5AW0B

Kinetics by x-ray crystallography: tl+-substitution of bound k+ in the e2.mgf42-.2k+ crystal after 55 min
Total Genus 53
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
53
sequence length
281
structure length
268
Chain Sequence
FLGRTGSSWFKIFLFYLIFYGCLAGIFIGTIQVLLLTLSDFEPKYQDRVAPPGLSHAPYAIKTEISFSISNPKSYESFVKSMHKLMDLYNESSQAGNSPFEDCSDTPADYIKRGDLDDSQGQKKACRFSRMWLKNCGYAEGKPCVVAKLNRIIGFYPKPLKNTTDLPEELQANYNQYVLPLRCAAREKIGSIEYFGLGGYAGFPLQYYPYYGKRLQKKYLQPLLAIQFTNLTQNMELRIECKVYGENIDYSEKDRFRGRFEVKIEVKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Na, K-ATPase alpha subunit
publication title Sequential substitution of K(+) bound to Na(+),K(+)-ATPase visualized by X-ray crystallography.
pubmed doi rcsb
molecule tags Hydrolase/transport protein
total genus 53
structure length 268
sequence length 281
ec nomenclature
pdb deposition date 2015-07-01

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00287 Na_K-ATPase Sodium / potassium ATPase beta chain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.170 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 5aw0B01
2.60.40.1660 Mainly Beta Sandwich Immunoglobulin-like Na, k-atpase alpha subunit. 5aw0B02
3VYIA 2QM8A 5APTA 4XE5B 3T97A 3P7KA 1A02F 1GK4A 3HE4A 3P8MC 5AW1B 5APQA 3KDPB 3UIAA 1GD2E 4GKGA 4JYCA 2WPQA 2WPRA 3L37A 4I2LC 1OXZA 1GK6A 1GU4A 1HJBA 2ZFCA 3V5BA 2WTYA 2P2UA 1HUCA 3MGNA 5AVWB 2Z5HA 3V4WA 2WT7A 2W6AA 3OAKA 2W27A 5AVUB 5AVRB 1FOSF 3P32A 3VN0A 3SWFA 1J2JB 1H8AA 2R3CA 1JUNA 5AW7B 5AVYB 2N9BA 2Q7CA 2P7JA 3M06A 5AW8B 1S9KE 3TK1A 5APVA 5AVXB 4C46A 5AW2B 1T2KD 3TNUB 5AVZB 1IO4A 4KHXA 1SP4A 4GT1A 5AVSB 4EOTA 5AW9B 2VRSA 4RETB 4M3LA 3M0AA 1H88A 1NWQA 3LIEA 5CMZA 3TNUA 3I5CA 2E42A 2JJLA 1MUUA 4DZOA 1FOSE 3O8ZA 4I6MC 1S9KD 4AUWA 4LC1A 3VMZA 3LIDA 5AW0B 3MD0A 1A02J 4HYTB 4AYCA 5APXA 2YO2A 3A3YB 1MV8A 2R5DA 2P67A 2ZXEB 3NTNA 2E43A 2IPPA 1GU5A 1MFZA 5APUA 5AW5B 1HWTC 1CI6B 1FAVA 2XZRA 2WWWA 4RESB 4AQRD 5APYA 3WGUB 1KQLA 2KP8A 5APWA 2C9NY 3M9HA 4C7NB 2XU6A 2R32A 5AW6B 1GTWA 3A2AA 3VTPC 1JNMA 1YYCA 3IR9A 1H89A 5AVTB 1CI6A 3V4QA 3A5TA 5APSA 3WGVB 2R5BA 3L35A 2Q5UA 5AVQB 3L36A 1X8YA 3HE5B 1G2CB 3KQGA 4C7NA 1T2KC 3A7OA 4JYBA 2C9LY 2WT7B 3VMYA 2QM7A 2Z5IA 1OWAA 5AW4B 3HTKA 4B86A 1CSBA 3TYYA 3NFQA 2WPSA 2Q3IA 3NXSA 3HE5A 2BASA 3M9BA 1SLQA 3M91A 1NAFA 1GZLA 2H7HA 3NMDA 3HE4B 2YO3A 1HBWA 2YNYA 5AW3B 3M0DA 2XV5A 5AVVB 3VMXA 1CZQA 1DH3A 3B8EB
chains in the Genus database with same CATH superfamily
1VQ8P 4WK2B 5DEJA 1GDTA 4HC1H 4WFGD 3U9WA 4IFMA 4QRRE 3JC22 3PIQB 2IWEA 3H1KG 1BDCA 1CLOL 4FNRA 2XICA 2ZX9A 2R56H 1TZIB 4UB0H 4YNYA 2ZXXA 1M57D 3BRVB 2GUOB 3ZKNC 4LQFL 4B0MM 4NRZB 4YDKL 4H1LG 2OMUA 3FF8A 5FK9B 3CXDL 1MFUA 3BZEA 1AFVH 2Z7ZA 1H8AA 4H25A 4JFXA 3FQUB 1G7IB 2W65A 3D6YA 1S4IA 5JHAA 3U30C 2JKVA 4RFOH 4NQEB 3UYOD 4ANXA 1X5FA 3OKEB 3TFKD 2R2CA 4YSOA 3ZBMA 2IV8A 3T0AA 3D4CA 3QUMB 2FFDB 1M3IA 3NCEB 3OB8A 2DWSA 1KTKE 4QTHA 3RE0A 3ZQWA 3APNA 3O11B 1JGDA 4X4XA 3VI3F 3B2UD 2D2CB 3FTZA 5LCVH 2NXZC 4IOFC 1T1YA 4PRPD 4TLSA 5KBNC 4JPZB 3WFBH 1NDMA 2GJJA 4FQCL 1UKSA 2AEQL 4MMYB 5D7JB 4QHLA 4DGWC 4ZMPA 1NCAL 3IFOA 2GAZA 4LRIC 1NINA 3ARRA 3BQUA 2AXJA 4WWID 2EEDA 4XNQB 1HU8A 5DUML 1P4UA 3KJ4B 5BRPA 4LOUD 1CN4A 3FZUD 1F4XL 1R34A 4UILL 1TQWA 4QNPF 2O5NA 1MHEB 1WS8A 3FOLB 3GT6A 3ULSA 3L75G 3AXLA 4PJHF 3TBWB 5D1XB 4Y19D 2E3VA 1CI6B 1FAVA 4H44B 1UUSA 3IPEA 3O81A 5B1AB 5JW5A 1MEXL 4DGYL 3ECQA 4AL8H 2ICWB 3GTVA 4CBPA 2VYRE 2CD0A 3OLEA 3ARGC 3HG0A 1INEH 5B1KA 4BQ9A 3RK2C 4NPYB 5I18L 1QOKA 3IJYB 1D5BB 4G7VL 3RPKA 1MCOH 3OAZK 1J0IA 1KPVB 4JDZA 1EHAA 3B5ND 1E65A 2EXSA 4L1LA 2W07B 1MELA 1Y9BA 3L36A 2E6QA 1FZKA 2CLVB 3CQPA 1H3XA 3V6ZA 4KDTC 5AZ2H 1FDIA 3VQ1C 2E86A 2IH1B 3L4CA 4OZHA 4H1LH 3NCYP 1NH4A 2Q8BH 3M9QA 5TK2A 1NM9A 1EGJA 1LD9A 1M56D 2UWJE 1RULH 3HB3D 3QEQA 4FQLL 4HPOL 1NEPA 4KKRA 4TVUA 3RA7H 3N04A 1IGFH 1RV6X 5FDWA 3PWVA 1WZMA 2KPNA 1EZUA 4JQVC 1JGUH 1BZ7A 5KTEL 4L4TB 5GJTL 2F54A 4UDTB 3O4LE 1CFNA 4R6UA 5AOIA 5TDOA 1S5IL 3BMWA 5I0DA 1UA6L 2B8OT 1ZTXL 2KQMA 3TU6A 3WXWH 4CMHB 5FW7A 2NY3D 3S97C 4CAGA 5BVPH 1W72A 1EUTA 4JO1H 1HKLH 3APDA 4G8FA 4HP5A 4QKXB 2ZP8A 1ZHKA 1OAUH 1RUPH 2CR0A 4PJAA 4UTBL 4UNTA 3BEVB 1MCCA 2P8LA 2Y7MA 3RK3D 5SX5K 1L4AA 4OUOA 1W80A 1H6EA 2XWJA 4HK3N 4TVPL 2UXGA 2W0LA 1EEZA 4KO9A 4YZWA 2V2TA 4UV4L 4PGBA 1SQPD 4PJIA 2QQNH 3QH3A 4XP4H 4F33B 3RL0D 4GEIA 3ARZA 2BNQE 2VZUA 4G6FD 4AJ0A 2VDRL 1MJUH 1IAII 1MF2H 1KCSL 4B95C 3PHAA 1W6WA 5KVGH 2Y0EA 4ABUA 5I76B 5BU8B 3H1HE 5EOCL 1X22A 5LVEA 3B4SA 4LO9A 2FH8A 2EIJB 4GRMB 1DL7H 1U6AL 3BFQG 4WCYH 4NC0B 4WO0A 2AXWA 4Z1MH 3CFIC 2NY1B 4Z7OE 3KHQA 3D18A 3QWOC 2ZOUA 3FSZA 3K8MA 4JY6B 4N1EA 5ECJE 4ZFOA 4XNZB 4M61A 4KJPD 2OCCB 2FSDA 3DLQR 4BKLB 1F86A 1WFNA 1GY2A 1KN4H 4QRQB 4BH7B 1NTMD 2NY6D 1JZDC 1W0VA 2YD8A 2HRGA 1F11B 1A7OL 4TVSa 3V0WH 5HGHB 3UAJA 1KBGL 2DDQH 4UNVA 4Z76A 2KOGA 4MXWL 1SQVE 2YO2A 5F1SA 4HUWB 3SGDI 3A5VA 3AE6C 4X7TB 2CO4A 3FQTB 2ZWLT 4AJWA 1V8HA 1P4IH 2X6UA 1JF6A 3H1JJ 4L4VA 5CINH 1GZPB 3D33A 2E46A 3N0AA 2C26A 3IGKA 5H4ZA 2HSIA 5LWYH 2CHDA 2DWXA 3C60B 4H8QA 3IF4A 1S78C 3BD4A 1L5GA 4HZ1A 4UQ9A 2FLRT 2DYPB 1XMEB 1FYTE 1PFOA 2ZJSH 3W9DA 4QPEA 3WGVB 3IGLA 3S36X 1YEHL 2Y5QA 1HHJB 3D4ZA 2BP3A 1WD9A 3BQUD 3NCWA 3IM1A 2WUBL 3MNDA 4ZSOA 4WVZA 4HS3B 1JYWA 2FUQA 3DUHA 3QUXA 3TIEB 4BZ1A 5L8JB 5F3BB 1CF1A 2AVGA 2P5EE 2KI7B 2XACC 4NGHH 4R84A 5FUZH 4HU8A 3EH3B 4F9LA 3O6QA 2PYEE 4YHKH 5C08B 4F93B 2ZG2A 3NRFA 1NMBH 3HUJF 4N0UB 4AIXA 4OV6F 3UC2A 4FD0A 2BASA 4Y2DB 4LEOA 2GB2A 3H1JD 3QH9A 2YPLB 5GGUB 3I9GH 5CCGC 3L95B 4U2YA 1O75A 5ERWA 2J58A 3CFJB 4X4YB 1P84E 4FXGC 2DQTL 1YEEH 4IMKC 4FHBD 2ODHA 4TQPA 4Z7WE 3W39B 4ZPVA 4HCIA 3ZYOA 4DGVL 4N0FB 4OLUL 3NCBB 3TS8A 4FG6C 4RQQA 2VDNH 3SDCC 4EEEA 2QADC 4XE5B 3N2JA 2KZJA 5JMRA 2DWDB 4AT6A 1K8AQ 3MZWB 4Y99B 1B3JA 3GMMA 3F00A 2LVCA 5HI5D 2ZG3A 3QEQD 1OAXH 1S2EA 3BP7A 3FCBA 1VFMA 5GS1C 3ZT5A 3PJLA 4MD4A 2A73A 3FO0L 1ACYH 1E8XA 3L2MA 2WXGA 4RGMC 4ACPA 3II3A 2IWGA 4AYMC 4B97A 2F54D 4PVNA 4LEXL 5E6IC 1URZA 1NBZB 3FO2A 3I2CL 2CKBB 2IALB 3QP3A 4IRZA 2EEFA 1JWUA 4FXKA 3TNNB 3MNWB 2LT9A 1HE7A 3L74D 1T5WA 3H1LJ 1SMDA 1WISA 1JI2A 3AMLA 4HD9A 3W2DH 1CCZA 1OY3B 4YGAB 1WO2A 2HKFH 1XMWA 2P26A 1T66C 3EFFK 1L4AD 4RWHA 5A6MA 2D7TH 1RUKL 3V5HB 2YS4A 2CK0L 1SBBA 3KGTA 2H32B 3RHWK 1EHLH 4K5PA 4N8UA 3BRFA 12E8L 3E6FA 3NFPB 4MAZA 3RY6C 3PWJA 2Z8VC 1F18A 5JMOC 3PTZA 2JSFA 1GW4A 5LDSA 5IVXE 3C2SA 4JRXA 3U4AA 4ZQTA 5DD5H 1FSKB 3EGDB 3VWKC 1R3IL 1PLCA 3GKZA 4WQOA 1MH5B 4PLOB 4HKBA 1VFAB 2XN9A 4OW6A 3ZE2F 1A6VH 1E28B 5ESVA 4N0CD 1INDL 2RCSH 5C3LD 5C0FA 5CCJA 4YQXL 4WV1B 4DT2A 4DP2X 1IC7L 3HZKA 4HKZA 5AW6B 4KNQA 3GZPA 2WXHA 1EANA 1MDTA 1Q9WA 1RZJH 3KAAA 5E4IA 4DO5A 4NZRL 4ESKA 3C5ZC 2NW3A 2K8MA 4KJQC 4F7EB 7FABL 5BNXD 1J1PL 4UB8H 2VKXA 3LXBA 5CP3H 3UAJD 1ZLSH 3U7YH 3KLAA 1WEJH 5FUOL 1YEIH 5CJ5A 1CBVH 2JTDA 1FZAA 3E7KA 1KYDA 3BN9D 3QWRA 3CCQP 3PPEA 4LL9A 5SWSA 1Y6KR 4YX2H 32C2A 5E6UB 4LVHC 5EEUA 1RK0A 4WRLA 3OKDB 4PJGB 1SQVG 1JZJA 1I8UA 3M6DA 3MRQA 5I16B 4ZMQA 1QABA 4MNHB 4UDUB 3QGVA 1OAQL 1BMZA 3RG1C 4QRPE 4DT0A 3D69A 5E8PB 1OT1A 3ZL4H 5KVDE 4K15A 4R90L 4O2CA 1Q9OA 2R59A 3N91A 1JV2A 4R2GB 3ZTNH 1GS7A 3S9DB 1E5BA 4YE4L 3CZSA 2TSBA 4M93B 1DH3A 1FORL 3C08L 4WSGA 4H20H 3QUXD 3ZHFA 1IQDB 3S37H 2E7MA 1F58H 2ETWA 1S7SA 2ZUQC 3ZKSD 4PJ8D 4TQHA 3C2AL 3VFNB 1R5WA 3GO1L 3V6OA 4Z3TA 4ZD3H 2L5GB 1QBML 2UWEE 3MBEB 3EYFB 5DZOA 3B7RL 3O41A 4Z3FA 1OL0A 2AGJL 4RGNE 4ETYA 1FVEA 3NN8A 3HS8A 5DD6B 2F1BA 1ZEAH 3HC0A 1JUNA 4OZIA 1B0IA 5MEOA 3MYJB 3M06A 3BYYA 5DHYA 2PP9A 2GT9B 5E95B 2OW6A 1JS4A 1AQTA 5KJ7C 4GKNA 5E1AB 3AM8C 5DMKB 3QDHA 3LKQB 2A3TA 3R4RA 4JAMB 5C0ND 5C7ZA 1WZLA 2OJEB 4U1JB 4Y8DC 2XHNA 4PM1A 2OS7A 1N0XH 3VE0A 3T8MA 5I24A 3DXAE 1ESOA 4HULB 3IDIA 3FFDB 2PPDA 1HDMA 4DEUA 4Q89A 2FX8H 4XZUB 3CFKA 3C5XA 4LIQE 4UM9D 4D0DB 1ETA1 1KFMA 4YIQB 2I7SA 2CH8A 1CFVH 4TMPA 5AZEH 5LGJB 2J2ZA 1U93A 5CNHA 4ZO9A 1PG7H 3G5VB 3E1ZA 4YHOL 3KZIH 2R2BA 1HJ0A 4FZEL 2ADYA 2OSLB 3BVWA 1FVCB 4M5YH 2CIIB 4FKHA 1Q0XH 1OSZA 5GS0D 2CG9X 3AGWA 5B7EA 3P4OA 1UXWA 2VL5A 3BPLB 3QORA 4HS6A 4LPCA 4YHIB 5F88A 1RFDH 4U3FJ 1B2WL 1JOCA 1NLBH 5DFAA 4D9RE 1MRCL 1NM4A 2K6WA 3EJJX 2C3WA 4M9OA 1M7DA 2AJVL 4R9HA 3U9PL 3RWFA 5AEAA 5IW6B 4J23A 5L4IA 1CYXA 3H85A 3LV3B 4NKDA 1VFBB 1WITA 1ZWIA 2CHZA 4JRXD 3VX0A 5JA9A 2AABL 1YYMH 1YZZA 2NUPB 2ZPKL 4UV7H 4U1NA 2Y69B 1U42A 2XN9D 1U3YA 5B3NA 1W0WA 2N59A 5L4MA 4XVTH 3MUGB 1SYSB 2L8AA 3QJRB 2AXFA 1D7DA 2ARJB 1JNNH 4ZOCA 1A4JA 2FZ3B 4NYLA 3D2UA 2ADFL 4WWKA 3O8XA 5HVGB 2ICEC 1P84H 1RMFH 3G6JE 3QE5A 4V2CB 4WNQA 1JGEA 4YGVB 1IFNA 2I5YL 4OCXH 3VG9C 3FB7B 3GMAA 5BU5A 1V5JA 3HHSB 4JPWH 3BT0A 5CKGA 3O2WH 4JM2C 1R3LA 3IAQA 5I1HH 4A2EA 4S11A 3RX7A 1XR8B 3LIZH 1YNKL 3Q2WA 1IO4C 2XZAH 5DJ6A 2RN0A 5SWSD 1JY2P 5BUAA 3EGSA 1L9MA 1X7TA 3KYOB 3L6FB 2IDBA 1DO6A 2AK4E 3QDGB 4PWKA 3ZSTA 3KPOA 4H7VA 2E75C 2HTLC 5EN2B 2Y1ZA 4QI3A 2UY7B 4JDVB 1I9IH 2P8MB 5DJ2A 4HJ1A 2CJ3A 2R9HC 3OAUL 3EQ2A 3JWDC 1V27A 3ZZQA 4C83B 3LTVA 5FA3A 2WBXA 1J1OL 1HL4A 1FFOB 3OMAB 2R7EB 3U7WH 4W68A 1JTTA 5EEXA 4PV9B 4Z3GA 4UI2A 1XGYH 1YMHA 4HHAA 4I2XA 3RJQB 5EBLA 3U36B 1MIMH 4LOEA 5CZRA 2AJ3B 5INCA 3ZKMC 4A6YA 5ICYB 1DSYA 4I4WA 5E2UH 1Q0EA 1K73Q 2NLJA 2RIKA 4YSCA 2AJUL 1Z9LA 4I0PA 3WIHH 4FFVD 4DQOH 3MCLL 2CXGA 5A3ID 43CAB 3BVXA 2ERJB 2KZWA 3F7QA 1FL6B 2DV6A 4JDTH 2CR6A 3ARDA 1P4BH 2H1PH 3LYRA 4PBVC 1CR9H 5CJ0A 5AG8A 3ETBJ 5I1LB 3HI1A 2WB7A 5I17B 4GSDL 5J13B 1MPAL 2YA0A 1T5KA 2A9NL 3LEXB 4OLWH 3MRCB 1OP3H 3RVTD 3UTTA 1DIPA 5CGYC 4JPIA 2VIRA 1PBYA 4K8RC 3VSTA 4WEBH 1RUAH 1VEMA 2KP8A 2NQCA 3KL5A 3Q01A 3H6PA 2R3SA 4GXUN 3CFTA 2HODA 3QDMA 4ONFL 5DJYB 3BP6A 2AEPH 2ZG1A 3PXHA 4N1CA 4Y2NA 4PJGF 4AQOA 5HHQA 4OFIA 3Q5OA 4BQCA 4Y89A 3WBDA 3HI5L 5EEVA 2HYMA 5HGBB 3WUUA 3KLKA 3VXTB 2XZQL 1AKJB 1BBDL 3CFUA 3TL5A 4FTDA 3S96A 1J1EC 1KXVA 2VMEA 5TGBA 4ANKA 2ADJB 2GTZB 3EO9L 1PSKL 2DD8L 1Q86Q 1NKZB 2X2HA 1KQGB 3WI9A 2GBTA 2J5LB 5KYXA 1L0LJ 1XGQB 3TYYA 1OCOB 4A2GA 3QORD 3TZVA 1AY1H 3P4LA 4KBPA 5E2TL 4IYKA 1BQHA 3FRPA 4I77H 4K94H 1TJHL 4MNQA 1WAAE 3MV01 5KVDH 2VDRB 3EYOA 1Q1JL 3ABVC 3ELAT 5DJ0A 5C0IB 4NZ8A 3FTGA 3GHEL 4HS8H 3V0VB 2Q7YA 4M62L 3VCLB 1H0DB 1RERA 1YJDC 4GW5B 3GGWB 4P2QA 1XTGB 4TV3A 1LO2H 1A4KA 2F8OA 2X41A 4FFZH 3FO1A 4HBCH 2X1QA 3EZ8A 5F9OL 1GK4A 2EECA 3VW3L 4LSSH 3IKCA 4S2SA 4X4ME 3MI6A 1NWPA 1T2JA 4HA1A 5I82A 3TPUA 1VQOP 3N85H 1NU1E 4H40A 3RNKB 3Q8BA 3EBIA 4H0IA 4LSRL 4HALA 3SBQA 4NO2A 4WWKD 3O8XD 4XPFH 4L0YA 1SOXA 1QLED 3CC7P 2OMBA 4I89A 4F7PA 5I6OA 1AH1A 1TMCB 1XSKA 2BOLA 2OBGA 5I0XA 5GTHE 1OE1A 4LF3A 1E4XL 3AAZA 3WJLC 3TTYA 3TEWA 5IJCC 3NCYS 3MLSL 4MA3A 1NKOA 3KH3A 5AVZB 3IGAA 3M1OA 4JHWH 3CLEH 5T1DH 2EDYA 3AE4C 2YBRB 4NAJA 4BUHA 1KEML 3P54A 4M8UA 3F6LA 3LNHA 5GISH 1BQ5A 4BFGA 1F8TL 1MI5E 3WE6B 2X3CA 4LIQH 4MA1B 2HRLA 4HV8B 4MASA 4Z7VA 2R51A 1IUZA 1P7KA 2GY5A 3CXHI 3N06B 1CURA 4I1LA 2X0UA 3VXRE 3OAYH 1YTZT 1KYOJ 3L3OA 5MEPB 1SEQH 3D0VA 1WV7T 1Q1PA 3WXVH 5TPWL 5FKPA 4NUPA 4XCFL 2IGFL 3V8OA 3VG0H 4L3EB 5DD3H 1TYEB 1EZLA 3RY4A 4LCCC 3FSOA 4DWHA 2FYYB 1BHGA 3SQRA 4PJ9A 3VXQA 2K8QA 1YQ4C 4KTEL 2FH6A 4U7MA 3LZFH 1HWTC 3ZMRA 2RR3A 1DBAH 2G5BB 4AQRD 1ZGLB 2NW2B 5G5DA 1BD2E 2N1TB 1M71A 2WBJA 3CCHA 1RZ8A 2WJ5A 4IS6A 4I0PD 3SCMB 1OFCX 2JE8A 2K9YA 4I9WD 5FM4A 5DWUH 4QTFA 4ZI8A 4GXVL 1MRDH 5BRQA 4C56B 5IT2H 2F7OA 2NRDA 4CNIA 4LHUG 1V7NH 1CFTB 3AG3B 4N24A 4PS4L 3EYSH 2ZCHL 3DX4A 3GWJA 2Y5TB 1ZJAA 2Q20A 5L6YH 5E9DB 3P30H 3UBXI 4P46B 5AW4B 3AW5A 3UTTD 3KPSA 2JI3A 3KBHE 4YSPA 4LVEA 4D0CA 5A43C 3O3EB 2BSDA 1E79H 4HUUA 1QW9A 2CBQA 1KN7A 5E99H 1L9QA 1QACA 4JFEB 2JJTA 2AV7B 1J12A 2AV1A 3QDMD 1TZOA 4HIIB 5I23A 4IFFA 5ISZB 3JV6A 4GLRI 3EXJA 3QO0B 2C9VA 2VW7A 2EEAA 5ILTL 1GGIH 3UIYA 1T04B 2WKGA 1CZ8L 1HT6A 2NX5A 2R56L 3D08A 4QR7A 4YUEH 5CLZA 3SPHA 1BQLH 2NNAB 4RSYA 5CZXC 5AKRA 1EGJL 1UQSB 3REVB 3MDJA 2OYIA 3G5XA 5E1QA 4AQ1C 2ZCLL 4XPBH 1E3XA 4PRIB 3TZVD 4Q58C 1DDTA 3UPRB 3RPBA 4Y9BA 3BSZA 1C1EL 1IFHL 4MNQD 3OSVA 4MQXD 4BKSC 4WO4A 4R4BB 5C0CB 3QJHB 2XBZA 1DZ0A 4PJCB 2GY7B 4RFOL 5GXBB 1MREL 5CCGE 1E7VA 2XA8H 1UGNA 2JQAA 3SY0A 4QHMA 4LP5A 1Q94B 3VTTA 4P2QD 4KHXL 1SEBB 1TUPA 2JB5L 4F9PC 3VI4B 1ZOXA 5TQ0H 2K45A 4MS6A 1SFCD 1W72L 2E74B 2BH0A 3FONB 1RPKA 1DEEA 3WTUA 3JTTA 1J87A 2P24B 2X6MA 5AOLA 1MIEH 5LCVA 3R7QA 3NSFA 2JV6A 1U58B 4DKEH 3VWJA 2AEJA 4HIPA 4AVHA 3AMKA 3D4YA 2R0WH 4PGDA 5IMLA 4LE8A 3UABA 1TETL 3BUYA 4I48A 1IIKA 1OMIA 2J3SA 5DO8A 2GHWB 3BQVA 1C5DB 1GR7A 1PLAA 1HCFX 2JMRA 3IJ7A 1NU1G 4QRSA 1L6PA 4G1EB 2QZQA 3EFOB 5J1AB 2H45A 1ZR2A 1NTZK 1IFMA 2WITA 3KWWA 3ASWA 5HDBE 4A1RA 4PJ7E 4OF8A 4OCRL 4J3OC 1KPUB 1WCBB 5I1CH 1PZ2A 2UVFA 5LB1A 5CF3A 1PLGH 5CGBA 2DLGA 1Q4NX 2IBZY 1ED3B 2IANA 1P5UB 4NSKB 2ZKHH 4YXKH 2JIXA 5F93C 3VRLE 5H35B 3U2IA 4CVZA 1EBPA 1MCOL 1NGXA 1HHKB 1MCSA 4KQ4H 3FS9A 4LSDA 4NRYA 4F2ME 4KKNA 4G6KL 5E23A 2HFFB 2ZSWB 4K3DH 4PW3A 1A4CA 4OVVA 5AZ2L 4HFWA 5TF0A 3KXFE 5D1ZI 2DKUA 3RTQB 2BCMA 3OMIB 3CC1A 4DP1X 2BCCE 2RGSA 1IK9A 3D7PA 2QZ5A 2N7AA 1CD0A 2GYSA 3GBML 3J8F7 3A0BE 1MCQA 1TCMA 2ZX7A 1MOEA 1TJIL 3IBEA 2VLKA 2N01B 2ED9A 3MBWB 2R15A 1G7MB 1JE6A 4L1BA 2HT4D 4WZ9A 2EKSA 3BIKB 4NZTH 2WBJD 1VFUA 1WGOA 2WK2A 2H3XC 5D4QA 3TC9A 5E1GA 3UTZB 4L37B 1QKZH 5IMOB 1GTNA 3PUUA 3CVIH 4PTUA 4RIRA 3DHMA 5CM1A 1PNDA 1BOYA 4FQJH 5FYLD 8FABB 4BZ1L 5KYWB 2QDWA 3COOA 3AU1A 4IW4C 4RA0C 2LFEA 5AUMB 1GH7A 1XIWB 2E9JA 2QSVA 4JFPA 5FO2A 2EIDA 1QFWL 5I74C 2QQKH 1BW8A 1SXSA 5HYQB 1T03L 4W9IC 5D5MB 4CSSA 4Z18A 3I75A 5I0VA 5JIDA 5IVNA 3FU7A 5I19L 2ED7A 3CVHL 2YOCA 1MCIA 1N9PA 2OMXB 4RISL 2C9XA 2ZFCA 2ATPA 2B5IC 4LLDB 4Q4EA 2FJHB 1PKQA 5BPPA 3KM2A 3PF2A 2BVEA 2Y7SA 4AYBA 1ZHNB 3PFQA 1AYOA 1AG0A 1AYRA 5GTHH 3VN0A 4WDIA 3TF4A 4FQ2H 1UWGL 3DWTA 3QA3B 4MA7L 1HZHH 2CO1A 4XBMA 4MKTA 2XRAL 3R0MA 2NX5D 4FE9A 5DSCB 4ZZFA 2VXVL 2NPSA 4XN1A 3VSQA 2YAQA 4XNXL 1S7XA 1U21A 3JWNC 2FATL 4GIFA 1NEZA 4MJ5B 3ZSSA 4XMPL 5CD3B 2AS5M 1ITCA 4Z7UB 3WY3A 3ZR5A 5FV1L 1KN4L 3EYUL 1T7XA 3VGGA 2HLAA 1NWQA 1ROCA 2VLRB 3D48R 3GSRB 2QVAA 4WO4D 5EUKB 5SV3A 1M1JB 3CMOH 2AK1L 1U91B 4L9LA 3S35X 3UAEA 4UOZA 3LW5J 2ZT9D 2W8CA 4OZGE 3RI5K 5E8NB 2APFA 4PLKD 1QWUA 3K4AA 4POUB 3WKYA 4ZDHA 4AYCA 3QJSB 1QQDB 4F8PA 3NCCB 2M5AB 5KJ7E 1LEKA 1EUUA 4JFYB 1EMTL 3F12A 3MV9A 2QFPA 4R8WH 4AMKH 5LWYL 2WMPA 3GSVB 4PJDE 3VWJD 2L4OA 4PS8A 4HCRH 1IARB 3VB9A 3RZWA 4ZYKB 1WZAA 4G42A 2MTPA 3PP4H 4K73A 3SDXB 4A2HA 4TNFA 4GH7B 3B9DA 3NFSH 4KMQA 2W0PA 2NTFB 5K39A 1AGEB 1L6ZA 3X1NA 5BZDA 4H0LD 4JFFA 3S5YA 3GLZA 5IEKB 3S4SG 4OI9A 4K3AA 1KPRB 4N2KA 2J44A 2CCVA 4FI7A 1NMBL 2IZ1A 3BE1L 1UM4L 2VSMB 2JKJA 3EFDH 5I5IA 3R06B 4M5TA 2DM4A 2EE2A 3NA4A 5DFVD 5TE4H 3C6SB 3LEYH 4XN2A 2IAND 3HMXA 2JIXD 2JNZA 4ZMLA 5HPMA 1QRKA 2BIHA 4BFEA 4CILA 5CCHC 1UJ3A 4MBOA 4X4ZA 5HI3D 4AI7A 2VSCA 1OGPA 2Z31B 3VFRB 1YAIA 4FMVA 3GHGB 5IQNA 4FKKA 1S9WB 1VADA 2IBGA 5EO9A 3C1LA 1KTRL 4LCWA 3RIAF 4NDMB 1T2QL 4BFRA 2CBPA 4PRPB 4PD4D 3SKJH 1WH0A 2EC9U 3NH7L 4N9GA 4PJCF 1OAXL 4QY8B 5C92A 1RZGB 2FEDC 1E9QA 3EOAA 5TFSH 2OI9B 3LH9A 1SYVA 5FF6B 1MCBA 2VLKD 3B34A 3RIKA 1RPUA 1ACYL 4H26A 4I2LC 4OGYH 4XN4A 1SQBK 3O3DA 3TJHC 3VI4F 2ZUTA 3ZDXE 7CGTA 4NHUA 2YKQA 4KJWC 3EJPA 3PG2A 3HPLB 1N73C 1WUNT 1KFAH 3MOAH 4LLQA 4EI5C 5LN8A 5ANME 5GRWA 2K88A 5JA8B 2XT1B 2E9WA 3E80A 2FWLB 2O93L 2A38A 1F6AA 1I3GH 2DICA 2EDRA 2OTWA 4G9FB 2IH9A 7TAAA 1CJYA 2OK0L 4M4PA 1FNGB 3N40F 5FCSH 5JQIB 1KELH 2DQHL 3PU7A 1M6OA 4NKOA 2BSEA 1B6DA 3RJDA 3FBKA 4KKPA 2OSYA 2WW8A 1HNFA 3MX0B 3S3JA 1EHLL 3OAZH 2GHZA 4Q14A 2GSIB 3B5NB 4G9DA 3ILEA 4NN5B 4KNTA 4LSUH 4XWGL 2KHAA 3I5CA 4EIUA 1HK6A 1KYAA 3QFDB 1A1NB 3UZVB 1Q9LB 3CH1B 5DD5L 4ODWA 1KMIZ 3HTKB 4JBZA 3MV7A 4PMFA 3U2SB 3GI9H 2B16A 3CN0A 1AVAA 3FFCB 5F21B 5F7MC 3QIBB 1A6VL 4MZRA 3X11A 3O0RH 1MLBB 3PL6A 3CN2A 1M56B 3HB3B 2I69A 5FFOA 5T33L 4LDEB 8CGTA 4UUJB 4YE0A 4WFED 4LASH 4ABWA 5FHAL 2NPSD 1CIUA 3SE4A 4HAGA 2K3TA 3GMLA 5BUGA 2FXOA 2JWYA 1FHGA 2HJLB 4N3YB 3GBNH 2A2QT 1NPJA 3DARA 1RZJL 4ANVA 5CUSL 1TVHB 2M3EA 3B3IA 3GSUB 1T1XB 1I9RH 3V6IA 3QJVB 4JFSA 2NY3B 2WLJA 4EVNB 2K4AA 2AC0A 4X9GA 4Z7AA 4YTPC 4FOMA 3PJSA 1G9EA 1NDTA 1VESA 5SX5H 3VXMB 3W67A 3PNRB 5B38A 2D31B 3U9UB 1K5NA 3DETD 2G5RA 1HNGA 4HOWA 4LARL 4G6FB 1KTLA 1KACB 3WFHA 3WS3A 2VC2H 1ZANL 4JRYB 2ZUVA 4HK0B 4KH9A 5EWIH 5AKVA 5D6CB 5AZUA 1RUQH 3CX5D 1T5XB 2NR6C 2DMGA 2R44A 5FGBA 1QO3A 1Y6MR 2H2SC 3GRBA 3I50L 4G6ML 3CBRA 2IEPA 2MSPA 2V2XA 4H20L 5D5MF 2C3XA 1W15A 3S37L 2ZWYA 4IBVA 1AR1C 5I6XC 5JPMA 3PWLA 4JFFD 1X3DA 1FNFA 4YNYB 1JNHA 5BJTB 4H4NA 3CHOA 2YSTA 3RIFF 4O58L 3CLFH 2OMUB 2Q0ZX 2ED6A 2NY6B 3BZEB 3PHLA 4FEIA 2ITDA 3OWEA 3IDNB 4H25B 1A25A 4JFXB 4ZS7H 2W65B 3UTPE 1QLEL 4F7MA 1BFOA 3O6MH 1TQCC 5C07E 1XCXA 1LE9A 1HUCA 1G7JA 4PSRA 4NT6A 2QHRL 1AXIB 1EQWA 3KWUA 4QTHB 4JJ5B 4Z7UF 1D6EA 5IBTH 4YEEA 1OK0A 1TYRA 4GAAA 3SJVA 2PWEA 4W4OA 4X4XB 3KPRA 2WQSA 4LLVA 1SQXG 1EFQA 4RAVA 3AY2A 3L2NA 4MD0A 1CGWA 2VR3A 4OTXL 3RVUD 5JR1L 3N1MC 3QAZC 3F5WA 1NDMB 3N9GH 5BO0D 3WN5C 4QHLB 4HZAA 5D72H 2X6BA 2PO6C 2GAZB 3SE8H 4UZGA 5MENE 2VSKB 3BQUB 4Y1AB 1N68A 1K72A 1FAIL 2CRYA 4L9DA 5TISE 1F4YL 2G5UA 3OZKA 5IB5A 3HKZA 5AENA 1YPZE 5GS0C 1VQMP 4FZ8L 3ULSB 3TV8A 1JTHA 5CZVL 5JW5B 2H6PA 1NAYA 1MJJA 3P3YA 4CU7A 4KFMA 3OL2A 3QIUC 3U4BH 3SDXF 5APXA 2CGRH 4DJMA 1JZGA 2VXUH 1NLBL 1OVVA 3K2KA 3Q9PA 2DBLH 2BSED 2EIZA 4N90D 1E5AA 4MQ7A 3SO3B 1PZ5A 2KYIA 2M26A 4JDZB 1LP9A 1WLHA 2ZCKL 4N25A 2J21A 5D1QA 5C2UB 4P23C 1FZKB 3V6ZB 1KB5A 4B7LA 5C0AD 4M1CD 2R27A 1YYML 3DPDA 3MV7D 5D7IA 1B0WA 4OZHB 2XIIA 4P3CH 3NEOA 2L7EA 3RGUA 1TU2A 4S1QH 1Z5YD 1LD9B 3HBQA 3QEQB 5MP6L 3K6DA 1R1CA 1JZ4A 3ECVA 3ZDZE 5DD0H 5KKZC 6FABL 3N42B 5FDWB 1I7UA 2CJSA 3HC3L 1BZ7B 1S9YA 3RY5A 2F54B 5L2KD 2AQNA 1IEAA 1CFNB 2BXZA 4Q2ZA 3FC8A 1UIIA 1R5LA 4QLRA 1DQJA 3O2WL 4WFHE 5I1HL 5AAWA 5EDSA 4F37K 2QJDA 1W72B 2H0FA 3BAYA 4G8FB 4LPUA 4HJ0D 2XZAL 1M9WA 1ZHKB 4PJAB 3OM3B 4OCNC 2BIPA 5B7FA 1QVOB 1L4AB 2XWJB 4G8GA 1EEZB 1CGSH 2V2TB 4PGBB 4PJIB 2GM4A 2GFBA 3QH3B 5EPMA 3GNMH 4OBSA 2L3BA 1LGHB 3V55A 5MHSD 1EHNA 4K5OA 1I9IL 3MOBL 4HMEA 4O02H 4UYPA 1VF5D 1P9MC 5A2LH 2X1PA 1S7QA 2E9IA 4DTGH 2X28A 1OGAE 5CEZE 4GMSL 3W3BA 2P1JA 4JG9A 3E3QE 2I9LA 1H0TA 1OPGL 1WFUA 4MA8L 3LN4A 4FQ1H 1OPOA 1VQNP 4AUUA 2BSBA 1S3JA 4ZFOB 4X98B 1VCAA 4J3SA 1H8OA 1UH3A 1D5XA 1KNOA 2VDOH 1EFXA 5KN5A 3OGCA 1A3LH 2H43A 1YQVL 1EHKB 5BCAA 4DH2A 2V5SA 1U2HA 2BK8A 3HE7A 4MTMA 4U7KA 1GC1C 3MQIA 3QDAA 1TPXC 1W0VB 3E0GA 5HHOA 5C0DA 3WIHL 2YQ3A 4KRPD 4DQOL 2ZYGA 3B7UX 4Z76B 4BIKA 2N4IA 4YSEA 2O01H 5DRWA 3S1KA 1P4BL 3ARFC 3FWNA 5F96H 3PRZA 3VGHA 3SJVD 3X1BA 3JWDH 4RMSA 4E5XA 1VQKP 1SHSA 1KCKA 2UXFA 5IR1A 4L4VB 3KPRD 3NESA 1NVOA 4HUNB 1HH6A 3NJKA 1TEYA 1A02J 2WBWB 3IKKA 3K72A 3MSPA 5DHVH 3LN5A 4ZOAA 2WO3B 3HFMH 2HKAA 3BFWA 1KGYE 1AAJA 2VABA 4NM8H 3RX8A 3NPSB 3U1AA 4PIRF 2CWRA 3W9DB 3BW9A 3H9HA 1I1AC 3F05A 3NSYA 2FLBT 4XVUD 4ZSOB 1LWJA 3QUXB 5F9WB 2G75A 2OJZH 2A4EA 4WKXA 3OJMB 3MLZL 3O6QB 4E68A 3UX9B 4MNGE 1LHZA 1LQSR 3FTUA 3OPUA 1F4WL 1T3JA 2M3BA 3DVGB 1FC2C 2Z7YA 3TLRA 2X70A 1VGKA 1CL7L 4LEOB 4TL5A 1C5CH 2R0LH 4JG5A 5AOZA 3CVHB 3LZQA 3QUYC 4JY4B 4K94L 5ERWB 4HOZA 1QBAA 3BZ5A 4H13C 3VXUE 4FABL 2MKLC 4M7KH 4K8RH 1T0PB 3FU5A 5GRYA 4HS8L 4XNBA 3S36H 3L70J 2F1EA 5D1QD 4RQQB 4XNYL 5FYLL 4P5TD 5F70A 3RX9A 1MCKA 1NLDH 2O5XL 4QAWA 5EO0A 3OMZA 5HHME 2GJRA 5FO7A 2WYTA 3SD5A 4FFZL 2WUCL 1FZCA 1UJTA 4AT6B 3FQXB 2B1AH 3GMMB 4KK9D 5IP4A 3A6OA 5JHLH 1G1KA 3D07A 3BKYL 4QUOA 2FB4H 3BT2H 5DDHA 3QQ9C 4LSSL 4E41A 3W9EB 3AREA 2ZONA 5DVNA 3TWCL 4YHLL 4MD4B 2A73B 3N85L 1IBFA 1BGXL 3KCWA 5KSAA 4KO5A 1CC3A 4UZSA 3LH2L 1XF4A 1O0VA 1JRHH 3K91A 4JR9H 1MQKL 1OK8A 3OR7B 1QZ1A 2GI7A 1JWUB 4G7SB 4U33A 2YUWA 1DANU 4Q9QH 2E76D 2PYFA 2GG1A 2FFDC 2PR4L 1ETB1 1T5WB 3L70D 3JBG7 4NKQB 3AG2B 3MHZA 1NCTA 5HP5A 5T1DL 1SY6A 2D2CC 1YJDH 3CLEL 2HWZL 4JHWL 5E5MA 5G2NA 3ZRCC 4RMRA 4DKDC 5HYSG 3B9VA 4DP9X 1DVFD 1W2KT 4HWBH 4PY8I 4AM0Q 4L2YA 5KSVA 2OZ4H 3FH5A 4XO3A 2WXOA 4G8GD 5GISL 3ZQXA 4UZUA 1EC5A 3TP4A 5D7JC 5F7DA 1JK8A 3T0BA 4MWFB 3QHFH 4YH6A 3E6FB 3BSZL 4BFIB 3PWJB 4YDLB 1TFHA 1ZE3C 3HG3A 2YXVA 3ZLQC 2Y9ZA 3P2TA 3IFMA 3KJ4C 2EE6A 4JRXB 4X83A 3TASA 3TJEL 3A67H 5TISH 2XVKA 4HKBB 3V9FA 3ZYIA 5C0EA 1GIGL 2DQEH 3CHSA 5H37G 4ELME 1LM8V 3ZDYE 5D1XC 3NPZB 3S0PA 5ESVB 4DKFL 1WUZA 1N7SC 4H44C 5ADOL 5GPRA 1RU9H 4MJIE 4G80B 5C0FB 1QEXA 4FLSA 5LCVL 2C8NA 3AEDC 1FLRL 2CPCA 4WJKB 2BP0B 3QR1A 1EFXD 3Q6FA 4HKZB 3CH8A 3NTNA 3AS1A 5I15H 4DF9A 3FT3A 4A2FA 1IMHC 4OZHF 3RVXD 3HE7D 3JWNE 5HJBA 2FUTA 2NW3B 3BH4A 5HHOD 1MFBL 4V33A 5DWUL 5ANHA 2BHUA 1MJ7H 2XWEA 4EUPG 1MRDL 1OD9A 4UOQA 1AXSA 1GPOH 1V7NL 4GG6A 1X5KA 3ZU8A 5IMMB 4ZOEA 1KTCA 5SWSB 3WNKA 4PGJA 3JVFC 3L4XA 3WKML 32C2B 1CLYL 1RK0B 2P49B 4G1MA 3SBPA 1L0LK 4MMZA 3D3VE 3MRQB 2XCMC 5FYJD 3QG7H 5I1IH 3OKOA 3D69B 5ESAA 4OZFG 5ID0A 1MAJA 4O2CB 1FDMA 4UWQB 1O9ZA 2DL9A 3DRTA 1Q9OB 1JV2B 4IK6A 4PJAF 4E9YA 1KN2L 4QHUA 3MXWL 1JPGB 4NHCH 3T0VA 4ZKUA 3WFCH 1KGCE 3DMMA 5D55A 4DGIL 1ETZA 4J27A 4PJIF 3DI3B 3DA0A 3QPQD 3IDXH 3WIIH 2XYBA 3WAJA 2CA4A 1R5WB 4J6IA 3EJRA 2J8UA 1CZQA 3S6CA 2CUMA 1DUYA 1HINL 3LSOA 2IQ9H 5HJGA 4XNDA 3O41B 4NZUH 2J6WA 3X3FH 1FVEB 3WTWA 3KPNA 1PZ3A 1UYWH 5HGAA 1ZLWK 4G6JL 1NBCA 5H37H 3RWDA 3HC0B 3AWFA 4OZIB 2DI7A 2Q7AA 4TM9A 5MEOB 1MW0A 2Q76A 5DHYB 5LGYA 4GKNB 2DTSA 3IN0A 4J3OG 5CEZH 1NTZE 5CO1A 5TQ0L 2NY1C 1HHIA 5CCHE 2GBUA 2V8LA 3VE0B 1A6UL 1YN6A 2FYNB 4XNZC 1FZMA 3IDIB 1EZVI 2FQEA 3Q1SL 1HDMB 4LKCA 4E41D 1BLNA 4QXGH 1OAYL 4DKEL 3CFKB 3ARED 4XXCC 3ROLA 3VVVA 4EAEA 4JX0A 2VITA 1GMEA 4EUPH 3FYEB 2EC9T 3RURA 1E6OH 3VDBA 3L1OL 4FTVA 5KSAD 2EVGA 2Z34A 2J2ZB 3P3TA 1U93B 4HH9A 2WXRA 5EOTA 1QATA 1KYOK 4JS7A 4Y16D 1BGYD 1X5AA 2QVTA 2ZAHA 4L1HA 4NQCE 2R2BB 1XCWA 1R5IA 4JRFA 4QMAA 5E79E 1L0NK 2FWOA 4CC4A 4TYUA 4BE5A 3L7FA 1KILE 1OSZB 1SXCA 4BK5C 2XNAA 1MXGA 5I6MA 2F61A 1E42A 4DN4L 4D3CL 2VL5B 3QXAA 3QORB 4HS6B 1SRDA 5DJCA 2BY1A 5F88B 3GIZH 4J8RA 3RL2A 3TA3A 3C60C 1AJYA 1BEYH 5GS3A 2D2OA 2WWMD 1M7DB 1GMIA 2ZKHL 3ME0A 3V7AE 2E43A 3RWFB 3E8UH 1NTKJ 4ENEC 2J4WL 1XF1A 4HLEA 1G1CA 1IE5A 4KQ4L 4PJFB 5AB9A 1UENA 4NKDB 2V7QH 5J12B 1ZWIB 2JLPA 3Q5PA 3KHUA 1XB8A 2BVOB 2NSQA 1HCVA 3CDZA 4U1NB 4NO0A 1VQLP 1W0WB 5EU6A 1ZLUH 1GHFL 3L5JA 3DTDA 3LD8B 2ED8A 3H32A 2AXFB 2A77H 2DYSB 2O5YH 3CZFA 1MN4A 1A4AA 5C0BA 5DI8A 4Y2DC 4YDZA 1M7UA 1A4JB 5T1KD 1DSFH 4NYLB 3D2UB 5L9DL 3MHVA 3O8XB 1IEBB 3V4UL 1NO4A 1ZLEA 1QLEB 5A16A 4PR5A 2GCYA 1JGEB 2OP4L 3TGUD 3LB6C 4J3OH 4NZTL 4BD4A 3TT1H 3TH4T 4ZMYA 4MZ3A 4IRJD 4D6TD 3PAVA 4JJOA 5HY9A 3STLA 4B5EA 4YK4B 1SQQJ 4KJMA 1YIJP 2D3NA 4FQJL 4ZX4A 4RO0A 3OKKA 3AQXA 3EJUA 3JWNG 4Z0BH 1NKGA 2XIBA 2UYLA 2E56A 4M7LT 3H1KJ 1JTPA 1AZRA 4Y99C 1F2QA 3EGSB 1QYGL 2QQKL 4M6OL 5C0JA 3VD4A 4M1GH 2B1OA 3B8SA 3IF1A 3GLEA 3KPOB 3AWEA 1OTSD 4ZAKA 2QM8A 3MRFA 2X89A 4K3JL 2A5UA 2VLLA 3P7KA 3FQ4A 5APQA 4KXDA 5DJ2B 5GGVH 2Q1KA 3CSTA 3FT4A 1CMOA 1OZUA 2PW1B 4NJ9H 5FA4A 2XN1A 1NCUA 4LCYA 1JZHA 5FA3B 4FQ2L 1JWMA 2CQVA 2EDOA 3TBBA 1HXMA 3DMMD 3MNVA 4NLHA 1LP1A 2WZ0A 1H3TA 4M7JH 3SPCA 3S8GB 4P5MA 1KENH 1SQQD 2M0BA 2DQUH 4GAGH 5TD4A 3QIWA 5J57B 3GHPA 3TO4A 1YMHB 1FF5A 4HHAB 4I2XB 4A6YB 4I4WB 5TDNA 1I8MA 1E2WA 1T0NA 2NLJB 1FO0H 1FN4A 3VFGL 4I0PB 3DUSA 5FEBA 2IOMA 1WICA 3VFWA 2PP7A 2VN5A 3MR9A 3OR6B 4MDRA 3VQ2C 1RF0A 2H0EA 3CMOL 1JB0J 1FRGH 4AKQA 5M95B 1FSKC 2DIAA 4BELD 4K3GA 5GSVA 2BIOA 3ARDB 3V2RA 4FQPA 4ZUUA 3OHMB 5F44A 1A2YA 4F24A 1VPOL 2YEZA 4PLJC 4ELKA 1XH1A 1LILA 4UMSA 3FUDA 3L75J 1S7TA 3UTTB 1FL5A 3IRPX 4WV1C 2VIRB 4R8WL 4AMKL 3ZT6A 1NTZG 1RZKC 4GY4A 4NWTH 3TFBA 4YFEA 1O9VA 1SUHA 1S1CX 4HU2A 3BUQA 4YFDB 4EXKA 1SUJA 2JCWA 4FTVD 3JWNH 2F68X 3QDMB 2HODB 5DJTB 4RFEB 3PP4L 1WFJA 3BP6B 5HHXH 4O4YH 4PRBA 3VI3E 3VD2A 5HHQB 4Y9GA 4RESB 3WFZA 1ZPLA 2QQLH 3HTLX 3T09A 3S96B 3DUUB 3CXFA 1E3FA 1IZKA 1U41A 3D9AL 2ZE0A 3GS0A 3QDJD 5TGBB 3SDYL 4JW3A 5CFHA 5KVEE 4P57A 3AG4B 3WJJC 5KJRH 3QUKA 4G8AC 4Z7QE 3WFEL 3MJ9A 3L75D 3EFDL 1KB9E 2BCKA 4AUYA 1MY5A 1SQBE 3TA3D 1LTGC 1BQHB 3T2OA 3N50A 3LEYL 3EYOB 4JPQA 3SB3A 1MFDH 3HC4H 5DJ0B 3V4PH 4R2GC 4LGSB 3RKDD 1ZA6B 3FTGB 2Q7YB 4PJHE 2YMKA 2YBGA 4M93C 4NC2B 3OA7A 2LLLA 4P2QB 4WHCA 2R4SL 5BOJA 3JWOC 3V7AG 2YD0A 1A4KB 3LQMA 1A66A 4QD2E 3H9SE 1GZLA 3OXSA 4KPHH 1FJPA 2ILLA 4RNRA 4ZG1A 4HIHA 3FO1B 1X9QA 1KOAA 4N28A 3RAJH 4XMTA 4NO0D 3KCPA 4M43H 2IMNA 3VM5A 3BSGA 5EU6D 2Z7WA 5FECA 1PY4A 4FX5A 4S2SB 3MBEC 2CO7A 5C0BD 5K59E 3TPUB 4BCXA 4OZIF 5D2NA 3GF3A 5FLUA 4G8EA 5DYFA 4TLKA 4B50A 1RIVL 4NO2B 1NANH 4XBGA 1GGBH 3WYRA 4F7PB 1RQVA 1Z9PA 2OFQA 3I9AA 4QRUA 2HT2C 3ULUE 2XQ0A 2YD4A 3L37A 3L72E 4JM4L 4P2YA 4LF3B 1JDDA 1GU4A 1NHLA 3AAZB 5IGXH 3GG2A 3VB8A 2H5UA 2QSQA 4YHYB 3D0AA 4K5MA 4XHJC 4DEWA 4KO7A 2K9JA 1M8OB 1KTMA 2D9CA 3DO3A 2H47C 1E9OA 3SOBL 1KELL 3FCGA 2HX7A 3TEYA 3G5WA 4MVBC 2Q6QA 3GSOB 3ATEA 1RK1A 4UT9H 4ZAKD 5BW7A 5B4MD 4Z7VB 2WQXA 5F3HA 4RX4A 1SHMA 5FIEA 1H9DA 1B0GA 3KVPA 4KOCA 1XH3A 3L3OB 5F6HJ 3PY9A 2Y9RT 3D0VB 4HGMA 2Y6TE 5FKPB 2WY3B 3MUDC 3GI9L 5E79H 1JGLH 1O7SA 1SLXA 2VR8A 3PLNA 2HAZA 4UIKL 5I1JH 1N6QH 2EUZA 3GXIA 2B2XH 35C8L 4H0HB 4OFDA 1LK2A 5CJQH 3QIWD 1K85A 4K3EH 4PJ9B 3HR6A 3NIFE 3V52H 1HHGB 3IAOA 3BPLC 1NBYA 3TO4D 4PU2A 4URKA 4OSUH 4M5ZH 5KYYA 4PHXA 4NQXA 4BWUA 5E8OA 1IAKA 5HI4D 1MHPH 5G5DB 1M71B 2WBJB 3CCHB 1RZ8B 2BY0A 2KXPB 1LNQA 4IS6B 4QRRD 4IGBA 2J1YA 4U1KA 1GU5A 3UTSA 5J1TC 1ILSA 3DSNA 4UOW0 4A67A 4NCC1 4PIBA 1M42A 4AVKA 3G9RA 4CNIB 2PW2A 3QJFA 3WGUB 5HDLA 1UT9A 4B9GA 2A4ZA 2PXYA 2OX5A 4PRAA 1FDLL 4LNVA 4KY1L 1FE8L 3KPSB 3LDBB 4TKWA 4ODHH 5GGSA 1ICTA 3PDOA 5F0JB 4D0CB 4WHTA 4POYA 1KDIA 4O00A 5ABZA 4UQ2A 1MZZA 3L08A 1JZ2A 1VACA 2DI8A 5T3XD 3F01A 5IW1A 4A7UA 2B3RA 4F8NA 1G4MA 2AV1B 1U8PB 1F02I 1JXJA 4R26H 4X5LA 5JIMA 4K07A 3P40A 1NBVL 4P5SA 5MERA 2J73A 3JV6B 4XMUA 3QISA 3POCA 5F9JA 1KB5L 2WYZA 4MAUL 3ES6A 5EIIG 3D71A 2BJML 2NX5B 3OV6A 5IG7A 3BATA 3MO1B 1CU4H 2HUEA 1FYTA 3HG5A 4XN7A 4ADGA 3V4VH 1LJ2A 5EZIH 5KEZA 2OYIB 1BXAA 1CK0L 1TDQA 3G5XB 1NCDL 3CLFL 2HVKA 3Q06A 1FPTH 2M2DA 2YZ1A 1CLCA 5DF0A 1LK3H 5CIPA 5DRXA 3ZVVA 4ZS7L 2GSMB 1MCHA 3G5ZA 3MRPA 4D9QD 3MC0A 2P5EA 4WO4B 1NJ9A 2PYEA 5JYMA 1J9RA 1SQBG 4G72B 3L9BA 2ZT9B 5E7FA 3CK0H 4QHMB 1SOKA 3SY0B 3TCTA 4U6VL 2NY2B 4E9RA 2MRYA 3WO4B 1LLAA 5M7QA 2BSRB 5IBTL 5DO2D 4JFUA 2ZSVA 1WRGA 1DEEB 5F0PB 3JTTB 4YSRA 1FOSF 4HBQA 2ZAEB 3C5JA 3BAIA 2FX9L 3VWJB 4OQTH 3VFVA 4EKJA 3KBPA 3OQRA 3CFNA 2HFGH 3VH8A 3T65A 4F27A 2E5TA 1PGJA 5ID1A 5IMLB 4I48B 1DQML 5DEFA 3HJ0A 4ZMZA 3W81A 3C8KA 3LIZA 4NJAL 1THAA 3C87A 3MA9H 3FT0A 4XAKE 1TNMA 2OARA 3HA0A 2ERJC 1BYOA 3PNWA 4NERA 1YEGL 4QRSB 4K7FB 4QXTA 4R0LA 3K6IA 4H0LB 1RIUH 1L9TA 2HX8A 3EJTA 4NQEE 4EF3A 3LEVH 3QJOA 5J13C 1DANT 3KWWB 3L72G 3SPGA 4YHMH 3PGDB 5EU3A 3WMM0 2MOQA 3NMEA 1JYVA 3BI9X 5IQ9A 3BVNA 5FR3A 1KUMA 2GABA 4HG4K 3LAFA 2Y1AA 3MRBA 2VXUL 3QXUA 2WXMA 2A6JA 2WIMA 3V95A 1UTDA 2DBLL 2IANB 1L3NA 2VJ0A 1IIIA 2JIXB 1J11A 1KJ3L 4I13B 2VR9A 4EJ1C 4CVZB 4DSYA 1NGXB 3GLMA 3CHQA 2D7PA 4NRYB 4RX4D 4HEPG 1QNZH 1UM6H 1GA2A 2UZPA 1E43A 4ODTH 3RVVD 4WFFD 3S3PA 3AT9A 4HFWB 2FX7H 4MLIA 4KXZH 1TTUA 1OHZA 4C4UA 1OM9A 2G4EA 3X3GL 1ODAA 3T04D 1CDBA 2UVEA 4OCSL 2DQIL 3GQFA 4S1QL 3SDAA 3LRSA 5KVEH 1J0YA 3AY4A 4LBEA 1GSKA 1U57A 4OAWA 3JVGA 2J5LC 2OMZB 4DVBB 3I3DA 2VLKB 2QKSA 5D1XE 1KB9H 5HVFB 1UCBL 2RACA 4I5BA 2YPVA 1KWKA 3H1HD 3QI9D 5EC2A 2ZX6A 2IFFH 5FKAA 4EDWL 2VJ8A 4LPYA 4X4KA 1U8CA 4IGBD 3UTSD 5C9KA 4RIRB 3KM1A 5GJSH 3H0TB 2FBOJ 1ET7A 3UBXA 3V5DA 4XPHH 3AU1B 3FB8A 2Q3IA 4JHAH 5C2BL 1B4TA 4E9QA 3AB0B 4JFPB 2YN5A 2WSPA 3F5HA 2IAAC 2NNFA 3K1DA 2PXYD 1J10A 3MUJA 3FSWA 1NCWL 4PG2C 3FH7A 1S7RA 3I75B 3ECWA 1XT5A 3FU7B 1AE6H 5F72S 1FHNA 1KT2A 3GNML 2Q3AA 3D70A 1SQVD 4RMVA 2ATPB 3KLHD 1PKQB 1V3MA 1XGZA 2AQRA 3SDDA 3S48A 3P8MC 3ZDMA 4DAGH 1CYGA 2DQFA 4L4TE 4WDIB 4DTGL 4F5CA 2EEXA 2WPRA 2R8SH 5HVWA 2D73A 4GAYA 1P84J 1HJBA 1K3ZA 4XFJA 2YJLA 4QRPA 1P1VA 3OKMA 1X7SA 1JP5A 3VQLA 4U3FE 2H3NA 4Z7VF 2NPSB 3LRKA 2W90A 1FYTD 4N1HB 1S7XB 2JF1A 1NEZB 4X6FA 3BDBA 3QCTH 1KCVH 3EOTL 2Y24A 5APVA 4MA1C 5E8EA 4KDWA 1LEGA 1M7IA 2HLAB 1AQKL 5BZXA 4AYFB 1D6VH 5F8RC 2P5ED 1ECYA 2QSCL 5J1SC 1YEKL 1FC1A 2PYED 4L9LB 1RIHL 1MHHA 4I1PA 4NBZB 5GQBA 5C71A 1YRKA 25C8L 2NZIA 2W6BA 1R9FA 4ZDHB 1SY6L 3QFJA 1MWAA 1LEKB 4ZFZB 1PZQA 3MV9B 3F12B 3D50A 2VTFA 1HH0A 3O8ZA 4I6MC 2WMPB 4NM8L 1A6TA 5JW4Q 1A22B 1IAIL 3R2PA 2NXYD 4I3RL 2N1TC 2BVYA 2BSCA 1NMCB 2JLLA 3SCMC 2CALA 4G42B 4R4FH 4JPSA 2YMXL 5IROC 3TN0A 2WVRA 3RK2B 5F0MB 3NA9L 2HRPL 2Y6SC 5LN4A 3VX1A 1GC1H 1T83C 5K39B 5DR5L 1PY0A 5BZDB 1DQLH 2IX7C 4I3SH 3BVDB 3ESOA 1CFBA 4F1SA 1AD9A 1AI1H 2Q8AH 1LQBC 5LBGA 2VXQA 3RIFK 4BHUA 5EC1A 4P46C 2PTUA 3GXNA 4FLOA 4XI5D 5CSZA 3T2NH 2QA4P 4LXFA 1EEYA 4GP8B 1UT2A 3TONA 4XNMA 3TF7C 4CBZA 1UKQA 4K0OA 3W11D 1IM9A 3CXHD 2Y72A 3US9A 2BSTA 3TWYA 1J8HA 1D5IL 4QXWA 3NJIA 3EGXA 3DJZA 3ALPA 2H4EA 1UJ3B 5LHDA 3E1IA 3B5TA 2YIUC 4LP8A 4NENA 4MXQC 1D5MA 2V3DA 1FUNA 1HIML 4P9HL 3KPEA 5D1ZA 1KBKA 5IHBA 4XP1H 1VADB 5EO9B 3UJIL 1F3JA 1YY9C 1QVGO 1RJLB 4LCWB 4UT7L 4NEHB 3AT0A 2B1AL 4BRVA 1BBJA 3K3QA 3SSGA 1BSIA 5J6GB 3SDAD 3BH9A 5DQDH 1Q9KA 2FB4L 2V17H 4N9GB 1MNUH 1UWFA 3GBLA 1H15B 1E9QB 3EOAB 2XNDH 2YNYA 4GDOA 1SYVB 3MFFA 3OHXA 5EEYA 4QRTA 5C08E 3M0DA 1FNSL 4H26B 1TQSA 1ZPUA 3O3DB 4JN2B 5EZOL 1N5AA 2CRMA 2FWUA 3BD5A 4NHUB 4BQ8A 5JQHC 4XODA 4GUCA 1OAZL 2O1JA 4HX1A 5CILH 2P48B 3ZXAC 1DBKL 4G6AD 2IVFC 3T97A 1P0SE 4LLQB 4ATWA 1LDPL 3MBXL 2P58A 4TLTA 2H8PA 5C09A 3TH3T 3ZE1B 1RHHA 4MZIA 5I8EA 2E74C 2OTWB 1F6AB 3F3HA 2V5YA 4Z77B 3QBTB 2WT7A 4FGMA 3T0EA 2H1LM 3H2PA 4GUQA 4M7LH 1M6OB 4NKOB 2OZ4L 1SJVA 1KSRA 3QRBA 3T2QA 2R4RL 1OIOA 1IC5L 3Q6GH 4OKDA 5EBWA 3F58L 4G9DB 1ADQA 2F8VA 1HSAA 2EYTA 4XC3H 5FOBB 4PV1D 2R29A 4YDVB 4ODWB 2DJMA 5TDPA 3MV7B 4Y4HA 2AQSA 5JO5A 5JNYA 4OH8B 5F9AC 3U7AA 2AK4A 5FUCE 2IBZX 2DQEL 2FT8A 4N2NA 3O2DH 3L16A 3X11B 3BISA 4YN3A 1L0LE 3PL6B 5CBAA 4QRPD 5IBLC 5E24E 1RU9L 2O1KA 3ZKXB 3MN8A 4RAHA 2X87A 3SE3C 3VXSA 3EO0A 3GMLB 5JHMA 4DW2L 3JXAA 1VJSA 2QEJA 1P5UC 1I8AA 1IGCH 3D6ZA 2BC4A 3KW7A 3VUAA 5KVFL 1V55B 3PGFH 3U1SH 1I9JL 4YDIH 5I6LA 2GK0A 2XPYA 3A4FA 3B3IB 2XY1A 5IV2A 1T89C 4YXLL 1ZXGA 1IBBA 2NYKA 3EUUA 1A0QH 1BIIA 5TF1L 1MFAL 1BECA 1ZE3H 2Z35A 3PJSB 1JZEA 1G1IA 4JO8A 1NUDA 1IAOA 2WXPA 4LRNH 4TNVF 2APWA 3RTQC 3G08A 1JZ8A 2A6KA 1TTAA 4ODSH 5FAAA 5B38B 2XU6A 3SGJC 5FGRA 2NNRA 1PYWB 1K5NB 4WTZG 4HWEH 1UWEL 3A5TA 2NSXA 1WF5A 1SNRA 4H8HA 1KTLB 2JKXA 2DQDH 3WFHB 3WS3B 5D6DA 1VF5B 5CJOL 3OG4B 3TN0D 1UT1A 3WELA 1QO3B 5JIPA 5DEZA 4FXGB 1MZYA 3K46A 3WUTA 4KNSA 4BA8A 2V2XB 4JO5A 3TBYA 1XIWC 5JPMB 3PWLB 2NZ2A 3WIIL 2UZXA 15C8H 1JHKL 1JNHB 5BV7L 5DRZA 1MCRA 3L3KA 4ODVL 5E4AA 2FBJL 1HZLA 2XWCA 1WWBX 4JBSA 3TYFA 3WHXA 3CPUA 4AIOA 2ITDB 3S5LA 2AAVA 1QAWA 4PJGE 1KYOE 2WAHA 3FCUB 3N1FC 1J8HD 4F7MB 1BFOB 2NY0B 1F13A 1ORQB 1LE9B 2P80A 4HJSA 3MKGA 1G7JB 3NSCA 5DMGD 2HLFD 1YUHA 3RFZA 3ZRFC 2BZ7A 2VM4A 1SXZA 1L0NE 2FD6H 5D1ZD 4DP8X 1OP4A 2C1PA 5E6IB 1D6EB 2VLJB 3SJVB 4XMKL 4HIEA 4KVPA 1DQQA 5D93B 3ESPA 2W91A 4D9RD 4LLVB 2WN3A 2WTYA 3GTNA 4RAVB 2O5ZL 3MZTA 2ZOLA 4MD0B 3VVWA 3TTSA 3QK0A 1H5BB 4CPGA 3HUSA 3F5WB 3IMSA 5T1MA 4GQ9L 2JWDA 5I1DA 2OL3H 2X1WL 4OJFH 4B9CA 1IE4A 3QARA 5FM8A 4X9YA 5A6LA 3I9PA 4AK1A 1OO2A 1M1JC 1SQPK 1S5LH 4DN3L 3B43A 4R5TA 2O1AA 2RQEA 3TO2A 1E4KA 4S0TD 1IQWL 4GO6B 3BZFA 1LTIC 1YQ3C 4X4MA 2H8PD 1JF5A 4A63A 2IAMC 1JTHB 1FH5H 3K2IA 2W80C 2H6PB 1MJJB 2V4LA 3NIDE 3QPXL 4QDGA 3HD7B 5JZ7C 2PABA 2G0KA 2Y23A 1NIAA 2F5AL 3APMA 2JCCB 4BFFA 3WUWB 4J3TA 1CICA 2EIZB 4WUUA 1PZ5B 5F1OB 1NGQH 3FNKA 4UM8A 1LP9B 2X09A 4FQIL 4PJ6A 2E0PA 5D1QB 4F2EA 5EBMB 3JT0A 3D05A 1KB5B 2OCJA 1U95A 4NQSA 4Y4HD 5D7IB 2LV4A 1XDTT 1MI5A 2AK4D 4UYQA 4B9YA 3O0LA 5G4NA 1T0OA 4RGOH 3H3PL 4Y5YA 2VQUA 4ZUSA 3HNSL 1NUNB 1QTSA 2YIHA 3VXRA 5GZOD 3VXSD 4RRPG 1I7UB 3EBHA 5CJXC 1DSFL 2VDPL 1L0LG 1S9YB 3HI6H 5EOQL 3MRGA 5T3XL 4OM1L 1SJEA 1IEAB 3WSQH 2GTQA 4J3WA 3TFKC 2G3ZA 2R0KL 3ZYZA 1E4WL 5D9SA 4JYBA 2MIZA 2E76B 2Z31C 2KQNA 2R1YB 4I88A 1YMMA 3GHGC 2QSTA 3ZMNA 4Z0BL 5DD1L 2WTPA 4NP4H 5K9QI 4U7JA 5I8KL 4LVNC 1E8WA 1DJWA 4OGAD 3IPFA 3CZUB 4LHUD 1PCXA 4G8GB 5K1NA 5F97E 2ZUQB 1T3UA 3PGCA 3MJ9L 4K7PH 2OI9C 4FADA 2GTWA 5AYUH 5IMKA 5EPMB 4F1ZA 4RWYH 4ZKPA 2VR7A 3AEAC 3ZE1F 3F84A 5F7BA 5JQ6L 4NAMA 1N70A 4NRXA 3IU4L 4LOUC 4NM4L 4GSUA 3FZUC 2E59A 1S7QB 1GS8A 5KAIE 4QT5A 3CU1A 5KANG 4KROD 5F71A 2I9LB 1SJHB 3DVNA 1H0TB 3LN4B 4GAGL 3GDCA 1RE4A 3KWVA 1IV8A 2NXZD 2CLRA 4N9OB 4M3JA 4X7FC 1SPDA 5B1BB 1D5XB 1ZLDA 4K2UL 1EFXB 2RTTA 5KN5B 3OGCB 2IQAA 2WQVA 1HYSD 4LSQH 3U0TA 4ACTA 3HE7B 5HHOB 3B5NC 1BVOA 4X7CC 5E6YA 3QDGE 3MJWA 1CFSA 3L5WA 4AQ8A 3SGEH 5HHPA 2VXSL 2P80D 3K7UA 3Q2YA 2VLME 4GQPH 3PQYA 1NU1J 1YEWA 3JV4A 3SQOH 2N7BA 5IHLB 5JHDA 3QIBC 2CKBH 2JQMA 4E5XB 5IR1B 2JXMA 3HB3C 2GIMA 1HH6B 4QO1B 1L0NG 3LN5B 1X4ZA 3IGUA 3VD9A 1JPSL 2VABB 2YGNA 3L71E 1GW6A 4ABQA 1NTKK 4IMKA 4DOJA 3BW9B 3H9HB 2QSIA 2XC8A 3M45A 4KUZL 2H32H 1DN2A 4OJEH 2NY3C 2WLZA 4PV8A 4DZ8A 1DJIA 2G75B 4I7ZB 5LG6A 1Y0LA 3HW7A 3D09A 1HQ4A 2VN7A 4C7RA 2Y1VA 3VYOA 5C6PB 5JPNB 3OKYA 2HPCA 1KQLA 2YGQA 3GM8A 3NSDA 1CO1A 1HEZA 2X70B 3S4SA 1PQZA 4BINA 1VGKB 3OKLB 5ABDE 3X14A 1UA7A 2PUQT 4Y4FA 1F3DH 1VCBC 1ZLWH 1CICD 2AEIT 4WUUD 5E08L 3HC4L 2Y2WA 1RZKH 3RDTA 4GQQA 5ELIA 4L3FA 2E27L 3A0OA 4PVMA 5CN1A 1RZ7L 3G6DH 2W81C 4PJ7A 1EQ7A 4V1DA 2ZF8A 3JUYA 5ECGA 2FT6A 5EO0B 1AOZA 4A2LA 3L1GA 5FO7B 1ZTXE 2OTJP 1FZCB 2FHFA 2I07A 4KXCA 1MI5D 4IU2A 3MTRA 3IGFA 4M43L 1WHPA 3HE5A 3M9BA 3NUKA 4JCWA 2D3JA 5DDHB 4HVBA 2G3NA 5EA0L 2GEEA 3AREB 5KUKA 5F1NA 1C5BL 5HHVH 1U8NA 3RX5A 3VFSB 5EB9A 4PS7A 2NY6C 1ZP0C 3F6JA 4TUUA 5E9NA 3VXRD 3L8QA 4F8LA 5KSAB 5L8KB 4I3GA 2KIKA 1I1FA 3WN6A 4TVPE 4XP6H 5K9OA 3BESR 3N44B 4XVSL 3WV0A 3P4MA 3BFOA 3BGAA 5G4MA 4J6RH 1GS6X 3RGBA 1JPTH 3F7VA 4B6ZA 2QEXP 1ZMYA 1GKOA 2PYFB 3U83A 2ENPA 2CU9A 1AQDA 4KZ0A 1YMMD 4WK4B 4YLQT 4XNUH 2AQQA 1A5FH 5C7XH 2Z8WC 5KS9B 1RHZB 2BXYA 1OXZA 3GTTA 5IJVA 1BD2D 3JWOH 2UXTA 4N26A 4ONOA 1WSST 2F6AA 4OGQB 1E6JL 5CLWA 5KSVB 2FGWL 4IFDK 3Q43A 3I3EA 3LHPH 2IG2H 5F7DB 3LKNA 1JK8B 5BS0B 2BOCA 3L3DA 3BQUC 5IHHA 1VQ5P 4BXVA 1T2KD 1X9LA 4HPHA 2A74A 2ROXA 1SOSA 2Z9TA 3K5RA 1TTFA 2ZOTA 3GXMA 4IDJH 3DPBA 3U79A 1IGJA 3O6LH 1IZJA 4KY2A 4ES9A 2FSEA 3BP4A 1LP9F 3FBQA 4MHHG 4TNWF 4WWPA 5CJQL 5DJAB 3B2XA 1V7MH 1FGNL 1QZNA 2KNCA 3IMVA 3Q6FB 4D8OA 4DZOA 3SO3C 3BGMA 1N6VA 4JN1L 3FT3B 5D7IF 1AGDA 4LLWA 5LQBL 4GKLA 3UC0L 4JGNA 1GL2A 4FMFA 4TRPL 4XB7A 1MV8A 1IKNA 3SE9L 4Z9KB 4H8PA 2PAJA 3SSUA 1AXSB 4KI5F 4GG6B 5E1HB 3PQYD 2NYYD 1WT5A 1U2YA 5APUA 5JHDD 3BAEL 3SN6N 1NMAH 4LU5L 3S37X 1NAMA 2PWHA 5HI5C 3LKSB 4G1MB 1CFMA 4MMZB 2XDJA 4QYOA 1VLXA 2V6HA 3BPOB 4KV5F 3HE6A 5HVHB 4ODHL 3ZO9A 1J1EB 2YJQA 4JPKH 3QQ3A 3OKOB 3RZCA 1TNNA 5ESAB 5CCGD 2W83C 3IDJA 1H19A 4OZGA 5ID0B 1WBYB 3DRTB 1RQ5A 3IJSA 5ALCL 1XV8A 5ADPL 5DJXB 3X12A 4QHUB 2C5DC 3L71G 2R69H 2N1TE 3NJLA 4FG6D 5GGTH 3L3GA 5GGSY 4E9WA 5DS2A 1DD4A 1ETZB 4Q97A 3D39A 4PJDA 3P0YL 4PQXA 4C56E 4A7QA 1L4AC 1GZQA 1NL0L 4L8SA 3GRWA 2J8UB 1CLOH 2DF3A 3L4ZA 4GIOA 1BQUA 3LSOB 1KCLA 5E9DE 4XMXA 2CM6A 2YPVL 4P2AA 3GS4A 3KPNB 4LQFH 2QG4A 4X80H 4YDKH 5HGAB 2WPGA 3RWDB 5DZNA 1A9EA 5ES4B 3ARBA 3CXDH 4GO9A 2Q76B 4XGZB 1MRFL 5KAIH 4JFEE 4BV1A 4QRFA 2J43A 3MCG1 4JM0A 4N0CC 1HHIB 5ETUB 2BNRA 1YN6B 1FZMB 4LMQE 1T66D 4LKCB 3TOPA 3ROLB 4OQTL 2VITB 1XZWA 4A7SA 1JV5A 1RE3A 1JO5A 2HFGL 3FUHA 4FTVB 1BCCE 3SWFA 3JZYA 3UGUA 3IYLW 1FVDA 4HH9B 4FQCH 1I8LA 5EOTB 2AEQH 4FMKA 3ZHDA 2BWDA 3KXFD 1I8KA 4HF5H 3UAJC 1J5OL 1N3NA 1NCAH 2Z91A 3L1FA 3LN9A 5CD5D 2BCCD 3VWKD 1R5IB 5C0CE 3BN9C 1UGKA 2MCPL 2FWOB 3L7FB 3LEVL 2CUIA 4NLAA 1IT9L 4UILH 2IFNA 2J8HA 4ODUB 1SQMA 2XNAB 3QHZL 4C54A 3QXAB 5DJCB 1RF1A 2EDQA 4O02A 3VI4E 4HJTA 3TA3B 2IH8A 4MJJA 1XHHA 3E6HA 4GS7B 2YKPA 3MLUL 3NPSC 4ZNEE 4DGYH 5HYIA 4JY5L 3QPKA 3F85A 2P5WA 1Z66A 1KJMA 2L7JA 1RH8A 4PCTA 5K33A 4M02A 3C5ZD 3QNZB 4KJQD 5I18H 5FFGA 2MQGA 4G7VH 5F7HA 1PJWA 3CWBE 3GRGA 4ODTL 3QUXC 4QOKB 5F9WC 3B7TA 2C3VB 4HJIA 1WA0X 4NIYE 4ZW3A 2OTUA 3D30A 4NO0B 4A7PA 4X7SL 5BV7B 4F9LC 1D5ZA 1IC4H 5EORL 2UUDK 2X0VA 4Q7DA 2I24N 4YHZH 5EU6B 1RHFA 3UACA 2DLIA 1MWAL 3H32B 3DIDA 3CZFB 5C0BB 2KZKA 1MUJA 5DI8B 4MRCA 2BVPA 3LQAC 4EKXA 4FQLH 4HPOH 5A16B 3M07A 4PR5B 2GCYB 3T08A 3LKOA 1H89A 5DUPH 3ATFA 5LGHH 1KMGA 2EIMB 3GIVA 5KTEH 2COQA 1OKEA 5GJTH 3RBGA 3STLB 4AQZA 5HY9B 4C7NA 1PZCA 3E9UA 4QWWC 5C0NC 2B87A 3FN3A 3OKKB 1S5IH 4XPHL 4FJZA 1UA6H 2UYLB 1LE5A 1ZTXH 3SIKA 2B77A 4NC1C 1RXLA 1G84A 1KQFB 3W68A 2VXQL 4KO6A 4WU5A 1AS8A 3N44F 1KCUL 5C0JB 3B71A 1ZS2A 2QTEA 3IF1B 4AXWA 4JPVL 3HE6D 3HLKA 4UTBH 4D9LL 5BVJA 3FRUA 5F7WC 2WWNA 3DI2B 4OLZH 4TVPH 4WSJA 4ENZA 3FMGL 3BYTA 4UV4H 1ZHLA 4APXA 2FRGP 5KS9F 1WWWX 5AVVB 5TJHA 1R3HB 3BAKA 4LCYB 3TX4A 4UQ3A 2VDRH 1TLMA 1JWMB 3R7RA 2EVJA 1VZHA 3RUGA 1KCSH 1HXMB 2DLTA 3MNVB 1PP9E 1NGYA 2ZUWA 4P5MB 2YSSA 5EOCH 1EEQA 4Y9FA 3MLXL 4M8QA 4G8IA 3CD6P 1U6AH 3EDEA 1YCSA 1SQXJ 1KZQA 1NKNA 3BUPA 4R4MA 3CFEA 2V7HA 5TDNB 1I8MB 3NZUA 4FKEA 1T0NB 4PJ5A 1FN4B 2X2YA 5TJWK 3FB5A 4DOHB 3CG8A 4YDLC 3DUSB 2J1KA 5L7XL 3VFWB 3MR9B 5D5ME 2J57A 4NUJA 3LPFA 3U25A 5DMIL 3H25A 3ARBD 5DVKA 1QFUL 1NDGA 1GCFA 5GS2D 1VAHA 2D0FA 4KITB 4ZUUB 4Z95L 1A2YB 3FSVA 4HT1L 4XCNA 2YEZB 1A7OH 2X4RA 4ELKB 1L9NA 3KH4A 4EMZA 4HGWA 4FYQA 1ZV9A 2C4FT 4MXWH 3P9LA 3OC5A 1S7TB 2BNRD 2QHLA 1FL5B 4FJYA 4NIKB 5LAXA 3KZ8A 4X99A 5C07A 2BIMA 3D12B 3AACA 2AXGA 2VDPB 2CCWA 3ULVD 4U6YB 2J88L 4GI6A 1CQKA 1AVYA 1NH6A 4JFTA 5CAYB 4GG6F 1FZJA 5KZCD 2XWRA 4LOFA 1OF2A 4WI0A 4KI1A 3X1GA 5J5EA 4R4FL 3V2AR 1ADQL 4XVOA 4Z7UE 2CA3A 1EJ8A 4PJEB 4PRBB 4OV5A 2Z4TA 2PFXA 3QW9A 5CGTA 1BCCG 2VLRE 1YEHH 3A3YB 1NGWA 1DQLL 1IBYA 1VZGA 1ZXQA 2MQ0A 1UB6A 2VO8A 4I3SL 5DHMC 1ID5I 2FBWC 4WK0B 5I1AA 3WCYA 1JOIA 4EQ2A 4AW7A 2DEYX 2LQRA 4H5SA 3NQKA 3T2NL 4FA7B 3K71B 2O01J 2BIIA 1FA4A 2BCKB 2Y5EA 4KX7A 1J7VR 1EJOL 3KR3L 3L3HA 1YPZA 1EEUA 2XVGA 3DO7A 2P5WD 4UOW1 3AE9C 1HOCA 4XRCA 1MAML 3FULA 2ZXQA 3I3BA 2DQTH 2Q3ZA 2J8UF 1NGZA 1L9PA 3S9OA 2O4EA 4DGVH 3SDXE 3OXSB 4RNRB 4OLUH 5KYUA 3WY4A 4HIHB 2XQBL 3W82A 3KCPB 5K9KA 3CWBG 3BCCD 1ZK5A 3UJJL 3V6OC 1D2PA 1K9TA 3UCRA 2CO7B 5DJUB 3ML9A 4YXWH 3FXDA 4G8EB 2E75D 5D2NB 2DLHA 2HTLD 2HPTA 4FFVC 4GRWB 4XBGB 2CGYA 4IBQA 5F7NC 4J39A 3FO0H 2Z8SA 3L4WA 1EAQA 1DVQA 5BUPA 2WKOA 4M8RA 3TJPA 1GRWA 4IL6E 3BUTA 4LEXH 3CMEP 1R24A 3FU9A 3O3BA 4ZMVA 2EUVA 4JHZA 1E5UI 1DDHA 3UADA 5CN2A 2XTJB 5IFHH 1BZ8A 2K9JB 2JFCA 4FNTA 3GB7A 2FYNC 2DEWX 3OJAB 1E9OB 3Q0HA 1OVRA 3ZKMD 5BXFA 3VSVA 1N7ML 2NZ9C 3T5WA 1YEDA 3C6LA 1RK1B 4PRPE 4UTAA 3VTAA 1E9PA 1HS6A 5GSRB 2CK0H 3TBVA 4MYWB 1YI2P 1JI1A 4BZYA 3USSA 5MEQA 2BX5A 2PRRA 3IXTA 1B0GB 1QI3A 2Z3FA 12E8H 1EDHA 1Z5LA 2E7BA 1D2OA 5KG9B 4M56A 4MN4C 2J59M 4TT3H 5BO1L 4JFZL 4FFTA 4OLYH 5EF0A 5IB1B 1L0PA 2JH2A 3HLAB 3UPCA 1LK2B 3QORC 5H37A 1NBYB 5KYYB 3LRHA 4G9FE 1PP9G 4K8RD 4NQXB 4D94A 1QR1A 3LIEA 1INDH 5E8OB 1M2VA 1PS3A 2YAFA 2HZHA 2ITCA 3QCUL 1BREA 2XETA 1QLRB 1JGIA 4YQXH 4CN6A 1OGAA 2J6EA 2J5WA 1GAFL 3PGFL 5J6HA 1RD6A 3PHSA 1BZEA 2WTOA 4YDIL 3UTSB 4U1KB 1IC7H 1XF5A 3BIBX 3CN1A 4OJYA 2ESVE 4URTB 2DLFH 3CDGA 4ZPTA 5J12C 1AO7A 4TSAL 3ZGIA 2HKHL 1A0QL 2PW2B 3QJFB 4NZRH 2VMJA 3U59A 5HD8C 2R0ZL 2BIQA 7FABH 5IHZA 1J1PH 4LRNL 3TV3L 1RSFA 3NACL 4XO4A 2PXYB 2Y7LA 3M7OA 2OX5B 3QT2A 2K7QA 1HWGB 4PRAB 4XOBA 5T3ZH 2QELA 3LD8C 3UTPD 5FUOH 5KLVD 2QBWA 5GGSB 1VB9A 1SMAA 3FFCE 4X6DA 3PDOB 4WHTB 5C07D 4JHUA 4UQ2B 2HPOA 2KL6A 3L4TA 3O8XC 4PBDA 5I8OL 1VACB 1QFOA 1PX8A 2EIEA 2X44D 1X9UA 4P2RA 5IW1B 3EO1A 2VGLM 1OAQH 2FR4A 3O6FA 3TEZA 5MERB 4B5ZA 1XEUA 3MCKB 4OZFA 2J12B 3UTQB 1CDJA 4R90H 4I1NB 4YK4C 5F9JB 4U4IA 5EMYA 3ES6B 4LT7A 4XZ4A 4ZUTB 4X8CA 4YE4H 1IGML 2OYHA 5IG7B 2ATKB 3NEXA 15C8L 1FORH 3C08H 3HG4A 1MFMA 1FYTB 3FQNA 5MEND 1ZTMA 3F7PC 2ADIA 3J7HA 3NJFA 2KK7A 3VXME 4MD5A 5IOKA 3C2AH 5CIPB 3GO1H 2VZVA 3DGGA 3G5ZB 3MRPB 2P5EB 1GXEA 1QBMH 1SQPE 4IJ3B 2XA3A 1NJ9B 4AIEA 4KKQA 2P7TA 4Q52A 1IBZA 3KYNA 2AGJH 4XCCH 2X10A 3CUPA 3HNVH 4KC3B 4JRYE 3FU0A 2TRYA 4DO6A 4NZJA 3DOIA 4RDBA 5D71L 1HE8A 3R4DA 3F8UB 1HILA 2ZSVB 5DJDA 2FKWB 5DFTA 3LZNA 4S10A 4Z78A 4M3KB 3FCTA 3VXUA 4JYCA 2C9RA 3B4NA 1J8SA 4BZ2A 1PVHA 3AXIA 3DJSA 3C5JB 3FO9A 2A6IA 4OJDH 1BWMA 1P1ZB 2NXYB 3VFVB 3VH8B 1LTXA 4MXVE 4XP9H 3T65B 5ID1B 2KLRA 5DEFB 4I0PC 2OL3L 2EH7L 1BF2A 3R1GL 1X5YA 4N2FA 3OAKA 5CLXA 2BNUB 4BFNA 4Z3EA 4R4ND 3PNWB 3BRDA 1O5PA 2WMMA 4OIFA 3ARDC 4R0LB 4QXTB 4C55A 4A7VA 3CL3D 1UD8A 2WKLA 3GF8A 4C46A 3ARSA 5GRVL 2HMID 5LBVA 5DZJA 1OCWL 5HGDB 4FZEH 4HJGA 1CE1L 1PD0A 1EA9C 3BVNB 4E9XA 4Y8AA 3FQWA 3MRBB 5E5RB 3HG1A 4Y7OC 1MZ9A 1COBA 4WFHD 1MJ8H 5AOKA 3PHOA 5I9QC 3C6LD 1Q0YL 1B2WH 1R5SA 2X9YA 2ZWZA 5K5GB 1CLZH 3EUDA 1MRCH 1JYNA 2LU3A 2EDWA 2AJVH 2EC8A 3US0A 3U9PH 3VMAA 2CNZA 5L4FA 4G83A 4Y1AE 3FN0L 2XJKA 5BRZA 1KXVC 4BRYA 2IBZE 1UUNA 3GSNA 3SDAB 3LRSB 2AABH 2W6JH 4X6CA 4OAWB 2ZPKH 4W9JC 4HWZA 2I1KA 3TZVC 3RWIA 1PMYA 1QSEB 2OTKE 3H8NA 3A21A 1K9MQ 1FYHB 3HI6L 3K81A 5APWA 4I5BB 4Z0XA 3UGXA 5EH1A 4MCZA 5EC2B 5FKAB 4F3FA 1OGAD 3AQDA 3WSQL 5CEZD 1U8CB 3DNKA 2CRIA 3C9NB 2ADFH 5GRXG 3FQRB 3I6GB 3S34L 3QQDA 3KYMA 2I5YH 3UBXB 3SHSA 3FB8B 4XR8C 3S3DB 1BX2A 3MJ7A 3FOMA 4NQDA 1KIQA 4NP4L 1QUPA 2OXGA 4GRWF 1I1CA 3T0XA 2V7QJ 1BM3L 3OKNA 4OZHE 1S7RB 1UOKA 1AC6A 3WLBA 1D7BA 4K7PL 1JHLH 1KT2B 4HFUL 2NCMA 3QEQE 1XL6A 2YQ2A 3ISRA 4P2RD 3SDDB 4M9PA 4PV1B 5DA4A 4HISA 4XOEA 4IL6H 1RJZA 2F54E 1B9KA 2XPZA 2AXHA 2DLEA 3D3VA 5I0WA 3ILDA 4KZEL 1AD0A 4GAYB 4YHYC 2IDQA 4QRPB 3OKMB 2XBTA 1M9SA 2HTKC 1J1OH 1QSFB 4CL7A 4AYSA 3L74E 3V4PA 3II2A 2LR2A 1XTMA 1IBGL 5JW4M 4X6FB 1R46A 1IGTB 1DVSA 1NTKE 4PJAE 4FFYA 1HAWA 1H8NA 4F7TA 4E42A 4DUVA 5E8EB 1LEGB