5AW0B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw0B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw0B02
5APSA 3A3YB 5AVVB 3V5BA 1JUNA 2WT7B 5CMZA 5AW4B 3A5TA 1SP4A 2R5DA 1GK6A 1MV8A 4XE5B 5AVZB 1NWQA 2YO2A 3VYIA 3WGUB 1FOSE 3VMZA 3VTPC 2WT7A 2H7HA 2ZFCA 3HE4A 3HE5A 3V4QA 3T97A 5AW2B 2WPRA 3P32A 3VMYA 1T2KC 1FOSF 2JJLA 4HYTB 1S9KD 1YYCA 1A02J 1CI6A 1CI6B 1JNMA 5AVXB 1MFZA 4AUWA 2P67A 3A7OA 2WPSA 5AW0B 3MGNA 4JYCA 3HE5B 4AYCA 3P8MC 1G2CB 2P2UA 4JYBA 5APYA 1GTWA 2C9LY 4GT1A 1GK4A 1GU5A 3SWFA 1HWTC 3TNUB 3IR9A 1MUUA 3P7KA 4RESB 3M06A 1HJBA 2QM7A 1FAVA 3M9HA 5AVYB 3VN0A 1H89A 3VMXA 4I6MC 5AW8B 5AW6B 3L36A 1H88A 2KP8A 3NXSA 3TNUA 1OWAA 1GZLA 2R3CA 3A2AA 1CZQA 2Z5HA 2WWWA 3L37A 5APQA 3LIDA 3M0AA 2E42A 5AVWB 2ZXEB 4M3LA 5AW5B 2XZRA 1OXZA 3MD0A 2P7JA 1J2JB 5AW3B 5AW9B 2Q3IA 4C46A 1DH3A 3TK1A 4KHXA 2N9BA 5AVRB 3HTKA 3M9BA 3OAKA 4LC1A 3KDPB 1S9KE 2W6AA 2XV5A 3UIAA 2R5BA 1H8AA 2R32A 1GD2E 1IO4A 2YNYA 2XU6A 5APVA 5APXA 2C9NY 4RETB 2VRSA 5APWA 2YO3A 4EOTA 5AW1B 4I2LC 5APUA 2E43A 3M0DA 1A02F 4AQRD 3HE4B 2IPPA 2Q5UA 3I5CA 1X8YA 3WGVB 2BASA 1NAFA 3B8EB 3NMDA 1T2KD 4C7NA 3NTNA 3LIEA 5AVUB 5AVQB 4B86A 4GKGA 3TYYA 2Q7CA 2Z5IA 5AVSB 1GU4A 1HBWA 2WPQA 2W27A 4DZOA 1HUCA 3V4WA 3M91A 1CSBA 2QM8A 4C7NB 3KQGA 5AW7B 3L35A 5APTA 5AVTB 2WTYA 3NFQA 1KQLA 3O8ZA 1SLQA
chains in the Genus database with same CATH superfamily
4LGPB 4NZUL 4I9WD 1ZXKA 5ENWB 4IBTA 4L0ZA 2QBWA 4L4VE 1IFPA 4ZO7A 5C7XH 1JZ6A 4HGWA 1U3JA 4Z78B 1L4AB 2YAPA 5E2WL 1OF2A 1T6AA 3PWNB 3NJKA 2CDGA 5E94B 3CFUA 4HKBA 1OX3A 1E0OB 2TSBA 4LVNC 3DX8B 1WYJA 2P48B 4XP6H 4MDRA 3OR6B 2H45A 4EN3C 1PP9J 5EU4B 1P84K 1F13A 4PGDB 1Q4NX 2I25N 1FSKB 3HG0A 1JV2A 1LWUB 1H8OA 4BXVA 2BSRA 5LG6A 5C0AD 2I07A 4PRID 2ZXCA 5APYA 4GRMA 2BINA 1OAJA 1XD1A 2K0RA 4NRZA 2ITAA 2JF1A 2VDPB 6PAZA 5JPNA 2EQDA 1PGQA 3DUHA 1AS6A 1I1FB 1MUUA 1K72A 1KXTA 1A6AA 1A8JH 2HLFC 4XNQB 2ZUYA 3V4LA 2ICWA 1D9KA 1MZ9A 3GIZH 4FTVB 3HNTL 4P5SA 3BVUA 2HJLB 3FPYA 3VMAA 5C8JB 5C2BL 2XX0A 3I84A 4LAQH 2FX8H 2IQ9L 5FR3A 4AUYA 3RJDA 2XIDA 7PAZA 2DS4A 3S36H 3U6XA 3V4VH 5JORB 3OJDA 5C9JA 2Y5EA 1JGLH 1S8DA 2IO5A 4LSVH 4DVBA 3HBZA 4XPBH 2A2QT 2RFXB 3OAWA 3QR2A 1SYSB 5SWZD 5KYWA 3ZVVA 2QQNH 2MCPH 2PXYB 1VSCA 5FA3B 2J43A 1SFCA 2CDGB 5CILH 1QOKA 1L0PA 3DDGA 5TJWK 3RHWF 4DKAA 1JYNA 5JHDE 2WSEH 3VGAB 1Z9NA 5CCHD 1RZIA 2C26A 3CZEA 3SDDC 1U92B 1KJ2A 4P23C 3U1SH 1NIBA 1RK1A 4P2QE 3CN2A 3S8GB 3K2IA 5AZEL 3FSWA 4U6VL 3USSA 1A21A 1YJDC 2UX6A 3O0LA 4QRRE 2WCGA 4FNLH 2DWEB 4PS7A 1AHKA 2FX9L 3QEQB 4JDZB 4L3FA 3F84A 2XV2A 3QDMB 3MLTB 4FQ2L 3I5CA 3ZTJH 3VD9A 2HPOA 4C4UA 1YECH 2QPUA 5GZNA 2XQYA 1NCGA 3OAZK 2YGNA 4HJGB 5SWZB 1IGJB 1V3JA 3TSIA 4YDMA 3S34H 5FKAA 1YEEL 1I3RB 3MHZA 3RGBA 1RQUA 2D2CC 1U8OA 4OIBA 4POZC 5GSVB 1J11A 1U8CB 4Z3HA 4G1MA 3APFA 5F7NC 1RE3C 2BJMH 1DJXA 1IBYA 3WFCL 5BNXD 1YMHB 2Z31B 4N2CA 3M86A 3AE4C 1LTTC 3DHUA 3HC3H 2DM3A 1ETZB 3O11B 4Z8FH 2EC8A 1TQBB 4NKDA 1EXUB 3CXDL 1YPZE 4LASH 3U6RB 4YQXL 2J1WA 3WNJA 2HH0L 1GY1A 2YD7A 4EI6B 2GHWB 3CCVP 1N5YL 3KEDA 3Q5SA 3CZJA 4NO0A 1UD5A 4U1LB 3B5NA 3S0PA 2O6DA 4UF7C 3V5DA 2YUVA 1E79H 1KLGA 3D2UB 3V55A 2IDUA 4OFIA 1A9BA 5IB2B 4EE2A 2P7TA 3V4QA 4KK5D 3DSNA 4JY4B 3B34A 2XZAL 4QOKA 2SEBB 3AWFA 1IK9A 2YPLE 1FFPA 1BW8A 1JTOA 3DPBA 2X70A 4HF5L 4AEHH 5SX4H 5KUKA 3K4DA 3R06A 2FLMA 4PFEA 1I8AA 4JEGB 1IL1A 3L70E 4EUPB 3ZJAA 1QLRA 3WFDH 4RFOL 3WYRA 5IQ9B 3K2UH 3NSJA 1E8WA 1IILE 2IDBA 4H25A 2QQKH 3SBWC 5ANMB 3HBPA 4APQA 1SQMA 4N28A 2OQJA 3BDYH 1I9RL 3Q1SH 4UDUA 5EWIH 1NCCL 3TNNB 2P5WD 4MA7H 1H89A 1H3WM 2FEJA 4N2GA 4AW4A 5FF6A 1XF5A 1G1IA 5KJ7E 1R8EA 2YQBA 5E8PB 1PY0A 5F0JB 4NM4H 2WWWA 4L5FE 3WD5L 2GJ6B 4MVBC 1FO0H 3CN3A 4WFHE 2YKKA 3TJHD 5AW5B 1NDGA 4U3FE 3LEXA 4JHWL 2VN5A 2O93L 3M1BA 4R2GB 2DD8H 3L2LA 4MNQB 1U3YA 3C5ZC 1DLHB 3APNA 3RVVD 3G3ZA 4LGDE 3CC2P 1X5MA 2WZ0A 5B1CA 1E67A 3OJVC 3HS0C 3UTZB 1ZTXE 3CPLB 4MN4C 3IDGA 5EBMA 4XOAA 3JWDH 4BZ2A 4LIQL 2AJZA 3R8BB 2X6BA 3ZDXB 4UT9H 1MRDL 1P84E 3NABL 1XGQB 4Q2ZB 2B15A 4TUUA 3TOPA 3QDJE 1U2CA 1J1XH 5I2IB 1MNUL 1KJ3H 1FVEA 3JWNH 1FF5A 2GBUA 3OJ2C 3SE9L 3HZMA 3GI9L 4QXGL 4XHJC 3RPBA 3RZWA 4OGQD 2P45B 1QRND 3CUPA 5I1LB 3MTUE 1J88A 3OZ9L 2MPAL 4UIMA 2GAZA 1T2JA 1WZ1L 2C7UB 1AFVL 1FVEB 2Y2WA 1TQVA 3E6HB 4XPGH 5IK3B 4L75A 1MHPL 2VMFA 3VXSD 5I1JH 1BOYA 1KTRL 2A77H 1X4XA 4XMKL 1WFNA 1QO3B 3PP3K 4N1EA 4W9LC 2QSIA 5CZVH 4DZ8B 4JFED 2B4CC 3VFSB 1J5CA 4X0KA 1O7SA 2P8MA 3HZKB 1GYAA 3GZQA 4FXTA 4H1LG 1T5XB 4G2AA 5TDPA 4N2IA 4AV5A 2I5YH 1RSYA 2QT6A 5DRWB 4G6FD 4NB7A 4KRLB 3LN4A 1H3UA 3PLNA 1DFBH 3KPSE 4H8WL 4Y16D 5CIPA 3CSFA 3HBQA 2EYTA 2CD0A 1MAJA 2OL3H 4G3YH 3GMRA 3NFNB 3NK4A 4TL4A 1MFMA 1ZHNB 5I6LA 5CS7A 5G55A 3F64A 4ATTA 5DZ9A 2EDRA 1IAKB 2NCEA 1XTCC 4HCRH 2E6JA 1E9PB 1KLUB 3RIFK 2R0LH 3HE4A 5GJSH 1O0VA 1T8ZA 1OVZA 1FGNL 4WW2A 1NVOA 3TU6A 4M48H 4NHUA 3AE1C 5BZWB 1P4UA 5C07D 1T7VA 3GJFK 1FL3B 4P5MA 5AZEH 1N86A 2W07B 4M7ZC 1ANUA 3BEVA 1JZ2A 2DQHH 1CC3A 1KCRL 1RIUH 2P80A 4UT6L 2CJ3A 5IQ9A 4PRHD 2YSTA 3CN4A 4OBRA 5IFJB 3JTSB 5KYYA 2FFDA 2DYPD 5F8QC 4BCZA 4ZT1A 1NZRA 4FI7A 1HWTC 2IQAA 3S34L 3FU3A 4B5EA 1QLFA 4Z23A 1UM5L 5BVPL 1AGDB 4XCYA 1YQ4C 5HI5C 1BCIA 2C4FU 4I9XA 3T6WA 1XL6A 2E9GA 2W94A 1JNNL 3DX3A 3EO1A 3TJHC 1ACYL 1TZIB 1DCEA 3QJFA 5FIEA 5CJOH 3TGXA 4MHHI 3H1HJ 3VH8G 1YJ9P 4FN0A 2WSPA 4GRWH 1FZKB 1QWNA 1YEDB 4PRNB 3L37A 4X5WB 4XXDA 5ALCL 3QEGH 4Z0BH 5FX3A 2P24A 2FTAA 3FU5A 3V7AG 3UP1A 2HH0H 5CSZB 3VVVA 2E59A 5TDNA 2Y6TE 2BW4A 1IC4L 1KB9D 2OPCA 2ZSWA 4HT1H 3KL5A 2PR4H 5C09B 1F3JA 5DJ0A 5J13C 2K9UA 2AQPA 4L1LA 1XV8A 5DUPL 1LDPL 2DF3A 5D2LE 4N2KA 5FK9A 1UUSA 1RJCA 2C9PA 2WP3O 1IO4A 1MJ7H 2VR9A 1NMAH 5DEFB 5ACMA 5FYKE 4PRPA 1J1DC 3FDWA 1JCDA 2ZAHA 1N3NB 1HI6B 1H3VA 4FD0A 4FP8L 3NACH 3EFFB 1DVFC 4S1DD 2O01N 2A83A 3RURA 1AZZC 2IFFH 2XYCA 2BHYA 2FBOJ 4X7FC 1FZCC 1P7QD 3UZEC 4DK3A 2P43B 2Z1PA 2ZOLB 2FKWB 1KQFB 1NAFA 1DE4A 3V6IA 1NEPA 5E6SB 4MA3A 3HZVA 4FEIA 4P46A 1A1OB 1MEXH 2P9RA 2FO1A 4Q52A 2H6PB 3PU7A 4CN1A 4IKNA 2N7AA 2Z8RA 1BE3D 2Y0DA 1L9NA 3CDZA 4X6EB 2BWDA 4X0NA 3GPSA 3WAKA 1WUNT 2C4XA 3HZ3A 1HCYA 3GS7A 2QKIA 4F7MA 3L7EA 3QJHA 1SJHB 4JQ0D 4NAMA 4MQXC 3LN4B 1SN5A 1GJWA 3IM1A 4JRXB 4BKSC 5APSA 4P2QA 1AVAA 1BXUA 3BSZA 4PGZA 4ONGL 1DHKA 4KKZA 3VWJB 2X89A 4L1HA 2CZNA 3RIAF 3L75E 4B53A 1M3JA 5D7LB 3BWSA 3BSGA 2X5PA 3CHXA 3TBYB 1T7XA 1VZHA 3FTSA 2CDFB 2CHZA 3APCA 1J8KA 2WPRA 1PD6A 2YGQA 5D7SL 3ARBC 1AYOA 3GSNL 2IBZE 4IRJB 3DX7B 3OKKA 4HLZH 1A6VL 1NTKD 4JE0A 4CA4A 5HYEA 4HIXL 1E9OB 1GJUA 4HISA 2MQGA 1IAOB 1HT6A 4OLZL 5AW0B 3MAWA 3S4SA 3WUUA 3HFFA 2GSGA 2VIRB 1PEZA 2M2DA 3BC9A 5SWSA 1K4DB 1NFDA 2F15A 3JTTB 1U9KA 4XPGL 1JMBA 3AE6C 1O6SA 4JVWA 5ID0B 1M42A 3QWQB 3WXVL 4PCTA 3H42H 4OCRL 4F8NA 1HJBA 2J55A 4JDTL 1EO8L 4CKQA 4PJIE 1YC7A 3DXAA 4LOUD 2C4FT 2EIZB 4F2MB 3X11A 1RZ8B 2YHGA 3MLRH 1G7QB 1ACZA 4UTCA 1PLGL 1RK0A 1NLBL 1EXHA 1K8AQ 1UM6L 4NWUL 2X4RA 1LT9B 3TO4C 1KJ2B 1U8NB 3IDYB 1OM9A 5M94B 2VO8A 4H7VA 4NIKB 4D0BB 5HHOE 2CK3H 4PN6A 1CFNA 3V6FA 1PAMA 4CL7A 1MCKA 4LSVL 4M5TA 2R0LL 3PHAA 5E4EB 3D3VD 2QVAA 3MODL 1L4AD 4LARH 3U4BH 1J05A 4P2OB 1JOIA 3FRUB 5I0DA 3TT3L 4ZQKA 1GOHA 1ZLUK 1ZLWH 4JRYE 1SYVA 4KKQA 4LOVA 4M6AA 2VZ3A 2XJLA 2JELL 5CMAB 4ASVA 3P77B 3EH4B 4O2FA 3D08A 3Q8BA 2CHDA 2W80C 4GQRA 2DQHL 2WYIA 1CE6B 4Y9GA 2A45H 1IV8A 5TK2A 4XPTH 5FYJD 2UZPA 2YD0A 1S3KL 3I6KA 5CGTA 4ODUA 4FXGC 1TQCB 4G6AC 2E9BA 5I8EB 4AM0Q 3GBNL 1XGTB 3S97C 2KQNA 1VCBC 1PZAA 4PJIF 5F1NB 1YECL 2VN3A 2YBGA 5B38B 2ZUWA 4AQOA 2MOVA 2R2HB 3D0VA 3NZ8A 3N41B 4ZW6A 3RWCB 3HVDA 5C97A 4KDVA 4F8QA 1SLQA 1EDIA 2RB8A 1NFIB 3VFSA 4XMTA 3QP3A 2ZCKH 3ZRSA 3RY5A 3J07A 3CFQA 5GPRA 4KK8D 4BA0A 4R8WL 1CVRA 2ADFL 2Y1ZA 1SXZA 4RWYL 3MFGB 2OK0H 1SQPK 3FCTB 5BUAA 3VMZA 4ZSOB 1QRKA 4WFFD 1BQLH 3UAJC 1KTLA 1ODUA 1Z3GL 3BVDB 4M56A 4HA1A 1T2KC 3I9PA 2NXYD 2O5XH 4ONHA 4HIHA 1TF4A 5GS0D 1K5NA 3OJMB 5KSBE 2X4SA 2J8UB 1DQMH 2R27A 5FM4A 1F97A 4DKFH 3SB3A 1L0NK 4BCXA 1NOHA 3LZRA 1XDTT 4PIBA 3UAJD 4UAOB 2WVTA 4GOSA 3REWB 2I9LB 1GY2A 3UEZA 4RFEA 3MLPA 1WAAE 4N9GB 4Y8DC 4D9RD 4FXKB 5B38G 4LRIA 4UIKH 3FN0L 4F57L 3U9UB 3KBFA 5T5NG 4Y5VA 4A68A 5TJHA 3ZDZF 1FC2D 4L48A 2W60B 4TV3A 1J0KA 5AW6B 1S8DB 2QQKL 5E23A 5HYQA 2FEEL 3BAKA 1NMCB 3UJTL 1MFBL 4DQOH 4N8VB 3H1JE 3WMSA 4KUZH 3T2LA 1U91B 1KACB 1AXTL 3QIBD 4MA8L 1D2PA 1URZA 2V9TA 4BQBA 2J71A 1R34A 1JMMA 1XR9A 3LZFL 1KIPB 3BRDA 1J2JB 1T0NA 1W8OA 2VDOH 3CFJA 1NUFA 1KXTB 2F1AA 5IW6A 4HJGH 1E3ZA 4KWUA 5F1IB 4PJDA 1CGXA 2KS1B 1EERB 1ZLDA 3EJPA 3KWXA 2HPCB 43C9A 3MLSH 2CBMA 2WQVA 3HLAA 3SYQA 4IBWA 3TFKC 1ODAA 3PYCA 3VGHA 3HS0B 4KI5F 1EGJA 5C0GB 4NQSA 3EJQA 5L7XH 3H7BB 2VLRB 1A6UH 4HLJA 4GQQA 5D2NE 1BMGA 1OCCB 3DLQR 4NI3A 3TA3C 3RL0C 1XXDC 4LLYA 1XAKA 4J4PA 3KHUA 3MLZH 1A8ZA 1KFGA 4N2OA 3KYAA 1U7MA 2WBWB 2HMID 4TPRH 4ZUTA 4TVUA 1GW0A 3H7LA 3QYMA 4BXLA 1F3RB 1S1CX 1J0IA 1WBYB 3V5KA 3U6RA 1V3MA 3MJ9A 2ITDB 2WXKA 4HWZA 2FYUK 5E7FA 3AEEC 1LEKB 1USDA 2AK4E 4DW2L 5AL8A 3P30H 3GLMA 3IXTA 4K9EL 4DN3L 1T2QH 4HV8B 5JO5A 1S3RA 2GK0A 5HD8D 2WT7B 3DC0A 5K59E 4LLWB 4KI5C 1JI2A 2YXQB 3L3GA 3V4PL 1L4AA 3TBVA 2CHNA 1O6TA 2KHAA 3HNSH 3QIBC 4XAWL 4Y4KA 3KL3A 1AKJB 2RR3A 2WT7A 3LNDA 5J5EA 4XGZA 2OMUA 4JO4L 1JD7A 1JWUA 1KPUA 3QG6B 4L8DA 1IEHA 4G80A 3REVB 1FOSF 4HYTB 4A2MA 3X3FL 2GSIB 1VERA 2B89A 3FONB 3BO8A 1NAYA 1MFZA 4NDMA 4NT6A 1HZHL 5IT2H 4Z7OB 2FJHB 1OQOA 2MOQA 2WTOA 3EF7A 4HWEH 5GS0L 5I6OA 3N06B 4HGKC 1FVDA 3IJYA 3LZQA 1C5DA 4XPTL 3FONA 5CCHE 5C3IA 4IBVA 1IAIH 1RZJL 2GVYA 2XBZA 4X7TB 4LLYB 4V1DD 3MV9A 1TMQA 2JI1A 5DS8B 1INDL 1CDBA 2GIXA 2Y2TA 3H3BC 3MOAL 4LSRL 3IWUA 4YXLH 1CDJA 1VRSA 3TWYA 4EI5D 3FW6A 1LP9E 2GG1A 4TTGA 3WU2E 1AMXA 3SGKA 4HU8A 2V5MA 2ZSVA 1WTGT 3IETA 4P4KD 1SN0A 3K81A 2O01J 3MRNB 1CFSB 5JMOC 3DJRA 4NQVA 2K3HA 3Q6GH 1OF0A 4UTAH 4NFCA 2EDYA 3PGDB 3Q5PA 4NKOA 2AEQL 2IOIA 5DO2D 4HV8A 5JO5B 2DJSA 3M0AA 5JOPE 4CN4A 2ZCKL 1Z9MA 4KXBA 3FU8A 3UTQB 4PRDB 4BSWA 5LUMA 3B9AA 5EEWA 4GG8B 1TXKA 1CXHA 1FVCB 1T0NB 2HT2D 3K5SA 4ONHB 3EADA 3GLEA 3ZDYE 1R17A 1SNRA 2D3VA 4PJ7B 1JTHB 3K1DA 4X4YB 2HX9A 4LLMB 5DR5L 2BK8A 2WJ7A 4AYEC 3NDZE 3ETBJ 1J9TA 3UIAA 1DJSA 1MCFA 1EVTC 1YEHL 4HLZG 5ITBH 3PV6A 1CF8L 1E27B 5F7DB 1L7TH 3RG1C 1HNFA 3CU7A 4I0KA 1S2EA 4PB9L 4GRLD 5J0BA 1DQML 4MJ6A 1CBVL 4WWKA 4KROB 5BZZA 4OV5A 5GGQL 5DRNB 4JUTA 2AJ3A 2I24N 1X8YA 2FE0A 1RJYA 2YWZA 1FGVH 1BCCE 2EDJA 2ROXA 1R75A 3DMMD 4O9HL 2VITA 5JTWA 2BCKB 2VDQH 5DF0A 2OMYB 5BXFA 4HSCX 2OMTB 2P4AB 2RA1A 5DDHA 1FNEA 5KAIE 1WHPA 3ILQC 3W0WB 2AQRA 4JPSA 2HRLA 3EJSA 1SQQG 3MGOB 3RQ3A 1HYSD 2ZVOB 1GC1C 1QRNA 4JY6A 3NZHL 2N4IA 3BKYL 1U3ZA 2ZJSE 3QH3A 5GTHH 5T3XE 4M6ML 5KVEL 1NAKH 1OT2A 1QI3A 5AVTB 3IJ7A 2FYNB 1PMYA 2Z7UA 5IVOA 4YSQA 5E9DE 4E5XB 5B7FA 3H1LG 1FNHA 1UZGA 3L3OA 4FG6C 4WY4B 3CD4A 3L3JB 2BS71 3MX0A 1U4FA 4YFLF 1TJXA 4EKJA 4BUGA 5DJZA 1OE3A 4APXA 3OC5A 1PTZA 5AOJA 1QNIA 1FZGA 2NX5E 3TWCH 4DSYA 3WIFB 1NOLA 2ZKXA 1TTUA 1B3JA 2A06E 4KZDL 5FGCE 2J5WA 3CVHH 4G6MH 4Y9CA 1RPQA 2YPVA 5DHMC 3LX9A 2PWFA 1Q0YL 4ZX4A 4JFDD 1JI1A 5C7ZA 4ZQTA 1MW3A 2A6IA 1H6UA 3FUJA 1LE9B 1UGNA 3MA7A 1I8MB 1MFNA 3X13B 2LU4A 3T2NL 5F7YC 4FXLA 3ZYIA 1G6RL 1JMZA 3QAZB 5EN2A 3TO4A 3II2A 1S7WA 5F7WC 1EZVG 3G5YB 3HTKB 1OGPA 1CPUA 3IR9A 3GI8H 1MF2L 3X17A 3QIBA 2JLLA 1T3UA 3WUWG 5I1LA 5I19H 4CILA 1YEGH 2HJFA 5JIHA 2K1AA 3MA9H 1JK8A 3PNWB 2JDIH 3PWUB 4CPGA 2XQYK 1E6OH 3DVIA 5E00B 5FDYA 2F1BA 3CCMP 2AKRA 1QFWL 4A7TA 4AYFB 1N0XH 1QSZA 3K6DA 1ZAGA 5CCGC 2CG9X 3ZKNC 4Q9RL 1OGSA 3ARDA 2Q76B 3IDXL 1TLMA 2YQGA 3EH1A 4JY5L 3SE8H 2VN7A 3DSFH 3SGDI 4C54A 1KBWA 3KJ6H 1DDHB 2B08A 1YG9A 1NUGA 2HFTA 3MR9A 4LVHB 4R5VA 5ESAA 3W39B 1MQ8A 3BAJA 2ZXDA 2IWFA 3NCYS 4MNQA 3F8UB 4OLEA 3QQXA 5AYQA 4LC1A 2O5NA 5DHDA 1UM6H 4NWUH 1CO1A 5AKTA 3S7GA 2PXYC 2DH2A 2FYVA 5IJBC 5KW9H 4KO7A 2ATKB 2PWEA 3FUEA 4FQXA 1JDDA 2NSMA 3AADB 4AOFA 2NYYC 2JKTM 3PDOA 5E4EC 4QNPF 4IOSA 5F71A 5J06A 3QIUB 4LVEA 4UZSA 3L72D 1MZZA 2JCCB 4PJHF 1LL1A 3V9CA 1TCRA 4LQFH 3RVUD 5A2KH 3IKCB 4WVRA 3PP3H 3EYFA 4PJCE 3KDMB 3B8EB 3II6A 2JTYA 1Q9LB 3G5ZA 4QD2E 4RISH 3QWRD 3HN5A 3QUXB 5L8JB 3IXAB 1HXYA 4IRSA 3P0VL 2APXA 4JR9L 1BMZA 3UACA 1PG7X 3R4RA 1FYTA 4PIRF 4Y4FD 3DVFA 3DX0A 3CLWA 1AFOA 1M1JA 2XETA 2Z8VC 4X7CC 2IMMA 3TV3H 5DQDL 1S78D 3SPGA 1BEXA 3B3IA 1SQVG 3FWLA 1QSED 2X2IA 4KTEH 1PSKL 1OAYH 3FU0A 1FC2C 3O9WB 1NFDF 2L91A 4NBYB 1BIIB 4WU7B 4AVKA 4JCWA 4K71C 5AW4B 3T4AB 2VO5A 1FZCA 4FADA 5KTEH 2XHNA 4EAEA 1BBJB 5B7MA 1AGEA 1DL7L 1F11A 4NFBA 4XC3L 2OYIC 2C9SA 4U1KA 4BH7B 1U6AL 4BUQA 3CDCA 5IUCA 1U95A 3LMJH 2KZ1B 3QDJA 3ULSB 3AZUA 3NJIA 5SX4I 5KSBB 4Q9QH 1SM3H 2R1XA 4MAYD 1NBCA 4FULA 3VFNB 2EIMB 3RILA 1BREA 3VI4B 3LEVH 1SJHA 1KMIZ 4ZSOE 4OT1H 1URQD 5H2FH 3QDME 4LHUB 3L70J 3GSOB 5IVNA 5HJDA 1XAUA 5ESQB 3NJMA 5CO1A 4H26A 1ZMYA 5MEOA 1U3HB 1ZY9A 1H6FA 2A74C 2EDHA 3DRTA 3L3OB 5FXCH 1M56B 3NGBB 1UEYA 3NP4A 5B5EE 2IOOA 4L3EE 1IAII 2JIXB 1AA0A 2X87A 4LASL 3GSWA 2E9JA 3VN0A 4QR7A 4O00A 3T0AA 1LTBC 1BAGA 4P9ML 1N5YH 2CHXA 2J1ZA 3IVKB 2YMXL 1ZIAA 5ADOH 4LDOB 2D03H 1IZNB 5I1KH 5HI5D 4ZAKC 3SDCC 1BIIA 4G8FB 3QRGH 3QJVB 3FB7B 3NPZB 4MCZB 3K71B 5IBLC 3IF4A 4KK5C 4LFHG 2A6IB 7CGTA 4HF5H 1LE9A 2I69A 4GRWF 4W4OC 4RAUA 2X1PA 3UTPE 4W80A 1W0VA 3KHOA 2XV5A 3QCUL 3WFDL 4CVXA 2A99A 3VXRE 4BRVA 1DZBA 2EUWA 4OCXH 4U1KB 4W9GC 3QZOA 3L73E 2F18A 3LKSB 2W83C 2IDSA 4MQTB 5FO2A 3OHMB 3V9EA 3GHGB 4Z77B 5C0DB 2WWKO 3B2PA 4R96A 2ICWB 1U58B 1EEZA 5ILTL 2E6QA 4GG8A 1BVLA 1M7IA 5DLLA 2P5EE 1JG9A 1LILA 2ZXAA 4UV7L 5DO2C 5IKCA 2XXMB 2BNRE 3QXTA 5DHYB 1Q90D 3AJ7A 2AK4B 3QWOB 3WD5H 1DANU 3FTGB 2OYPA 4QRPB 3AMKA 2VLKA 2ZUTA 1RE4C 3EOAB 4FL4B 2RQ8A 3PL6B 1I8IB 3NFQA 1N19A 1WZAA 4UM8B 5I23A 1SJEB 3S9DB 1AO7A 3PHLA 3ZR5A 4YVNA 4QIRA 3EDEA 4YH6A 4WI5A 1GZPB 2EH8H 4CGUB 5E95B 2D2OA 2C1PA 1SY6A 5CJQL 5JHDB 3ILEA 2UXFA 2WKOF 4IU2A 3F2LA 3MBEC 3L3KA 2GY5A 2EDQA 2PCFB 3C6LB 2FJHA 4XBMA 1KJ3L 3ZTJG 1I9IH 5EEZA 3QQ4A 4JB9L 4QXWA 1JPFA 2A5UA 4JFFE 4MXVE 4K2UL 2F6AA 2FHCA 3VFTA 2OJEA 4WDIB 3QUZA 2ZYSA 5K5GB 2BDNH 4FKEA 4PJ5B 4ELMA 2YEQA 2X3AA 3UTTD 1JIBA 5I82A 4FNPA 1F4XH 1P6FA 5E2TH 3QUKB 2YQ3A 3ZOAA 1BYPA 1E4HA 5FM5M 5E5UB 4ISVB 4WU5B 2ID5A 4CSSA 4ZMPA 1OMIA 3ARBA 2GK2A 5EU6E 4N6JA 4B9GA 3OC8A 3PXLA 2VERA 5IK3A 4EZKA 4QHMB 3G6JB 3U9PH 1R0AH 3OKOB 1G0DA 4XPHH 1CLVA 4ONFL 4S1SL 4LSDA 2I7OA 1JY3P 1GC1H 1U2HA 3ZTEA 4HW6A 1G7IB 1IGTB 1IVLA 1ZRUA 1RJLA 2UYLA 4DKEL 3G5YA 4LDEB 4BZ1H 3IEAA 4ZXBA 4LCVA 3KWTA 3B4NA 3EH5B 4J23A 1KV3A 3MXVL 4PSPA 3TBWA 3ATEA 4JO8A 5DYOA 4C58B 5CP3H 1GKEA 1XCTA 4GKSA 4J3BA 4GEIA 1HQ4B 1IK7A 4OLWL 4HIJB 3KLHC 5LXGH 4MXVF 3H2WA 1SOKA 3V8OA 1PJ9A 4P46C 4NQDE 3G08A 1U8PA 3UJJL 4WFFE 1E28B 4L5FH 3E6HA 4ORZC 1BJ1J 1NC4B 1ADQH 2OMTA 5DDHB 2VRSA 3TS8A 4P3DA 1S7XB 1RHZB 4IRSD 1AS7A 4RMVA 4YFLI 3KLHD 2E43A 3GBLA 5SWQA 1OCWH 1UM5H 4WHYG 1BJMA 3GJFB 3IFLH 1D5ZB 1NCOA 3ARGB 4NC2B 5M1BA 5E6YA 1XO8A 2XQBL 3QJRB 4OIIH 2C3HA 4YDKH 4DN4H 5I75C 1XGQA 2IH1B 3QJZA 4NENA 1CT8B 3BVNA 3ECBA 1J9CT 3QNFA 3UYOD 5IIEB 1HIMH 2ZJSH 1F00I 3AT8A 5K33A 2EYRA 2V5RA 3WKPA 5MEND 1LEIB 2P46B 4B9JA 5E9DB 4QJ3B 3WFBL 4HS8H 5HDQL 3Q01A 1DANT 1OTUC 4WZ9A 4WUKL 2G2RA 4KMTH 3ETTA 2BCKA 5CJ5A 1INQA 2G60H 3WJJC 2R0ZL 3C60A 2X70B 3SDXB 4BFFA 5IB4B 3U9UA 4LSQL 4OQ1A 5F9JB 2D7QA 2FUTA 3MLTA 5BVZA 1QPPA 3U4EA 5DU7A 4JFYA 4GSRA 3MRQA 3LNGA 4YPCA 2D2CD 3L81A 4L3CB 4LEEA 3VH8A 5AYUL 4M6MH 4GKZA 4MS8C 2IJ0C 4ANKA 4J7RA 1SS1A 4YSDA 3GZOA 4C4BA 2YPLB 1A6TA 3IAGC 1FZFA 3BUPA 5EPMA 1UCTA 2QVFB 3DX9B 4EI0A 4Z3JA 5IB1B 2AXGB 4G6KH 2QLYA 2VGLM 3TC9A 3T77B 2IFFL 5DMGD 2EJ1A 4YWGL 1KQGB 1JEKA 3GMLA 4FQLL 1PKQB 4WNQB 3CFJB 3PDGA 1PFOA 1K3IA 2F54B 1P1ZA 4P99A 2CXGA 2JQAA 2CGRL 3IGFA 2OULB 2YD1A 2VZSA 2AABL 1DD4A 5EOQL 3FQ4A 2AXTE 4IOFD 1AD0B 2QZ5A 3MVSA 2N3JA 1MIMH 4ESKA 4CU6A 4U4BA 5TFSL 5ESVB 3O6MH 3EYVB 3HN8A 3ARDC 4PJAB 4I0PA 3OD3A 4OCSH 4U6TA 4PJFB 4X5LA 4L8DB 4JCLA 4JQVC 1P7BA 1UD3A 4Y5VB 4D0DB 5EU3B 3TH2T 5MEPB 1KLFB 2LFGA 4I6MC 3UYPA 1P84H 4JUSA 3O2WH 4NRZB 3PHOA 1LGVA 4GAAA 4PRIE 4UV4H 3R7RA 5I8CA 4ZZFA 1HEJC 3WLBA 1OFCX 2KZIA 4EO5A 4QY8A 3HI6L 1M7DB 3O2VL 1RZIB 2Q10A 1D7FA 1JNLH 2XV6B 4JJOA 4RBPH 1KYUA 2A6KB 4DKDC 1NPJA 1B4RA 4W6XB 3HKFA 2QHRH 4MDIB 2MNUA 2X4SB 4KBPA 4NKMA 4OCYL 5DVNA 1LEKA 5BUGA 1GGUA 3ULUD 4JY5H 3SE8L 4QRFA 4Z7NE 4LMQI 4XN9A 4YEEA 3L54A 1WFUA 2NY3B 2F19H 2EEBA 2YPVH 1OP3H 3I9AA 4ZZKA 5B21A 4XVUD 4M6NH 2AQTA 4X6FA 4YR6A 4GMTH 4F80A 1RU9L 2UZIL 3E9TA 4EI2A 1Y1DA 3APDA 3I3DA 2DB8A 3SQOL 2D31A 3CH1A 3F00A 4C7NA 3BWUF 2V33A 3QJOA 3OGCA 4J3TA 2E7CA 3HB3D 4DTGH 2CR6A 2Z3FA 1PPIA 3ZKND 5CJ0A 1BG9A 4M4RB 4PWJA 4YHLH 2ZKWA 1WZLA 4UQIM 2BY3A 4WWNA 1RE4A 4ZX6A 4PGDA 1FNSL 4WWID 1Y0LB 3P0YL 2EVGA 3ZGHA 1FHGA 4GOEA 3AEAC 2Y9ZA 1R5VA 5IVXA 1UXWB 1OCOB 1UC6A 4MMXB 4BD4A 1JZ4A 4IFMA 2BM3A 2VABA 1FH5L 1NEZB 2X4QA 2Y7QA 5A6MA 2BEZF 4MJ5A 3K2MC 3TJPA 4YBLC 2HKHH 2ZCHH 3BOVA 4OM1H 1JY3N 2AK4A 4I13B 2DEWX 4ZOEA 4WWKC 5CAYB 3QSKB 4APQC 2K45A 2JWAA 1XH1A 3CX5K 3VGFA 4B50A 1IBBA 3GK8L 3IU4H 5BQDA 3TYGH 3FZUC 3Q13A 2XFXA 5BOJA 5T1KB 4N9OB 1USZA 1A7QL 4AL8L 4BGLA 1P9MC 5CN3A 1BFVL 1R24A 4MB5A 2YA1A 3GUTB 4ZUWB 1YDPB 2YIUB 5GJTL 5ERWB 1PGRB 4WWKD 4P07A 2XVBA 5DA0B 4PJ9A 4DOHB 1BGYJ 4JQIH 4JRFA 4M93B 4IS6A 3VFWB 3U59A 3H2QA 5E08L 4JPVH 1N73B 4NXKA 4N22A 1NCAL 5EU6A 1KBKA 5CHNB 3B5TA 3DDFA 5INCA 3M17B 2HWZH 2ICES 3DO4A 4HKXB 5T3XL 3VCLA 3VA6A 5HVHC 4YHML 1MWAA 5DURB 3ZRFC 2DV6A 5EC2A 5IVZB 1FAVA 1HHJB 1R3KA 2R0WH 4OLXH 3NPSB 3FRPG 2C3XA 4YTPC 4WUKH 1QNZL 2OCFD 2RGSA 3UX9B 1KGJA 2OMZA 1E28A 4Q9BA 2NPSC 4BM7A 5KJ4A 4JNXA 3A0BE 4GP5B 2HRGA 4MJIE 4UB6H 5FGRA 4GT7A 1ETB1 4LBEA 1J86A 5ENWA 4JG0H 2XWJA 3F65A 4AY0A 1LO2L 2GJJA 3SY0A 3F7LA 4X9IA 2Q9OA 3B5HA 4BFKA 1AH1A 2YJLA 1RE3A 1F58H 5J4MA 2JB6A 2E7BA 5F1KC 5D1XA 3EBIA 4UCFA 4ODSL 1D5BB 3BESR 1UUNA 1LTGC 3ES6A 5EZOL 5TF0A 1BEYL 1EAPA 1GAFL 1VLXA 3B2DC 4G9FA 3VU2A 1WEJL 4NUGH 2XTJD 3MRPB 5KYXB 5KYUB 3K6OA 1XZ0A 4Y19B 2IMNA 1ICTA 1S9VA 2D7TH 4G70B 4R26L 3RVXC 5SWSD 1ZIBA 4BK5A 3ESUF 2OP4H 1NKRA 4I2LC 3DUSB 5ESVA 3QCUH 1CICA 1IBDA 3QXUA 4S1QL 4X4ME 1RUQL 4X9GA 5IHWA 1T0MA 1TITA 3U7YL 2A06D 3H53A 5D5MF 3T0EB 5E2UH 1IGML 2QIWA 4FQXD 4HIIA 3BAYA 5T1MB 1SYVB 4KHTH 3ENEA 4GH7B 5KSBA 4XHJD 3PJNA 1I7TA 4ZFOA 5JQ6L 3H1KD 4EBQL 2K70A 1HBWA 4KUZL 5E79H 5TTRA 5CCGD 4KZ0A 4XMPL 5EZJA 5I8KL 5F3BA 1JZ3A 1TCMA 3A4DA 2N7BA 4GKNA 5IB3B 4LP4A 3JYCA 4X6BA 4B3VA 5LVEA 4WFED 5C0AE 1Y7VA 3A23A 1GGBL 4XWGL 2W1NA 1NTMG 4FHKA 1PZUB 2OR9H 1K4CB 4LKCB 1MCBA 4MYPA 5ES4B 5JA8B 3H1LE 3ARDD 1MH5B 1KPRA 4PWEA 2HG0A 4EKXA 3PL6C 5J6HA 1AR1D 1I85C 1LWJA 2WIMA 4FQCL 4UT7L 5D96B 3V0AC 3G3LA 2W9EL 4XPAL 1LP9A 1ZXGA 1FNAA 2R5DA 1NTKJ 4CC4C 3LB6D 5KSVB 2FJFB 3BQUA 3HRZA 4HUWA 3L4CA 5IOPB 2HKAA 1M57B 5DA4A 3FS9A 3D4ZA 2B59B 1AO7B 3JWDL 1W0VB 2ZXWB 4YDLB 4PJHE 12E8H 5FYLD 1WE5A 2P42B 1J1XL 1F4WH 2ZSWB 3QXWA 2EUXA 4L8CB 3ROLA 2EVFA 4N1HB 1E9PA 4HZLB 2PW2B 3BFOA 3QI9B 3FB7A 3V6ZA 1FZEA 5IP4A 3LRSB 3FOMA 4U6XB 2A6JB 4NGHL 3NCBB 5A2JH 2NYKA 4PP1C 3P3YA 1P2CB 4M1DL 3ZHDA 5JW4N 2ZT9B 1FQ9C 4R0LB 3O2DA 5EHFA 1ORSA 4W9HC 3VI3F 3RTQB 3HCVB 3T1FB 2DM2A 1KYAA 3P30L 4XMZA 2D7PA 3GHEL 1QW8A 3HFMH 1EUTA 3WXWL 5E9NA 2CR0A 1QA9B 1SHXA 3HNTH 2GI7A 1ZT4B 2I5YL 5E1IA 3Q8AA 3IPEA 4R3SB 1N0LA 2R44A 3ZHKA 3ARDB 3W82A 5I28A 3L3IA 3N50A 3FBKA 2HZHA 4Y5XA 4G72B 5IJKA 2CAKA 4RDQG 2N9YB 1MFCL 3JV4A 5AB0A 3CSTA 1RCYA 2A9AA 3HHSB 2NW3A 2HR3A 2BOBB 5CILL 1NLDH 4JPKH 4K07A 4MTMA 1S7TA 5FKPA 3MUDA 2PKDA 1QSVA 4GS7B 5EN2B 1SXNA 1E4XI 1UURA 5IFAL 3WBDA 2EE3A 4K3DL 1N70A 1KB9J 3UAJA 4UOW1 4GINA 5CWSA 3QR0A 3MA7B 1SHSA 1I8MA 4W7YA 3BKCH 4KX9A 4BZ2L 4UYQA 3TPUA 2BVQB 1K2DA 1L0LE 4Z18A 2ZIDA 2HLOA 3H1HD 4F9LA 2CIIA 1S7QB 1JGUH 4G59C 2A4ZA 2FX8L 3CFCL 3W37A 2Q7CA 5IUSA 2KSJA 4GAGH 2XA3A 3MC0A 3CDZB 1XCQA 3QZBA 3LZNA 5BRQA 5BS0E 1C16A 1SF3A 1KCSL 2WM0A 2R0WL 5E6ZA 5CJOL 4MJIA 3RPKA 4GQ9H 2NTFB 4EOWL 3NEXA 2WQWA 3SWYA 1ZVSA 2WUBH 4I3SH 1ZLVK 5DUMH 3WKNA 4UDUB 2J6EL 4IU2B 3C6SA 2CLZB 5EOTB 4DO4A 4KUCD 5CLZA 4L8SB 4QCIA 4ENEC 1QLED 5HTSA 1KILB 1PIFA 1L9OA 2EIJB 4MMXC 3L73G 4MXQD 4CU8A 1P7HL 1DQJB 2QSCL 4F5CE 4XWOC 1J8SA 1DZ0A 5DK0A 3LXUX 3E8UH 3L3HA 4FLHA 4P2QD 2F54E 4TF4A 4D6TE 2KZWA 1NGYB 1NKGA 5ICYA 5GGQH 1JE6A 4U7SA 4DOHE 1PPJD 1FFPB 3EG9A 2BC4A 1UVQB 1KPVB 3LPGA 5AUMB 4RMUA 2YMTA 4XBGA 2D7TL 2G5RA 4WWKB 3VFUB 5C6WH 4XNZC 5D7HA 2JFCA 5I1EL 2ZOKB 3MI6A 3EW3B 3PXHA 3RK2D 3NZHH 5C0AA 1RQ5A 1D7DA 3L16A 1AQ5A 4HWUA 2XG4B 3JV5A 1T5WA 1EUUA 1CJYA 1MEXL 2FLRT 4APXB 5C0DA 5GZOD 2P5EB 3T6ZA 4QMEA 1ET8A 3ARFC 4Y2OA 3VW3H 2B4CH 2EDLA 3LNHA 2N1TD 1AXSB 1CIDA 5C0AB 2FQEA 3VG0H 5CR1A 4LVHC 4G9DB 4QRTA 1XSOA 4OV6F 1AACA 25C8L 2YSSA 4A39A 2P5ED 4DWHA 1U8MB 1E65A 3L13A 3H3PL 5IOPA 4Z7WE 3VTTA 3JYBA 2EYTB 3KR3H 3X1BA 4JM2C 4M3LA 2QEXP 3K71A 4MCZA 1NIEA 2ZCLH 1ES0B 5HHVL 4IEFA 1OP5K 3SODB 3NRFA 2A9DA 3UG3A 2DD8L 4EQ2A 5GS1B 2PO6D 2DTML 4XBEH 1FSKC 5CBEA 2OZNA 4G7VH 4KK9C 3MRCB 4RLDA 2YXFA 3WTYA 4DEUA 4LSTL 3BAEL 1M05B 4U3XA 4KRPD 4ONOA 1IAKA 3SJVB 3OKMA 3FUIA 3ASOB 5F9WC 4U33A 3A5VA 1GW4A 4JS7A 5C07A 4K9JA 1FBIH 2ADGB 4G5ZL 4Z0XA 5JDJA 1RPKA 4GSQA 5AB9A 3CUPB 5EWIL 1KILD 5HGHB 1A7PL 3OZ9H 2EADA 1CGTA 2YPVL 3GMQB 1GVIA 3N1FC 2YN3A 4W9DC 1CF1A 3Q2WA 4B86A 1CICB 2A9ML 2QADC 4PYHA 1KB5A 4WVZA 1ZLSH 5B39B 2VAJA 3S5YA 4DZ8A 4F7TB 1B4LA 3SQOH 1S9VB 1I9JH 1OB1B 1J0HA 2GCYB 4PUBH 2NUPB 3JZ7A 3JTBA 5ISZB 4QWWD 3L35A 4D8PA 4Z7UA 2ATPB 2MHAA 2W5PA 1J8HE 4OFDA 2Q7AA 3O6FC 4FI8A 3HMWH 3QCVL 5C0EA 2R69A 5GRVK 3CNKA 1I82A 4N25A 3K72A 5TQ0L 1DJGA 4IIQC 4JDZA 5AZUA 5JPMA 3BZEB 4AVIA 2VERN 1EJ8A 1MKFA 3MACH 2OX5A 3WSQL 2ZKHH 2G75A 3NABH 2F0CA 4YDZA 5EEVA 4EDXA 5D8JL 2AJUL 5CEXA 1LLAA 4C59B 4H40A 5LN8A 2WPVB 2B9AA 4Z3GA 2KSEA 4MA1C 3QDJD 3B2VH 2EDWA 5BRZA 4YBLB 3AAZB 3AREA 4Z95H 3VD2A 2E75D 2OTUA 1KJVB 2Q6WB 1HHGB 2J7LA 4A38A 1EWHA 5ICXA 2JB5L 2QA4P 4OAWA 2FD6L 2B59A 3AW5A 4P2RE 3QUYA 1HGZA 4HMEA 4EZMA 2H9GB 3ELQA 5TQ2L 2VKWA 5I73C 5GS0C 1H0DA 3CCJP 1IL1B 5B39G 5MERA 1BZQK 4HDIB 4QHLB 4XOBA 2YBRB 3CCSP 3F7YB 4Y7OC 3S36X 3T8XA 3ZL4L 4M8QA 1FNFA 2A6JA 2FRGP 5B3NA 1ZA6B 4R7LA 1KIPA 4OJDH 3QIWC 1C7TA 2WOYA 1FG9C 5K39A 1BF8A 4JN2B 1F90H 1I1RA 2YD5A 2Z91B 4OCWL 3U48A 3VXTB 1JDAA 1GGCL 3BPLC 3HE6C 5CLXA 5DUBA 2YZ8A 1A02N 4TYUA 4YPJA 5EZLB 1FVDB 2V8MA 3LIDA 3FQ1A 4DGWC 5KVGE 2OJZH 4HHWA 5C07E 1TUPA 3A0BH 2XZRA 2W60A 1G7LA 1NEZA 3QZLA 1GXEA 4HQQH 3QO1B 1ROCA 2A06G 1THAA 4HJIA 5CKGA 1RIHH 1FHNA 1HDMB 3H9SE 3DUSA 3MLYL 1I31A 4IRZL 1YNLH 1B0RB 2P7TB 2QJKB 3E8UL 4PP1D 5D7JB 3EWKA 1CGSL 1VQ4P 4LL4A 4WW2C 5CSBA 3VQLA 2XU6A 1YITP 3TCLB 4QRAA 1HHHA 4ODSH 1GMEA 4NJAH 4X8GA 5CU9A 3SSGA 3TBVB 3ZY7A 4Z7NB 3ZDZE 1DN0A 4F33B 4IK6A 3SO3C 3P9MA 4HSQA 1G4MA 1DFXA 1NC4D 3OLEA 4X6BB 4F8TA 4JANA 2BASA 1CFQA 4R26H 3KZIE 4BELD 2MTPA 4PMFA 3GMAA 1Z66A 2VR4A 4EZJA 1A9EB 3MOBL 3LIZH 4ZSOA 4HFUH 1QGKB 4RVBA 2Q3ZA 5IMOB 5DK2A 2DBJA 5E24E 4K3HA 1WBYA 3DOSB 1I3GL 3BSHA 1CFVH 3BVXA 1R33A 2MPVA 4Z3TA 1K9MQ 4DQOL 2CWRA 2AQ3A 3FCUB 3MBEB 1IC4H 5F7FA 3V0HA 2OXHB 4DVRL 3UTSD 5L2KD 5JXED 2EILB 4P57A 3KLKA 4D0DA 1PF3A 4XGZB 1RY7B 3O3BA 1G7HA 4LCUB 1MJ8H 2ZWLT 1NTZG 4NQXB 3LKQA 2QVIA 2WNGA 4R84A 1NWQA 1PP9D 4K7PL 4XN2A 2OBGA 1FNLA 1OAZH 5I8EA 3I50L 3FJTA 2KLVA 1ZANH 4OJAA 4PLJD 1AVYA 1VIWA 3T3ME 3LB6C 2D0GA 3BLPX 3OXRB 1KXVC 2EYSA 4KDTA 1YMMB 1PZ5B 1KG0B 2YUXA 4DFIA 1G5GA 3D6GA 3H4HA 3LNFA 3H8NA 4M00A 1FE8L 1MCOL 4MMYA 1K85A 3WTTA 1EGJH 3RUGA 1NFAA 2R2BA 3RX7A 5TDOB 3AEBC 2VDRB 1T22A 2XTJC 3L6FB 2WQXA 3N42F 3UADA 4U3SB 4D9LL 4A2FA 5I66B 4Y16C 2NY6B 1LO3H 3K4AA 4C83A 3VE0B 5FLVA 2VUYA 4R7NB 3FX0A 1NCBL 3OR6A 2FYUG 1N6QL 1ZTXH 2KI6A 4Y19A 3NFSL 4JPIB 3FNKA 3BCCJ 4QXTA 2ZYRA 4JQVA 1J12A 1PZCA 5ERWA 4U2YA 6CGTA 4I0PC 3FPXA 5AAPA 2BOCB 1DDTA 4ENZA 3EJZC 5ECJE 4LDLB 2VN4A 3MRMA 4UNIA 1M71B 2XIIA 4XVSH 3L4VA 2VDKL 1DVFD 2CM6A 1UD6A 1YEKH 2QMKA 3OGOE 1ZHLB 4Y5YC 1R4XA 5C08E 3QUYD 1LNQA 4ZODA 2G2RB 1K4DA 2NZ2A 4QRSB 1MFAL 1UG9A 4N6RA 4RNRA 5L8KB 4WEBL 4M9PA 1OAKL 3F3HA 1XF1A 4MJHA 5D1XD 2XLLA 2YXRB 4PLKD 4H5SA 2LR4A 3E7KA 1BZ7A 2D8KA 3D33A 4UUJB 5DJ2A 1NGQL 2B7DT 4WI7A 4GXUN 4BUHA 4P46D 3BEWB 3FUKA 4H0GA 3BPNC 4YHYB 1A4BA 4RFEB 1J5OH 5BS0B 1PV3A 4ZAKB 3ET9F 3L4XA 4NC1C 1D5RA 2ZICA 2QJYC 1ZA3A 5E4AA 4RRPA 3GUTA 4QY8B 3GBNH 4ELDA 1AZNA 2Z4EA 3ZDMA 5F1NA 3C09B 2F5BH 3CVIL 4PD4E 3G5XA 3G71P 1KYOD 3FFCE 1T04A 2D3JA 2J5LB 3TDKA 5B66H 3N2JA 3KYOB 3BH9A 1R3IL 4NHCL 1YN7B 2EP6A 1BM3L 4MCMA 1FZJB 1MWOA 1K73Q 3AQDA 4ZFGH 2Y7OA 3CLFH 2WSFJ 4RCAA 3TVMD 2XBTA 2WXJA 1NSNH 3WIHL 2VABB 5D7IB 4KX7A 2WBJB 5T1DH 3B9KB 3UJJH 4KZEL 1TZOA 3L1EA 4YHNA 5KBNC 3MU3A 3VYIA 1X5GA 4JJ5A 4U6HB 1FCGA 5F0MB 1G6RA 3KWWA 1O7DC 4JANB 4RGOH 4DH2A 2BZCA 4NZJA 1QZ1A 4XMVA 4KRNA 3SDYL 3GHBH 1BZEA 2EXYC 4H0IA 2DIEA 3FQXB 4KXCA 3KPPA 5KWYC 1OV8A 3MN8A 2WW8A 3WFBH 3BP5B 4L3CA 1L9TA 1NHLA 1DQLL 2COVD 3LVEA 3PGCA 4MWFA 4N87A 3H7BA 3UCQA 5KBMA 1UM4H 3QBTB 4ZTOH 2C9RA 4PTTA 4ZXBC 1IM3A 5FA4A 3AM8C 3D4YA 5T3ZD 3GINA 2HJKA 1WCQA 4S2SA 4AM0A 1KORA 3TN0D 2CXKA 4PY8I 3WOVA 1TEGA 4XVTH 4BZYA 5EU5A 4F7MB 5DVMA 5JDSA 5T3ZH 4V11A 5EDSA 2X12A 3FT2B 5J7CC 1A22B 2ADFH 4BHUI 1V10A 2D7NA 1J9QA 3X1FA 3GHGC 2EH7L 1KGYE 2J73A 3LDBB 5ISZD 4MZ3A 1GOGA 2G3MA 5B8CA 2E7LA 1MAMH 2BSSA 2R4SL 3JWDC 1T4KA 4WEMB 3I2CH 2NCMA 4FQLH 1Q0EA 1UHVA 4OLVL 1HCVA 2KLSA 5JHLH 2XG5A 4KVPA 1CDCA 5FW7A 4LVOB 2ZCLL 1H8AA 2I60L 3D05A 4GG6A 1E8XA 5AWNH 1HKFA 4JRXD 2VLKB 3D12B 3VYNA 4E2OA 1ACXA 2XDJA 4GIFA 2IALA 1KBVA 4DP4X 5K9KA 2YPLD 1Q1PA 3MBEA 3OHXB 4N9GA 3SHSA 7TAAA 5C0RH 3B9KD 4HC1L 2M5AB 4D9RE 5I0ZA 1EZVY 1Y6KR 3QFGA 5EIIB 4AZUA 1KCUL 3GS0A 1QHQA 1DR9A 3IRCA 4YLQT 3OHXC 3L7EB 1SQBJ 3RK3B 3D5OF 1UH3A 3CWGA 1V7ML 2XQYG 2R4RL 4MVBD 1JUFA 4NN5B 4Z0XB 4HAFA 5LAXB 1D5MB 1P7QB 2J1XA 2PO6B 3MRJA 1WIPA 5GRJH 4JFUA 4OR1A 1D5ZA 1QFWH 1AFVH 1EX0A 2HVBA 3GRWA 1EHKB 4GPVA 3P40A 3ZE0B 2VWEC 2VH5H 3EBAA 4G1EA 5CLWA 4Y9FA 3NCFB 1C12A 5KLVD 1BD2D 3CSBA 4JGJA 5EPMB 4RDBA 1YN6A 4GSUA 1N2RB 3VXQA 2JIXA 5LBSL 4IOIA 1BD2E 3ARGD 4O2CB 2DM4A 1OB1A 3ARBB 2XUWA 2FWUA 2VDKH 1VKXB 2VISA 1CLZL 4A2LA 1TFHA 1AHWA 2JV6A 4L9DA 5GRVL 4N0CC 3HJEA 3ELAT 2GUSA 2XNXA 1M9WA 5B38A 1MW1A 2YMOA 1PLAA 3GKZA 2ADGA 1MXGA 2HFEA 2QPDB 2CKBA 5HGAA 1PNCA 5BV7H 2R1XB 1J0JA 3VP9A 2KPNA 5LGHH 4A7SA 5JMRA 1ZA6A 2ZXXA 4YAQA 1U3HA 1LD9A 1ZGLA 4PLKC 4P3CH 1B9KA 1N64H 3V4PA 5KLIC 1OGTA 2BSDA 4YSUA 2Z7YA 1E4KC 3DBXB 3H42L 4OCRH 1H3PL 1RY3A 4OLUH 4LCWD 3HPLA 1F4AA 1BSIA 4JG1L 4ZX3A 3FTZA 1KPVA 2ZXGA 2J8UF 4R5XA 1K2DB 4CMHB 3DV4B 1E7VA 3MUZ1 1PDKB 3TNUA 3HUSB 1NTZK 1QLEB 1IFHL 2QL1A 3QZWG 1N2DC 3V4PH 4A7GA 3ML8A 2ZF9A 2WCSA 1RUMH 2YD6A 2FIKB 4G7QB 1BMWA 43CAB 1NEUA 3D87B 5IJDC 2DEXX 3EXJA 2CR3A 3JUZA 5E8EB 3OG6B 3RUGE 3U4AA 4OQTH 1DUYA 1ZLVH 5CEXB 4Q9QL 5AFAA 2H8PB 5F7MC 4E0RA 2VYRE 1KJMB 1LNUB 4MCYB 2ISDA 3DGGA 4AJ0A 2OXGB 1A25A 2AERT 3WFHB 4O2EB 4I2XE 1GMJA 4F3FB 1JWMB 4OT1L 1IAIL 1TJMA 2I85A 1W9XA 4XNXH 5TPWH 4KITB 1VA9A 3T08A 3UMNA 4AH2B 3CD6P 3VXRB 3WENA 4I1LA 3INUL 2IFGA 5KSAD 2UY7B 5H94A 2L8AA 1BVKB 3BN9C 3DI2B 1IKFL 3EG9B 4YHMH 2WAQA 2ZWKA 1EO5A 3CFDB 5DZVA 2DMGA 4J3OG 4PD4J 4OKDA 4I18B 2DQEL 1DQLH 4P23D 4KI5E 5H37G 3WTSA 3KYMB 4PRHE 3NACL 4J28A 4OZ4B 5IB2A 3RTQA 3Q9QA 5FV2A 1AD9A 4Z1MH 3I74A 5EEXA 2NY6C 1Z9SB 3MLXL 4IL6E 1U8HB 1U41A 3QFDB 1ORQB 2H6UA 3MOBH 3PGFH 2CHWA 2GABA 5JOPD 4OFVA 3ZYZA 2B14A 1D7MA 1UATA 2PCFA 3C6LA 3PWUA 2J21A 3NA4A 4PJ8C 3OXSB 1IBGH 3LKRA 1CYGA 2C9QA 5EH1A 5ESAB 1UIXA 4P4KB 3VVWA 4ANXA 2QJDA 2BZ7A 5FAAA 2GUOB 4MNQD 4R2GD 2KIKA 2XTSA 2KKQA 4XMXA 1VKXA 2Q76A 3QPQD 2ZFCA 4TKWA 4GUPA 4WO0A 3GF7A 3IDGB 4PJBF 5LB1A 4B27A 1G9MC 2D7MA 4MX7B 3SOBH 4K7PH 1A02J 4WHTB 1IAMA 1FDLH 1NCJA 4JPWH 4UNUA 2DWEA 4DKFL 1OP9A 2DWXA 1E5CA 4JY4A 4AK1A 2JJUA 1TDQA 4EBQH 1TSHA 2VQ1B 1DJWA 1BVLB 1M7IB 1LT9C 4KJWC 4KKRA 3TO4B 1ASOA 3LHAA 4X9FA 4MD0B 1I1AB 3O3DA 5HPMA 4ADGA 3FH8A 5FKPB 1XF5B 3QI9A 2B3RA 4F57H 4TVSa 1M57D 1WSST 2QVMA 4R90H 4MS8D 1G9EA 3MRGB 2NX5D 1OZTG 1IEAA 2FO4B 2WPGA 5I2IA 2HSIA 4QYAA 1M56D 1WFTA 3KPOA 4OFQA 3BSZH 1UD8A 4H1LB 1NGPL 3IXAA 1M2OA 3ESPA 3P11L 2PWDA 1PG7W 4LPUA 4E5XG 1CXKA 3RU8L 5ICYB 2A4EA 4P8QA 3EFOB 2DMBA 1WLHA 3FQTB 4WSKA 5C0BD 1A5FL 2VITB 4ZUUB 1S5LH 1JP5A 3FXIC 4U3FG 2EINB 3ZSTA 1QP1A 2N7SA 3SKNA 2BSSB 4G43B 3VFPA 3N1QC 2G3ZA 2ATKA 4FQXB 1U7JA 1HJCA 1YNKH 2QMJA 1EFQA 1MRDH 3PNRB 1JNHB 1XH0A 2YEVB 2BRQA 2EDDA 4MMZC 2CH8A 3CHQA 5G5DA 1L7IH 5TGBA 3LQAH 4A67A 3S3BB 4M6OH 1ZHBA 4LQFL 3DBXA 1KTDB 3G6EP 3DIDA 2BOLA 5KYYB 4K71B 4OD2B 3T0EA 3O4LE 1O9ZA 2DJ4A 4FMKA 4XNZB 2JELH 4MA1B 3V0WH 3V0EA 1HK6A 5AVUB 1IQDA 3QUXA 2VRKA 5KANI 1N64L 1WFIA 4HS6B 2X0UA 2E27H 1S5LX 1NTME 3AG3B 3BVVA 3KPLB 3QDMD 4NBZB 5I9QB 5F9DC 2R51A 4JFEE 2O6FA 3QB7C 4WLCA 1NBQA 5EN3A 1AR2A 3C87A 5AG9A 2EZ0C 2Q7YB 1N10A 4PRDA 4BSWB 5C2BH 4WFGD 1YYLL 5CJXC 5DD6A 3L4ZA 2AQQA 4PG2A 2CIIB 3V4VL 4KT0J 1SQQK 3MCG1 2TRHA 4L4JA 2RACA 3CZFA 4OIAA 3VTPC 2G0KA 2F7QA 4ZKUA 3SD2A 2WLLA 4LLUB 5T33L 3UZQA 4BZ2H 1RIVL 5KAIH 4MAYA 1HHJA 1OW7A 1JV5B 1YEIL 3HB3C 1FNGA 4U4IA 2VDPL 3SBRA 3TASA 1AQ8A 5JIDA 3CFBA 2CK2A 3SKUD 3PAUA 3P2TA 5E1QA 4I48A 4OZIE 4OI8A 2ITEA 1U8CA 2X88A 4PJGE 2ARJB 1A1NB 2M26A 4OH8B 2BY1A 5T8IA 1RH5B 3WHE1 4AWJC 2DQDH 3LQZB 2F58L 4G11A 4X4KA 4PWFA 4E9VA 4N2MA 2O6PA 2Z6FA 4LLDA 2JMRA 4K94H 1BF5A 1W72H 1AQDA 3HRZC 1KSRA 1R5SA 3VNYA 4GNKB 5C70A 1C08A 2X1QA 3ABGA 2Z35A 2G9HB 2VZTA 1HOEA 5JPNB 3UXFA 1IFGA 2PO6C 3KPRA 1Q81Q 3V6OC 4X98B 3ZZQA 2FATL 2GITA 4ZMLA 1BZ7B 2OLDA 1BIHA 1U6AH 3P4NB 4UQ3B 4Z7UF 5CN1A 4Y2DB 2B88A 3BCCE 3NIDB 1TKWA 4WAFA 2EEFA 5KVMC 4I89A 4HC1A 2XY2A 3GSRB 1XB8A 2JWYA 2P1YA 3N43F 2EEXA 4KHXA 2OARA 3KBHE 4HT1L 1ZK9A 2YZ1A 3QR1A 3SPHA 2X7LB 1SVCP 3HB3B 4JM2F 4LAJH 1LDPH 3DO3A 7FABH 2VLRA 5KN5A 5GGSA 3D07A 3AB0C 3HLKA 3QUZD 3SQBA 3WKMH 4Z7OE 3DTXA 2QSVA 4WWPA 1DBAL 4MD5A 1CICC 5HY9B 4HJEA 4WTXA 1A7OH 3FFDA 2CKBH 3ULUC 2WQSA 4M4RA 4FP8H 3LJ3A 3VSQA 1NU1D 4X9YA 5FYKD 1DUZA 4XH2B 1W2EA 2WNKA 4LHUG 5H2BA 2UWEA 1AJ7L 3NMDA 3B2UC 1MIML 3ZPDA 5A2AA 2GHZA 2J5UA 2J1KA 3IDNA 5F44A 3MUGB 1LP9B 3C09C 4HKJA 2B87B 3QT2A 4PJAA 2FYNC 3MLUH 4X6CF 3BZ5A 5GGVL 5A16B 2O6CA 4Q97A 4JMXA 3VXQB 4I1PA 5D70L 3RIKA 2NY4D 1JNJA 2X1OA 4OVNF 3SPJA 4U1NB 5JW4M 2VLKD 3UTPD 2BVTA 4PRBB 1HTYA 2FJSA 3BN3B 5IQLA 3DA0A 3O6LL 4D6TD 3ARFD 5DXWA 1HL5A 2V7HB 4PBVC 1UXLA 3GSVB 4HKZB 3O2VH 3DX8A 1KB5L 2PO6A 1JUNA 1PZBA 4HIEB 4JJ5B 3CLQA 1J1DB 1RULH 2KXPB 2VH5L 3V0VA 3RFZB 3IJYB 2B2XH 4I88A 2Z93A 4F92B 5K1NA 2VR6A 1D5XB 5E6RB 4R4BA 3KW7A 1O5PA 2HJKB 4NDMB 5L2JB 3QWNA 2ZWZA 2DQFA 2MTAA 2VCOA 3IMSA 3BLKA 4XCFH 1S5IH 2EO9A 3UYRL 2BNRD 4FA8A 3QRFM 1MCJA 1NCDH 4J3WA 4NQDB 5ILTH 2IH9A 3BH9B 4IFDK 1CLYH 1K5NB 1K04A 3BP5A 5HBBA 2W9DL 4X6FB 5E2TL 1NBVL 1OHQA 5DD1L 5IB4A 2UXGA 4F93B 4P9HL 3MHVA 1EAPB 3FO1A 3OKNB 3VJ6A 3WHXB 2PW1B 3AY4C 1R3KB 4MAYC 1AOHA 3REWA 2HRPH 4OZGE 3UTSE 5FDWA 2XFGB 5L2KE 1MPAH 1QSFB 3JC22 3QQNA 3V4VA 1Q9OB 4AL8C 5IHHA 1AC0A 3U0WH 2BCCD 2Q87A 3HD7C 1IC5H 2GUYA 4OCNC 1ZSDB 3U30C 4JGMA 2XWJB 3BISA 4UINH 3AFLA 4L2LA 4FI6A 3T77A 1HE8A 2EO7A 3KXFE 2AJVH 1M7XA 2IOMA 3MACL 4OJYA 1UWFA 3RLSA 3LZLA 4ZUTB 3LKOB 2ZT9D 5ANHA 2WITA 4WFGE 1MJJB 2FQFA 3WS3B 4PREA 1S46A 3G04B 1R46A 2KOGA 3PQYD 2AV7B 2BLFA 4OZHA 1DH3A 5I6MA 5I6NA 3TGUJ 4F2FA 1H5BC 3WN5A 1RF1A 2IGLA 2N0MA 4JFVA 5IESH 2YGOA 2PABA 2DQFB 4AK2A 1URQA 4ELKB 3C5SA 2OMBA 4R7XA 1FCCA 2O5ZL 1DBJH 4ZMTA 1AKJD 5APXA 1R5VB 1GZQB 1A4KB 3BZDA 4GP4B 5LO7A 4MMZA 4F91B 3US1A 3L1FA 5EA0L 4UUJA 2HVJB 4ONFH 4M3JA 3GKWH 2E75C 3GMLB 3PFQA 4UB0L 3TURA 3LS4H 2AC0A 2XDHA 1H3XA 4J8QA 4Z7VE 3OLDA 1U4EA 1UA3A 1UJ3A 2WIIB 3DXAE 3WEXB 1C1EH 3DTUB 4OD3L 3CMAP 2EKSB 4XCNA 4F7CB 5FFLA 5M7QA 2CPSA 1L0XA 2EEAA 2QGCA 2KI7B 1ZOYC 5IVXB 2IF7A 3RNQA 4XI5D 4AXWA 1TJGL 1J05B 4P2OA 5CLTA 4N0UA 3ABZA 2HYNA 1LO5B 3NCCB 3PWNA 4IDJH 4JG0L 4CMMB 2AK1H 2BOCA 1RZ7H 1SUHA 4Y8AA 2R7EA 1SQXK 2OTUB 3B7SA 4LLWA 2WXFA 4NQTA 4HG4J 4D6TJ 3Q7JA 5JA9A 3CV5A 1BE3G 2VJ0A 2TAAA 1IC2A 1MUJB 3DTXB 4QHNA 4BKTC 2D31B 3CH1B 3ABMB 4FA7B 5IW6B 3BQVA 4GYBA 1G7HB 4LCYA 1E30A 3L9BA 4XVUC 1UGKA 2DKUA 3ARGA 3MYZA 3A47A 4S10A 1ONQB 4L9LB 3B9KC 3BX7C 2XC8A 4DP5X 5DCCA 1WJ3A 1FZOA 4K15A 4KZDH 1AGFB 2CUHA 2Y6SC 2TRYA 2CO2A 1I8IA 2YLKA 3QORC 4NFDA 4Q7DA 3L95B 4L74A 1LVEA 1FIGL 3VTMA 4UQ3A 2FLBT 4TNFA 1OT4A 1FI8C 5E2UL 2DWYA 5D72H 1FDLL 1GK4A 4WV1A 4FJZA 1VFAB 3PPEA 2PFXA 1RZFL 3EYVA 3NN8B 3OMNB 3KZIH 5A1AA 3UZQB 1U8JB 1MDAA 2F7PA 3PAYA 4MRCA 3E38A 1JF1B 3H9SD 1NINA 2Z93B 3MRDA 1OWAA 3PHOB 4ODTH 1B3IA 3I3EA 4PJ8A 1OWWA 4QTHB 4V1DA 1XGTA 4YHKH 1Q9WB 3K2KA 2OMXA 3HUJB 3PCYA 4PJFF 3S8WA 1Q38A 2PPCA 4LCIH 3AEGC 4FQCH 3BEWA 4AKQA 1ZANL 4O5LH 1AYRA 4WUUA 3QO1A 2PCPB 2BXZA 1A3QA 4HJ0D 4KQ4L 4FQJL 4NO5B 4H8QA 3US9A 1P7KB 1EZUA 3G6JA 3GXMA 3DSFL 2H1LM 5AOIA 4QRRB 2YFNA 3DJSA 4I1NB 1II4E 3D25A 1T3FB 1RHHA 3KH3A 4NRXA 3FRUA 3Q2VA 2PLTA 3TLRA 3ATDA 3C1LA 4TULL 5KS9E 3BP6B 3CAFA 3CMGA 3K80A 3ME0B 4HJUA 5DD3L 5FK9B 1ECZA 3BLBA 1P1VA 3T8XB 3CXHE 1K8DB 5ETUB 5ANME 3FSOA 5HY9A 3HG1B 3LIEA 4YNYA 1QBMH 4OZFA 5I5MA 4PBWD 1PCXA 1Z1WA 3MUJA 4M6OL 4PJBA 4XMWA 5ISZE 2Z5IA 4Z77A 2BNQB 3SKJH 3GG2A 1N7ML 3OB0H 4TPRL 1YQ3C 4KKLC 2P8PB 3ERXA 3HI6H 1OD9A 3CXFA 1R5WB 1HL4A 4XZUA 1SQBK 3QJSB 4ANWA 5LWYH 4C56B 3FMGL 3L71E 2X4TB 1R3JA 1HHGA 5E0FA 3O4OB 5FUCC 4JO3L 3HI5L 4TVPH 3WLWC 2GJ6D 2XU9A 1T1ZA 4NN5C 1HYSC 3RJOA 3MV7B 4JDTH 2XA8L 4FG0A 3ZE0F 5DS1A 3FK3A 5I1IH 1BJ1H 3KNBB 4AG4L 1OAUL 1DLFL 2OTWA 4FZ8L 4EMZA 2JKWA 1SOSA 2Y0CA 2F53B 1MFAH 5EF1A 3WNPA 4BSVB 1F4YH 3L08A 4WEUD 1UZ6F 1PZ5A 4JPKL 3UPRB 3H1IJ 5KOMC 4PWGA 2ZAEB 4F33A 3BI9X 5F89A 4BSJA 4JRYA 2AAVA 2XNDH 1REIA 2IAMA 4D8PB 2JJWA 1Z5LA 4E41A 1JF6A 1N12A 3TBYA 1HEHC 4A6YH 2CIKA 1KXVA 3MODH 1DN2A 1WAEA 3L48A 4H1LH 5FYLL 5HJBA 3UBXG 1T03H 1F45A 4YHLL 1GGIH 2UYLB 2R39A 3QUZC 4KHXL 2LFEA 4ZMXA 1QSFD 1J18A 5HHQA 3NJXA 1RZKL 1VQPP 2PRRA 2FO4A 5D93B 3P2DA 2YJQA 1YA5A 1UOLA 1BM3H 3P73B 4HFWA 1KB9K 2VDKB 2CLRA 1BQHA 3MRLA 2Z9TA 1NFKA 2LW3A 4N6QA 4YX2L 2Z31C 3RX9A 2PP7A 2V5TA 1GL2A 4G8FA 3EJZD 4PLNC 1TJGH 1FFOA 4X8JA 2DLHA 2NOYA 3Q2NA 4NQDD 5C08D 2AEMA 3GC3A 1Q94B 2WSDA 3BWAA 1DEEA 4ZDHA 3B9EA 5D7IE 4FNTA 2NY4C 4WV1C 1JB0J 5JYLA 5J89A 4YSSA 1U33A 5E6UB 4U0QB 1OXYA 2BIHA 3A6OA 3K5RA 3FTVA 5GS1A 1BQUA 1CGWA 3QORA 1HXKA 2X0VA 1S4IA 4AGLA 1GH7A 3GBDA 1KCBA 2I1KA 2VT0A 2YKOA 5IMKB 2LLGA 2MKLC 3BXNB 3KWVA 4XO4A 1XGRB 5FO7A 2BXYA 1ESOA 2DN7A 3FSZA 1W5CE 3GMQA 2BEQD 1ADQL 4GAJH 4ELMF 4ERSH 1BXAA 3Q06A 3QFJB 3OBAA 4XB3A 3QDGE 5DJ0B 4OZIF 1N0LB 5I1EH 4JQXA 5BCAA 1BVKA 4ZS6D 1MVUA 2CO6B 4JO2H 4MKMA 2NLJB 3H2PA 4KH2A 4NNPH 4PJAE 3P3SA 4W7ZA 3CWBD 1G1OA 2APBA 3HKZA 4X5XA 1RJZA 4BWNA 3HCVA 3TYYA 1NO4A 4NC1E 3SKNB 3GIVB 3UAAA 3CU1A 3OG4B 5GQBA 1MI5A 1WT5C 4F1ZA 5SWZE 2HVKA 1A3ZA 1JXDA 4Q2ZA 1CK0H 3BKYH 3FOMB 2Q7YA 3OKDB 4U6XA 5E9DD 4DIXA 5HPOA 4ZOCA 25C8H 3BFQG 5T1LB 3F62A 3GHGA 1H15B 4NNYB 2F8XC 1N8ZA 5E6IB 5DLMH 4YJZL 4FG2A 3ATBA 1BOGB 1WAPA 1ZDSA 4F7TA 5J8OA 5IG7A 1EAJA 3MJ7B 3CFIC 3QIWA 3FB8A 5DRXA 3MR9B 2Z8SA 2ZUSA 5JIKA 5I6PA 2DTMH 3ASWA 3NJHA 4OKVA 5C0BA 3I55P 3OMAB 4JRXA 3PP5A 1AXSA 2W07A 4FGMA 5JLZB 4XAKD 4E0RB 1RULL 3BZFA 4X4XA 4HJJL 5TE4L 3FQNA 4WY7L 2UUDH 3JV0A 3R0NA 5E56A 4N3TA 3EYFB 3RGVD 5G2NA 1UTDA 3WUVA 1MCRA 2XT1B 4X5WA 1ZP0C 3L5WA 1FBMA 3TYFB 1CCZA 3QIUA 5CN2A 3ZHNA 3NP3A 3R19A 5H4ZA 2VW6A 3DWTA 3CZGA 5ACLA 4HOZA 1XIWD 1LK2A 2AABH 2C9LY 1PP9G 3VFPB 1EEQA 2ZOLA 1YJDL 1GPOL 3AREC 4JFDB 2NNAA 4GKNB 4PJEB 3N55A 3GSXB 4HIPA 4DGYH 3T4YA 3MMEB 4HU2A 3HAEA 3D30A 4OQTA 3N44B 3VD0A 2CRMA 3QS2A 4B60A 4J3OH 5DK0B 2ZT9C 2G5UA 4R0LC 5DEFA 1AHWB 1XTMA 2J25A 3RP1A 2IDQA 3SDAD 1DSYA 4DCQA 4KPHH 4P4KA 4ZO8A 1IC5L 1BZOA 1Q82Q 1NC2D 1KLGB 3OTTA 5AG8A 4AW7A 2EVHA 4LBAA 3SE3C 3QIWD 4HULB 3MNWB 4U3HA 1OXZA 4JQIA 3VFNA 2P7JA 2NTFA 4FABH 2QHRL 4GAFB 1BQKA 2YXMA 1E5ZA 3JV4B 2DDQH 2W9LA 4YHIB 4N78E 4X4YA 3HTKA 2PPAA 5C07B 1GTNA 5F7AA 4HOWA 1C7SA 1XGUB 2CKNA 2H3NB 1FZBA 3VI3B 3GSOA 2J2ZB 4DP0X 1UKQA 4FX5A 2AJZB 4XXWA 1PGOA 2WK2A 4DGUA 4K3DH 4YLBA 1R19A 3A6BL 1BFSA 2AEPH 3NZSA 1PZ3A 2GI0A 2IBGA 2W90A 4A1RA 3ZKMD 2X9WA 3KD4A 1HGVA 3QUGA 5HDBF 1JPEA 2ZSVB 3PUCA 3U7WL 2WWMD 2AV1A 3MMEA 1TSRA 1OARH 4TRPH 5I0WA 2QTEA 3BEVB 1X79B 3P8CE 5DJUB 1RHHB 2VAAB 1HH6B 5C0BE 2OTJP 4LNRB 4KTDH 4QRPD 4YHOH 4RMBA 4KKNA 2ZYIA 4GAYA 2X89D 3QUHA 1IBHA 4MJIB 1QAWA 2XX1A 1QFPA 4D7PA 3AE7C 3O8ZA 1X9LA 3O2DL 5ID1B 4NT6B 5DUML 2L5GB 1FFNB 1QVOB 4AEFA 4KY1L 3LN5A 5HHMD 5GJSL 3GMRB 3NFNA 3TH4T 5EBMB 4AIOA 5J3HD 3STLB 3RYMA 2R0ZH 3VXMD 3SO3B 3KPSB 4YL9A 3G5ZB 2ADJA 5CBNA 5TE6L 4EI5B 1TJHL 4KJWD 3GSUA 3QW9A 1DDHA 1IM3B 3MCLL 2IANB 4P2RD 1VAHA 4IGBD 3T8VA 2NZ9D 4Y9EA 4KMQA 2XKNA 3AWGA 3PDOB 4U1JA 5L6YL 5EU4A 2CMRL 3GO1H 1A9BB 1QFWI 3WE1A 4AH2A 5AB1A 1I8KB 1LE5A 1WT6A 5HYSG 3Q1MA 4QF1A 4OZHF 1XGYL 4J3OF 4V2CB 3RDJA 4M8UA 4AZ8A 4X6CE 3WELA 4MSWB 1I1AD 4PV9B 5GIRA 4PJCB 1ACYH 1UJ3B 1LYQA 2WIIA 3JVGA 3WEXA 1PX4A 2IPUG 1SF5A 4AGQA 3HE6B 5HI4D 2WVVA 4Y2NA 4PJ7A 1A6ZB 3WE6B 3QI9D 1TTBA 2J6EH 4X5RA 2AP2A 1FV1A 4HEPG 2C9AA 3VMXA 5JOFB 1TOXA 1UYWL 4W6YB 3QJXA 3VX0A 3C9NA 3O45A 4Y4HB 1TYEB 4NSKA 2NNXA 4LPYA 2VDMH 4XP4L 4RQQB 2D03L 4RMQA 1KPRB 2FHBA 3QUMB 3FO9B 5DJ8A 4M5YH 4J1UB 1CQYA 4ANVA 2YAFA 4MAUL 2VN6A 1F58L 1COBA 4OVUA 2EXYD 2JK5A 5AAMC 4LHUD 1KD1Q 4XX1G 4YL4A 4A7VA 3LPWA 3HD7B 4ABWA 4TNGA 1S9KC 4NQUA 1BECA 2R9HD 5D1QE 5DC4B 4ZFQA 3MBXH 3RNQB 2O3JA 1JUFB 4J6RL 2R23B 2FJUB 3B43A 3DVNA 4NNXA 2LKMA 4RGNE 1XR9B 2MQ3A 2X9XA 3SKOB 1D5XA 5DZAA 3O8XB 2VE6A 1S7TB 4XB8A 3TZVD 5AW1B 1E5AA 4NYLB 1S7UB 4IJ3C 3WNIA 2ARJQ 4YDJA 5A2BA 2FL5B 2X6CA 4JPQA 5EORL 3NTCL 1D6VH 4P5TC 3S8FB 1DQQB 1HHIB 1VQOP 3EZJB 1KQSO 4KK6C 4IIQB 2EXWD 4N1CA 5B1KA 2NZIA 1OSPL 1Y47A 3TEXA 1I3RA 1RF1C 1RUKL 5DWUL 5CEZD 3MXWH 4M3HA 1PIGA 2PN5A 3VGGA 4IBYA 2J4WH 3MV7E 4W1TA 1QA9A 2YARA 1U21A 1F4HA 4ZMOA 3L5HA 2OYLA 1KTMA 2BNQE 3CH8A 3HMXL 5FGSA 2JJVA 3EO0A 1K3ZA 4FQHA 5H37H 2FB4H 4KKLD 1FV1B 3OKYA 4MB3A 2AEFA 2UVFA 3WMPA 1L0NG 4HH8A 5HYJD 3FMGH 4LSTH 4RAVB 3MRRA 3I85A 4EI6A 4TM9A 1SPDA 1BX2B 5B1JA 3QYNA 4MD5B 2MMXA 1QG3A 3C60D 3TBSA 5HYFA 1VL2A 1QWHA 5AB2A 3W9DA 3KXFD 2SPZA 3D85D 4RX4A 5C09E 3VCLB 3P32A 1U8QB 3DRQB 5HYQB 1AE6H 5T5FA 1DEEG 2JE8A 3TIDA 1Y0LA 5EO0A 2DQCL 5B3JE 4Y88A 2O72A 3B56A 3P3RA 5AKVA 1NFIA 5I66A 1YJWP 2XBDA 3ULUL 3A6BH 3S5LG 5FPIA 2EC9U 4FXKA 5D4JA 3WHXA 3FL7A 2VDRH 4HKZH 3FO1B 3VJ6B 2P47B 3IETB 4Z78A 2VDLH 2D7OA 3NZUA 2W65B 4Y99B 3MO1B 3LHPL 2Y06L 3G6JF 3TJEH 4XP9H 4I77H 4PJDB 4X5PA 1CFTA 5FYJU 3ZE1E 3N40P 4XPHL 1S78C 1NQBA 1J10A 5IWLA 3CHSA 3LN5B 2RBLA 1CG9B 5LGJA 3KZ8A 4JPVL 2MKVA 4XOEA 5C0CD 5DS2A 2WB1A 3VM5A 3FWNA 5EFIA 4LAQL 4OUUA 1LWUA 2A0LC 1J1EB 3DK2A 4H44C 2ZYHA 3P0VH 4JR9H 5DHVA 1RURH 2X4OB 3VB8A 3JVGC 4Z9KB 1VQ6P 5HYJA 1NTKE 1QL1A 4XODA 4FFYL 4LARL 1T0MB 5CHNA 2OXHA 4HQQL 4OLWH 4HPYH 3BCCD 4PJ8D 4A66A 4XO5A 1B4JH 1JTTA 2GTWA 1LTJA 5GTIE 2H47C 1NGXA 5JW5B 3V52L 3FF8A 1KCVL 2DQIL 1CGSH 1P5UB 3MCLH 3QAZC 3AEDC 1QUPA 4GW1A 1S3KH 2APTA 3CZNA 4W9ZA 3UO8B 3T3MB 2H26A 4WKZA 4M8RA 2NNRA 3NH7L 2IIJA 3QULB 4KNTA 2J2ZA 3VRIA 3QPQC 4O02B 3ISWA 3P9MB 5F9AC 5L9DH 4PJFA 1OCWL 4HIHB 1U0QA 3IU3A 2H0JA 4B9YA 1G9MH 2BVOB 1JFQH 3FFDB 2OYMA 3OAZH 3JWOL 4KU1A 1FP5A 3U36B 4OCWH 5ID0A 4EJ1C 1GGCH 5HVHB 2BY0A 1E6JL 2OZ4H 5C0NC 4PJFE 3L4WA 1WFMA 4KGLA 3CX2A 3PP4L 4D0BA 4TUKL 1NBYB 2ITCA 4PHZA 3QULA 4WNJA 2AJYH 3HVNA 3W67A 5EOCH 2IADA 1U8NA 1KDIA 3K0YA 2YMXH 4QXTB 1MV8A 3AS1A 1MUJA 1DJZA 1Z9LA 2KH2B 3H32B 1M1KQ 1OSYA 1Q0XH 2NW2A 2QSCH 2YFOA 3I02A 4OLVH 4PR5B 5DLML 4Z5RB 3TF7C 1A7OL 5ELIA 3HPJB 2QRXA 3QZWA 4UOZA 3A6CH 4ETQB 3SCMC 2EIZA 4F2MA 4AEHL 2LHAA 2AGJL 2XN9A 1JK9A 1L3NA 5GS2D 4AC4A 4EEEA 1FU1A 1AD0A 3G5VA 3MV9D 1EJ6A 2W0PA 5TH2B 3QXAB 4DP2X 4DUXA 4NPEA 5CMAA 2ITFA 5LBVA 9PCYA 1BZ9A 3CIQA 1KBGH 4RFNB 5DFVD 2HPCA 4YDVB 3BZFB 2K9FB 4PCKA 4QRSA 1CTNA 4GQZA 4OCXL 2NR6C 2VDQB 3EOAA 3U0PA 4X4MA 1H3GA 2WZ6A 1LM8V 2NY2D 4XNUH 4HCGA 1CFNB 1MJUL 3EDKA 4Q6YA 3IPFA 3V6FB 3S37L 4AGOA 1OD7A 3O6LH 1TTGA 5GRJL 2OYIB 4V33A 3BRFA 1K9TA 1A2YB 3BUYB 3GMNA 4LPXA 5IBLD 1JYWA 2BP8B 3KGUA 1D6EA 4J3VA 2E76C 1IFIA 2CPBA 1OY3B 5T1LA 2B2XL 4OCMC 3LH2L 1I7RB 2PAJA 1N67A 2IH3A 1A4CA 1QEWA 3FU7A 3KPQB 1KEMH 4PW3A 2ZUUA 2VQ1A 3KEHA 5H37A 1G1JA 1S5LE 3SWKA 4Q6IA 2HP4A 5DGQA 2A73B 1KTLB 1S5IL 3UYRH 4LT7A 5EO9B 1KB9I 2WBJD 4QMAA 1F8TH 1CLYL 4JCMA 1VGEL 2ZP9A 4MZ2A 3W11D 4JM4H 1WH0A 2ZNWA 4U7MA 4XE0A 1VFBB 4HMCA 1X6NA 2B1OA 3KPLA 4UZUA 4XZ4A 5TDOA 4F9LC 4KV5F 4YDLC 4UT9L 3RUGB 5I26A 2CJTA 4WNQA 2WQYC 4WEBH 4FFVD 2GUOA 1CTMA 5IBTL 1EEYB 5G4MA 2YKLL 3QNYA 4OD1L