5TISH

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Photosynthesis
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
total genus 14
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5tisH01
3WU2H 5E79H 5TISH 3KZIH 5KAFH 3JCUH 4IL6H 1S5LH 5GTIH 4PJ0H 5B66H 5KAIH 2AXTH 5H2FH 5B5EH 4UB8H 3A0BH 5GTHH 4UB6H 3A0HH
chains in the Genus database with same CATH superfamily
3G9RA 1MZ9A 3L75G 3FWNA 3V5BA 2HYNA 1VPCA 2FBWC 1KYOI 2OYIC 1JTHA 1RE4A 1M7LA 4D6TJ 1NAFA 4OGQC 1SQBD 1KTMA 1LTBC 5APXA 1H88A 5B66E 1JO5A 2JDIH 1HVVA 2ZXEB 1SQVJ 4H0LD 1LGHB 3SSUA 1EZVG 1JMBA 1NWQA 3MTUE 3H25A 5KAFE 3PP5A 2ZAEB 1Q7YQ 5BU5A 3T97A 1SQXK 1LWUC 1GW4A 1BSNA 1R5SA 5AVZB 1ZRTD 2WPSA 5AW4B 1CZQA 2N9BA 4RKUJ 3RL0C 3VMXA 5AVUB 1G2CB 2KSEA 1R5LA 1JUNA 2K37A 4QMAA 2R32A 1PP9E 1YJWP 1KB9D 1K9MQ 4UB6E 3ZDMA 1QLED 3Q5RA 3H1KG 1JNMA 4N78E 1NO4A 1Z56A 4PD4I 3OAKA 1YITP 1FOSE 1R8EA 3H32A 3FXEA 1NU1E 2KSJA 1KQGB 3TYYA 1S3JA 1IFDA 3KHUA 5AW8B 1NTZD 2O1JA 1L0LE 2ZT9B 3UIAA 2HPCA 3A2AA 3M0DA 1X22A 1IO4A 1P84E 1M1JC 3FXDA 4JQ0D 3M0AA 1JY3N 3PH0A 4JBZA 1BGYD 3D71A 1BSHA 1J1EB 3H1IG 3L73J 1K04A 4PV1B 3AEAC 2HODA 3MUDC 1SFCD 1GD2E 1GTWA 2FYUD 5KLVG 4B86A 5KTBA 3H1HG 3CXHH 1YTZI 2D2CD 2KS1A 1JY3P 1URQB 4BWNA 3TGUE 2FXOA 3ITKA 1HH0A 1HGZA 4K3AA 2E5YA 4ASWA 4YTPC 3M9BA 2KNCA 1FE6A 4I7ZC 2CPBA 1L4AA 2K9YA 3KZIE 1JCDA 1S5LE 1T3JA 3AEEC 1OIPA 1JMMA 2FYUK 1NOHA 3HUSC 4I2LC 2XU6A 2OYIA 2LXBA 3HE4A 2J58A 1VDFA 4LLHA 2XNDH 2PFXA 2BEQD 2Z5IA 2V7QH 2OGUA 4IL6X 4CPGA 1FOSF 2OYHB 3CI9A 1N7LA 1NAYA 3U1AA 3CCJP 2GA1A 3AE3C 1SQQE 4JF7A 1XTGB 1JY3O 1EQ7A 3SFEC 1KILC 1N7SC 1YQ4C 2Q5UA 5AVYB 2N1TB 3CWBE 2WQYC 3LW5H 4NPFX 1IFPA 1LT9C 3N7NA 1LWUA 2R44A 3TNUB 2WPRA 2QRXA 1VQMP 1SQVG 1T2KC 3V2NA 2WWWA 1NHLA 4AQRD 2QJYB 5BVZA 3HTKB 1T3UA 2ZYDA 1VQ6P 1BCCG 1L2PA 3VOPA 4N3YB 5KJ7D 1OW6A 1Q90D 3AEBC 1PP9D 2VRSA 4IFDK 2JJLA 1MFZA 1X0TA 2M3BA 5KLIC 1ZMEC 1VQOP 1HJBA 1S2EA 1RF1C 2KLVA 5AVQB 1H0TA 2KUBA 2YNYA 3A0BE 2IDBA 2IYOA 2A06E 3P8CE 3PJSK 4L76A 2W6JH 1BE3J 3VMAA 2B87B 1M1JA 1ZR4A 4H0LB 3VTPC 1NKZB 1L0LD 1LT1A 3Q3DA 3G4SP 4U3FE 2JWDA 1HF9A 1DIPA 4WBAA 3L74G 2FFDB 1SQBJ 4L75A 3MUDA 2HG5D 2ZYAA 5DJTB 3V4WA 1EZVE 4WY4C 2WSFH 3HE5A 4BRYA 1VQ9P 1DEEG 3RBZA 3NXSA 2E5TA 3NTNA 1K05A 3CX5E 3VYIA 1K8AQ 1W2BO 1KORA 1T8ZA 3MZWB 3A0HE 1L4AD 4XE5B 3TDKA 1VQPP 1NU1K 5KKZC 2E76D 2QSIA 4ZMDA 2C9NY 3D6YA 1GU5A 1QX8A 1CSBA 1HJ0A 1GL2B 1MFTA 1KYOE 4ZNCA 3O8ZA 1L0LK 2IBZG 3H1JG 4GDOA 2K9JA 2E42A 3L73G 1IZNB 1NTKE 1J1DC 3TGUD 1RY3A 2E75B 2A45I 4GT1A 1KILE 1CW5A 3CCLP 1E5WA 3HUSA 4W7YA 2Y0DA 3C9IA 3EFGA 2KYVA 4GOFA 3IAOA 4IL6H 1L0NG 3Q2YA 1NTMG 1KC8Q 3CCRP 2QJPC 3Q5PA 5CCHD 3CC7P 4BXLA 4R4LA 1KILA 1KFMA 1N7SA 3RL0D 5K5GB 3WUTA 3H1IJ 1NTZJ 2WT7A 1SQQD 1SQPE 1SFCB 3RK2C 3KDPB 2I1JA 2WPQA 2KXPB 4EDFA 1FZFA 2QA4P 1YQ3C 3WU2H 2J5UA 5KLVJ 3CWBD 1VQ7P 4WB4A 2D2CB 1OVVA 1VQ4P 1EDKA 1N73A 4PD4E 4L74A 1BGYJ 2ZYGA 3H1HE 3S9OA 1G1IA 3U59A 2QG4A 4H44D 2AXTE 4DJGA 2WZ7A 2FYUJ 3M06A 4GKGA 3L70E 2WSEH 2QEXP 1SQQK 1KB9H 1YTZT 1OW8A 4HH2A 2QJKC 1AA0A 1Q81Q 1RF1A 2PP6A 5GTIE 1YI2P 2J59M 1M56D 1T6AA 2K3RA 1G1JA 3BCCE 2BCCE 2UWJE 2OQQA 4TT3H 3VMYA 3GHGC 2MKVA 1E79H 1LNQA 1YIJP 2Z4EA 2A06D 3JCUE 3CCMP 1OXZA 4W80A 2KB7P 5CMZA 2IYPA 3BVHA 1IK9A 3L72E 3N4XA 2RMZA 2ZT9C 4KJMA 3SWFA 1FZBA 2FYZA 1SQXD 1SS1A 4WY4A 1Y47A 1OX3A 4U3FD 3H1LE 1H89A 3KXDA 4PD4H 3KYQA 1ZV8A 1QVGO 1BE3G 1HWTC 2SPZA 3CPWO 3II6A 1KFNA 4D6TE 1S9KE 3IN6A 2AXTH 1A02F 3CC4P 3F5HA 4PV1C 1BCCJ 3AE6C 1IFMA 2ZFCA 2C0WA 5AW7B 3O6QA 1FDIA 1PGJA 1GDTA 2PGDA 3QH9A 1SQBG 4C7NA 2IX7C 5CBOA 2L91A 3AE8C 4H13C 1KYOD 3AEDC 3GF7A 3USSA 2HPCB 1LTJB 3EFFK 3A7OA 1NTKD 5AW2B 3E1RA 1KILD 1YJ9P 1GL2D 2FXPA 3GMAA 3B5NC 3JCUH 1RQUA 1QVFO 3AE4C 2RH0A 3JC22 1PP9J 2P7JA 2HODB 1MV8A 1VF5D 2NPSD 1H8AA 1S5LX 2E75D 1AV1A 1QL2A 4A7PA 2I8DA 2YXQB 1T2KD 3L74J 2KS1B 5B66H 1NTKK 2OYHC 5AVRB 2M3EA 5TISE 2FYNB 1RHZB 2R3SA 1FDMA 1VQ5P 2KNCB 1L0LJ 5AVSB 5APUA 1SQPD 1X79B 1L4AB 5KAFH 1FS0E 2N1TC 2E76B 4HKZH 3C8VA 3RK3E 1FBMA 2V7QJ 3H1JJ 5C39A 3GF3A 4PD4D 1NTZG 3RGUA 2YO3A 1DH3A 5AVVB 5AW0B 2JEEA 3K5BA 2H7HA 3R2PA 4AYCA 1JY2N 2K88A 1IJDB 2O01N 3L73E 1LTIC 2V4HA 1IFIA 3L70D 1OMIA 4HB1A 1RF0C 4UB6H 1SQPK 1BGYG 3CC2P 3V4QA 1JOCA 1L0NJ 3B4SA 3GHGA 3PLNA 1NTMJ 3LIDA 3L36A 1U57A 2M5AB 2GUVA 2H8PD 2KZIA 2FYUG 2FY8A 3BCCD 2BCCD 1LWUB 1PFIA 1FZCB 3NFQA 1W2EA 1NVOA 3RL0g 1JY2P 2OARA 1JCCA 1AVYA 3RL0B 1WMKA 2QM8A 3AE1C 2B9BA 3P7KA 1KZUB 1P84H 1Y9BA 4H0LC 1OW7A 3L72D 1LP1B 1W5CE 1LTGC 1S4XA 2QM7A 3L71E 3GG2A 2E74C 3H1LD 2E43A 1CI6A 4NPEA 1AJYA 4XA4A 4DOJA 1SQQJ 2LR2A 4D6TD 2ZVOB 4LC1A 2BASA 3KQGA 4H44B 2WVRA 5KAIE 4MN4C 1JY2O 1RE3C 3OW2O 1M90Q 1PPJE 1IFNA 3CXHI 2YKOA 1N73C 2QIWA 4Y99B 2AEMA 2WSFJ 3D6ZA 4C46A 4RESB 3M91A 3B5NA 2WSCH 3KZIH 5AW9B 3QWOC 1S5LH 3MP7B 3RK2D 1KQSO 5AVTB 2HFED 4OWFA 4N78D 2OYHA 2YMKA 2W83C 3FGAD 4JYBA 3L75E 1ZW0A 2A45H 1X8YA 2KLUA 1M8OB 1ZN5A 2JO1A 2K9JB 3E1IA 1PP9G 5EFWB 1NU1D 2IBZI 4I7ZB 4RO0A 1LTAC 2Y9ZA 2KK7A 2Q7CA 2N1TA 3NMDA 2P1JA 2IFNA 1SFCC 3L37A 1SQXJ 5KAIH 1FJPA 3HUSB 1P84D 2P58A 3TNUA 3D70A 4HJGH 1N2DC 3RK3D 2D2CC 4EYYQ 4I6MC 3HTKA 1IK7A 1JM0A 3I5CA 2WTYA 1GU4A 2N9YB 4OH8B 3TK1A 1ZXGA 1SQBE 1TU3F 1L0LG 3CCQP 4W7ZA 3TSIA 4ZKPA 1RF0A 2M8RA 2W27A 1PZQA 1KILB 1KQLA 3C1LA 5L8RJ 5CBNA 3HD7C 1N7SB 1X9VA 4JPZB 4PJ0E 1SP4A 1BDCA 3H6PA 4OGQD 4Z1MH 1LT9B 1VF5B 2NPSB 2H43A 2POHA 2XV5A 5APVA 3A0BH 2XKMA 5AW1B 3W67A 3L4FA 4LGDE 4EIJA 3H1KE 4UB8E 2WSEJ 3F89A 2B87A 1M57D 3G6EP 2YMYA 2ZXXA 1K73Q 3TGUG 3BASA 1EXIA 3WMM0 3BRVB 4H13D 3BATA 3HRNA 4L73A 3PTZA 2YKQA 5APYA 3L71D 1YYCA 2CPSA 3CX5H 2WPVB 3A0HH 2WSSH 2RN0A 3ABVC 1RE3A 3H1IE 1NTZE 1KYOH 4PJ0H 1VQNP 3G71P 3CD6P 2L5GB 5KJ7C 2Z5HA 1HBWA 5KLVE 1KMIZ 2OYOA 1SQQG 1PPJD 4M3LA 2O1KA 1UIXA 1OVRA 2OTLP 1JTHB 4GOEA 1LTJC 1BGYE 3CWBG 1FZEA 3Q5SA 2XDJA 3AE9C 4UB8H 1Y8AA 1U7JA 3R4YA 1KV4A 3WUVA 2B88A 1OWAA 1EDLA 5APWA 2WITA 2Q9IA 3AE5C 1OZHA 1RH5B 2AEFA 4OVNF 1YBKA 3LIEA 1J1DB 3T97B 2JP3A 3L75D 5AVXB 3VP9A 3P8CD 1PGQA 1SFCA 2BEZF 1ZP0C 2QE7H 2KOGA 1PV3A 2FYNC 4YXWH 2P10A 1ZR2A 2IZ0A 3L72J 3VMZA 4I1LA 2IZ1A 4O9BA 1ZOYC 2E76C 1EDIA 4Y28J 2QJPB 3GW6A 3H1LJ 2A06G 3AECC 5H2FE 2YKPA 1EZVD 4KT0J 3EWKA 1J1EC 2B89A 3HD7A 3CX5D 3SWKA 2Q3EA 1SQXG 1AVOA 1OVUA 1YHQP 3L35A 3PRJA 1SQVE 3H32B 4U3FG 3CCSP 3W68A 3RK2B 3OJAB 3RBXA 2LKMA 1BCCE 5GTIH 1HUCA 1KB9I 1GZLA 5TJHA 1URQC 1FZGA 2Y9YA 2E74D 4RJTA 4AUWA 2P67A 5AVWB 2KZJA 2P2UA 1EDJA 2O01H 1NH4A 1N7SD 1FZCC 3H1KD 5CCHC 2YIUB 1SQBK 3SWYA 1HTLC 1VQLP 1USDA 3V6IA 1U7MA 1NTKG 4ASVA 1S1CX 3CXHE 3P8MC 2QJKB 3TF5A 3MD0A 5CCGC 1DD3A 5AW6B 5CHXA 5H2FH 3RK3B 3CMAP 1NU1J 3GHGB 2XZRA 3L74E 2R5DA 2AXCA 2GUSA 3Q1MA 4JYCA 5KJ7A 3FX0A 1IFJA 1LJ2A 4C7RA 4H44C 1QEXA 1Q82Q 4IOIH 3H1ID 5E79E 2OYIB 5AW5B 3HE4B 2R3CA 1LTJA 2W6AA 3JSVC 1Q86Q 2K1AA 4OGQB 4DZOA 5KLVD 1VQ8P 2AEJA 1G2CA 3H1HD 2QJYC 1SQPG 2IBZE 3H1JE 4Y99C 1IC2A 3I56P 3LW5J 1MKMA 1NJIQ 1CI6B 2Y0EA 2Q1KA 3A5TA 2R5BA 3A3YB 3MGNA 1NKNA 1DEBA 3PHLA 1NTZK 3TGUJ 2C0XA 4WY4D 4H13B 4YPCA 3KPEA 2JR8A 1EC5A 3AEFC 1L0NE 3L70G 5KLVK 3CL3D 3IF4A 1NTME 5APSA 2WSCJ 2G3AA 1D7MA 5TISH 2M0BA 3HD7D 4WWIA 3AE2C 3B5NB 2CK3H 3M9HA 3BCCG 2BCCG 3EQ2A 4NPDA 1N8RQ 5E79H 1QGKB 2FFDC 4KHXA 2HLOA 2ITAA 3L71J 1VQKP 1WT6A 1WRGA 2MJZA 1H0TB 3AE7C 4R4MA 5AW3B 3P32A 1S9KD 3L72G 2H89C 3CWBJ 3I55P 5B5EE 1KD1Q 1SQVD 1URQA 3H1LG 1GL2C 1M1JB 4YXDC 5APTA 2OTJP 1BCCD 2IFMA 3V2QA 2M5AA 1LTTC 4D6TG 2YO2A 4EI2A 1VF5C 2NPSC 1FZCA 5DJUB 3MHVA 4XFJA 5CCHA 2KI7B 2PAJA 2E75C 1PGOA 1AQ5A 2O3JA 3HE5B 4BRYB 4EOTA 3CLQA 4N6JA 1Q2NA 5CCGA 2OTKE 2ZJSE 1SQVK 4TLFA 1LP1A 2IPPA 3CXHD 4IFMA 1YJNP 3GLMA 2G8YA 1P84I 1BDDA 3L75J 1FDOA 2DW3A 2H88C 4WVZA 1GK4A 1UIIA 1MUUA 4K35A 1KN7A 5M1BA 2JKVA 3V2PA 3L74D 2Q3IA 1BE3E 1PGPA 2PRRA 1FZAA 1FC2C 5B5EH 4U3FJ 2FXMA 3IFMA 4IL6E 2W90A 3VP8A 1NU1G 1J2JB 1SQXE 1RQVA 3VN0A 1ZLLA 2ZVNB 1JB0J 3CCEP 5BU8B 2E74B 5CJ0A 1DD4A 1JEKA 4HYTB 4U7JA 2IBZD 1RE4C 3H1JD 1SLQA 3L73D 2ZT9D 2RKLA 1S72P 2WT7B 1HGVA 3AEGC 2I1KA 3WU2E 2NZ2A 3CMEP 2W8ZA 1NTKJ 1M1KQ 3G3ZA 1EXJA 1DX7A 1N73B 2KP8A 1L0ND 1ZRTE 3H1KJ 4PV1D 1XTCC 1NTMD 1OFCX 1LTSC 5APQA 2YXRB 4IFFA 2QVAA 3WUUA 1KB9E 2FFDA 2HR3A 5KLIB 1URQD 5GTHE 1KQFB 1RF1B 1AFOA 1SVFA 5CJ4A 3SFDC 1L0NK 2C9LY 3B5ND 1NYHA 1NTMK 1SQPJ 4DT0A 1A02J 3CCVP 1GL2A 2KIKA 3E7KA 1QL1A 3S1KA 2LXCB 3IR9A 3L71G 2A45G 1N86A 1LT9A 1AQTA 4ZKUA 1GW3A 5CCGD 2NPSA 2GM4A 1VL2A 3H1HJ 2FKWB 3M0DC 4WY4B 3B8EB 3FWLA 3CCUP 1GK6A 3L70J 3M9QA 1PL5A 2FYUE 2N1TD 5KKZB 2Y0CA 2XNXA 2YIUC 1PPJG 1PIXA 3HD7B 3MIWA 3O6QB 1FJKA 4DCKA 4GIFA 3BCCJ 2BCCJ 4C7NB 3S4RA 2W6BA 5GTHH 2WMMA 2JWAA 2O01J 1GMJA 3OA7A 1FU1A 1USEA 3BRTB 1NGMB 4GODA 3RK3C 1EZVI 2NRGA 3U1CA 2Q6QA 3CX5I 1FAVA 3V2RA 1BE3D 3B71A 1L4AC
chains in the Genus database with same CATH topology
3WU2H 5E79H 5TISH 3KZIH 5KAFH 3JCUH 4IL6H 1S5LH 5GTIH 4PJ0H 5B66H 5KAIH 2AXTH 5H2FH 5B5EH 4UB8H 3A0BH 5GTHH 4UB6H 3A0HH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WU2 H;  5E79 H;  5TIS H;  3KZI H;  5KAF H;  3JCU H;  4IL6 H;  1S5L H;  5GTI H;  4PJ0 H;  5B66 H;  5KAI H;  2AXT H;  5H2F H;  5B5E H;  4UB8 H;  3A0B H;  5GTH H;  4UB6 H;  3A0H H; 
#chains in the Genus database with same CATH topology
 3G9R A;  1MZ9 A;  3L75 G;  3FWN A;  3V5B A;  2HYN A;  1VPC A;  2FBW C;  1KYO I;  2OYI C;  1JTH A;  1RE4 A;  1M7L A;  4D6T J;  1NAF A;  4OGQ C;  1SQB D;  1KTM A;  1LTB C;  5APX A;  1H88 A;  5B66 E;  1JO5 A;  2JDI H;  1HVV A;  2ZXE B;  1SQV J;  4H0L D;  1LGH B;  3SSU A;  1EZV G;  1JMB A;  1NWQ A;  3MTU E;  3H25 A;  5KAF E;  3PP5 A;  2ZAE B;  1Q7Y Q;  5BU5 A;  3T97 A;  1SQX K;  1LWU C;  1GW4 A;  1BSN A;  1R5S A;  5AVZ B;  1ZRT D;  2WPS A;  5AW4 B;  1CZQ A;  2N9B A;  4RKU J;  3RL0 C;  3VMX A;  5AVU B;  1G2C B;  2KSE A;  1R5L A;  1JUN A;  2K37 A;  4QMA A;  2R32 A;  1PP9 E;  1YJW P;  1KB9 D;  1K9M Q;  4UB6 E;  3ZDM A;  1QLE D;  3Q5R A;  3H1K G;  1JNM A;  4N78 E;  1NO4 A;  1Z56 A;  4PD4 I;  3OAK A;  1YIT P;  1FOS E;  1R8E A;  3H32 A;  3FXE A;  1NU1 E;  2KSJ A;  1KQG B;  3TYY A;  1S3J A;  1IFD A;  3KHU A;  5AW8 B;  1NTZ D;  2O1J A;  1L0L E;  2ZT9 B;  3UIA A;  2HPC A;  3A2A A;  3M0D A;  1X22 A;  1IO4 A;  1P84 E;  1M1J C;  3FXD A;  4JQ0 D;  3M0A A;  1JY3 N;  3PH0 A;  4JBZ A;  1BGY D;  3D71 A;  1BSH A;  1J1E B;  3H1I G;  3L73 J;  1K04 A;  4PV1 B;  3AEA C;  2HOD A;  3MUD C;  1SFC D;  1GD2 E;  1GTW A;  2FYU D;  5KLV G;  4B86 A;  5KTB A;  3H1H G;  3CXH H;  1YTZ I;  2D2C D;  2KS1 A;  1JY3 P;  1URQ B;  4BWN A;  3TGU E;  2FXO A;  3ITK A;  1HH0 A;  1HGZ A;  4K3A A;  2E5Y A;  4ASW A;  4YTP C;  3M9B A;  2KNC A;  1FE6 A;  4I7Z C;  2CPB A;  1L4A A;  2K9Y A;  3KZI E;  1JCD A;  1S5L E;  1T3J A;  3AEE C;  1OIP A;  1JMM A;  2FYU K;  1NOH A;  3HUS C;  4I2L C;  2XU6 A;  2OYI A;  2LXB A;  3HE4 A;  2J58 A;  1VDF A;  4LLH A;  2XND H;  2PFX A;  2BEQ D;  2Z5I A;  2V7Q H;  2OGU A;  4IL6 X;  4CPG A;  1FOS F;  2OYH B;  3CI9 A;  1N7L A;  1NAY A;  3U1A A;  3CCJ P;  2GA1 A;  3AE3 C;  1SQQ E;  4JF7 A;  1XTG B;  1JY3 O;  1EQ7 A;  3SFE C;  1KIL C;  1N7S C;  1YQ4 C;  2Q5U A;  5AVY B;  2N1T B;  3CWB E;  2WQY C;  3LW5 H;  4NPF X;  1IFP A;  1LT9 C;  3N7N A;  1LWU A;  2R44 A;  3TNU B;  2WPR A;  2QRX A;  1VQM P;  1SQV G;  1T2K C;  3V2N A;  2WWW A;  1NHL A;  4AQR D;  2QJY B;  5BVZ A;  3HTK B;  1T3U A;  2ZYD A;  1VQ6 P;  1BCC G;  1L2P A;  3VOP A;  4N3Y B;  5KJ7 D;  1OW6 A;  1Q90 D;  3AEB C;  1PP9 D;  2VRS A;  4IFD K;  2JJL A;  1MFZ A;  1X0T A;  2M3B A;  5KLI C;  1ZME C;  1VQO P;  1HJB A;  1S2E A;  1RF1 C;  2KLV A;  5AVQ B;  1H0T A;  2KUB A;  2YNY A;  3A0B E;  2IDB A;  2IYO A;  2A06 E;  3P8C E;  3PJS K;  4L76 A;  2W6J H;  1BE3 J;  3VMA A;  2B87 B;  1M1J A;  1ZR4 A;  4H0L B;  3VTP C;  1NKZ B;  1L0L D;  1LT1 A;  3Q3D A;  3G4S P;  4U3F E;  2JWD A;  1HF9 A;  1DIP A;  4WBA A;  3L74 G;  2FFD B;  1SQB J;  4L75 A;  3MUD A;  2HG5 D;  2ZYA A;  5DJT B;  3V4W A;  1EZV E;  4WY4 C;  2WSF H;  3HE5 A;  4BRY A;  1VQ9 P;  1DEE G;  3RBZ A;  3NXS A;  2E5T A;  3NTN A;  1K05 A;  3CX5 E;  3VYI A;  1K8A Q;  1W2B O;  1KOR A;  1T8Z A;  3MZW B;  3A0H E;  1L4A D;  4XE5 B;  3TDK A;  1VQP P;  1NU1 K;  5KKZ C;  2E76 D;  2QSI A;  4ZMD A;  2C9N Y;  3D6Y A;  1GU5 A;  1QX8 A;  1CSB A;  1HJ0 A;  1GL2 B;  1MFT A;  1KYO E;  4ZNC A;  3O8Z A;  1L0L K;  2IBZ G;  3H1J G;  4GDO A;  2K9J A;  2E42 A;  3L73 G;  1IZN B;  1NTK E;  1J1D C;  3TGU D;  1RY3 A;  2E75 B;  2A45 I;  4GT1 A;  1KIL E;  1CW5 A;  3CCL P;  1E5W A;  3HUS A;  4W7Y A;  2Y0D A;  3C9I A;  3EFG A;  2KYV A;  4GOF A;  3IAO A;  4IL6 H;  1L0N G;  3Q2Y A;  1NTM G;  1KC8 Q;  3CCR P;  2QJP C;  3Q5P A;  5CCH D;  3CC7 P;  4BXL A;  4R4L A;  1KIL A;  1KFM A;  1N7S A;  3RL0 D;  5K5G B;  3WUT A;  3H1I J;  1NTZ J;  2WT7 A;  1SQQ D;  1SQP E;  1SFC B;  3RK2 C;  3KDP B;  2I1J A;  2WPQ A;  2KXP B;  4EDF A;  1FZF A;  2QA4 P;  1YQ3 C;  3WU2 H;  2J5U A;  5KLV J;  3CWB D;  1VQ7 P;  4WB4 A;  2D2C B;  1OVV A;  1VQ4 P;  1EDK A;  1N73 A;  4PD4 E;  4L74 A;  1BGY J;  2ZYG A;  3H1H E;  3S9O A;  1G1I A;  3U59 A;  2QG4 A;  4H44 D;  2AXT E;  4DJG A;  2WZ7 A;  2FYU J;  3M06 A;  4GKG A;  3L70 E;  2WSE H;  2QEX P;  1SQQ K;  1KB9 H;  1YTZ T;  1OW8 A;  4HH2 A;  2QJK C;  1AA0 A;  1Q81 Q;  1RF1 A;  2PP6 A;  5GTI E;  1YI2 P;  2J59 M;  1M56 D;  1T6A A;  2K3R A;  1G1J A;  3BCC E;  2BCC E;  2UWJ E;  2OQQ A;  4TT3 H;  3VMY A;  3GHG C;  2MKV A;  1E79 H;  1LNQ A;  1YIJ P;  2Z4E A;  2A06 D;  3JCU E;  3CCM P;  1OXZ A;  4W80 A;  2KB7 P;  5CMZ A;  2IYP A;  3BVH A;  1IK9 A;  3L72 E;  3N4X A;  2RMZ A;  2ZT9 C;  4KJM A;  3SWF A;  1FZB A;  2FYZ A;  1SQX D;  1SS1 A;  4WY4 A;  1Y47 A;  1OX3 A;  4U3F D;  3H1L E;  1H89 A;  3KXD A;  4PD4 H;  3KYQ A;  1ZV8 A;  1QVG O;  1BE3 G;  1HWT C;  2SPZ A;  3CPW O;  3II6 A;  1KFN A;  4D6T E;  1S9K E;  3IN6 A;  2AXT H;  1A02 F;  3CC4 P;  3F5H A;  4PV1 C;  1BCC J;  3AE6 C;  1IFM A;  2ZFC A;  2C0W A;  5AW7 B;  3O6Q A;  1FDI A;  1PGJ A;  1GDT A;  2PGD A;  3QH9 A;  1SQB G;  4C7N A;  2IX7 C;  5CBO A;  2L91 A;  3AE8 C;  4H13 C;  1KYO D;  3AED C;  3GF7 A;  3USS A;  2HPC B;  1LTJ B;  3EFF K;  3A7O A;  1NTK D;  5AW2 B;  3E1R A;  1KIL D;  1YJ9 P;  1GL2 D;  2FXP A;  3GMA A;  3B5N C;  3JCU H;  1RQU A;  1QVF O;  3AE4 C;  2RH0 A;  3JC2 2;  1PP9 J;  2P7J A;  2HOD B;  1MV8 A;  1VF5 D;  2NPS D;  1H8A A;  1S5L X;  2E75 D;  1AV1 A;  1QL2 A;  4A7P A;  2I8D A;  2YXQ B;  1T2K D;  3L74 J;  2KS1 B;  5B66 H;  1NTK K;  2OYH C;  5AVR B;  2M3E A;  5TIS E;  2FYN B;  1RHZ B;  2R3S A;  1FDM A;  1VQ5 P;  2KNC B;  1L0L J;  5AVS B;  5APU A;  1SQP D;  1X79 B;  1L4A B;  5KAF H;  1FS0 E;  2N1T C;  2E76 B;  4HKZ H;  3C8V A;  3RK3 E;  1FBM A;  2V7Q J;  3H1J J;  5C39 A;  3GF3 A;  4PD4 D;  1NTZ G;  3RGU A;  2YO3 A;  1DH3 A;  5AVV B;  5AW0 B;  2JEE A;  3K5B A;  2H7H A;  3R2P A;  4AYC A;  1JY2 N;  2K88 A;  1IJD B;  2O01 N;  3L73 E;  1LTI C;  2V4H A;  1IFI A;  3L70 D;  1OMI A;  4HB1 A;  1RF0 C;  4UB6 H;  1SQP K;  1BGY G;  3CC2 P;  3V4Q A;  1JOC A;  1L0N J;  3B4S A;  3GHG A;  3PLN A;  1NTM J;  3LID A;  3L36 A;  1U57 A;  2M5A B;  2GUV A;  2H8P D;  2KZI A;  2FYU G;  2FY8 A;  3BCC D;  2BCC D;  1LWU B;  1PFI A;  1FZC B;  3NFQ A;  1W2E A;  1NVO A;  3RL0 g;  1JY2 P;  2OAR A;  1JCC A;  1AVY A;  3RL0 B;  1WMK A;  2QM8 A;  3AE1 C;  2B9B A;  3P7K A;  1KZU B;  1P84 H;  1Y9B A;  4H0L C;  1OW7 A;  3L72 D;  1LP1 B;  1W5C E;  1LTG C;  1S4X A;  2QM7 A;  3L71 E;  3GG2 A;  2E74 C;  3H1L D;  2E43 A;  1CI6 A;  4NPE A;  1AJY A;  4XA4 A;  4DOJ A;  1SQQ J;  2LR2 A;  4D6T D;  2ZVO B;  4LC1 A;  2BAS A;  3KQG A;  4H44 B;  2WVR A;  5KAI E;  4MN4 C;  1JY2 O;  1RE3 C;  3OW2 O;  1M90 Q;  1PPJ E;  1IFN A;  3CXH I;  2YKO A;  1N73 C;  2QIW A;  4Y99 B;  2AEM A;  2WSF J;  3D6Z A;  4C46 A;  4RES B;  3M91 A;  3B5N A;  2WSC H;  3KZI H;  5AW9 B;  3QWO C;  1S5L H;  3MP7 B;  3RK2 D;  1KQS O;  5AVT B;  2HFE D;  4OWF A;  4N78 D;  2OYH A;  2YMK A;  2W83 C;  3FGA D;  4JYB A;  3L75 E;  1ZW0 A;  2A45 H;  1X8Y A;  2KLU A;  1M8O B;  1ZN5 A;  2JO1 A;  2K9J B;  3E1I A;  1PP9 G;  5EFW B;  1NU1 D;  2IBZ I;  4I7Z B;  4RO0 A;  1LTA C;  2Y9Z A;  2KK7 A;  2Q7C A;  2N1T A;  3NMD A;  2P1J A;  2IFN A;  1SFC C;  3L37 A;  1SQX J;  5KAI H;  1FJP A;  3HUS B;  1P84 D;  2P58 A;  3TNU A;  3D70 A;  4HJG H;  1N2D C;  3RK3 D;  2D2C C;  4EYY Q;  4I6M C;  3HTK A;  1IK7 A;  1JM0 A;  3I5C A;  2WTY A;  1GU4 A;  2N9Y B;  4OH8 B;  3TK1 A;  1ZXG A;  1SQB E;  1TU3 F;  1L0L G;  3CCQ P;  4W7Z A;  3TSI A;  4ZKP A;  1RF0 A;  2M8R A;  2W27 A;  1PZQ A;  1KIL B;  1KQL A;  3C1L A;  5L8R J;  5CBN A;  3HD7 C;  1N7S B;  1X9V A;  4JPZ B;  4PJ0 E;  1SP4 A;  1BDC A;  3H6P A;  4OGQ D;  4Z1M H;  1LT9 B;  1VF5 B;  2NPS B;  2H43 A;  2POH A;  2XV5 A;  5APV A;  3A0B H;  2XKM A;  5AW1 B;  3W67 A;  3L4F A;  4LGD E;  4EIJ A;  3H1K E;  4UB8 E;  2WSE J;  3F89 A;  2B87 A;  1M57 D;  3G6E P;  2YMY A;  2ZXX A;  1K73 Q;  3TGU G;  3BAS A;  1EXI A;  3WMM 0;  3BRV B;  4H13 D;  3BAT A;  3HRN A;  4L73 A;  3PTZ A;  2YKQ A;  5APY A;  3L71 D;  1YYC A;  2CPS A;  3CX5 H;  2WPV B;  3A0H H;  2WSS H;  2RN0 A;  3ABV C;  1RE3 A;  3H1I E;  1NTZ E;  1KYO H;  4PJ0 H;  1VQN P;  3G71 P;  3CD6 P;  2L5G B;  5KJ7 C;  2Z5H A;  1HBW A;  5KLV E;  1KMI Z;  2OYO A;  1SQQ G;  1PPJ D;  4M3L A;  2O1K A;  1UIX A;  1OVR A;  2OTL P;  1JTH B;  4GOE A;  1LTJ C;  1BGY E;  3CWB G;  1FZE A;  3Q5S A;  2XDJ A;  3AE9 C;  4UB8 H;  1Y8A A;  1U7J A;  3R4Y A;  1KV4 A;  3WUV A;  2B88 A;  1OWA A;  1EDL A;  5APW A;  2WIT A;  2Q9I A;  3AE5 C;  1OZH A;  1RH5 B;  2AEF A;  4OVN F;  1YBK A;  3LIE A;  1J1D B;  3T97 B;  2JP3 A;  3L75 D;  5AVX B;  3VP9 A;  3P8C D;  1PGQ A;  1SFC A;  2BEZ F;  1ZP0 C;  2QE7 H;  2KOG A;  1PV3 A;  2FYN C;  4YXW H;  2P10 A;  1ZR2 A;  2IZ0 A;  3L72 J;  3VMZ A;  4I1L A;  2IZ1 A;  4O9B A;  1ZOY C;  2E76 C;  1EDI A;  4Y28 J;  2QJP B;  3GW6 A;  3H1L J;  2A06 G;  3AEC C;  5H2F E;  2YKP A;  1EZV D;  4KT0 J;  3EWK A;  1J1E C;  2B89 A;  3HD7 A;  3CX5 D;  3SWK A;  2Q3E A;  1SQX G;  1AVO A;  1OVU A;  1YHQ P;  3L35 A;  3PRJ A;  1SQV E;  3H32 B;  4U3F G;  3CCS P;  3W68 A;  3RK2 B;  3OJA B;  3RBX A;  2LKM A;  1BCC E;  5GTI H;  1HUC A;  1KB9 I;  1GZL A;  5TJH A;  1URQ C;  1FZG A;  2Y9Y A;  2E74 D;  4RJT A;  4AUW A;  2P67 A;  5AVW B;  2KZJ A;  2P2U A;  1EDJ A;  2O01 H;  1NH4 A;  1N7S D;  1FZC C;  3H1K D;  5CCH C;  2YIU B;  1SQB K;  3SWY A;  1HTL C;  1VQL P;  1USD A;  3V6I A;  1U7M A;  1NTK G;  4ASV A;  1S1C X;  3CXH E;  3P8M C;  2QJK B;  3TF5 A;  3MD0 A;  5CCG C;  1DD3 A;  5AW6 B;  5CHX A;  5H2F H;  3RK3 B;  3CMA P;  1NU1 J;  3GHG B;  2XZR A;  3L74 E;  2R5D A;  2AXC A;  2GUS A;  3Q1M A;  4JYC A;  5KJ7 A;  3FX0 A;  1IFJ A;  1LJ2 A;  4C7R A;  4H44 C;  1QEX A;  1Q82 Q;  4IOI H;  3H1I D;  5E79 E;  2OYI B;  5AW5 B;  3HE4 B;  2R3C A;  1LTJ A;  2W6A A;  3JSV C;  1Q86 Q;  2K1A A;  4OGQ B;  4DZO A;  5KLV D;  1VQ8 P;  2AEJ A;  1G2C A;  3H1H D;  2QJY C;  1SQP G;  2IBZ E;  3H1J E;  4Y99 C;  1IC2 A;  3I56 P;  3LW5 J;  1MKM A;  1NJI Q;  1CI6 B;  2Y0E A;  2Q1K A;  3A5T A;  2R5B A;  3A3Y B;  3MGN A;  1NKN A;  1DEB A;  3PHL A;  1NTZ K;  3TGU J;  2C0X A;  4WY4 D;  4H13 B;  4YPC A;  3KPE A;  2JR8 A;  1EC5 A;  3AEF C;  1L0N E;  3L70 G;  5KLV K;  3CL3 D;  3IF4 A;  1NTM E;  5APS A;  2WSC J;  2G3A A;  1D7M A;  5TIS H;  2M0B A;  3HD7 D;  4WWI A;  3AE2 C;  3B5N B;  2CK3 H;  3M9H A;  3BCC G;  2BCC G;  3EQ2 A;  4NPD A;  1N8R Q;  5E79 H;  1QGK B;  2FFD C;  4KHX A;  2HLO A;  2ITA A;  3L71 J;  1VQK P;  1WT6 A;  1WRG A;  2MJZ A;  1H0T B;  3AE7 C;  4R4M A;  5AW3 B;  3P32 A;  1S9K D;  3L72 G;  2H89 C;  3CWB J;  3I55 P;  5B5E E;  1KD1 Q;  1SQV D;  1URQ A;  3H1L G;  1GL2 C;  1M1J B;  4YXD C;  5APT A;  2OTJ P;  1BCC D;  2IFM A;  3V2Q A;  2M5A A;  1LTT C;  4D6T G;  2YO2 A;  4EI2 A;  1VF5 C;  2NPS C;  1FZC A;  5DJU B;  3MHV A;  4XFJ A;  5CCH A;  2KI7 B;  2PAJ A;  2E75 C;  1PGO A;  1AQ5 A;  2O3J A;  3HE5 B;  4BRY B;  4EOT A;  3CLQ A;  4N6J A;  1Q2N A;  5CCG A;  2OTK E;  2ZJS E;  1SQV K;  4TLF A;  1LP1 A;  2IPP A;  3CXH D;  4IFM A;  1YJN P;  3GLM A;  2G8Y A;  1P84 I;  1BDD A;  3L75 J;  1FDO A;  2DW3 A;  2H88 C;  4WVZ A;  1GK4 A;  1UII A;  1MUU A;  4K35 A;  1KN7 A;  5M1B A;  2JKV A;  3V2P A;  3L74 D;  2Q3I A;  1BE3 E;  1PGP A;  2PRR A;  1FZA A;  1FC2 C;  5B5E H;  4U3F J;  2FXM A;  3IFM A;  4IL6 E;  2W90 A;  3VP8 A;  1NU1 G;  1J2J B;  1SQX E;  1RQV A;  3VN0 A;  1ZLL A;  2ZVN B;  1JB0 J;  3CCE P;  5BU8 B;  2E74 B;  5CJ0 A;  1DD4 A;  1JEK A;  4HYT B;  4U7J A;  2IBZ D;  1RE4 C;  3H1J D;  1SLQ A;  3L73 D;  2ZT9 D;  2RKL A;  1S72 P;  2WT7 B;  1HGV A;  3AEG C;  2I1K A;  3WU2 E;  2NZ2 A;  3CME P;  2W8Z A;  1NTK J;  1M1K Q;  3G3Z A;  1EXJ A;  1DX7 A;  1N73 B;  2KP8 A;  1L0N D;  1ZRT E;  3H1K J;  4PV1 D;  1XTC C;  1NTM D;  1OFC X;  1LTS C;  5APQ A;  2YXR B;  4IFF A;  2QVA A;  3WUU A;  1KB9 E;  2FFD A;  2HR3 A;  5KLI B;  1URQ D;  5GTH E;  1KQF B;  1RF1 B;  1AFO A;  1SVF A;  5CJ4 A;  3SFD C;  1L0N K;  2C9L Y;  3B5N D;  1NYH A;  1NTM K;  1SQP J;  4DT0 A;  1A02 J;  3CCV P;  1GL2 A;  2KIK A;  3E7K A;  1QL1 A;  3S1K A;  2LXC B;  3IR9 A;  3L71 G;  2A45 G;  1N86 A;  1LT9 A;  1AQT A;  4ZKU A;  1GW3 A;  5CCG D;  2NPS A;  2GM4 A;  1VL2 A;  3H1H J;  2FKW B;  3M0D C;  4WY4 B;  3B8E B;  3FWL A;  3CCU P;  1GK6 A;  3L70 J;  3M9Q A;  1PL5 A;  2FYU E;  2N1T D;  5KKZ B;  2Y0C A;  2XNX A;  2YIU C;  1PPJ G;  1PIX A;  3HD7 B;  3MIW A;  3O6Q B;  1FJK A;  4DCK A;  4GIF A;  3BCC J;  2BCC J;  4C7N B;  3S4R A;  2W6B A;  5GTH H;  2WMM A;  2JWA A;  2O01 J;  1GMJ A;  3OA7 A;  1FU1 A;  1USE A;  3BRT B;  1NGM B;  4GOD A;  3RK3 C;  1EZV I;  2NRG A;  3U1C A;  2Q6Q A;  3CX5 I;  1FAV A;  3V2R A;  1BE3 D;  3B71 A;  1L4A C; 
#chains in the Genus database with same CATH homology
 3WU2 H;  5E79 H;  5TIS H;  3KZI H;  5KAF H;  3JCU H;  4IL6 H;  1S5L H;  5GTI H;  4PJ0 H;  5B66 H;  5KAI H;  2AXT H;  5H2F H;  5B5E H;  4UB8 H;  3A0B H;  5GTH H;  4UB6 H;  3A0H H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...