5AW0B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw0B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw0B02
1MUUA 3L35A 5CMZA 3A7OA 5AW5B 3V5BA 3NXSA 5AW7B 2C9NY 2WPQA 5APQA 5AW2B 2R3CA 1GU5A 5AVRB 3WGVB 2W27A 2KP8A 1DH3A 5AW0B 3HE4B 2WPSA 3M06A 3NMDA 4AUWA 3MGNA 2E43A 3VN0A 4C46A 1A02F 3B8EB 3HE5B 3WGUB 3SWFA 5AW4B 3P32A 4KHXA 5APXA 4GT1A 5APVA 3O8ZA 4XE5B 1JUNA 1J2JB 3KDPB 1CZQA 2XZRA 5AW3B 5AVWB 3TNUA 5AW1B 3OAKA 2R32A 4AQRD 5AVQB 4GKGA 1YYCA 4AYCA 3A5TA 1A02J 4HYTB 3TK1A 4B86A 2VRSA 3M9BA 5APTA 1OWAA 1T2KD 2ZXEB 4RESB 1FOSE 3NTNA 1G2CB 2Q7CA 2WPRA 2YNYA 3A3YB 2WT7B 2XU6A 1OXZA 3IR9A 5AW8B 1FAVA 1HJBA 1NWQA 1H89A 2R5BA 2WWWA 2W6AA 4DZOA 2YO2A 1JNMA 1FOSF 2QM7A 1T2KC 3L36A 1H8AA 4EOTA 1CI6B 1HBWA 3T97A 3I5CA 3P8MC 3VMYA 1KQLA 4I2LC 5AVSB 2P7JA 1X8YA 2IPPA 2N9BA 2XV5A 1GK6A 3HE4A 1HWTC 2Q5UA 1SLQA 2JJLA 4C7NB 3M91A 2WT7A 3LIEA 3KQGA 1GD2E 1GZLA 3VTPC 4LC1A 1SP4A 3V4QA 3HE5A 5APUA 2YO3A 2Z5HA 3LIDA 4I6MC 3HTKA 2Q3IA 5AVVB 4M3LA 3VMXA 5APSA 3M9HA 2WTYA 2R5DA 1CI6A 2ZFCA 4RETB 3TNUB 5APYA 1HUCA 3TYYA 2C9LY 3MD0A 5AVUB 2QM8A 3M0AA 3V4WA 1S9KE 5AVTB 5AVYB 1NAFA 1MV8A 4C7NA 2E42A 3NFQA 2BASA 3M0DA 5APWA 2Z5IA 1CSBA 3VMZA 2P2UA 5AW9B 3A2AA 2P67A 5AW6B 3P7KA 1GTWA 5AVXB 1MFZA 1S9KD 1H88A 3L37A 2H7HA 1GK4A 4JYCA 1IO4A 1GU4A 5AVZB 3VYIA 4JYBA 3UIAA
chains in the Genus database with same CATH superfamily
1MUUA 3BPLB 1PLGH 3G08A 4GUPA 4YDJB 3T3MF 1IKFH 1GL2B 4YUEL 4LFHD 4K3JL 2Y5QA 4QYOB 2YXFA 1L4AB 1H0DB 5I1AA 4E5XA 1TYJA 4K9EC 4PJCA 1S3KL 4K3GA 5K1NA 2H3KA 2FUQA 1BZ9A 2PN5A 1NU1E 2L8AA 2MNJB 4HV8B 1RUKH 3CI9A 4OZHA 4QRRB 3MMEA 4XO3A 3BDYH 3WNJA 5FX3A 2JKVA 4LEXL 5TFSL 3L74D 2OTLP 1JZFA 1KPVA 3MUGB 4JDVA 1DEDA 4TVPD 5APVA 5DHVB 3EOTH 2ALAA 4C56B 5J1SC 1GSKA 1WEJL 2QPSA 2IPTL 4GS7B 4MD0A 2N1TB 2GKIA 3GTNA 4JPQA 1H8OA 2P24A 3VFMB 1SDYA 2XHNA 3C5SB 5ACZA 2GA1A 5DURD 3GUTB 1QTPA 2I85A 3T1FA 1M71B 1MH5A 3LS5L 1AHKA 2ZP0T 1IGTB 4BBWA 4OD3L 3WTSA 1VENA 2NNXA 2P48B 3CZUB 2YFNA 4YLQT 1JN6B 3HLAB 3ZO0A 4HXBH 4N87A 1I75A 4LGRB 5IB2B 3PGFH 3OKEA 3FSZA 2GJPA 1NTMG 4QDGA 2QQNH 1N59B 5KLIB 1J0JA 4G8IB 4OLYH 2ICWJ 5SWSD 4RH4A 2QGDA 3T4YB 3AXIA 2DLFL 1JTHB 1M1XB 4YGVA 3TBYA 1JGIA 3WO4B 5DMYA 1YYLL 3IPFA 3BJLA 4C8XA 4ODUA 5ESVB 1MHHA 4Q9RL 4ZOAA 2QV4A 1OPGH 1TPXC 1SQQG 1JWSA 3ZE1E 4AQZA 2ZKMX 3AE1C 3BXNB 4UINH 4LLAA 2F2HA 3A5VA 5DURB 2Z5HA 2FXMA 4XC3H 5CCKH 4WJ5A 1DVZA 3SEPA 4PBVC 3IYLW 4QCIB 4QHUB 1J5CA 3BRFA 1WZMA 3O8XA 4GAAA 5G4NA 3DSNB 3TO4D 3KHOA 2GQHA 3OJDB 3VI4A 2BFGA 4LSQH 2VLKA 3TS8A 3RY6A 3ZKXC 4E0RB 5KVEE 3LKOB 4EUPH 1H8NA 3G6AB 1KEGL 2FIKB 3FU0A 2IADA 4UTAL 3CFMA 3V4UL 1X5FA 3ZK0A 2R3SA 4XN2A 4F15C 3MRJB 2DQDL 1LE5A 4M93C 4WY4A 3MLTB 3V5KB 1F6AB 2FJGA 3LHAA 5IWLA 2J7LA 3TEUA 2HWZL 2QT6A 4A2GA 3IT8D 1MFAL 1MJ7L 1R4XA 3ABKB 4Y5VA 3LNIA 4G6AD 5FO9A 1AKJB 3P77B 5BRZD 2OBGA 2BXZA 1RF0C 3BQUC 1JPGA 3KWUA 4B27A 1MVFA 3IDIA 1PY0A 1UZ6F 5ANME 1I7UB 5F89A 1E6OH 4KJPD 3U7YL 2L04A 5JZ7D 3VYOA 1BQLL 4ELMA 1WTLA 4HGWA 3C12A 1AHWC 2JKIS 3CHPA 2DMBA 3SB3A 2KZJA 4I48A 2XYBA 3KXFB 2RAMA 5EU5B 3QCVL 2QG4A 1QLEL 5AD0B 5EO1B 1ITBB 3AT8A 2FRGP 2Y07H 1P84K 3RWEA 5DA0B 5IVZA 2ZPKL 4L73A 3GSRA 1D7BA 4RA0C 2QHRH 4POYA 1DN0B 5D2LB 2LTQB 5TD4A 4YL9A 4WY7H 5KG9B 3WAKA 1V7MH 1YEIL 2XFXA 3MLPA 4ZAKD 1A9BA 3C8KB 2UZIH 3F7KA 3DECA 3QNZB 4N9GB 4HS3B 2LXBA 4XMPH 3EJSA 4HJSA 3MRHB 3NBNA 2OJZL 1UXSA 6PCYA 8CGTA 4NN6C 5E4EC 3R8QA 4XB8A 3K81A 4FXTA 2FYUE 4YIQB 5KVEH 4NP4L 1G43A 1FGNL 1HHGB 4HSQA 4NNPL 1ETZA 3VXQA 3VFWB 5JNYB 1FHGA 4NAQA 2CDGB 3P2DA 2G2NA 1EERB 1FZKB 2QMJA 1ZPUA 2E7LA 2OQJA 3O45A 1ZPLA 1IBZA 3FCGA 4OGYL 5A2LH 3QDHA 5CU9A 4I7ZB 1T6VN 1RLBA 2X10A 3PRJA 3IKKA 3FO9A 4D3CL 5DZOA 3TH4T 1MY7A 4D9LL 3NFPB 1OF0A 1QYGH 1KJ3L 2DIEA 3GNML 3QISA 3MCKA 1CGWA 5CLXA 4AH2B 3PV6B 5I9QC 2ZNXA 4AL8C 2FGWL 2F74B 1MCQA 3JV6B 4LLUB 4MNQE 3TEZA 1UOLA 1M7IB 1AQHA 5E5MB 3V4QA 4ADGA 1P1VA 4KTDH 2MPVA 4LHUG 5FGSA 3QFJA 1LVEA 4GQRA 3CZGA 1HSAA 1NLDL 1FDOA 1A66A 2M8XA 4WUUA 1UM6H 4Z9KB 5HDRA 2OMTA 3BASA 4KV5F 1U8KA 2JCCB 4ODHH 3KXDA 5JMRA 4A6YL 2FEDD 2YN5A 4QRPE 4XVJH 3CN3A 1NGMB 2J6WA 4OFVA 1ORSB 2DQGH 4JRFA 1GVIA 2D3NA 4UUJB 4DTGH 2QJYC 3O2WL 2KS0A 2PPCA 2HTLC 2W80C 4JM0A 4Y4FA 3FTZA 2AC0A 3VO0A 3I3DA 1S9KD 4QRTA 4IS6A 2LAAA 5C0CE 1PGQA 2YD9A 1WWAX 3P1VA 1V54B 3IN0A 3U7WL 3L35A 5EF0A 2D9QB 4QTFA 4GT7A 4P23D 1FZMA 1E3XA 1ET8A 3F2LA 4H26A 5K9OA 2X5PA 1S9WB 2XZQH 2Z31C 5FIEA 4A7TA 1ZXQA 3IDGB 3X2QB 3QG6A 2W27A 2HUEA 1INEL 4OB5H 1VIWA 4PW4A 5LN4A 2E46A 1CE6A 2A38A 3PWLB 3RAJH 4GXFA 1J8HA 4ENED 1CGVA 1KJVB 5C6TL 2Y6SD 3AVEA 1JPSL 2C9XA 1N3NB 1LJMA 2UYLB 5E99H 3HD7A 3RWDA 5F7HA 1KBGL 4XN5A 4UB0H 3WHE1 2UUDH 2WZ5A 1FAKT 4NOFA 4UNVA 2I9LA 4Z7WE 1BHGA 3BH9A 4TSBL 3FL7A 3C6SB 3VVWA 1KTLA 1QSVA 2K45A 5DHXB 2PCFA 1LWJA 1YTZI 1R3LB 3DBXB 5LXGH 4K73A 1VQ7P 2OL3A 4NBYB 3AAZA 4MSWA 4PP2B 2WSFH 2X4QB 1HHJA 3DARA 3RVWC 4NC2B 3CFEA 1LO4H 2UVFA 3N1MC 3X3GL 1PP9D 1GMIA 3HS0B 4UV7H 2KUBA 5AUMB 1H19A 2J4WL 2NOYA 3MBWB 4WI4A 3RA7L 1CGTA 4I3SL 4P23B 4Q9CA 1QA9B 4DCKA 3DV6B 3U1SL 5DMGC 4X4YA 1D9KA 4LF3A 2VDOB 1XQ4A 2UY6B 1QUNA 4FI8A 4OCMC 4PVNA 2X4OB 3H2WA 5GTIE 3VAEA 2XN9A 4JCLA 4J28A 2NW2B 2BP5M 5C3LD 1L7IH 5DJ6A 3QDJA 4IBVA 2OYHB 1IJ9A 4LB8A 4L8BB 1U3ZA 2DDQL 5DQJB 4AQ8A 5CR8A 1XSOA 1DD3A 3MRCA 2ZQKA 2DMCA 4TT3H 1J1EC 3ZHDA 4XP5H 2C7UB 5MEND 1LEIA 3LVEA 1A7OH 4ZT1A 1KLGA 2BP0A 3CGTA 4I9WD 3SQBA 2HVKB 3ZE0E 3FH7A 3RNKB 5HGBB 3EBIA 1JPEA 5F70A 1FZOA 4IK7A 4R26L 3S35L 3H85A 5IMMA 4FLOA 3MRRB 1NDMB 3M88A 4ZFOL 3BFWA 5D1XA 2EC9T 3O9WC 5DRXB 3PPSA 2GB2A 4H1LA 3P9MA 1O6SA 2A3TA 4E9SA 5J89A 3IAGC 3OKNA 4XZUA 3TONA 2W91A 2CHXA 4RBPK 4J4PA 4UQ2A 3EUUA 1Q72H 2E7MA 3IU3B 2BOBA 3FO0L 4EI5C 1GCYA 1G0XA 2V2WB 1NDGA 4PLKC 4QXUL 3U0TA 4S1QH 5L88L 1HC1A 3DX0A 4F7PB 3MREA 3H1HE 1QPKA 3BP5B 3HMXH 1WFMA 4JUTA 2ZYRA 5ID1A 5F9OH 2BC4B 4B5EA 5BS0E 2GJ6D 2VMEA 2VR4A 2WXLA 2J55A 1EJ8A 5MENB 4NKOB 2NNRA 3DGGA 4P5TD 3QNFA 1NAMA 2ODIA 4WNQB 2KS1A 2PRRA 3QZMA 5AZ2H 1OW8A 2AXFA 2N9YB 3BT2L 3CN1A 1BGYE 5GTIH 4AEHL 1J1XH 1KIPB 2ESVD 4MXQC 2YJLA 1HNYA 1A6WL 1FNSL 1T4WA 2HWZH 1GKOA 3USSA 4N2OA 5F9WB 4N0CC 2J1WA 2E76B 1XBRA 3SD2A 5IZ7A 1ZHNB 2DICA 4JHWL 2PWGA 1E28A 4LU5L 4OJFH 4XNYH 1NC2A 1YNLH 1A02F 1FNEB 4W9KC 2LKMA 1A6AB 4PRHE 3S8WA 3ZZSA 5ERWA 1FIEA 4XE5B 2XV3A 4LLDA 3GLEA 1T1XA 1B88A 3X1BA 4OI7A 3LZLA 5TE7L 4ELKB 1XCQA 5JHDD 3RVTD 1O75A 4N8VB 2OCFD 5KTBA 4BXVA 5IW6A 4S1SL 1U3YA 3WY2A 4CILA 3WFCL 1DTUA 1IAIM 3HUJF 4HS8L 3VXMD 1ZTXE 4G8FA 1HEJC 2GJ6B 4OZIF 1ZT1A 1WHOA 5JORB 1XV8A 1A4KA 5KSBA 1IGML 4YHPA 2JB5H 1P5VB 4P5TB 4M1GL 4TVSa 2RQEA 1CFSA 1SYVB 1DSFH 5EU7E 1DL7L 1OXZA 3KYAA 4B53A 2VC2H 4P0DA 3SKUD 3L45A 5I19L 1SRDA 1N64L 2HG5A 5HHVL 2OTUA 4N24A 2VDMH 3CFDA 1WE5A 4U1SB 4YZFF 2O5NA 3GBDA 1S4XA 3HC4H 1OSEA 3AU1A 3QC6X 4JKPL 4OQTA 4XNZC 2EKJA 1B3JA 1QSEB 3QO0A 4UQIM 1TFHA 4LSRL 43CAB 3M07A 5KSUA 4N2FA 4EAEA 2HFED 2JJLA 2LHAA 4MCYA 4MX7A 3VXMB 4F2FA 3DRTB 5D70H 4N22A 4G6KH 4GSXA 1PZ5A 4UOJA 2E56A 1OGTA 4FXGB 3T65B 1LEGB 3UTQA 3ML8A 4TVPL 3QDGE 2J20A 3QNXA 1G87A 3LKQB 3DDGA 3CZFB 3EGSA 4N8UA 3NPSB 2C1OB 1XF3A 1IC7H 1P9MC 4F58H 4CC1A 3V6FA 1HOCB 1A5FL 3MV9A 1Z5LB 3M0DA 3L4WA 3N0PB 1FFRA 1ZTXH 5HDBF 2Y9YA 1DSWA 2VMCA 1JV5B 3HRZC 3M17A 4MMZA 1XCTB 4PJ7B 2Y22A 2ZYHA 5KVDL 2IDCA 2R2EA 3CMEP 4NKIH 1BQKA 1L9NA 3I6LE 4N0FA 4QY8B 1CFQB 1TSHA 3D4YA 2ZAHA 3CFKA 1XZ0B 2HFEB 4HJGB 5C0BA 1OQOA 1Q7YQ 3K2MC 3TFBA 1KB5A 2Z7YA 1KFMA 1SQBD 4AJ0A 2YRZA 1SFCC 1ROWA 3ZDXE 2IPUG 2LE9A 3O2WH 1NGYB 5EBWA 3BQUD 4BRYA 4JN1L 1PEWA 5D71H 5GJTH 3TO2A 3B7SA 4PJ9C 4YAQB 4RX4D 4AUWA 4WO4A 2EDEA 4L3EE 4NBXB 5CP7B 4XVSH 1K8DB 1CXFA 2LU3A 3UJIL 5KW9H 1QW8A 3WELA 3CCEP 4F1ZA 1IVTA 4WHTB 5FECB 1ZV9A 5JPNC 3MYJB 1ZGLP 1D7FA 2ADJA 3NRFA 4JANB 4RMQA 2VABA 5KJ7E 3JTSA 5I1GL 1I9IH 1JWMB 3G04A 4JDZB 5IGXL 5KYXB 1WO2A 1UVQA 3MHVA 4X5PA 2Y1VA 3CMOL 4YDLC 3F62A 4OUUA 4X4XB 4U1HA 3V4PA 4HKZA 1HYRC 4JZNA 4HKJA 4AWJC 2SEBB 4QF1B 3FUNA 4FYQA 4U3HA 5T1MA 1OSPL 3BQUB 3ZT7A 1FRGH 5D72L 5F0PB 1AD0A 4U1IB 1KY7A 1VQPP 1KTRL 4OZFH 2GY5A 2HYNA 3F84A 1T2KC 4JE4B 4JZJC 5I17B 1T5WB 3ZTJG 5HGAB 2H32A 1USQA 5MEPA 1QR1A 5DMJB 1QASA 5D9SB 3RFZB 2HLFD 2WWMD 3KLLA 3NJIA 4BRJA 3IFNH 2F18A 3VGDA 3ZDZB 1HDMA 2HH0L 3A0BE 1OVVA 3B2MA 1EHLL 1T3UA 2HJKB 3UTSE 3L48A 1CBVL 1U8QA 2CKBH 2V2TB 3SDYL 5H35B 4EKJA 4F7EB 1OK0A 2D7NA 1U91A 2W0FB 3VI3E 2YRBA 1U8LA 2A9MH 5KS9A 3RHWK 1IM9D 1W0WA 5D7LA 2HVBA 4OFQA 3MNZB 2P5EE 1TXKA 2FFDB 3DVGB 4FJZA 5FKAB 3V0WH 5E4AA 5E4EB 3Q5YA 1NCDH 5AVYB 1E67A 1GGBH 2FO1A 2WC7A 3PFQA 1NJ9A 3L2NA 4CW1A 1GS7A 3KVQA 3P7KA 4AG4L 4V1DD 1FORL 4AQ1C 4JRYA 4QWWC 1CDHA 1OF2A 1Q86Q 2DEWX 2F8OA 3KH3A 3ARBC 5DJAA 1DQIA 3KPSD 3RZCA 1MCNA 4M8UA 3G5WA 1IFHH 3QEQD 1D2PA 1ZLDA 2W6BA 1RHHB 2M83A 3ARGC 5I9QB 5CJOL 2AK1H 1CN4A 4ODTH 5FO7A 3IJ8A 1XGRA 2OPCA 4IOFC 3CC7P 5JW5B 1QVGO 1TJIL 3CFNA 2QFRA 3B2XA 2GSGB 2ZAIA 2XNXA 2IBZY 1IM9B 4U6VH 2G9HB 5HHQA 3WIHA 3F6LA 4HG4K 2GUVA 4GNKB 1NBQA 2MH4A 3GTVA 2COQA 2Q8AH 1COBA 3FAXA 2EICA 3CC1A 2OYKA 4ZOEA 4YO0B 2Y36L 3A0BH 1L9TA 3FTGB 2W92A 2YOCA 2D9CA 1VQOP 4UM9D 3L75G 2BIQA 2BFVH 2ZCHH 3ARRA 1TZAA 2CLRA 3K6IA 1NCAH 3QEHB 4WQOA 1NEZG 1F1AA 3S98A 4JHAH 5DGRA 1U8NB 4AGMA 3MO1B 2GPZA 4OCWH 1ZK9A 1FJ1B 1A9VA 1R47A 2ZWSA 1S78C 1KIUA 3PP4H 1FVCA 2XTSA 4OFYD 3DUUB 1KQSO 4PCSA 5CEYB 5A7BA 3EH3B 3FU7A 1GDTA 3QZOA 2QJYB 2XPGA 1UWEL 3BOVA 4Y9FA 5EC2B 3S2AA 3AG2B 4RMRA 4AMKH 3A6CH 3UG4A 3OGOE 3QEQB 1NKZB 2ED6A 4GMTL 3CHRA 5IJVB 1P7QA 1V3KA 3DSFH 4PB9H 3AGVA 2WUBH 2JKRM 3O41B 3TVMD 3RJDA 5HHMD 2H1LM 4NPKA 4NN7B 2A45G 1S46A 5DMGD 5HGDA 1L6XA 1MFNA 3QDMB 4WVRA 3PTZA 4DKAA 1U3NA 3W11D 3Q48A 3DOSA 1E4JA 4Y99C 4WLCA 3A0HE 1N4XL 1ZA3B 5D2NE 3S0PA 3L3DB 4UM9B 1RE4A 4UCFA 4R97C 1GIGL 2IO5A 5DI8B 3TGUJ 1QP1A 3HI6H 1Z3GH 3C9NB 1JJUA 3F6IA 4JUSA 4WWKC 1VL2A 1XH3B 2MCPH 1FFPA 1IUZA 2AW2A 4LVNC 5EIVA 5EU7C 2Y7QB 3IJHB 5E79E 2BSCA 4YSOA 4AMXA 5FR3A 3ZMRA 1NIFA 1EDJA 1J1OL 5D6DC 1KBWA 2FT8A 4HWUA 2IGFH 5KAQG 4NENB 2WWOA 1J5OL 1URQC 1CT8A 4R5XA 2W07A 5DK2B 3EG9B 3NIGE 5IQOA 3WS3A 3H1KD 1XEUA 2D0GA 4IMKC 3ZU8A 1UZGA 4IKJA 3IWVA 2EH7L 3AWGA 1ZA6B 4QXTB 5HHMB 4P49A 3OZ9L 3D87B 1PKQE 1T2JA 1RZFL 2NDGA 4Y5XC 3SPGA 2CIIA 1U8OB 4A2HA 1GYWA 5L9DH 1ZT7A 3HI1B 4WV1C 2DJUA 2UVEA 2JTDA 5EF1A 1KYOD 4MYPA 1NWOA 5TPWH 1K9TA 3BUPA 4PLKD 1YCSA 4YPGB 5FHAL 5TDOB 3SE4C 4EUPB 4ZD3H 1BD2A 3BVTA 4NHUB 3P3UA 1AQ8A 4YSRA 2Y72A 1RK1B 1ECZA 2PXYC 1SY6A 3S3SA 1J1EB 4IOSD 3ESVF 4DZ8B 5DQ9A 1N70A 1FVDB 2X2YA 4YSSA 3FU6A 2WPSA 2GITA 3CVHH 3W67A 1AE6L 4JZOB 4L4JA 4A7PA 3MGNA 2E43A 2WXJA 3VN0A 1KORA 3A0HH 1DBKL 3P54A 5CU5A 4MXQD 2B8OT 1KILE 4MFHA 1KYAA 3T4AB 2FATH 3IKCB 2NSXA 3MROA 1IEBA 4X6CE 4ZUUA 4XMLH 2FWOA 2YGPA 1MQKH 3LEYL 3WO3B 3VG0L 3BZEA 5E79H 1ZLVH 1DYZA 3ZVVA 1DJYA 2RCSH 1U3HA 1CXEA 1MFEL 3RL0g 2AGJH 3HUSC 2PR9A 2CGRH 1RHZB 3AE5C 5BVJB 5APTA 3PH0A 3FQWB 4ZYKB 2K3TA 1MAML 5K9QG 4KROC 1UA7A 3LIZL 3AQYA 3OZKA 2R8SL 2AQSA 2NZ1A 2FECL 3TIEA 2OYMA 4AJYV 1WJ3A 5HHPA 2XKNA 4NRYA 1HWGB 4ACTA 5B21A 1JFQH 3CVDA 4PWFA 5IB5A 3Q2NA 1MZZA 1SJHB 3B2UC 1E4XL 2R5BA 1Z2KA 3OKOA 1WVZA 6CGTA 4EMZA 3DXAE 1DQJB 3H6PA 2ZF9A 5FDWB 2EE0A 3ZKSD 2ZOTA 5KJ7C 5HSFA 2QV2A 1NBZA 2BVPB 1X5GA 2EINB 4ZUTA 1CD1A 1FBMA 3D07A 4QT5A 5F88B 2Q7YA 3SSUA 2BJML 4MNGA 1GGIL 3BZFB 5D93C 3FCUB 3GMRB 1SOSA 3LIEA 2YGOA 5KBMA 1H6TA 4QTHA 2PR4L 2AK4A 2G5RA 4FP8L 4I89A 4NT6A 3I9GH 1G9MH 4DSYA 3US0A 3I3BA 2WZ6A 3NZSA 1AY1H 4EZKA 5ANMA 4YSAA 4HSCX 2HX8A 2K6ZA 1NSNL 2P42B 2VDRL 4L5FE 1R24A 1U6AH 3ATFA 3C8HA 1CG9A 2DYSB 2YKQA 3VFVA 5L8LB 5F3HA 2IBZD 2XN0A 3SFEC 1EHLH 1JPFB 4IQHA 4J3OF 3DROA 1QBLL 4FYTA 2PP6A 5I8KH 3TPUA 4FA7B 1A7NL 1OARH 4QXWA 4DN4L 1OIOA 3F7YA 2ZCKL 4YHNA 5DC2A 4BK5C 3WXWL 4NQSB 1MCFA 5IEKB 2ADYA 2OJEB 2FECI 1RV6X 4MJIA 2JJWA 4G3YH 2YMXH 4I3RL 5AVZB 3P30L 4NKMA 4XNZB 4GEJA 4LL9A 2MKLC 5HYIA 1BPLB 2AJXH 4PRDB 3NVQA 3FYIB 1TQBB 2E75C 3UYPB 1KWGA 2O5ZH 1HWWA 3TCXA 2WBXA 2M5AB 5F3BA 1ONQB 4GSRA 5C09E 1IAMA 5KVGL 2VDKL 4LBEB 1H0TA 3FRPA 1HHIA 1X9UA 1Q38A 4JFQB 1I9EA 3AADB 4QRFA 4JX0A 2CAKA 4B96A 1IGJB 1SFCD 3AEEC 1TTBA 1NTZJ 3PG2A 1A3ZA 4YTPC 1WCQA 2YUZA 4M61B 43C9B 5IREA 4HCGA 4YGAB 2H8PA 4LLWA 1XGPA 1Q9LB 4M5YH 1MJUH 2VERA 5GGUB 3VCLA 1BFOA 5CJOH 3GTTA 1IAOA 4QRPD 4L2YA 3VXTA 2WBWB 2A06E 2ZOKA 3R1GH 5C0DA 1R3JB 3HVNA 2BP8A 3Q01A 5E4IA 1UYWH 1ETJA 2DQCL 4LOEA 4M7JH 4BM7A 5F7BA 2IEPA 3H9HA 3K4DA 4L5FH 2GAZB 1CDYA 2IBZX 4XRCB 5GGSA 4M43H 1GPOL 1KFNA 5AOMA 5J9PA 3KCWA 4BH7B 5A2BA 3C8VA 3HRZB 4MNQB 3BUYA 5DMKB 4HJJH 4KK9C 3UZVA 3CC4P 2KQMA 3EJUA 2PCPB 3U0WL 3DURB 3QJHA 4M5ZL 3TEYA 5KBDA 3CZKA 4XCCH 3VE0B 2NYYD 2FHCA 4IGBC 2JE8A 1Z3RA 4JHBA 1EXJA 2GJJA 1G84A 1J11A 2A2QT 1SFCB 2ARWA 4O5LH 3DJSA 3ARDA 3VXRA 1GKEA 1PG7W 4A2EA 1KZYA 3BD4A 2R7EA 1BEYH 2P80A 1SM3H 1NTKJ 3O3BA 5E8NB 3FQXA 4Y2DC 2XV5A 4QRPB 3MOAH 2VDQH 5D8JL 4KDTA 1ACZA 4FQ1H 4QD2E 3D12B 3RBZA 4MAYD 1IJNA 4UTBL 4X4ME 4I3GA 4KQ3L 1M42A 5ETUA 3RTQA 1EZVY 3B43A 1A7PL 1K72A 5C0CB 4LPUA 1HKLH 4I2XE 2WSEJ 3AMKA 1ZXKA 2LR4A 5EBLB 3AXLA 3QWRA 2FCBA 5D5MF 1A1OA 3X12A 3C60C 3NN8A 1G1JA 2FX7H 2X4SA 5I1DA 4QHKI 2DZEA 2QPUA 1JXGA 4HU8A 1GIGH 2B1AL 4IIQA 4Z7VF 1PAZA 4DF9A 4FQXC 4E42B 5GZOA 1EV2E 1PCSA 5CSGA 4YDLB 5D2NC 2EXTA 1CDBA 3OJMB 1A6VH 4I18A 3RX9A 2AEQH 1UOWA 1MCHA 2QVMA 2VR5A 2WQYC 5KKZC 1R5VA 2R59A 3V10A 4AGNA 4D9QD 3D0LB 4KO5A 3HAEA 4Z7WB 2J88H 5E8EA 2QVFB 4JZJB 1PBYA 2AXGB 3HBPA 4L4VE 2H2PD 3QWNA 4MAYB 4ES8A 1AGBB 4N20A 1PCXA 2HR3A 3PWJB 3GUFA 3K2UL 4RWYH 4RAUA 3LN4A 3RKPA 1F97A 5CD3B 3BZ4B 3EYFB 3NZUA 4FQHA 3MKKA 1J48A 1SHSA 4U1KA 1OHQA 3AT9A 1UZ6E 1T4KB 1ULVA 2R29H 1I9JH 2AZAA 2QZ5A 3M8OH 2B2XH 4KXBA 5CIPH 7CGTA 3KVDD 2D7PA 1IFNA 1M7DA 3ARGD 4PLJC 4UTAA 4LNRA 4YHLL 3H3BC 3IFPA 2IQAA 1A3QA 3QJZA 1UH4A 2MCG1 4XP4H 1MCBA 5I6XC 2AKRA 4RDQF 1BQHA 4ZX3A 4NUPA 5B1JA 4GBXD 3NCYS 2W9DH 1SXAA 5C2BL 5I75C 3BAXA 2ZOLB 4KMLB 4JY5L 4GAGL 4JPVL 4WFGD 4ZUWB 5BZDA 2WXMA 3N5AA 4F9LC 5DS8A 4IRSC 1IJDB 4S11A 3TIDA 5DC9B 5CJ4A 3X3FL 3WEOA 1K8IB 4PYGA 3DOIA 3OMZA 3BWSA 3ZE0B 4AQ1B 5I1HL 4GP8B 3JWNE 3T0AA 3O2DL 4AZ8A 1E42A 3LKRA 2NXYC 3FN9A 1NFIB 2WUCH 3KGUA 1KILC 5FYKU 3ARBB 2B3RA 3MGTB 4PRPE 4FQQB 4Z18A 4H0GA 1Y18B 4IRJD 4KKRA 3B6SA 3ARGB 2KHAA 4FZEL 1CI6B 4P5MB 4XPFL 5IQ9A 3X13A 1FAIL 3FB5B 3SBWA 2YXWA 3UG5A 1MCWW 2E8ZA 4DHLA 5H4ZA 2VC2B 3D08A 3ZHFA 5DD3L 1HGVA 2MSPA 4KK5D 4OGAC 2YEZB 3GYRA 4OFIA 3ZQWA 3BLPX 2WT7A 1DBJH 2JH2A 1JB0J 1AGDA 1HI6B 4GBXB 3BGFB 1JS4A 4H8VA 2IMMA 3ILQD 2IH8A 3ISYA 2W83C 1DE4B 5KVGE 5IJKC 1ZLLA 3DRQB 2ITCA 3IDNB 1UKTA 1AMXA 2NY7H 5HYJE 1PL5A 1LTJA 2CKNA 4MB1A 4XP1L 1SQVD 1OANA 3A6BL 3OAZH 1LT9C 1ZGLA 4MCZB 3EO1A 1U7JA 1P1ZB 2YWYA 4A7VA 1RUQL 3NSFA 2F8IA 4CNIA 3K6SB 1DP0A 2HRGA 4IRJB 4CN4A 3EHBD 3UAAA 3Q8CA 1JZ8A 1NFAA 2R1WA 3R4DA 3CH8A 2IAMD 1AJ7H 1G7HA 3CQPA 3QFDB 1JPTH 3L3GA 4KV5E 3QRLA 1KZQA 3FTWA 3HG0A 5INDA 3JWNH 4FFZL 1SN5A 3VNZA 3FDWA 4APXB 5ECGA 1PNDA 2G2RA 3GSOB 4WW1A 4ZMDA 2RTTA 2EIJB 3LPWA 4BQ6A 2D2CC 4OTXL 4Y99B 1FCCA 1FFOB 3NJXA 2LLNA 4YH6A 1RY7B 4K35A 4R90L 2F0CA 4Z5RA 2KP8A 4ETYA 4LDOB 4R97B 2JXMB 1FDIA 5CN3A 4L8SB 1HH6B 5CLZA 1NKGA 1HK6A 1HESA 2X42A 3KR3L 4WWKB 2ZX9A 4A6YA 4LVNB 6PAZA 5IB1A 2APWA 1BVLB 2AV1A 2Y0SA 2UWEF 3WGUB 5HDQL 4OAWA 4QIRA 2A4EA 3CDGB 1EJFA 4YHOH 2HLAB 3VSVA 1T03H 2HPTA 3TA3A 1MHCB 2HRPH 4WU5A 2YAEA 3MBXH 2G5UA 1URQB 5DD5L 4B7LA 3FOMA 3TJHC 4CC4C 1P4BH 2X6CA 4HUNB 2K7PA 3WLBA 2IAMB 5KLVE 2RA1A 5IMKB 2F08A 3GKZA 4GXVL 2OR8A 4JY4A 4WI6A 5GGVY 4A68A 2BZCA 4XXDA 3Q6FB 1OAQL 3AE9C 2QJDA 4AGPA 5EOTB 4PJDB 1UZ8B 3MV11 3BCCE 1IVLA 1MCPH 3C08H 3MLRL 2WPRA 4XNQA 1LO2L 4WV1B 3DMMA 5K39A 4NI6A 3CUPB 3K5BA 3RIAF 4PWGA 3MCG1 2XLLA 4NDMA 3P73A 3HTKB 1FLTX 5IOPB 3L73J 4W7YA 25C8H 3VG9C 4WK4B 2N7BA 4BXSV 3CBRA 2PXYB 3KJ4C 4GO8A 4JKKA 4DAGH 2A6IA 1ZWIA 4RMUA 5JA8B 4JF7A 3VYNA 4AYSA 3MP7B 1XXDC 3FZUC 4N90D 5DJXA 2WKOA 1SF3A 2DMHA 1I8LC 1X8YA 1RF1C 4PJAA 4L1BA 4TM9A 1U8MB 2J8UA 3BAJA 2WD0A 4ZRGA 3VH8A 2OSLA 1OB0A 4QHMB 4E9RA 4XN1A 1WLHA 3DJRA 5BQ7A 4L05A 1NGQL 1JM0A 1SXZA 4JRWA 4NQVA 4XCNA 2P8LB 1UH2A 3LIDA 3MRLB 5IKCB 5CZVL 3QW9A 2XWTB 2AJZA 3G6JA 2N7AA 1ID2A 4QAMB 1QBML 4XX1E 1HYSC 1F4HA 5DD6A 3H3PL 4FC3E 4F33A 4KVNH 1ZW0A 2P1YA 3ROOA 4APQD 1DJZA 1II4E 4NNXB 1QFWL 1A3LH 3HUSB 2ZWZA 3ZDXB 4YNYA 2HFTA 4K94H 5CHNB 5L4IA 2CKBB 3OB8A 3AUVA 1F2QA 1G7LA 3LXUX 1B0RB 3TF4A 1TJGL 3B71A 1I1AC 4AIXA 2OSXA 4DUXA 1S5HA 2P9RA 2P2UA 1EZVX 4L3EB 3SKNA 4HEMA 2JJTA 1IM3D 4XOBA 4JQIL 3TTSA 3DDFA 5FYLL 1UM4L 4KO7A 1W72H 4D6TJ 2ICEC 2WN2A 1SQXE 1LEKA 2FJUB 5JOPE 1XT5A 2Q2LA 4ZFOA 1AGCA 1KBKA 2G3AA 1P5UC 1VGEH 1KYOI 5D93B 3UFIA 2HSIA 3FRPG 3NA9L 5E6ID 5IV2B 5I18L 2HKFL 2OXGB 5ICZA 4LCCA 1IFMA 2JIXD 3GXFA 2C3VB 1GTNA 2WO2B 1NGPH 1U41A 1LTGC 1P7BA 1A4JB 3H1IG 4Y1AD 2EVFA 1QNZH 1SQBK 2AJYL 5DUBA 4WTZA 1L5GB 5DFVC 3TT3H 4BZ2L 5D6CA 5B3NA 1IKNA 1PSKL 2IOIA 6FABH 3SPVA 1BBJA 1EAJA 4MJ5A 3IDUA 4O58H 4NZ8A 3Q5OA 1IM3B 1NCBL 4FQJL 3FX0A 3ASOB 3QJFA 2ZUSA 3I75A 4FULA 3FK3A 3H1JG 4G1MA 2D4DA 1QFWI 4Y19E 2WLLB 5HPMB 2OK0L 2OMXA 4KUCF 4KQ0A 1A2YA 1MNUH 1DEEA 1FI8C 2F7QA 1FFQA 1TKWB 3O2VH 5MEQA 4Y7MA 3HUJE 4JFHE 4B97A 3ZX1A 4CKQA 3VDBA 1OP5H 4OZIE 1XEDA 4JO3L 3C5ZC 3VI3B 3OQRA 5IMLA 4C4KT 2JIXB 5FUOL 3EJTA 1KN7A 1JHKH 4KK9D 1KN2H 1I7ZB 1GL2A 1U4FA 5I6MA 1FNGA 2DB8A 2OXHA 3B5ND 4I5BB 3TH2T 2NPLX 1L4AA 4Y1AB 3VFRA 2VERN 1KG0B 2DAVA 4FCAA 4NQDE 4IGBD 5GHWL 1QUPA 3RZWA 4F7TB 2V17L 4YZFE 3NZHH 5BQDA 4H2AA 5TE4H 1DDHB 1FPTL 4P2OD 1YEDA 2FXPA 2A4CA 2R4RL 4DPAX 5LAPA 3MXVH 3VJ6A 3MBED 1CDCA 4P59H 4XO5A 3SDAC 4Y2DD 1TU2B 3O11B 3FKUS 1DVUA 3JBG7 1IGYB 1I85C 3LV3B 3Q5TA 1BDDA 3VFMA 4HZLA 4LPTA 5C0AE 2CRYA 4WEUD 3K1DA 1C7SA 1DQML 1R5IB 2R69H 4LARL 1BE3G 3IMRA 2BSSB 2VISB 4M1DH 4PJXB 5JW3H 3GUTA 1ILUA 3KLSA 3TA4D 5GISL 4IRZH 1MV8A 3C60D 4JDEB 4RFEB 3U7AA 3DJZA 4R4BB 1SBSH 5LO7A 4RA3A 5FWQA 2IBZI 3PL6C 9CGTA 3A2AA 4KJWD 5JLZA 3B5NB 1JN6A 3HLAA 5AKRA 3G3LA 3IPEA 3FUFA 2P58A 4UU9B 5IB2A 4IGBB 5B39A 3BVXA 1L4IA 4HVBA 3PHSA 5HDBE 1CI5A 4G8IA 1HH9B 2I7SA 5EOQL 2CIKB 3MBEB 4NB7A 3L3OB 4Y2DB 2VKXA 1RZ7L 1QPXA 4W93A 3WXVL 5A43C 2FH6A 4MJ6B 4N2EA 4YHYC 1JXKA 5ESVA 2FYYB 3NFSL 1RERA 5JPMC 4RAVB 2H89C 4BSVB 1K4CB 5FOBB 3I3EA 2FYUJ 4MB5A 3CC2P 1IBGH 2HFGL 4GW5B 4U6HB 3FRUB 3X1FA 1G1CA 2VITB 3ESUF 5I82A 3SE3C 2MHAB 3S4RA 1UD8A 4QHUA 3C60B 3BVDB 1NAKH 3IMSA 3MA9L 1H3WM 1A9EA 1GZPA 3DSNA 2EEBA 4TF4A 3CVHB 1WG3A 2R44A 1MVYA 4FQXB 4E0RA 3ULUF 4RFOL 1FFNB 2CR0A 4ZX6A 4NJAH 2FIKA 1Z9LA 5D2NB 2OW7A 2FQGA 3OJ2C 3HE7A 4LKCA 5HVWA 3MRJA 5EIIB 5SWSA 1K6QH 1GS6X 1T7ZA 4H88H 3LS4H 4MDRA 1B6DA 3QZWG 3QUMH 2RQ8A 3EFDL 3FB6B 2DQJL 2PO6C 2F7RA 4IRSD 4GB9A 3P77A 1UXMA 2DM3A 5I1CL 2X4TA 2WSFJ 1S7TA 3IAQA 1YI2P 3BE1L 4K94C 4L9LB 3UBXG 4PJ5D 3WDJA 1PTZA 5MERA 3BO8B 1UB6B 4UANA 4K3AA 3FF7A 4XNUH 4MA8H 4QHLB 3VOPA 4KI1A 4G11A 1IBHA 2XPZA 4C7NB 2NR6C 1RKRA 3TO4A 1FZEA 2GIYA 5EU5A 5AD0A 5A6LA 5EO1A 3NDZE 5BXFB 3A4EA 3UERA 1Q0EA 5CGMA 2V9QA 2Z92A 3PQYE 3K6OA 4P3CL 1WF5A 4X7TA 1FIGH 4DT2A 5IB4B 1D3CA 1X7QA 4M3LA 1XCWA 4OGAD 1KIQB 5I1JH 4PJHB 3LNDA 5DFWH 3FXEA 1BM3H 3GRWL 3QEGL 1EHNA 3IF4A 3C8KA 4NWUL 5I75B 1T89A 3QNZA 5KJRH 5B7EA 4FG6C 1Q9KA 1PF3A 2M2DA 1OSZA 3GMQB 3HNTL 4G7SB 4IRSB 4H44C 2D03L 2WLKA 3BEVB 5BRZA 2EXWD 2PABA 5BV7B 5C92A 4PTUB 3P40A 3B1UA 2VRKA 3CMAP 4YIQA 2IPKA 3P4OB 12E8H 1HHGA 2BZ7A 3P4NA 3QORD 1VLXA 4LOFA 4ERSL 5JNYA 1KILB 2W9EL 3VFWA 4LP5A 4F27A 2Q1KA 1H3PH 1MCSA 3RVXC 4X6CB 1XH2A 4E9YA 5CO1A 2P1JA 4I1LA 3VYIA 2FYNC 5F1IA 1UT9A 3QXDB 2Y0DA 1S5LX 1KPUB 3NESA 4H0HB 4RGOL 4GG6F 2BOCB 2WLJA 4MB3A 1N8OE 4I4WA 1VFUA 3PWVB 1S2EA 4AH2A 3B5GA 4NN5B 2J2ZB 4YBLC 2DKSA 2F74A 1PLAA 1KYOK 2G30A 2NDFA 2VR8A 3AS1A 1FJKA 3P4LA 4Y16C 1G5AA 1XF4A 4ZAKA 5I1KL 2WQXA 1M7IA 5E5MA 5D7SL 1HAWA 4BUHA 2Y6TE 1KJ2H 4NUJB 1CICC 3RQ3A 3HPJA 1TETL 4N6JA 2F5AH 4HAKA 1LT9B 3PUUA 3D6ZA 5FGBC 1CZ8H 4JL1A 5BU8B 2F9BT 5F0MB 4LKXB 5D55A 2Y24A 2OLDA 4BWTA 1T7YA 4KUCD 1GYAA 5EEZA 3FO1B 1JHLH 3U1CA 2DM7A 4J12A 1SGKA 3TJHD 3ABMB 4AV4A 4BWWA 1G2CB 1ORSA 4R4FL 2J1XA 5EBGA 4BZ2H 4UUJA 1IBYA 4F9PC 5JHBA 3EH2A 3T3PF 1ND0A 2XU6A 5IFAL 2XQ0A 2IIJA 5G4OA 5LKNA 4XOEA 1TVHA 1JL8A 4FZ8H 4R7VA 4Z7QF 1SDDB 2A9NH 5C09D 5DHYB 3VD4A 2W60A 1DZ0A 4Z7UA 4AUJA 2YEQA 2HX9A 1NCWL 2FO4A 4YX2H 15C8H 4WENB 5JDSA 4OLEA 4BFBD 4HLZH 1N5YH 3GLMA 3P8MC 1RURH 2VR7A 4H20L 4YR6A 1S9WA 2H5UA 4GAYB 1ITCA 2MQ3A 4KVPA 3STZA 1JG9A 1TZIA 3IJYA 4XBPB 5CUSH 4D0CB 3PWLA 1Q0YL 4R7LA 3IGKA 1E5BA 4GAJH 2KXPB 2UYLA 4G8EA 4RISL 5JIKA 1I8IB 3H1HJ 2FVNA 3DIVA 5FFLA 1SFDA 1ZLWH 4CSTA 2X53A 1JGLL 3OX8B 2VWEE 2AEPH 2JI1A 3WJJA 1FL3B 1Q94A 2WSDA 2PTTA 1AOZA 3N7NA 1RZJL 3H1LE 4XN4A 2VLRA 3NABH 4AEEA 2WWNA 3EYVB 4ZUSA 3CFJB 2P7TB 2H0FA 5EU3A 2B08A 5C09B 3QUZD 3Q3DA 4PBDA 1EGJL 4D8OA 2GJRA 1N6QH 5AUMA 5LVEA 1E7UA 2ZWLT 2Z5IA 1QTYT 3MBWA 4GT0A 4JO1H 3VXNB 3WHE0 4P23A 4I13B 1WH0A 1EFXD 4KJQC 4OVVA 3OLEA 3MXWL 4BK8A 1Y07A 2J3SA 5DJZA 5I8EB 2WPVB 1Q9WB 1FN4B 1CIUA 5DSCA 3Q8AA 4MGXA 2NW2A 3U9WA 2OYHA 3EUDA 3QRFM 5IIEA 1CW5A 2X3BA 1MJ8L 4L8BA 2V7QH 1RF1B 2QSQA 2I07A 5IY5B 2WYTA 4FFWD 4I77L 5FUCE 1PL3A 1QFUH 4GW1B 2YIUC 3H1ZA 4KKBD 3AY4A 4X8CA 1JNNL 2DQUL 2BSEA 2UUDK 4HIXH 5DRWB 2PW2B 1HFUA 1JWUB 1JXFA 2Q6WB 4LPVA 4Q7DA 5LCVH 5C70A 2FYZA 2IDTA 3G9VA 1SQPE 3OMNB 3QUZB 3MRRA 1NDMA 4KKQA 4NZUL 3RUGF 5CM1A 3EBHA 3QJQB 1S7UB 5BZXA 2Y5TA 2AJSH 3OWRA 2ENYA 5B3JF 5CIPB 5DFVD 2IZ1A 1F5WA 3FBKA 3W0WD 7FABL 1X79B 3T0DA 4JQVA 1NTMD 4LLMB 3E2HC 1D6EB 4HB1A 4F7PA 3B9KC 4BFEA 2GY7B 1D7CA 2ETWA 4DCQB 3L9RA 4JKWA 1EZVI 4YBQC 1UC6A 4I2XB 3U83A 5MENA 4NKOA 1YNKL 5D7IF 3WKML 4E41D 3GMMB 2ARJQ 2KQNA 3I2CL 4S1DD 5C0EB 3GI9L 1L0NJ 1IFRA 2OULB 5B8CA 1P5UB 2H0JA 4LK4A 3UJJL 1L2PA 2K78A 3C5ZD 3ISRA 1H3UA 2D2OA 1KACB 2IG2H 1KJMA 2AXTE 1FYTD 2FIRT 2TSBA 3PE9A 1RU9H 5K9JL 3Q3GA 4JKMA 1R5LA 2FB4L 3CD4A 5GRUL 4ZMYA 1WSST 1C16B 2EIZB 1B2YA 4U3FE 2FWUA 5ABDE 5FCUH 1JZ2A 4CMHC 2OJ1A 1AOHA 1FNEA 5APUA 1AS7A 3LIZA 5F7YC 1A6AA 1INQB 5DLLA 1JGVH 3CFBA 3W0WB 1WAAE 4LVOB 4WI0B 4DPBX 2M26A 4J1UB 2QTVA 3BHBA 3G6DL 4LSDA 2H6UA 4RRPM 1ETB1 4JFWA 3CSTA 4UQEA 1YRKA 4ABQA 4PUBL 1H5BA 1GGCH 3J07A 4NQTA 3VGEA 3U9UB 1P5VA 2DLEA 4IBSA 4P5TA 4E41B 3SWYA 4MVBC 1EVTC 1NIEA 4WJKB 4HG4J 2F7PA 2DQEH 2ATKB 1P7KB 1QEWA 1XO8A 3C5ZB 4J3WA 2WVRA 2ESVA 3SBPA 1FYTB 1KOAA 1NFDB 5KSAD 2JJSA 1FH5L 5HI4D 1NLBL 4TLKA 1BMZA 1YEHH 4U1SA 2O5YL 2XU9A 4NZRH 4EDWL 2WPGA 3V7AG 3NK3A 4FADA 2C9NY 1L6ZA 3ZJAA 3L74G 4ZI8A 3GI8H 2Q7NA 3PUCA 4YS4A 5ADOL 4OCXL 4OZHF 1ODAA 3AUWB 3I50L 3HI5H 4BQ9A 43CAA 1WCBB 1CFBA 4OM0L 4Q0XL 4YSCA 1VZGA 5BOPA 1IC1A 3LXCA 5JHDA 1W6LA 3KLDA 1QRNE 3ESPA 3SDAB 3B9EA 2AXTH 4KHTH 3VXMA 4D8PB 3SGEI 3DRTA 3HZVA 3SGDI 2W5PA 1CJYA 1M6UA 4Z3TA 3BLBA 5AWNH 1A7RH 1NGZB 4PRPB 4UDUB 4FXGA 1VF5C 3T65A 2EH8H 1LEGA 4TV3A 1GHFH 2Z35B 4WW2C 3F7PC 5GRVL 2OYPA 5JW4Q 4LRNH 1BCCE 4PY7B 3RX7A 3LKQA 1JZJA 5CBEA 5HYSB 3JZ7A 1AZNA 3TWCH 4JHVA 5T33L 1AGFA 4ZSOE 1A4BA 2AV7B 4KPHH 3BGMA 2YD7A 3JSSA 2ZJSL 4GKZA 3LNHA 4A1RA 1G7QB 3OF6A 2GTWB 1L0LJ 3SOBL 2AJUH 4N0UE 4BKTC 3FFDB 1RUPL 3FTUA 5I23A 1JV5A 3VFPB 2C4XA 4PJ7A 5L6YL 1EJ6A 1MHPH 3G5XA 1YQVL 4KXDA 5C1MB 1FAVA 4QY8A 5I71C 3GKWL 2AEIT 5T1KD 4ZS6D 3S5LA 4HJGA 4UV4L 1T6WA 3OKKB 2Y7SA 5E8OA 4KK6D 1E8ZA 3ULVD 3PYCA 4HPYL 4N4YB 1WBXB 3T2NH 1AHMA 1SXSA 3JWDL 5GGVL 4JY6B 2PO6D 4YHYB 3VFUB 3DKHA 1IQWL 1NGYA 2WN3A 1IGCL 1LO5B 4A38A 4MZ3A 5JPMB 4LHUD 4AV0A 3ZT6A 8FABB 1KV7A 3E1RA 1AQKL 4UBDC 4AK2A 1QGKB 1PJ9A 4DZBA 2VW6A 5E0QA 5I1LB 2X87A 2GTZB 5CP7A 4LVHB 1K8DA 4UI2A 2X6BA 4DJGA 1OAYL 1VQNP 3FQ2A 3APNA 1JTTA 2OCJA 5FECA 3KPRD 3BCCD 5FB8B 1MFMA 4PBXA 2YKPA 1OEZW 1WQVT 2OMBA 2I8DA 3RRQA 3QIBC 3HZKB 5J1AB 2Q7AA 5LLIC 1JWMA 5CLTA 1UACL 1B0GB 5HHOD 1WZ1L 2WLMA 5T1KB 3US1A 3Q1SH 2XQYA 3ZE2F 4F8NA 1ADQL 2VM3A 5D5ME 4KVCH 5B4MC 4YEFA 2A77H 3LY6A 3SKOA 4ACPA 1D5BB 2VR9A 4BIKA 1SQVK 2PO6B 3DX1A 5D7JD 2SEBA 1ID5I 4KJMA 2DQTH 2XWBB 4NNYB 2QPDB 3W9DB 3OWEA 4UTBA 2IQ9L 4HFWB 4LHUB 5C0JB 5B3SB 1T2XA 2QKSA 2QKIA 1FZAA 4U1IA 3ZXAC 2VWEC 4LDEB 4RX4A 4KJYA 3KYKL 1GYCA 1T5WA 2UZYB 5BV7L 2JK5A 4PCTA 3NH7L 1N19A 3RVXD 4ZKPA 4RGMB 5D9SA 3T0EE 5KBLA 3RFZA 1U95A 4YXHH 1JZEA 3F89A 3IE9A 4BDVB 3ETBF 2FX9H 3SE6A 1ESOA 2ADIB 3D4CA 1DLHB 3KPRB 3MA7B 1DVFC 3LZRA 1J8KA 1GJIA 3N44B 1DEBA 1W72B 2V37A 3AG4B 2V2TA 2CHDA 4NERA 4X5XB 4G6JH 1RE3A 5H35A 5HHOB 1CCZA 5JHLL 4GUCA 3BESR 4GT1A 2QPEB 2W0FA 5I30H 2YPKB 3REVA 3U30B 3OV6A 4MJHA 2WMMA 3P3YA 5FAAA 4OJDH 2FFDA 1OALA 2NNAB 3DVGA 1UIIA 4OF8A 5FKAA 3V6OE 4JPKH 3RL1B 4ZBJA 5ABAA 4EOWH 5FUCC 2XWCA 1PZCA 3ZDWA 4O02L 1E4HA 4P2RD 2Z3FA 3WLWD 5BVPH 1XBDA 1Z9MA 3PDGA 5DZLA 3U1PA 3F12B 4OJEH 3EYSL 3WNOA 2FYNB 1U93B 2WWWA 3QAZB 1HNGA 3G9AB 1CURA 4LT7A 2QGBA 4PR5B 3ULSB 5F1NB 5GS2D 3TCLB 1MRDL 2YGQA 1T2QL 1KGUA 4XPAL 2QE7H 1CXHA 1QNIA 3B2PA 1BFSA 3LKSA 5IHUH 2X1OA 1V7NL 4I8DA 3JC22 3GIVA 4YBLB 2P5WE 5C6PB 2Q6WA 5JW5A 4JCWA 1HOEA 3OKYA 3BAEH 5LNEA 3ZTNH 2BVQB 2BSRB 4QAWA 5ENWB 5IFJB 3ET9F 2CA4A 2NTFB 3CFTA 3JZYA 3TV3L 1N86A 3NQKA 1EDYA 2VKWA 1NMAH 4YO0A 1R5WB 3FTGA 3O3AB 3D2UD 5L2KD 4JFDE 1FG2A 3O2DA 4HBCL 2EUVA 5GSRA 2VQUA 3DGDA 4X4ZA 3BUIA 5J57B 1CU4H 3VNYA 1FO0H 1TCRB 1U8NA 2K6YA 3H8NA 3MO1A 4V1DA 3DETD 3ZYZA 3SGEH 3UTTD 1FJ1A 1W8EA 3GBNL 3U4KA 3SGDH 5CEYA 2JMRA 4LLYA 5I2IA 2Z1PA 3DUUA 1ACCA 2H3NA 3DVNB 5EC2A 3KPSA 2A6JB 4G7YH 5APWA 5IQMA 5FGCE 1H3GA 1O7SA 3QEQA 1MLBB 1MCJA 4M62L 1P2CA 5ILTL 5IJVA 1E5CA 1I3RA 2EDRA 4KXCA 4XP9H 1NCTA 1MPAH 3CSBA 2G3ZA 3WDIA 4NRZB 3O41A 3BDXA 3UDWC 3EYQC 1MCRA 2VXVL 4XGZB 2QJKC 3DTXB 1JZGA 3O3UN 3BGAA 2X6UA 4Y19A 3VSTA 3HBZA 4QO1A 2P49B 1MEXL 5L2KB 1LQSR 3D2UB 4J2QA 2XA8L 3BPCB 3L3DA 3VDCA 4XMXA 3BDBA 3HE4B 4Q9BA 4JFEA 1TU3F 3CPUA 1RY3A 5DI8A 3PJNA 4F20A 4PJEF 4OM1L 4R4NC 4DGYH 2MOGA 3C9NA 3G5ZB 4XPGL 3UTTB 3CNKA 3FTVA 1Q90D 2Y7QA 2NY5C 4OFYA 4LSVH 4P57A 1PYWA 4XPBH 5J6HB 3PWPE 4HGMA 3EH1A 2YK1H 2V3FA 1NA8A 1BQ5A 4HJ1A 1KB9I 4B9KC 3FQNB 4UB8E 3HNVL 3GMPA 3QI9C 2UWEE 4FFZA 4FG4A 2M3EA 4K71C 4NI3A 4ODWA 4EI6B 2J44A 3TVMA 2NLJB 1EXHA 1SJMA 1ZA6A 1JCDA 1ODUA 5F6IC 4MS8C 3LHPL 3QJOA 1BJ1H 4LDCA 4BA0A 5ELIA 4WRLA 4GRMB 1U8OA 3TNMA 3QZBA 4NHCH 1MFCL 3HI1A 4BH8B 1ZSDB 1HXYB 5TDOA 4EQ2A 1I8MB 4NSKB 2ZSVA 3HZMB 4NHUA 5C0AB 4KFZC 2VDNH 3RG1C 4XN9A 1CFVH 2X3CA 3GXIA 3Q2YA 4Q6IC 3HMWL 2YIUB 1C8QA 4CMMB 3QUMB 4OLZL 1S5LE 2FBOJ 4CADB 1B2WL 2FNWA 2AS5M 4GW4B 2FD6L 1NTZG 2APXA 5M1BA 2ED9A 4BFFA 1QLRB 3S3DB 2HVJB 3D69A 4QGYA 3T4AA 3X1GA 5KAQF 3BSZL 3TZVC 1RJYB 4NXKA 4OF6A 5CINL 4L3FA 5ISZE 3W39B 3B2VL 4K2UH 1ZANL 4P46C 4N8VG 1BF8A 4UT9H 1EZSA 1OD9A 4UAOC 1S6NA 2Z6FA 2VLME 2AFNA 1BIHA 3AS0A 1QRKA 2HMIC 1ORQA 2AQRA 4HH9A 1VAHA 3TT1L 1RH5B 3TDKA 3ULUL 1PD0A 5DJ0B 5DK3A 3FQWA 4ZYKA 5E9NA 3ME0B 1E50A 1ZDQA 4UB8H 1FDLL 4N6QA 4W9CC 1JHTA 2J21A 4OQ1A 1CDUA 5E7FA 4MA1C 3G9RA 4G9FD 2QJPB 4O9HL 1N26A 5DD1H 3EZ8A 1B9ZA 4UILL 2HJFB 2D7TL 1XIWC 4BCXA 3C6LC 4IOSA 3CQFA 2RKLA 3V0GA 4KKNA 5EBMB 5J3HD 1EUTA 2IDFA 2WINB 1E8WA 4R7NB 1D6VL 5DHDA 5DWUL 5EN2B 3FN3A 4MVBD 1YECH 4ATTA 1RQ5A 3P9LA 4L0PB 2QRXA 2LFGA 2E5TA 1DQJA 1Q8MA 1VCBC 4UM8A 4UT6H 1XWVA 4YDVA 1KCSH 4JRLA 4NZTL 3CBKB 5EUKA 2BVPA 3G5YA 3PQYD 4JFUA 2A9AA 1BVNT 2Z8VC 3GRGA 4IM8A 5F88A 1I7RB 1D5XA 3BZFA 1JZIA 3CLFL 3PAUA 1MLCB 4CMHB 1UUSA 2YD1A 2VE6B 3MJ9H 3KWTA 1KELH 4KTEL 35C8H 1SJXA 2I69A 4R84A 1S5LH 4GMSH 1CGSL 4QRUB 1BAFH 2LAGB 2JJVA 4EPSA 5I6KA 5FM8A 3PGDB 3FB7A 4JQIA 4HHGA 5KSBF 4G9FB 4IHOB 5D1ZD 3NEEA 4DESA 5IBTH 3TJEL 2YWZA 3V5DA 1QLFA 1PP9J 2WNGA 3MLVL 5FDYA 1JPFA 2YAMA 1O7DE 3ZSSA 3T0EC 1VF5D 1MWAH 1F1GA 3CZLA 5AB9A 4TSCH 2D4FA 1KJ2B 3HN3A 5E08H 1DQDH 1RL1A 1UD2A 1VSCA 4GRWE 3N42F 5AB1A 4P8QA 3QWOC 2IANE 4MASA 1C12B 3AQXA 1N73A 5BJTA 4ZXBD 5IEKA 1SN0A 1W0YT 3PQYB 3L54A 4KAQL 3T77A 2D0FA 3VXSE 3ZKND 2EO7A 1XL6A 3OXSB 2L4OA 2ENQA 5INCB 1AXTH 4G80B 1YVLA 1I3GL 3AMLA 4NWTH 2R56L 4BZ2A 1BFVH 2C4FU 4JG1H 3VMOA 3D6GA 4KH2A 1Q1JH 4M5TA 4I2LC 5FYJD 3SQOH 1KULA 4JFFD 3N41B 4YBHA 3V6OC 1IC2A 1IKOP 3DI2B 4JLRA 4LBEA 4LLVB 4XOAA 3VM7A 5BNXD 5C7XL 4JFQA 3MIWA 4HOMA 5D1ZB 1R17A 1U92B 3L3KB 1IGJA 3P2BA 1SEQL 4W9GC 4C59B 2YMOA 4C57C 3LEXB 4M61A 4W9LC 43C9A 4NBZB 5BOZG 4IIZA 5DZNA 3V55A 4ZW5A 1VF5B 1Q9LA 5L8RJ 4WW2B 2P28B 1DLFH 1J88A 2JDIH 4UBDD 3S37H 2DTML 4Z0BL 3W68A 1R3JA 1TEYA 3ATBA 5EU6D 1HUCA 5AB2A 2HZHA 4ZXBB 3GB7B 3M0AA 3P11L 4I1RA 5FK9B 2NQDA 5I1EL 2E42A 3RNQB 4FTDA 5BW7A 3IFLL 1NCCH 2BIIA 2I60H 3QIBD 1TMCB 1CDGA 3G4SP 4UNIA 1J9SA 2JKXA 1G1KA 5F7LB 4ZPTB 4KMTH 5LUMA 3GHEH 4L8DB 1CFMA 3OAYK 3QEUB 3DURA 4JFFB 4PGEB 3QHTC 3MAWA 1UFUA 4GRWH 1GK4A 1LO3L 2FSDA 2G60H 5B4MD 4BJLA 1CQYA 3TBBA 2DF3A 5TQ2L 2GJZA 3QUXD 1A64A 1UFGA 1WBYB 4Z78A 4FEIA 5LBGA 3TBVB 1KTJA 3FCSB 3ULVL 1LP9E 1PFOA 4FCHA 2J73A 5DRNB 2OZ4H 4DP7X 4XBGA 1CWVA 1M7UA 5BUGA 4TNGA 3OPZH 4Z7OF 1AZCA 2OI9B 4GG8B 2BX5A 1U8JA 3MRFB 2F58H 5EU6B 1OTUC 2YS4A 1X6NA 2Y0CA 3AE2C 3D05A 3GGWB 5E9DE 4NUGH 3MODL 1H9DA 1IK7A 1LK2B 4ELDA 1F8TH 3TEWA 3JSVC 3QIBB 3MZTA 5AW3B 3A67H 3OMAB 3X1NA 1HHKB 3N06B 4QHPA 3LSOB 1YC7A 4XVOA 3L71G 3P0YH 3BKJL 1UJ3C 2EE2A 1R3KB 1MI5D 3KPQB 1PDKA 4GLRH 4OIIH 5CILL 4ABUA 3WMSA 5TISE 3PNWB 2E7DA 1BQSA 4JVUA 2NX5E 4NRXB 4X50A 1VADB 3QUXB 1ZOYC 3NK4A 4DP4X 1C08B 1J0ZA 2JKNA 3AQDA 3QXWA 5C08D 5E2VL 5M7QA 1NGXB 3AC0A 3QQNA 3HPLB 3BIKB 4ZG1A 4G8GE 2FX8L 2W6AA 1TITA 4ZFFB 2AXGA 5F7KC 4XCEA 3S4SG 4MAYA 5I15L 4L4TE 2PNDA 1NEZB 5EMYA 1JAEA 5AZUA 2JB6B 4MXWL 1DJSA 1TG8A 3PWJA 3UACA 1RJLA 4BZ1H 3GM0A 2HPOA 5CD3A 3V0EA 3BZ4A 4QHKJ 4XBEL 1KIRB 4BZYA 1T4KA 3RX5A 4AIZB 5GSVB 1GZQB 2DQIL 5KVMC 4X99B 3GG2A 1FE8L 5KS9F 1Q0XH 4JFOB 5E5UB 4WEBH 1SQQE 2JTYA 3VU1A 4HMEA 4PJGB 2HJLA 4XA4A 1MI5B 1SOXA 5AVVB 3FCTA 2YPLA 1N7LA 3L5XL 4PD4D 4NYLB 2CBPA 2V0AA 2ENJA 1R3HA 1ZVSA 3Q6GL 2KZIA 4OLZH 2ZXCA 5C08B 2JWAA 3MGAA 2WAQA 2BY1A 2ZOLA 4FNRA 1E27B 5AVTB 3VYPA 4L1SA 1VACA 1WD9A 4WI8A 4ATWA 2WJ5A 3RGHA 2WXPA 4KY1H 3PU7A 4XWGH 3V8OA 2OAAA 3H9SD 3QIWD 5TISH 3EFOA 4TNFA 3MLSH 1NFIA 4ZMZA 1SQBJ 2CPBA 5ADPL 2XETA 4M4RB 3MGTA 4FQQA 4GQQA 1Y18A 4HIHA 4DW2L 5B38G 4C83B 5AW5B 3L3JB 4P5MA 4RNRB 1PIFA 3FB5A 5D4JA 4ZFZA 1TCMA 3GRWA 1FLRH 4GQ9H 5JIHA 3EOAB 2Z93B 3D4ZA 4UILH 1JYXA 5CD5D 1RZGB 4MKTA 4J6IA 5EH1A 5LGHL 2KLUA 3KZIE 4DVRL 1ASOA 1HI6A 5I1IL 1Z9SA 3AABA 3MRMA 4GBXA 4X8JB 3MACL 3ZGHA 3GSNB 1AR1C 4F92B 1DZBA 1A6PA 1MW3A 3ZIYA 5GPRA 3DRQA 4P4KC 4WDIB 2MEJB 4P3DB 4NLHA 4UZUA 1NCGA 3D33A 4R4ND 4C7RA 1VHPA 5EV7A 3I9IA 1X9LA 4ZDHB 2XI9A 4L8CB 4ZO6A 3QIWB 3SDXB 3MRBA 2KI6A 1QVOA 1P1ZA 1JZ4A 3FONA 1NH6A 3ZHLA 1NU1G 3LEVL 1CFNA 4NFDA 3K6SA 4WB4A 2H1PH 3FT4A 4IRJA 3GBMH 4KOCA 1WIPA 4JVPA 3AE4C 3B4SA 4ICWA 3MVSA 1BPVA 1OWWA 4ANXA 4L76A 3UC0H 3OHXA 4KGLA 3NCWA 3VFGL 4K9JA 1T0MB 1G9HA 3M1CA 4LQFH 5EFIB 4EUPG 1HXMB 3RGVA 2IZ0A 4JG0L 3SIKA 3GSOA 3T3PE 1NTMK 3T71A 5KYWA 1SFHA 2JELL 3C6EA 3UJTL 4PGDB 4ZTOH 4Z7QE 1AQDA 3EJZC 2JR8A 4FQCH 1O7DC 3VRJB 4YFLF 4B5ZA 3C75A 2Q8BL 1LGVA 4B7IA 2XZAH 4DETA 4L8SA 1HH6A 1JK9A 3QT2A 4HJIA 5ESQB 3MU3A 3FT0A 4V33A 5G5DA 4E9QA 4MQXC 3R06B 3SCMD 5KYYA 3T6QC 1A7BA 3F64A 3H1KG 2BNRA 4R0LB 5EDXA 4X8XA 3RK3E 3MNDA 1CPUA 3KZIH 2HKHH 2R1XB 4ODXB 1L0XA 5ITFB 3AGWA 3CWBD 4HH2A 1OGAD 3FMGL 1F3DJ 1HQRA 1L7TL 5AYUH 2IAMA 4BFIB 1SQXJ 5IMKA 3TZVD 3I56P 5EFWB 1IEAB 4NM4H 1NGWB 3WFDH 4P46D 3Q6FA 5EOCL 5F6IB 1KDIA 5DHEA 4PJDA 2BCCD 5EOTA 2L5GB 1N7MH 1UZ8A 5EIQA 4M6NH 3VACA 5E8PB 1BX2B 1QRNB 4TQEL 1U8CA 2HMID 4DT0A 4WBAA 2AQNA 4HX1A 3ILPB 3CUPA 5KN5B 3UCQA 3BW9B 3LZPA 4TYUA 5IOPA 4KRLB 2KERA 3UXFA 1GU4A 1QO3B 3EH4B 5DLMH 3IJEA 2XACC 1U8PB 1YY9C 4GRLD 4GOEA 5GGRB 4Z7NF 2WAHA 2PYFB 1KCKA 4PB0L 4E2OA 2WPQA 1MF2H 4JB9H 3CH1B 1HILB 2ZD0A 4Q6IB 4TOYL 4P04A 1YO4A 5FA3B 5E70A 3X14A 1AZRA 1G7PA 1AC0A 4EIGB 4YXLL 2KZ1B 4NFBA 3P8CE 1XZWA 2JKJA 3AECC 1USDA 3GW6A 1MRCH 1OGAB 5DJ2B 1QACA 4NQEA 4LLHA 4IL6X 1CF8H 1EGJA 3TZVB 5H4YA 5DYOB 4LBAA 4HJEA 2O1JA 3MRLA 5IKCA 5AW4B 1X6LA 3FGAD 3I9AA 4P46B 3IDMB 4PJIF 1Z0MA 4OCSH 1XR9A 2FR4B 3MPCA 3ABLB 1G7JA 3VMNA 4UAOB 1YEJH 2OX5B 1IMHC 3CSYB 1NM9A 2Y69B 5HD8C 2P8MB 5AAWA 3OAKA 4OD1H 4PH8A 5EB9A 4TUOB 4RRPG 3VFNB 5JIIA 3CLEL 2X4RB 3KYMB 5IG7B 5CHNA 3E0GA 3ARSA 1XXFC 3QC5X 1HEZA 1B0RA 1IC5L 4N26A 1ZS8B 1Z9NA 3J2PA 1VGKA 4GRLB 3QUYC 3T8XA 1F4WL 3GXNA 3H54A 1HINH 3N9GL 5I5RA 3KWXA 2LFEA 4P2YA 3S36X 1R3IL 2AABH 3BVVA 3D70A 4LEOB 1NWQA 3LTVA 3LKNB 1GGTA 3BKJH 1NIDA 1NINA 3O4LD 1HL8A 4M48H 4YLCA 1P0SE 5HJ3A 1D5MB 2CCWA 4JFTA 1MCCA 3TP4A 5C8JB 2GI7A 4S1RH 4QRQB 1X5AA 1UH3A 5IV2A 4UOW1 5IMOB 5D7IE 5D5MB 2EYTB 1JY3P 3OXRA 4Z7VA 4AM0Q 4APQA 4P2QD 3B9VA 5DQDH 4FTVD 1TTAA 1A4JA 2CUHA 2DY2A 3L4YA 4JDTL 2KOGA 1IT9H 2XTJE 4LP8A 3L5IA 3KBPA 1BGXL 4K07A 5EZLB 1CLYL 1ZHBA 2DL2A 2FEJA 2R0ZL 3NJGA 5C2UB 2YD0A 2MWCA 4PTTA 4RETB 3OR7B 3NACH 2EDFA 2XX0A 1IM3A 5GS1B 3GK8H 3ZSTA 3WTYA 5DTFB 2OV0A 5DFTA 5SWQB 3COOA 4MTMA 1S9XA 1KD1Q 4H4NA 2WLLA 5HPMA 2IFGA 3BH8B 1MZYA 1YPZE 3QWOB 3O4LB 1RIHH 1KYOJ 5DCCA 1T66C 4BWUA 1TSRA 1JNLL 2ATPB 2DBJA 5LHDA 2P5WD 5E6IA 2IDUA 4X5QA 4YDIL 3M7OA 1UTDA 3N43F 5FO8B 2JIXA 3QPXL 3Q44A 1QZ1A 4M7LL 3PJSB 4AYMC 4KQ4L 3CMGA 2PF6A 4XAKD 4P2QB 3MUUA 1X5XA 1O6VA 2IV9A 3PV7A 4FTVB 5A16A 4M7KH 4I5BA 4RGNE 2R3CA 3O6FD 3IXAA 1KG0A 2CG9X 5ALCH 4YE4H 2ZYSA 2A73B 3VP9A 1F58L 1FNAA 2NCEA 5E1AB 3GO1H 1JVKA 4PJCE 5FYJL 1KXVC 1QSFD 4X6EB 1DDHA 4WHYH 4A7UA 1DFBL 1S5IH 3WFBH 4C46A 2DIAA 4OZHE 1RUML 4ZS7L 1JGEB 1H15B 5CJQH 4XMTA 2OFQA 1U8HB 3HJEA 3Q05A 3H7BA 4Y89A 3KDPB 1IGYA 3LV3A 1TZGH 3FC8A 4F57L 5ITBH 4XZ4A 4DP6X 3AEBC 2VH5L 5BCAA 2VISA 4PJXA 5I1IH 5JW4N 3GIZH 1M6OB 2Y25A 2P5WB 4FFYH 5L2JA 4HCRL 4DPCX 5KBNC 3GS0A 4JKNA 4ZO8A 4A67A 4DGIH 4ZMWA 4JDEA 4R4BA 3V52L 2AXJA 3PP5A 1YITP 4DH2A 3KJ6H 4N8CH 3TBTB 3CXDL 1F4YH 3MYZA 3B5NA 3IDJB 4Y4HD 1OLLA 3KDMB 3O6FB 5G2NA 3V79C 4UU9A 3PWNB 1MIEL 4H25A 3PHLA 3FT2A 5GGTL 5I0XA 2UX6A 3M45A 2WVVB 1VFOA 2OMYA 5KTEH 4KITB 1LP1B 1QSFB 3OKLA 4PJ0E 1IB5A 4HWBH 4FD0A 4P2OA 3VA6A 3SJVD 4MAZA 2V9TA 4YHIA 1UA6H 2CIKA 5SX5K 3MBEA 1BIIB 3D4GA 1LM8V 3L3OA 1IFIA 4BWNA 2F19H 4MDJB 1HNFA 3VB9A 3OAUH 1WIUA 1K73Q 1KN4H 2WLZA 5IK3A 5I0WA 3VWKD 4ZPVB 2WITA 4TTDC 1WRFA 3HE6D 2BIPA 3HG4A 1DUYA 2CCVA 5FOBA 4KGJA 3AREC 3OMIB 2Z64C 1QW9A 4EN3C 3DO7A 1AMYA 1A0QH 2BDNH 4YXDC 4U6HA 1KC5L 1LGHB 2K6WA 1LE9A 4JGMA 4EVNA 4PS3A 9PCYA 2MHAA 1I9RL 4KKPA 2CO7B 2X4NB 3ZL2A 2J5LC 1OCRB 2VDPB 4RQQB 4AMWA 4CPGA 3MJ7B 1SNRA 2OCCB 4NAJA 1YUKB 2Q8BH 1EMTL 4AKQA 5CCHD 4Y4HB 3VW3L 5GRJH 1UJ3B 1AYOA 3VI4E 4MD5A 2VLKE 4HIQA 5IR1A 1MCKA 2C9QA 2LLGA 3T0VA 3UGXA 4OKVA 3DTUB 4DKTA 4TTGA 1RK7A 2W0KA 1J7VR 1KCUH 2EXYD 4WTWA 4AIOA 2VZUA 3VWJD 5TH2B 3IVKB 1N6VA 4EJ1C 3JTTB 3HC3H 1URZA 5I0YA 2JLPA 3FB6A 4YXKH 4L3AA 5I74C 3RK3C 1EEZA 4PGBB 3PWPB 2J8OA 3X11B 3ZE2E 3F65A 3LNFA 2PWFA 3HE6B 2KSJA 1FDMA 2FQEA 2O01H 2G75B 4L9LA 2B4CL 5M95B 2UWEB 1J0KA 3MFFB 1B4JL 3MC0A 3E7JA 2A99A 3PHQB 4LGDE 4UQ3A 1QKZL 3GMOA 3WNNA 4OZGF 2GUOA 4TULL 4D7BA 4ANVA 4PGCB 2APFA 3H1HG 1HCVA 3ALXA 1I82A 1K5NB 2YXRB 4POUB 4XCYA 5BXFA 2IFFL 1ADQA 2WBJD 2ATAA 5B1KA 2NSMA 3RB5A 2PAJA 1EO7A 1HU8A 2XJLA 4FKHA 4DKFL 1PY4A 2PPFA 1WHPA 5TDPB 2K4WA 2KSEA 3M9QA 4NUQA 4PJHA 2VCOA 4ORGA 1CDIA 4WUKH 1AR1D 3VWJB 2XDJA 3OJAB 4YC2C 1BGYG 4HHWA 1MFVA 1OCWL 4MZRA 3S88L 1ZTMA 3GMQA 4MZIA 4N1HB 1MG2C 3T97B 5ALBL 5ESAB 1WP6A 1EXIA 3BEVA 3WN5B 4LSPL 4JPSA 1Y6MR 1NPJA 3GSNL 2ICCA 4GUQA 1FOSE 1NPUA 4Q2ZA 4LL4A 3P4OA 4PJ8C 1Q2NA 1UQSB 2K9FB 4PJ5A 3WDHA 5JXEC 2N0KA 1SUJA 4PWIA 4CUCA 1E5WA 2I7OA 1E9OB 2RMNA 3GEWB 4L1DA 4WFFE 3SQRA 4BGLA 4BFGA 4QUOA 2JO1A 4H8QA 1JI2A 4FABL 4ZMXA 1OCOB 5FKPB 3LNGA 4AQEB 1WC7A 4HD9A 4JFZL 5JHLA 1MWAB 1E3FA 2A45I 4IEFB 2X40A 2WBJB 1SBBA 2A1WL 2BOCA 3H1LJ 2ALWA 2OZNA 4FQLL 4RCAA 3TBWB 4O4YH 2JQAA 2A74A 2YC1B 2I9TB 3CE1A 1OLZA 3W2DH 2V7HB 4U6XB 2C8NA 4WU7B 1FP5A 2J2ZA 1SQVG 2XVLA 5KYUB 5HY9B 4M6AA 5JOFA 3IRZA 1AR1B 4B0MB 4RZCA 4K3EL 1RZPA 4XE0A 1T1YB 4M3JA 2HT4D 3WIIL 3GHGA 4HW6A 4O02A 3P0GB 4ANUA 4N5EC 4UQAA 1YNTB 4TPRH 1C1EL 3H56A 4EEEA 1JF1A 3EJQA 2QADD 4KKCD 1IE4A 3D9AH 3QFJE 2XZCL 3ATAA 5DMIL 3QORA 1MG3C 1KMGA 1CR9L 4LKXA 3ES6A 4N2HA 3LCYA 2MIZA 3LQZA 1LO0L 1P4LB 4WUUE 3CIAA 1A22B 5GJSL 1KCLA 2GBUA 1OX3A 4TQIA 5CJXC 2NY5L 3STLA 4KI5F 3UAJA 1AGEA 1G2CA 1P53A 3L4UA 3NIDB 4LSUL 1UCBH 5DEZA 4M56A 4KHXL 3ZL4H 1MREH 3ABZA 5KAFE 1R0AH 1EEYB 2NW3B 2GSMB 5CFAA 4YOKA 2LV4A 3FUHA 1SDDA 4JE0A 1NUFA 3L37A 5GQBA 2XTJC 4JGNA 1OZTG 3OJVC 1FJPA 3WFHA 1URLA 3D39D 4QXGH 5IFHL 1YJDH 4N6RB 4Q52A 4YXWH 4HUWB 4TKWA 4R4MA 7PAZA 4IFDK 3C2AH 3GJFB 3QR0A 1IC0A 2IANA 2QADB 3O6LL 2OMUB 2ZKHH 4GRWB 4G82A 1XB6A 4HDIB 1J8HE 1N7SA 1I7TB 4OZFG 4DQOL 5FYKL 4CU6A 1J5DA 5IHHA 1I8IA 3VXSB 1ERNA 1OAJA 3FS9A 5E2UH 1W80A 4G1EA 4MMYB 3UPRA 1FZBA 2ICWB 1FL3A 2IGTA 2NPSD 1DJWA 1ZHKB 4GOFA 4PJEE 2XRAL 4U1GC 2QDVA 1PZ2A 1T0NA 4PLNC 3L75E 4YQXH 3S5YA 3CFJA 5FCSH 5EORH 4RGNC 2V3DA 3ELAT 3KWVA 5DUPH 2V5MA 5K9QI 3MLUL 3OR6B 2JKSA 3LQMA 5MEOB 1J9QA 2I26N 4HHAB 5SX4H 3RHWF 4X98B 1MRFH 2DLGA 3D39B 4X6DF 4CJ0A 3VXNA 5EUOB 3WIAA 3L9EA 1H8LA 2V6HA 3K6FA 3ZW3A 1TOXA 1Q9WA 1FN4A 3QUYD 2ZTBA 4PJAF 5KAFH 1U9KA 2J8UF 4LPXA 5F7DB 2XN9E 1TZHA 4EOTA 3MLZH 2W1NA 3L1OH 3MX0B 1DQLL 1RCYA 1UHVA 2G3NA 3QDJE 5DO2C 4JJOA 4Z77B 1Q9OB 2XG4A 1WV7T 3TFKC 1A7QL 1XR8B 3L70J 2DTSA 3NQIA 4MA3B 4A2LA 1AC6A 2NPSB 1GK6A 2B1HH 4RMTA 3IF1B 5DRWA 3G6JF 2PW2A 3EGDA 1ZP0C 2L91A 1CI3M 1TQWA 3F3HA 4TLUA 4XVTH 5DT1L 5FA4B 1ZLWK 4AC4A 3PNRB 4CU7A 3IDXH 1BE3D 1S7QB 1NBVL 3QUZA 2LW3A 4M7ZC 4YWGH 5KAIE 3LAFA 3MLYL 3WE6B 1HIML 4M02A 1S7UA 1YG9A 3KGTA 4C47A 3F85A 5D1XE 1NVOA 3BUQA 3JQOB 1NMCC 4B3VA 3LQAL 1TVBA 1EFXA 5E8DH 3Q1MA 2WNXA 5EZIH 3RX8A 1NYHA 3V6BR 1LP9B 1OAUL 3TV8A 2XKUA 5IVXB 3QUYB 1YEGH 4LLMA 3E8UL 2K9YA 1S7XA 4MB4A 5JQHC 2HP4A 2OL3H 2AEWA 3I02B 4J6RL 4I9XA 1INDH 1WITA 2ORBH 5AVXB 1EXUA 1ZRUA 4QRSB 1G1IA 3GXMA 1I4FA 2AZUA 2X9XA 2AF2A 1DX7A 1IO4A 3H4FA 3BISA 3BSZA 2YN3A 4ZUVA 2IH1A 2VM4A 2ZOUA 2NXZD 3WENA 5C0EA 2AERT 2XYCA 3RFRA 4JM2D 3IFOA 4F2MA 4UIKL 2NUPB 3O8XC 2WYHA 2R0LH 1WIOA 2F54A 3RY6C 3KPLB 4D0BA 3LRMA 4CN1A 2H9GA 3C5JA 4NKDA 1JFHA 5TTRA 2VT0A 4FNLL 2X3AA 3NJNA 1KSRA 1HQ4A 3QO1B 4G8GA 4XO9A 5AAMA 4WY4C 2OYIA 2X0UA 4U7KA 1A4CA 2WQVA 3WKYA 5IWLC 2FBJH 1V05A 3W0WA 1RHFA 4GKSA 1J2JB 4WI0A 3I55P 1FV1B 4J1UA 2KYIA 4Y5VC 3V0IA 3JWOH 5ANHA 4XTRC 4WCYH 5E24E 1LD9B 4TULH 4ZW3A 1T0OA 1T1ZA 3V6ZA 2HODB 5KAIH 3E8VA 3SHSA 3QJUB 3THMH 2PGDA 1G9NH 3RDTA 4RESB 2W65B 1TTUA 1UM5L 3W1ZA 3LRKA 4S2SB 4Z23A 2NXZB 5KSBE 1KLFB 3LZFL 4H1LH 1UWGH 4JM2B 2R4SL 4HAGA 3IR9A 4X7FC 1DCLA 3NRPA 5BUAA 2EP6A 1FYTA 1HJBA 1NFDA 2YBGA 4GXUM 2MKVA 1GAFH 1D5ZB 1RMFL 2MPAL 3GSQB 3DX9B 2C3XA 1AVYA 4XPHH 1BZDA 4BD4A 5J6GB 1XGQA 1NTKE 4P4RA 4EXPX 5M94B 5CEZD 4MN4C 1LWRA 4TQHA 3WUWB 2HPCB 1KLUB 1OM3H 1WCBA 4OGXL 3MCLL 4OLXH 4M8QA 2DI9A 3MHZA 2C9SA 1J1PL 1L0QA 4Z95H 1NAMH 5CBOA 3D0VB 3ROLB 2ZG1A 4M00A 1JV2B 4N78E 1IBFA 4CBPA 1RIVL 3ISWA 5K1JA 3DX6A 5HHNA 3UPCA 1YJDC 3ZDMA 1QSZA 4JPWH 1NGZA 2Q86A 1CLCA 4AOFA 3ARED 2Z35A 5FYKE 3RVUD 5IQ7H 3UBXB 2HUHA 1NIBA 3DIFA 3P0VL 4PY7A 4ALAH 2E7LC 5HYSA 1K85A 1FZCA 1ZEAH 5B66E 4DO4A 2AV7A 1IIKA 4KI5D 2DYPA 2VJ0A 5KSAA 2HN7B 1X7TA 1G7QA 2GTWA 3EIFA 2XWJA 2BVOA 4U2ZA 4A55A 4GG6A 1SQ2N 2IWEA 4PV9B 5EIIG 3NFQA 1ML0A 1XF1A 1EJOL 3MV9E 5BPPA 1S9YB 1V27A 1JY3O 4PD4K 2E5EA 3BZDA 5CZXC 2VDPL 3FW6A 2XTLA 3L4CA 2OTPA 4Y4KD 3QQ9C 5SWZA 3UH8A 1UB5B 1XTGB 1UGKA 1EVUA 2RJMA 1SS1A 1TQCC 1BBDH 1WBXA 2HXAA 5C0BE 3EYUH 3W3BA 4Z8FH 2XQBH 2O5XL 3BVNA 2YKLH 3FSWA 1A4AA 3KL3A 3IU4H 2YD3A 2QA4P 2CRIA 2NT1A 3V9CA 3AREB 2CM6A 4OQTH 3U4EA 1MZ9A 2CU9A 1MIMH 3BT0A 2CJSA 2J43A 1JGDB 1Q4NX 2J5UA 1E40A 2DI7A 1IQDA 2GTZA 3AROA 3QPQC 3SWFA 2P46B 3A23A 3K7UA 1KMIZ 3D25B 2J5LB 1BM7A 4R8WH 1Z66A 1HAUA 3BN9C 4Y4FC 2B0SL 1KBBA 4YHML 3HR5B 4HT1H 5HVGB 5FB8A 2BS8A 4A63A 4ABWA 5TQ0H 2PPAA 5J1AA 4ONOA 2R32A 3SDCD 4IOIA 5AG9A 4KU1A 4EI0A 1B0GA 3FT3A 5DR5H 4Y9GA 3CHSA 2N56A 1T83A 5B66H 2HTKC 3ZBMA 4YPCA 5C0RL 3Q2CA 1D5BA 5EU4A 5CFHA 2B89A 2CO3A 1TZ8A 2EDJA 4NNYA 1S4IA 1JRHH 3HD7C 1JPST 5E6YA 1JD7A 4HFWA 4LHUA 5EWIL 5JXAL 2ZUUA 5EZJA 3QCTH 3BUTA 5JXED 3MOBH 4OW6A 4P9HL 1I1FA 3D3VE 2UZYA 4K7PY 3K1KC 5HGHB 3I84A 5BRQA 1K05A 3LRSB 2ZWNA 3V8CA 3KPEA 4HFUH 4RLDA 2AP2A 4AEIH 1E5YA 3HC0A 1CK0H 3S36H 2ADIA 1QEXA 2XIBA 1WMKA 2QSVA 3MA7A 2QGEA 1KB5H 1YN6B 5D2LF 4KNQA 1KYUA 2FYVA 4W9HC 4YFLI 1GSMA 3SDCB 3NAAH 5E1IA 3NTCL 1XGYL 2Y5EA 3ECBB 4JM4L 5GTHE 2CBTA 5L0QC 4PI2A 3WI9A 2Z0UA 4C4BA 1D9KC 1SEBB 2WM0A 2YPKA 4ODVL 3F01A 5CMAA 1U2HA 2WYIA 5FLUA 1AO7D 4YC2B 4LOVA 3PWUA 5KS9E 2BRRH 4G43A 3QNYB 3MRQA 3UEZA 5LQBH 3MD0A 5D7JA </