3EFG A;  1L4A C;  3H32 B;  3HUS A;  1AQ5 A;  1LWU A;  2WZ7 A;  5BVZ A;  1GZL A;  1A02 F;  1LT9 A;  2XKM A;  5BU5 A;  2PAJ A;  3HD7 B;  1SQB K;  3A7O A;  2OYH A;  1JNM A;  1KIL C;  3KDP B;  3P8M C;  1SFC A;  2Z5I A;  3HTK B;  2P1J A;  1LTI C;  3B5N B;  1SQQ K;  1T2K D;  3U1C A;  1RY3 A;  2YKP A;  2P67 A;  1N7S A;  2A45 H;  5AW6 B;  4C46 A;  1G1I A;  3V2N A;  1LTJ A;  1MFZ A;  3LW5 H;  1RF1 A;  4W80 A;  4EOT A;  1ZLL A;  1FZC B;  4Y99 B;  3EQ2 A;  2WPS A;  3SWY A;  3TNU B;  2C9L Y;  5AW5 B;  1GL2 C;  4LC1 A;  2HYN A;  3HE4 A;  1MV8 A;  2N9B A;  2NPS C;  5AVZ B;  5AVY B;  1JY3 O;  2HFE D;  3MUD A;  4HH2 A;  2KP8 A;  1L0L K;  3VMX A;  4AUW A;  1YYC A;  2HPC A;  1YTZ T;  3O8Z A;  1SVF A;  4I1L A;  1AFO A;  3RK3 D;  1M1J B;  4ZKP A;  3M91 A;  1N73 B;  2QM7 A;  1NTK K;  3VOP A;  2H7H A;  3V2P A;  1WRG A;  3KQG A;  2VRS A;  3M0D C;  3HD7 C;  1MZ9 A;  1W2E A;  1KIL A;  5KTB A;  1RE4 A;  2XDJ A;  1GK4 A;  1DH3 A;  2HLO A;  3LIE A;  3H6P A;  3P8C D;  1FZE A;  1N7S D;  3P8C E;  5CJ4 A;  4GIF A;  3B5N C;  3BAT A;  3NTN A;  1SQP K;  1NKN A;  5AVV B;  1DEB A;  1G2C A;  4N3Y B;  4W7Y A;  1J1E C;  1RF0 A;  4N78 D;  1RE3 A;  4N78 E;  3CLQ A;  2XV5 A;  4WBA A;  5APS A;  1JY2 P;  3UIA A;  2FYZ A;  3N7N A;  5AW8 B;  1IO4 A;  3VMY A;  1FZG A;  1FZC C;  1SQX K;  3BRT B;  4Y99 C;  2A45 G;  2YKQ A;  1GL2 B;  3RL0 D;  2NPS B;  3E1I A;  5BU8 B;  5AW0 B;  3VN0 A;  3KPE A;  1IC2 A;  5CHX A;  3R2P A;  5APT A;  1H89 A;  3A3Y B;  1L4A D;  4IFD K;  3TK1 A;  2Q5U A;  3L4F A;  3NXS A;  4C7N A;  4DOJ A;  2R5B A;  1M1J C;  1J1D C;  2WIT A;  3LID A;  2C0X A;  4LLH A;  3CL3 D;  3H32 A;  5CCH C;  1KIL D;  1LGH B;  4M3L A;  1IFN A;  3HD7 A;  1DX7 A;  1CI6 B;  2N1T B;  4LGD E;  1T8Z A;  3KYQ A;  1FDM A;  4RES B;  5AW9 B;  3P7K A;  3HTK A;  1JY2 N;  3B5N A;  3MD0 A;  1QL2 A;  1JY3 N;  2HOD B;  4WY4 C;  2KLV A;  2E42 A;  2OYI B;  3BVH A;  5AVX B;  1SP4 A;  1FOS E;  1L0N K;  4B86 A;  2FXM A;  4W7Z A;  3SWF A;  1J1E B;  1URQ B;  3NFQ A;  4AYC A;  2I1K A;  3N4X A;  1NOH A;  1LT9 B;  2A45 I;  3L36 A;  3RK2 D;  1GL2 D;  5APV A;  1FU1 A;  1HH0 A;  1FZC A;  2OYH B;  2NPS D;  1IFD A;  4C7R A;  3TNU A;  1NTM K;  5CMZ A;  1GD2 E;  3TYY A;  2KSJ A;  2KOG A;  4JF7 A;  1FZF A;  2POH A;  5CCG C;  1FAV A;  1FOS F;  1JTH B;  4JYB A;  2W6B A;  4O9B A;  2WSE H;  1VDF A;  2FFD C;  2WT7 B;  5AW2 B;  1GDT A;  2Q9I A;  2GUV A;  1CW5 A;  2J58 A;  3HD7 D;  1N73 A;  1J1D B;  3HE5 A;  1NH4 A;  5CCH A;  3VP8 A;  1L4A A;  3M9B A;  2CPS A;  3HRN A;  1NWQ A;  1EQ7 A;  1IFI A;  1XTC C;  2N1T C;  3B5N D;  4DZO A;  4IFM A;  1LTB C;  3VTP C;  2FYU K;  1FZB A;  4WY4 B;  2WPR A;  4WB4 A;  2OYI C;  3T97 A;  5APX A;  5KJ7 C;  2O1K A;  1KQL A;  2P7J A;  1URQ C;  1JCD A;  3HUS C;  1FJK A;  1IFM A;  2GUS A;  1LWU C;  2C9N Y;  2M8R A;  1LT9 C;  3G3Z A;  4GT1 A;  3BRV B;  5APW A;  5CJ0 A;  1JY3 P;  2OYH C;  2GM4 A;  2C0W A;  1GL2 A;  1OXZ A;  1SFC C;  2R32 A;  3NMD A;  1YTZ I;  2IFM A;  2YO3 A;  1Z56 A;  2NPS A;  3GHG B;  3M06 A;  5CCG A;  2WTY A;  4GKG A;  1G2C B;  5APY A;  2FFD B;  5AVT B;  3MTU E;  3L35 A;  1E5W A;  5AVU B;  1HBW A;  5AW1 B;  5CCH D;  3M0A A;  1HGZ A;  1SQV K;  1X8Y A;  2WWW A;  1LTA C;  1NO4 A;  1IFJ A;  1XTG B;  1IJD B;  3V2Q A;  2L5G B;  3PP5 A;  2KYV A;  1HTL C;  2Z5H A;  2YO2 A;  3M0D A;  2IFN A;  1CI6 A;  1S9K D;  1JCC A;  2Z4E A;  1N86 A;  1NAF A;  2FKW B;  2CPB A;  2WSC H;  1IK9 A;  5AW3 B;  4KHX A;  3V2R A;  1KFN A;  5KLV K;  2HOD A;  2XZR A;  3VMZ A;  4C7N B;  1GU4 A;  2OYI A;  3IFM A;  1N2D C;  5AVS B;  2MJZ A;  2W27 A;  5KJ7 A;  2JEE A;  4IFF A;  1FBM A;  1CZQ A;  3B8E B;  3I5C A;  3HUS B;  1LWU B;  1NHL A;  3RK3 B;  3OJA B;  2JJL A;  4N6J A;  5CCG D;  3IR9 A;  5AW7 B;  2HG5 D;  2R3C A;  1RE4 C;  1SFC B;  1KZU B;  1ZN5 A;  1FJP A;  3M9H A;  1LTT C;  1LTG C;  1HVV A;  2QM8 A;  1HJB A;  3GHG C;  1JTH A;  2XU6 A;  3V4Q A;  3WMM 0;  1JOC A;  3OA7 A;  2WT7 A;  1N7S B;  1RF0 C;  2O01 H;  1SLQ A;  1RE3 C;  1T2K C;  1ZR2 A;  3OAK A;  1LTJ B;  1A02 J;  2YNY A;  1RF1 B;  1G1J A;  2J59 M;  1JO5 A;  5AW4 B;  1M1J A;  3V5B A;  1HWT C;  2N1T D;  3P32 A;  3RK2 C;  3CI9 A;  2KB7 P;  1J2J B;  1QL1 A;  1PFI A;  3HE4 B;  1WT6 A;  2IX7 C;  2ZXE B;  1JY2 O;  5APU A;  2O1J A;  3RL0 B;  3A5T A;  2YMY A;  1X9V A;  5KJ7 D;  1FZA A;  1URQ D;  3II6 A;  2IPP A;  4WY4 A;  2HPC B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...