5AW0B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
molecule keywords Na, K-ATPase alpha subunit
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw0B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw0B02
3P32A 3UIAA 3M06A 2WPQA 3NFQA 3MD0A 3V4QA 1T2KC 3VMZA 4AUWA 3P8MC 4GKGA 2YNYA 1X8YA 3A2AA 2JJLA 2WT7B 2Z5HA 3V5BA 1GU4A 5APSA 1SLQA 5APWA 3TYYA 3M9BA 5AW0B 5AVTB 3M91A 1HJBA 2E43A 2R5BA 5AW9B 2W27A 2WT7A 1KQLA 1NAFA 5AW3B 1DH3A 1MFZA 4AYCA 5APXA 1HUCA 3HE5B 2QM8A 4KHXA 3WGUB 2IPPA 1JUNA 4C7NA 4C7NB 5AW6B 4AQRD 4HYTB 4C46A 2BASA 1CI6B 1S9KE 4JYCA 5AVUB 1H89A 1H8AA 4I2LC 3HE5A 3V4WA 3VN0A 1H88A 1HWTC 3HE4A 5AW1B 1A02J 2ZFCA 3TNUB 5AW8B 2Q5UA 2Q3IA 3M0AA 5APQA 1T2KD 4B86A 1OWAA 5AVQB 2R32A 4I6MC 4JYBA 2R5DA 3M0DA 3VYIA 1FOSF 1OXZA 3SWFA 1A02F 3O8ZA 5AVSB 3NMDA 2R3CA 3HE4B 3TNUA 3P7KA 2QM7A 3MGNA 5AW5B 4RETB 5AVXB 5APUA 5AVYB 1FAVA 1G2CB 2KP8A 3NXSA 5APTA 2YO3A 2XV5A 5APVA 5AVRB 1NWQA 2Z5IA 3KDPB 5AVVB 1GU5A 3A3YB 5AW2B 5AW4B 4XE5B 5AVZB 1GD2E 2WPSA 3VMYA 2E42A 2H7HA 4DZOA 1JNMA 3I5CA 1CI6A 4EOTA 4M3LA 2W6AA 2WWWA 3L35A 3A5TA 2YO2A 3WGVB 5AVWB 2C9LY 1MV8A 1GK4A 3HTKA 4GT1A 1MUUA 1IO4A 5AW7B 3VTPC 3NTNA 4RESB 3LIDA 1FOSE 3A7OA 3M9HA 2C9NY 3L36A 2N9BA 2P67A 2Q7CA 2XZRA 3TK1A 4LC1A 1SP4A 2P2UA 2WPRA 2VRSA 5CMZA 1GTWA 1YYCA 2XU6A 1J2JB 1GK6A 5APYA 3IR9A 1S9KD 2ZXEB 3T97A 2WTYA 1CSBA 3LIEA 3OAKA 1HBWA 3B8EB 3VMXA 1GZLA 1CZQA 2P7JA 3L37A 3KQGA
chains in the Genus database with same CATH superfamily
3AU1A 3MRIB 1IE4A 3ARDC 2XNAB 2IADB 1RY3A 2VLJE 4LDEB 5DHVA 4XPAL 1BZ9A 4G7VH 3RWIA 3V0WH 3NSXA 1GGUA 4S0HA 1RZ8A 2E6QA 4PW4A 3T2LA 1Z5YD 1KJVB 3GMPB 3MLTA 5FM8A 2NPLX 3W67A 2CJSA 2VDNB 4LRIA 3AC0A 5DQJB 4YFEA 2HUHA 2B1AH 1HEZB 5ESAB 3EJYC 2Y07H 1P4BH 2B15A 2DTMH 3X11A 5F1NA 1D6EA 1E9PB 4WHYH 1HL9A 2WXHA 4FQCH 4C46A 4LIQL 2HPTA 4OZIB 1TO5A 2OCFD 3GSUB 4GINA 3ZE1F 3REVA 2WVVA 3I6KB 3B2VL 4WO4A 4A55A 3DJTA 1FNAA 1M1SA 4WHCA 1N18A 2Y0CA 5D6CA 5MEQA 1MWOA 2Z35A 4KKPA 1CLYL 1QNIA 2EEDA 4L3ED 3V6OC 2BY1A 1EFXB 3O6FD 4Q2ZA 4AV0A 4F2FA 5D4QA 3BRFA 3MRIA 3VI4F 2GYSA 2CCLA 1IJDB 3DX0A 2AV7B 4I8DA 4OCYL 3TCTA 3VYNA 2GJPA 3GK8H 2VSDA 4M56A 1WBXB 4K5MA 1LWRA 2DI7A 4LLYA 2KUTA 4UOW0 1FFRA 3NIGF 3ORJA 1BJ8A 4PJ0E 3K6DA 3BO8B 1ZN5A 1GU5A 1HSBB 3OKLB 3BUPA 5I5JA 5B1CA 2EH8H 5AVZB 3HD7D 4JM2B 4PJ8B 4EZJA 3WMPA 1PV3A 1EDIA 5ISZB 4JPWH 1K9TA 3U7AA 1JZ3A 5CFAA 3DUUA 3BAKA 5LXGL 1BG1A 2VLKB 4FRWA 4JANA 4TRPL 4U3SA 3CVHH 4PRIB 1N5YH 2WNKA 3H1LG 1I9IL 4EN2A 4YHOL 1ZLDA 2VRKA 1IGYB 2R1YB 4V2CB 2F5AL 1MAJA 4E9LA 2P24A 5J9PB 5I1IH 3BCCE 2XXFA 3JT0A 5J89A 2C9NY 1AA0A 12E8L 1MJ7H 3AEDC 1R5LA 1A7RL 1AFVH 1T04B 3MREA 2AEIT 4KI5D 4M7LH 1QSFE 4UILH 3L72E 3PV6A 1CLCA 3AREC 5TPWH 5B8CB 2EYRB 1ZRTE 1NFDA 1GHFL 1X5HA 1SQVK 2WWKO 2XN0A 3G6EP 1NDGB 2GUOA 3WN6A 1T83C 1GVIA 3L5WA 5FUCE 1MQ8A 2BS71 1UD6A 3OA7A 1L4IA 1QP1A 4JB9H 1VESA 3VXRD 4Z78B 3QR1A 3RLSA 3DI3B 3HG5A 4PJBE 2VZ1A 1EHAA 1J8HB 3VQLA 5CZVH 3HLAB 2A9BA 2FEEL 2P8LA 2EVIA 3ZT5A 1U8PA 3HVNA 3DVNA 4AEIL 5K9OB 4HKZA 3FFCE 1FC1A 1S7VB 1DVQA 5APSA 4FLSA 4JE4B 4ZO6A 4Z77B 5D1XA 3OWRA 4L4TE 1MCPL 3QDGE 1WFOA 4X7TA 2ZSVB 2ZG2A 5DVMA 2JP3A 4GUCA 3QS3A 1Y1DA 3CWGA 3SEPA 3RKPA 3ZMNA 3TBYB 5A2AA 1MZ9A 3GI9H 1SJMA 3L3HA 4HUVB 4PGEA 3L9RA 1F3JB 1SOKA 4JDEA 3C2AL 4FERA 4HULB 4S11A 4BE5A 4AMXA 1AZNA 3AS0A 3D33A 3L4XA 2K78A 5IT2L 3QIUA 2HLAB 3EO9L 3NZ8B 1UWYA 2MTPA 2H32A 4I9WE 1G7QA 4R6UA 1O6VA 2VM4A 1QRNE 2AXFA 3O3DB 4NM4L 3SDCA 1HILA 5IR1A 1YY8B 4Z7NF 3G3ZA 2E0PA 3E1F1 4UT7H 3ULUE 5E4EB 2VIRA 4G8FB 4HIXH 1CFSA 2FO4B 4APQD 3OV6A 1E8XA 2R5DA 2E46A 2IBBA 4LMQE 4XBEH 2V0AA 4MMYB 2FXOA 5J1SC 2J25A 3K72A 3BAXA 3Q2LA 4K23H 2Q9OA 2V9UA 3OQRA 5D7IB 5CBEB 1VQ6P 1S9XA 4UB8H 4X4YA 1G0YR 4PRPA 1PY4A 2P58A 1F3RB 2VAJA 3L4VA 1UKQA 4Y7OC 4A2HA 2VZVA 5JW4N 2ZKWA 5ADPH 5KVDH 5AW4B 1OP5H 4ZXBA 3ZTJG 2D7PA 2VZSA 2X12A 4YDIH 2CA3A 3ROOB 1IFHH 1PU0A 32C2B 1GYCA 3PHQB 5FPIA 5A40E 1MFEH 4L4VB 1AIFA 3T9WA 4NQEB 1JNHB 1ZR2A 3O6LL 5F0MB 1N2RB 3UPAA 4GAJL 1GJWA 1T7VA 4UAHA 2KZ1B 5J6HA 1X5IA 4J23A 4QHMA 3P77A 1R3LA 4CADA 1FNEB 4RESB 5DD3L 4C56D 2IX7C 4OLZL 3MNZB 2IH9A 4LHJB 3D69B 4NUJA 3SGDH 4I18A 5CMZA 5JOPE 1IIIA 4JRXE 4M5YL 2AZUA 4ONOA 4F80A 1S7VA 1DEEA 2C3XA 3CHPA 4WW1A 3T8XB 3CVIL 4ODTH 4Y5VC 1HL5A 3BYYA 3VI4B 4NO2A 2NY0C 3F3HA 1K2DA 1BYPA 2ICCA 5FHBL 1T2QL 4DVRH 1H9VA 3QC6X 1M42A 1QNZL 3AM8A 4WWKB 3LOWA 2WBJA 3SGJA 3BRGC 5DLML 3UYPB 1T3UA 4AUWA 2C4FT 4XT1C 3ULVD 3BOVA 1LWJA 5E1AA 5IFAH 1JV2B 2PUQT 4WLCA 3KPRE 5EO1B 4PTTB 1BREA 3I6LD 2WAQA 1PF3A 2LXBA 1FFPA 1V55B 2NUTA 2OQQA 4P59L 4EJ1C 5TF1H 2ADYA 1XF3B 3HI5L 4NQUA 2WKOA 1U93B 5GGTL 5DJAA 5JW4M 3FFCB 2FYYB 2N1TA 1RK1A 1YEDB 3IDMA 3PP4H 3S9OA 5CF3A 5I0DA 4I9XA 3IGUA 4HLZH 1KGIA 1OQXA 2C34A 1LE9B 1DQJB 4X42A 1OAYL 1UXSA 2BY3A 1LJMA 1SFCC 3GNMH 4H44B 3AFLA 1EJ6A 1QBBA 3UAJA 5JXEC 5L4MA 1KTLB 4IKJA 3VFRA 3SBWA 3LQAC 1TITA 5EUOB 1ZTXE 3P4OB 4OAWB 1CT8A 2WXKA 1X5GA 4ETQA 3PCYA 2K70A 1IKOP 2B0SL 3FUDA 2IG2L 3L4UA 1V8HA 4G7VL 3FCTA 1HZHL 4MJID 1YNLH 3BYTA 3V4VL 3CMOH 3N9GH 4TUKL 4ZMYA 3VQ1C 4V11A 4EI6A 3SD2A 3TVMB 3RGVD 5I30L 1FSKC 5BNXD 3S3SA 4X50A 5C2BL 3TSIA 1U6AL 2PWHA 4ELME 1T0NB 1O0VA 3FONB 1WDAA 3FTSA 5I8EA 2CO4A 1MH5A 4MTMA 2C1OA 5F0JB 3BRVB 3U48A 2ZUQB 3GXUB 7PCYA 4IL6E 4PRIA 5E08H 2IAMD 3T09A 2IWFA 4FX5A 1ZCRA 4ISVA 5T1DL 3RGVC 2I60H 3BP7B 4TUUA 4NO0D 1RZJC 4ODXA 3HEIB 5SV3A 2J4WH 2QZQA 2XWEA 3QEUA 1XCTB 4PJIA 4EKJA 1FJPA 5JZ7D 5C2UB 3K5SA 4Z7OB 4FF9A 2FYUK 1WK0A 4TS6A 1W2KT 1HHIA 5HDQH 5C0NC 2K6ZA 2DWEB 1L0LE 3UZQB 2VL4A 2V5TA 2YUVA 4PJCF 4CJ0A 3QRLA 3T0VA 1P2CB 3MP7B 1DEEB 3MMEA 4WW1B 5EFIA 4HWNA 2HJFA 3CFCH 1N73A 3K4AA 2ARWA 5BCAA 2VMFA 4B0MM 3KLKA 1U3JA 4OGQC 3I9GH 5CU5A 2BW5A 4Y88A 4GG6E 3OB0H 2WBXA 3F8UB 4PCKA 5ESQA 1INQB 4DPBX 1I8LC 5K1VA 3PP5A 3TBBA 1OP4A 1NAMB 3ILQD 2VN5A 2VZ3A 4TVPL 4Y2LA 1QVGO 4AGLA 1RMFL 1ZRUA 1RUQL 4GW5A 3FAXA 2DQEH 1JD7A 5D7IF 1J1EB 2NY3C 5IM7B 1ND0B 2R4SL 2ESVB 1SNRA 5DZAA 2Z31C 1E6OL 2K1MA 4WSJA 2OXGB 3MOBL 1FIGH 3KAAA 3BUTA 3MXVL 5BRQA 5JHLH 1R9FA 5I75B 1K2DB 1YC8A 1M6UA 1VQ5P 2HPCA 1KB3A 3V4PH 2NY4D 3DPBA 5E8PA 3D39D 1KFAL 1P7KB 4WKXA 3EYOB 1CFVL 1UADC 5IVXB 3LCYA 3UTSD 2M0BA 3SYAA 4ANUA 1NC2D 1S7WA 1SHWA 2KI6A 3ZIMA 4B9CA 3QNXB 3VD7A 3MLPA 3OKEB 2WSFJ 3PWPE 4L8BB 2YA1A 5E99L 4C7NA 3MZWB 2CM5A 4BFKA 2OZ4L 4P2QD 3ZDXE 3BH9A 5KVFH 2YMXL 3QJXA 1FVEA 4D7BA 3UBXB 4S1RH 3EYFB 1LNUB 3J27A 2FUQA 5LXVA 3UTPD 3O9WD 1PYWB 1D7MA 5CJBA 5TDNA 4O51B 1PSKL 2H6PA 4LARH 5HGDA 3H1KG 3V0IA 3TNUB 4K5LA 4CC0A 5GSVB 1PD6A 4L76A 3OVUB 4OZGF 3SGEI 1HEJC 4P23C 4Y28J 2XV3A 2FX7L 3B2UD 2CKBB 4UUJA 4L18A 4F7MA 3R1GH 3KYKL 3VSUA 1MJJA 4PJDB 4Y4KA 2AV1B 1TQWA 4CRPA 2HPOA 1NCWL 4JM2F 1HVVA 1J5HA 4D6TJ 4QWWC 1G2CB 3CZGA 2YWZA 1A4KB 1ZLVK 1JXGA 3U9UB 5SWSB 2UWEF 2AVGA 3Q9QA 2WWOA 4X9BA 4OZHA 3O3BB 1OTTD 1W15A 4ELMB 5JDSB 2Q8AH 4HWEL 4M1CC 5EG6C 4LLDA 5EORL 4FZEL 5E79E 3MNVB 1S3KH 3H1LJ 3AITA 5DJ2B 3WEXB 2MRYA 5BV7H 3ARYA 5BU5A 3KWXA 3T0ED 1GTNA 3MUDA 2C9LY 5KLIC 2VLMD 4L1BA 1CPUA 3X14A 5DD6A 2XXGA 4MXWL 4K5PA 3E6HB 1YBKA 2IO5A 3SN6N 1S3JA 2IV9A 4AQEB 1V7NL 2V2XA 2Y0SA 3E8UH 5C08D 3SDXF 2ETWA 2ZOLB 3WKNA 1OTUD 1FPTL 3UJTH 3IT8D 1CIUA 2IFMA 2JTDA 3KZIH 5D7JB 1K3IA 2XQYG 3UJIH 4GBXB 5DZOA 1IC1A 5D72L 3P9MB 1B3JA 3RGUA 2NUPB 2IDFA 3BVNB 1TQBB 3A47A 2AERT 1U8LB 3QI9A 3VWJD 2YKOA 4HLJA 3FB5B 4NPEA 5F9JA 1IGTA 3QWNA 1IKNC 4PCSA 3VFSA 3W56A 4M1DL 4JPSA 2K3HA 2V2TA 1D5BB 2A4CA 3CH1A 3AB0B 2DTSA 2Q86B 4TQHA 3LKQB 4R4FL 1KG0B 4PCTA 5GZND 1RPQA 1X8YA 1W72H 4ZMOA 2GSMB 4HIXL 3D4ZA 5TFSL 2HKHH 3IU3A 3C9NA 1D5XA 3RL0g 1RU9H 3L5HA 4K4KA 5DDHA 3ARFB 3SCMB 3ZQXA 1OPOA 3OMAB 3SBWC 1ZHNA 2HFFB 3SQBB 2YPVH 3EGSA 3B56A 3WUVA 3EOBB 3MLUL 1XH3A 4NWUL 1FDOA 1KBKA 5FHBH 1JIBA 1MSPA 1XVSA 4ORGA 3RPKA 4NZJA 4HAKA 3VG9B 1QBLL 4XZ4A 3H1HD 4IMKC 1MW3A 3ARGB 4OGAD 1UVQB 1MFEL 4HIPA 5CGYD 4GBXA 4JFVA 5IG7A 5IB3A 5SX4I 2AITA 5C9JB 4BGLA 3O6LH 5I8OH 1QEXA 2VTFA 1HH6A 1RJYB 1M4KA 2IMMA 5D8JL 3P02A 5FUCC 4UANA 5KLIB 1NGWB 2AHIA 3O6QA 3TF5A 3SE3C 2ZXWB 3FT4B 4HK0A 3AMLA 3GDBA 2ITAA 4U6VL 1UURA 3GIVB 5F7EH 3HMXH 3L3DB 2E7BA 1URZA 2UXVA 3V6FB 4DZ8B 5I1JL 4D6TD 5GRWA 5BVJA 3SFDC 5PCYA 1GAFH 3WEXA 2NYKA 5I8CB 5EPMB 2MNWA 5TQ2L 4MB1A 4HHAB 4N2FA 1AACA 4X8CA 4YSTA 5LHDA 4ZMZA 5CGBA 1XSIA 1JNLH 1XF4B 1U8NA 4XODA 4X7TB 5I18H 1NA8A 5I1CH 5I1LA 3OHXB 2UZPA 3MSPA 1U58A 4YE4H 4Z23A 1NCDH 1UXWB 5DD0L 2W6AA 4JW3A 4H26A 4Y16B 3DVNB 1CICB 4ZPVA 4A2MA 4JDVB 1YZZA 1YQ4C 2X89D 1JPGA 2G4GA 1R24A 1B90A 1H0DA 1MFCL 4NFDA 4K71C 1F3DJ 1F18A 1C5BL 5L0QC 1XSJA 5J1AB 3JCUH 2WSPA 3V5DB 3CVDA 1MUJB 5EBLB 3FBKA 2ZP8A 4NKOA 1ZGLA 3VI4E 3L72J 2MWCA 4HKZH 3BWZA 3NCCB 3L75D 2QSQA 4U1IB 4L1TA 1BQLL 1ZSDB 5F1KC 1PP9J 1ZT4A 2EZ0D 1MRCH 3GHGA 1KXTB 1THAA 2IIJA 4RMQA 6FABL 3VRIB 1SLWA 2G3ZA 2VDNL 4HJGB 1SQXE 4XWGH 1NKZB 1OB0A 3B43A 5L2KA 4GAGL 1JPSH 2PWDA 3ZE1E 2F1EA 4GW1B 2HLFC 3E9UA 4RISL 1IO4C 3GTVA 2X10A 1IE5A 4IHBA 4L3EB 5LO7A 3Q5RA 1XEUA 5H2BB 1PFOA 3V9EA 3WMSA 4D0CB 5IJVA 3B2UC 5IREA 1EEQA 2UXFA 3KLQA 4MJ6B 1IT9L 3IJ7A 4MCZB 3AUWB 2YEVB 1LDPL 3QIBB 2A83B 3DO4A 3QDJE 2BIQA 5DA4A 4PY8I 3FHAA 3IWVA 4MNHA 2VIRB 1KFNA 3LHAA 3CFMA 2WN2A 3KH3A 5D7SL 3U0PB 3WN5A 4L3CA 1U8OB 4U4BA 3V0GA 1W72B 3L3GB 1F1AA 2AXTE 3W38A 1DBJH 1XL4A 4YHOH 2DQDH 4LLUA 3AEEC 1T20B 2DWYA 4HYTB 5CD3B 3O45A 5L8KB 2L3BA 2MFNA 4O5LL 2BIHA 3G5VB 1TO4A 4AV5A 3D9AL 5IB5B 1Q9WB 3SY0B 4BQ9A 4HLZG 2OMVB 2L4OA 4N90E 3ESOA 5HXMA 4KRLB 2A9MH 3THMH 3LN4A 3CCQP 2CPSA 5IIEB 2XZAL 2X4UB 1NAYA 1UACH 3ETSA 4OUOA 5AZEH 2KS1A 3I6LE 4LOUD 1TTUA 1RZGB 4M6OH 4OLYH 1MFTA 1M1XA 4W6WB 1N7SD 1JZ5A 1Z2KA 4PIBA 5SWSA 4M7ZC 4LLQB 1CUOA 5CCHC 3GMOB 4MWFB 3V79C 4QY8B 2CLZA 5E6ID 3D2TA 5E2WH 2BCCG 1DJGA 5APTA 2R56L 2WGXA 4ZPVB 5EU6B 2Z9TA 1SLXA 3BSZH 4MLIA 4DW2H 1VSCA 2G5UA 3HVDA 3TO4D 3SQRA 4HH8A 1U92A 2O01J 1INEL 1H6EA 1MKFA 2EEBA 1BPLB 1P69B 1HGVA 3F6IA 4JFQA 1NEUA 4MMXA 4PEEA 2DQFA 3C6SB 4TSBL 2BCCE 5CBNA 4FFVC 1AG6A 3TGUJ 5F21B 3SE9L 3TWYA 1YYML 1ACZA 4HIJB 2QIWA 2ITCB 2YHGA 5CJ4A 1KN2L 5MEPB 4PJEB 3DTDA 1CB4A 1BBJA 1CFNB 4AKPA 4WTXA 5DJTB 1QSEB 4M1GH 2AK1L 5JPNC 2K4AA 3R7RA 3EYSH 1E5AA 4LOEA 4OAWA 1RI8A 4N2GA 5KBMA 1MWAL 4AG4L 1U7MA 4H25B 1L0LK 3WUTA 5HHXH 1HHHA 2A6DB 1E7UA 3OAZH 2ESVE 3WIIH 5IBLC 4ZSOA 3RWHA 1MCEA 2K88A 1AKJA 2B1AL 3C5XA 4WCYL 3T3MB 5KVFL 2JKVA 3VA6A 4FC3E 1PW3A 4NN7B 3H1KD 5CCGD 2YKLL 1ZIAA 2GBTA 3TH3T 2ZYGA 3VB9A 4IU3B 4QCIB 3SE3A 3FONA 3UH8A 2GTWB 3M0DC 1OP5K 2WZPA 3SPGA 2E6JA 3DX9B 1EXHA 5CIPB 3U4EB 3ABLB 2GY5A 3LQMA 3L5IA 3N04A 1A02N 2FY8A 2JI1A 4NQTA 4E41E 3KPOB 5ALCH 1J10A 4PRAA 3OQ3B 4M9OA 5F7YC 4AIXA 5MEQB 1T0PB 3ZKNC 1MG3C 1F3DH 5HJBA 1L0ND 3X13B 1ZR4A 4L73A 4BRVA 5T1LB 4WSGA 4W9CC 2X4SA 3APCA 4FHJA 1PAZA 5ETUA 4PJAE 2X40A 1E28A 4XVJH 1EEYA 3ETBJ 4N2KA 5CAYB 4S2SA 1PZSA 1N19A 1YEJL 4A2EA 2WQVA 4NGHH 1G6RA 2LLLA 3AWFA 2FWOA 4LVOB 3HE4A 2OZ4A 2FVNA 2I5YH 4N28A 1BPVA 1N6VA 1L0LG 1CICD 1Y6NR 4NRZA 2QJPB 1AXSA 2VE6A 2ZCZA 3MUGB 4Y1AB 2YPVA 4O2CA 1AQ8A 4Y2DA 1SMDA 2PTVA 3WY3A 1ZP0C 4NQDA 5HHNA 4ZTOL 1AQTA 4M7ZB 5E03A 4MAYA 4XNYL 4YWGH 4LVHC 1X4XA 1UD5A 4I77L 3WNIA 4UOQA 3FH8A 1MLBB 4Q8BA 5CCGE 4F92B 1RD6A 2DWEA 1KJ2L 4JHWL 4Q4EA 4TTDC 2EKJA 4AE1A 5L2KE 3ZE2F 3U46B 3ULUF 3U1CA 4M93B 2XKNA 4A7QA 3DDFA 3SDDA 4G59C 5JYMA 3KJ4C 1UM5L 5EN3A 4N5EC 4ODSL 3CBJB 5F71A 1PIGA 2WWWA 1A6VH 1JZDC 2FX9H 2YLKA 3MRKB 4G7SB 4LCWA 1NTMG 3N7NA 2XUWA 3H1ZA 5J6GA 3NP3A 1XZ0B 4ELMF 1A0QL 3KYOA 3QDMB 3PDOA 2IQAB 2PO6B 2FO4A 2YZ8A 3KDMB 3AEBC 2WXOA 1M7XA 1PEWA 3P8CE 3TBCA 1W2BO 1HQ4A 3CN2A 3BPLC 4HWBL 4KNQA 4ILDA 5I1CL 3QG6A 5FO8B 4OB5L 2UVFA 4PUBL 1G9HA 3Q06A 1OCRB 2CR3A 2NYYC 2EDDA 1BVZA 3PP4L 5DHEA 3UGUA 1XF2A 2WSSH 1RF0A 3VD3A 3TV8A 3MN8A 3AAZA 1W0VB 4P2RA 4J6IA 3BISA 4XR8C 4DGIL 3QA3A 1JXDA 4GW5B 4ZXBB 1NPUA 4FQLL 1M1JC 4KAQH 4ZX3A 5HYIA 5HGDB 1FV1A 1QNZH 1OSZA 3HJ0A 1FVCB 4NZDA 2W91A 4TYUA 3H32B 4U2YA 2EDNA 4QTIH 4YAQB 3QUZB 2DKSA 1FYHB 4K7PH 1OB1A 1U8KA 5D8JH 5EEXA 2Y25A 2ZSWA 3NEXA 1FNSH 1TKWB 3HC4L 4DQAA 5BVPL 4NM4H 4UIKH 3MAWA 2BOBA 3FN3A 3EYFA 2FH8A 3GFUA 3NA4A 35C8H 1GS7A 3CZFA 5E6SB 1DH3A 3CJJA 4UMGA 1JF5A 4XBEL 3IGKA 3K6NA 5KSBF 3OKEA 4YNYA 4QNPE 3G6DL 1FH5H 3V2QA 5DRNA 4LCWD 2IGTA 1FRGH 3AXLA 4AL8L 2EVGA 3OG6B 3GF7A 2B4CH 3K5BA 3BAEH 1NIEA 1EIBA 1P4IL 3NDYE 1JGLH 1YCSA 3PGDB 1JJUA 4LAJH 2W60B 3W5NA 2AJ3A 1BGYG 3FCGA 3P30H 1OD7A 2VMCA 4QHPA 3FB8B 3KPRD 3PPEA 2IG2H 1AHWB 1IAII 3UTOA 2O26U 2P10A 4L2YA 3CLFL 4D9QD 4ECNA 3UDWC 1A6TB 4J4PC 2WLZA 3GI9L 4TSAL 4HC1H 1LMIA 4URTB 5HYJE 2IPKB 2WUCL 1RVFH 3U1AA 4OD1H 3RY5A 4PGDB 2G3XA 5DK3A 5EZJB 4U3SB 4JO8A 5AW5B 2QQKL 1MNUH 2C1PB 3IMVA 4LAQL 4MQ7A 1FG9C 2D3VA 5IHUL 2DBJA 1T0MB 2RACA 2JWAA 1DN2A 1G0XA 2CLVA 3V55A 4NSKA 3UO8B 3G9AB 5I18L 1A66A 1YJDC 2O6DA 3W11C 3N2JA 3FO2A 2IQAA 4UT7L 4YE4L 4AGOA 4QXUH 2AKRB 1NBVL 4JFHD 5H37H 3T1FA 1WYJA 5JIDA 2WQWA 4JCWA 1IAOA 4R96B 1EUTA 3KWTA 3IDYC 5FO8A 1KGWA 4ZFQA 3ARBB 3C5ZC 3H7BA 4ZNCD 3BCCG 4IIZA 4MXVE 3VGAB 1IT9H 3VXQB 5DJZA 2AQQA 1JPEA 1PFCA 2Q86A 4X6BA 5K1JA 3N5AA 4L75A 1NYHA 1J9TA 2B2XL 4J6RL 4NOFA 5DLMH 3N0PB 3CX5E 3SOBL 4KROB 5TGBB 5KUKA 1LP1A 1NANH 2FWUA 3D18B 4Y5XA 5EIQA 2PCYA 4P0DA 4L5FL 4LC1A 1WG3A 3CBRA 2P2UA 2W6BA 4XCFL 2V2WA 4DKAA 4KQ4H 3MGOB 1T1ZA 2GCYB 4MASA 1H3TA 3LPWA 2ZAHA 4E0RA 1NDGA 4PJ5E 4CKQA 4RMSA 2N9YB 5FO2A 1KPVB 2NY2D 3S36X 1KIQA 5T3XL 5GGQL 4LLHA 2DKMA 3NH7L 3X12A 2LGNA 2V3FA 5C0RH 3DIFA 5CJQH 4YPGB 4X80H 5AB0A 1VQKP 4XXDB 3UBHA 5T3ZL 3PLNA 3E7JA 3GHBL 4XRCB 3V5BA 4YK4C 3JXAA 2POHA 2XN9B 1FAKT 1R8EA 1ZK5A 5E2TH 3HE6A 3D0LA 1J0JA 2MHAA 2VN6A 5IEHB 2ORBH 2ZAIA 3HE7D 4ICWA 4TVSa 2WUBL 2ROXA 3GLAA 1BQSA 2JB5H 5EU7E 4JR9H 1GW6A 3ZW3A 2XLLA 1VDFA 3BZFB 2Q7NA 2C8NA 2RQEA 4K9EL 5JUEH 2V37A 5GZOD 2VXTH 2GI7A 2FWOB 4N0FA 5ITFA 2JMRA 5E7FA 1S4XA 2E56A 3WU2H 4N78D 1S7QB 1PGRB 1JZ8A 4K3AA 2Z4QB 1SQVE 3U1PA 5KAFH 3UZEC 2BSSB 1NCBL 3AT8A 3EO9H 1BGXL 4U7MA 2MQGA 2R29A 1AO7E 1VZHA 3GMLB 5KANI 1L0XA 4U1SA 4ENZA 1EDQA 4OT1L 2NXYD 4KNTA 4H88H 2BSCA 2P8MA 1UCTA 3K4ZA 3MROB 1U3NA 3WY4A 2JH2A 1DO5A 1J11A 3WLBB 3NP4A 4JYBA 2QA4P 2WNXA 2QLYA 2DTML 3SPVB 1SEQL 1PGOA 4GLRI 5E9DA 5E1GA 1NIFA 5HP5A 5CJXC 1N68A 5APUA 1BZEA 1FL6A 2KPWA 5E9AA 1H6TA 2OR9H 3VCLA 2I24N 2Q3ZA 3C2AH 1AC6A 3MV8B 4LB8A 4HS3A 4G8IB 4NCC1 5JO5B 4AEIH 2CR0A 2DM2A 2GC7C 3TN0B 4G5AA 1MFVA 1GMJA 2X6UA 3R1GL 4BA0A 5C3TA 1HGZA 4AQ1B 1XCWA 1BD2A 1FO0B 5AZ2H 4V1DE 3VFVA 3L9YA 5B38A 2A6KA 1FJ1A 4MJ6A 4Z7WA 1X7QA 3VXSD 4ELDA 1AGEB 5A3IC 3ESNA 1OM9A 2P46B 2XZCH 4Q58C 3ATEA 4YXLL 3RL0B 5FECA 1T66D 2ZYSA 4JG1L 3HTKA 3GBML 4MZ2A 3GF3A 1BFVH 4H4NA 3CLEL 3I9GL 4WTWA 1P84I 3T1FB 3BE1H 2J12B 3O11B 1KTDB 4MD4B 1SEBB 1NU1K 1MJ8H 5L88L 1P1ZB 2NX5E 4NRXA 2CXKA 4R84A 1BBDH 2J8UB 2Z7UA 4B7LA 5DJ0B 4EUPH 5EZIL 1IQWL 1PKQE 3AU1B 1KC8Q 3OTTA 4K94L 4W9LC 3KR3L 4ZUTA 3RTQD 2FYUD 4FYRA 5FA3A 5EU3B 4PV1B 3QDGD 1Q4NX 4XVJL 5D6CB 1KXQE 3LRGA 1BG9A 1UCBH 3OXRB 2Y72A 1QW8A 4TULH 3VFPB 1ILUA 5C0DB 2JELL 2VL5B 1CN4A 1NC2A 3UJJH 1QUPA 1J9QA 2QHRH 1E8YA 1KMGA 2WIMA 3TIDA 3ZDMA 4Q9QL 2YAPA 3EYUH 1BDDA 5IB5A 2XWJA 4A7GF 1D6EB 3DXAE 1J9RA 1N64H 1LO5A 2CIKB 1ES0A 1SQBE 4BFEA 1HTLC 1MJUH 3CSFA 5KZCD 2MSPA 1KXQA 3ASWA 1OT2A 5J13C 5AFAA 5J7CC 2D7QA 4N3TA 4KZEH 1N3NB 2HT4C 1RUQH 2OMUA 4QRPE 1NCJA 5IMKA 4HH9A 4GG6B 4JZOA 1IEAA 2AABL 2OI9B 3HZVB 5ICZB 2G4EA 1E2WA 1I4FB 1YA5A 1MJUL 4WUUB 4WY4A 1AD0A 5EU7C 1A14L 1KEML 1O9ZA 2GUOB 4YFLF 3WKMH 3WEMA 1X9VA 2PCFA 1KFGA 1SVFA 2ZYRA 4X5LA 4BSWB 2NPSA 2ZICA 3RAJH 1C08B 3NCFB 3BUDA 1J12A 3JC22 4TQPA 1W9XA 5FYLE 3BC9A 4RRPG 4Q9RL 3MRJA 3QO0A 1SHMA 1J8HA 1F6LL 4EI0A 2LKMA 4KJWD 5DJCA 1FVDB 2HH0L 5I74C 2P43B 5L2JB 4O2EA 4AQAB 5IQ9B 3OZKA 5K5YA 1MRDL 4N8UA 3QAZB 5T1DH 3VFPA 3GTNA 1GY2A 2O5XL 1KTBA 2WLMA 5G5DA 2E59A 1N7MH 1LTAC 4R4MA 4HBQA 5ANME 5DZPA 4IMKA 3BLKA 3VD2A 3DURB 4X6FA 4A7VA 2WWMD 3QUYC 1WFUA 4XBPB 1X22A 2H32H 4HIIB 2JKXA 1FYTB 4PJXB 4QYAA 2EDFA 3C8HA 1OAUL 1PIFA 3RY4A 5FWQA 4JRXA 3C6EA 3LY6A 4RDBA 1NU1J 4X80L 3DHMA 3RBZA 4QRQA 2GITA 1ZJBA 2D03H 1IIKA 4P57A 1JGEA 1K73Q 4GAGH 1JWMA 4YHIB 4K2UL 1PCSA 1MV8A 4JFEB 2DH3A 5J11B 1JGVL 1R47A 3ZN6A 3LQZA 4JKPL 1KFMA 4XN5A 4K3EL 1OV8A 1CFBA 4GMTH 5FFGA 5HHOA 2EXYD 4DGUA 5GTHH 4DTGH 2DQEL 4P5TD 3T3PB 3RL2B 4TL5A 1QW9A 2FIKA 2VLRD 4QRTA 1ODUA 1RKRA 4DKDC 4Y4KD 4A2GA 3O8XC 2WTYA 3TV3H 4LASH 1S6NA 2PCPA 4FFZH 1BGXH 4JM4L 3QWRA 4NPFX 5HHVH 2B87B 1KIRA 1A9VA 2MQ3A 4O9HL 1RZPA 4H2CA 4NENA 4XB7A 5BOZG 1SF3A 4LCWE 1FAIL 1JN6A 3I85A 2NY3B 1C12B 3BT2L 1RULL 4POZD 4H8QA 4NQEA 4DQOH 4GDOA 4PV8A 4YDVB 4WHYG 3S9DB 5FM5M 3V4PA 1JPGB 1HJBA 3KL0A 1PL5A 2JJWA 2Y2YA 3CZEA 3IS0X 3K5RA 3U4BL 2YJQA 4M5YH 5E70A 5CKAA 4G42B 2QPSA 3ES6A 1BE3E 1CLZH 3LN5B 1QFWI 1MHPH 5FUZL 4ADGA 5C6PB 2WTOA 3PJSA 1M6OA 3MRDA 3OF6D 5D7IA 3QIWD 3OR6B 5T5FH 2AV1A 2PYEE 1EWHA 1U8QA 1KBGH 3L70G 2WZAA 1BJ1J 4IS6A 1SDDB 3FO1B 3PJNA 3BEWB 3F7QA 3HPJA 5BQ7B 4DCKA 5ACZA 2BPBA 1H0TB 1PZ5B 3C08L 4MJIA 3IMBA 4ZMQA 2OQJA 4C56A 3KGTA 1BSIA 2RFXA 3IU4H 3U4KA 2CUHA 1JK9A 3EBHA 1VQ9P 4PWJA 1O9WA 3O0RL 5EUOA 3HUJF 3TXAA 4HK3J 4U6XB 5CSGA 4UQAA 4WVRA 3B3BA 3P9MA 1OP9A 1FE8L 3EJQA 3G6AB 2CO2A 3QG7H 4XCCH 1LEGA 2O5NA 3H85A 4AENA 4FCAA 2J88L 4HXAL 4LDLB 4UM9A 3EBIA 4KPHL 4NI3A 3P0YH 2NTSP 4IIQC 3QORD 4H88L 5HHPB 4LBEB 1JFQH 5G4OA 1YEWA 3ESPA 4ALAC 4G1MA 1SBBA 2Y36H 4C7RA 5FK9A 2NUPA 2EH7L 2HLEB 4AYID 4QHLA 4BK4A 3HMXL 1M3JA 1QFPA 1NGYA 5DVNA 3GMQB 4WNSA 3IF4A 1F1DA 3MA9H 3PDOB 2E74C 5FYJL 3S98A 3C5ZA 1IBZA 4MNGA 3B3IA 4PJ5B 5ESVA 3DIVA 5FDWB 4HIEB 3CHQA 1FOSE 4XHQA 3UJTL 2FZ3B 1QFHA 3I56P 4GXFA 4U1HB 4G6KH 2MJWA 2CBTA 1Q1PA 1PZUB 3MZGB 4JO1L 5BZXA 3QWRD 2OPCA 5C0GB 5HGHB 3VD1A 3C8DA 4U6HB 2N01B 2YXVA 1LT1A 1CTOA 4FQHA 2PP8A 3LXUX 3FB5A 1IGJA 1VQLP 1YDPA 5AD0A 5IMMA 4PGDA 2WLNA 3MCLL 3TPUB 3EO1B 3F89A 2Q8BL 3SB3A 5HYEA 4JKNA 5C7XH 1PNCA 3P8MC 1S4IA 5KLVE 4KVPA 5DTFB 1XCTA 3RUGA 3DRQB 4KDTC 3X2QB 2BSED 4XC3L 4JFFB 3QFJD 4KXZI 5FO7A 4F27A 4Z3IA 9PCYA 2FO8A 3LSOA 1RY7B 5D2LA 7PAZA 2J5UA 1VIWA 5JLZB 3OGOE 2YMTA 3N1PC 3NSCA 2A6JB 4RJTA 4DIXA 2NY0B 3PY9A 3IDNA 5I1GL 1GC1H 3H7BB 1MFZA 2A0LC 4HAGA 4XX1E 4ZTEA 4KVNL 3VXTA 1A7RH 3C5ZD 5F1OB 3OMNB 4KV5E 1P7KA 3T8VA 4XN2A 5JW5A 3E8UL 2YUZA 5J5EA 1BXAA 2BNRA 1T5XB 2GI0A 3UG4A 1SN0A 2QPDB 3FCTB 5E5LA 1SQVG 2BY0A 5EZJA 2AJXH 4AK2A 1OCWH 3LV3A 3MACL 3ZTJH 4Q7DA 4ETYA 3Q6FB 2ZOTA 3DYPA 4CU6A 1EJ8A 1CGWA 5TPWL 2CUAA 5DRXA 3FZUD 4WEMB 3GB7A 4HWBA 4I6MC 3UTZA 3WTXA 3QBTB 2A9DA 5CIPA 2WCGA 2RMNA 3JQOB 5SWZB 3TNUA 4W9JC 1WTLA 3QIUD 3UYRH 3P7KA 2QSCH 1AP2B 2A06G 3DGGB 3G71P 3QZWA 2GK2A 3E2HC 1DJZA 1V54B 3V0VB 1QBLH 5KAQF 2L8AA 4LCCB 5AG8A 1QRNA 4UU9B 3KBEA 1MUJA 2ZF8A 1DP0A 1Q1JH 1YY9C 1JPTL 5EBLA 1HH0A 4FABH 5BZDA 3G6JB 3MLWH 4AW7A 4L8SA 4PG2A 4U1JB 5FM4A 2PYFB 1GGIH 4OCXL 1HHHB 5E8DL 3TEXA 5FYKH 3KXFA 5GHWH 3L2NA 4DHLA 1QBAA 5ESQB 4HPYH 2B8OT 1HHGA 2X70B 2ZXBA 3WTTA 2NDFA 1E3XA 1Y0LA 2BVTA 3K2UL 4WFGD 3JV6A 4P9MH 5ABAA 2NX5B 4AGMA 4AKQA 2DM7A 2CDGA 2YAHA 3QXUA 4JKLA 3ERXA 1U2HA 1OGPA 2HRHA 2XA3A 4R26L 4YXLH 3ZYOA 1U8CB 2HKAA 3S4RA 1AGCA 4K7PL 1W6LA 2AQSA 5F9AC 2APVA 4LLMA 1EXIA 3IKCB 4AWJC 4K3DL 3AM8C 3DO7A 4ANVA 4N2MA 5E1HB 5HHQB 1U95A 1CLZL 2Y23A 2XN9A 2P8MB 2ZKHL 1W16A 1KELL 4HBCL 4XI5C 4FTVE 2N1KA 1U8MA 3T97B 2NW3A 3JUYA 1T1YB 5D96B 4PWFA 1S5IL 5CEZD 1EZVG 2NW2A 2WBJD 1A9EB 4RKUJ 2Y6SD 3GMRB 4HOZA 4QT5A 2BERA 2JQAA 3NCXA 3BIAX 4PV1D 2XVBA 1IEBB 2I60L 3GZPA 1KILE 1HTYA 5L7XH 2WKGA 4YBLB 4IRJC 2VKXA 1O7SA 3L1FA 4P3CH 4PLJD 2P24B 3VMZA 4EUPA 5J9PA 1QR1A 4I1LA 4Q9RH 4S2SB 2ZYHA 4LLQA 2Y07L 4JZJB 2G9HA 1CFQA 5J6GB 2A3TA 2DWTA 3OR6A 2W27A 4KKNA 1BHGA 5C0AD 4FFZL 1IJNA 2BJMH 3WKQA 3HG1E 1E4KC 1TU2B 5AW3B 2X6MA 3FQWA 4FFZA 4TSAH 2X9WA 5F7LB 1OKEA 4P5MB 4KKAC 1NGPL 4IGBB 2AJZB 3JWDL 3L4YA 2OR8A 2UV3A 1QLRA 4NKDB 4CDHA 3NTCL 2R2EB 4DUVA 5AW6B 1RIVH 3LEYH 5D1XD 3GSNH 3JTSB 4FNLL 1B6DA 3EKCA 2DQTL 2NZIA 1P4IH 2NZ2A 1VKXB 4LSQL 3IXAB 4BM7A 5HHOE 3GSRA 5I26A 1Y8AA 2EDRA 1ZLEA 2NCMA 3N44B 1TQCC 4MDIA 3G6DH 4WHTB 1WBXA 4YDNA 3EAKA 3FB7A 4FQXC 5BRPA 4WUKH 4O00A 4NC0B 1J9SA 3C09B 4PJXF 4PJ9B 1B0RB 1FBIH 1NCNA 4JZNA 4AVHA 4KFZC 1LP9A 4O4YH 1AGDB 4JDEB 4NWTL 2L7QA 5KKZB 4OJFH 1MAMH 4U1NB 5KYWB 5F89A 3NXSA 1M71A 1TFHA 4K7PY 4NRYB 3TFKC 3VGEA 4IKNA 3CVHB 1M9WA 3GC3A 3HAEA 3L7EA 1OAUH 1HQRB 5GZOC 5B4MD 2BFVL 1HHJB 4OF6A 3DA0A 4XMVA 2C9SA 3O2VL 3ARTA 4JFXB 2V9QA 2W9EH 3MJ9A 5DFVD 3UTSB 3ILEA 5TJHA 3UCQA 3CFDB 5LCVA 2NPSC 3L35A 1A7BA 3D5OF 1MI5D 1U95B 4HF5H 2VDKH 2X1XR 5C07E 4AL8C 4U1JA 1V3JA 5BJTA 4P5TA 4U3FJ 3A4DA 1G43A 2GTWA 2YXFA 3ZDZE 3O81A 1MHEB 1SF5A 1YPZE 1IBYA 4OM1H 2CDGB 4MZ3A 4JLRA 4NKIH 2VXVL 3BAYA 3L81A 2RMZA 5DR5L 1V7MH 2WXQA 4NNXB 2EDTA 1G7QB 5GRVL 2WPRA 2BY2A 1UACL 4W4NA 2H6UA 4DKFL 1AKJB 3MLVH 2DJSA 4HKBA 4D8OA 2G9HB 3LN9A 4PJ7F 3S8FB 2FX9L 3OF6A 4HHAA 4ERSH 4TT3H 1QSFB 5L6YH 5DHYA 2L5GB 4MJ5A 4BH8A 2VITA 3MDJA 2JWDA 3S35L 2WPGA 1T1WB 2BNQD 2NNCA 2GQHA 2YD4A 4DZ8A 3V4QA 1CYGA 1RZJL 1S9VB 1KTKE 2DV6A 2QGEA 1EJOH 2XN2A 3IDNB 5KTBA 4YHYB 1JMBA 2WZ5A 2G0KA 1N9PA 2Y7SA 4BBWA 4CADB 1GU4A 2ICWI 1DANT 1TQTA 2EUVA 5IMOA 4CKVX 5GGSB 2DDQH 3FXIC 3S37L 3SJVD 5KAIE 1HH6B 1RJYA 4PRNA 2X2IA 3I6GA 3L72G 2EEXA 2ZPKH 4JPIB 3OZ9H 5JW5B 3UIZA 2E7CA 3MBWB 4FD0A 2OJZH 5BMFL 4L4TB 2XYCA 1C7TA 2NY1D 2NYZA 3TYGH 2VDQL 1IV8A 2XA8H 3NN8B 5J8OA 4G82A 1PGJA 2KLVA 4F8NA 1NPJA 5E8EA 5J12B 4PJIE 2DQGH 5L2JA 1Q0XH 1GJIA 2Y1VA 1A22B 4IL6X 3K2UH 4LKCA 4IBZA 1TYEB 2EQDA 2PR4H 2R1XB 3CFBA 5I1EL 1QGKB 4JRYB 4B9IA 1KBPA 1HH9A 1QUNB 2CDEA 3N42B 2O01H 5EIVA 2Z6FA 3RBGA 5T3XE 1ECZA 3FF8A 4N0UA 5ELIA 2ATPB 1XH1A 2CWRA 1UENA 5IHBA 4OZGA 1GPOL 3BXNB 1WC7A 4P5SA 3W2DH 2R0WL 3T2OA 4YDIL 1MZYA 3P9LB 2KS1B 4MJHA 4XI5D 1AOZA 4QRPA 4L5FE 1ZA6B 1XZ0A 4MRBA 2MTAA 4WV1B 1KIPB 4L48A 4AGPA 5T1JA 3M1OA 4M62L 2R44A 3CDFA 1RHZB 1D5MB 1MFMA 3ZHKA 3U30B 4GP8B 4XVTL 2PO6D 4O02H 3L3GA 4LSSH 2KT6A 3VMYA 3RVVC 3C12A 4JO5A 1P84J 3UMNA 2WWKT 5DJXB 2IH1B 2Y7LA 1AO7D 3CQQA 2C4XA 4J28A 3HB3C 4U6TA 1GL2B 1UCBL 1AE6H 3CVHA 5EU6E 4UYPA 3U0PA 4OZFH 1NSNL 4A2FA 4B5ZA 4GUOA 3MIWA 1ZXKA 1MNUL 1UEYA 5KAIH 3UIYA 1TJGL 3MA7B 1Z0MA 3HC2A 4JQIL 3S5LA 3NSJA 4W9GC 3HG1A 4HUXB 5DF0A 4IRJA 1XB8A 4XNXL 1NCTA 1JXJA 4OWFA 1AGBA 3DECA 1OW7A 1ZWIA 2ED7A 1HXMB 1PLBA 1GL4B 4EUPB 4U2ZA 3X1NA 4J3XA 1PLCA 4U3XA 3VP9A 5JPMC 1N2DC 1HYRC 1TJIL 3E2HB 3TTYA 1I1AB 4AJ0A 1IZNB 3MNWA 2YSSB 3NFQA 2VXQA 4HT1L 5EULV 2D8KA 4F20A 3FQXB 3IS1X 3H42L 5CEXA 1HEZA 4Y2OA 4HMEA 3CVIH 4G6JL 1Z9OA 3UEZA 1KWGA 3BD3A 5TTRA 3V4PB 4GO8A 4F7PB 5D5ME 3O8XB 3OKKA 4L74A 4JG0H 5LBSL 4ZMPA 3DGDA 3WELA 3CX5I 4S1QH 4KDTA 4GBXC 4XP9H 5JXED 3WBDA 3UO1L 5IFHL 1IGML 1PZ5A 4ZO7A 3AECC 4P48A 3SDDD 3LN5A 1DVUA 4UTAH 3NABL 4RVBA 4X99A 2CLZB 1QFUH 1WMKA 1NUGA 1XIWC 1U8QB 4L1HA 3RPIB 2G60H 1NTZK 5B3SB 2PMZA 4P46D 5F9DC 3LKSB 4XO8A 2DB8A 4P46B 1L9QA 2MEJB 3TEYA 4ZOEA 4XMWA 1U92B 4QRUB 1HXMA 1SPDA 2EDEA 4LSTH 1UWXK 5AW8B 1JB0J 4LSRH 2QKIA 3FQTA 1HIML 3IWUA 3BSZA 1II4E 3X1BA 1QASA 2KL6A 1JHKH 3M1BB 4N5ED 2JJVA 4NB7A 3TIDB 2PW2B 5IESH 3EFFB 3RX7A 1YPZA 5DJ8B 1T8ZA 4F8QA 1SUJA 4M1DH 1A6AA 1RERA 1TLMA 2K6WA 1AI1L 3C5SB 5C9KA 5AVYB 1DVTA 1QLEB 5AG9A 5DURD 1YAZA 2WXJA 1KYDA 2W59A 2J73A 3LS5H 3NJGA 3P4LA 4DQOL 5C0BB 2DQFB 1A21A 2LLNA 3JZ7A 4F37K 1ZMYA 3O8XA 5KWYC 3S88L 4XE5B 3C8KB 4HSQA 4LP8A 1JNNL 1R3KB 1XEDA 1L0NK 4XXWA 5DWUL 3PAYA 2HT2D 3WNJA 1I1CA 1UH2A 1EA9C 3ARDA 2IGLA 2X1QA 2QBWA 3GI8L 3PL6B 4H40A 5D9SB 3OMZA 3PS6A 4YJZL 3U0TB 3MNVA 1ZT7A 3CXHJ 3HC0B 4AL8H 5I1DA 3UFIA 1RE3A 5ECJE 3MJ7B 3TFBA 4DTGL 3M9HA 4XX1G 4OLWH 1JY2P 1NQBA 4GQRA 5EA0H 2GJ6A 4MDJA 3BIKA 3KPPB 3TYGL 3C9IA 2C5DC 5I6KA 4JQIA 3WLWD 1SLUA 3HNVH 3BH8B 3KPEA 3B4SA 2PWGA 1J5IA 2LR2A 2DQGL 1D9KB 2NNXA 4M8RA 1JO5A 4XMPH 3KGSA 1MXGA 1OF0A 4KO7A 2OSWA 5LNEA 3TNMB 3L5XH 1Z1WA 3QCVH 4PS4H 1YJNP 2OYMA 4HUNB 4ZMAT 3KPMB 3MGAA 1ZWIB 4C59B 3IFNH 1AR1B 1MIEH 4G6AD 2V2XB 1FAIH 4RZKA 3WY1A 2F74A 2WXPA 2DMBA 2H2PD 2ZXDA 1HCFX 2J88H 3SPVA 4ZFFA 3TV3L 2XDJA 3RWGA 4TRPH 3BZ5A 3QQ4B 4UTBH 3LHPL 1WT5C 1ZGLM 3TZVC 3JWDC 2ITDA 2H3XC 2QELA 4LEXH 5A1AA 3RJOA 4L8BA 3X3GH 1MW1A 1H3UA 4O4YL 3MRJB 5E2UH 1IC7H 3RJDA 4J8RA 1PDKB 1UOWA 1FIEA 2G5BA 3UTPE 1FIGL 1IFJA 1FZOB 3MXVH 4OLEA 3WEAA 4DP9X 4IBUA 5DJ2A 3FT1A 3NACH 4RFEA 1TQBC 3B7SA 2EKSA 3QAQA 4NAJA 4JL2A 5D1ZI 3A0BE 1MW0A 3BASA 2FRGP 4I0PC 2G2RA 4Z7UE 5DD6B 3FN9A 5EO9A 3TO4A 4AH2A 2FECL 4EO5A 1PG7W 4QLRA 2Q6QA 3EFFA 5K9OA 2OA9A 1VCAA 2WV3A 3VGDA 1HEHC 3C1LA 1FHNA 4FG0A 3RIFK 2DQUL 1UT9A 1B4LA 3KYKH 5D1XB 3RZCB 3F00A 1ZEAL 2IOMA 1RJZA 5CCHE 4AGNA 3GSXB 2D0GA 3R2PA 1FVCA 4P5RA 2VKWA 4BSVB 1CLYH 3QZPA 3VFNB 4I0PD 5I8CA 2W0FB 4IGBD 4RDQF 3UTTA 3K71A 3KWWB 3HB3D 3AQDA 2OV0A 1XQ4A 4YBQC 3GSVA 5KZCB 5CGMA 1RSYA 4F9LA 1IAKA 1B3IA 1DQDH 3IDIB 4U6YB 2YD6A 1Q72L 4HA1A 1SQVD 1ERNA 4HJ1A 1BW8A 5I1HH 2XACC 3H54A 3L73D 2CDFB 1THCA 3RK2C 5KVEL 1KC5L 4WNQA 5AVRB 3QNZA 3G7TA 1LEKB 4CC4A 1FZCC 1TSHA 2BFVH 4HJJH 1I8LA 2VLJB 4FNUA 4NYLB 5FGBC 1NTKE 4WF7A 4RA3A 1B0GA 3C9NB 3QUHA 2HJFB 4J3WA 3KYOB 2XJKA 4NUGH 4ZUTB 4ES8A 1CVSC 5DJ6B 4JFPA 4MDJB 1KCRL 3CK0L 1MNNA 1JP5A 1QBML 2FAUA 4MSWA 1XGUB 5BV7C 3H9ZA 2BSTA 3E6FB 1BAFL 2A99A 2IVFC 4EIUA 1MJ8L 3WNPA 1Z5LA 2WVRA 3MKKA 1X7SA 1VL2A 1U7JA 4WI4A 4AUYA 2B20A 1C1EL 4AQ8A 2XY2A 3EFGA 5J3HD 3EJSA 2YOAA 1KOAA 2H8PD 2EADA 2VLRE 4POZC 2A73A 3MV01 1G9MH 3K74B 4PGJA 1LTTC 3QVAA 4MA7L 3PGCA 4CN1A 3CXDH 3GMNB 1T1XB 1OL0A 2RIKA 3UROR 3BZDA 3ETBF 4W68A 1M6OB 3MRDB 4MDIB 1MI5E 2NSXA 1L6ZA 3LMJH 1S7UB 2J7LA 4HCIA 4GKGA 1C8PA 4YXHH 1SFCD 4PQXA 3GZQA 2XIDA 2W90A 3TA3B 4MKTA 4NQXB 3NQKA 5MEOB 4H1LB 2BXZA 1AIZA 1CYXA 4AGQA 1YUHA 3L4TA 2FX8H 2A4ZA 4MBRA 5DFTA 3V0EA 3H1HG 3VH8G 2OK0H 2ICES 2WYZA 3QS2A 1HKLH 3VRIA 4WFHD 3GUFA 4R5TA 4OW6A 4UAOC 2N4IA 4JBSA 1D7DA 3ZYIA 1MLCA 1U8IA 4IK6A 3WE6B 3CXHH 1U3HB 3VTAA 3WIFA 4OCLC 4J2XA 3VYPA 4N2BA 3TBTB 2XQBH 3OD3A 2BVQB 5DYFA 4NKMA 2DQIH 4GT7A 4JFXA 4ZPTA 1D3CA 2QV2A 4JFUA 4OH2A 5FGRA 1D2PA 1NWPA 2XWBA 1T1ZB 2GCYA 3NJVA 5LBVA 4F57L 1UH4A 1XSOA 5KYWA 4IK7A 4JG9A 4JO3L 4Z7IA 4P9HC 4XMUA 3NUKA 3EYSL 1HXYB 1FYTA 2G3AA 4HKXB 4PY7B 4OU3A 4MB5A 4PI2A 2AXJA 3DIFB 4U1NA 3L2MA 1KELH 4LBEA 4EI5C 3BE1L 1A4KA 3U6XS 4Q74A 5KN5B 3Q44A 3FB7B 3EZ8A 1MCKA 1KJ2A 1UM6H 1R3IH 5D1XE 2DMCA 4F15C 1WV7T 3AS3A 3WIHL 5SX5H 1XFPA 4UV4H 1GOGA 2CRMA 4ZNEA 1DDTA 1GW0A 5JXEA 4GUPA 4UQDA 5H37A 2JF1A 2D9CA 4EN3B 3JV4A 4JFEA 4LVOC 1M1KQ 1IBHA 1UZ6F 3TDKA 1DQKA 3QQ3A 3FQNB 2K3TA 1QLEH 3RVTD 2IDSA 4JY6A 1YEFL 3DTXB 2EIDA 5E4EC 1UJ3C 1E4WH 1TETH 3LS4L 5EU4A 3VH8B 4BRYA 4PRNB 1S7QA 3N6YA 4ZW3A 5MP6L 4PB9L 1DQTA 5DMKB 4NXSA 1JHKL 3WS6A 4X6BB 3NEEA 1TEGA 4Z7UA 4YC2C 1OZHA 2ICEC 1KB9I 2CKNA 2YO2A 1EGJA 2AP2A 3QDGB 4YEFA 4DWHA 1UWXH 3FPYA 5HGBB 1NFAA 1VGEH 4J12A 5AWNH 2CK0L 3ETTA 3CC7P 3WUUA 3ZKXB 4JM2D 4X5WB 3EFDL 3C60B 4FP8L 3WUZA 3HG1D 2KZKA 3NIFB 5DFAA 3UABA 1Q82Q 1Y1UA 2F19H 3MRQA 1AZZC 2FGWL 4WGKA 4X4XA 1KJ2B 1R0AL 4KQ3H 2AAVA 5CLTA 5IY5B 4CSTA 4IBLT 2DM3A 2IDQA 3PWJA 1GZLA 2GBVA 4M3HA 1H0TA 1MW2A 4HIJA 4NM8H 4EOWL 4WRLA 1NBVH 1EAPA 2OMZB 2JKTM 1HHKA 3RZCD 3MBWA 4WK4B 4B9ZA 3WNNA 5D55A 1HHGB 3G4SP 1JHTA 2X70A 3LXBA 3N4XA 3V5KB 2BNQA 2V7HA 5B8CC 1BXUA 3TBTA 5E6IA 3RFZC 5APWA 4J7RA 3RHWF 5IMOB 5D70H 2FB4H 2D73A 2P4AB 1CI3M 5JW3H 1FZJB 3ARDD 2IH8A 1VEMA 5HVGB 4XVSL 4M03A 2BWDA 1VQ7P 4APXB 1HH9B 1QUNA 2HG5B 3VJ6B 4UQCA 2D2CB 1TJMA 2KS0A 2UYLB 3MC0A 4NQCD 2HJKA 2WINA 2Z31A 3L75E 1IKFH 3MCLH 1OAZL 3D39B 4X6EB 4UIMB 5SWZA 4EDWH 5I6LA 3S4SB 5K9JH 4BK5C 3WFDL 4DK5A 2HP4A 1LTJA 5LGHL 2FE0A 3KJ6L 1RK7A 1TJXA 5T1LA 1NUDA 4NZTL 2JXMB 3S97C 1U8IB 3O2WH 5JHLA 4PHXA 1TMCB 1YPZF 1JGUL 2F54D 4QRPB 1M3IA 4R7DA 4U6YA 3Q3GB 1KQSO 4JDZA 2OFQA 4UQEA 4LGSB 4QMEA 4UINL 3WJJC 4F24A 4Z3EA 3NCWA 5AENA 4G8AC 2X88A 3UCRA 3PHLA 1FL6B 1JV5B 4LDCA 2ATPA 4P5TC 1L7IL 4WWNA 2BVOA 2MCMA 2EEFA 1UJTA 4J27A 1JNLL 2J2ZA 3H3KA 3LPFA 2W88A 4HAFA 4PWIA 4YDJB 3LKPA 1S8DA 3RZWA 3JCUE 5CBEA 1JZJA 5TK4A 1ZE3C 3GMQA 3QQ9C 2BC4A 1G6VK 5DD0H 4CVZA 4PW3A 3F58H 2KP8A 1J1OL 1MY5A 1OPGH 2NY5L 5IQOA 3ARFC 3GHGC 3KNBA 4H20H 3P3YA 4P2QA 1A7PL 1DCEA 1AO7A 2J1WA 2VJXA 3P0YL 4HIEA 5LCVL 5EO0A 5AUMB 3VI3F 1IEHA 4G8FA 2JI3A 3ZKSD 4DO6A 4YDKH 1YSOA 1JFQL 1MWAB 3Q2VA 2VN3A 3ELAT 4LKXB 1UOLA 3PL6D 2PO6A 3EXJA 4RFNB 2Q6WB 3RU8L 2YARA 5I2IB 1L6XA 3A6BL 4JY6B 2QQQA 5FO7B 3U2SB 1A6PA 5JHBA 2MCPH 2X09A 1BQHG 1J18A 1LMKA 4LSPH 3LXAA 2W6JH 1U2CA 5CGTA 4HJGA 1DQML 5AW7B 4FFYA 5IJKC 1Q0XL 2WPVB 2P5ED 2PR9A 4FQQA 5FX3A 4YOKA 3ZHLA 2KHAA 4FJZA 4JDTL 1CU4H 1I8IA 4Z1PA 4ZFGL 1CD1A 3WN5C 3VXRB 4HEME 1J0IA 3HS0A 4WGVB 4XPFL 1JEKA 1OHZA 1WT5A 4B5EA 4ODUA 3KPNA 2ZSWB 3M17A 2Z0BA 2ZX9A 3MUHL 2XA8L 3GK8L 1D9KD 4LPVA 3IF1A 3HHSA 1MCRA 1YUKB 3E3QC 3ZBMA 1DQJA 3CC2P 3MJWA 5H2BA 2F2HA 1BEYL 3VTMA 1KILD 1N4XL 3RIFF 3NBNA 1E8WA 2H2SC 4NUMA 3B1TA 5E2JA 4OI7A 2DEWX 4F2MB 2Z91B 4QOKA 3QI9C 5D72H 4MD0A 1BDYA 1Z9PA 4RGNC 1NTZD 4P23A 3AE3C 1S9KC 1PMYA 3ARZA 1X0TA 1WP6A 4QTFA 3AE1C 1A3QA 3MRRB 4PV8B 4HJ0D 1P5UB 3CN1A 4UTCA 4UU9A 5EIIA 1RE4A 4K0OA 2OMTA 1KCSH 1UA6H 5IKCA 1J0ZA 1JVLA 2NR6C 2WBJB 5IMLB 1V05A 1AY1L 2VM3A 1WA2X 5I6OA 3D85D 4L0ZA 4M62H 3FU7B 1O6SB 3ZGHA 2X0WA 3STLB 4H0LC 4M4RA 1KB9E 4P06A 3VXOB 7FABL 1Y6KR 4I13B 4NQDB 2MQCA 5HHNB 3C8KA 2GIMA 2FYZA 1A6UH 2RCSH 1G6RH 4FXLA 1YHPA 3IKKA 4IRSC 3D6ZA 3D1MC 4F3FA 3D4CA 4KDVA 4PJ0H 1I7TA 1UZ8A 3FT2B 3RL0D 3VGFA 4ZS7L 1LWHA 4MJIB 2PW1B 3DETD 3IRZA 4QF1A 4TF4A 4PSPA 4WO4B 1W8OA 1X7TA 2EDXA 1JZ2A 3C5SA 2H1XA 2ZXAA 3HE7C 2VC2H 4FI7A 4Z0BH 2I1KA 4PJCE 3WNOA 2WB7A 2BOCA 4EZKA 2GTZA 2W9EL 1ANUA 1ZT7B 4CMMA 7CGTA 4Y4FB 2WSCJ 1EFXA 4AT6A 5GISH 2FYUE 4QT5B 4XE0A 4J3OH 5MI0B 2Q1EA 2GK0B 4NQCB 1AJYA 2DLTA 3O41A 5IBTH 3MRRA 3OHMB 2QTVA 3IVKB 4EOTA 2C4FU 1J1DB 1KYUA 2X1OA 5I5MA 4YHLL 2PYEB 3U59A 1MIMH 4DFIA 3QR0A 1FBIL 4FLOA 3JWNG 4GS7B 2HRPH 4O2FB 2OMWB 2V6HA 5EEZA 2IAAC 2Y9ZA 3DMMA 3FU3A 3AE2C 1BX2A 4PBDA 4Q0XH 4BQCA 4C8XA 1LO0L 4L23A 1T03L 4X8GA 3QWQB 5L8LB 1AD9B 4EMZA 3CBKB 1NMBH 3WJLA 3NGBB 3MUY1 3HA0A 1QR4A 3QRGL 3TH2T 3Q6GH 3SGDI 2WVTA 1LGHB 4IFFA 1UWEL 1KYOD 4PH8A 1WFNA 5F3HA 2D7TH 3TT3H 1J88A 3PABB 5D93B 2NTFA 2JKJA 3H32A 1A64A 4FMKA 1CG9A 3T0EC 2JKWA 3IDIA 2FJHB 3N91A 3QXVA 1MREL 2W38A 1N70A 4KZEL 3P73B 1BFTA 1LWUA 4KH9A 1PZ2A 4XNMA 5AAWC 1QVOA 3HS0B 3L74J 4NAMA 2OW7A 3MODL 4J3BA 4AEHL 4UB0H 1KPVA 4TNVK 2GVYA 2Z5HA 3CZFB 3WY2A 3G6JF 1TG8A 1KB9J 2UZIL 4P9HH 4YBHA 2OYPA 4WY7L 1IRAY 2APSA 2PXYB 3ABMB 2TAAA 3EBAA 4H13B 1MI5A 3RKDC 3UAJD 1I7UB 3D85B 4G7YL 1U8PB 3CCEP 4NJAL 4F2ME 1S7WB 5FCUL 1CD9B 1CFTA 1JOIA 4HJIA 5JIHA 4ZFOA 1JZHA 5IEHA 5FLVA 2J43A 2K8MA 3QWOB 3LXCA 3TNNA 1NOLA 3QEQD 4X6DE 4KK6C 2V8MA 3GGWB 3PE9A 5EF3A 2UXTA 4LLVB 3WTUA 4XHJD 3QIBA 4IOSA 3L70E 4JN2B 4LHUG 4GSXA 3MJ9L 1HAUA 4Z95L 5A2IH 4YL4A 1QD0A 2J4WL 3WEOA 1QTYT 3KEHA 4N24A 5AVQB 1AR1D 2JKSA 1VERA 1FVEB 3L6FA 2AXWA 4HH2A 3SE4C 1NM4A 4IM8A 2P8PB 3O3BA 3PV7A 2X7LB 5F0LB 4DN3L 4F37F 4R7NB 4NQDE 1NGYB 3BD5A 1K72A 2KBGA 2ZONA 4UM9D 3S96B 4WTZG 3SYQA 4HGMA 4ZMLA 4DP1X 2GW5A 4OFDA 1X7QB 5CGYC 4CN6A 5I66A 2NY6B 2QHRL 1GZQA 2J1XA 4XOBA 2PXYA 2GABA 3FOLB 1HSAA 1HHJA 2C9AA 1P84D 2JQMA 3ARBA 3G9RA 3EJZC 2FFDC 1HINL 1MCOL 2XKNB 3LD8C 5IGXL 4YDLC 2H7HA 4E9VA 3PP3H 2KMWA 4U6HA 5E2UL 3FMGL 4KOCA 2B2XH 2BOCB 1U3HD 3D25B 4QYOB 2WD0A 3F7VB 4NQXA 3D9AH 3IDGB 4JRYE 3WGVB 4F7TB 5CCGC 3INUL 3E6HA 1WGVA 5I75C 3B7YA 4F91B 3D12B 3NRQA 4KXAA 3PAUA 3OXSA 5HSFA 4IDJL 1UQSA 3V6ZA 3II2A 2WSKA 4DKEH 3FCBA 1MDAA 1QVOB 4YE0A 1TTRA 4FZ8H 5D2NB 4FA6A 2EIEA 1NC2B 2VERN 3TPUA 5D1XC 5LQBL 2X0UA 3LNDA 5D1QE 2IYPA 3W39B 3B2DC 3TC9A 3D2UB 3VD4A 4GXUM 2XWJB 3LX9A 5IW6B 3L4CA 2AJYL 3FHEA 3SPIA 5JPNA 1OSZB 3CE1A 3QUML 4HIQA 2J20A 3EOBA 4TM9A 3I75A 2CKBL 2NR6A 3K6OA 3GRGA 2GAZB 4M93C 2WLLA 1C16B 4UINH 4GQPH 5F7HA 5EU6D 4Z7QB 5CJOH 3PUUA 2E27L 5EOQH 1HOEA 2DEYX 4XPFH 1YECH 2H1PL 5F93C 3CSGA 2BSEA 4R4ND 1J48A 3MLZL 1D5ZA 3EYVB 3RFZA 1OZTG 3V4UL 1YNLL 2YZ1A 2PLTA 4JY4B 1L9NA 3RURA 3U0WH 1FJ1B 4N9GB 2CBPA 4X2UA 5L9DH 5ITBH 4WO0A 3DBSA 2FTAA 4QCIA 3IU3B 2XV0A 4NBZB 1L0NJ 1PD0A 4UT9L 4UZUA 4HC1A 1PY0A 1IC2A 2NW3B 3WFZA 2O1JA 4O2EB 2I8DA 1R4XA 3HTLX 1D7BA 1UG9A 3R06B 3LKOA 5EPMA 4A7UA 2X3AA 4GEJA 3RNKB 3SFEC 1PZDA 2F7OA 3Q48A 1J1DC 2VYRE 4G9FE 1W5CE 4ZYKA 1AZCA 1FFNA 3DV6B 2J44A 3FWNA 2VMJA 3KGUA 5KVDL 5CKGA 2YKQA 2PCFB 1DBAH 2MKWA 4Z0XA 1MLBA 2J55A 4AVIA 5IW6A 3ENEA 4OGXL 3RWCA 2R3CA 1JTTA 3VUAA 1I3UA 1Z9LA 5C86A 2Q3EA 2R59A 1WIPA 5FKAA 1S5HB 3CVCA 4YX2L 2N7BA 1KB9H 2HB0A 1KILC 2BSBA 3HG0A 1UVQA 1LK2B 3BMVA 3LVEA 2X4QA 1X3DA 3E80A 4JFOA 5JZ7C 3HG1B 1MXDA 4HUXA 3V6BR 1RULH 1YQ2A 4EI6B 1Q0EA 1AFVL 4M7LL 4APQA 4IDLA 1RZJH 4LSTL 3V2RA 4FFTA 3WO4B 1GGCL 2XYBA 3OXSB 4I9WD 1WF5A 2A74B 3SDCC 3PQYD 1JNHA 2QDVA 4W7ZA 4FJYA 4E5XG 4QRRD 4M3KB 3FTUA 3N55A 4KGJA 2I85A 4PS8A 4WI0B 5CLWA 3MRNB 1OW8A 5KLVD 2WMPA 5JQ6L 2DYSB 2P45B 1BQRA 4QD2E 1EQ7A 4R0LA 4MAYB 4JGJA 1E43A 3D0VA 3IJYB 5DD3H 3L71J 4BEIA 5A2FA 2A06D 3X12B 4MYPA 4KTYA 4PJDE 1O5PA 2CO6B 3BQUC 4AJYV 4X7CC 2O5YH 4MD5A 3GXMA 4MCZA 3S0PA 4YLCA 2N56A 1RSFA 4LCUB 2YPVL 1BZ8A 5DEJA 4APQC 4NC1E 2OXHA 4F1SA 2SEBA 1DL7H 5A16B 3HN5A 3MV7E 4CDGC 1RZ8B 3DC0A 1HKFA 2FLMA 2HJKB 2IXQB 2WINB 2Z31B 2W0PA 5FKAB 3PWPD 3H55A 1LP9B 4PI0A 3UYPA 1JM0A 4XXDA 5GRUH 1TJGH 3GWJA 3GSWA 4PW9A 3D52A 5I19H 1B4RA 1RV6X 4P4RB 3WXWH 3W81A 2VCOA 2FATL 4KRPC 4MA1B 2LLGA 4XP4L 2ZE0A 3VI4A 1FZKA 1WCBA 5HJ3B 3AU0A 2VN7A 5FYJE 1N59B 2KIKA 5DRNB 3P4OA 3CWBD 3VACA 3TF4A 3QK0A 4H1LG 5D7KE 2VXSH 2YMXH 3DDGA 5AB2A 5I5IA 2XBDA 3B5NB 5I1IL 4IFDK 1Z9MA 4KWUA 4FFVD 2FEEI 3DX3A 1UXSB 1JRHL 3PFQA 1QYGH 3U2JA 3PQYE 4L9LC 1TDQA 4H8WH 4NGHL 4S1DD 5F70A 3CWBJ 1LEKA 4BFIB 1FGVH 3CLWA 1TEFA 3UP6A 3IJ8A 3EFDH 4ODWB 3U6RA 5JIKA 1VLXA 5MP6H 3ISRA 5JDSA 4NNXA 5E94B 4G8GA 3WNKA 3QIUB 3IMUA 3RGVB 4FKHA 2QQLH 3H6AA 3KYNA 5K59E 3E1ZA 1NCUA 4JQ0D 2OYLA 4QXGH 3CCMP 4HIHB 2BXYA 2HTKD 2R9HC 3OPZL 1XWVA 2ZUVA 3CZJA 3VRLF 3VXSB 2H6PB 2GJZB 3VFOA 1KYOI 1DLHA 1A3ZA 2EE9A 4UYQA 1E4XI 2OTWB 3BAWA 1A6WH 4I77H 1FSKB 4MKMA 3TT3L 2YKKA 2GEQA 1JY2N 3EF4A 1HJCA 2PF6A 3B2PA 4WJ5A 3VXRA 2AXTH 1L4AC 2E76C 1MQKL 4JFQB 4PJIB 5C0IB 5IHZA 1LVEA 3GUTA 1HHIB 1UFUA 3QQ4A 3BRDA 4H44C 3TONA 4W4OA 3UJIL 4BDVA 1DDHB 4Z7VB 3MMEB 5EFIB 3TFKD 4NPYB 3DPDA 3TH4T 1I1RA 5I73C 4FMFA 3L9BA 3QZLA 1NTME 4HOMA 5DD1H 5DEZA 1ZXGA 3CGTA 5I6PA 5L4IA 5HHVL 4ZW7A 2VL5A 5B3JE 1QSFA 4NI6A 1M57B 2N0KA 5GZOA 1A0QH 4H0LB 3B5ND 3GRWH 1LTIC 2XJLA 1T1WA 2DMGA 3IMWA 1A5FL 1D9KA 4ZMXA 1KQFB 1DUYA 4JBZA 2SPZA 3AG4B 1AE6L 3RUGB 4LCYB 2E75C 3WSQH 4YXHL 5B7FA 3RDTB 2XTJC 2GSGB 4PRHA 2CO6A 4GAFB 4HKZB 2PKDA 3US0A 3E9TA 1IZJA 3ZPDA 2IAMB 1HZHH 4MA3B 5AOMA 4F3FB 3NJXA 3KVPA 1TPXC 2W92A 4KJQD 3BFWA 5KYNA 4I89A 3ZJAA 5IMMB 4HB1A 4HJTA 3V9FA 5KVGL 1SRDA 2YN3A 1S7XB 1NAMA 2UZIH 4OI8A 1BMZA 5DZLA 1GIGL 1EC5A 4QHUA 3L70D 3KM1A 2X53A 4PRAB 2IBZY 4JFDA 4X98A 1EDJA 1ID2A 1VFMA 4KJYB 5BU8B 1GYUA 5GJTL 2IFNA 3Q43A 2GIYA 1P5UA 5FV2A 2CO3A 1AYRA 4TUKH 5A2LH 3X13A 4DF9A 4XC1H 3GMLA 4OFQA 4F5CA 1RUML 4KHXA 1MEXH 4GQQA 4YHNA 1ET8A 3MKGA 2QJYB 2N1TB 1GZHC 1RK1B 2IH3B 4PWKA 4R5XA 2H6OA 3HZKB 4JPVH 4NERA 1VPOL 1JY3N 3BKYH 4ZOBA 4NNYA 5CN1A 3V52L 4IOIA 4UT6H 2KLRA 1KGJA 2AEWA 3QJTB 3V4WA 4N0CC 5IJCC 1KCVL 3D69A 1V10A 4R8WH 1BVKA 2WBWB 2YAEA 4FQCL 4WFGE 3MCG1 2FT7A 5D2LB 1KIUB 1XAKA 4OSUL 4OLVH 5D4JA 1TT6A 3NIGB 2VE6B 4L8SC 3SDDB 3TYFA 2W80C 3IJEA 4O02B 1AQDA 3TJHD 4V1DA 3F65A 3L45A 4RISH 3KCPB 1MJJB 3JYBA 4LL1A 4PJDA 4Y4KB 3TBSA 4ETQB 2QJDA 2EIZB 4KHTL 4J3TA 1JCCA 3EO1A 4XMPL 3KZIE 5DXWA 1IFGA 1IM3B 4HCRH 2MIZA 5KTEL 1G6RB 3FT4A 4HK0B 2EO7A 4K7PX 3B5HA 3K2IA 3FQ1A 4WI7A 3TOPA 1HZLA 2O6CA 1KUMA 3KM2A 3LZFH 4Y2DB 2YGQA 2ADJB 3F12A 4UQ2B 4LFHD 5KW9L 1XO8A 4Z7VA 1GRWA 3V6OA 2HG0A 3FU0A 3MUGA 2ZWNA 1T4KA 3Q5OA 3D3VB 3CC1A 4YL9A 3ZYJA 4JFPB 4CVXB 1EZSA 2C3VA 1ESOA 1BVLB 2DIJA 2Z4TA 3VNZA 4I48A 2O93L 2GB2A 5HI4D 4AZ8A 4Y19E 4RX4A 3S4SG 4H8WC 2HYNA 1T3JA 1JBJA 3G5YB 5IZ7A 1U36A 1P5VA 2HODB 1PG7H 4JY5L 5KOMC 2A9ML 5H94A 3THML 1FLRL 3WIFB 2I7OA 2DQUH 4KKRA 3BVDB 4ASVA 2VSCA 4FXGA 4HP5A 5I71B 5AZEL 5EZPA 5JIMA 3H1LE 1J8SA 1D5XB 1DR9A 1JDAA 3MNWB 5APYA 2MCPL 2AEQH 1DBMH 4OZIE 4YDVA 3DARA 1AHKA 1N67A 4OCWL 4GO9A 1U3ZA 3RY6A 1JV2A 1OVZA 3QJRB 2E3VA 3JWOC 2ZOOA 4GQZA 2Q76B 2LW3A 1DSFL 3GT6A 4LLUB 4WGWB 4NQVB 1JL8A 4KK9D 1S7UA 4FEMA 1BEYH 2R69H 2ADGB 4DW2L 4TLTA 3GLDA 1HZKA 1OQOA 3DO7B 2XIIA 2WVUA 1ULVA 1UD8A 4HFUL 4IRSA 1IGCL 5GGQH 5I1HL 2M3EA 2PNDA 4K94H 3MJGX 3ZE2B 2JB5L 4ZFZB 4P2RD 4J3OC 2RKLA 4XAWL 3SPCA 3TYFB 4P2YA 1M7DB 1VHPA 4XN4A 3SKMB 4HJEA 3PJSK 5CNHA 3ZDZF 3PDDA 5LGHH 1BEXA 4X9IA 4GRMA 4IEFB 2W60A 3HRNA 1SQXG 1WZ1L 4YBQD 1HSAB 4GP4B 1TZIA 4B3VA 1Z3GH 4Z7WE 5KSAA 4A7SA 5T1KD 1YO4A 4K3JH 4S0TD 3NAAH 4ABQA 2FH6A 5FIEA 1FDIA 3GEFA 5CP7B 5I1GH 2X87A 5F1NB 2W95A 3IDGA 1UH3A 1H8AA 3CDZA 4KHXL 2R2BB 2IALB 2YLHA 3ZOAA 2WTRB 4H44D 2C1PA 1ET7A 1NCAL 3M45A 4YHYC 1LGVA 5G5DB 3PF2A 3NAAL 5DQJA 2JCCF 3N50A 3ZDYE 3H2PA 4CL7A 1QSZA 3LW5H 4RGNE 3APMA 3QISA 1L4AD 2E76D 3BN3B 1A6TA 2XETA 4XBPA 2HCZX 4XP1L 2F58L 2P8PA 5DC2A 5JORA 1I1AD 3GRBA 1OCWL 3FFCD 1TMQA 3S2AA 1OVUA 3GF8A 3HI5H 4AI7A 1CDCA 1SJEB 1A7PH 3MRQB 4I87A 2R2EA 2PYED 2Z7YA 3UAJC 4G7RB 3IAPA 4BKSC 1P7HL 1CBVH 1E5BA 3AG1B 4J8RB 4ANKA 4FEIA 4F7MB 1TVBA 4G8GE 2V9TA 2C9UA 4GSDH 5GGRY 3UGXA 1ZGLB 3HCVB 1LLAA 4DGWC 1YVLA 1K8IA 2EC9T 3C75A 5F88A 1GGBL 4Y4FD 5HHPA 5A6MA 1CXFA 4MNGB 5ESVB 1HX0A 2ZD0A 4KO9A 3SQOL 2WGNB 1PL3A 3CQFA 4OZGE 4Q52A 1IILE 4UNTA 3M86A 4Z7UB 4YEEA 1KB9D 1USQA 2GG1A 4DGIH 1CICA 3RWDA 4WY4C 4TPRH 2J21A 4TTDD 5ISZA 3MRGA 2L7JA 3BH9B 3BCCD 4OFYA 2ZKHH 4IU3A 4KROC 4DETA 1XCQA 1J9CT 2DQHL 2R27A 1IO4A 3AB0C 1QL2A 3DURA 4ODVL 1UFGA 4S1DC 4X6FB 3TO4B 1KV4A 1T22B 3VX1A 3A4EA 4RLDA 2K7QA 1UD3A 3CH8A 4O58H 2N9BA 1JCVA 3FRPG 4W9IC 2GKIA 2OR7A 3LS4H 1XX9C 3L71G 5E7BA 3U2IA 1I31A 4IBVA 2GAZA 2Q7YB 2R51A 1W6WA 2BCKB 1ORQB 3QNZB 5L2KB 3U36B 1IGJB 4E41D 3CNKA 5AD0B 1LJ2A 2XWTA 2GJRA 5D71L 2EYRA 4ZBJA 3U1SL 4N0FB 5ITFB 1ZTXH 4H0HB 1R5IB 2BVUA 3B3IB 4PJ5A 1JYVA 3VGHA 4XMTA 4MNQB 4YQXL 4G6ML 1URQC 4G42A 4P2OB 1XTGB 1CXIA 2QGDA 2XQ0A 1AHWC 3DRTB 5JMRA 4PWHA 2MHAB 1KGYE 5AW0B 4D0DB 4ONGL 1QWHA 3H6JA 3DMMB 3BP5A 4EVNB 2R2HB 4PWEA 5EWIH 1MCHA 3WJMA 2CG9X 2P5EE 1U91B 3B8SA 4MB4A 2BSRB 1Q81Q 3L17A 2IFGA 4GRLD 3FYEB 2O61A 1Z56A 5CD5D 4JM2A 2Y6TE 3QH3B 4AQRD 2BDNL 1FNFA 3G08B 2EVFA 3D70A 1RPUA 2E8ZA 4FXTA 3MV8A 2OTKE 5ETUB 5B1JC 1YQVH 4R90L 4PJ9A 3OAYH 2EXWD 4PIRF 5GRVK 2X4UA 3AUVA 3T2NH 3W0WE 3S3DB 1AGDA 1FG2A 1YN6B 1HOCB 1I85A 1DUZB 1XF5A 5SWZD 2OYKA 4WKZA 4L8CA 3TN0A 1MZZA 2H41A 1E5YA 4JFZL 3IJHB 1M8OB 4PG9A 2OYIA 3L74E 5I16A 3GQFA 3GSOA 3MHZA 3KS0J 4MZIA 4J5VA 4XVUD 1KFAH 3OJVC 4RETB 5KLVJ 1IC4L 4AYEC 2QPUA 1WE5A 4MNQA 4UM8A 1KBGL 3SCMD 2E74D 2Y69B 3EDFA 1GL2A 5D1ZA 1NO4A 2FWLB 4KT0J 1XCXA 3CLFH 4KK5C 4OFIA 3T0XA 2Y1AA 5DDHB 3SCMA 1DVFC 5DQ9A 4GKSB 1KV7A 2X4RA 1RE4C 4NHUB 4Z7NB 5C09B 4BA8A 3EGSB 1FCCA 2IPUK 1G7PA 4D7PA 1WFMA 1BD2B 3GGWA 3VFVB 5PAZA 3L9RB 1PSKH 3DXAB 4K2UH 4X8JA 3ZT6A 4R8WL 5DO2C 5TQ0L 1M90Q 2IH1A 3HTKB 1R34A 2B59B 4GT1A 3JWOL 2GSIB 1SQ2N 4YGVB 4MYWB 2D03L 3UZVB 1JOCA 2CGZA 1NANI 2I27N 4M1GL 2IBZE 5ACLA 1NTZG 2FJFB 2A6KB 2B16A 2AJVL 1H3PH 4LQFH 5BQDA 2Q7CA 3T6ZA 5C08B 3H7LA 1L7TH 3NCBB 3QNFA 4XC1L 3RP1A 4XZUB 4LHUB 3L3JA 1KC5H 1RP8A 1SBSH 2WB1A 3IB4A 3NCYP 4WKZB 5EBWB 3T97A 4L8CB 1MKMA 2GC4C 1T6VN 4GQ9H 2Q5BA 1P84E 1GY1A 4X7SH 4WWIA 4XBGA 3AQXA 1A8JH 1KB5A 1I7RA 1Q90A 1L3NA 4LVNB 2P49B 5D7JA 1YMME 3QT2A 5JHDE 3H1HE 2XQYK 1BFSA 4H25A 1PCXA 1NFDE 1VGEL 5DHDA 1F97A 4NO2B 4PJ7B 5B3NA 3AADB 2XXMB 3BSZL 3CQPA 2GUSA 1EANA 3K3QA 4FYSA 5D7LD 4ZAKA 4PJ5D 1NTKJ 1CXHA 2JJSA 3IGAB 2AZAA 3QHZL 3HZVA 5ICZA 1U58B 1N0LA 5E2WL 5AVTB 1AVAA 1DQIA 1RUPL 1Q72H 3FPXA 2N1TE 1CDYA 4WY4B 1NGZB 4Y1TA 1BQKA 4D3CL 5FO9B 2FQGA 3MLRH 2QJPC 1OAKL 4C56B 3CFQA 3TASA 1N73C 3D87B 2F6AA 4DT2A 2W07A 3NCMA 3VYOA 1A6UL 4HIHA 4WNJA 2BHUA 2X5PA 2VERA 1UIXA 5D2LF 3OAZK 1CYWA 2DICA 4XAKE 4LMQI 4F9LC 3B83A 1WHPA 5EIIG 4B60A 1L3WA 2E6PA 5AVUB 3TA4D 3M6DA 4PJDF 3CK0H 3FUHA 5AW1B 1A02J 5LGYA 1N5AB 1TZOA 2J6EL 1GTFA 1VA9A 1J7VR 3MU3A 2CGYA 3HN8A 1A7QL 2DF3A 4ONHB 1QACA 1JZGA 2JKNA 1E5WA 4TLUA 5EEYA 2ODIA 3GO1L 5IBUB 3TBVA 3VGGA 5IJBC 4IOIH 2WQSA 1EHNA 1MCWW 1HKLL 4BSWA 1DN0B 3ZTNL 2VUYA 2BZCA 4QXTA 4UT9A 3X3GL 5JIQA 4O2FA 3N42F 2VW7A 3A22A 3T0BA 2QFRA 3ZVVA 2YMYA 5FUOL 1SN5A 3BKCL 1UXWA 2OMYB 4LCYA 3WXWL 1E6OH 3ZZ1A 3KDPB 2J56A 1TZHA 4I1RA 3RWFB 2WLKA 3BKJL 4N5UA 3FF7A 4J3OD 4Y19B 4PJ8A 3QH9A 1ZVSB 1JG9A 4OLYL 1U8OA 4NHCL 1G6RL 1MH5B 3RA7H 1DL7L 4FYQA 2JXMA 1K04A 4LRIC 4PTUA 4JFYB 1NINA 2XU9A 4Z7NE 5JR1L