5TISH

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 14
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5tisH01
5KAIH 5KAFH 3A0BH 4UB6H 3KZIH 4IL6H 5E79H 1S5LH 4PJ0H 5B66H 5B5EH 3WU2H 5H2FH 3JCUH 5TISH 5GTHH 3A0HH 2AXTH 5GTIH 4UB8H
chains in the Genus database with same CATH superfamily
1EZVI 3V2QA 1JTHA 1OIPA 3OA7A 3P8CE 3H1IE 3L73E 1VL2A 1FJPA 2XV5A 2E43A 1L0ND 3FGAD 3U1CA 1KC8Q 1Q82Q 1L0LE 1RQVA 1AA0A 3L70J 3H1KE 1VQ9P 3CX5E 1LTTC 1FZAA 2KLVA 1NH4A 3CCEP 4OGQB 3Q3DA 4GOEA 2IYPA 2Z4EA 1G1IA 1SFCA 2KOGA 1X0TA 2JJLA 3CMAP 1SQXG 3WUUA 4L73A 3CX5H 3M0AA 2AEJA 3L71D 3PH0A 1YTZI 4NPFX 5APYA 4RESB 3H1ID 3E7KA 1FZCB 3BRVB 3L73D 1AVYA 2Y9YA 2B9BA 1NVOA 1KB9I 3AE5C 1L0LD 3C1LA 2Z5IA 5CCGD 1G2CB 3M9BA 2HR3A 2ZT9B 4JF7A 3RK2C 1CI6B 3L70G 3I5CA 1GZLA 3IAOA 4RKUJ 1T2KD 1J1EB 2J5UA 2ZVNB 1CZQA 4M3LA 2IFNA 2FYUK 1M57D 5CMZA 3MUDC 3OJAB 4H44D 3KQGA 1NTZD 3FWNA 1SQXE 3U1AA 5E79E 2RMZA 3NXSA 3SWYA 1ZMEC 2KYVA 3P7KA 3B5NA 1USDA 1SQQG 1DD3A 1QL1A 4WVZA 3D71A 3G4SP 3BRTB 4C7RA 2ZFCA 2M5AB 1N7SD 2P67A 2K9JB 2R44A 3CMEP 5E79H 3RK3B 2XKMA 2V7QH 1SQPK 2KIKA 1U7MA 1LTJA 2K1AA 4DT0A 3L70E 1ZXGA 3H1JJ 5AW1B 3VOPA 2W6BA 1BE3J 1FZCC 1JY2N 1ZW0A 1KILE 2BEQD 1SQXD 1QX8A 2C9LY 4EI2A 1UIIA 1Z56A 1EXJA 5AW0B 1YYCA 1IFDA 3A2AA 3UIAA 2ZT9C 3MIWA 4QMAA 4DOJA 2YKQA 1SQQE 3VTPC 3KPEA 2NPSD 1BDDA 1VQ5P 3M0DC 4H0LB 3L70D 1IFIA 1HF9A 2A06D 1K04A 1L4AA 3LIDA 1EDJA 3TK1A 4BWNA 5APXA 3H1JG 3QWOC 1BSHA 1KILD 2N1TD 1GU4A 1GW3A 1OZHA 2SPZA 4B86A 1LTSC 3JSVC 3RBZA 4PD4I 1NAYA 5K5GB 5AW3B 2E75B 2M0BA 1JCDA 5CCGC 3FXEA 5BVZA 2YXRB 2KZIA 1HUCA 3GW6A 1BDCA 4EDFA 3CCLP 1T2KC 5KJ7A 1CSBA 5AVRB 1HVVA 3HE5B 3M9QA 1NGMB 2H7HA 3NFQA 3NMDA 3Q5PA 4GODA 1NTMK 3CWBG 5B5EE 4H13B 4NPEA 3VN0A 4I7ZC 1LTGC 1T6AA 3H1JE 1T8ZA 1QLED 2CPBA 3T97B 2K3RA 1PFIA 2YO3A 4Y99B 2LR2A 1FAVA 5B5EH 1KQFB 1QGKB 3VMAA 3SFDC 4C46A 1LT9A 2IBZG 1SQPG 2QJKC 2R5BA 1BGYG 1ZLLA 1FDIA 1N73B 1T3UA 3L72G 1PZQA 3CWBE 5CCGA 3H1JD 1JMBA 2A45I 3EFGA 3RGUA 1KYOE 1GW4A 4HB1A 3GHGB 2HYNA 2G3AA 3KYQA 4ASWA 2WSEJ 1RF0C 4RO0A 5AVWB 2MKVA 3RL0B 2NPSC 1PIXA 1VQMP 4HJGH 3H32A 3CI9A 1RHZB 1K05A 2P10A 1KYOH 1RQUA 1JB0J 1D7MA 1P84E 2IBZE 1L0NJ 2HG5D 1JTHB 1G1JA 1SQPE 2WITA 1BGYE 3CCSP 2QVAA 2OYOA 1AFOA 1KILC 1URQB 3H25A 1N7SA 2NZ2A 3AE4C 2O1JA 1KYOD 3L72E 1P84H 1QEXA 2IX7C 2C9NY 1SFCB 4HYTB 1VQKP 5CJ4A 4ZNCA 1GL2B 1KQLA 2QEXP 3P32A 4L76A 3O8ZA 2E74B 1GDTA 2KUBA 1JY2O 1MV8A 3KDPB 3VMZA 2IBZD 4MN4C 2GA1A 3V5BA 3H1KJ 2XZRA 1EXIA 3AEGC 3HD7B 5AVXB 1Q2NA 2ITAA 3L36A 2V4HA 3AEFC 2WWWA 3GHGC 1PGPA 2FXOA 3HTKB 1DEEG 3RK2D 5EFWB 2YKOA 1NU1J 1VQPP 2YO2A 1NOHA 3RL0C 1R8EA 4NPDA 2Q3IA 3A0BE 2W83C 2O3JA 2E5YA 4ASVA 3CXHI 2OTJP 2KB7P 3C9IA 1KILA 2N1TA 2QSIA 4TT3H 2QM7A 3WUVA 4PV1B 2Y0DA 2D2CB 1MZ9A 4N3YB 1E79H 3A0BH 2JR8A 3B5NB 3Q5RA 1S4XA 4OGQD 1AJYA 1YTZT 1K9MQ 2WSEH 3QH9A 3Q5SA 4KT0J 1HJ0A 1Q7YQ 4WBAA 3A0HE 1S1CX 2B87A 1GL2C 1LTJB 1VQ4P 1YHQP 5APVA 2E74C 1JY3N 1FOSE 3F5HA 1Y9BA 1X9VA 2FFDA 1J1DB 1IJDB 5CCHA 4WY4A 2POHA 3A0HH 1VPCA 4IOIH 1L2PA 1OMIA 4BRYA 2KNCA 3MP7B 3CX5I 3CXHD 1KTMA 2ZT9D 1N8RQ 3G71P 1RH5B 3L35A 3RK3E 2KS1B 1M1JB 3GF7A 2WSFH 2E5TA 3EFFK 1QVGO 3IN6A 1MFZA 2ZVOB 1SQVK 1YQ4C 3L4FA 1L4AB 1NYHA 1OFCX 1NU1E 4PV1C 2UWJE 1NKZB 2PGDA 1X22A 2J58A 5KLIB 3CCMP 2WT7B 2KI7B 1DX7A 1JO5A 1SQQJ 3P8CD 3BCCG 2OYHA 2H8PD 3RK3D 2QA4P 1RF1C 1IFMA 5DJTB 1ZR2A 3H1KD 4LGDE 2OYIC 3CX5D 3EQ2A 1BCCG 2Q5UA 3B8EB 1PV3A 3PP5A 2LXBA 2ZJSE 2N9YB 3SFEC 4N78E 3O6QA 1NU1D 5CJ0A 1LGHB 3TNUA 2FYZA 1CW5A 2O01H 2W27A 2HPCA 4OH8B 1WRGA 1YJNP 1H0TB 2IYOA 1M7LA 2RKLA 2GUSA 3AE9C 2FKWB 2BEZF 1HGVA 1WT6A 5AVUB 1LT1A 1SQBK 4OGQC 4Y28J 1HTLC 2WZ7A 4IFMA 4TLFA 4H0LD 1HGZA 3V4WA 1H8AA 1FZEA 2FYNB 1SVFA 5AVTB 1YBKA 3L74G 2E76B 4W7YA 2ZYGA 2L91A 1Q90D 2YXQB 4N78D 4IFDK 1BCCE 2N9BA 4JBZA 1ZOYC 2WQYC 3MHVA 1SLQA 1VQNP 5KLVK 2FY8A 1KQGB 3TYYA 1EDKA 2E75D 2WSCJ 1PP9G 2I1KA 1VQ6P 3WUTA 2W8ZA 1J1EC 1PGJA 5CBOA 3MUDA 4AYCA 3H32B 1N86A 2RH0A 1JY2P 3GMAA 3L74E 5TJHA 4H13D 3H1HJ 2JWAA 3ITKA 3CWBJ 1SQVG 1JM0A 3CCQP 2FYUJ 1GK6A 4U3FG 2LKMA 4JYBA 1W2BO 4ZMDA 3MD0A 3R2PA 3B4SA 4D6TJ 3IR9A 3RK3C 1PP9E 5KKZB 2E76C 2P58A 3BASA 4C7NB 2KZJA 1SQQD 2WSSH 1JY3O 1RY3A 1LWUB 1MKMA 2JP3A 1UIXA 1SQPJ 1KD1Q 1FZCA 1BGYJ 2HFED 4KHXA 2B88A 1FOSF 4YXDC 4GDOA 2PP6A 4YPCA 3F89A 3L74D 2Q1KA 3I55P 3C8VA 3H1HG 2C0WA 1CI6A 3L72J 3CC4P 2FYUG 1SQVE 4AQRD 5AVVB 4U3FE 3MZWB 1VF5B 1NTKK 3M0DA 3RL0D 2IZ1A 3USSA 1IC2A 2WPVB 4D6TG 3AEAC 2HLOA 4H0LC 1SQBG 4ZKUA 2PRRA 3HUSB 4WWIA 2XNXA 3PJSK 2VRSA 3A3YB 4LLHA 2OTKE 3ABVC 1DIPA 1URQD 2M5AA 3CLQA 2WSCH 3WU2E 1KYOI 3D6YA 5GTHE 3H1LJ 3H1HE 2Q3EA 1LP1B 1SFCD 2E75C 2FYUE 4DZOA 3K5BA 1L0LK 2B87B 1GL2D 1LWUC 2H88C 3M06A 3JC22 1JOCA 1KZUB 3G9RA 3WU2H 1S72P 2E74D 2WVRA 5GTHH 2R3CA 1NJIQ 2FFDB 1KORA 2IBZI 2KSEA 4D6TE 4WY4B 2KXPB 3HD7D 3VP9A 2GM4A 4BRYB 2KNCB 1RE3C 2NRGA 4H13C 1NTZK 3CC2P 3KXDA 1NTMJ 3GLMA 3AEEC 3H1HD 3LW5H 4Y99C 3CWBD 3H1LG 5C39A 4JPZB 2FYUD 2I1JA 4HH2A 5H2FE 4DCKA 3HUSC 5AW2B 2WSFJ 3VMYA 3S4RA 1IK9A 4UB8E 1LTIC 3L75J 4PV1D 4UB6E 1AVOA 2D2CD 3CCVP 4D6TD 3AEBC 2XDJA 5DJUB 3B5ND 2WPSA 1N73C 4K35A 5H2FH 4GOFA 3AE6C 1P84D 2CK3H 1SQXK 4BXLA 4R4MA 1SQPD 3V4QA 5GTIE 1AQ5A 1BGYD 4UB8H 1GD2E 1EDLA 3D6ZA 2OYHB 1DD4A 4UB6H 1RE4C 1FZFA 1NTMG 3II6A 1Y8AA 1NKNA 1RF0A 2FBWC 3HE5A 2NPSA 3L72D 3H1LE 1YJWP 5GTIH 3G3ZA 1NTKG 3O6QB 3TNUB 1QVFO 2LXCB 1VQ7P 3L75G 1WMKA 3T97A 3SSUA 1GMJA 3JCUE 2XU6A 3OAKA 1YJ9P 5TISE 2Q9IA 3Q1MA 1URQC 1ZN5A 2O01J 3TGUG 5APTA 1YIJP 2BCCG 2YMYA 4R4LA 3N4XA 5B66E 3BATA 2YMKA 3AECC 1SFCC 3JCUH 3L73G 5TISH 3TDKA 1L4AD 3TSIA 2B89A 1NTME 3S9OA 5AW4B 2W6AA 3H1LD 3U59A 2JDIH 3HE4A 1ZP0C 1EZVG 2KP8A 2WPRA 1J2JB 2AXCA 5AW6B 2AEMA 4PJ0E 1FDOA 2FXMA 3GF3A 2W90A 1NTKE 5B66H 2IZ0A 1IO4A 3HD7C 1FJKA 2Y9ZA 3GHGA 3L75E 3R4YA 1Q86Q 1R5SA 3BCCJ 4L74A 4W7ZA 1NTZG 4PJ0H 1FBMA 3V2NA 3LIEA 1JEKA 1JNMA 5KJ7D 3TGUE 1JY3P 3CCRP 2BCCE 3WMM0 1NTMD 1BCCJ 3EWKA 2Y0CA 1OWAA 2I8DA 2R5DA 4OVNF 2KSJA 1R5LA 2P2UA 2R3SA 1URQA 1EZVE 1MUUA 1NTKD 2Q7CA 2D2CC 2PAJA 1VDFA 3P8MC 3CCUP 3B5NC 3L37A 3L75D 4EIJA 2R32A 4KJMA 2WPQA 3H6PA 1KMIZ 3AEDC 1GL2A 3MGNA 1VQ8P 2E76D 1NHLA 1LTJC 1JMMA 2WMMA 1NTZE 3TGUD 1Y47A 3L74J 5AVQB 2BCCD 4GKGA 3N7NA 5CHXA 1FU1A 4W80A 1VQLP 3HD7A 1J1DC 2YKPA 4K3AA 1NAFA 1LTAC 3Q2YA 1EZVD 3M91A 4ZKPA 1OVRA 1X79B 2QG4A 3HTKA 2O01N 1FZGA 2YIUB 2A06G 1NWQA 1OW6A 1K8AQ 1KB9E 5APWA 1PP9J 3V6IA 1M1JC 2W6JH 3I56P 2HODA 2QJYB 2IFMA 3S1KA 3BCCE 3D70A 5L8RJ 1USEA 1IK7A 1KB9H 1L4AC 1EDIA 1LT9B 4I6MC 1GK4A 2KLUA 1A02F 1H89A 5AW8B 3CL3D 1SQVJ 2Y0EA 1YITP 5KLIC 4O9BA 4U3FJ 5KAFE 1PGQA 1FZBA 1RF1A 3BVHA 5AW5B 1KB9D 3CCJP 2OYIA 2A06E 1DEBA 4Z1MH 2IDBA 3FX0A 3V2PA 3AE1C 2AXTE 2XNDH 3AE3C 5KAFH 1M8OB 3IFMA 3BCCD 1YI2P 5KJ7C 1PGOA 5APSA 1TU3F 5APQA 4H44B 1M90Q 3SWFA 4GIFA 4I7ZB 2AXTH 1N2DC 2YIUC 3HRNA 2KS1A 1M1JA 1BCCD 2OQQA 1GU5A 1SS1A 2JKVA 1HBWA 4DJGA 2ZYDA 1VF5D 2JEEA 4U7JA 2QJYC 2C0XA 3AE7C 1N7SB 1Q81Q 2CPSA 3FWLA 1YQ3C 1ZR4A 2FYNC 2QJPB 4XE5B 1BSNA 3LW5J 1LT9C 1SQBJ 1MFTA 2QJKB 4WB4A 1BE3G 1LJ2A 1XTCC 2DW3A 2WT7A 1U57A 1JUNA 1FC2C 3W67A 4CPGA 2P7JA 3MTUE 1G2CA 4LC1A 1U7JA 4PD4E 5KLVJ 2H43A 2M8RA 1E5WA 1L0NK 2NPSB 1AV1A 1A02J 5KTBA 3AE8C 3VP8A 1M56D 5CCHD 1W2EA 1PP9D 1ZV8A 4WY4D 4H44C 2J59M 4PD4H 1H0TA 2ZXXA 5APUA 1IZNB 1BE3E 1DH3A 1KILB 2N1TB 2A45G 3M9HA 3PRJA 1AQTA 1X8YA 3CPWO 1H88A 1N7SC 2G8YA 2K9JA 1IFNA 4GT1A 4YTPC 4PD4D 3V2RA 2OARA 1SQVD 3FXDA 5KAIE 2P1JA 3PHLA 2QJPC 2Q6QA 4U3FD 1S3JA 5KKZC 5KLVG 5BU5A 3RL0g 2FXPA 5M1BA 1HJBA 1N7LA 3HE4B 1OVUA 2PFXA 3NTNA 1ZRTE 2YNYA 2GUVA 4OWFA 1SP4A 4A7PA 4N6JA 1P84I 2QE7H 4IFFA 5KAIH 1BE3D 1NU1K 1SQBE 3RBXA 1VQOP 3KHUA 5AVSB 1FS0E 4I2LC 3IF4A 1S2EA 1IFPA 4XA4A 1OW7A 1XTGB 4AUWA 1KV4A 2AEFA 3TF5A 2QIWA 1VF5C 3A5TA 2IPPA 1JCCA 1KQSO 4L75A 1FDMA 3CD6P 1GTWA 2M3EA 1NTKJ 5KLVE 2A45H 1S9KE 1T3JA 1ZRTD 2KK7A 4RJTA 2K88A 2N1TC 1KFNA 4YXWH 1OW8A 3KZIE 1EC5A 5AW7B 1SQBD 4IL6X 1KN7A 1S5LX 2QM8A 4C7NA 3CC7P 3TGUJ 2WTYA 3L71J 1LWUA 1PPJG 2BCCJ 3KZIH 3GG2A 3H1IJ 3L73J 1QL2A 1W5CE 2K9YA 2OGUA 2JO1A 1L0LJ 2FFDC 5KLVD 1S9KD 1L0NG 5AVZB 5CCHC 4WY4C 3VYIA 1LTBC 1RE3A 5AVYB 2O1KA 2ZXEB 2HPCB 1OX3A 1EQ7A 2OTLP 1OXZA 2QRXA 4JYCA 3A7OA 3E1IA 4EYYQ 2MJZA 3SWKA 1NTZJ 2E42A 1OVVA 2HODB 4IL6E 4XFJA 1PL5A 1S5LE 3HUSA 1FE6A 3L71G 4JQ0D 1KFMA 1PPJE 2BASA 1M1KQ 2ZAEB 3H1IG 3E1RA 1SQQK 2M3BA 3W68A 2RN0A 5BU8B 3AE2C 3CXHE 1L0LG 1N73A 3H1KG 3OW2O 1LNQA 4IL6H 4I1LA 1S5LH 3B71A 1L0NE 2Z5HA 1NO4A 2JWDA 1LP1A 2K37A 1K73Q 1RF1B 2ZYAA 2L5GB 3PLNA 1RE4A 3G6EP 1NU1G 2OYHC 1HWTC 3CXHH 2OYIB 5CBNA 1SQXJ 3RK2B 3PTZA 4HKZH 1HH0A 2V7QJ 4EOTA 5AW9B 2H89C 3VMXA 3ZDMA 1PPJD 1IFJA 3L71E
chains in the Genus database with same CATH topology
5KAIH 5KAFH 3A0BH 4UB6H 3KZIH 4IL6H 5E79H 1S5LH 4PJ0H 5B66H 5B5EH 3WU2H 5H2FH 3JCUH 5TISH 5GTHH 3A0HH 2AXTH 5GTIH 4UB8H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5KAI H;  5KAF H;  3A0B H;  4UB6 H;  3KZI H;  4IL6 H;  5E79 H;  1S5L H;  4PJ0 H;  5B66 H;  5B5E H;  3WU2 H;  5H2F H;  3JCU H;  5TIS H;  5GTH H;  3A0H H;  2AXT H;  5GTI H;  4UB8 H; 
#chains in the Genus database with same CATH topology
 1EZV I;  3V2Q A;  1JTH A;  1OIP A;  3OA7 A;  3P8C E;  3H1I E;  3L73 E;  1VL2 A;  1FJP A;  2XV5 A;  2E43 A;  1L0N D;  3FGA D;  3U1C A;  1KC8 Q;  1Q82 Q;  1L0L E;  1RQV A;  1AA0 A;  3L70 J;  3H1K E;  1VQ9 P;  3CX5 E;  1LTT C;  1FZA A;  2KLV A;  1NH4 A;  3CCE P;  4OGQ B;  3Q3D A;  4GOE A;  2IYP A;  2Z4E A;  1G1I A;  1SFC A;  2KOG A;  1X0T A;  2JJL A;  3CMA P;  1SQX G;  3WUU A;  4L73 A;  3CX5 H;  3M0A A;  2AEJ A;  3L71 D;  3PH0 A;  1YTZ I;  4NPF X;  5APY A;  4RES B;  3H1I D;  3E7K A;  1FZC B;  3BRV B;  3L73 D;  1AVY A;  2Y9Y A;  2B9B A;  1NVO A;  1KB9 I;  3AE5 C;  1L0L D;  3C1L A;  2Z5I A;  5CCG D;  1G2C B;  3M9B A;  2HR3 A;  2ZT9 B;  4JF7 A;  3RK2 C;  1CI6 B;  3L70 G;  3I5C A;  1GZL A;  3IAO A;  4RKU J;  1T2K D;  1J1E B;  2J5U A;  2ZVN B;  1CZQ A;  4M3L A;  2IFN A;  2FYU K;  1M57 D;  5CMZ A;  3MUD C;  3OJA B;  4H44 D;  3KQG A;  1NTZ D;  3FWN A;  1SQX E;  3U1A A;  5E79 E;  2RMZ A;  3NXS A;  3SWY A;  1ZME C;  2KYV A;  3P7K A;  3B5N A;  1USD A;  1SQQ G;  1DD3 A;  1QL1 A;  4WVZ A;  3D71 A;  3G4S P;  3BRT B;  4C7R A;  2ZFC A;  2M5A B;  1N7S D;  2P67 A;  2K9J B;  2R44 A;  3CME P;  5E79 H;  3RK3 B;  2XKM A;  2V7Q H;  1SQP K;  2KIK A;  1U7M A;  1LTJ A;  2K1A A;  4DT0 A;  3L70 E;  1ZXG A;  3H1J J;  5AW1 B;  3VOP A;  2W6B A;  1BE3 J;  1FZC C;  1JY2 N;  1ZW0 A;  1KIL E;  2BEQ D;  1SQX D;  1QX8 A;  2C9L Y;  4EI2 A;  1UII A;  1Z56 A;  1EXJ A;  5AW0 B;  1YYC A;  1IFD A;  3A2A A;  3UIA A;  2ZT9 C;  3MIW A;  4QMA A;  4DOJ A;  2YKQ A;  1SQQ E;  3VTP C;  3KPE A;  2NPS D;  1BDD A;  1VQ5 P;  3M0D C;  4H0L B;  3L70 D;  1IFI A;  1HF9 A;  2A06 D;  1K04 A;  1L4A A;  3LID A;  1EDJ A;  3TK1 A;  4BWN A;  5APX A;  3H1J G;  3QWO C;  1BSH A;  1KIL D;  2N1T D;  1GU4 A;  1GW3 A;  1OZH A;  2SPZ A;  4B86 A;  1LTS C;  3JSV C;  3RBZ A;  4PD4 I;  1NAY A;  5K5G B;  5AW3 B;  2E75 B;  2M0B A;  1JCD A;  5CCG C;  3FXE A;  5BVZ A;  2YXR B;  2KZI A;  1HUC A;  3GW6 A;  1BDC A;  4EDF A;  3CCL P;  1T2K C;  5KJ7 A;  1CSB A;  5AVR B;  1HVV A;  3HE5 B;  3M9Q A;  1NGM B;  2H7H A;  3NFQ A;  3NMD A;  3Q5P A;  4GOD A;  1NTM K;  3CWB G;  5B5E E;  4H13 B;  4NPE A;  3VN0 A;  4I7Z C;  1LTG C;  1T6A A;  3H1J E;  1T8Z A;  1QLE D;  2CPB A;  3T97 B;  2K3R A;  1PFI A;  2YO3 A;  4Y99 B;  2LR2 A;  1FAV A;  5B5E H;  1KQF B;  1QGK B;  3VMA A;  3SFD C;  4C46 A;  1LT9 A;  2IBZ G;  1SQP G;  2QJK C;  2R5B A;  1BGY G;  1ZLL A;  1FDI A;  1N73 B;  1T3U A;  3L72 G;  1PZQ A;  3CWB E;  5CCG A;  3H1J D;  1JMB A;  2A45 I;  3EFG A;  3RGU A;  1KYO E;  1GW4 A;  4HB1 A;  3GHG B;  2HYN A;  2G3A A;  3KYQ A;  4ASW A;  2WSE J;  1RF0 C;  4RO0 A;  5AVW B;  2MKV A;  3RL0 B;  2NPS C;  1PIX A;  1VQM P;  4HJG H;  3H32 A;  3CI9 A;  1RHZ B;  1K05 A;  2P10 A;  1KYO H;  1RQU A;  1JB0 J;  1D7M A;  1P84 E;  2IBZ E;  1L0N J;  2HG5 D;  1JTH B;  1G1J A;  1SQP E;  2WIT A;  1BGY E;  3CCS P;  2QVA A;  2OYO A;  1AFO A;  1KIL C;  1URQ B;  3H25 A;  1N7S A;  2NZ2 A;  3AE4 C;  2O1J A;  1KYO D;  3L72 E;  1P84 H;  1QEX A;  2IX7 C;  2C9N Y;  1SFC B;  4HYT B;  1VQK P;  5CJ4 A;  4ZNC A;  1GL2 B;  1KQL A;  2QEX P;  3P32 A;  4L76 A;  3O8Z A;  2E74 B;  1GDT A;  2KUB A;  1JY2 O;  1MV8 A;  3KDP B;  3VMZ A;  2IBZ D;  4MN4 C;  2GA1 A;  3V5B A;  3H1K J;  2XZR A;  1EXI A;  3AEG C;  3HD7 B;  5AVX B;  1Q2N A;  2ITA A;  3L36 A;  2V4H A;  3AEF C;  2WWW A;  3GHG C;  1PGP A;  2FXO A;  3HTK B;  1DEE G;  3RK2 D;  5EFW B;  2YKO A;  1NU1 J;  1VQP P;  2YO2 A;  1NOH A;  3RL0 C;  1R8E A;  4NPD A;  2Q3I A;  3A0B E;  2W83 C;  2O3J A;  2E5Y A;  4ASV A;  3CXH I;  2OTJ P;  2KB7 P;  3C9I A;  1KIL A;  2N1T A;  2QSI A;  4TT3 H;  2QM7 A;  3WUV A;  4PV1 B;  2Y0D A;  2D2C B;  1MZ9 A;  4N3Y B;  1E79 H;  3A0B H;  2JR8 A;  3B5N B;  3Q5R A;  1S4X A;  4OGQ D;  1AJY A;  1YTZ T;  1K9M Q;  2WSE H;  3QH9 A;  3Q5S A;  4KT0 J;  1HJ0 A;  1Q7Y Q;  4WBA A;  3A0H E;  1S1C X;  2B87 A;  1GL2 C;  1LTJ B;  1VQ4 P;  1YHQ P;  5APV A;  2E74 C;  1JY3 N;  1FOS E;  3F5H A;  1Y9B A;  1X9V A;  2FFD A;  1J1D B;  1IJD B;  5CCH A;  4WY4 A;  2POH A;  3A0H H;  1VPC A;  4IOI H;  1L2P A;  1OMI A;  4BRY A;  2KNC A;  3MP7 B;  3CX5 I;  3CXH D;  1KTM A;  2ZT9 D;  1N8R Q;  3G71 P;  1RH5 B;  3L35 A;  3RK3 E;  2KS1 B;  1M1J B;  3GF7 A;  2WSF H;  2E5T A;  3EFF K;  1QVG O;  3IN6 A;  1MFZ A;  2ZVO B;  1SQV K;  1YQ4 C;  3L4F A;  1L4A B;  1NYH A;  1OFC X;  1NU1 E;  4PV1 C;  2UWJ E;  1NKZ B;  2PGD A;  1X22 A;  2J58 A;  5KLI B;  3CCM P;  2WT7 B;  2KI7 B;  1DX7 A;  1JO5 A;  1SQQ J;  3P8C D;  3BCC G;  2OYH A;  2H8P D;  3RK3 D;  2QA4 P;  1RF1 C;  1IFM A;  5DJT B;  1ZR2 A;  3H1K D;  4LGD E;  2OYI C;  3CX5 D;  3EQ2 A;  1BCC G;  2Q5U A;  3B8E B;  1PV3 A;  3PP5 A;  2LXB A;  2ZJS E;  2N9Y B;  3SFE C;  4N78 E;  3O6Q A;  1NU1 D;  5CJ0 A;  1LGH B;  3TNU A;  2FYZ A;  1CW5 A;  2O01 H;  2W27 A;  2HPC A;  4OH8 B;  1WRG A;  1YJN P;  1H0T B;  2IYO A;  1M7L A;  2RKL A;  2GUS A;  3AE9 C;  2FKW B;  2BEZ F;  1HGV A;  1WT6 A;  5AVU B;  1LT1 A;  1SQB K;  4OGQ C;  4Y28 J;  1HTL C;  2WZ7 A;  4IFM A;  4TLF A;  4H0L D;  1HGZ A;  3V4W A;  1H8A A;  1FZE A;  2FYN B;  1SVF A;  5AVT B;  1YBK A;  3L74 G;  2E76 B;  4W7Y A;  2ZYG A;  2L91 A;  1Q90 D;  2YXQ B;  4N78 D;  4IFD K;  1BCC E;  2N9B A;  4JBZ A;  1ZOY C;  2WQY C;  3MHV A;  1SLQ A;  1VQN P;  5KLV K;  2FY8 A;  1KQG B;  3TYY A;  1EDK A;  2E75 D;  2WSC J;  1PP9 G;  2I1K A;  1VQ6 P;  3WUT A;  2W8Z A;  1J1E C;  1PGJ A;  5CBO A;  3MUD A;  4AYC A;  3H32 B;  1N86 A;  2RH0 A;  1JY2 P;  3GMA A;  3L74 E;  5TJH A;  4H13 D;  3H1H J;  2JWA A;  3ITK A;  3CWB J;  1SQV G;  1JM0 A;  3CCQ P;  2FYU J;  1GK6 A;  4U3F G;  2LKM A;  4JYB A;  1W2B O;  4ZMD A;  3MD0 A;  3R2P A;  3B4S A;  4D6T J;  3IR9 A;  3RK3 C;  1PP9 E;  5KKZ B;  2E76 C;  2P58 A;  3BAS A;  4C7N B;  2KZJ A;  1SQQ D;  2WSS H;  1JY3 O;  1RY3 A;  1LWU B;  1MKM A;  2JP3 A;  1UIX A;  1SQP J;  1KD1 Q;  1FZC A;  1BGY J;  2HFE D;  4KHX A;  2B88 A;  1FOS F;  4YXD C;  4GDO A;  2PP6 A;  4YPC A;  3F89 A;  3L74 D;  2Q1K A;  3I55 P;  3C8V A;  3H1H G;  2C0W A;  1CI6 A;  3L72 J;  3CC4 P;  2FYU G;  1SQV E;  4AQR D;  5AVV B;  4U3F E;  3MZW B;  1VF5 B;  1NTK K;  3M0D A;  3RL0 D;  2IZ1 A;  3USS A;  1IC2 A;  2WPV B;  4D6T G;  3AEA C;  2HLO A;  4H0L C;  1SQB G;  4ZKU A;  2PRR A;  3HUS B;  4WWI A;  2XNX A;  3PJS K;  2VRS A;  3A3Y B;  4LLH A;  2OTK E;  3ABV C;  1DIP A;  1URQ D;  2M5A A;  3CLQ A;  2WSC H;  3WU2 E;  1KYO I;  3D6Y A;  5GTH E;  3H1L J;  3H1H E;  2Q3E A;  1LP1 B;  1SFC D;  2E75 C;  2FYU E;  4DZO A;  3K5B A;  1L0L K;  2B87 B;  1GL2 D;  1LWU C;  2H88 C;  3M06 A;  3JC2 2;  1JOC A;  1KZU B;  3G9R A;  3WU2 H;  1S72 P;  2E74 D;  2WVR A;  5GTH H;  2R3C A;  1NJI Q;  2FFD B;  1KOR A;  2IBZ I;  2KSE A;  4D6T E;  4WY4 B;  2KXP B;  3HD7 D;  3VP9 A;  2GM4 A;  4BRY B;  2KNC B;  1RE3 C;  2NRG A;  4H13 C;  1NTZ K;  3CC2 P;  3KXD A;  1NTM J;  3GLM A;  3AEE C;  3H1H D;  3LW5 H;  4Y99 C;  3CWB D;  3H1L G;  5C39 A;  4JPZ B;  2FYU D;  2I1J A;  4HH2 A;  5H2F E;  4DCK A;  3HUS C;  5AW2 B;  2WSF J;  3VMY A;  3S4R A;  1IK9 A;  4UB8 E;  1LTI C;  3L75 J;  4PV1 D;  4UB6 E;  1AVO A;  2D2C D;  3CCV P;  4D6T D;  3AEB C;  2XDJ A;  5DJU B;  3B5N D;  2WPS A;  1N73 C;  4K35 A;  5H2F H;  4GOF A;  3AE6 C;  1P84 D;  2CK3 H;  1SQX K;  4BXL A;  4R4M A;  1SQP D;  3V4Q A;  5GTI E;  1AQ5 A;  1BGY D;  4UB8 H;  1GD2 E;  1EDL A;  3D6Z A;  2OYH B;  1DD4 A;  4UB6 H;  1RE4 C;  1FZF A;  1NTM G;  3II6 A;  1Y8A A;  1NKN A;  1RF0 A;  2FBW C;  3HE5 A;  2NPS A;  3L72 D;  3H1L E;  1YJW P;  5GTI H;  3G3Z A;  1NTK G;  3O6Q B;  3TNU B;  1QVF O;  2LXC B;  1VQ7 P;  3L75 G;  1WMK A;  3T97 A;  3SSU A;  1GMJ A;  3JCU E;  2XU6 A;  3OAK A;  1YJ9 P;  5TIS E;  2Q9I A;  3Q1M A;  1URQ C;  1ZN5 A;  2O01 J;  3TGU G;  5APT A;  1YIJ P;  2BCC G;  2YMY A;  4R4L A;  3N4X A;  5B66 E;  3BAT A;  2YMK A;  3AEC C;  1SFC C;  3JCU H;  3L73 G;  5TIS H;  3TDK A;  1L4A D;  3TSI A;  2B89 A;  1NTM E;  3S9O A;  5AW4 B;  2W6A A;  3H1L D;  3U59 A;  2JDI H;  3HE4 A;  1ZP0 C;  1EZV G;  2KP8 A;  2WPR A;  1J2J B;  2AXC A;  5AW6 B;  2AEM A;  4PJ0 E;  1FDO A;  2FXM A;  3GF3 A;  2W90 A;  1NTK E;  5B66 H;  2IZ0 A;  1IO4 A;  3HD7 C;  1FJK A;  2Y9Z A;  3GHG A;  3L75 E;  3R4Y A;  1Q86 Q;  1R5S A;  3BCC J;  4L74 A;  4W7Z A;  1NTZ G;  4PJ0 H;  1FBM A;  3V2N A;  3LIE A;  1JEK A;  1JNM A;  5KJ7 D;  3TGU E;  1JY3 P;  3CCR P;  2BCC E;  3WMM 0;  1NTM D;  1BCC J;  3EWK A;  2Y0C A;  1OWA A;  2I8D A;  2R5D A;  4OVN F;  2KSJ A;  1R5L A;  2P2U A;  2R3S A;  1URQ A;  1EZV E;  1MUU A;  1NTK D;  2Q7C A;  2D2C C;  2PAJ A;  1VDF A;  3P8M C;  3CCU P;  3B5N C;  3L37 A;  3L75 D;  4EIJ A;  2R32 A;  4KJM A;  2WPQ A;  3H6P A;  1KMI Z;  3AED C;  1GL2 A;  3MGN A;  1VQ8 P;  2E76 D;  1NHL A;  1LTJ C;  1JMM A;  2WMM A;  1NTZ E;  3TGU D;  1Y47 A;  3L74 J;  5AVQ B;  2BCC D;  4GKG A;  3N7N A;  5CHX A;  1FU1 A;  4W80 A;  1VQL P;  3HD7 A;  1J1D C;  2YKP A;  4K3A A;  1NAF A;  1LTA C;  3Q2Y A;  1EZV D;  3M91 A;  4ZKP A;  1OVR A;  1X79 B;  2QG4 A;  3HTK A;  2O01 N;  1FZG A;  2YIU B;  2A06 G;  1NWQ A;  1OW6 A;  1K8A Q;  1KB9 E;  5APW A;  1PP9 J;  3V6I A;  1M1J C;  2W6J H;  3I56 P;  2HOD A;  2QJY B;  2IFM A;  3S1K A;  3BCC E;  3D70 A;  5L8R J;  1USE A;  1IK7 A;  1KB9 H;  1L4A C;  1EDI A;  1LT9 B;  4I6M C;  1GK4 A;  2KLU A;  1A02 F;  1H89 A;  5AW8 B;  3CL3 D;  1SQV J;  2Y0E A;  1YIT P;  5KLI C;  4O9B A;  4U3F J;  5KAF E;  1PGQ A;  1FZB A;  1RF1 A;  3BVH A;  5AW5 B;  1KB9 D;  3CCJ P;  2OYI A;  2A06 E;  1DEB A;  4Z1M H;  2IDB A;  3FX0 A;  3V2P A;  3AE1 C;  2AXT E;  2XND H;  3AE3 C;  5KAF H;  1M8O B;  3IFM A;  3BCC D;  1YI2 P;  5KJ7 C;  1PGO A;  5APS A;  1TU3 F;  5APQ A;  4H44 B;  1M90 Q;  3SWF A;  4GIF A;  4I7Z B;  2AXT H;  1N2D C;  2YIU C;  3HRN A;  2KS1 A;  1M1J A;  1BCC D;  2OQQ A;  1GU5 A;  1SS1 A;  2JKV A;  1HBW A;  4DJG A;  2ZYD A;  1VF5 D;  2JEE A;  4U7J A;  2QJY C;  2C0X A;  3AE7 C;  1N7S B;  1Q81 Q;  2CPS A;  3FWL A;  1YQ3 C;  1ZR4 A;  2FYN C;  2QJP B;  4XE5 B;  1BSN A;  3LW5 J;  1LT9 C;  1SQB J;  1MFT A;  2QJK B;  4WB4 A;  1BE3 G;  1LJ2 A;  1XTC C;  2DW3 A;  2WT7 A;  1U57 A;  1JUN A;  1FC2 C;  3W67 A;  4CPG A;  2P7J A;  3MTU E;  1G2C A;  4LC1 A;  1U7J A;  4PD4 E;  5KLV J;  2H43 A;  2M8R A;  1E5W A;  1L0N K;  2NPS B;  1AV1 A;  1A02 J;  5KTB A;  3AE8 C;  3VP8 A;  1M56 D;  5CCH D;  1W2E A;  1PP9 D;  1ZV8 A;  4WY4 D;  4H44 C;  2J59 M;  4PD4 H;  1H0T A;  2ZXX A;  5APU A;  1IZN B;  1BE3 E;  1DH3 A;  1KIL B;  2N1T B;  2A45 G;  3M9H A;  3PRJ A;  1AQT A;  1X8Y A;  3CPW O;  1H88 A;  1N7S C;  2G8Y A;  2K9J A;  1IFN A;  4GT1 A;  4YTP C;  4PD4 D;  3V2R A;  2OAR A;  1SQV D;  3FXD A;  5KAI E;  2P1J A;  3PHL A;  2QJP C;  2Q6Q A;  4U3F D;  1S3J A;  5KKZ C;  5KLV G;  5BU5 A;  3RL0 g;  2FXP A;  5M1B A;  1HJB A;  1N7L A;  3HE4 B;  1OVU A;  2PFX A;  3NTN A;  1ZRT E;  2YNY A;  2GUV A;  4OWF A;  1SP4 A;  4A7P A;  4N6J A;  1P84 I;  2QE7 H;  4IFF A;  5KAI H;  1BE3 D;  1NU1 K;  1SQB E;  3RBX A;  1VQO P;  3KHU A;  5AVS B;  1FS0 E;  4I2L C;  3IF4 A;  1S2E A;  1IFP A;  4XA4 A;  1OW7 A;  1XTG B;  4AUW A;  1KV4 A;  2AEF A;  3TF5 A;  2QIW A;  1VF5 C;  3A5T A;  2IPP A;  1JCC A;  1KQS O;  4L75 A;  1FDM A;  3CD6 P;  1GTW A;  2M3E A;  1NTK J;  5KLV E;  2A45 H;  1S9K E;  1T3J A;  1ZRT D;  2KK7 A;  4RJT A;  2K88 A;  2N1T C;  1KFN A;  4YXW H;  1OW8 A;  3KZI E;  1EC5 A;  5AW7 B;  1SQB D;  4IL6 X;  1KN7 A;  1S5L X;  2QM8 A;  4C7N A;  3CC7 P;  3TGU J;  2WTY A;  3L71 J;  1LWU A;  1PPJ G;  2BCC J;  3KZI H;  3GG2 A;  3H1I J;  3L73 J;  1QL2 A;  1W5C E;  2K9Y A;  2OGU A;  2JO1 A;  1L0L J;  2FFD C;  5KLV D;  1S9K D;  1L0N G;  5AVZ B;  5CCH C;  4WY4 C;  3VYI A;  1LTB C;  1RE3 A;  5AVY B;  2O1K A;  2ZXE B;  2HPC B;  1OX3 A;  1EQ7 A;  2OTL P;  1OXZ A;  2QRX A;  4JYC A;  3A7O A;  3E1I A;  4EYY Q;  2MJZ A;  3SWK A;  1NTZ J;  2E42 A;  1OVV A;  2HOD B;  4IL6 E;  4XFJ A;  1PL5 A;  1S5L E;  3HUS A;  1FE6 A;  3L71 G;  4JQ0 D;  1KFM A;  1PPJ E;  2BAS A;  1M1K Q;  2ZAE B;  3H1I G;  3E1R A;  1SQQ K;  2M3B A;  3W68 A;  2RN0 A;  5BU8 B;  3AE2 C;  3CXH E;  1L0L G;  1N73 A;  3H1K G;  3OW2 O;  1LNQ A;  4IL6 H;  4I1L A;  1S5L H;  3B71 A;  1L0N E;  2Z5H A;  1NO4 A;  2JWD A;  1LP1 A;  2K37 A;  1K73 Q;  1RF1 B;  2ZYA A;  2L5G B;  3PLN A;  1RE4 A;  3G6E P;  1NU1 G;  2OYH C;  1HWT C;  3CXH H;  2OYI B;  5CBN A;  1SQX J;  3RK2 B;  3PTZ A;  4HKZ H;  1HH0 A;  2V7Q J;  4EOT A;  5AW9 B;  2H89 C;  3VMX A;  3ZDM A;  1PPJ D;  1IFJ A;  3L71 E; 
#chains in the Genus database with same CATH homology
 5KAI H;  5KAF H;  3A0B H;  4UB6 H;  3KZI H;  4IL6 H;  5E79 H;  1S5L H;  4PJ0 H;  5B66 H;  5B5E H;  3WU2 H;  5H2F H;  3JCU H;  5TIS H;  5GTH H;  3A0H H;  2AXT H;  5GTI H;  4UB8 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...