2HFED

Rb+ complex of a k channel with an amide to ester substitution in the selectivity filter
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
43
structure length
43
Chain Sequence
b'DLYPVTLWGRLVAVVVMVAGITSFGLVTAALATWFVGREQERR'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords FAB Heavy Chain
publication title Structural and Functional Consequences of an Amide-to-Ester Substitution in the Selectivity Filter of a Potassium Channel.
pubmed doi rcsb
source organism Mus musculus
molecule tags Membrane protein
total genus 18
structure length 43
sequence length 43
ec nomenclature
pdb deposition date 2006-06-23
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.110 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 2hfeD00
4JF7A 1L4AA 3HD7A 1T3JA 3KYQA 4OH8B 5CCGA 1NHLA 2N1TD 2N1TC 5CCHD 2KOGA 5CCHC 1GL2A 2YMYA 3B5ND 3B5NC 1KILC 1JTHB 1SFCA 1L4AB 3RK3B 4N78E 4W7YA 3HD7B 2PP6A 3HTKB 5KJ7A 5CCHA 4WY4A 3TSIA 1URQD 1GL2B 1URQC 2M8RA 3RL0B 2HFED 2NPSA 1SFCB 3RK2B 1KILD 1HVVA 3VOPA 1L4AD 1L4AC 1N7SD 4WY4B 1N7SC 4W80A 2XDJA 3RK3C 3RK3D 2N1TA 1URQA 2NPSB 2H8PD 3B5NA 4LGDE 1KILA 1GL2D 1GL2C 3RL0C 1XTGB 1SFCD 1SFCC 3P8CE 1N7SA 2N1TB 1URQB 3M0DC 3HD7D 3HD7C 5KJ7D 3B5NB 5KJ7C 1KILB 5CCGD 4WY4D 5CCGC 4WY4C 4W7ZA 2NPSD 2NPSC 2WZ7A 3RL0D 2HG5D 1JTHA 3PP5A 1N7SB 3RK2D 3RK2C
chains in the Genus database with same CATH superfamily
1JM0A 5AW4B 5GTHE 3P8MC 1JB0J 3T97B 3M06A 2WT7A 2WPVB 3CCLP 4Y99C 1M1JC 1M1KQ 3B5NC 4I1LA 3PH0A 1RE4A 1QL1A 3H1LE 2ZT9C 3WMM0 1JY3O 2JDIH 1KFMA 3II6A 1JCDA 3TNUA 5KLVJ 4ZMDA 3TF5A 4PD4I 2KLUA 5AVUB 5CCHA 3VMAA 2IFMA 1M90Q 1OWAA 2BEQD 1YIJP 1NJIQ 2O3JA 3L72D 1RF1C 1FJKA 2Q3EA 2FFDC 3AEAC 2JWAA 1SQVJ 4JYBA 2C9LY 3A2AA 1RHZB 2P2UA 2FYNC 1SQPD 3M9HA 4HJGH 2MJZA 1G1IA 3L71J 5KKZC 3MIWA 1YQ4C 1SQVK 1SVFA 3AE9C 1QX8A 3KZIE 4I6MC 5AVRB 1FU1A 1ZOYC 1FAVA 4NPDA 3F89A 2QE7H 4H44C 3G9RA 1NVOA 3RK2D 4JF7A 1KV4A 4CPGA 1EDLA 1T6AA 1VF5D 2RMZA 2N1TC 1CSBA 2NRGA 2KOGA 1L2PA 2D2CB 3UIAA 2YKOA 1SFCA 2WSSH 5B66E 4PJ0E 2OTJP 2QJPC 4W7YA 3MHVA 4UB8E 3H1IG 1DH3A 5B66H 2A06E 1IFIA 2E76B 1LWUB 4C7NB 3AEBC 2OYIB 1NTZD 3TYYA 1FZGA 4D6TD 1DX7A 1KTMA 1EXIA 1GU5A 1JMMA 1EZVE 4AQRD 1JY2N 1P84D 1SQBG 2IPPA 1W5CE 5KLIC 1XTGB 3HE5A 3G4SP 1NWQA 3L73G 1U57A 1JOCA 1Y47A 1NTKJ 4L74A 2JO1A 3CX5I 1J1DC 1HWTC 1KQFB 1S2EA 1Q7YQ 4WY4D 1R5SA 4C7NA 1NAFA 1MKMA 3MTUE 2BEZF 3PLNA 4ZKUA 1N7SB 1WT6A 5APQA 3V5BA 1N7LA 1T8ZA 1NTKK 1L0LJ 3SWYA 3NMDA 3VP9A 1ZN5A 3A7OA 4RKUJ 1QEXA 1GU4A 1L4AB 3FGAD 1M57D 3HTKB 2B89A 2JWDA 3TSIA 1HF9A 1Q86Q 2M8RA 5B5EH 3RL0B 2H89C 2HFED 2ZYDA 2BCCD 3Q1MA 1NTMK 1PP9D 3CXHI 1FDIA 2XV5A 1SQVG 1N86A 3RK3C 3VMXA 1S5LE 1URQA 1Q2NA 2HYNA 3TDKA 1BGYD 2MKVA 3CCUP 2K88A 1M8OB 1VQOP 5CMZA 4IL6E 1E79H 1KORA 3L71G 3NFQA 2KS1A 5TISE 3D71A 5BU8B 3AEDC 4Y99B 3HTKA 2OQQA 3SFEC 3B5NB 5KJ7C 1A02F 5CCGD 5TISH 2W27A 5AW7B 5CBOA 2QG4A 2WZ7A 2YMKA 3WUVA 2WMMA 3U59A 1L0NK 1NU1D 3HD7A 3CI9A 2O1JA 2KK7A 2SPZA 2OARA 1LTGC 2GUVA 1CW5A 1K05A 1KYOD 2K9JB 2KNCA 2G3AA 1RF1B 1JTHB 2FFDB 3GHGA 4DCKA 2LXBA 2FYNB 3M0DA 2PP6A 4R4LA 4BWNA 2YKPA 3WU2H 3R2PA 3L4FA 1M1JA 1SQBE 3RK2B 3BRVB 3L73E 2KUBA 1IJDB 1U7MA 2FYUJ 1MFTA 3L72J 1IO4A 3L70J 3KPEA 2OGUA 4H44B 4XE5B 1VQNP 1GL2C 1RF1A 3U1AA 1BE3E 1SQPJ 2FBWC 1SFCD 2FFDA 3AE3C 1KQLA 2XNDH 3CWBG 1LP1A 1NTKG 2B9BA 5APYA 2N1TB 2POHA 4I2LC 1GW3A 2FYUK 3C1LA 1LNQA 5AVWB 2O01N 1VQMP 4KT0J 1JY2P 3V4WA 4JYCA 4IFMA 2E76C 2QJPB 2C0XA 2OYHB 3A0BE 2I8DA 2OYIC 1SQPK 4EIJA 3AEFC 3BVHA 1NO4A 2KZIA 1VQ6P 3QWOC 1PPJG 3EFFK 5AW5B 5KLVE 4K35A 1QLED 4UB6H 2IBZG 3A0BH 1KC8Q 3GLMA 2G8YA 3H1LD 1NH4A 1P84I 4C46A 2KSJA 2M0BA 1XTCC 3AE5C 2RN0A 1SQVE 1J2JB 1NKZB 1OVVA 3A0HH 1VPCA 2PFXA 3CCEP 3GF7A 3CL3D 2QEXP 3CPWO 2ITAA 3A3YB 2E5TA 1CI6B 5GTIH 2WPRA 3VMYA 3EQ2A 3L71E 1J1DB 1RF0C 2A45I 1ZXGA 4B86A 2OTLP 1N7SC 3L75D 1NKNA 3H1IJ 1FJPA 2DW3A 1PGJA 4MN4C 1YQ3C 3CLQA 1LTSC 3L74J 1L0NG 3NXSA 5APSA 1KFNA 2P58A 5KAIE 2QVAA 1T2KC 1SQXJ 2QJKB 4PD4H 1NTZK 1TU3F 1GDTA 1FE6A 4XFJA 1IC2A 3I56P 1CI6A 1SQXK 1PGOA 2FY8A 4HH2A 5APTA 4OH8B 2L91A 4GIFA 1FS0E 4BXLA 2QJYC 1KILC 2E74D 4EI2A 2CPSA 2PGDA 4H13D 3CCVP 4Z1MH 1ZV8A 3RK3B 2HODB 2Y0EA 1OZHA 3H32A 1GMJA 2M3BA 3B8EB 2NPSA 2R32A 3N7NA 1ZP0C 1QVFO 1J1EC 1KILD 5AVZB 1SQQJ 2ZVOB 2R5BA 1FZCB 2IZ1A 2QM8A 2W90A 1EZVD 1NTKE 2YO2A 2FYUG 3BCCD 3G71P 3L72G 1PP9J 3L70G 1KYOI 2H8PD 2O1KA 2J5UA 3BATA 3WUTA 2K37A 1PFIA 1SQPG 4EYYQ 1LTJA 1Y9BA 1SQQK 1IFNA 5KAFH 2KZJA 1WRGA 4DOJA 1PPJE 1VL2A 3AE8C 1JEKA 4GDOA 3M91A 2IBZE 2K1AA 4GOEA 1DD4A 2FYZA 2W8ZA 3O6QB 1L0LE 2B87B 4BRYB 3T97A 2KI7B 1N8RQ 3TGUJ 4JQ0D 1NYHA 3RK2C 2Y9ZA 2Q7CA 2ZVNB 4YTPC 4OGQD 3FX0A 1VF5C 3V2NA 1NU1J 1NHLA 3CX5E 2M5AB 3Q2YA 2LKMA 2FXPA 3KDPB 4KHXA 1Z56A 2IX7C 1LTBC 3CX5H 3N4XA 2W6JH 1X22A 4N78E 3MGNA 1LTAC 3L36A 3K5BA 1FOSE 2AEJA 1FOSF 1NU1K 1GL2B 3O6QA 1OVRA 3H1HD 1HVVA 1NTZG 2IDBA 2WTYA 1QGKB 4K3AA 2OYHC 2IZ0A 4EDFA 2AEFA 4XA4A 1QVGO 1Y8AA 1DD3A 3L74G 5AW1B 2Q6QA 4QMAA 1SQXG 1ZW0A 3SWKA 1AA0A 3HE4B 2OYOA 2KSEA 5M1BA 3H25A 4ZKPA 4WY4C 3P8CD 1JMBA 3CXHH 2FXMA 5H2FE 4ASWA 3D6YA 1Q81Q 3Q3DA 3E1RA 2OTKE 1BCCJ 1SLQA 1IFJA 5BVZA 3VMZA 3CWBJ 5H2FH 1YJ9P 2R3CA 2RKLA 2A45G 3IFMA 4GT1A 2JEEA 3CC2P 1LWUA 2YMYA 2YIUC 4OWFA 2OYIA 1GZLA 3V2QA 2J58A 2WSFH 2FYUE 3L72E 3L70E 2QJKC 1LJ2A 1SQBD 2JJLA 1JY3P 1N73B 3L73D 1SQPE 1SQQG 3VN0A 1NTMJ 1RE3C 3CCSP 1JY2O 2WQYC 4OVNF 5B5EE 2YO3A 1PP9G 3B4SA 1VQ5P 1AJYA 1BE3D 3H1JJ 4H0LD 1IZNB 3L75J 4H13B 3M9BA 4L73A 1RE4C 1BGYG 3MP7B 3HUSC 4U3FD 1N7SA 1YBKA 2QJYB 3H1KJ 1KILB 2JR8A 4ZNCA 5CCGC 3G6EP 4PV1D 1Q90D 2NPSD 1YJNP 1L0NJ 3TGUG 5KLVD 1JCCA 4YXWH 4LLHA 4YXDC 1FZBA 1DIPA 1EZVI 1L4AA 1FZCC 2WWWA 1NU1G 2LXCB 1PGQA 1J1EB 1VQ9P 5CCHD 4WVZA 1FZEA 1SQVD 3D70A 3P7KA 2PAJA 2V7QJ 2XNXA 1KQSO 1HBWA 1JO5A 3JCUE 4HKZH 4DZOA 1HUCA 3H1IE 5AVTB 4AYCA 3JCUH 3L71D 3L74E 3WU2E 1SQXE 3WUUA 1KB9E 2WPQA 2QA4P 4OGQB 2WITA 3AEGC 2QSIA 1YTZT 5AW0B 4GKGA 3C8VA 1P84H 1KB9H 1LTTC 2ZAEB 3BCCJ 1KN7A 1EDIA 3ZDMA 1Q82Q 3SFDC 3B5NA 2WSFJ 2J59M 2H43A 1SFCC 1VF5B 4RO0A 1DEBA 5AW6B 4L76A 5E79H 1G2CB 3F5HA 2K9JA 3KQGA 2LR2A 2NZ2A 2A45H 2HG5D 1JTHA 1BCCG 1K04A 2KXPB 2KB7P 5CJ0A 2Q1KA 5CBNA 1T3JA 3QH9A 3GF3A 4R4MA 1FDMA 1DEEG 1S5LX 1VDFA 2YXQB 1PV3A 1E5WA 1SQQE 1OXZA 4UB6E 3B71A 4IL6X 4KJMA 1PP9E 1X9VA 2AXTH 3OW2O 3OA7A 3C9IA 2HR3A 1NTMG 2D2CD 3A0HE 2QM7A 3H1HJ 2YKQA 4WY4B 4TT3H 2N1TA 3W68A 1RQUA 1YITP 3H1JG 5GTIE 3RK3E 3L75G 1YJWP 3TGUE 1PPJD 1UIXA 2WSCH 3FWLA 1S9KE 2OYHA 2IBZD 1IFDA 1NTZJ 1H0TB 3CCQP 1L0LD 1NU1E 3H1KG 2N9YB 4D6TJ 1EQ7A 2YIUB 3PTZA 4PD4E 3JSVC 2R44A 3V6IA 1EDKA 1OW7A 1N73C 1KYOH 3ABVC 2KYVA 2K3RA 1HJBA 4LC1A 1PGPA 2K9YA 5APUA 4N78D 1NAYA 2E74C 2Z5IA 2AXCA 1WMKA 1ZRTE 3E7KA 4H13C 2E43A 2I1JA 4N3YB 1H88A 4TLFA 3MD0A 2JKVA 2WT7B 1URQD 2XU6A 1JY3N 2E5YA 1LTIC 3RGUA 4EOTA 3HUSB 1VQKP 2IYOA 3H6PA 2ZXXA 1FBMA 2WSEJ 3TNUB 2Z4EA 3VTPC 2A06D 2E75D 1L4AD 4W80A 3BCCG 2O01J 2Q3IA 3V4QA 1AQTA 1SQBK 1IK7A 1BCCE 3LIDA 1R5LA 3RBXA 3CWBE 2GA1A 1YI2P 4L75A 2BCCJ 3IN6A 5AW2B 3M0DC 4YPCA 3HD7D 4U3FJ 2W83C 5KAFE 5GTHH 1RQVA 4WBAA 4N6JA 3AE6C 1AV1A 4IFFA 3PP5A 4DT0A 3HUSA 1BGYJ 3AECC 3EFGA 4C7RA 4I7ZC 3BASA 2HODA 3AE1C 4OGQC 2ZYGA 5CCGA 1PL5A 1X79B 1BDCA 1X8YA 2WSCJ 2QRXA 4HB1A 5APWA 2JP3A 3B5ND 1N2DC 1NTME 1OIPA 2FYUD 1K73Q 2ZT9D 2ZYAA 3L70D 3AE7C 3I55P 1FZCA 1IFPA 2RH0A 1NOHA 3GW6A 5KLVK 5KJ7A 3FWNA 3H1JE 1ZR4A 3MUDC 3L75E 2WPSA 1D7MA 1FDOA 1SFCB 1X0TA 3Q5RA 4NPEA 2IYPA 3H1HG 4JBZA 1USDA 3TK1A 3H1KE 5AW8B 4Y28J 1R8EA 4LGDE 1K9MQ 2B87A 4BRYA 2Y0DA 1KQGB 3KZIH 1L0NE 1OW8A 1LT1A 2WVRA 1GK6A 3NTNA 4GOFA 5AVSB 3AE2C 3OJAB 2GUSA 1LT9C 4D6TG 3VYIA 2CPBA 3HE5B 3V2RA 2M5AA 1OMIA 4H44D 3AE4C 3IF4A 1W2BO 5C39A 1S1CX 1SP4A 3CXHE 3KYQA 1MV8A 4PJ0H 4IOIH 4ASVA 2N1TD 5AVYB 2V7QH 2VRSA 4UB8H 1AVOA 1GK4A 1GL2A 3CCJP 3RL0g 1OW6A 1IFMA 1KILE 3H1ID 2IBZI 1AQ5A 1U7JA 2H7HA 3PRJA 4RESB 3BCCE 3L74D 1FZAA 1SQXD 1KB9D 3CCMP 1EXJA 3H1LJ 5AVQB 4GODA 1PIXA 1MZ9A 1ZLLA 2KIKA 3SSUA 2V4HA 3HE4A 3VP8A 4H0LC 1GW4A 1BE3G 3CC4P 2HLOA 1VQPP 3USSA 2P10A 5AVVB 2BCCG 3D6ZA 1OVUA 1URQB 4A7PA 4U3FG 1IK9A 2Q9IA 3M0AA 2FKWB 2E74B 4PV1C 2C9NY 2NPSC 5BU5A 1ZMEC 3L35A 2E75B 1RF0A 2KS1B 2W6BA 5KLVG 5AW9B 2P67A 5AVXB 2W6AA 1SQQD 2L5GB 5CCHC 1VQ8P 1L0LK 1YHQP 2R3SA 4WWIA 1N73A 2P1JA 1LTJC 4RJTA 2ZFCA 3GG2A 1EC5A 3H1HE 3HD7B 3IAOA 4JPZB 2Y0CA 1K8AQ 3CCRP 1QL2A 2AEMA 2Z5HA 3PJSK 2KNCB 3HRNA 3CD6P 1T3UA 3GHGB 3CMEP 1S5LH 2FXOA 3GMAA 4HYTB 5L8RJ 3AEEC 1NTZE 4IL6H 3RK3D 1M1JB 1HGZA 5DJUB 4D6TE 1H89A 1KZUB 3JC22 4WB4A 3TGUD 2ZT9B 1KILA 1VQ7P 1S9KD 1CZQA 3Q5SA 5K5GB 3P8CE 1BSNA 1P84E 4I7ZB 2YNYA 5KTBA 4PD4D 5KJ7D 4W7ZA 3MZWB 3V2PA 2E42A 1W2EA 2QIWA 2XKMA 2HPCB 3G3ZA 1LP1B 5E79E 5DJTB 3PHLA 1HTLC 2I1KA 1G1JA 1VQLP 2N9BA 1YYCA 3LIEA 1ZRTD 1VQ4P 1JUNA 2CK3H 3BRTB 5KKZB 1BDDA 3LW5H 1UIIA 3W67A 1YTZI 1KMIZ 1NGMB 3CC7P 2Q5UA 3CMAP 3SWFA 4NPFX 2WSEH 5CJ4A 2BASA 1MFZA 1USEA 3S1KA 1GD2E 1PZQA 2D2CC 2HPCA 3H1LG 2M3EA 2O01H 2UWJE 3M9QA 2BCCE 1LT9B 2AXTE 1EDJA 1JNMA 2PRRA 3MUDA 4U3FE 4AUWA 2B88A 1G2CA 1BCCD 1GL2D 1LWUC 3R4YA 2IFNA 3CWBD 3FXDA 1M7LA 1NTKD 1BGYE 3KXDA 1AFOA 2XZRA 5APVA 3S9OA 3E1IA 5AW3B 2ZXEB 1L0LG 4O9BA 1KB9I 4M3LA 2E76D 1GTWA 2YXRB 1S72P 2Y9YA 1LT9A 3S4RA 1NTMD 1A02J 1OFCX 5KLIB 1HH0A 3RBZA 1FZFA 2R5DA 1KYOE 2ZJSE 1HJ0A 1BSHA 4U7JA 1KD1Q 2P7JA 5EFWB 3IR9A 3Q5PA 1S4XA 3H1JD 3CX5D 4H0LB 4WY4A 3O8ZA 1URQC 3FXEA 1H8AA 3OAKA 2KLVA 3P32A 3VOPA 3H1KD 3H32B 3EWKA 2E75C 1L4AC 1N7SD 5KAIH 1H0TA 2XDJA 1LGHB 4PV1B 1OX3A 2A06G 1RH5B 2NPSB 3LW5J 1L0ND 2C0WA 2H88C 1ZR2A 3I5CA 1SQBJ 3RL0C 3U1CA 1T2KD 4IFDK 2KP8A 1FC2C 1M56D 3L73J 1AVYA 1RY3A 1SS1A 5TJHA 4DJGA 1MUUA 1EZVG 3HD7C 1LTJB 5CHXA 1S3JA 3A5TA 3KHUA 1RE3A 3RL0D 2GM4A 1BE3J 3GHGC 3ITKA 1HGVA 3CXHD 5APXA 3L37A
chains in the Genus database with same CATH topology
5AW4B 1SP4A 1L4AA 5AW5B 3P8MC 1FZCC 2WWWA 3KYQA 1MV8A 2N1TD 5AVYB 3M06A 1J1EB 5CCHD 2VRSA 2WT7A 1NH4A 4Y99C 1M1JC 1GK4A 1GL2A 3B5NC 4C46A 4I1LA 1FZEA 2KSJA 1RE4A 1QL1A 1IFMA 1XTCC 3P7KA 3WMM0 1JY3O 2PAJA 1KFMA 1AQ5A 2XNXA 3II6A 1HBWA 1JO5A 1J2JB 4DZOA 1JCDA 3TNUA 1HUCA 2H7HA 1NKZB 4RESB 1VPCA 5AVUB 5AVTB 5CCHA 3CL3D 1FZAA 4AYCA 2IFMA 1OWAA 3A3YB 1CI6B 2WPRA 1RF1C 3VMYA 5AVQB 3EQ2A 2WPQA 1FJKA 2WITA 1J1DB 1RF0C 2FFDC 2A45I 4JYBA 1MZ9A 1YTZT 1ZLLA 5AW0B 2C9LY 3A2AA 4GKGA 4B86A 1N7SC 2P2UA 1NKNA 3HE4A 1FJPA 1LTTC 3VP8A 3M9HA 3B5NA 3CLQA 2MJZA 1LTSC 1GW4A 1G1IA 3NXSA 5APSA 1KFNA 2J59M 2H43A 2HLOA 1T2KC 1SFCC 5AVVB 1NTZK 3MIWA 1URQB 1DEBA 1GDTA 1SQVK 1SVFA 5AW6B 4I6MC 5AVRB 1IK9A 1G2CB 1FU1A 2Q9IA 3M0AA 2FKWB 1FAVA 2C9NY 1IC2A 2NPSC 5BU5A 3KQGA 2A45H 2HG5D 1CI6A 1JTHA 3L35A 1RF0A 3RK2D 2W6BA 1SQXK 4JF7A 2KB7P 5CJ0A 5AW9B 4HH2A 2P67A 5APTA 1T3JA 4OH8B 5AVXB 2N1TC 1CSBA 2W6AA 4GIFA 2L5GB 2KOGA 5CCHC 1FDMA 3UIAA 1L0LK 1VDFA 2YKOA 1E5WA 1KILC 1N73A 1OXZA 1SFCA 2P1JA 1LTJC 2ZFCA 2CPSA 1ZV8A 3RK3B 4W7YA 2HODB 3HD7B 1DH3A 3H32A 1IFIA 1QL2A 2M3BA 2Z5HA 1LWUB 4C7NB 1X9VA 3HRNA 3B8EB 2OYIB 1T3UA 2NPSA 2R32A 3GHGB 3N7NA 3OA7A 1J1EC 3C9IA 3TYYA 1KILD 5AVZB 1FZGA 4HYTB 2R5BA 1FZCB 2QM7A 2QM8A 2YO2A 1DX7A 2YKQA 3RK3D 4WY4B 1M1JB 1GU5A 1HGZA 2N1TA 1JMMA 4AQRD 1H89A 1KZUB 2H8PD 2O1KA 3BATA 4WB4A 1JY2N 1PFIA 1KILA 1S9KD 1CZQA 1LTJA 2IPPA 1XTGB 3HE5A 2WSCH 3P8CE 1NWQA 1SQQK 1IFNA 1S9KE 2OYHA 1IFDA 1JOCA 1WRGA 4DOJA 2YNYA 5KTBA 1J1DC 1HWTC 3M91A 2FYZA 5KJ7D 1EQ7A 4WY4D 4W7ZA 3T97A 3V2PA 2E42A 4C7NA 1NAFA 1W2EA 2XKMA 3MTUE 2HPCB 3G3ZA 4ZKUA 1N73C 1N7SB 3RK2C 1WT6A 5APQA 2Q7CA 3V5BA 1N7LA 1HTLC 2I1KA 1T8ZA 1NTKK 1G1JA 2KYVA 3V2NA 2N9BA 1NHLA 1HJBA 1YYCA 4LC1A 3SWYA 3LIEA 3NMDA 3VP9A 2LKMA 1ZN5A 1JUNA 3KDPB 3A7OA 3BRTB 4KHXA 5APUA 4N78D 1Z56A 2Z5IA 3LW5H 2IX7C 1GU4A 1YTZI 1LTBC 3N4XA 1L4AB 2E43A 4N78E 2I1JA 4N3YB 1H88A 3MGNA 2Q5UA 1LTAC 3SWFA 3L36A 1FOSE 3HTKB 3MD0A 1FOSF 2WT7B 2WSEH 5CJ4A 3TSIA 1NU1K 2BASA 1URQD 1GL2B 2XU6A 1MFZA 2M8RA 1JY3N 3RL0B 2HFED 1LTIC 1GD2E 4EOTA 2HPCA 1NTMK 3HUSB 1HVVA 3H6PA 2O01H 2WTYA 1FBMA 3TNUB 2XV5A 3M9QA 2Z4EA 3VTPC 1LT9B 2OYHC 1N86A 1JNMA 1L4AD 4W80A 3RK3C 3VMXA 3MUDA 1URQA 4XA4A 4AUWA 2HYNA 1G2CA 2Q3IA 3V4QA 1GL2D 5AW1B 1LWUC 5CMZA 2IFNA 1SQBK 1M7LA 3LIDA 3NFQA 1AFOA 3HE4B 5AW2B 5BU8B 2XZRA 3M0DC 5APVA 3E1IA 5AW3B 4Y99B 2ZXEB 3HTKA 3HD7D 3B5NB 5KJ7C 1A02F 5CCGD 4ZKPA 4WY4C 4O9BA 4WBAA 2W27A 3P8CD 5AW7B 4M3LA 2FXMA 4N6JA 1GTWA 4IFFA 2WZ7A 3U59A 1L0NK 3PP5A 1SLQA 3HUSA 1IFJA 5BVZA 3VMZA 3EFGA 4C7RA 1LT9A 3BASA 2HODA 3HD7A 3CI9A 2O1JA 2R3CA 2A45G 3IFMA 5CCGA 2OARA 4GT1A 1LTGC 1X79B 2GUVA 1CW5A 2JEEA 1A02J 1X8YA 1HH0A 1FZFA 1LWUA 2YMYA 5APWA 1RF1B 3B5ND 1N2DC 2R5DA 1JTHB 2OYIA 2FFDB 3GHGA 1GZLA 2P7JA 3V2QA 2J58A 3IR9A 2WSFH 1FZCA 3M0DA 2PP6A 1NOHA 2YKPA 3R2PA 3L4FA 5KLVK 5KJ7A 1ZR4A 4WY4A 1M1JA 3O8ZA 1URQC 2JJLA 1JY3P 2WPSA 1N73B 1SFCB 1H8AA 3OAKA 3RK2B 2KLVA 3BRVB 3VN0A 1RE3C 1JY2O 3P32A 3VOPA 1IJDB 3H32B 2YO3A 3TK1A 1IO4A 1L4AC 1N7SD 2XDJA 1LGHB 3KPEA 2NPSB 5AW8B 4LGDE 4XE5B 2C0WA 3M9BA 1GL2C 1ZR2A 3I5CA 1RF1A 3U1AA 3RL0C 3U1CA 1RE4C 1T2KD 1SFCD 2FFDA 4IFDK 1KQLA 2KP8A 1GK6A 3NTNA 3HUSC 5AVSB 5APYA 1N7SA 2N1TB 2POHA 4I2LC 1GW3A 2FYUK 3OJAB 1RY3A 2GUSA 1LT9C 1MUUA 3HD7C 1KILB 5AVWB 3VYIA 5CCGC 1JY2P 1LTJB 5CHXA 3V4WA 2NPSD 2CPBA 3HE5B 4JYCA 3V2RA 4IFMA 3A5TA 2C0XA 2GM4A 1RE3A 3RL0D 2OYHB 2OYIC 1SQPK 3GHGC 1JCCA 1HGVA 4EIJA 4LLHA 1FZBA 1NO4A 5APXA 3BVHA 3L37A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4JF7 A;  1L4A A;  3HD7 A;  1T3J A;  3KYQ A;  4OH8 B;  5CCG A;  1NHL A;  2N1T D;  2N1T C;  5CCH D;  2KOG A;  5CCH C;  1GL2 A;  2YMY A;  3B5N D;  3B5N C;  1KIL C;  1JTH B;  1SFC A;  1L4A B;  3RK3 B;  4N78 E;  4W7Y A;  3HD7 B;  2PP6 A;  3HTK B;  5KJ7 A;  5CCH A;  4WY4 A;  3TSI A;  1URQ D;  1GL2 B;  1URQ C;  2M8R A;  3RL0 B;  2HFE D;  2NPS A;  1SFC B;  3RK2 B;  1KIL D;  1HVV A;  3VOP A;  1L4A D;  1L4A C;  1N7S D;  4WY4 B;  1N7S C;  4W80 A;  2XDJ A;  3RK3 C;  3RK3 D;  2N1T A;  1URQ A;  2NPS B;  2H8P D;  3B5N A;  4LGD E;  1KIL A;  1GL2 D;  1GL2 C;  3RL0 C;  1XTG B;  1SFC D;  1SFC C;  3P8C E;  1N7S A;  2N1T B;  1URQ B;  3M0D C;  3HD7 D;  3HD7 C;  5KJ7 D;  3B5N B;  5KJ7 C;  1KIL B;  5CCG D;  4WY4 D;  5CCG C;  4WY4 C;  4W7Z A;  2NPS D;  2NPS C;  2WZ7 A;  3RL0 D;  2HG5 D;  1JTH A;  3PP5 A;  1N7S B;  3RK2 D;  3RK2 C; 
#chains in the Genus database with same CATH topology
 1JM0 A;  5AW4 B;  5GTH E;  3P8M C;  1JB0 J;  3T97 B;  3M06 A;  2WT7 A;  2WPV B;  3CCL P;  4Y99 C;  1M1J C;  1M1K Q;  3B5N C;  4I1L A;  3PH0 A;  1RE4 A;  1QL1 A;  3H1L E;  2ZT9 C;  3WMM 0;  1JY3 O;  2JDI H;  1KFM A;  3II6 A;  1JCD A;  3TNU A;  5KLV J;  4ZMD A;  3TF5 A;  4PD4 I;  2KLU A;  5AVU B;  5CCH A;  3VMA A;  2IFM A;  1M90 Q;  1OWA A;  2BEQ D;  1YIJ P;  1NJI Q;  2O3J A;  3L72 D;  1RF1 C;  1FJK A;  2Q3E A;  2FFD C;  3AEA C;  2JWA A;  1SQV J;  4JYB A;  2C9L Y;  3A2A A;  1RHZ B;  2P2U A;  2FYN C;  1SQP D;  3M9H A;  4HJG H;  2MJZ A;  1G1I A;  3L71 J;  5KKZ C;  3MIW A;  1YQ4 C;  1SQV K;  1SVF A;  3AE9 C;  1QX8 A;  3KZI E;  4I6M C;  5AVR B;  1FU1 A;  1ZOY C;  1FAV A;  4NPD A;  3F89 A;  2QE7 H;  4H44 C;  3G9R A;  1NVO A;  3RK2 D;  4JF7 A;  1KV4 A;  4CPG A;  1EDL A;  1T6A A;  1VF5 D;  2RMZ A;  2N1T C;  1CSB A;  2NRG A;  2KOG A;  1L2P A;  2D2C B;  3UIA A;  2YKO A;  1SFC A;  2WSS H;  5B66 E;  4PJ0 E;  2OTJ P;  2QJP C;  4W7Y A;  3MHV A;  4UB8 E;  3H1I G;  1DH3 A;  5B66 H;  2A06 E;  1IFI A;  2E76 B;  1LWU B;  4C7N B;  3AEB C;  2OYI B;  1NTZ D;  3TYY A;  1FZG A;  4D6T D;  1DX7 A;  1KTM A;  1EXI A;  1GU5 A;  1JMM A;  1EZV E;  4AQR D;  1JY2 N;  1P84 D;  1SQB G;  2IPP A;  1W5C E;  5KLI C;  1XTG B;  3HE5 A;  3G4S P;  1NWQ A;  3L73 G;  1U57 A;  1JOC A;  1Y47 A;  1NTK J;  4L74 A;  2JO1 A;  3CX5 I;  1J1D C;  1HWT C;  1KQF B;  1S2E A;  1Q7Y Q;  4WY4 D;  1R5S A;  4C7N A;  1NAF A;  1MKM A;  3MTU E;  2BEZ F;  3PLN A;  4ZKU A;  1N7S B;  1WT6 A;  5APQ A;  3V5B A;  1N7L A;  1T8Z A;  1NTK K;  1L0L J;  3SWY A;  3NMD A;  3VP9 A;  1ZN5 A;  3A7O A;  4RKU J;  1QEX A;  1GU4 A;  1L4A B;  3FGA D;  1M57 D;  3HTK B;  2B89 A;  2JWD A;  3TSI A;  1HF9 A;  1Q86 Q;  2M8R A;  5B5E H;  3RL0 B;  2H89 C;  2HFE D;  2ZYD A;  2BCC D;  3Q1M A;  1NTM K;  1PP9 D;  3CXH I;  1FDI A;  2XV5 A;  1SQV G;  1N86 A;  3RK3 C;  3VMX A;  1S5L E;  1URQ A;  1Q2N A;  2HYN A;  3TDK A;  1BGY D;  2MKV A;  3CCU P;  2K88 A;  1M8O B;  1VQO P;  5CMZ A;  4IL6 E;  1E79 H;  1KOR A;  3L71 G;  3NFQ A;  2KS1 A;  5TIS E;  3D71 A;  5BU8 B;  3AED C;  4Y99 B;  3HTK A;  2OQQ A;  3SFE C;  3B5N B;  5KJ7 C;  1A02 F;  5CCG D;  5TIS H;  2W27 A;  5AW7 B;  5CBO A;  2QG4 A;  2WZ7 A;  2YMK A;  3WUV A;  2WMM A;  3U59 A;  1L0N K;  1NU1 D;  3HD7 A;  3CI9 A;  2O1J A;  2KK7 A;  2SPZ A;  2OAR A;  1LTG C;  2GUV A;  1CW5 A;  1K05 A;  1KYO D;  2K9J B;  2KNC A;  2G3A A;  1RF1 B;  1JTH B;  2FFD B;  3GHG A;  4DCK A;  2LXB A;  2FYN B;  3M0D A;  2PP6 A;  4R4L A;  4BWN A;  2YKP A;  3WU2 H;  3R2P A;  3L4F A;  1M1J A;  1SQB E;  3RK2 B;  3BRV B;  3L73 E;  2KUB A;  1IJD B;  1U7M A;  2FYU J;  1MFT A;  3L72 J;  1IO4 A;  3L70 J;  3KPE A;  2OGU A;  4H44 B;  4XE5 B;  1VQN P;  1GL2 C;  1RF1 A;  3U1A A;  1BE3 E;  1SQP J;  2FBW C;  1SFC D;  2FFD A;  3AE3 C;  1KQL A;  2XND H;  3CWB G;  1LP1 A;  1NTK G;  2B9B A;  5APY A;  2N1T B;  2POH A;  4I2L C;  1GW3 A;  2FYU K;  3C1L A;  1LNQ A;  5AVW B;  2O01 N;  1VQM P;  4KT0 J;  1JY2 P;  3V4W A;  4JYC A;  4IFM A;  2E76 C;  2QJP B;  2C0X A;  2OYH B;  3A0B E;  2I8D A;  2OYI C;  1SQP K;  4EIJ A;  3AEF C;  3BVH A;  1NO4 A;  2KZI A;  1VQ6 P;  3QWO C;  1PPJ G;  3EFF K;  5AW5 B;  5KLV E;  4K35 A;  1QLE D;  4UB6 H;  2IBZ G;  3A0B H;  1KC8 Q;  3GLM A;  2G8Y A;  3H1L D;  1NH4 A;  1P84 I;  4C46 A;  2KSJ A;  2M0B A;  1XTC C;  3AE5 C;  2RN0 A;  1SQV E;  1J2J B;  1NKZ B;  1OVV A;  3A0H H;  1VPC A;  2PFX A;  3CCE P;  3GF7 A;  3CL3 D;  2QEX P;  3CPW O;  2ITA A;  3A3Y B;  2E5T A;  1CI6 B;  5GTI H;  2WPR A;  3VMY A;  3EQ2 A;  3L71 E;  1J1D B;  1RF0 C;  2A45 I;  1ZXG A;  4B86 A;  2OTL P;  1N7S C;  3L75 D;  1NKN A;  3H1I J;  1FJP A;  2DW3 A;  1PGJ A;  4MN4 C;  1YQ3 C;  3CLQ A;  1LTS C;  3L74 J;  1L0N G;  3NXS A;  5APS A;  1KFN A;  2P58 A;  5KAI E;  2QVA A;  1T2K C;  1SQX J;  2QJK B;  4PD4 H;  1NTZ K;  1TU3 F;  1GDT A;  1FE6 A;  4XFJ A;  1IC2 A;  3I56 P;  1CI6 A;  1SQX K;  1PGO A;  2FY8 A;  4HH2 A;  5APT A;  4OH8 B;  2L91 A;  4GIF A;  1FS0 E;  4BXL A;  2QJY C;  1KIL C;  2E74 D;  4EI2 A;  2CPS A;  2PGD A;  4H13 D;  3CCV P;  4Z1M H;  1ZV8 A;  3RK3 B;  2HOD B;  2Y0E A;  1OZH A;  3H32 A;  1GMJ A;  2M3B A;  3B8E B;  2NPS A;  2R32 A;  3N7N A;  1ZP0 C;  1QVF O;  1J1E C;  1KIL D;  5AVZ B;  1SQQ J;  2ZVO B;  2R5B A;  1FZC B;  2IZ1 A;  2QM8 A;  2W90 A;  1EZV D;  1NTK E;  2YO2 A;  2FYU G;  3BCC D;  3G71 P;  3L72 G;  1PP9 J;  3L70 G;  1KYO I;  2H8P D;  2O1K A;  2J5U A;  3BAT A;  3WUT A;  2K37 A;  1PFI A;  1SQP G;  4EYY Q;  1LTJ A;  1Y9B A;  1SQQ K;  1IFN A;  5KAF H;  2KZJ A;  1WRG A;  4DOJ A;  1PPJ E;  1VL2 A;  3AE8 C;  1JEK A;  4GDO A;  3M91 A;  2IBZ E;  2K1A A;  4GOE A;  1DD4 A;  2FYZ A;  2W8Z A;  3O6Q B;  1L0L E;  2B87 B;  4BRY B;  3T97 A;  2KI7 B;  1N8R Q;  3TGU J;  4JQ0 D;  1NYH A;  3RK2 C;  2Y9Z A;  2Q7C A;  2ZVN B;  4YTP C;  4OGQ D;  3FX0 A;  1VF5 C;  3V2N A;  1NU1 J;  1NHL A;  3CX5 E;  2M5A B;  3Q2Y A;  2LKM A;  2FXP A;  3KDP B;  4KHX A;  1Z56 A;  2IX7 C;  1LTB C;  3CX5 H;  3N4X A;  2W6J H;  1X22 A;  4N78 E;  3MGN A;  1LTA C;  3L36 A;  3K5B A;  1FOS E;  2AEJ A;  1FOS F;  1NU1 K;  1GL2 B;  3O6Q A;  1OVR A;  3H1H D;  1HVV A;  1NTZ G;  2IDB A;  2WTY A;  1QGK B;  4K3A A;  2OYH C;  2IZ0 A;  4EDF A;  2AEF A;  4XA4 A;  1QVG O;  1Y8A A;  1DD3 A;  3L74 G;  5AW1 B;  2Q6Q A;  4QMA A;  1SQX G;  1ZW0 A;  3SWK A;  1AA0 A;  3HE4 B;  2OYO A;  2KSE A;  5M1B A;  3H25 A;  4ZKP A;  4WY4 C;  3P8C D;  1JMB A;  3CXH H;  2FXM A;  5H2F E;  4ASW A;  3D6Y A;  1Q81 Q;  3Q3D A;  3E1R A;  2OTK E;  1BCC J;  1SLQ A;  1IFJ A;  5BVZ A;  3VMZ A;  3CWB J;  5H2F H;  1YJ9 P;  2R3C A;  2RKL A;  2A45 G;  3IFM A;  4GT1 A;  2JEE A;  3CC2 P;  1LWU A;  2YMY A;  2YIU C;  4OWF A;  2OYI A;  1GZL A;  3V2Q A;  2J58 A;  2WSF H;  2FYU E;  3L72 E;  3L70 E;  2QJK C;  1LJ2 A;  1SQB D;  2JJL A;  1JY3 P;  1N73 B;  3L73 D;  1SQP E;  1SQQ G;  3VN0 A;  1NTM J;  1RE3 C;  3CCS P;  1JY2 O;  2WQY C;  4OVN F;  5B5E E;  2YO3 A;  1PP9 G;  3B4S A;  1VQ5 P;  1AJY A;  1BE3 D;  3H1J J;  4H0L D;  1IZN B;  3L75 J;  4H13 B;  3M9B A;  4L73 A;  1RE4 C;  1BGY G;  3MP7 B;  3HUS C;  4U3F D;  1N7S A;  1YBK A;  2QJY B;  3H1K J;  1KIL B;  2JR8 A;  4ZNC A;  5CCG C;  3G6E P;  4PV1 D;  1Q90 D;  2NPS D;  1YJN P;  1L0N J;  3TGU G;  5KLV D;  1JCC A;  4YXW H;  4LLH A;  4YXD C;  1FZB A;  1DIP A;  1EZV I;  1L4A A;  1FZC C;  2WWW A;  1NU1 G;  2LXC B;  1PGQ A;  1J1E B;  1VQ9 P;  5CCH D;  4WVZ A;  1FZE A;  1SQV D;  3D70 A;  3P7K A;  2PAJ A;  2V7Q J;  2XNX A;  1KQS O;  1HBW A;  1JO5 A;  3JCU E;  4HKZ H;  4DZO A;  1HUC A;  3H1I E;  5AVT B;  4AYC A;  3JCU H;  3L71 D;  3L74 E;  3WU2 E;  1SQX E;  3WUU A;  1KB9 E;  2WPQ A;  2QA4 P;  4OGQ B;  2WIT A;  3AEG C;  2QSI A;  1YTZ T;  5AW0 B;  4GKG A;  3C8V A;  1P84 H;  1KB9 H;  1LTT C;  2ZAE B;  3BCC J;  1KN7 A;  1EDI A;  3ZDM A;  1Q82 Q;  3SFD C;  3B5N A;  2WSF J;  2J59 M;  2H43 A;  1SFC C;  1VF5 B;  4RO0 A;  1DEB A;  5AW6 B;  4L76 A;  5E79 H;  1G2C B;  3F5H A;  2K9J A;  3KQG A;  2LR2 A;  2NZ2 A;  2A45 H;  2HG5 D;  1JTH A;  1BCC G;  1K04 A;  2KXP B;  2KB7 P;  5CJ0 A;  2Q1K A;  5CBN A;  1T3J A;  3QH9 A;  3GF3 A;  4R4M A;  1FDM A;  1DEE G;  1S5L X;  1VDF A;  2YXQ B;  1PV3 A;  1E5W A;  1SQQ E;  1OXZ A;  4UB6 E;  3B71 A;  4IL6 X;  4KJM A;  1PP9 E;  1X9V A;  2AXT H;  3OW2 O;  3OA7 A;  3C9I A;  2HR3 A;  1NTM G;  2D2C D;  3A0H E;  2QM7 A;  3H1H J;  2YKQ A;  4WY4 B;  4TT3 H;  2N1T A;  3W68 A;  1RQU A;  1YIT P;  3H1J G;  5GTI E;  3RK3 E;  3L75 G;  1YJW P;  3TGU E;  1PPJ D;  1UIX A;  2WSC H;  3FWL A;  1S9K E;  2OYH A;  2IBZ D;  1IFD A;  1NTZ J;  1H0T B;  3CCQ P;  1L0L D;  1NU1 E;  3H1K G;  2N9Y B;  4D6T J;  1EQ7 A;  2YIU B;  3PTZ A;  4PD4 E;  3JSV C;  2R44 A;  3V6I A;  1EDK A;  1OW7 A;  1N73 C;  1KYO H;  3ABV C;  2KYV A;  2K3R A;  1HJB A;  4LC1 A;  1PGP A;  2K9Y A;  5APU A;  4N78 D;  1NAY A;  2E74 C;  2Z5I A;  2AXC A;  1WMK A;  1ZRT E;  3E7K A;  4H13 C;  2E43 A;  2I1J A;  4N3Y B;  1H88 A;  4TLF A;  3MD0 A;  2JKV A;  2WT7 B;  1URQ D;  2XU6 A;  1JY3 N;  2E5Y A;  1LTI C;  3RGU A;  4EOT A;  3HUS B;  1VQK P;  2IYO A;  3H6P A;  2ZXX A;  1FBM A;  2WSE J;  3TNU B;  2Z4E A;  3VTP C;  2A06 D;  2E75 D;  1L4A D;  4W80 A;  3BCC G;  2O01 J;  2Q3I A;  3V4Q A;  1AQT A;  1SQB K;  1IK7 A;  1BCC E;  3LID A;  1R5L A;  3RBX A;  3CWB E;  2GA1 A;  1YI2 P;  4L75 A;  2BCC J;  3IN6 A;  5AW2 B;  3M0D C;  4YPC A;  3HD7 D;  4U3F J;  2W83 C;  5KAF E;  5GTH H;  1RQV A;  4WBA A;  4N6J A;  3AE6 C;  1AV1 A;  4IFF A;  3PP5 A;  4DT0 A;  3HUS A;  1BGY J;  3AEC C;  3EFG A;  4C7R A;  4I7Z C;  3BAS A;  2HOD A;  3AE1 C;  4OGQ C;  2ZYG A;  5CCG A;  1PL5 A;  1X79 B;  1BDC A;  1X8Y A;  2WSC J;  2QRX A;  4HB1 A;  5APW A;  2JP3 A;  3B5N D;  1N2D C;  1NTM E;  1OIP A;  2FYU D;  1K73 Q;  2ZT9 D;  2ZYA A;  3L70 D;  3AE7 C;  3I55 P;  1FZC A;  1IFP A;  2RH0 A;  1NOH A;  3GW6 A;  5KLV K;  5KJ7 A;  3FWN A;  3H1J E;  1ZR4 A;  3MUD C;  3L75 E;  2WPS A;  1D7M A;  1FDO A;  1SFC B;  1X0T A;  3Q5R A;  4NPE A;  2IYP A;  3H1H G;  4JBZ A;  1USD A;  3TK1 A;  3H1K E;  5AW8 B;  4Y28 J;  1R8E A;  4LGD E;  1K9M Q;  2B87 A;  4BRY A;  2Y0D A;  1KQG B;  3KZI H;  1L0N E;  1OW8 A;  1LT1 A;  2WVR A;  1GK6 A;  3NTN A;  4GOF A;  5AVS B;  3AE2 C;  3OJA B;  2GUS A;  1LT9 C;  4D6T G;  3VYI A;  2CPB A;  3HE5 B;  3V2R A;  2M5A A;  1OMI A;  4H44 D;  3AE4 C;  3IF4 A;  1W2B O;  5C39 A;  1S1C X;  1SP4 A;  3CXH E;  3KYQ A;  1MV8 A;  4PJ0 H;  4IOI H;  4ASV A;  2N1T D;  5AVY B;  2V7Q H;  2VRS A;  4UB8 H;  1AVO A;  1GK4 A;  1GL2 A;  3CCJ P;  3RL0 g;  1OW6 A;  1IFM A;  1KIL E;  3H1I D;  2IBZ I;  1AQ5 A;  1U7J A;  2H7H A;  3PRJ A;  4RES B;  3BCC E;  3L74 D;  1FZA A;  1SQX D;  1KB9 D;  3CCM P;  1EXJ A;  3H1L J;  5AVQ B;  4GOD A;  1PIX A;  1MZ9 A;  1ZLL A;  2KIK A;  3SSU A;  2V4H A;  3HE4 A;  3VP8 A;  4H0L C;  1GW4 A;  1BE3 G;  3CC4 P;  2HLO A;  1VQP P;  3USS A;  2P10 A;  5AVV B;  2BCC G;  3D6Z A;  1OVU A;  1URQ B;  4A7P A;  4U3F G;  1IK9 A;  2Q9I A;  3M0A A;  2FKW B;  2E74 B;  4PV1 C;  2C9N Y;  2NPS C;  5BU5 A;  1ZME C;  3L35 A;  2E75 B;  1RF0 A;  2KS1 B;  2W6B A;  5KLV G;  5AW9 B;  2P67 A;  5AVX B;  2W6A A;  1SQQ D;  2L5G B;  5CCH C;  1VQ8 P;  1L0L K;  1YHQ P;  2R3S A;  4WWI A;  1N73 A;  2P1J A;  1LTJ C;  4RJT A;  2ZFC A;  3GG2 A;  1EC5 A;  3H1H E;  3HD7 B;  3IAO A;  4JPZ B;  2Y0C A;  1K8A Q;  3CCR P;  1QL2 A;  2AEM A;  2Z5H A;  3PJS K;  2KNC B;  3HRN A;  3CD6 P;  1T3U A;  3GHG B;  3CME P;  1S5L H;  2FXO A;  3GMA A;  4HYT B;  5L8R J;  3AEE C;  1NTZ E;  4IL6 H;  3RK3 D;  1M1J B;  1HGZ A;  5DJU B;  4D6T E;  1H89 A;  1KZU B;  3JC2 2;  4WB4 A;  3TGU D;  2ZT9 B;  1KIL A;  1VQ7 P;  1S9K D;  1CZQ A;  3Q5S A;  5K5G B;  3P8C E;  1BSN A;  1P84 E;  4I7Z B;  2YNY A;  5KTB A;  4PD4 D;  5KJ7 D;  4W7Z A;  3MZW B;  3V2P A;  2E42 A;  1W2E A;  2QIW A;  2XKM A;  2HPC B;  3G3Z A;  1LP1 B;  5E79 E;  5DJT B;  3PHL A;  1HTL C;  2I1K A;  1G1J A;  1VQL P;  2N9B A;  1YYC A;  3LIE A;  1ZRT D;  1VQ4 P;  1JUN A;  2CK3 H;  3BRT B;  5KKZ B;  1BDD A;  3LW5 H;  1UII A;  3W67 A;  1YTZ I;  1KMI Z;  1NGM B;  3CC7 P;  2Q5U A;  3CMA P;  3SWF A;  4NPF X;  2WSE H;  5CJ4 A;  2BAS A;  1MFZ A;  1USE A;  3S1K A;  1GD2 E;  1PZQ A;  2D2C C;  2HPC A;  3H1L G;  2M3E A;  2O01 H;  2UWJ E;  3M9Q A;  2BCC E;  1LT9 B;  2AXT E;  1EDJ A;  1JNM A;  2PRR A;  3MUD A;  4U3F E;  4AUW A;  2B88 A;  1G2C A;  1BCC D;  1GL2 D;  1LWU C;  3R4Y A;  2IFN A;  3CWB D;  3FXD A;  1M7L A;  1NTK D;  1BGY E;  3KXD A;  1AFO A;  2XZR A;  5APV A;  3S9O A;  3E1I A;  5AW3 B;  2ZXE B;  1L0L G;  4O9B A;  1KB9 I;  4M3L A;  2E76 D;  1GTW A;  2YXR B;  1S72 P;  2Y9Y A;  1LT9 A;  3S4R A;  1NTM D;  1A02 J;  1OFC X;  5KLI B;  1HH0 A;  3RBZ A;  1FZF A;  2R5D A;  1KYO E;  2ZJS E;  1HJ0 A;  1BSH A;  4U7J A;  1KD1 Q;  2P7J A;  5EFW B;  3IR9 A;  3Q5P A;  1S4X A;  3H1J D;  3CX5 D;  4H0L B;  4WY4 A;  3O8Z A;  1URQ C;  3FXE A;  1H8A A;  3OAK A;  2KLV A;  3P32 A;  3VOP A;  3H1K D;  3H32 B;  3EWK A;  2E75 C;  1L4A C;  1N7S D;  5KAI H;  1H0T A;  2XDJ A;  1LGH B;  4PV1 B;  1OX3 A;  2A06 G;  1RH5 B;  2NPS B;  3LW5 J;  1L0N D;  2C0W A;  2H88 C;  1ZR2 A;  3I5C A;  1SQB J;  3RL0 C;  3U1C A;  1T2K D;  4IFD K;  2KP8 A;  1FC2 C;  1M56 D;  3L73 J;  1AVY A;  1RY3 A;  1SS1 A;  5TJH A;  4DJG A;  1MUU A;  1EZV G;  3HD7 C;  1LTJ B;  5CHX A;  1S3J A;  3A5T A;  3KHU A;  1RE3 A;  3RL0 D;  2GM4 A;  1BE3 J;  3GHG C;  3ITK A;  1HGV A;  3CXH D;  5APX A;  3L37 A; 
#chains in the Genus database with same CATH homology
 5AW4 B;  1SP4 A;  1L4A A;  5AW5 B;  3P8M C;  1FZC C;  2WWW A;  3KYQ A;  1MV8 A;  2N1T D;  5AVY B;  3M06 A;  1J1E B;  5CCH D;  2VRS A;  2WT7 A;  1NH4 A;  4Y99 C;  1M1J C;  1GK4 A;  1GL2 A;  3B5N C;  4C46 A;  4I1L A;  1FZE A;  2KSJ A;  1RE4 A;  1QL1 A;  1IFM A;  1XTC C;  3P7K A;  3WMM 0;  1JY3 O;  2PAJ A;  1KFM A;  1AQ5 A;  2XNX A;  3II6 A;  1HBW A;  1JO5 A;  1J2J B;  4DZO A;  1JCD A;  3TNU A;  1HUC A;  2H7H A;  1NKZ B;  4RES B;  1VPC A;  5AVU B;  5AVT B;  5CCH A;  3CL3 D;  1FZA A;  4AYC A;  2IFM A;  1OWA A;  3A3Y B;  1CI6 B;  2WPR A;  1RF1 C;  3VMY A;  5AVQ B;  3EQ2 A;  2WPQ A;  1FJK A;  2WIT A;  1J1D B;  1RF0 C;  2FFD C;  2A45 I;  4JYB A;  1MZ9 A;  1YTZ T;  1ZLL A;  5AW0 B;  2C9L Y;  3A2A A;  4GKG A;  4B86 A;  1N7S C;  2P2U A;  1NKN A;  3HE4 A;  1FJP A;  1LTT C;  3VP8 A;  3M9H A;  3B5N A;  3CLQ A;  2MJZ A;  1LTS C;  1GW4 A;  1G1I A;  3NXS A;  5APS A;  1KFN A;  2J59 M;  2H43 A;  2HLO A;  1T2K C;  1SFC C;  5AVV B;  1NTZ K;  3MIW A;  1URQ B;  1DEB A;  1GDT A;  1SQV K;  1SVF A;  5AW6 B;  4I6M C;  5AVR B;  1IK9 A;  1G2C B;  1FU1 A;  2Q9I A;  3M0A A;  2FKW B;  1FAV A;  2C9N Y;  1IC2 A;  2NPS C;  5BU5 A;  3KQG A;  2A45 H;  2HG5 D;  1CI6 A;  1JTH A;  3L35 A;  1RF0 A;  3RK2 D;  2W6B A;  1SQX K;  4JF7 A;  2KB7 P;  5CJ0 A;  5AW9 B;  4HH2 A;  2P67 A;  5APT A;  1T3J A;  4OH8 B;  5AVX B;  2N1T C;  1CSB A;  2W6A A;  4GIF A;  2L5G B;  2KOG A;  5CCH C;  1FDM A;  3UIA A;  1L0L K;  1VDF A;  2YKO A;  1E5W A;  1KIL C;  1N73 A;  1OXZ A;  1SFC A;  2P1J A;  1LTJ C;  2ZFC A;  2CPS A;  1ZV8 A;  3RK3 B;  4W7Y A;  2HOD B;  3HD7 B;  1DH3 A;  3H32 A;  1IFI A;  1QL2 A;  2M3B A;  2Z5H A;  1LWU B;  4C7N B;  1X9V A;  3HRN A;  3B8E B;  2OYI B;  1T3U A;  2NPS A;  2R32 A;  3GHG B;  3N7N A;  3OA7 A;  1J1E C;  3C9I A;  3TYY A;  1KIL D;  5AVZ B;  1FZG A;  4HYT B;  2R5B A;  1FZC B;  2QM7 A;  2QM8 A;  2YO2 A;  1DX7 A;  2YKQ A;  3RK3 D;  4WY4 B;  1M1J B;  1GU5 A;  1HGZ A;  2N1T A;  1JMM A;  4AQR D;  1H89 A;  1KZU B;  2H8P D;  2O1K A;  3BAT A;  4WB4 A;  1JY2 N;  1PFI A;  1KIL A;  1S9K D;  1CZQ A;  1LTJ A;  2IPP A;  1XTG B;  3HE5 A;  2WSC H;  3P8C E;  1NWQ A;  1SQQ K;  1IFN A;  1S9K E;  2OYH A;  1IFD A;  1JOC A;  1WRG A;  4DOJ A;  2YNY A;  5KTB A;  1J1D C;  1HWT C;  3M91 A;  2FYZ A;  5KJ7 D;  1EQ7 A;  4WY4 D;  4W7Z A;  3T97 A;  3V2P A;  2E42 A;  4C7N A;  1NAF A;  1W2E A;  2XKM A;  3MTU E;  2HPC B;  3G3Z A;  4ZKU A;  1N73 C;  1N7S B;  3RK2 C;  1WT6 A;  5APQ A;  2Q7C A;  3V5B A;  1N7L A;  1HTL C;  2I1K A;  1T8Z A;  1NTK K;  1G1J A;  2KYV A;  3V2N A;  2N9B A;  1NHL A;  1HJB A;  1YYC A;  4LC1 A;  3SWY A;  3LIE A;  3NMD A;  3VP9 A;  2LKM A;  1ZN5 A;  1JUN A;  3KDP B;  3A7O A;  3BRT B;  4KHX A;  5APU A;  4N78 D;  1Z56 A;  2Z5I A;  3LW5 H;  2IX7 C;  1GU4 A;  1YTZ I;  1LTB C;  3N4X A;  1L4A B;  2E43 A;  4N78 E;  2I1J A;  4N3Y B;  1H88 A;  3MGN A;  2Q5U A;  1LTA C;  3SWF A;  3L36 A;  1FOS E;  3HTK B;  3MD0 A;  1FOS F;  2WT7 B;  2WSE H;  5CJ4 A;  3TSI A;  1NU1 K;  2BAS A;  1URQ D;  1GL2 B;  2XU6 A;  1MFZ A;  2M8R A;  1JY3 N;  3RL0 B;  2HFE D;  1LTI C;  1GD2 E;  4EOT A;  2HPC A;  1NTM K;  3HUS B;  1HVV A;  3H6P A;  2O01 H;  2WTY A;  1FBM A;  3TNU B;  2XV5 A;  3M9Q A;  2Z4E A;  3VTP C;  1LT9 B;  2OYH C;  1N86 A;  1JNM A;  1L4A D;  4W80 A;  3RK3 C;  3VMX A;  3MUD A;  1URQ A;  4XA4 A;  4AUW A;  2HYN A;  1G2C A;  2Q3I A;  3V4Q A;  1GL2 D;  5AW1 B;  1LWU C;  5CMZ A;  2IFN A;  1SQB K;  1M7L A;  3LID A;  3NFQ A;  1AFO A;  3HE4 B;  5AW2 B;  5BU8 B;  2XZR A;  3M0D C;  5APV A;  3E1I A;  5AW3 B;  4Y99 B;  2ZXE B;  3HTK A;  3HD7 D;  3B5N B;  5KJ7 C;  1A02 F;  5CCG D;  4ZKP A;  4WY4 C;  4O9B A;  4WBA A;  2W27 A;  3P8C D;  5AW7 B;  4M3L A;  2FXM A;  4N6J A;  1GTW A;  4IFF A;  2WZ7 A;  3U59 A;  1L0N K;  3PP5 A;  1SLQ A;  3HUS A;  1IFJ A;  5BVZ A;  3VMZ A;  3EFG A;  4C7R A;  1LT9 A;  3BAS A;  2HOD A;  3HD7 A;  3CI9 A;  2O1J A;  2R3C A;  2A45 G;  3IFM A;  5CCG A;  2OAR A;  4GT1 A;  1LTG C;  1X79 B;  2GUV A;  1CW5 A;  2JEE A;  1A02 J;  1X8Y A;  1HH0 A;  1FZF A;  1LWU A;  2YMY A;  5APW A;  1RF1 B;  3B5N D;  1N2D C;  2R5D A;  1JTH B;  2OYI A;  2FFD B;  3GHG A;  1GZL A;  2P7J A;  3V2Q A;  2J58 A;  3IR9 A;  2WSF H;  1FZC A;  3M0D A;  2PP6 A;  1NOH A;  2YKP A;  3R2P A;  3L4F A;  5KLV K;  5KJ7 A;  1ZR4 A;  4WY4 A;  1M1J A;  3O8Z A;  1URQ C;  2JJL A;  1JY3 P;  2WPS A;  1N73 B;  1SFC B;  1H8A A;  3OAK A;  3RK2 B;  2KLV A;  3BRV B;  3VN0 A;  1RE3 C;  1JY2 O;  3P32 A;  3VOP A;  1IJD B;  3H32 B;  2YO3 A;  3TK1 A;  1IO4 A;  1L4A C;  1N7S D;  2XDJ A;  1LGH B;  3KPE A;  2NPS B;  5AW8 B;  4LGD E;  4XE5 B;  2C0W A;  3M9B A;  1GL2 C;  1ZR2 A;  3I5C A;  1RF1 A;  3U1A A;  3RL0 C;  3U1C A;  1RE4 C;  1T2K D;  1SFC D;  2FFD A;  4IFD K;  1KQL A;  2KP8 A;  1GK6 A;  3NTN A;  3HUS C;  5AVS B;  5APY A;  1N7S A;  2N1T B;  2POH A;  4I2L C;  1GW3 A;  2FYU K;  3OJA B;  1RY3 A;  2GUS A;  1LT9 C;  1MUU A;  3HD7 C;  1KIL B;  5AVW B;  3VYI A;  5CCG C;  1JY2 P;  1LTJ B;  5CHX A;  3V4W A;  2NPS D;  2CPB A;  3HE5 B;  4JYC A;  3V2R A;  4IFM A;  3A5T A;  2C0X A;  2GM4 A;  1RE3 A;  3RL0 D;  2OYH B;  2OYI C;  1SQP K;  3GHG C;  1JCC A;  1HGV A;  4EIJ A;  4LLH A;  1FZB A;  1NO4 A;  5APX A;  3BVH A;  3L37 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...