5AW0B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw0B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw0B02
1MFZA 5AVQB 4I2LC 5APSA 3L37A 5AVSB 1FOSE 3HE4B 2R3CA 5AVTB 1HWTC 4AYCA 1GU4A 5AW6B 3V4WA 2H7HA 5AVXB 1IO4A 1NWQA 1GD2E 3P7KA 3KDPB 3KQGA 2R5DA 4B86A 1GZLA 1G2CB 2VRSA 1CI6A 1T2KD 4GKGA 1CSBA 5APQA 1OXZA 3M9BA 3T97A 4C7NB 4KHXA 3NXSA 1YYCA 2C9NY 5AW8B 1A02J 5AW3B 1FAVA 1OWAA 4RESB 1S9KE 5APVA 3TNUA 1SP4A 4GT1A 2Z5HA 4AQRD 2WT7B 5AVVB 3A7OA 3NFQA 1DH3A 1T2KC 3O8ZA 2ZXEB 2C9LY 2YO2A 5AW7B 3M0DA 3TNUB 5CMZA 3M9HA 5APUA 5AW1B 5AW4B 5AW9B 4LC1A 3WGUB 3VMXA 3IR9A 2R5BA 1MV8A 1HUCA 1GU5A 2BASA 3A2AA 1S9KD 5APYA 5AVUB 3MGNA 5AVYB 4JYCA 2JJLA 5AVWB 3UIAA 3SWFA 2Q3IA 1CI6B 2YNYA 5APXA 1A02F 1GTWA 3NMDA 2KP8A 3HTKA 3L35A 1CZQA 2Q5UA 5APTA 4JYBA 2WWWA 2QM7A 3M0AA 3P32A 3NTNA 3LIEA 1FOSF 2XZRA 2WPSA 5AVZB 3HE5A 1GK6A 1NAFA 3VN0A 2W27A 1MUUA 1JUNA 2R32A 3I5CA 4HYTB 1GK4A 3HE4A 4EOTA 3L36A 3P8MC 1H88A 3V5BA 2QM8A 2N9BA 2E43A 1HBWA 4I6MC 2XU6A 4XE5B 3MD0A 3OAKA 2IPPA 3WGVB 2YO3A 5AVRB 3M06A 2ZFCA 3V4QA 4AUWA 5AW0B 2P2UA 3M91A 1HJBA 2Z5IA 5AW2B 5AW5B 2P7JA 4C7NA 3TK1A 4DZOA 4RETB 3LIDA 2P67A 2Q7CA 3A5TA 1X8YA 3TYYA 2WTYA 1SLQA 3VYIA 3B8EB 4C46A 1H89A 2WT7A 3VTPC 1KQLA 3VMYA 2E42A 2W6AA 3A3YB 2WPQA 3HE5B 1JNMA 4M3LA 2XV5A 3VMZA 1H8AA 1J2JB 5APWA 2WPRA
chains in the Genus database with same CATH superfamily
2R23B 4PGEA 1MEXL 2QVTA 3V2AR 1PYWA 4L3EB 4MAYC 3QQDA 3MV8B 2NY3B 1QWHA 3ZYOA 1YTZI 3HG2A 3GZPA 4HG4J 4JCLA 4FLQA 1GD2E 4TSBL 1AR1C 3JV4A 5LCVA 4XVJH 2AJYH 5EEWA 2JJVA 4TLUA 3AS1A 3V52H 2ENSA 4LLMB 3N40F 43CAA 3Q2LA 3AG3B 4V2BA 3KPPA 1OXZA 5JW4R 4Z7VB 3DECA 5D7LB 4KNTA 3VI4E 3ARYA 2H1PL 3CFEB 3FK3A 3GBMH 1EAQA 4QTHB 4X7EC 1P5VA 2ZUWA 4FG0A 1I3VA 4J3OD 4M03A 4N0YL 1EEUA 4XN5A 1P4IL 5D1XE 4I0CC 1WTGT 5EIVA 2CLRB 1I85A 1UJ3A 4PAZA 3WENA 3L5JA 1JZ4A 1RUAL 1EAOA 1ZLEA 5C0RL 1A9BA 1IJ9A 5FUCC 1RIHH 3BXNB 4X6FB 2R1XA 1KQSO 5AW1B 5KTBA 1DJYA 4WW2C 3CE1A 1EEQA 1QABA 2ZOLA 4ONFL 2FUQA 1DD4A 4HLZG 2O6CA 2Q7NA 3HPJA 4PLJD 4U1JB 3VD0A 2WSEH 1O7DE 3MLUH 2Y7QB 2W9EL 1WCQA 1S9KD 2ZXDA 3IMUA 1RP9A 3UO8B 3KDMA 4FQLH 1U92B 2OMNA 3W39B 4KGLA 5FXCH 3PF2A 4Y9GA 1HC1A 3S37L 2OMYA 2XYBA 5HJ3B 5D8JL 2GJ6D 2NNAA 4D7BA 3T97B 4I4WA 3M46A 1FNSL 1XEDA 1C5DB 1YPZA 4E9YA 1UCBH 4C59B 2K9JA 5EIIG 2R0WH 3VXTB 3VW3L 5AKTA 3IGAA 1B3IA 2W88A 3RZCC 3V0EA 2QPDB 1RF1B 4MJ5B 3EFFK 4Z3FA 3D12B 2A06E 2P4AB 3SD5A 4E36A 4PV1B 2JK5B 3TVMC 1U0QA 5TE7L 3TF4A 3KPSB 1NAML 5EFIA 2W0LA 1TQBC 2OXHA 4M48L 3CN4A 3KXFD 3F58L 5E8OA 2YGNA 1KC5H 1OVZA 5F7MC 3GSOA 1KCUH 3GC3A 1A1OB 3RFZC 2Y06L 1X5GA 4DCKA 3KLHC 4WY4C 1LT9C 2QSIA 1CICA 3BESR 5IR1B 5KN5A 3MZTA 1KILD 3LTVA 4CBPA 1JV2B 3FDWA 3GMPB 4MXWH 1J9QA 1AO7B 2NNXA 3SGDI 4LBAA 4LIQH 5HHVL 3HR6A 1CBVH 4HFWB 1HT6A 3CFMA 1OSYA 5E4EB 2I85A 1I4FA 2I07B 5PCYA 4X8GA 3DVNA 5CCHA 4MXVE 1T1XB 1A14L 1IBZA 4GT7A 4AYFB 4WUUB 4ZFOL 1SFHA 4UT6H 1YEGL 3EFGA 1KYOK 1NAMH 4EN3B 3F58H 2NY3C 4ZUSA 2AK4A 5EU7C 3IXAA 2Y5TB 5FHAH 1RZIB 2GC4C 4DVRH 1Q82Q 1HFUA 4L4VA 3R4RA 2BP8A 3ENEA 1ZA6B 1K5WA 1F58L 1OGAE 4LOEA 5DUBA 1XH1A 2JLPA 4ANUA 5A40E 5I1JL 3MOBL 4Q4EA 5MENA 1XF2B 4E9VA 4L3AA 1SJEB 5GS1A 4DJGA 4PJGB 1J1OH 2XRAH 2YEQA 2AV7B 1MCDA 4OZIF 5KVGE 3CPUA 1UA6H 4LP5A 4EUPH 1LDSA 2DW5A 3S34L 5KAQF 2WWMD 2WLZA 3LQAC 4OKVB 4QCIA 3BJ91 1Q9LB 1RJZB 3CNKA 1U30A 3RGVA 4N85A 3HUJB 4KHXA 4U6YA 1U4EA 2WAHA 2WKOA 4RAVB 5JUEH 1YYCA 2X42A 1FNLA 3F7LA 4MNGE 5AW3B 1VEOA 4XBGB 5L7XL 1VQOP 4HKZH 3WS6A 2WLHA 2X3CA 1F4XH 1K8IA 3WY3A 5D2LF 3ABLB 2GEEA 3AY2A 3ISRA 3FCGA 5HGHA 2A6DB 2EH7H 2LHAA 5DS8A 3WFHB 1ZVYA 1JN6A 1I7ZB 1KENL 4TUJB 5EO0B 1CTNA 2Y1YA 3RTLA 3OX8B 5C70A 1L0LK 5CD3A 1KQGB 5BO1L 1UOLA 5E6SB 2MNUA 3QQNA 3DK0A 3CDGA 3UTPD 1IGCL 4LGSB 3GLAA 4YDVB 3X14B 4K07A 2XQBL 4K8RD 2F58L 2OZNA 2AHIA 2X53A 3FO9A 1PFCA 3TNMB 2KK7A 3LEVH 2GSIB 1MHEA 2OLDA 1J0IA 3W2DL 3PYCA 4LF3A 4LHJB 4CC0A 4F57L 3D2UA 2WO2B 3D06A 5INDA 2R2BB 3DTXA 1DVFC 1G5GA 2YXWA 3RKDC 3ARED 1S3KH 4L4VD 4A7TA 1U8HB 4MLIA 3QUMB 4PM1A 5E79E 1IT9L 3CMEP 1LNUB 4LHQB 1QWNA 2VLJA 4B9IA 3LN5B 4PY8I 4YSEA 5HYSB 4RJTA 5EU3B 5KSAA 1IGTB 4F1SA 3WSQL 5CJXC 4UILH 3Q3DA 3V5KA 4YHOH 2FJFA 2R0KH 4PHXA 3BKYH 3OHXB 4DWHA 1KFMA 2DMGA 3S5LG 4MMXB 3RGVD 3KNBA 1L9NA 1WF5A 1IEAA 1L0NE 1AACA 1I1FB 5CEYA 4F57H 3HG1D 4F7EB 2O5YH 2MH4A 4HOXA 3BVNA 3TWYA 3U7YL 3FTWA 3S5LA 1XGTA 4DH2A 4GLRH 3TBTA 4BZ1A 4Z1PA 3NQIA 4WGVB 2FX9L 5EDXA 3D2TA 4L73A 1TJIH 3CN2A 4LBEA 2DD8L 3A47A 1YZZA 1EJFA 4MJHA 1XZ0B 1KCSH 3BKCH 3GS4A 1QHPA 4GQ9L 2BSRA 3TSIA 4GRLA 1FQ9C 5EO9A 5F96L 4MX7B 4Z8FL 5C1MB 4KT0J 3PWJB 5LBSA 1UM4L 4NKDA 4IHBA 3MTUE 1FFPB 4O00A 4J8RB 4YXKH 2APSA 3ZT6A 2X4QA 1UCTA 4HD5A 2VDPL 1U8MA 2KLTA 3ULVH 2F7RA 3D2UD 5KG9B 1QI4A 1T22B 3P2BA 1MJJB 3WIHA 3MRPB 3Q01A 3M9BA 3CH1B 3NCBB 3QWOB 2NRGA 2XVLA 1OTUC 4BKSC 3WDJA 3TBSB 1ADQL 2HXAA 3DIFA 3CFKB 4H13B 3TN0A 2WC7A 1LK3L 2VLJD 4OTXH 2H1XA 5DEFA 3QNYB 5KLVG 2C9LY 4JCWA 5KSAD 3D69A 2GABA 5IEKA 3EJQA 3G6AA 4OLUH 4YNYA 1PGPA 1BIIA 4PTUA 5B1AB 4KKQA 4NKIH 3QAZC 4NS0A 2JF1A 3U7WL 2JELH 5TPWL 1ACXA 5GTHE 4S1QL 1L9SA 5DHVH 2N0KA 2FFDC 4W9CC 2G3XA 3WS3B 4O2FA 3HG3A 4XHJC 3VFSA 1U3HC 4RRPG 3F12A 1JPSL 4W4OA 4DZBB 1AYOA 1GAFL 4AYGA 1CT8A 4QLRA 3SJVD 3A4AA 3BQVA 4URTB 4DETA 3VFGL 2OW6A 4Z7QF 4MQ7A 5EN2A 1ED3A 1C8PA 3HC0A 4HHGA 3QDGA 3AWEA 4G9DA 5D7KD 4WNJA 2EO7A 2J5LB 3UAFA 1F4YH 2FJGA 2PWEA 4Y5YB 1D7MA 4JO3L 4DN3H 3BSZH 1LE9B 3MRBA 3HUSB 5K9JH 1HU8A 5T1KD 1U93A 4MN4C 2Y1VA 1QUPA 2YAQA 4GP5B 4S1QH 1YEKH 3S3SA 1ZV9A 2YPLE 4XC3H 3EKCA 5CWSA 4YC2C 2IH3B 1IRAY 2F74B 1CYGA 1DN2A 2X28A 2R7EA 4GAAA 3DX6A 2B2XH 3GXDA 4R0LA 2I69A 4PY7A 2VXVL 5L9DH 1YEFL 2DMCA 3D0LB 3AAZA 4S10A 2FR4A 1SFCB 1XB8A 2P67A 5ALCH 1CK0L 3SDAA 1ETJA 4YHML 1HHJA 3DO4A 3CQPA 5J11C 4JLRB 2OK0L 3MRQB 3KLKA 4P5TA 3KPEA 1KIPA 4Y7MA 4HUNB 2NNFA 2DQDH 3IXTA 1CGSH 5D2NE 2F61A 5KLVD 5DDHA 3ZRSA 2X4RB 4JMXA 3MYJA 5GGSB 1NCIA 3CQQA 3MUDA 3MODL 1TO5A 5IVXB 2KZJA 3BYTA 5HYIA 3S9OA 2ZCLH 2CNYA 3AWFA 1IBDA 3D4YA 4JPKH 1FO0H 3VWJC 4BWTA 2OSWA 4HLJA 5SWZE 3HCVA 4AQ1A 4ZD3L 5E6IA 4CSPA 3E6FA 1T5WB 3HN8A 3NVQA 2IOMA 4J6RH 2WGXA 1PZCA 4ZXBD 4X6BA 4KKLC 1HXKA 3BZEB 3DROB 3QFDB 4GUCA 5ESQA 3LXUX 2BNQB 3ZT7A 1F8TL 3AMKA 3RI5K 1GZPA 2OMXB 3WV0A 1XXFC 3VDCA 3IJSA 4EXKA 3M8OH 4NQCB 5APUA 4PJ8D 4ERSH 4YWGH 5M1BA 3EDEA 1N8OE 2DKSA 4N20A 3LPPA 3RNKA 3C8KA 3WDIA 4XGZA 4DOHE 2OMWB 2H0PA 3BFQG 4IOSD 3FZUC 3IAQA 2G75A 3CXHI 4R7DA 2RALA 1KYOE 2IYPA 2D7OA 2AQPA 1BWMA 1JGLH 2HT3D 2Z1PA 2Q3IA 3ATBA 3PDOB 4OH8B 1HTYA 3R1GL 2YAFA 4MD4B 3OPZL 2VDLB 4BD4A 2J5LC 2ATPB 4GQRA 3DXAD 4PJ9B 5I1EL 5A2JH 4G9FA 1FNFA 3QORD 1P4LA 3L3OB 1H6EA 3LOWA 4LLDA 4AEEA 3IVKA 4KJQC 1MVFA 2VKXA 2DDQL 4XMLL 1L9TA 2EABA 4XWGH 1YY8B 2Z31A 1LQBC 3RWEA 3VB8A 3MRHA 3VXPB 5I15L 3DX2A 3O45A 2Z4EA 1QO3A 1U2HA 3HE4A 1AD9B 2V3EA 4JFXA 4DFHA 1YQ2A 2OL3L 1Z9LA 1T0OA 2E5TA 3TJHC 5E6ID 4XP5L 4Q52A 3OPZH 2HJLA 2MPVA 4KRPD 1CGXA 1DCLA 1MDAA 3IBOA 3WHXA 3ROOB 3BSHA 4JZNA 4NP9A 4I5BB 1GYWA 4Q6IA 4WW2F 1L0LE 4PGJA 4P3CH 4K3HA 2VQTA 1P53A 2IQ9H 1TQUA 2V37A 2G3NA 4LXFA 2XWDA 1NUFA 4XP9H 4OR1A 3WHE0 2J6EA 1NGZA 3SKUD 2GFBA 4YS4A 3NJKA 4ABQA 4NFBA 4MQSB 1QUNA 1X3DA 4YTPC 2RQEA 3CWBD 4LLUB 4PRHA 5D1ZB 3D09A 1KN4H 2VZOA 3I3EA 1B0WA 1BMWA 2XA8H 4BK4A 3NZ8B 2X4OB 2B87B 3PV6A 4YVNA 4ANWA 1B0RA 1MNNA 3QJHA 4F5CE 2ZCKH 2JQZA 3KQGA 5LDSA 8FABA 3ET9F 2RHEA 1P7HL 3VCLB 5IVZB 2KXPB 4R96B 1ZXQA 3ZRFC 1NKOA 2IF7A 3QCUL 1CR9L 3TA3A 3FT3B 2GJ6B 5C07B 3RDTC 3RA7H 1ULVA 2WT7B 1BF2A 1SBSH 4R90H 3FN9A 1BYNA 3JV5A 2IADA 4K94L 5I0WA 4N0CC 3VFVA 1XGQA 1B6UA 1TU3F 1MCWW 2PFXA 2GJPA 4OQ1A 2G9HA 1FHNA 1JPFA 1RKRA 1FBIH 4W6WB 4PGEB 4XN8A 3MRDA 3KMDA 1PYWB 3CZNA 1DL7H 4PGDA 5CLYA 4CNIA 4OFPA 1FJ1A 3DI3B 3HHMA 3SO3C 4DGIL 3QQDB 1DBAH 1U95B 2NOYA 2R9HC 1RK1B 5AVYB 1DBBL 5E5RB 2HX8A 4NN7C 4DNLA 4KQ0A 1AAJA 4GW1A 1E3FA 1UXWA 3WEAA 4O51A 43CAB 3Q8EA 1X22A 2FEJA 3MLZH 3CBKB 4XXDA 4UB0H 1P5VB 2J25A 3T0VA 5EMYA 3HE7D 4H7VA 4Z7VF 2QQNL 5EORL 5CZVL 3O2VH 5DVMA 1UM5L 4Z7WA 5AVZB 1FDLH 3PGFL 1EVUA 1A9BB 5B7EA 1ID2A 3SFDC 5DQJA 4DP6X 2PN5A 3T1WA 1LGHB 3QQ3A 1ORQA 2R1XB 2VUKA 1BQHG 4HAGA 4A04A 2X4TA 2XBDA 3Q1SL 3QEHB 3SOBL 4PLOB 3HPJB 5T3XH 3LS5L 3G6JE 4GEJA 3BEVA 2EYRA 3UJJL 3CJJA 3GMNA 3RY6C 2VR4A 3KDMB 5LAPA 3LCYA 2R0ZH 2E86A 2OMYB 1F97A 2Z8VC 1S9XB 2BFVL 1LWUC 4HUXA 4NKOA 4B0MM 4BUHA 3M06A 2NNAB 4JFVA 5K59E 4I4WB 3MSPA 1YPZB 3OJ2C 2K9JB 4QRFA 5D1ZC 3U0TB 4DAGL 2B16A 2Q9IA 3IGAB 1BZ8A 4LNVA 3IKCA 5EF3A 5FFLA 4ZAKA 1KZUB 1EHAA 1ZWIA 4UIMA 5EIIB 5F6IC 4M1DL 3RAJL 2XI9A 3B83A 2NUPA 5EFIB 2OXHB 5E8OB 4PQXA 3C12A 5APWA 3C5ZA 1QRKA 3GSOB 3FRPG 5DZLA 2Q86A 1WIOA 5AVSB 4JGUA 2ZKHL 4UTCA 4GKSA 4BQCA 3HKFA 4JRXE 4B9FA 4L0YA 1CICB 5HI5D 2QPSA 2IBZI 4JO4H 5KN5B 2BIPA 5ELIA 4ANKA 3ZHKA 1ZOYC 2N1KA 1NTZK 1DJGA 3KL5A 5D1XD 2F7IA 3RX9A 4IBWA 2R56L 1NIFA 1UASA 3KW7A 3TT1H 1V7MH 5GGRA 4TNWK 1I4FB 5DK2A 4H88H 1NH4A 1JJUA 4J3TA 3DVNB 4MHHG 4ZX5A 4ZNCA 4XPAH 1V27A 3FO2A 4B3VA 3OKMA 1M8OB 4Q14A 2NPSA 4XP1H 3CHSA 3TZVC 4ZUSB 1UENA 2AK4B 1AY1H 3ARDA 3IXAB 1YEWA 3K6IA 4JUTA 1E67A 1GC1H 1TYJA 2A4CA 4L4VB 1KBPA 4LO9A 2BP8B 3PP4L 5DUBB 1N7LA 1XX9C 5I8OL 1NAYA 2XIIA 5JORA 4JFEE 5MENB 5AAWC 2ZXBA 5DR5L 4G3YL 2AJXL 5GS1B 1KG0A 1ASOA 1EH9A 2PR4H 3FBKA 3LRKA 1P9MA 2WLKA 4NO3A 4S0HA 5T1LA 1I85C 1UJ3C 3ZLQC 4PJGF 2A38A 2A6JB 4QCIB 1CFNA 3KEHA 3RGVB 4U6YB 2TRYA 3F85A 3MLYL 1NJ9A 3NIGF 1SEBA 2A1WH 3KWUA 4NQSA 1NGQL 4H8WH 3UZQA 2DMBA 4D0BA 5J3HD 4R83A 3HUJF 3BVVA 4DKFH 4XXWA 4ATTA 1K8IB 2BZDA 4O9BA 3QPQD 1N18A 2CAKA 4I3SL 5HGHB 3PAUA 1JN6B 2AERT 2VWEE 3Q1EA 3I3DA 3Q3GB 3QEUA 2DS4A 2UX6A 2M3BA 4FQQA 4YHZH 5I1CH 5CD3B 5MI0C 4G5ZL 2QLYA 2IGLA 3U36A 4JY4B 5K9QI 4POZC 2WCPA 5C7XL 4U4BA 1O6VA 3FMGL 1A1NB 4X2UA 1H88A 1MHPL 1UFUA 2HKHL 4MDJA 3EJTA 5E7BA 4GAJH 3HFML 5IHHA 3RHWK 1G2CA 3VP8A 2YXQB 1F1AA 3GRWH 3S3PA 3RWHA 3FO9B 4I2XE 1M56B 4X0KA 5INCA 2RMZA 3LV3B 5DYOA 1MHEB 2CMRH 5FCUH 4TQ8A 2J8UA 3BGFB 3R06B 2A45I 1YITP 1WFIA 3D2UB 5INDB 1U41A 3INUH 2NPSD 2B0SL 2B9BA 3MCLL 4IHOA 2Z7YA 3TO2B 5BJTA 2QQLL 2I60H 4HK0B 1AGFA 1U58A 3UP1A 2KERA 5BW7C 5KVEH 2CUIA 2O1KA 1T0NA 1CICC 4G5ZH 3GKWL 4CN4A 2Y7NA 1QI3A 4EYYQ 3J27A 4G72B 1XMWA 4MNQE 1FC2D 1QFOA 2VLJB 3LH9A 4F80A 5B21A 2L91A 4N8PA 1SQ2N 1L0NG 5KSAB 4HJ0D 5TISH 1D7BA 5GZNC 3V5KB 3KYNA 2FJFB 3QJOA 5T1LD 4NQVA 4AC4A 5F89A 4AM0B 3S5ZA 3KNBB 2XTJD 3U1PA 3CWBJ 4LL1A 5CEYB 2X5PA 3VX0A 2W95A 2IPUK 3BVNB 5DZPA 5KZCD 1FZBA 3S5LB 1XGTB 5KAIH 1JERA 4HXAH 4O4YL 3TBTB 1QRNE 2C1OA 3VVVA 3IGFA 4LLWA 4KOCA 3UEQA 5APVA 1GHFH 4LBEB 2B89A 3HRPA 3K2UH 3SJVB 4F91B 4GFTB 1H9DA 1AGDA 4UV7H 4GKNA 5IMMA 4OLXH 2UUDH 5KBDA 3ZZ1A 1MRFL 2CCLA 5D5MA 4TLKA 2P80A 1N64L 4GRLB 3V4PL 3V95A 5EO9B 4YZWA 4JREC 2XC8A 2AXJA 4PLNC 2GSMB 3CVHA 1G1IA 1RP8A 1KGYE 1KB9H 1JHTA 3VG9B 3ZKMC 1WWWX 4NKDB 3BZ4B 1HZLA 5T1KB 2VE6B 3MNVB 2X4QB 1U8MB 1LWHA 3VGGA 2YNYA 2CBQA 1FBMA 5C2BL 1JYVA 1XF4A 1A64A 4LRNH 4NYLA 1BP3B 3ULUC 4FTDA 4HGMA 4N5UA 1INQB 3BUDA 3DIFB 3VFMB 5BRZE 5I75C 4IL6H 3NRPA 3ARRA 4MA8H 2BVQA 1MRFH 2BVUA 3WUWG 4HUVA 3F7RA 2AJZA 4XNAA 4FHJA 2O26U 5HYQA 1MAML 3APDA 1VADA 3RBGA 2XN9A 3AE4C 5IEKB 1OZTG 1CFBA 1USZA 2R32A 1JD7A 3CVDA 2N0MA 3G6AB 3DV4A 3L13A 4LRIC 4YNYB 4PTUB 3B5ND 5D7IA 5B8CA 2AQ3A 1GK4A 1LTSC 1L0ND 1A6WH 4AK1A 3FQRA 1E4JA 1DR9A 2FJHA 3F8UB 3VXNA 3VTMA 1MFEH 4Q89A 4XNZC 2EEAA 4KUZL 3SGJC 4G5AA 4QIRA 4LCWE 4O2FB 5IJKA 4OCSH 3VFSB 3MFGB 4GQPH 3F12B 5DJ0A 2C3HA 1YO4A 3NYKA 4PBWD 2YD3A 1ZK9A 2QPUA 3WKMH 2VNCA 1E4KA 1CT8B 4P59L 3VUAA 2WTYA 2CK3H 3QUZA 5C0ND 5H37A 2ENQA 4MQ7B 1MW0A 4KGJA 1ED3B 4JPQA 5EN2B 3HC0B 4K7PL 1A7QL 2PWDA 1KMIZ 4G9DB 5DUJA 2KOGA 2FJGB 2HKAA 9PCYA 1K4CA 2CCVA 3AE7C 2Z91A 3RNQB 2NY7L 4HIJA 1U93B 5IB4A 5T5FL 4O58L 1WFUA 1F00I 4MZ2A 5CFAA 4GUOA 3GNML 4ASVA 2X70A 2GUYA 3JBG7 5C0GA 5CWSB 2NSMA 5EOTA 3I56P 2R7EB 5C0AA 3CUPB 3DX6B 4R0LB 2BNRA 3CMGA 2VM3A 4MVBD 4PY7B 3B37A 4XPTL 3AAZB 1EXUB 1I7RA 4NQDE 4WFFD 3Q44A 5GHWH 2FR4B 3SDAB 4YGVA 1HHJB 3RBSA 4R8WL 3QDHA 2XXMB 1WEJL 3OJAB 2WQSA 2FY8A 3FCSA 3FSAA 1KIPB 2PETA 3O0RL 1UM6H 4G7VH 3ZKXB 1CFQA 3VG9C 4XAKE 1HNFA 3IJHA 3H4FA 5I8KH 4WHCA 5DDHB 2IO5A 2PCXA 5DJ8A 2OSYA 2ZSWA 3MYJB 2V7NA 4ZMWA 5E2TL 4BHUI 2NY2B 2CR3A 5LGJA 5BS0A 4V1DA 1VPCA 2JJLA 5H2FH 3NOIA 3UIAA 1YJ9P 1CQKA 4XNYH 3OGOE 3HCVB 2EP6A 3QYCA 4AQ1B 4R3SA 3TN0C 1EHKB 4PW4A 1K5NA 2YD1A 3NMDA 3PPSA 5E6IB 5BXFA 2GIYA 1Z9SA 4KRPB 3R0MA 1ND0A 2VQ1A 4X6BB 5L2JA 4BFIA 2XETA 3HZVA 4A6YH 1Q2NA 4DERA 5ESAB 1HHIB 4PS8A 4RDQG 5CILH 1RURL 5KVDL 4FLOA 3QUYC 3MV9A 2O1AA 2CA4A 2QHRH 5GQBA 5LXVA 3DX9A 1GZPB 3T2NL 2X9YA 4QAWA 2AK1L 4Q2ZA 2A4EA 4BQBA 1P1ZA 1NTZE 3IJSB 1E0OB 4LNRA 3RL2A 4FTVE 2ZXXA 4F2ME 5I19L 3MNWB 3SFEC 1AQ5A 4UTBH 3RNKB 3C8KB 1I9RL 4XGZB 2MCPH 5AOZA 4YSOA 4YPCA 5C0AD 2IDTA 5KEZA 2G75B 5D4HA 4R7DB 1PIXA 4DZ8A 2EC9T 1E6JL 2KI6A 2NTFA 1KJ3L 2QVMA 2V5RA 4FZ8H 2PMZA 4GNKB 2VDRB 1A25A 4U3CA 4FD0A 4EF3A 1WRFA 4PJHE 1SFDA 4LDLB 1P84H 3RK3E 3WGVB 4HV8A 1LO5A 3IU3A 4YSTA 1I9JH 1VSCA 4KI5E 2POHA 4RQQA 3VOPA 2APXA 2EDDA 4NRXA 2KDGA 5B4MC 4IKIA 5F1IA 2ENJA 1CD0A 4LLDB 3IVKB 1OM9A 3B5GA 3D0VA 2ZVOB 3VXOA 3RL0B 2D73A 4CN1A 5H4ZA 4YHLH 4K9JA 3RWEB 3TX4A 2Q1KA 1MAKA 1PQZA 1PLGL 4FA8A 3MRHB 5EZIH 2GUOA 5K5YA 2BH0A 3O45B 5CP3A 3WG7B 1QO3B 1JZ2A 5SWZD 2VC2B 3CSYB 3GLMA 3HE4B 3SKOB 3RVTC 2BO0A 2CM6A 2JFCA 1L0LG 3OTTA 3FQWA 4OFYD 3S97C 4NT6A 3LZLA 3SDAC 1MWAH 2HJLB 1D7FA 3WHXB 2FZ3A 1PPJE 4BZ2L 4JZNB 4P5TC 1WHPA 2F53E 5F7YC 1KELL 4IJ3B 4Q6IB 1ORSA 2OYIA 4RSYA 2Y23A 1LK2A 3BAYA 4RISL 1CQYA 2GIXA 2P1JA 4TF4A 4O5LL 1NGZB 3AECC 2NY2C 3RIFF 2GFBB 3BRVB 5ID1A 3GS7A 4KTGA 2HLFC 4C56A 1QUNB 4AV0A 1KYOD 4N2DA 4PRHB 1TF4A 5F9OH 5AB2A 4S1RL 2KUTA 3GI9L 3PV6B 1BZOA 1H6UA 3TONA 4OV5A 1B0RB 5CUSH 3QJHB 5G4NA 5ISZA 3U4BL 1VESA 1X6NA 1RZKL 4NAJA 4TTDC 5CZRA 8FABB 2D4FA 4Q9RL 3OVUB 3OKDA 2LXBA 4EN2A 3Q5SA 1Z5HA 2Z34A 4JQVA 2O5XH 5L4IA 1SLUA 3DI2B 1EAPA 2GG1A 2W80C 3DX0A 2X6CA 3FO1A 3MTXA 4JB9H 4AIEA 1OARH 2IADB 4KVNH 5F1SA 5HTSA 2X2UA 2W38A 3VDAA 3VFVB 3V4VL 1XGQB 2R8SH 3AG1B 2G9HB 4Z1MH 1JPFB 1QKZH 3CFIC 2X7LA 3AB0C 2DM7A 4OLWL 4ORGB 1YYLH 2UVFA 4QAMB 3S98A 4FI6A 4XNQA 2OI9B 3B7TA 4PBVC 1YUKB 2UV3A 4PGDB 4CNIB 1UACH 2FYYA 2EEFA 1L0LD 4XE5B 1WFNA 4GW1B 1ESOA 1Z2KA 1WHOA 4P2OA 2QJKB 4XVOA 4XP4L 1UXWB 2ZXAA 3SE3A 4O51B 3EH5B 2XXFA 3QRGH 2XX0A 2Z31C 5T1MA 3RL0C 3P1VA 1L0NJ 1NMAL 3D52A 4XXDB 2OMZA 5D7SH 1KB5H 2X38A 5JQ6H 3KBHE 1PSKL 4C56D 4LIQE 1JB0J 3CSGA 5FYJH 2ZWLT 4F20A 3VFUA 4Z7WB 2B4CH 1V10A 3WO4C 1TTUA 3FB5B 1IB5A 3TT3H 4OLWH 5DQJB 3BLPX 1I8KA 5IMOA 3QQ3B 1TEFA 3CXFA 4YQXH 3S96A 2R39A 4ONGH 2Y7OA 2K7QA 3GSNL 5AYQA 2X4TB 3SYAA 5ISZD 3CC1A 4QTIL 4HF5L 2WVUA 3ZZSA 3AFLA 4HU8A 3BEVB 1TETH 2EYRB 4NZTL 5KS9A 3GMNB 3CLEH 3MREA 2FX7H 4NPDA 3E2HB 3TO4A 3E38A 5I1GL 5IWLC 2WYTA 4NKOB 3MOAL 3KWWA 4M8UA 1FZCB 1QFUH 5TF0A 1UVQA 2NQDA 3F89A 2YS4A 4P9ML 1USDA 1PSKH 5D71L 1B2WH 4OCRH 4BRYB 1FAVA 4YUEH 4FKHA 3IKCB 4LGDE 1HN1A 4ZAKB 4AL8C 4KKZA 2FE0A 4OZHA 4UIMB 3CZEA 4ZFZA 2SEBA 2Y6SD 1K3ZA 2NUPB 1GY1A 3HR5A 4BSJA 3C5ZB 4U1GC 4MCMA 4YSDA 2WXRA 3I6LE 5IESH 2B8OT 4GKSB 3ESMA 2JB5L 4H44C 3INOA 4JFDA 4LVOB 1SHSA 1OD7A 2YUWA 4JGJA 4NZDA 3TA3C 3EYSL 2EADA 3K2MC 1NFIA 5GJTH 1E9QA 1GTWA 4FKEA 1EDKA 1BM3H 4UTAL 1XHHA 5GGRB 2N1TE 3FTSA 2Q5UA 3USSA 1YMMA 1C7SA 1TJGL 5F3HA 2KL6A 4AJWA 4F58H 3BIBX 3IAPA 3FO2B 3KGTA 3OKMB 3MBEC 4IIQB 2NPSB 2HX9A 3PRJA 5IGXH 3ZO0A 3GMRA 3RVWD 4PRIE 4U6VL 4Y1AE 1Q38A 2DI8A 4BM7A 5DZOA 1RSFA 3DARA 4JVWA 4Y2DC 4HJSA 5J7CC 1MCNA 1ZDSA 2EIMB 2I24N 3TO4D 2P48B 5HDRA 5JPNA 5F7BA 2WNWA 3NIDB 3GHEH 3L71E 1KG0B 1PAZA 4M62L 1KYAA 1IGMH 3QDME 2F1EA 4NO3B 3H2PA 4APQC 4QXGL 5T1LB 5FUOH 1QW9A 5AB9A 3ML9A 2OM5A 3SD2A 1CFNB 5DJ6A 1Q0EA 4G8GA 4KTYA 1NCAH 5CZXC 1OCCB 4DZOA 2BSEA 2XTJB 4Y4HD 5K39A 1NJ9B 2L4OA 1SEBB 1E9OA 3ATAA 4NQSB 3V8CA 4EZMA 3UZQB 4D0BB 3HNTH 1HYSD 5TQ2L 3GPEA 4YK4C 1QEWA 4G8EB 2WJ5A 4X0NA 2WSCH 1KWKA 3QZBA 4ZMPA 2WZPA 1JNMA 4GKOA 4QRUA 3LQAL 3AQZA 4M3LA 2WPGA 1ZLLA 2HCZX 4JRXD 3SBPA 1L0XA 3QEUB 4KK9D 4JFDD 4FQQB 2B1HL 3RWJA 3AT8A 3ULUF 1HWTC 3NZSA 4OM0L 4K3DL 1M1XA 2ICEA 4PWIA 2WSPA 4MDJB 2H9GA 5DA4A 1JGUL 2ITCA 1FWXA 2NUTA 2C7FA 3P7KA 1KGUA 3BAJA 1WAAA 3CZSA 4X7DC 1G2CB 2VRSA 1KB3A 5KJ7A 1MVUA 1PG7X 1YMMD 3G5WA 4I18B 4KDTA 4ZAKC 4X0KB 2HPTA 3RWHB 5A6LA 5HVHB 4TUUA 5CS7A 1MI5A 1AOHA 4OZGA 5DYOB 4F93B 5EEVA 4Z9KB 2J8UB 2PP9A 3C5JA 1KTLA 2FATH 4I1NB 4TYUA 1JI1A 3TS8A 4B9ZA 5T8IA 5DC2A 4ETQB 4Y9BA 4IHOB 3BPOC 4PJIA 3U9WA 3UBHA 3ULVE 2HT2D 2LVEA 1AGFB 1U58B 3CCUP 3UGEA 1T0NB 4Y28J 2VIRA 1ML0A 4KRNA 4X6DF 1QGKB 3DX7A 4S1DC 1GIGH 2CRMA 3KS0H 4H1LG 2Y9ZA 3QDAA 1W80A 1JRHH 5DMIH 3UGUA 1KSRA 4HSCX 4KO6A 4IW4C 4TUKL 1CGYA 4HUWA 3KYNB 3G6EP 3IEAA 5EUOF 5GGTH 4L2YA 5F89B 3WXVL 1FDIA 3QR0A 1WD8A 3D3VE 4A67A 3IJ9A 1KYOJ 1R47A 3GEWB 1FG2A 7TAAA 5IREA 3ARDC 4ZFGH 2X2JA 2C1OB 3QHFL 1HI6A 2Y36H 3VB9A 3UH8A 4LLWB 3EW3B 4Y5VA 5KTEH 2N7SA 1RVFH 4CVWA 1OPGL 3TC9A 1RZ7H 4OGZA 1X5XA 2XWEA 4WFED 4CBZA 5IG7A 4GKNB 4DP4X 3K4ZA 4E42B 4K71C 1MVYA 4YSSA 5JR1L 1WAEA 3HAEG 1A65A 1D5IH 1MJ7H 1TTFA 3FSVA 1C5CH 2IWKA 2J1XA 3CVHB 4S1SL 4PVMA 1JHTB 4CILA 4G8AC 1ACYL 1Q9WA 2CSPA 2UZXB 3HAEA 2WYHA 3PCYA 4IU2A 4JHWL 1QFHA 3VD5A 4E9TA 1TJHH 2H41A 4JY5H 5FKPA 4ZPTA 5EOCJ 3EHBC 1XF4B 5JYMA 5LAXA 2HT4D 4PV8A 4NYLB 5FO2A 1MCEA 2FT7A 3DMMA 3RB5A 4ALAC 4DESA 1L0LJ 3LQZB 1X8YA 2WKLA 4KY1L 4ZFQA 3H9SE 1MRCL 4NPJA 1YMHA 1G9NC 2YQ2A 1WMKA 1BCIA 3OC5A 1CF8H 4JFZH 2AJZB 5ACMA 2LABA 5KUMA 5HYQB 2VH5L 1XSOA 3BATA 1QTYT 1IJNA 3OJVC 3QNFA 4OF6A 1NUNB 3QFGA 4GAFB 2DQCL 2WXPA 4HZLA 4B53A 4PYHA 5JHBA 1NFKA 4TULL 5IUCA 3S3DB 3DV4B 5IT2L 1WSST 3M1CA 4NHUB 4ZYKA 5B8CB 2XBTA 1P6WA 4PJAA 1JNLL 3FQRB 2WVRA 2FJHB 3EO9H 2HMID 1TZGH 3WFCL 3P9MA 3VXNB 2YGVA 3KHQA 2HLAA 3BUQA 2Y69B 1QRND 2HTKC 3HNVH 4MQXC 1J48A 4GMSH 5K5GB 5DJ0B 3UC0L 4PJFE 1R19A 2EUZA 4IRJD 3BFWA 2F8XC 2F19L 1T0MA 3TNNA 2BVPA 3QUZB 4EZKA 1DUYA 2HZHA 1TZOA 2Z5HA 1NTMK 3GG2A 1X5KA 4DP1X 1MCRA 1LO0L 2FQDA 1DQMH 1IJDB 4J3WA 2FQFA 5EC2B 1XV8A 2Z91B 5FFGA 4JAMA 4HIJB 3O9WC 2K4WA 3UFIA 2R5BA 4B6ZA 5IB4B 4G1MA 4RGNE 4XNUH 4G70B 1OAYL 5C0GB 4PWKA 2WLNA 5EOTB 4DQOH 3AE5C 3N04A 4JDTH 2GHZA 1FL3B 5C0AB 2WSSH 3CX5D 4NNPL 5T1DH 3TP4A 2ZOUA 1ZP0C 1CXHA 2FH8A 3QBTB 4R4ND 2BNRB 5I74C 5BRZD 4GAYA 1DJZA 2WBJA 1O75A 4UQ2B 1BPLB 1KXQA 1LTAC 2K8QA 1I7RB 3MROA 5TQ0L 3K72A 3N42F 4KMTL 1EZVE 1BFSA 2Z3FA 4FRWA 3B43A 4Y99C 4YGVB 2D3LA 1HCZA 3B2PA 1QSFA 3HS9A 3FCSB 4MA7H 3QUMH 4AVIA 1CFQB 5DK3A 3B71A 1OAQL 3O3AA 1F3RB 5F71A 2O30A 5DJ8B 3I9GH 2E7HA 4L74A 1Z3GH 1RIUH 2ZSWB 3BSGA 4TQIA 5BUPA 3J2PA 4O02L 4H4NA 5GGVH 2V7NB 2FBJH 2VRKA 5DRNA 2G60L 4YHYB 2IGFH 2VOTA 4OLZH 5HGGS 5LGJB 2Z1KA 2I25N 4Z7NF 4V1DB 5BS0B 5KYUA 5DJZA 3V0VA 2IAMA 4NC1E 2EXWD 3QDJA 1T7YA 1PY4A 3UG4A 1KEGL 4HHAA 4R3SB 4U1SA 4Q0XL 1HJCA 4PRPE 1Z9SB 1DEEA 3FWLA 1ND0B 2QKSA 2XY2A 4BE5A 1MCKA 1MW1A 5L2JB 3VAEA 1NTZG 1IUZA 4BFIB 4RVBA 4HPOH 3GO1L 3HZVB 1IM3A 3S4SG 1BMGA 1GL4B 5B8CC 2UUDK 3ALXA 5DLMH 3DX9B 4XC1L 2ZUYA 1JK9A 4WHDA 4GBXA 4KJWC 4ENEC 3E8UH 1P1ZB 3DUSA 3S4SA 2CHNA 4LNRB 1ET7A 1KB9K 3ASNB 3HI1A 4ACPA 4C4KT 1C16A 3PGCA 1RUQL 2ENPA 3ZKNC 4ORZC 1OCRB 4B27A 5E1HB 2NTFB 3NJMA 4NQDD 1YEIL 1CGUA 1S5IL 1DQLH 3CVCA 3KPOA 3QUZC 4V2CB 3FQUA 4JFPA 1KFAH 2C9VA 3P3TA 4HV8B 1LO5B 3IU3B 2H6PA 2KB7P 1CSBA 2LLLA 5E08L 1LDPH 3F84A 1BPVA 1P6AB 5CN3A 4RQQB 2Y7MA 4XAKD 3SDXE 4NRXB 4ZSOE 1A2YA 2XZAH 1BQRA 1UD5A 1U9KA 1A02J 3FQYA 2AXGA 2XN0A 3KLSA 1KF9B 4XC1H 5F1IB 2NW3A 1AZCA 5IQOA 3U1SH 3A6CH 1OAZL 4TUOA 4JPWH 1XR9A 3D0VB 3VXOB 4I0PA 2OP4L 2NXYD 1O9VA 3AQXA 4OKDA 4NZRL 3O4LA 2HFEA 3PABB 3O2WH 2OULB 1IIIA 1PQZB 3VI3A 3ZDXB 2ZG2A 5TE4L 2GUOB 2YSTA 2KLSA 1E7VA 1VERA 2DPKA 4LVNC 2OYOA 2Z0UA 4BFRA 3QIUD 3QDJD 1S5IH 3HBZA 3MKKA 3FQWB 3Q8AA 5GRZA 4NJAL 4NT6B 1UHVA 1N8RQ 2E76D 1AFVL 3IB4A 1O9WA 2ESVE 1Z9OA 1LGVA 3TCLA 1DHKA 1SMAA 2FZ3B 5I26A 3X17A 1CLYL 2FQEA 3HZKA 4XPBL 4NCC1 5GISL 1ORSB 1OP5H 2DIBA 5KKZB 2OYIB 1NFDF 2VDNB 1LK2B 1SDYA 1U6AL 1Z5YD 4F2EA 3MRGA 1NTZD 2IZ0A 2G3ZA 2Q7AA 3VXSA 5FGBC 1BEXA 1G43A 4FTVD 4LCCA 1HF9A 1HOEA 3P40A 4PWGA 3HI6L 1OAKH 1PZAA 4EI0A 4AMKH 5DUPH 4NQXA 2VO8A 4C56B 3BIAX 4WI2A 4KK5D 4C7RA 5HHXL 1EQWA 1BAGA 4G6ML 1YQVH 3RK3D 4QOKA 5I66A 5EC1B 4OV5B 3ZDZE 4KI5D 4GAGH 5ISZB 3FXEA 1UC6A 1CYXA 4XPBH 1VQPP 1FUNA 1XTGB 3I74A 2FHBA 4H8UA 3SOTA 3OKDB 1U6AH 2YD9A 2DQHH 3MJ9L 3UBXA 3N40P 4YFLI 4HEMA 5T3XE 1FI8C 4N1EA 4JHUA 3ALWA 1HGZA 3ZE0B 2DLFH 3HI6H 4I0PD 2IPUG 4WVRA 35C8H 1JCDA 3D6ZA 2IFNA 2PPDA 2ZKWA 3B9KA 5AOJA 4HZ1A 1M1SA 3EYOB 2JKIS 3RWCB 3NJNA 4NCC2 3LYRA 5E9DA 5AOLA 1UURA 1VGKA 2X7LB 5E7FA 4N2EA 4NOFA 2D2OA 5CJ8A 4PHZA 4XNQB 4XRCA 2WLLB 2F53D 3FNKA 2CRZA 1P69B 3HBQA 2FYYB 2YK1L 1FFQA 3S0PA 2OA9A 4EI6A 5DRZA 2MJZA 4W9DC 2BINA 2EZ0D 3VXSD 2G4GA 2GI7A 3NP3A 2OMZB 5FGCB 1GR7A 2Z8RA 1L7IH 3DGDA 5AW8B 3G5VA 3AACA 2BP0A 3P2DA 3WU1A 1OM3H 3MGAA 3P4NB 4LZKA 2CKNA 2C4XA 1EIBA 3Q9PA 5D1QA 1CDBA 1Q0XH 5IEHA 2JTYA 5IMOB 1I8KB 3M1OA 5F7DA 2ROYA 4HFUH 5EA0L 1EXGA 3S96B 3CIQA 3EO0A 1KT2A 4ODTL 3REWA 3ZMEA 4Z7WF 2YZ8A 4LC1A 3U6RA 1RZFL 4JRYA 1DVSA 5E6UB 1WYJA 3B1UA 3T6XA 1AJ7H 3MV7A 1HH0A 5ILTL 1P84K 5HPMA 3MREB 1BVZA 5I71B 2JJTA 3FAXA 3TO4B 1MPAH 1A6ZA 1RIVL 3EFDH 4OGAC 4EUPG 2DBLH 3KWWB 3IMRA 3ABVC 1A02N 3HTKA 3JSVC 1UVQB 5JHAA 3B9KD 4I9XA 4JX0A 4R26L 1E30A 3RB7A 1SQMA 5CJ5A 5I1KL 4KMLB 4JO1H 5E9DD 1F6AA 2XWBB 4OZHB 1VCBC 2ZYGA 4ZFZB 2HG5A 2VDOB 1FVDB 3IJYB 1ANUA 4MMYA 3CFCL 1TJXA 3HR5B 3EBHA 3OAZH 4YAQA 1O0VA 3ILQC 4PRBA 3B9AA 3KPRE 4OCYH 3AJ7A 4V11A 1SQVE 4JFDB 4JQVC 1WZLA 1NBQA 1MFAH 3W57A 1NTME 2Y5EA 3MGTA 1GCYA 1A4BA 2DICA 4P2AA 5JHDE 1ZLVH 1EJOH 3QJRB 3OXRA 3GM0A 4D0DA 1ZTXL 3LZFH 3F5WA 1NFIB 1E9QB 1RK0A 2Y2YA 1CFMA 4R26H 4N0UA 3MLVL 2DQGH 3HMXL 1YMMB 1A6UH 3BT2H 3UTZA 4LCYA 4XZ4A 3ABKB 5F3HB 5FIEA 3E80A 3MRMA 4KK6D 4AOFA 2W0FA 4RFOH 3ZO9A 3M7OA 5ANME 1ZHKA 5FR3A 4BEIA 3OZ9L 3GMRB 2YSSA 3N0AA 2JVUA 3L71G 3N85L 2YJLA 4NC0B 4OGYH 4P2OC 3K74B 4YSCA 1P7BA 4Y16A 1JGDA 1OWWA 3X3FL 4GW5A 2ILLA 1ZPLA 4FE9A 5KVEE 3VDBA 3MBXH 1W72L 4Z78A 5JPNB 4UF7C 4WEEA 4Z3EA 1K4DA 4K3JH 3N6YA 5FYJU 2E56A 3H1ZA 5HDOA 4PJDA 1MQKL 3HMXH 2RTTA 4R97B 1M53A 4F8NA 2YMOA 5TISE 1K2DA 5BCAA 4QHKI 5DJ6B 1FL6A 3BD5A 1XL4A 3CMOH 4G8GB 1HHHA 2N01B 4X99A 1M57D 5K39B 4P4KC 3M86A 4HC1H 3VQ2C 3UIYA 3PY9A 3TTSA 2UZIL 3L7EA 5BVPH 1QEWB 2GTZA 3N85H 2Y3AA 1IGJA 12E8H 4TRPL 2XKNA 4LOUC 4WFHD 3I6LD 4YH6A 5F7WC 1NGXA 4QRUB 5KAIE 3SPVA 4XTRD 3BWAA 1T20B 5F9AC 2WV3A 3TA4D 1A5FH 3RL1A 3FQTA 2ZYRA 3RWJB 1LO2L 3UAJD 3HZYA 1IMHC 3ROLA 1M1XB 1YBKA 2ICEB 3IDMB 4MS8D 2H9GB 3H1IG 5IJCC 2ITCB 2YWZA 4UAHA 1E5ZA 3NCXA 4W93A 2EACA 5LCVH 3RUGA 1ECYA 4UOJA 3EDFA 3A24A 5KLIB 1M1KQ 1MVUB 2DM2A 3QAQA 4GMTH 4HD9A 1MI5B 4OZGB 5IQNA 4D9RE 1KB9E 5CHXA 4XVUC 1R3IH 2E46A 3C5JB 5APTA 1KTLB 1LILA 4KVCH 5AB1A 4AITA 4KXZH 1IZJA 3C60A 2JJUA 3J7HA 4MFHA 3AUVA 3GJFA 2PW1A 1ZJAA 4PRID 4Y1AD 3ZL4L 2J8UF 4PJIB 3TYGH 2JMRA 1T6AA 4MB1A 1XCWA 2E59A 3F04A 3DX7B 2WXMA 2XVGA 4J1UA 3TGXA 3L71D 3C6LA 1NTZJ 2KS1B 2EEBA 3BN9C 3QDMD 4IL6E 3GSVA 4RMRA 3HN5A 5JDSA 3HHRB 4N8CL 4HUWB 1HGVA 2MFNA 4YDKL 4WI3A 5BOZG 2VJXA 2YWYA 1Q9OA 4HQQL 1TNNA 4H1LB 1PNCA 2H3KA 4KBPA 4W6YB 1QI5A 3RKPA 4JG0L 4BGDA 3QI9D 4U3SA 1MH5A 3N06B 1X5LA 1CDIA 4N0FA 4AC2A 4OZIE 3EJYC 2H3NB 3L9BA 1Q1JH 3NGBB 1QZ1A 1P84I 1KV4A 1VA9A 3TK1A 1DBKL 3MXWL 5FYKL 5HDBB 5DMGC 2EDJA 3L72E 1HI6B 2X9WA 4DP8X 1TTGA 4R5TA 4H8VA 4FC3E 4Y5VB 1X9VA 1R75A 3SDDA 4IRJB 5IG7B 1ADQA 3PXHA 1P4BL 4K5NA 3BDBA 4YBLB 1NCTA 4UINL 5EZOH 4QO1A 4K3EL 4YBQC 3BAKA 5D2LE 1EWHA 3BH8A 2K0RA 3L3HA 2JH2A 1AP2A 1SBBA 4FP8L 4R97C 2DMKA 1FOSE 5E8DL 5D5MF 1BQ5A 3O8XD 4HXBL 3G71P 5J1SC 4YE0A 1EHNA 1Q9WB 15C8H 3VRIA 1NKGA 2QTVA 3HAEB 5IBLC 3H1ID 4NO2B 4W9JC 4ONHA 2VR9A 2AV1A 4HIPA 1U8OA 3RVUD 3D51A 4X4ZA 5FKPB 4ZPTB 5TDOA 1DBKH 2K3RA 2F1BA 3DVFA 4U33A 2K6ZA 3SCMD 3VFPB 4DKEH 2DWSA 5DJ2A 5LAXB 4PV8B 4MS6A 4JJ5A 4DEPC 1YJDC 3JTSA 4HLEA 1CDJA 1FIGH 3G5ZA 4U3HA 5BV7B 4EIJA 1S7SB 1XGPA 5AKVA 5LBVA 3BVDB 1YMHB 3HE6A 1I1RA 4DGWC 4D8OA 4IM8A 2WBWB 3FH8A 2R2HA 1KJVB 1BFTA 2RH0A 4P2RA 3L9RB 3FKUS 3IAGC 4HZLB 2PXYD 1K8DA 4PJCE 1FA4A 4KDTC 4QRPE 4OCLC 4ZYKB 5KBLA 1FZGA 3QUXD 3GLDA 3UBFA 4PJAB 1ITBB 3P9MB 5D72H 5D7IF 4UDUA 4UOW0 2HLAB 2CJSA 5SWSA 1RHHA 4IDLA 1NCCL 4FLRA 1DQKA 2PO6C 1ROCA 3TEXA 4KHXH 1OEZW 1UD2A 2AEIT 3II6A 4M7JH 4KUCD 1XR8B 4B7LA 1HWHB 2WSEJ 3G7TA 5EPMA 5H2FE 1T0MB 4LSPL 3HLAA 4HX1A 2BVPB 3KGSA 3TNNB 1XTCC 1YECL 3WU2H 1DUYB 4H8HA 4RWHA 3LIEA 4RMBA 1HEJC 2IAAC 2DQFB 1A4JA 4AQZA 3ULUH 3O3DA 4G2AA 5B7MA 3QNZA 3SE4C 1OZHA 4KX9A 2YOCA 1T80A 2NXZC 3BI9X 4JAMB 4E9XA 1FLTX 1QLEB 5EEXA 4G82A 3CFDA 3B2VH 4G1MB 3NGBC 2H32A 3H6JA 4XO5A 1RZ8A 4ONOA 1LTXA 3UPAA 4HAFA 3FOLA 3NA9L 1EZVG 2YUZA 1HE7A 1X7QA 4M6ML 4N2IA 5LUMA 3JVFC 1Z9NA 4Y5VC 1YQ4C 1MSPA 4NBXB 2CKBL 3MJ6A 4Y9FA 2EIDA 3ARPA 4YXHL 2BZCA 2O6PA 3VG0L 3WLBA 4HBCH 2WBJB 2EYSA 3AABA 2DTSA 5F0JB 4QJ4B 4P2QE 2EDHA 3EBIA 3HE6D 3K72B 2AC0A 4P23A 3NAAH 2XWRA 2Z9TA 3H32A 5HDWA 1MFMA 1CS6A 1P84E 1LMIA 1LO3H 2BY3A 3JCUH 3RG1C 2PUQT 1L2PA 3W11D 3WOVA 4POUB 2OCFD 3EGDA 3KWVA 2HTLD 2CGRH 3O3AB 4WWIA 2H47C 1NH6A 4PJ7A 4KRLB 4Y2OA 1OW0A 4H20H 4HCIA 4OT1L 5DWUL 2E5YA 1J5DA 2VJ8A 4LKCA 4RFEA 5D4JA 5IUSA 2RKLA 5DRNB 3RQ3A 4GRWF 1QBAA 1N2RB 5J1TC 1FL5A 1I7UA 5J6HB 4WSKA 1J8HE 3DMMC 2ODIA 4UZGA 2ICES 2F2HA 1NFAA 3V0VB 5KYUB 2WQAA 2W5PA 2YMTA 4OIIH 2QRXA 2ZUQC 2JSFA 3QDJB 5DEGA 2CLVA 4M29A 4F8TA 2G8YA 1JTOA 1NCWL 4HHAB 4QNPF 4RGOL 1SLXA 4KC3B 3GRGA 2VZ3A 4FN0A 4BZ1H 3THML 3RPIA 4P4RA 4JK0D 3P0GB 2HKFL 1IM3B 1ZT1A 2O61A 2DH3A 1QOKA 2ICWJ 3EIFA 5AOMA 1B88A 3OA7A 1JK9B 2WWMC 2K88A 1N7MH 3PQYE 3MACH 4GBXB 4RGND 4Z7QE 3FTGB 1HIMH 1PLCA 3DUSB 3S4SB 4B0MB 3V9EA 3H1LE 4W9GC 5JNYA 3GIVA 1S9WA 4NJ9H 3KWTA 4M7ZC 3HI1B 3L3IA 5DFVC 3WGUB 1C16B 1O9ZA 5LBSH 1T1ZA 2NMSA 1BZ9A 3SWYA 1KTJA 2H8PA 3BMWA 4HWEH 4JM4L 4XVSL 5JOEA 2DYPA 4JANB 3VXRE 2AEFA 2OL3A 2X9ZA 2OTLP 1EZVD 3CC4P 3KPOB 3QH9A 3FQUB 4JFPB 3WIHH 5FUZL 4G80A 4N6RA 4FQXA 4MA1B 2H6PB 3A23A 2HKFH 5HGAA 3QRBA 4GT0A 3V6ZA 1UG9A 2MOVA 1A2YB 2VTFA 3CH8A 4I9WE 1HCVA 2AXGB 2NW3B 1GJIA 3QPXH 5ESVA 3WFDL 4C57C 4WWID 4M7KL 5GRJH 2ZYIA 2EUXA 2FKWB 2MTAA 2NY1C 1OCWH 1ZVSA 1XR9B 3WNIA 4I0PB 5E95B 5KYYA 2KPNA 2HFEB 2ZCHL 3Q0HA 1FZFA 3VI3B 2AEPL 2L7JA 3FQNA 4M6OL 4QHPA 3U0PA 1J9SA 3CDFA 1PL5A 4UQ3A 2KDYA 3ZL1A 3ZDXF 2A2QT 2QSCL 2WBJC 3I9IA 1FSKB 2Y0CA 4XI5C 2C1PA 3AREC 4TOYL 1AG6A 2H2SD 4PRPD 1WUZA 4U1LA 3NK4A 1F3DH 4YDNA 1CVSC 1VFMA 3CD6P 2MTPA 2XY1A 1WWBX 2QR0A 3HNSH 1HQRA 1SXBA 3PS6A 3L71J 3ZR5A 5BU8B 1T5KA 1OFCX 4QY8A 4J4PA 1AE6H 2ZFCA 3HZKB 2FB4L 4GI6A 3S35H 5AD0A 5E00A 5C0DA 3LIDA 1XB3A 1KJ2L 2ED8A 3MRGB 5CLWA 2FO4B 2R83A 1WCBA 3VXSB 4A7SA 4HAKA 4LCCB 5C0FA 2IDFA 3LNIA 4NQXB 2CK0L 1QFWI 3C8HA 2A9NL 5LGKA 3MJ8A 3LKNA 2IAMC 4MASA 4QT5B 3U30C 2H8PD 2Y9YA 1MRDL 1TEGA 2WUBH 2E7LA 1AXIB 5FYJE 1MKFA 1URIA 2FECI 4W68A 1MFCL 2EVHA 1PZ2A 4NO0D 4QOKB 3CZLA 4DP7X 3V8OA 1J1XH 5J12B 3L70E 4HALA 4A7UA 3MNDA 4QRSA 3WLWD 2FCBA 3MC0A 1T5XA 3JT2A 25C8L 3I02A 1NTKK 3UBXB 2C26A 2HR3A 4XFJA 4AYMC 4GBXC 3IF1A 4XMZA 4XPFL 3T3ME 3T0EA 1WIPA 1XIWD 2FT8A 5AAMA 1WA1X 2ZT9B 3ILPA 1OTSD 1QG3A 2DWTA 1A3RH 3DHPA 2JCCF 4NWTL 3B9KB 4HU2A 3ZE0F 4BQ9A 2XZQL 3L2NA 4XOCA 3RTQA 3NA4A 4QHNA 3EJZC 5E9DB 3GBNL 2R29H 3K0YA 5AW9B 2ZJSL 1IGFL 1WTLA 3ATEA 4KROD 1OW8A 1VGKB 3VM7A 4YEFA 4E41A 2XX1A 1TT6A 4MA1C 4AUYA 4XRCB 4YHPA 1Z32X 1X44A 3QIBA 4KKBC 4UIKH 1DBMH 1JRHI 3K6FA 4J4PD 5DVOA 3BDYH 3OAUH 2ZYHA 5GGQL 3EDJA 4EI6B 5DRZB 3GFUA 4DO4A 1RUKL 3O6LH 4Z7UA 4JM2A 4XE0A 2ADIA 2B5IC 4GUPA 2YEZA 3SPCA 2UXGA 3G5VB 5SV3A 4TS6A 1M9WA 5L2KA 3VGEA 1DQVA 3LB6C 1S46A 4HJJH 5D1QB 3DPBA 5IEHB 2HWZH 2CDGA 1T89C 5D70L 3TWCL 5E8PA 4XMKL 3QZPA 4WSJA 4NRYA 2KIKA 1KV7A 5F7DB 2O01H 3EO0B 1KT2B 5AEAA 3REWB 3X13A 1Z9MA 3IETA 4PJBE 1NAMB 5CGYC 3U6RB 4LCIH 3DOHA 4KI1A 4LLYA 4YDLB 4YHKL 2W60A 3MV7B 4KNSA 5T3XD 1ZGLM 4K7FB 3T4YA 5HPMB 3PNWA 3BLBA 3LIZL 1HXYA 3QYMA 4AE0A 5KS9F 3PU7A 1A6ZB 4NUGH 4BA0A 5F70A 1B4JL 4F37K 4YXWH 2JKJA 5D6DC 3HTKB 1NKRA 2NR6A 3M45A 3ARFD 3ZK0A 5C71A 1PJ9A 4EUPB 1LEKA 1CIDA 3B5HA 3RTQD 1YCSA 2APFA 2V17L 4MMZC 4NIKB 4Y4FD 3IMVA 1ID5I 1M57B 4ZFOB 1L3WA 4Y19A 4CVUA 2CUHA 1SQVG 5ECGA 4AVKA 1HX0A 2HG5B 3K8KA 4E41D 4LVEA 4F9LA 3QIBD 5KVFH 1O5DT 4N5EC 4JKPH 3MP7B 4ZKPA 1E50A 3GZQA 4YAQB 2VC2H 4XBMA 4JEGB 3QJFA 4PRBB 4RMQA 2D3JA 4OJDH 4FEMA 4N6QA 2XG4B 1QPKA 1U33A 5KSBF 3ARBA 4AL8L 3MGTB 2ZT9C 4NNYA 1B4JH 2EDXA 2G5BA 2CE6A 3LZRA 3IKKA 3OXRB 4JM2D 4TL5A 4V33A 3CN1A 1OP5K 3F5WB 4D0DB 1F90H 2YMXH 1GJWA 3BVWA 4L3EE 4N0UB 3MV8E 3VXUA 1DBJH 3WKQA 2V4LA 5FYLL 4AGPA 3ETTA 5CLZA 5L2KD 2OTKE 4J3XA 1KIQA 2BIIA 3VACA 2JCWA 4HOWA 3KPQA 1PDKA 3IFLH 2J6EH 3T3PF 5GRUH 3MRMB 4LP8A 1GOGA 2VR5A 1KBWA 2W0FB 3S6CA 2ZP9A 4OLVL 4Z7VE 5D7LE 3O8ZA 1T03H 2H1LM 1MFDL 1E4XI 1ZHKB 3O2DA 4PRIB 2CJ3A 1DLFL 5F93C 1MW2A 1OQOA 4ZXBC 1NEZG 3ABGA 4JPZB 1JIBA 1BSHA 1TOXA 3HS0C 3KBFA 1JGDB 3NCYP 3QZNA 2BCKA 4Y16B 2HFTA 5DURD 3SE9H 2VDQL 3IR9A 4BWWA 4GW5B 1GTFA 2NZ9C 1ZT7A 4Z78B 1CLVA 5DRWA 1S7TA 1K4DB 2YC1A 1S4XA 4FFVC 4PJ8C 4PJDB 1BQLH 3T0AA 1D5MA 1WK0A 2NR6D 5BQ7A 4ZT1A 1BMZA 1ODAA 3ZTCC 4F7KA 5HHMD 5E2UL 5D1QC 2APTA 4NKQB 2BSDA 4LQFH 3VA6A 5BUGA 1FL6B 3P0VL 1HHHB 3QI9B 2QDWA 4X99B 1AXTH 2O5NA 3HFFA 1UWEH 3ARVA 2JKNA 2O5ZH 3QRLA 3TEUA 5DZJA 3VD3A 4PLKC 3HMWH 1NCBH 4Z7OB 1WBZB 1CE1L 3ARGC 3FO0L 3GTVA 1YJNP 3L7EB 4JFSA 2GTZB 3BVHA 1OGPA 2XKNB 4ZMAT 3AS0A 4ZW5A 1NGXB 1TVDA 1SQVD 3SPVB 4UT9A 1NU1K 2K70A 3BWAB 2C3GA 2FX8L 1R5VA 2JJTC 4PI0A 5JHDD 5GRWA 3FQTB 3ARBD 3MHZA 2HYMA 3QORC 3HZYB 2OMVA 3ROLB 1MDTA 2TSAA 3KPSE 5F7HA 3TBWA 1IFNA 1R5SA 3SKJH 5JW5A 3O8XB 3RUGB 3SY6A 2R4RL 5DT1L 3X3GH 1N59A 4E0RA 3NCJL 5BPPA 1F41A 2VL4A 2XPGA 3LIUA 1WAAF 4FFZL 1SQXG 4AYID 3C60B 2DTML 1S5HA 1AO7E 3L3DA 4OZGF 2Q8AH 3GJFB 4APXA 5FA3A 1TIUA 2G0LA 2FO8A 3FFCA 4QXTA 5T3ZL 3O6FA 1HKLL 2V7HB 4D6TE 3DRTA 2SODB 3C6LB 4WUUE 3MMEB 4LPWA 3GSVB 3V4PA 5JDSB 1NOAA 2ROXA 3EJJX 1JY3P 5HHPA 3ZJAA 1SOSA 3EWKA 1WP6A 3H2WA 1TNMA 1Q9OB 4L5FL 3SQOH 1GGIL 3TEWA 1ETB1 3LNGA 2DM4A 4CMMA 3KDPB 3CCRP 1GOHA 4NUQA 2VN7A 2G3MA 3C09B 4U3SB 2WZ5A 4LPXA 1MH5B 4ISVA 2HJFA 4P0DA 3TV8A 4N0FB 2VDPB 5FV1L 2Z4QA 1THCA 3I9AA 4PJGE 5F7NC 2XVKA 1E42A 1TLKA 2RCSL 3I50L 2CO3A 5AOIA 3P77A 4Y16C 4HCFA 2DQUL 3DSNA 2CG9X 3NIGE 3SDDB 1GW3A 2XQ0A 2P5EA 3HUJE 2ZX7A 4FL4B 3WL9A 3OAZK 4QO1B 2NCMA 1PEWA 1WLHA 3BH8B 1SUHA 1MCBA 4WWKA 4WAFA 5E2VL 2H4EA 1SYVA 2IGTA 3L3HB 4QKTA 5E2JA 1INDH 4L5FH 4WF7A 1JPST 1Y1DA 2H26A 1JD9A 2X1QA 1UXSA 5DD0L 1ZLVK 5E8NB 3GEFA 4Y4KD 4WHTA 1X9UA 3SDCC 4K2UH 3F6LA 3VRIB 2JP3A 4D9RD 1KB9D 5JXEA 4P2CG 1A66A 4OGQD 1KXVC 4ONHB 4DGYH 2AV1B 4ZS6D 1U8OB 4F33A 3IMWA 1A8JH 1E5UI 5TDOB 3RIFK 4XMXA 1YC7A 3MA9L 4MXQD 3P30L 1G6VK 5DJ2B 1SQXD 4JN2A 4JJ5B 5MEOA 3JTSB 1QEXA 2W83C 2ATKA 2DLGA 3G5ZB 3M88A 4MCZA 3O6FD 2Q76A 3D7PA 1IO4C 4YSRA 4AEHH 4KZDL 3HE6B 1GMJA 3FJTA 4MNHA 4XMWA 1T4KA 3KM2A 3EH1A 1EFQA 1RULH 2R2HB 2UX7A 3N43B 1NAFA 1NTKE 4P2RB 4CVXA 3WMPA 2K37A 2QJYC 4P57A 1HNGA 3UTTE 1JDCA 1K8DB 4K4KA 4ALAL 5CP7A 1BE3G 1A3LL 1B0IA 1DIPA 4HUUB 2D4DA 1G9NL 4Q58C 4KO9A 5T5FA 3T0DA 1C7TA 2X4SB 4UDUB 4JQ0D 4C47A 4CDHA 1JXKA 5SWSB 5JOPE 4M5ZL 1RHHB 1S7QA 1TZHA 4QYOA 5I1AB 2KNCA 3EYQC 2LE9A 1GGTA 1QNIA 3H7BA 4X80H 4YDZA 43C9A 2AEJA 3AE1C 1M2VB 2HP4A 5DFAA 5IHUH 5DHYA 2P5ED 4WI5A 3C6LC 3TF5A 1BGYE 5EPMB 3HLAB 2J1WA 4HX1B 2GM4A 5CJOL 3TFKC 3HG0A 4E5XG 2GIMA 5B5EH 1F3JA 4XX5A 1N26A 2N7AA 4EI5D 3O3DB 4D9LH 3VWKC 3W56A 1L0YA 3EOTL 3TH4T 1LP9A 3JWOC 1RZJH 4NM4H 2YMYA 4ZTOL 4EIZC 2YD5A 3CFDB 5C6PB 2R3CA 1MY5A 5L0QB 2H32B 1RZ8B 1FV1B 5C3LD 4K55A 3FUDA 2EDKA 1PGOA 1QP1A 1G94A 3FOLB 3QCTH 4KKAD 1KACB 1X7QB 3TU6A 4YE4H 3DBXA 4AJYV 3ATFA 2OTWA 2YRLA 1YTZT 1RPUA 3SDDC 2W9LA 3A22A 3WLBB 1L7TL 4RMVA 1J1DC 2L7UA 4OCWL 1OAUH 2EYSB 4FL4C 3PWLA 4IYKA 4B9PA 4WCYL 3GIZH 4U6TA 5HI5C 3H32B 2FECL 2YD4A 3MJWA 3ILDA 1Y6KR 2J58A 1IK9A 3L6FB 1BDCA 4QRPD 3EGDB 4GG6F 2X9XA 3RU8L 2QJPB 5I1IH 1REIA 2HVBA 2YR3A 5EF0A 1M1JA 1XQ4A 3IU4L 1JEKA 1Q0YL 4GDOA 2WLJA 4HS6B 1YQ3C 3FONA 4JJHA 4Y2OB 2C4FU 1IFHL 1RUPH 5IBUG 4LKCB 4RFEB 1BFVH 4YX2L 4Y8DC 1E40A 4LPCA 2YA0A 4XNDA 1BE3D 3IMSA 1FL5B 1MF2H 4OGXH 6CGTA 3STLA 3A2AA 3KGRA 4NXKA 4JO2H 5AYTA 4JYCA 4RNRA 3L8QA 4HIQA 3GMMB 5DEGB 2CLVB 3TBVB 5CCGA 3S3BB 4UUJA 2XZCL 1DDTA 2WP3T 3VGAC 5KYXA 2FGWH 3RPIB 4KVPA 4WEBH 1U2CA 3JTTB 3LKSB 4P4RB 4GSRA 5EZLB 2AQ1A 1ZT1B 2O61B 1JPTL 1UFGA 4BFEA 2CBTA 4P5SA 2Q7YB 1D9KA 1DN0B 1OIPA 4B5ZA 3OV6A 1LTJA 5I76A 1SM3L 4XWOC 5JNYB 1PCSA 1S9WB 3GIVB 2G5UA 2I7SA 4QXUL 3TIDA 2FSEA 4CADA 3L3IB 1NANH 5JIQA 3CVHH 3K3QA 4PJ5A 1OL0A 1T1ZB 1YY9C 4G7YL 1WWCA 2E74C 3V0AC 2H8PB 2E7BA 1R33A 2DYPB 4AYDC 3ELQA 2OL3B 4P2QD 1SQVJ 3PTZA 1QVFO 1VFUA 2P3YA 4NO0B 2VMDA 3P4OA 4AJ0A 1NTMJ 2KZWA 2R27A 1N0XH 1Q7YQ 4N6RB 4FQXB 4G42B 2F0CA 2WVSA 3T0BA 4PG9A 4BZ2A 2GTQA 2XXGA 3MOQA 4ZSOB 5HGAB 1JPTH 3QWRA 1ZA3A 3V6ZB 2RR3A 1PVHA 1PZSA 1RU9L 3EJCA 2RACA 2X1PA 4A7GA 5ESVB 2KHAA 1JCKA 1TQCC 1Z0NA 3CHQA 4JN1H 1XIWB 3BZFA 3DOSA 3SKNB 5KBKA 2BY2A 1ZVSB 5CEZH 4PB9H 3NABL 3O3BA 6FABL 1MLCA 3WE1A 5BRPA 2BW4A 3CLFH 4UQ3B 3CMAP 2MCAA 3VI3F 2AQNA 3QUKB 5ALBL 2C1PB 3IDXL 4KO7A 2CPCA 3PL6A 2LKMA 4P23C 4R5XA 5GJSH 5EH1A 5FEBA 2QR0B 1HQRB 1DZBA 3CLWA 2A0LD 1NU1E 4QY8B 1R8EA 1FVCA 4MTMA 3L74G 1FGVH 5AD0B 2QJPC 5C0DB 2EYTA 4HJ0C 4NN6B 3PQYD 2C9NY 1OW0C 3Q2YA 1AKJD 2Z7WA 5H37H 3H1LD 1L9MA 1WCBB 5ADOH 1KCBA 1GGCH 3NABH 3P69A 5C0FB 4YPGA 4HULB 4IIZA 1IX2A 2LT9A 2YN3A 5CN1A 3MJ8B 3LKNB 3RIAK 1EC5A 3TCTA 4ZNEE 4YJZL 1NBYA 3S88L 3POCA 1L0QA 5H4YA 1X5FA 1NSNH 1XCQA 4PS7A 1EPFA 3V4VA 3GWJA 3S1KA 1QD0A 2ZONA 1NCDH 2OAAA 2BHUA 3LDBB 3G9VA 1V5JA 4NQCE 3GXNA 4QRSB 3SYOA 2W8ZA 4Q7DA 3IM1A 2P52A 1T5XB 3QWRD 4Q74A 1A8ZA 2GJRA 3BQUC 4I9WD 5CD5D 1NC4A 2Q3AA 1C08A 1CXKA 1CC3A 3I02B 1E4XL 3QJZA 4XT1C 5GS0C 4F2FA 5JIPA 4F1ZA 1EXHA 3IF1B 4HH8A 2JI3A 3T0EB 5K9QG 4FLHA 3W9EA 5ICYA 4L8BA 3ILPB 1KB9J 2ED9A 1JY3O 3UAAA 4ADGA 4F15B 2L3BA 1L3NA 5CSGA 1RZGA 3HC4H 4KXZI 5KW9L 4PCKA 1IC1A 3S88H 4W4NA 1AMXA 3RTQB 1AJYA 4QHNB 3A0HH 2PW2B 5IK3A 4EQ2A 1C1EH 4QHLB 3RVXC 2NY6D 4Q8BA 3MCKB 1IFGA 2DOCA 5DTFA 5M7QA 3PL6D 3AMLA 3L4TA 3MAWA 4E41B 1K04A 4X6EA 4YL9A 1F13A 4YHPB 3GSNA 4D2NA 3QIBB 3U9UA 4OFVA 1V3MA 3KR3L 4RX4A 3SPHA 4A7PA 2F5BH 3ZGHA 1JGEA 4LAQH 1E4WL 2YAHA 2WVTA 1G6RL 4EIUA 5CJQL 4H8QA 4QRTA 4ZQTA 1MREH 1SJVA 3LVTA 1NQBA 1FLRH 4NX0A 5IFAL 3IBEA 1GGBL 2VW6A 3L74D 3D85A 4JM2B 4WW2A 4Z7UB 3DSFH 1USQA 2ADIB 5IQMA 2IZ1A 2Y24A 4GUPB 2YEZB 3RVVC 4WY7H 3E1IA 2VABA 1W2EA 3Q6GH 3L72J 2R0LH 5L2KB 2V5YA 3VTPC 5JPMA 5EWIH 1OK0A 3DIDA 2WPQA 3DPBB 3QXAA 4FJZA 2NYZA 2CDGB 1UH2A 4L8SA 2MPAH 5E8PB 3L70D 3ASWA 4OZ4A 1N70A 4NRYB 4ZS7H 3X13B 4NQTA 2FXOA 3IETB 3E1RA 5E4OA 4PRAA 2FXPA 1WGOA 1VFBA 4TTGA 2VUYA 3QG6A 2X4PA 4LLYB 4BRJA 5E1AA 2W60B 3K6DA 2JWDA 3QCVH 4PSRA 1EZVY 5DURB 1JYNA 1GRWA 1NWQA 2FAUA 3PNWB 3JYCA 3K1DA 3WJLA 4WJ5B 1UYWL 2YAOA 8PAZA 3LZPA 2FSDA 4HKJA 3PP5A 5I1LB 3O0LA 1YAIA 2OMTB 4X5XA 3ARXA 1FGNH 3APFA 4MAYD 4UTAA 5FM8A 2H0FA 2QKIC 3RFZA 3CXDL 4L1HA 1UQSA 5HHMB 1AR1D 1S9KE 1LVEA 1N19A 1RPKA 4QHKJ 3PHQA 3BPCA 4UZSA 3V4UH 4CU7A 2QVAA 4UMSA 5DD5L 3Q6FA 4KRMB 4NEHB 3PG2A 3KBEA 5KLVK 2GJ6E 3FU3A 1S9YB 5C07E 2R2CA 5C0BA 5CP3H 4RX4D 4LFHG 4Z0BH 2YBGA 4KQ3L 2IFFL 5DS1A 2OYPA 1XF3A 3F3HA 3QJFB 7FABL 4O2CA 4OM1H 1INEL 4GIFA 2PYFA 3B8YA 3T0EC 5JHDB 1U8QA 3ARBB 2HRHA 4QD2E 1I8MB 1EX0A 1MCCA 3BUPA 3P9LA 3U2IA 3AXIA 3BH9A 3MRLA 3U9PL 1EHLH 3WYRA 2G5BB 4KQ4H 3DJZA 5IBTL 1NBCA 1MFBH 2FEEI 2P8PA 1KC8Q 2VDNH 1GKOA 1FIEA 4HPHA 1ZIBA 3IK2A 4L9LA 1YUHA 3GHGB 1KIQB 1PDKB 1ZMEC 1PG7L 1S78C 3LMJL 3EXLA 3CVIH 4ODSH 2IBZX 2ARJA 2AXFA 4XVTH 2QE7H 3CDZA 1LTIC 3WBDA 1NUGA 3DC0A 4OCMC 2FD6L 7FABH 1FFOA 4FQ2L 1A4AA 2OS7A 4O9HH 5I0ZA 1QSZA 2BCKB 1UB6A 3RZCD 3FN0L 5DRWB 1B3JA 1S7TB 2E9GA 1N5AA 3TVMD 3HPLA 1VEPA 1G7JA 2YC1B 1PKOA 1GY2A 1BBJA 3KJ6H 1D5MB 4UAOB 2VT0A 5EBLA 2JJSC 3KPNA 5M94B 5BQ7B 1LE5A 4P06A 5AZ2H 3OMAB 1R46A 3C5SB 3NCCB 3PHAA 4PJDF 3W0WA 3KLHD 4WY4D 2ZG1A 2B08A 1BFOB 3UYPA 3GSUB 1UWFA 2HJKA 3BYYA 5H2BA 4WO4C 5FLUA 4CSSA 5AWNH 5IOKA 1U8JB 2OV0A 3X1EA 3Q06A 2FD6H 2PWGA 1JY2P 4KXBA 1Y47A 2E42A 4FQ2H 4AZ8A 4XOBA 1LYQA 1YPZE 1P84J 3NJXA 4IS6A 4Z7OF 2G4EA 4QRQA 3K81A 1NLDH 4HIIA 1R5VB 3T1FA 4FFWC 5D2NC 3I75A 5C0JA 4LFHD 4FNQA 1L5GA 1VQ8P 1UD4A 2CQVA 2PP8A 1CL7H 3GPSA 2AEWA 2NY3D 1RJCA 3MV8D 1DVFA 5DEZA 3TBWB 3U0WH 3OB0H 1A9EB 1R0AH 1P7QA 5JW5B 2EC9U 4Y4KB 3PHOA 1NAKH 1N59B 1NBVL 3ZQXA 4E0RB 4PJ6A 2XPGB 1TCRA 4FQIH 3RUGF 5APQA 1J87A 1KULA 4BSWA 4ZMLA 4F9LC 4FZEH 4RIRA 1PTZA 3UTPE 2ZKXA 3AG4B 1R3HA 2AJUH 4D6TG 1ZR4A 1S5HB 3L3DB 4APXB 4RESB 3BVXA 1RK7A 1JCVA 3GMLB 5DHEA 5FA3B 4M4PA 5CJXA 2VO5A 1HH9A 1AQMA 4QXTB 1WBYA 2OMUA 2VN5A 3O6FB 4YFEA 4J28A 1ZSHA 5CCHE 3MZWB 3DRTB 4LU5L 3JWNC 5E0FA 5K1VA 4OF0A 5I5JA 1A0QL 2IV9A 5CEXA 4FG4A 3H1LJ 1JNNL 3V4PB 4XPHL 5TGBA 2AK4E 5HHPB 3ZGIA 1KN2L 5LXGH 1G7IA 4L4VE 1N73C 2BLFA 4CMMB 3FRUA 2R51A 3KPTA 5I82A 3W0WD 1FP5A 3SWFA 2X4UA 4AMXA 4DW2H 1HYRC 1S6NA 2FYZA 4ISVB 1MCPH 1NMBL 1PZBA 4JFOA 4AT6A 5MENE 5K33A 5IFHL 2Z4QB 2QG4A 3EYUL 3KYKL 2H88C 2VXSH 4FXTA 4G6KL 4R2GB 3V5DA 1JZ7A 4NB7A 3OAWA 5AZEL 1KCKA 3BPNC 3P77B 5KSUB 3DYOA 3LS4H 3PHSA 4PW9A 1TPXC 3DSNB 5B38A 3PFUA 2XZRA 4EOWH 4TSAL 2P5EB 3NFPA 2VDOH 3WL9B 4BCYA 2ORBL 4N9OB 4WWKB 4DKTA 1PV3A 1SYVB 3BD4A 3I84A 1DVFD 4DP9X 2H26B 3WU2E 1NPUA 2I27N 3RKDD 1UXSB 4IRZH 4EI5B 2HVJA 4WHTB 5ADOL 1OANA 4X7SL 2M5AA 3UL4A 2CJUL 3VI4F 1VCAA 1JL8A 2BIQA 4H0LB 4ODBD 4WK0B 3ULUE 2UZPA 3RE0A 3HEIB 4W9KC 1GVIA 4F33B 3FX0A 1SVFA 2XOTA 1KLUA 1IEBA 1KCRL 1CI3M 2RJMA 3MV11 5AZEH 1Q72H 2PPAA 3ARZA 1BLNA 1IQWL 2K6YA 2ZF9A 3VXMA 3MRJA 1G1OA 4JN2B 4P9HH 5MEOB 3KL0A 2ATKB 2Q76B 4D6TD 4DFIA 3KCWA 1VQ4P 3AVEA 1KZYA 1JHLH 4DGVL 1T4KB 2IXQA 1KGIA 4HJTA 4M1CC 1H8LA 1X4XA 3K6OA 5ITBH 2FFDA 1H8AA 4P57B 4QRPB 1IVTA 1V55B 1U3HA 3N43F 1H3UA 1V3LA 2X44D 1HILB 1H0TB 2RFXA 3JCUE 2ZSVA 5CP7B 1J1PH 3HG5A 2HN7A 5IW1A 4HSAC 5I5MA 3MA7A 2GSGA 4DK6A 1TTRA 3OLGA 2VLJE 2YHGA 3PE9A 3L70J 1S7QB 4EBQL 4QYOB 4X6CA 1H3PL 2KNCB 1B90A 4JG5A 5C09A 4JS7A 1NLBL 1SVBA 2DYRB 1I3GH 1ZE3H 4ODUA 43C9B 1NC2A 1SVCP 2AI0H 3MUUA 3NXSA 4HKZA 1W5CE 5DHYB 3SE8L 1BG9A 4RGMB 3U1QA 1SUJA 4HMCA 2V5MA 4HOMA 1TTAA 2NDGA 2XWTA 3C08H 1WV7T 5HY9A 4DO5A 1F3JB 3LNFA 4N2LA 1YJDH 5ENWA 3RWIA 5DI8A 1N7SA 4JRWA 2OYLA 5D6CA 4YXLL 4UM9D 1OTUD 2Y72A 4E5XB 3EOYG 3ME0B 3N9GL 4MJIA 2IOOA 4ODXA 4PJEA 4TQEH 4O02A 1BLIA 3SDYL 2CPBA 3ERXA 2GK2A 1X5JA 4KV5E 5IB2B 4P5MA 1PD6A 2Y6SC 3DBXB 1AC6A 3VXMD 3U79A 3MCYA 2DQEL 2M26A 2YKLL 2BSCA 5L8KB 4NHCL 1E90A 4JR9L 3WIIL 2VERN 3BVTA 1YDPB 3QXTA 3VSQA 1D6EA 2H6UA 4N22A 1TG8A 2X05A 1CD9B 2J4WL 1NGPH 2BOBA 3UTTD 4B9GA 5LQBL 4DF9A 5MEQA 4OIFA 2YGQA 4YXLH 1AOZA 2YXVA 3DV6A 1SDDA 4WLCA 4JFFA 4XHJD 4OQTL 1U3HD 4PR5B 3VWJA 5KSVA 4H0LC 1M1JB 3MLRL 1HE8A 1NMCC 3SDYH 5JOPD 3AC0A 3PWPA 4RMWA 1LMKA 4JE4B 4PJ7F 1OF2A 1ONQA 5DO8A 3I6SA 5EOQL 1EEZB 5SX4H 4OCXL 3STLB 1UKSA 1CFVL 3BD3A 5IBUB 4RNRB 5KLVE 1UA3A 4ODVL 1G7QA 1WJ3A 1NKNA 4UUJB 5LNGA 1SVZA 2YUVA 4N87A 5KYXB 3K1KC 1LWRA 1JMBA 4HIHA 3I6KA 1S7VA 1SJXA 3I3BA 1TQTA 5JW4M 1EVTC 1T2QH 1IQDA 4PBDA 1AGCA 2YD7A 1VGEH 4XO8A 2FYNC 1KGWA 1N86A 4N78E 3FSOA 2Z64C 4R4FH 5I76B 2ADYA 5EOQH 1J2JB 2QIWA 3MU3A 4CADB 3TIDB 3VMAA 2FSEB 3EBGA 4GH7B 4OCXH 4I2LC 3N50A 4X9HA 4AG4L 3QDGE 3CAFA 4PS3A 3OJDA 4OI9A 3U46A 1R3KA 3HAEH 1K6QL 1VACB 4X4YA 2WSCJ 1JFQL 1OGTA 1HEHC 3P4OB 3OL2A 2Y3NA 1OGSA 1BAFH 1IC5L 2IFMA 1NGWA 3OSVA 1MJUH 2VMEA 3CX5H 2G2PA 1L9QA 3HD7A 4DUXA 5KJRH 3MLWL 3CFTA 1ZA3B 5BV7H 1TQVA 1AQDA 3JTBA 2CRYA 1CLOL 5DRXA 5HYJA 3EUDA 5I28A 2XVBA 3DOSB 1E8ZA 4YSAA 3PWPD 4G59C 4LLQA 1CU4H 1QR4A 1FZKB 5JIKA 4AG4H 3UYRL 3O3BB 4X4XA 3GT6A 4KKLD 1L9OA 5F9WB 4KTDL 1TEYA 4YN3A 1AQKH 3EQ2A 1NU1G 4IBZA 2X6UA 4UWQB 1KXHA 1FJPA 4BK8A 2CNZA 2NY6B 1QAWA 5IOPA 2IANA 4K8RL 3PL6B 4LP4A 3A67L 3KW8A 3VMOA 3OBAA 2WUCH 2J59M 1JY2O 1IBGH 1P5UB 5MEPA 4OZFG 4NPKA 1YN7A 4AGNA 4ZJ9A 1FVCB 1KCVH 3KS0J 2WN3A 3DO3A 1U8NA 5GRVK 1CTOA 3MLPA 3T2LA 1JO5A 3FZUD 2GBVA 1QBMH 1A7RH 3MJ9A 4OZFA 5F8QC 3QXWA 2XYCA 2WSFH 4L4TA 1FJKA 1HHGA 3BAXA 1SY6L 5ICXA 1HS6A 4FXGA 1F86A 2IBGA 2DM3A 1QMUA 4YPGB 3WEXA 2M8XA 2YIUC 2BY1A 4KKNA 5I30L 5FHBH 2NZIA 5CINL 2EUVA 3QQ4A 3CCEP 1L4AC 2EXYC 1NBYB 1QLEH 1T04A 4GXVL 1BF5A 3WDHA 3V4VB 1XCQB 5CCGC 1L6ZA 1RFDL 4HIXH 2JQMA 1KBGH 1I31A 1UWGH 1MHHB 4KJQD 4BH8A 5DMYA 4F8QA 1HZHL 4G8FA 3ALPA 2P5WA 2QFRA 4TQPA 5HVFB 3MD0A 3LHPL 4OVUA