5TISH

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
b'ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 14
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5tisH01
3KZIH 4IL6H 4UB8H 5KAFH 5KAIH 3A0BH 5H2FH 5E79H 5B5EH 1S5LH 2AXTH 5B66H 3A0HH 3JCUH 5GTIH 5TISH 4PJ0H 3WU2H 4UB6H 5GTHH
chains in the Genus database with same CATH superfamily
1JTHB 2IZ1A 3QH9A 1CI6B 1HJ0A 3PHLA 1AQ5A 2WMMA 1VQNP 1S1CX 2ZT9B 4LGDE 2NPSB 1NTKD 1OFCX 1GD2E 2OARA 1SQBD 1X0TA 1CSBA 3L75E 1L0LE 4R4LA 1UIXA 1KFNA 4N3YB 3V2NA 4U3FG 1AJYA 2MKVA 1YJ9P 3ABVC 2JKVA 3Q2YA 4I7ZC 5AW8B 1RE4A 2QM7A 1VQ4P 3MP7B 3HUSB 3HTKA 1JNMA 3G3ZA 1LWUB 2FYZA 1IFMA 1IC2A 5CCHC 2HPCB 3AE4C 3PH0A 3H1KE 5TISE 1W5CE 2HLOA 2BEQD 4Y28J 3I56P 1JY2N 3N7NA 3KPEA 5KLVJ 5C39A 1S9KE 2BEZF 1NTKG 1SQBG 4H44D 1X9VA 1N7LA 2KZIA 1MZ9A 2KSEA 1SQQK 2FYUD 5AW9B 4ZKPA 3L70E 1CZQA 1JY2O 4XFJA 3WUTA 5AVZB 1YQ4C 3E1IA 1W2BO 2L5GB 4PD4E 3IF4A 2O01H 3AEGC 2IYPA 3T97A 3USSA 4GODA 2IPPA 3CC2P 5KKZB 3MGNA 1OVUA 4DJGA 3U59A 1USEA 1QVFO 3F89A 1URQB 3A0HH 1Z56A 2M8RA 3B5NA 1FJPA 1T3UA 1NKZB 2PRRA 1N7SD 2B87B 1FZFA 3S9OA 3VN0A 1WRGA 2JR8A 5KAIE 2BCCE 1SQVE 2WPSA 1BE3D 1NU1E 2QIWA 2RMZA 1QX8A 2E74D 2KS1B 1VQ8P 5CCHA 4YPCA 2WT7A 1OVRA 2I8DA 4H0LD 2FYUG 3L72D 1SS1A 1BDDA 2D2CB 4EYYQ 2KXPB 1JY2P 2E74C 4XE5B 1YBKA 1PGPA 2K9JA 3NMDA 2XNXA 5TJHA 2Z5IA 4L74A 1ZRTD 2YKQA 4KT0J 2WPVB 4OGQD 3GMAA 1AA0A 1S5LE 1FZEA 2GA1A 3CCQP 1HGVA 3M9QA 1L4AB 3L74E 3H1JJ 1PP9D 3EFGA 1FZAA 3KZIH 4A7PA 1U7MA 3M0AA 2YXQB 4IFDK 4OGQC 2RKLA 1GL2D 1BE3G 3D71A 1LTSC 5E79E 2PGDA 2JWAA 3EFFK 1T2KC 3H1ID 4QMAA 1S3JA 2A45H 1TU3F 2A45G 4XA4A 5GTHE 2QJPC 1HUCA 3GG2A 1IFIA 3HTKB 1EDJA 1GL2C 1H0TB 2KIKA 1PPJD 2C9NY 2ZVNB 4PJ0H 1KQLA 1HTLC 1UIIA 4UB6E 1YHQP 2AEFA 3HUSC 1S72P 1N86A 2W6BA 1IFPA 4Y99C 1T3JA 1SQQJ 4C7NA 1NTZJ 3L71D 1SQBE 3W67A 3BCCD 2R32A 2J59M 1IZNB 2WTYA 2M3EA 3L73D 1LNQA 2QM8A 4HH2A 2R3SA 4O9BA 2A06D 1JM0A 3PJSK 3K5BA 1M1JC 1SQVK 2IZ0A 3CCVP 1LT9C 3Q5SA 1ZMEC 3T97B 4D6TJ 1OMIA 3CCRP 5AW3B 2B9BA 2WSEJ 3P32A 3QWOC 3RL0g 2KI7B 2P67A 4JYCA 4K3AA 3P8MC 4L73A 2NPSA 5CMZA 5KJ7D 1MUUA 1RQUA 2FBWC 2O01N 3CCLP 3AEBC 2K3RA 4I7ZB 1KYOE 2K9YA 2SPZA 3E1RA 3CI9A 3NXSA 1DEBA 3L75J 4BXLA 1G2CB 5KJ7C 3L71G 2P1JA 1SQXD 3BCCG 3RBZA 1NGMB 1BGYD 3L73G 2WT7B 2E42A 2N1TC 2A06G 3W68A 1YYCA 1KZUB 3HUSA 1LWUA 3RL0D 4L75A 2HYNA 1BCCE 5CCGD 3AE1C 2HPCA 5AW6B 1GU5A 3H1HE 2R5BA 2Q7CA 3VMZA 2PFXA 1NOHA 3BRTB 1L0ND 4PV1D 3H1KJ 3HD7D 1OW6A 3RL0C 1Q82Q 1L2PA 3S1KA 1MFTA 3FWNA 5TISH 1GZLA 2NRGA 1M1JA 3CWBG 2Q5UA 1H89A 1LT9A 3GHGC 5KLVK 3IFMA 4WY4C 4PV1C 5APXA 2WWWA 5KLIC 1KILD 1GW3A 2V7QJ 1ZN5A 1KC8Q 1JEKA 1YTZI 2LXCB 1SQPE 5B5EE 3L70J 2V7QH 1LTAC 1KB9H 1BGYG 3L72E 1FS0E 1SFCD 4M3LA 1IK7A 2RH0A 1KILC 4L76A 2M0BA 3CC7P 1LT1A 1YTZT 3H1LE 1EZVI 2B87A 2E5TA 2QG4A 2N1TA 3M9HA 5DJTB 2IYOA 4C7NB 3RK2D 1PP9E 3EWKA 2KS1A 1JCCA 1GTWA 2WQYC 2BCCJ 2E74B 1SQVJ 1VQOP 1OIPA 2H8PD 4AYCA 2FYNC 4IFFA 1NU1J 2M3BA 4OVNF 1PL5A 3H1IE 2HR3A 1GW4A 2O1KA 2E75D 2R44A 5AW4B 1KV4A 1YIJP 1Y9BA 2Z5HA 1KTMA 2J58A 4WY4A 3VMXA 1J1EC 1PPJE 3U1CA 1J1DC 1DD3A 4RKUJ 2E75C 4OGQB 1L4AA 2QJYC 1M8OB 3S4RA 3O6QB 3PP5A 3M06A 3B71A 1HVVA 3L74J 2QJPB 4KJMA 2ZJSE 1GL2B 4EOTA 2YNYA 2FY8A 3WU2E 1E79H 3L36A 2A06E 3SSUA 5EFWB 2POHA 1FBMA 2FXMA 1H0TA 2FKWB 4Y99B 3Q1MA 3CD6P 1G1IA 2IDBA 5KTBA 2JDIH 5APQA 1R8EA 1LTTC 3LIEA 3RK3D 3TGUD 1RF1C 1KQFB 3AE6C 3A2AA 1YITP 1P84E 5H2FH 1R5LA 3NTNA 2I1JA 2OYHC 5AW0B 3VTPC 1M1JB 3IN6A 1OW7A 2FFDC 5KLVG 2ZXEB 2P58A 1LT9B 2JEEA 2E5YA 2N9YB 3RK3C 1EC5A 1NTZK 1FAVA 1VF5D 1FC2C 5KAFE 3TK1A 3BVHA 4NPDA 1SQXE 1EZVE 5B66H 1BDCA 3M91A 1BGYE 2W8ZA 3TSIA 4H44C 3AE7C 1JCDA 1LTJC 2WSCJ 4LC1A 1VF5C 1FZCC 2E76D 1HF9A 1Y8AA 2WSCH 1G1JA 3WUUA 5APSA 2YMYA 3CXHH 1S2EA 5BVZA 1A02F 1BSHA 1NJIQ 4WB4A 1L0NE 3TGUG 1NTME 2N1TB 3PRJA 3H1JD 3KQGA 3MUDC 5AVYB 3H32A 1G2CA 2AXCA 4DOJA 2HODB 3KHUA 3FGAD 1WT6A 2OGUA 1N7SC 1KYOH 5BU5A 1KILE 2KZJA 2W6AA 3L4FA 1IFNA 1L0LK 1RF1A 2KUBA 3RL0B 2WPQA 1NKNA 4HYTB 3WUVA 2OYHA 4OWFA 4H0LC 1AQTA 1NAFA 1BCCJ 1J2JB 2YXRB 2OYIC 3GHGB 4WY4B 3BRVB 3H1HJ 4PV1B 3Q3DA 4CPGA 1AVOA 2IBZG 2WSFJ 4MN4C 5KLIB 3MZWB 2QJKC 2WSFH 2C0WA 1SQQD 1Q81Q 1X79B 1LTJA 2ZFCA 3H1JG 4W80A 4U3FE 2KOGA 1FZCA 2AEJA 1KILB 4W7ZA 1U57A 1T8ZA 3HE5A 5AW2B 2IFNA 1X8YA 2VRSA 3CX5D 1SQPJ 1ZV8A 1FZGA 3CCEP 3FX0A 3L72J 1DX7A 4RJTA 4D6TD 5B5EH 4GKGA 1ZP0C 3G4SP 4NPFX 3OAKA 3A7OA 5APWA 4IFMA 4GT1A 5CHXA 1FZBA 2A45I 1Q2NA 1N7SA 3H1LJ 4H13D 3PTZA 2FYNB 1NTKE 1DH3A 2P7JA 5DJUB 1SQQG 3L75D 1M1KQ 1FOSE 1NTZG 2XNDH 1PP9J 5K5GB 1FDOA 4H13C 1HBWA 1NTMK 3IAOA 2QE7H 1N2DC 2OYIA 3KYQA 1GU4A 2Y9ZA 1J1EB 4ASVA 1J1DB 1NU1K 2E75B 3CX5H 1FOSF 3SWYA 3D6YA 3GF7A 3H1IJ 3P7KA 2QJYB 4IL6E 1ZR2A 2WSEH 4D6TG 4HB1A 1EXJA 1VQPP 3IR9A 1NAYA 3A0HE 3SWFA 1AV1A 3H1KD 5AVWB 3II6A 1KFMA 3H25A 1JUNA 4WBAA 1K05A 1MFZA 3CCMP 4DT0A 4HKZH 3CWBD 3RK3E 3O6QA 3TGUE 1JMBA 2Z4EA 1URQD 2Y0EA 4U7JA 2J5UA 3H32B 1RH5B 1GL2A 2KYVA 2YIUC 4BRYB 1L0LJ 2FYUE 3HE4B 3L75G 1RHZB 1KB9D 2N9BA 1PFIA 1SLQA 3ZDMA 4HJGH 2V4HA 1QGKB 1ZOYC 1RF1B 2KLUA 2C9LY 3O8ZA 2Q1KA 3WU2H 1KD1Q 2OYHB 4JF7A 3TNUB 3KXDA 1K9MQ 4ASWA 2FFDB 3RGUA 3BATA 1PIXA 3RK3B 4YXWH 1GMJA 5CCGC 3M0DC 2O3JA 3H1KG 2Y0DA 3RBXA 4H44B 4W7YA 2OYOA 1LTJB 1P84H 3HD7C 1BE3E 1VF5B 1FZCB 5AW1B 3A0BE 1SQVD 2BASA 2ZYAA 3EQ2A 1NTKK 3HE5B 3MTUE 2P10A 1S5LX 1SQBK 2ZYGA 1GK6A 4JBZA 2KLVA 1SQXJ 1OXZA 3OJAB 3L70G 1BGYJ 3V6IA 4EI2A 1RE3C 1LJ2A 5APUA 1A02J 3GW6A 4PD4H 1M7LA 1E5WA 3SFDC 1JO5A 2JWDA 1LP1A 1HWTC 3CCSP 5KJ7A 3WMM0 4PJ0E 2KSJA 1R5SA 1SFCC 1ZRTE 3OA7A 1VQKP 1YI2P 1H88A 1KB9I 1N7SB 3AEDC 3U1AA 3VOPA 5CJ4A 1L0NJ 2GUSA 4DCKA 1NTMJ 5GTIE 2HODA 2Q3EA 2QVAA 1SQQE 2KK7A 1T6AA 1FE6A 5AVUB 4I2LC 2P2UA 2XKMA 1U7JA 1QLED 4H0LB 5KAIH 4C7RA 3G9RA 2BCCG 1SQVG 4GOFA 3RK2C 4IOIH 2OYIB 4GDOA 1VQ9P 1NU1G 1XTGB 5CCGA 2QJKB 1IFDA 4JYBA 1NYHA 2FYUK 1N8RQ 3CLQA 3GHGA 2IX7C 2FXPA 3HD7A 3N4XA 2H88C 2R5DA 5KLVD 1SP4A 2YMKA 4OH8B 4IL6X 2YO3A 1S5LH 3L71E 1KILA 3B5ND 1PGQA 1RE3A 3BCCE 2YKPA 3L73E 3L74G 1RQVA 4U3FJ 2XDJA 2ZXXA 3OW2O 2R3CA 3AEEC 1M56D 3P8CD 1SFCA 2I1KA 1LTIC 5E79H 3B5NC 5CCHD 1IFJA 3AE9C 1SQPK 3CXHD 3NFQA 2O1JA 2Y0CA 3AEAC 5GTHH 1M90Q 4JPZB 1N73C 2H7HA 1JB0J 2Q3IA 4YXDC 1S4XA 3D6ZA 4H13B 1M57D 4ZNCA 3Q5PA 3ITKA 4BWNA 1HGZA 3CWBE 5CBOA 4UB6H 1OX3A 3AE8C 5APTA 1NTKJ 1PV3A 1ZR4A 3V2QA 1SQBJ 1VL2A 1KYOD 5L8RJ 2W6JH 2ZAEB 1AVYA 4N78D 3M9BA 3AE3C 2AXTE 3VYIA 4YTPC 3CPWO 1KB9E 4GIFA 1K04A 3FXDA 2Q9IA 1IJDB 3G6EP 1JY3N 4EIJA 2O01J 3JSVC 1KORA 4UB8E 2IBZD 1LP1B 1BCCD 2LR2A 2FXOA 4WVZA 4ZMDA 1OW8A 3H1HD 5AW5B 2YIUB 4IL6H 1JY3O 2E76C 1NHLA 1OZHA 1D7MA 2QSIA 3TGUJ 3AE2C 4ZKUA 1NH4A 1W2EA 3FXEA 4BRYA 3UIAA 2WVRA 1OWAA 3HE4A 3CXHI 2GM4A 2CK3H 4TLFA 1PGOA 2JP3A 4Z1MH 4EDFA 1Y47A 4K35A 1QL2A 2WPRA 1K8AQ 3D70A 2FYUJ 1NVOA 1N73A 4R4MA 5AVVB 1XTCC 1RF0C 1SQPD 3JCUE 2GUVA 3C9IA 1K73Q 3TNUA 1WMKA 1ZW0A 2FFDA 3A5TA 1KYOI 2M5AB 1RY3A 3CL3D 3HD7B 3CMAP 1BCCG 1DD4A 4GOEA 4WWIA 4I1LA 2WSSH 3H1HG 3H1LD 1KQGB 1YJWP 1KN7A 2LKMA 1NTZD 2G8YA 2ZT9D 2NPSD 5CJ0A 2WITA 1JY3P 2YKOA 3I5CA 4B86A 2IBZI 1T2KD 3TYYA 1VPCA 1BE3J 1PGJA 2KB7P 5AVRB 1VQLP 2ZT9C 2NPSC 2QEXP 1SFCB 3A0BH 1H8AA 1HH0A 2KNCA 1EDKA 3AE5C 1MV8A 2XZRA 1SQPG 1SQXK 3B4SA 3MUDA 3L72G 3MIWA 1YJNP 2W90A 5AVTB 5BU8B 3LIDA 3G71P 1SVFA 4KHXA 2MJZA 3H6PA 1VQ7P 4NPEA 5H2FE 3MHVA 3RK2B 4RESB 5KLVE 3H1LG 3CCUP 1JMMA 3C1LA 1RF0A 5APYA 1LWUC 3R2PA 1L0NK 1VQ6P 1EDLA 1L0LD 2Y9YA 4AUWA 1USDA 5GTIH 4C46A 5B66E 3I55P 1PP9G 2HG5D 3V4QA 3E7KA 2PAJA 3P8CE 2B89A 1GK4A 2DW3A 1X22A 2OQQA 2W83C 2K1AA 1LTGC 2AEMA 2ZYDA 3CCJP 2C0XA 3VP8A 1VQ5P 3H1IG 3CXHE 1ZXGA 3V2PA 2OTKE 2W27A 1JTHA 4DZOA 3GF3A 2KP8A 1CI6A 1YQ3C 3CX5I 1VDFA 1GDTA 1Q7YQ 4TT3H 1NO4A 4N6JA 1P84D 1EDIA 1PPJG 2K37A 3VMYA 1S9KD 5KKZC 1KQSO 1QL1A 3B5NB 5APVA 2XV5A 2N1TD 3L71J 3R4YA 1URQC 3BCCJ 5AVQB 5AVXB 2B88A 4N78E 3KDPB 3L70D 1PZQA 2ZVOB 1L0LG 3L73J 4RO0A 1N73B 2CPBA 2YO2A 3HRNA 3AECC 2OTJP 1EZVD 4PD4D 2CPSA 2WZ7A 3PLNA 2D2CD 2IBZE 3B8EB 5AW7B 2ITAA 1FDMA 1EQ7A 2H89C 2K9JB 2XU6A 2D2CC 4WY4D 3KZIE 3H1JE 3CWBJ 1KMIZ 1NTMD 3BASA 2QA4P 1ZLLA 1L4AD 2BCCD 3V4WA 3C8VA 1MKMA 1QEXA 1QVGO 1NU1D 1IK9A 1NWQA 3AEFC 1HJBA 3SWKA 2K88A 1AFOA 5KAFH 2HFED 3TF5A 1FJKA 2E76B 1L4AC 2KNCB 3FWLA 2AXTH 2L91A 1SQXG 1EZVG 1LTBC 1P84I 3MD0A 5AVSB 2G3AA 3TDKA 1BSNA 1FDIA 3LW5J 4UB8H 3LW5H 2JJLA 4JQ0D 1CW5A 3A3YB 1URQA 2LXBA 3VP9A 3VMAA 1RE4C 1EXIA 3JC22 4PD4I 3L74D 1DEEG 2PP6A 1NTZE 2H43A 1L0NG 4LLHA 4I6MC 2NZ2A 3CMEP 1NTMG 3CC4P 5M1BA 3GLMA 4U3FD 3V2RA 5CBNA 2UWJE 3Q5RA 1LGHB 3L35A 1OVVA 3SFEC 1FU1A 2JO1A 3M0DA 1DIPA 2QRXA 3CX5E 1JOCA 3F5HA 4D6TE 2OTLP 1IO4A 2E43A 4AQRD 2RN0A 1Q90D 2M5AA 1VQMP 2Q6QA 3JCUH 1Q86Q 3V5BA 3L37A 2IFMA
chains in the Genus database with same CATH topology
3KZIH 4IL6H 4UB8H 5KAFH 5KAIH 3A0BH 5H2FH 5E79H 5B5EH 1S5LH 2AXTH 5B66H 3A0HH 3JCUH 5GTIH 5TISH 4PJ0H 3WU2H 4UB6H 5GTHH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KZI H;  4IL6 H;  4UB8 H;  5KAF H;  5KAI H;  3A0B H;  5H2F H;  5E79 H;  5B5E H;  1S5L H;  2AXT H;  5B66 H;  3A0H H;  3JCU H;  5GTI H;  5TIS H;  4PJ0 H;  3WU2 H;  4UB6 H;  5GTH H; 
#chains in the Genus database with same CATH topology
 1JTH B;  2IZ1 A;  3QH9 A;  1CI6 B;  1HJ0 A;  3PHL A;  1AQ5 A;  2WMM A;  1VQN P;  1S1C X;  2ZT9 B;  4LGD E;  2NPS B;  1NTK D;  1OFC X;  1GD2 E;  2OAR A;  1SQB D;  1X0T A;  1CSB A;  3L75 E;  1L0L E;  4R4L A;  1UIX A;  1KFN A;  4N3Y B;  3V2N A;  4U3F G;  1AJY A;  2MKV A;  1YJ9 P;  3ABV C;  2JKV A;  3Q2Y A;  4I7Z C;  5AW8 B;  1RE4 A;  2QM7 A;  1VQ4 P;  3MP7 B;  3HUS B;  3HTK A;  1JNM A;  3G3Z A;  1LWU B;  2FYZ A;  1IFM A;  1IC2 A;  5CCH C;  2HPC B;  3AE4 C;  3PH0 A;  3H1K E;  5TIS E;  1W5C E;  2HLO A;  2BEQ D;  4Y28 J;  3I56 P;  1JY2 N;  3N7N A;  3KPE A;  5KLV J;  5C39 A;  1S9K E;  2BEZ F;  1NTK G;  1SQB G;  4H44 D;  1X9V A;  1N7L A;  2KZI A;  1MZ9 A;  2KSE A;  1SQQ K;  2FYU D;  5AW9 B;  4ZKP A;  3L70 E;  1CZQ A;  1JY2 O;  4XFJ A;  3WUT A;  5AVZ B;  1YQ4 C;  3E1I A;  1W2B O;  2L5G B;  4PD4 E;  3IF4 A;  2O01 H;  3AEG C;  2IYP A;  3T97 A;  3USS A;  4GOD A;  2IPP A;  3CC2 P;  5KKZ B;  3MGN A;  1OVU A;  4DJG A;  3U59 A;  1USE A;  1QVF O;  3F89 A;  1URQ B;  3A0H H;  1Z56 A;  2M8R A;  3B5N A;  1FJP A;  1T3U A;  1NKZ B;  2PRR A;  1N7S D;  2B87 B;  1FZF A;  3S9O A;  3VN0 A;  1WRG A;  2JR8 A;  5KAI E;  2BCC E;  1SQV E;  2WPS A;  1BE3 D;  1NU1 E;  2QIW A;  2RMZ A;  1QX8 A;  2E74 D;  2KS1 B;  1VQ8 P;  5CCH A;  4YPC A;  2WT7 A;  1OVR A;  2I8D A;  4H0L D;  2FYU G;  3L72 D;  1SS1 A;  1BDD A;  2D2C B;  4EYY Q;  2KXP B;  1JY2 P;  2E74 C;  4XE5 B;  1YBK A;  1PGP A;  2K9J A;  3NMD A;  2XNX A;  5TJH A;  2Z5I A;  4L74 A;  1ZRT D;  2YKQ A;  4KT0 J;  2WPV B;  4OGQ D;  3GMA A;  1AA0 A;  1S5L E;  1FZE A;  2GA1 A;  3CCQ P;  1HGV A;  3M9Q A;  1L4A B;  3L74 E;  3H1J J;  1PP9 D;  3EFG A;  1FZA A;  3KZI H;  4A7P A;  1U7M A;  3M0A A;  2YXQ B;  4IFD K;  4OGQ C;  2RKL A;  1GL2 D;  1BE3 G;  3D71 A;  1LTS C;  5E79 E;  2PGD A;  2JWA A;  3EFF K;  1T2K C;  3H1I D;  4QMA A;  1S3J A;  2A45 H;  1TU3 F;  2A45 G;  4XA4 A;  5GTH E;  2QJP C;  1HUC A;  3GG2 A;  1IFI A;  3HTK B;  1EDJ A;  1GL2 C;  1H0T B;  2KIK A;  1PPJ D;  2C9N Y;  2ZVN B;  4PJ0 H;  1KQL A;  1HTL C;  1UII A;  4UB6 E;  1YHQ P;  2AEF A;  3HUS C;  1S72 P;  1N86 A;  2W6B A;  1IFP A;  4Y99 C;  1T3J A;  1SQQ J;  4C7N A;  1NTZ J;  3L71 D;  1SQB E;  3W67 A;  3BCC D;  2R32 A;  2J59 M;  1IZN B;  2WTY A;  2M3E A;  3L73 D;  1LNQ A;  2QM8 A;  4HH2 A;  2R3S A;  4O9B A;  2A06 D;  1JM0 A;  3PJS K;  3K5B A;  1M1J C;  1SQV K;  2IZ0 A;  3CCV P;  1LT9 C;  3Q5S A;  1ZME C;  3T97 B;  4D6T J;  1OMI A;  3CCR P;  5AW3 B;  2B9B A;  2WSE J;  3P32 A;  3QWO C;  3RL0 g;  2KI7 B;  2P67 A;  4JYC A;  4K3A A;  3P8M C;  4L73 A;  2NPS A;  5CMZ A;  5KJ7 D;  1MUU A;  1RQU A;  2FBW C;  2O01 N;  3CCL P;  3AEB C;  2K3R A;  4I7Z B;  1KYO E;  2K9Y A;  2SPZ A;  3E1R A;  3CI9 A;  3NXS A;  1DEB A;  3L75 J;  4BXL A;  1G2C B;  5KJ7 C;  3L71 G;  2P1J A;  1SQX D;  3BCC G;  3RBZ A;  1NGM B;  1BGY D;  3L73 G;  2WT7 B;  2E42 A;  2N1T C;  2A06 G;  3W68 A;  1YYC A;  1KZU B;  3HUS A;  1LWU A;  3RL0 D;  4L75 A;  2HYN A;  1BCC E;  5CCG D;  3AE1 C;  2HPC A;  5AW6 B;  1GU5 A;  3H1H E;  2R5B A;  2Q7C A;  3VMZ A;  2PFX A;  1NOH A;  3BRT B;  1L0N D;  4PV1 D;  3H1K J;  3HD7 D;  1OW6 A;  3RL0 C;  1Q82 Q;  1L2P A;  3S1K A;  1MFT A;  3FWN A;  5TIS H;  1GZL A;  2NRG A;  1M1J A;  3CWB G;  2Q5U A;  1H89 A;  1LT9 A;  3GHG C;  5KLV K;  3IFM A;  4WY4 C;  4PV1 C;  5APX A;  2WWW A;  5KLI C;  1KIL D;  1GW3 A;  2V7Q J;  1ZN5 A;  1KC8 Q;  1JEK A;  1YTZ I;  2LXC B;  1SQP E;  5B5E E;  3L70 J;  2V7Q H;  1LTA C;  1KB9 H;  1BGY G;  3L72 E;  1FS0 E;  1SFC D;  4M3L A;  1IK7 A;  2RH0 A;  1KIL C;  4L76 A;  2M0B A;  3CC7 P;  1LT1 A;  1YTZ T;  3H1L E;  1EZV I;  2B87 A;  2E5T A;  2QG4 A;  2N1T A;  3M9H A;  5DJT B;  2IYO A;  4C7N B;  3RK2 D;  1PP9 E;  3EWK A;  2KS1 A;  1JCC A;  1GTW A;  2WQY C;  2BCC J;  2E74 B;  1SQV J;  1VQO P;  1OIP A;  2H8P D;  4AYC A;  2FYN C;  4IFF A;  1NU1 J;  2M3B A;  4OVN F;  1PL5 A;  3H1I E;  2HR3 A;  1GW4 A;  2O1K A;  2E75 D;  2R44 A;  5AW4 B;  1KV4 A;  1YIJ P;  1Y9B A;  2Z5H A;  1KTM A;  2J58 A;  4WY4 A;  3VMX A;  1J1E C;  1PPJ E;  3U1C A;  1J1D C;  1DD3 A;  4RKU J;  2E75 C;  4OGQ B;  1L4A A;  2QJY C;  1M8O B;  3S4R A;  3O6Q B;  3PP5 A;  3M06 A;  3B71 A;  1HVV A;  3L74 J;  2QJP B;  4KJM A;  2ZJS E;  1GL2 B;  4EOT A;  2YNY A;  2FY8 A;  3WU2 E;  1E79 H;  3L36 A;  2A06 E;  3SSU A;  5EFW B;  2POH A;  1FBM A;  2FXM A;  1H0T A;  2FKW B;  4Y99 B;  3Q1M A;  3CD6 P;  1G1I A;  2IDB A;  5KTB A;  2JDI H;  5APQ A;  1R8E A;  1LTT C;  3LIE A;  3RK3 D;  3TGU D;  1RF1 C;  1KQF B;  3AE6 C;  3A2A A;  1YIT P;  1P84 E;  5H2F H;  1R5L A;  3NTN A;  2I1J A;  2OYH C;  5AW0 B;  3VTP C;  1M1J B;  3IN6 A;  1OW7 A;  2FFD C;  5KLV G;  2ZXE B;  2P58 A;  1LT9 B;  2JEE A;  2E5Y A;  2N9Y B;  3RK3 C;  1EC5 A;  1NTZ K;  1FAV A;  1VF5 D;  1FC2 C;  5KAF E;  3TK1 A;  3BVH A;  4NPD A;  1SQX E;  1EZV E;  5B66 H;  1BDC A;  3M91 A;  1BGY E;  2W8Z A;  3TSI A;  4H44 C;  3AE7 C;  1JCD A;  1LTJ C;  2WSC J;  4LC1 A;  1VF5 C;  1FZC C;  2E76 D;  1HF9 A;  1Y8A A;  2WSC H;  1G1J A;  3WUU A;  5APS A;  2YMY A;  3CXH H;  1S2E A;  5BVZ A;  1A02 F;  1BSH A;  1NJI Q;  4WB4 A;  1L0N E;  3TGU G;  1NTM E;  2N1T B;  3PRJ A;  3H1J D;  3KQG A;  3MUD C;  5AVY B;  3H32 A;  1G2C A;  2AXC A;  4DOJ A;  2HOD B;  3KHU A;  3FGA D;  1WT6 A;  2OGU A;  1N7S C;  1KYO H;  5BU5 A;  1KIL E;  2KZJ A;  2W6A A;  3L4F A;  1IFN A;  1L0L K;  1RF1 A;  2KUB A;  3RL0 B;  2WPQ A;  1NKN A;  4HYT B;  3WUV A;  2OYH A;  4OWF A;  4H0L C;  1AQT A;  1NAF A;  1BCC J;  1J2J B;  2YXR B;  2OYI C;  3GHG B;  4WY4 B;  3BRV B;  3H1H J;  4PV1 B;  3Q3D A;  4CPG A;  1AVO A;  2IBZ G;  2WSF J;  4MN4 C;  5KLI B;  3MZW B;  2QJK C;  2WSF H;  2C0W A;  1SQQ D;  1Q81 Q;  1X79 B;  1LTJ A;  2ZFC A;  3H1J G;  4W80 A;  4U3F E;  2KOG A;  1FZC A;  2AEJ A;  1KIL B;  4W7Z A;  1U57 A;  1T8Z A;  3HE5 A;  5AW2 B;  2IFN A;  1X8Y A;  2VRS A;  3CX5 D;  1SQP J;  1ZV8 A;  1FZG A;  3CCE P;  3FX0 A;  3L72 J;  1DX7 A;  4RJT A;  4D6T D;  5B5E H;  4GKG A;  1ZP0 C;  3G4S P;  4NPF X;  3OAK A;  3A7O A;  5APW A;  4IFM A;  4GT1 A;  5CHX A;  1FZB A;  2A45 I;  1Q2N A;  1N7S A;  3H1L J;  4H13 D;  3PTZ A;  2FYN B;  1NTK E;  1DH3 A;  2P7J A;  5DJU B;  1SQQ G;  3L75 D;  1M1K Q;  1FOS E;  1NTZ G;  2XND H;  1PP9 J;  5K5G B;  1FDO A;  4H13 C;  1HBW A;  1NTM K;  3IAO A;  2QE7 H;  1N2D C;  2OYI A;  3KYQ A;  1GU4 A;  2Y9Z A;  1J1E B;  4ASV A;  1J1D B;  1NU1 K;  2E75 B;  3CX5 H;  1FOS F;  3SWY A;  3D6Y A;  3GF7 A;  3H1I J;  3P7K A;  2QJY B;  4IL6 E;  1ZR2 A;  2WSE H;  4D6T G;  4HB1 A;  1EXJ A;  1VQP P;  3IR9 A;  1NAY A;  3A0H E;  3SWF A;  1AV1 A;  3H1K D;  5AVW B;  3II6 A;  1KFM A;  3H25 A;  1JUN A;  4WBA A;  1K05 A;  1MFZ A;  3CCM P;  4DT0 A;  4HKZ H;  3CWB D;  3RK3 E;  3O6Q A;  3TGU E;  1JMB A;  2Z4E A;  1URQ D;  2Y0E A;  4U7J A;  2J5U A;  3H32 B;  1RH5 B;  1GL2 A;  2KYV A;  2YIU C;  4BRY B;  1L0L J;  2FYU E;  3HE4 B;  3L75 G;  1RHZ B;  1KB9 D;  2N9B A;  1PFI A;  1SLQ A;  3ZDM A;  4HJG H;  2V4H A;  1QGK B;  1ZOY C;  1RF1 B;  2KLU A;  2C9L Y;  3O8Z A;  2Q1K A;  3WU2 H;  1KD1 Q;  2OYH B;  4JF7 A;  3TNU B;  3KXD A;  1K9M Q;  4ASW A;  2FFD B;  3RGU A;  3BAT A;  1PIX A;  3RK3 B;  4YXW H;  1GMJ A;  5CCG C;  3M0D C;  2O3J A;  3H1K G;  2Y0D A;  3RBX A;  4H44 B;  4W7Y A;  2OYO A;  1LTJ B;  1P84 H;  3HD7 C;  1BE3 E;  1VF5 B;  1FZC B;  5AW1 B;  3A0B E;  1SQV D;  2BAS A;  2ZYA A;  3EQ2 A;  1NTK K;  3HE5 B;  3MTU E;  2P10 A;  1S5L X;  1SQB K;  2ZYG A;  1GK6 A;  4JBZ A;  2KLV A;  1SQX J;  1OXZ A;  3OJA B;  3L70 G;  1BGY J;  3V6I A;  4EI2 A;  1RE3 C;  1LJ2 A;  5APU A;  1A02 J;  3GW6 A;  4PD4 H;  1M7L A;  1E5W A;  3SFD C;  1JO5 A;  2JWD A;  1LP1 A;  1HWT C;  3CCS P;  5KJ7 A;  3WMM 0;  4PJ0 E;  2KSJ A;  1R5S A;  1SFC C;  1ZRT E;  3OA7 A;  1VQK P;  1YI2 P;  1H88 A;  1KB9 I;  1N7S B;  3AED C;  3U1A A;  3VOP A;  5CJ4 A;  1L0N J;  2GUS A;  4DCK A;  1NTM J;  5GTI E;  2HOD A;  2Q3E A;  2QVA A;  1SQQ E;  2KK7 A;  1T6A A;  1FE6 A;  5AVU B;  4I2L C;  2P2U A;  2XKM A;  1U7J A;  1QLE D;  4H0L B;  5KAI H;  4C7R A;  3G9R A;  2BCC G;  1SQV G;  4GOF A;  3RK2 C;  4IOI H;  2OYI B;  4GDO A;  1VQ9 P;  1NU1 G;  1XTG B;  5CCG A;  2QJK B;  1IFD A;  4JYB A;  1NYH A;  2FYU K;  1N8R Q;  3CLQ A;  3GHG A;  2IX7 C;  2FXP A;  3HD7 A;  3N4X A;  2H88 C;  2R5D A;  5KLV D;  1SP4 A;  2YMK A;  4OH8 B;  4IL6 X;  2YO3 A;  1S5L H;  3L71 E;  1KIL A;  3B5N D;  1PGQ A;  1RE3 A;  3BCC E;  2YKP A;  3L73 E;  3L74 G;  1RQV A;  4U3F J;  2XDJ A;  2ZXX A;  3OW2 O;  2R3C A;  3AEE C;  1M56 D;  3P8C D;  1SFC A;  2I1K A;  1LTI C;  5E79 H;  3B5N C;  5CCH D;  1IFJ A;  3AE9 C;  1SQP K;  3CXH D;  3NFQ A;  2O1J A;  2Y0C A;  3AEA C;  5GTH H;  1M90 Q;  4JPZ B;  1N73 C;  2H7H A;  1JB0 J;  2Q3I A;  4YXD C;  1S4X A;  3D6Z A;  4H13 B;  1M57 D;  4ZNC A;  3Q5P A;  3ITK A;  4BWN A;  1HGZ A;  3CWB E;  5CBO A;  4UB6 H;  1OX3 A;  3AE8 C;  5APT A;  1NTK J;  1PV3 A;  1ZR4 A;  3V2Q A;  1SQB J;  1VL2 A;  1KYO D;  5L8R J;  2W6J H;  2ZAE B;  1AVY A;  4N78 D;  3M9B A;  3AE3 C;  2AXT E;  3VYI A;  4YTP C;  3CPW O;  1KB9 E;  4GIF A;  1K04 A;  3FXD A;  2Q9I A;  1IJD B;  3G6E P;  1JY3 N;  4EIJ A;  2O01 J;  3JSV C;  1KOR A;  4UB8 E;  2IBZ D;  1LP1 B;  1BCC D;  2LR2 A;  2FXO A;  4WVZ A;  4ZMD A;  1OW8 A;  3H1H D;  5AW5 B;  2YIU B;  4IL6 H;  1JY3 O;  2E76 C;  1NHL A;  1OZH A;  1D7M A;  2QSI A;  3TGU J;  3AE2 C;  4ZKU A;  1NH4 A;  1W2E A;  3FXE A;  4BRY A;  3UIA A;  2WVR A;  1OWA A;  3HE4 A;  3CXH I;  2GM4 A;  2CK3 H;  4TLF A;  1PGO A;  2JP3 A;  4Z1M H;  4EDF A;  1Y47 A;  4K35 A;  1QL2 A;  2WPR A;  1K8A Q;  3D70 A;  2FYU J;  1NVO A;  1N73 A;  4R4M A;  5AVV B;  1XTC C;  1RF0 C;  1SQP D;  3JCU E;  2GUV A;  3C9I A;  1K73 Q;  3TNU A;  1WMK A;  1ZW0 A;  2FFD A;  3A5T A;  1KYO I;  2M5A B;  1RY3 A;  3CL3 D;  3HD7 B;  3CMA P;  1BCC G;  1DD4 A;  4GOE A;  4WWI A;  4I1L A;  2WSS H;  3H1H G;  3H1L D;  1KQG B;  1YJW P;  1KN7 A;  2LKM A;  1NTZ D;  2G8Y A;  2ZT9 D;  2NPS D;  5CJ0 A;  2WIT A;  1JY3 P;  2YKO A;  3I5C A;  4B86 A;  2IBZ I;  1T2K D;  3TYY A;  1VPC A;  1BE3 J;  1PGJ A;  2KB7 P;  5AVR B;  1VQL P;  2ZT9 C;  2NPS C;  2QEX P;  1SFC B;  3A0B H;  1H8A A;  1HH0 A;  2KNC A;  1EDK A;  3AE5 C;  1MV8 A;  2XZR A;  1SQP G;  1SQX K;  3B4S A;  3MUD A;  3L72 G;  3MIW A;  1YJN P;  2W90 A;  5AVT B;  5BU8 B;  3LID A;  3G71 P;  1SVF A;  4KHX A;  2MJZ A;  3H6P A;  1VQ7 P;  4NPE A;  5H2F E;  3MHV A;  3RK2 B;  4RES B;  5KLV E;  3H1L G;  3CCU P;  1JMM A;  3C1L A;  1RF0 A;  5APY A;  1LWU C;  3R2P A;  1L0N K;  1VQ6 P;  1EDL A;  1L0L D;  2Y9Y A;  4AUW A;  1USD A;  5GTI H;  4C46 A;  5B66 E;  3I55 P;  1PP9 G;  2HG5 D;  3V4Q A;  3E7K A;  2PAJ A;  3P8C E;  2B89 A;  1GK4 A;  2DW3 A;  1X22 A;  2OQQ A;  2W83 C;  2K1A A;  1LTG C;  2AEM A;  2ZYD A;  3CCJ P;  2C0X A;  3VP8 A;  1VQ5 P;  3H1I G;  3CXH E;  1ZXG A;  3V2P A;  2OTK E;  2W27 A;  1JTH A;  4DZO A;  3GF3 A;  2KP8 A;  1CI6 A;  1YQ3 C;  3CX5 I;  1VDF A;  1GDT A;  1Q7Y Q;  4TT3 H;  1NO4 A;  4N6J A;  1P84 D;  1EDI A;  1PPJ G;  2K37 A;  3VMY A;  1S9K D;  5KKZ C;  1KQS O;  1QL1 A;  3B5N B;  5APV A;  2XV5 A;  2N1T D;  3L71 J;  3R4Y A;  1URQ C;  3BCC J;  5AVQ B;  5AVX B;  2B88 A;  4N78 E;  3KDP B;  3L70 D;  1PZQ A;  2ZVO B;  1L0L G;  3L73 J;  4RO0 A;  1N73 B;  2CPB A;  2YO2 A;  3HRN A;  3AEC C;  2OTJ P;  1EZV D;  4PD4 D;  2CPS A;  2WZ7 A;  3PLN A;  2D2C D;  2IBZ E;  3B8E B;  5AW7 B;  2ITA A;  1FDM A;  1EQ7 A;  2H89 C;  2K9J B;  2XU6 A;  2D2C C;  4WY4 D;  3KZI E;  3H1J E;  3CWB J;  1KMI Z;  1NTM D;  3BAS A;  2QA4 P;  1ZLL A;  1L4A D;  2BCC D;  3V4W A;  3C8V A;  1MKM A;  1QEX A;  1QVG O;  1NU1 D;  1IK9 A;  1NWQ A;  3AEF C;  1HJB A;  3SWK A;  2K88 A;  1AFO A;  5KAF H;  2HFE D;  3TF5 A;  1FJK A;  2E76 B;  1L4A C;  2KNC B;  3FWL A;  2AXT H;  2L91 A;  1SQX G;  1EZV G;  1LTB C;  1P84 I;  3MD0 A;  5AVS B;  2G3A A;  3TDK A;  1BSN A;  1FDI A;  3LW5 J;  4UB8 H;  3LW5 H;  2JJL A;  4JQ0 D;  1CW5 A;  3A3Y B;  1URQ A;  2LXB A;  3VP9 A;  3VMA A;  1RE4 C;  1EXI A;  3JC2 2;  4PD4 I;  3L74 D;  1DEE G;  2PP6 A;  1NTZ E;  2H43 A;  1L0N G;  4LLH A;  4I6M C;  2NZ2 A;  3CME P;  1NTM G;  3CC4 P;  5M1B A;  3GLM A;  4U3F D;  3V2R A;  5CBN A;  2UWJ E;  3Q5R A;  1LGH B;  3L35 A;  1OVV A;  3SFE C;  1FU1 A;  2JO1 A;  3M0D A;  1DIP A;  2QRX A;  3CX5 E;  1JOC A;  3F5H A;  4D6T E;  2OTL P;  1IO4 A;  2E43 A;  4AQR D;  2RN0 A;  1Q90 D;  2M5A A;  1VQM P;  2Q6Q A;  3JCU H;  1Q86 Q;  3V5B A;  3L37 A;  2IFM A; 
#chains in the Genus database with same CATH homology
 3KZI H;  4IL6 H;  4UB8 H;  5KAF H;  5KAI H;  3A0B H;  5H2F H;  5E79 H;  5B5E H;  1S5L H;  2AXT H;  5B66 H;  3A0H H;  3JCU H;  5GTI H;  5TIS H;  4PJ0 H;  3WU2 H;  4UB6 H;  5GTH H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...