5TISH

Room temperature xfel structure of the native, doubly-illuminated photosystem ii complex
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
65
structure length
65
Chain Sequence
ARRTWLGDILRPLNSEYGKVAPGWGTTPLMAVFMGLFLVFLLIILEIYNSTLILDGVNVSWKALG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Photosystem II protein D1 1
publication title Structure of photosystem II and substrate binding at room temperature.
pubmed doi rcsb
molecule tags Photosynthesis
total genus 14
structure length 65
sequence length 65
chains with identical sequence h
ec nomenclature
pdb deposition date 2016-10-03

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF00737 PsbH Photosystem II 10 kDa phosphoprotein
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.880 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Photosystem II reaction center protein H 5tisH01
3A0HH 4IL6H 2AXTH 3WU2H 5B5EH 1S5LH 5B66H 5KAFH 3JCUH 4UB8H 5H2FH 3A0BH 5KAIH 3KZIH 5GTHH 4UB6H 5GTIH 5TISH 5E79H 4PJ0H
chains in the Genus database with same CATH superfamily
2WSCH 1L4AD 1FZEA 1YJWP 4D6TD 5B66H 2ZT9C 1N86A 1YTZT 3JCUE 2P1JA 3VMZA 3T97A 1HH0A 4DT0A 1SLQA 1L2PA 1JO5A 2N1TA 2FYUJ 2C0XA 4U3FE 2R3CA 4MN4C 1S5LE 1HGVA 2PRRA 1DH3A 2QJKB 1IJDB 2WZ7A 2C9NY 2KK7A 1LWUC 4HH2A 5KJ7C 3VOPA 4OVNF 3B5NB 2JDIH 2K3RA 3L72J 3HE4B 1FOSF 2I1JA 1QGKB 5KKZB 3W68A 3CXHH 3VMAA 3H6PA 1LTSC 1OZHA 1K05A 3FXDA 1GL2D 1SFCB 4GOEA 2QE7H 3AE4C 1GTWA 4OGQB 1EXJA 3CWBJ 1IC2A 1VQ5P 1NTMD 4EYYQ 3H1KJ 3S9OA 1GU5A 4ASVA 3L35A 4UB6E 5K5GB 1KC8Q 1VQPP 1EZVE 5APUA 1RQVA 3I55P 2KSJA 1YQ4C 1LJ2A 1NO4A 1H8AA 4EIJA 3CCJP 1USDA 1G2CA 2FYUE 2G8YA 5AW3B 4GT1A 2W8ZA 1YI2P 2ZAEB 4C7NB 2BEQD 2O01H 2A45G 1GMJA 4WY4A 2Q3EA 1YIJP 2KSEA 4BRYA 1OW8A 3V6IA 3KPEA 2AEFA 2E76D 2YKPA 1U57A 3L70J 3K5BA 3L72E 3RL0B 2HLOA 3EWKA 1RE4C 2Q9IA 3RK2B 3PH0A 4RESB 3Q1MA 1ZLLA 3L37A 1PP9J 1PGJA 3N7NA 3I56P 1HVVA 1KN7A 2XNDH 3PHLA 3W67A 3KXDA 2RH0A 4H13B 1G1IA 3H1HG 2ZXXA 3L73G 4W80A 1EDJA 3BRVB 2WPVB 1L0NE 2O3JA 3H1KE 3PJSK 3CX5H 3VP8A 3HD7D 5AW2B 3MD0A 1H0TA 2JR8A 1ZR2A 3V2QA 3E1IA 3TK1A 3TYYA 2YNYA 1KFNA 3L75J 3VYIA 5B5EH 3WU2E 2KZJA 1KV4A 1VQMP 1SQXD 2IDBA 2AXCA 3H32B 2WT7B 2HR3A 1JMMA 2G3AA 3V2RA 2ZYGA 3H1JD 1WT6A 1VQ4P 3SFEC 2R44A 2M0BA 2P7JA 2W90A 1KB9I 3IF4A 2BCCG 3V2PA 1LTJA 1LT9B 3GMAA 5H2FE 3GG2A 5TISE 2ZXEB 1HUCA 3KQGA 1HWTC 1Q86Q 1Q7YQ 2OYIA 1X0TA 2B87B 2W83C 4PV1C 1CI6B 1FZCA 3MUDA 2POHA 2FBWC 5AVSB 3CC2P 1BE3J 4Z1MH 1YITP 1N7SD 5BVZA 5CCGA 2IBZD 3U1AA 1R8EA 4H0LD 3H1IJ 1SQVE 2IYOA 1NAFA 4UB8H 1HJBA 2FYNB 1ZR4A 1L0LD 2Q5UA 5E79H 5APYA 1USEA 1VF5B 2OARA 1JNMA 1M90Q 3M0DA 1KILC 2A45I 4L76A 2M5AA 3B4SA 4JPZB 1RHZB 2YXRB 2IZ0A 2QJPB 3MIWA 4BWNA 1QL2A 3JCUH 4NPDA 2D2CB 2LXCB 5APTA 1S5LX 4AYCA 4BRYB 1RF0C 2WQYC 2JWDA 4DJGA 3CC7P 3HE5A 1J1DB 3TGUG 2J59M 3RK3C 1K9MQ 4EI2A 1LWUA 5KJ7A 2HFED 1KTMA 2OYHC 2P58A 1L4AB 3JSVC 1L0NG 1HJ0A 1N8RQ 1X22A 2W6JH 1MFTA 4W7YA 1XTCC 3IR9A 2RMZA 5KAFE 1SQXG 2LKMA 1OVVA 4H44C 1NHLA 2AEMA 2N1TD 1NGMB 2YIUB 2KS1B 3H1JG 4IL6E 2K9YA 2NPSC 1NTKK 1KYOE 3Q2YA 1UIXA 2FFDC 4UB6H 1X9VA 1LP1B 1JY2O 3H1HJ 1GL2B 2KLVA 3L73J 2YMKA 1M7LA 1IFDA 1NOHA 1OX3A 1RE3C 1KILE 1SQPD 1Q90D 2QA4P 1S1CX 2E75C 2I8DA 4I7ZC 4C46A 1DD4A 1KQGB 1W2BO 3AE7C 2IBZG 3SFDC 3HTKA 3PLNA 3L74D 3H1LG 4U3FJ 3NFQA 5AW7B 1KORA 1EQ7A 4A7PA 1IK9A 3L71D 1RE4A 1L0LG 4LGDE 5APVA 3MHVA 3CCUP 4GODA 2Z5IA 1QLED 5APXA 1SQQD 2LXBA 1GK6A 2XNXA 2BCCJ 1SQBG 1VQLP 1N73C 2QEXP 1J2JB 3M06A 2KP8A 2E76B 2E74D 5AVWB 1FZGA 4WY4D 1WRGA 2IFNA 3NMDA 3H1HE 3BCCG 1URQC 3L73E 3U1CA 5KLVG 1EC5A 3WU2H 3P8CD 1VDFA 2XDJA 2E5TA 5KTBA 3VP9A 1FU1A 1NKNA 3TNUB 5GTHE 4PD4I 1T3JA 1OVUA 2HG5D 1IFMA 3HD7B 4R4LA 2GA1A 2HODB 3C9IA 1LTIC 2UWJE 1FJPA 3C8VA 1NTZG 1IO4A 2H88C 1VQ6P 4GDOA 1NU1G 3AEDC 5H2FH 2PP6A 1BGYG 3HUSB 5TISH 2WSEJ 1GDTA 5AW9B 4BXLA 3D71A 2FKWB 2FYUK 1RF1B 2O1JA 2SPZA 2BCCE 2NZ2A 4B86A 4Y99B 2LR2A 3A2AA 2K9JB 1OVRA 5GTIE 2Q6QA 5CBNA 3D6YA 1CW5A 1PGPA 2AXTH 3TGUJ 2JJLA 3B5NC 1PFIA 3G71P 3CMEP 1AFOA 5AVUB 3V4QA 2R5DA 3M0AA 3VMXA 1L0NJ 4M3LA 4WVZA 1SQPG 3O6QA 1VQ9P 1T2KD 1SFCC 3SWKA 1KILA 1DD3A 1BSNA 1QL1A 4KJMA 3R2PA 2QM7A 2R5BA 4LC1A 1MFZA 1N7SB 2IBZI 2H8PD 4I6MC 4OGQC 2KI7B 3KHUA 3L74G 3LW5H 5AW8B 1L0NK 1R5SA 4N78E 1A02F 3Q5PA 3EFGA 5CCGD 4H0LB 1JY3N 3CXHI 3AEFC 1Y8AA 2KUBA 3V5BA 3AE3C 2DW3A 3SWFA 1RF0A 1SQQG 5CCHC 1P84E 5C39A 1HTLC 5EFWB 1RH5B 1VQ7P 2IFMA 2ITAA 3KZIE 2QRXA 2FYUD 2FYZA 3OA7A 2PFXA 1PPJD 4ZKPA 2OYHA 2R3SA 1JOCA 3GW6A 1PIXA 4ZKUA 2V7QH 2Y0EA 2ZT9D 3AEGC 3TGUE 1AVYA 3ITKA 2QJYB 1Q81Q 3RL0C 5AVVB 2OGUA 1KQSO 3BVHA 2GUVA 1AVOA 4D6TG 3H1LJ 3GHGB 4K35A 5KAFH 4IL6X 3WUTA 3RK2C 2KIKA 4PD4D 1JEKA 1FZFA 3FWNA 3O8ZA 4IOIH 3WUUA 2NPSA 1SQVJ 1FBMA 4IL6H 2HPCB 4H13C 3CWBD 1BCCD 2YKQA 2FFDA 2FXMA 2IPPA 5KJ7D 1SQXE 1BSHA 1KYOH 3SWYA 5BU5A 4KT0J 1EXIA 2MJZA 1SQBJ 1ZOYC 3H1JE 2QG4A 1SQVK 3LW5J 3T97B 2P2UA 1X79B 3E1RA 1S9KD 1RE3A 3F5HA 3JC22 2N1TB 1JY2P 2WSFJ 2IYPA 2WVRA 1A02J 1SQBK 1Y9BA 1NH4A 3A0BE 3BCCJ 4JQ0D 2Q3IA 3TSIA 2YO2A 5KLVJ 3G6EP 4DCKA 2KNCA 1FZBA 4RO0A 2QVAA 1MV8A 2OTLP 3S4RA 1M56D 3A7OA 2C9LY 1NTMG 3L70D 4K3AA 3AE9C 2IBZE 1LT9C 4JBZA 2V7QJ 2A45H 1JY2N 1JY3O 2XZRA 3H1LE 2A06D 4KHXA 2J58A 1FDOA 1N73A 1W5CE 1NTZJ 1PP9D 4W7ZA 3CCQP 1PGOA 1NU1J 1L0LE 4ZMDA 4C7RA 3N4XA 1JM0A 1BGYJ 3CXHD 1AJYA 1S2EA 3M91A 2O01N 1AQ5A 4R4MA 5AVZB 2KXPB 1NTZK 1T8ZA 1URQA 1FE6A 1SQBE 3PTZA 1NU1K 1YYCA 3AE5C 5APWA 3VN0A 4YPCA 1BDCA 2FYNC 3B71A 2P67A 1G2CB 5AW5B 3LIDA 1DX7A 1N7LA 2Q7CA 3GF7A 3L75D 1CSBA 2KOGA 1E79H 1PPJG 1VF5C 3AECC 3BCCE 2E74B 2E43A 5L8RJ 4WY4B 3BRTB 5GTHH 5KLVE 3SSUA 4CPGA 2XV5A 4WB4A 1KQLA 1ZW0A 2OYHB 1S5LH 3CI9A 2QJPC 3QH9A 2D2CC 4PJ0E 1IK7A 4DOJA 3U59A 5AW1B 1NTZE 2JO1A 1FDMA 2JKVA 3CWBG 1BCCG 1NU1E 1J1DC 1SQQJ 1BE3D 1BGYE 4U7JA 1WMKA 1AQTA 1HF9A 1L4AC 5GTIH 1M57D 3B5NA 2ZJSE 5KLIB 3IFMA 3AE8C 1H0TB 3HE4A 2NPSB 5DJTB 2KLUA 1KB9E 2KZIA 1J1EB 1LTGC 3H1ID 1SFCA 4PV1D 4XE5B 3CPWO 3CX5D 1GD2E 3RGUA 5APQA 1ZV8A 2Y9ZA 2HYNA 4L74A 2YIUC 1AA0A 4GKGA 1W2EA 2OQQA 2M3EA 1N2DC 4D6TJ 1SQPE 3D6ZA 2N9BA 2E75B 3V4WA 1KYOD 2YKOA 3CC4P 4O9BA 3L70G 3CCLP 3KDPB 5CCHA 1LTJB 3UIAA 2C0WA 4QMAA 4GIFA 3I5CA 2AEJA 3L74E 1GL2C 2A06G 1XTGB 3CCVP 2OYIB 1P84H 2CK3H 1PP9G 2WSEH 1FZCB 3AE6C 1QVFO 1MKMA 1UIIA 3KZIH 1KILD 2Z5HA 3CL3D 3PP5A 3BATA 4C7NA 1CZQA 5DJUB 1SQQE 2QM8A 2B89A 1FZAA 1VL2A 2OYOA 1MUUA 3CCSP 1H89A 1N73B 4N6JA 1SVFA 1FAVA 5CBOA 3GF3A 1ZN5A 2YXQB 3A0HE 3L75G 1NTKD 3P7KA 2FXPA 4N3YB 1NWQA 2E42A 2MKVA 1NTMJ 4UB8E 3RK3D 1QX8A 3FWLA 2W27A 2OTJP 1OW6A 3AEEC 2M5AB 3H25A 4D6TE 1D7MA 1LTTC 2ZT9B 2E76C 1M1JC 3TF5A 2L5GB 2CPBA 2Y9YA 4XA4A 5BU8B 3MP7B 1JCCA 3USSA 3GLMA 3L73D 1ZRTD 4H44D 3H32A 2NRGA 2WT7A 3HE5B 1K04A 1BE3G 3D70A 1LWUB 3IN6A 3A0BH 2NPSD 5KAIE 2K37A 4NPEA 1ZP0C 5CJ0A 3HD7C 2WSSH 1E5WA 4YXDC 4U3FD 5AVRB 3EFFK 1LT9A 3H1IG 2P10A 4TT3H 2CPSA 4IFMA 3CCMP 3OW2O 1SS1A 2QJKC 2GM4A 1H88A 1QVGO 2B87A 3HUSC 4TLFA 2WWWA 1CI6A 2QSIA 4AQRD 2E75D 1GW3A 4JYBA 1RF1C 1JY3P 1NTME 2BCCD 5KKZC 3ABVC 1K73Q 1OWAA 3OJAB 3WUVA 4Y99C 2YMYA 2IX7C 3B8EB 3RL0g 1AV1A 1FC2C 2W6AA 4XFJA 1IFIA 1BCCJ 3M9BA 4I1LA 4NPFX 2RKLA 4ZNCA 1SQXJ 4YXWH 1NYHA 2Y0CA 3A3YB 3L71G 2E5YA 4AUWA 2WSFH 3H1JJ 2OTKE 1LTAC 2WPQA 1VQOP 1EZVD 1N7SC 2WSCJ 3CD6P 3HTKB 1SQXK 1GK4A 5CJ4A 4N78D 3VMYA 1PPJE 3II6A 1ZXGA 4H0LC 1KFMA 1URQD 1NTKG 3S1KA 1MZ9A 1Q2NA 1P84D 3AE2C 4LLHA 4OH8B 4PJ0H 3L72D 1OXZA 4WBAA 1LTBC 1Q82Q 3HRNA 1L4AA 1KQFB 2IZ1A 3CLQA 2K1AA 4PD4E 3NTNA 1PZQA 1S72P 1RQUA 1PV3A 2BEZF 3NXSA 1GU4A 1L0LJ 3CWBE 2QIWA 1YTZI 1BCCE 3TGUD 1OMIA 1KB9H 2QJYC 2WTYA 4HYTB 1OFCX 1L0ND 3Q5SA 1KZUB 3H1KD 3GHGC 1VPCA 3CMAP 1S9KE 2KS1A 1LGHB 3A5TA 1L0LK 1JTHA 4GOFA 1BDDA 3G3ZA 4HB1A 2FY8A 3V2NA 2KYVA 4Y28J 1G1JA 4L73A 4U3FG 1FS0E 5B66E 2O1KA 2N9YB 3M9HA 3KYQA 1LP1A 4HKZH 3B5ND 1EDIA 1IFNA 1GL2A 4I2LC 2WPSA 2J5UA 3CX5I 4PV1B 2GUSA 1PL5A 4RJTA 1SFCD 1GW4A 1OW7A 1T6AA 4EDFA 4ASWA 3L70E 1IFJA 1TU3F 2N1TC 2RN0A 2XKMA 3IAOA 1LNQA 4RKUJ 2O01J 2JP3A 3L4FA 1KYOI 4OGQD 1JCDA 1PGQA 1NVOA 2A06E 3MGNA 5KLVK 1OIPA 2JEEA 1PP9E 2ZYDA 3CXHE 1U7JA 1FOSE 5CCHD 5AW4B 2JWAA 3A0HH 1T3UA 3O6QB 1S3JA 2AXTE 2V4HA 2YO3A 1KILB 3H1LD 3LIEA 1EZVG 1YBKA 1KD1Q 2Y0DA 1SQVD 3BASA 3L75E 4JYCA 1M1JA 2FYUG 1DEEG 2H7HA 2WITA 1SQBD 3RL0D 1VQNP 3MTUE 2PAJA 5CMZA 1SQPJ 1Z56A 3RK2D 4WWIA 3RK3B 3L72G 1ZMEC 3TNUA 3L74J 1GZLA 2I1KA 4H13D 3BCCD 1X8YA 3HD7A 5KAIH 3QWOC 1SQPK 2E74C 2HODA 4HJGH 4WY4C 3L71J 5M1BA 5KLVD 1HBWA 2PGDA 2M3BA 1BE3E 4L75A 1Y47A 1VQKP 2M8RA 1IFPA 3HUSA 4H44B 3AEAC 3F89A 2XU6A 3H1KG 2H43A 2ZVOB 1RF1A 3CCEP 2Z4EA 2VRSA 2KB7P 3L36A 2BASA 3AE1C 3H1IE 1NTZD 1SQQK 1NTKJ 3EQ2A 1IZNB 1NU1D 2FFDB 1YJ9P 2K9JA 3CX5E 1BGYD 1YHQP 1SP4A 1NAYA 3G4SP 5KLIC 4YTPC 1JTHB 3FX0A 2ZFCA 3G9RA 4DZOA 5B5EE 3TDKA 1KB9D 2B9BA 3FGAD 1J1EC 1U7MA 1QEXA 3AEBC 4I7ZB 1LT1A 2L91A 3PRJA 3WMM0 3CCRP 2WMMA 1M1KQ 1N7SA 1EDLA 1VQ8P 3VTPC 3RBXA 1EDKA 2FXOA 5CHXA 2B88A 2KNCB 1FDIA 3L71E 4IFDK 3RBZA 5AVXB 3OAKA 1M8OB 5AVTB 1DEBA 3P32A 1LTJC 3ZDMA 1YQ3C 1NKZB 1R5LA 3Q5RA 1T2KC 3M9QA 2OYIC 1VF5D 1EZVI 4IFFA 4OWFA 2Q1KA 1FZCC 3MUDC 1JB0J 2R32A 1SQVG 1S4XA 1NTKE 2K88A 1JMBA 5AW0B 1HGZA 4PD4H 5TJHA 3P8MC 5APSA 5CCGC 3RK3E 3R4YA 1DIPA 1KMIZ 1URQB 1JUNA 2W6BA 2H89C 5AVQB 3E7KA 1NJIQ 5AW6B 3Q3DA 1P84I 4JF7A 5E79E 3P8CE 2D2CD 1FJKA 3FXEA 1YJNP 3C1LA 1M1JB 4EOTA 3GHGA 1RY3A 3MZWB 1K8AQ 2ZYAA 1NTMK 2ZVNB 2WPRA 5AVYB 3M0DC 2HPCA 1ZRTE 3H1HD
chains in the Genus database with same CATH topology
3A0HH 4IL6H 2AXTH 3WU2H 5B5EH 1S5LH 5B66H 5KAFH 3JCUH 4UB8H 5H2FH 3A0BH 5KAIH 3KZIH 5GTHH 4UB6H 5GTIH 5TISH 5E79H 4PJ0H
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3A0H H;  4IL6 H;  2AXT H;  3WU2 H;  5B5E H;  1S5L H;  5B66 H;  5KAF H;  3JCU H;  4UB8 H;  5H2F H;  3A0B H;  5KAI H;  3KZI H;  5GTH H;  4UB6 H;  5GTI H;  5TIS H;  5E79 H;  4PJ0 H; 
#chains in the Genus database with same CATH topology
 2WSC H;  1L4A D;  1FZE A;  1YJW P;  4D6T D;  5B66 H;  2ZT9 C;  1N86 A;  1YTZ T;  3JCU E;  2P1J A;  3VMZ A;  3T97 A;  1HH0 A;  4DT0 A;  1SLQ A;  1L2P A;  1JO5 A;  2N1T A;  2FYU J;  2C0X A;  4U3F E;  2R3C A;  4MN4 C;  1S5L E;  1HGV A;  2PRR A;  1DH3 A;  2QJK B;  1IJD B;  2WZ7 A;  2C9N Y;  2KK7 A;  1LWU C;  4HH2 A;  5KJ7 C;  3VOP A;  4OVN F;  3B5N B;  2JDI H;  2K3R A;  3L72 J;  3HE4 B;  1FOS F;  2I1J A;  1QGK B;  5KKZ B;  3W68 A;  3CXH H;  3VMA A;  3H6P A;  1LTS C;  1OZH A;  1K05 A;  3FXD A;  1GL2 D;  1SFC B;  4GOE A;  2QE7 H;  3AE4 C;  1GTW A;  4OGQ B;  1EXJ A;  3CWB J;  1IC2 A;  1VQ5 P;  1NTM D;  4EYY Q;  3H1K J;  3S9O A;  1GU5 A;  4ASV A;  3L35 A;  4UB6 E;  5K5G B;  1KC8 Q;  1VQP P;  1EZV E;  5APU A;  1RQV A;  3I55 P;  2KSJ A;  1YQ4 C;  1LJ2 A;  1NO4 A;  1H8A A;  4EIJ A;  3CCJ P;  1USD A;  1G2C A;  2FYU E;  2G8Y A;  5AW3 B;  4GT1 A;  2W8Z A;  1YI2 P;  2ZAE B;  4C7N B;  2BEQ D;  2O01 H;  2A45 G;  1GMJ A;  4WY4 A;  2Q3E A;  1YIJ P;  2KSE A;  4BRY A;  1OW8 A;  3V6I A;  3KPE A;  2AEF A;  2E76 D;  2YKP A;  1U57 A;  3L70 J;  3K5B A;  3L72 E;  3RL0 B;  2HLO A;  3EWK A;  1RE4 C;  2Q9I A;  3RK2 B;  3PH0 A;  4RES B;  3Q1M A;  1ZLL A;  3L37 A;  1PP9 J;  1PGJ A;  3N7N A;  3I56 P;  1HVV A;  1KN7 A;  2XND H;  3PHL A;  3W67 A;  3KXD A;  2RH0 A;  4H13 B;  1G1I A;  3H1H G;  2ZXX A;  3L73 G;  4W80 A;  1EDJ A;  3BRV B;  2WPV B;  1L0N E;  2O3J A;  3H1K E;  3PJS K;  3CX5 H;  3VP8 A;  3HD7 D;  5AW2 B;  3MD0 A;  1H0T A;  2JR8 A;  1ZR2 A;  3V2Q A;  3E1I A;  3TK1 A;  3TYY A;  2YNY A;  1KFN A;  3L75 J;  3VYI A;  5B5E H;  3WU2 E;  2KZJ A;  1KV4 A;  1VQM P;  1SQX D;  2IDB A;  2AXC A;  3H32 B;  2WT7 B;  2HR3 A;  1JMM A;  2G3A A;  3V2R A;  2ZYG A;  3H1J D;  1WT6 A;  1VQ4 P;  3SFE C;  2R44 A;  2M0B A;  2P7J A;  2W90 A;  1KB9 I;  3IF4 A;  2BCC G;  3V2P A;  1LTJ A;  1LT9 B;  3GMA A;  5H2F E;  3GG2 A;  5TIS E;  2ZXE B;  1HUC A;  3KQG A;  1HWT C;  1Q86 Q;  1Q7Y Q;  2OYI A;  1X0T A;  2B87 B;  2W83 C;  4PV1 C;  1CI6 B;  1FZC A;  3MUD A;  2POH A;  2FBW C;  5AVS B;  3CC2 P;  1BE3 J;  4Z1M H;  1YIT P;  1N7S D;  5BVZ A;  5CCG A;  2IBZ D;  3U1A A;  1R8E A;  4H0L D;  3H1I J;  1SQV E;  2IYO A;  1NAF A;  4UB8 H;  1HJB A;  2FYN B;  1ZR4 A;  1L0L D;  2Q5U A;  5E79 H;  5APY A;  1USE A;  1VF5 B;  2OAR A;  1JNM A;  1M90 Q;  3M0D A;  1KIL C;  2A45 I;  4L76 A;  2M5A A;  3B4S A;  4JPZ B;  1RHZ B;  2YXR B;  2IZ0 A;  2QJP B;  3MIW A;  4BWN A;  1QL2 A;  3JCU H;  4NPD A;  2D2C B;  2LXC B;  5APT A;  1S5L X;  4AYC A;  4BRY B;  1RF0 C;  2WQY C;  2JWD A;  4DJG A;  3CC7 P;  3HE5 A;  1J1D B;  3TGU G;  2J59 M;  3RK3 C;  1K9M Q;  4EI2 A;  1LWU A;  5KJ7 A;  2HFE D;  1KTM A;  2OYH C;  2P58 A;  1L4A B;  3JSV C;  1L0N G;  1HJ0 A;  1N8R Q;  1X22 A;  2W6J H;  1MFT A;  4W7Y A;  1XTC C;  3IR9 A;  2RMZ A;  5KAF E;  1SQX G;  2LKM A;  1OVV A;  4H44 C;  1NHL A;  2AEM A;  2N1T D;  1NGM B;  2YIU B;  2KS1 B;  3H1J G;  4IL6 E;  2K9Y A;  2NPS C;  1NTK K;  1KYO E;  3Q2Y A;  1UIX A;  2FFD C;  4UB6 H;  1X9V A;  1LP1 B;  1JY2 O;  3H1H J;  1GL2 B;  2KLV A;  3L73 J;  2YMK A;  1M7L A;  1IFD A;  1NOH A;  1OX3 A;  1RE3 C;  1KIL E;  1SQP D;  1Q90 D;  2QA4 P;  1S1C X;  2E75 C;  2I8D A;  4I7Z C;  4C46 A;  1DD4 A;  1KQG B;  1W2B O;  3AE7 C;  2IBZ G;  3SFD C;  3HTK A;  3PLN A;  3L74 D;  3H1L G;  4U3F J;  3NFQ A;  5AW7 B;  1KOR A;  1EQ7 A;  4A7P A;  1IK9 A;  3L71 D;  1RE4 A;  1L0L G;  4LGD E;  5APV A;  3MHV A;  3CCU P;  4GOD A;  2Z5I A;  1QLE D;  5APX A;  1SQQ D;  2LXB A;  1GK6 A;  2XNX A;  2BCC J;  1SQB G;  1VQL P;  1N73 C;  2QEX P;  1J2J B;  3M06 A;  2KP8 A;  2E76 B;  2E74 D;  5AVW B;  1FZG A;  4WY4 D;  1WRG A;  2IFN A;  3NMD A;  3H1H E;  3BCC G;  1URQ C;  3L73 E;  3U1C A;  5KLV G;  1EC5 A;  3WU2 H;  3P8C D;  1VDF A;  2XDJ A;  2E5T A;  5KTB A;  3VP9 A;  1FU1 A;  1NKN A;  3TNU B;  5GTH E;  4PD4 I;  1T3J A;  1OVU A;  2HG5 D;  1IFM A;  3HD7 B;  4R4L A;  2GA1 A;  2HOD B;  3C9I A;  1LTI C;  2UWJ E;  1FJP A;  3C8V A;  1NTZ G;  1IO4 A;  2H88 C;  1VQ6 P;  4GDO A;  1NU1 G;  3AED C;  5H2F H;  2PP6 A;  1BGY G;  3HUS B;  5TIS H;  2WSE J;  1GDT A;  5AW9 B;  4BXL A;  3D71 A;  2FKW B;  2FYU K;  1RF1 B;  2O1J A;  2SPZ A;  2BCC E;  2NZ2 A;  4B86 A;  4Y99 B;  2LR2 A;  3A2A A;  2K9J B;  1OVR A;  5GTI E;  2Q6Q A;  5CBN A;  3D6Y A;  1CW5 A;  1PGP A;  2AXT H;  3TGU J;  2JJL A;  3B5N C;  1PFI A;  3G71 P;  3CME P;  1AFO A;  5AVU B;  3V4Q A;  2R5D A;  3M0A A;  3VMX A;  1L0N J;  4M3L A;  4WVZ A;  1SQP G;  3O6Q A;  1VQ9 P;  1T2K D;  1SFC C;  3SWK A;  1KIL A;  1DD3 A;  1BSN A;  1QL1 A;  4KJM A;  3R2P A;  2QM7 A;  2R5B A;  4LC1 A;  1MFZ A;  1N7S B;  2IBZ I;  2H8P D;  4I6M C;  4OGQ C;  2KI7 B;  3KHU A;  3L74 G;  3LW5 H;  5AW8 B;  1L0N K;  1R5S A;  4N78 E;  1A02 F;  3Q5P A;  3EFG A;  5CCG D;  4H0L B;  1JY3 N;  3CXH I;  3AEF C;  1Y8A A;  2KUB A;  3V5B A;  3AE3 C;  2DW3 A;  3SWF A;  1RF0 A;  1SQQ G;  5CCH C;  1P84 E;  5C39 A;  1HTL C;  5EFW B;  1RH5 B;  1VQ7 P;  2IFM A;  2ITA A;  3KZI E;  2QRX A;  2FYU D;  2FYZ A;  3OA7 A;  2PFX A;  1PPJ D;  4ZKP A;  2OYH A;  2R3S A;  1JOC A;  3GW6 A;  1PIX A;  4ZKU A;  2V7Q H;  2Y0E A;  2ZT9 D;  3AEG C;  3TGU E;  1AVY A;  3ITK A;  2QJY B;  1Q81 Q;  3RL0 C;  5AVV B;  2OGU A;  1KQS O;  3BVH A;  2GUV A;  1AVO A;  4D6T G;  3H1L J;  3GHG B;  4K35 A;  5KAF H;  4IL6 X;  3WUT A;  3RK2 C;  2KIK A;  4PD4 D;  1JEK A;  1FZF A;  3FWN A;  3O8Z A;  4IOI H;  3WUU A;  2NPS A;  1SQV J;  1FBM A;  4IL6 H;  2HPC B;  4H13 C;  3CWB D;  1BCC D;  2YKQ A;  2FFD A;  2FXM A;  2IPP A;  5KJ7 D;  1SQX E;  1BSH A;  1KYO H;  3SWY A;  5BU5 A;  4KT0 J;  1EXI A;  2MJZ A;  1SQB J;  1ZOY C;  3H1J E;  2QG4 A;  1SQV K;  3LW5 J;  3T97 B;  2P2U A;  1X79 B;  3E1R A;  1S9K D;  1RE3 A;  3F5H A;  3JC2 2;  2N1T B;  1JY2 P;  2WSF J;  2IYP A;  2WVR A;  1A02 J;  1SQB K;  1Y9B A;  1NH4 A;  3A0B E;  3BCC J;  4JQ0 D;  2Q3I A;  3TSI A;  2YO2 A;  5KLV J;  3G6E P;  4DCK A;  2KNC A;  1FZB A;  4RO0 A;  2QVA A;  1MV8 A;  2OTL P;  3S4R A;  1M56 D;  3A7O A;  2C9L Y;  1NTM G;  3L70 D;  4K3A A;  3AE9 C;  2IBZ E;  1LT9 C;  4JBZ A;  2V7Q J;  2A45 H;  1JY2 N;  1JY3 O;  2XZR A;  3H1L E;  2A06 D;  4KHX A;  2J58 A;  1FDO A;  1N73 A;  1W5C E;  1NTZ J;  1PP9 D;  4W7Z A;  3CCQ P;  1PGO A;  1NU1 J;  1L0L E;  4ZMD A;  4C7R A;  3N4X A;  1JM0 A;  1BGY J;  3CXH D;  1AJY A;  1S2E A;  3M91 A;  2O01 N;  1AQ5 A;  4R4M A;  5AVZ B;  2KXP B;  1NTZ K;  1T8Z A;  1URQ A;  1FE6 A;  1SQB E;  3PTZ A;  1NU1 K;  1YYC A;  3AE5 C;  5APW A;  3VN0 A;  4YPC A;  1BDC A;  2FYN C;  3B71 A;  2P67 A;  1G2C B;  5AW5 B;  3LID A;  1DX7 A;  1N7L A;  2Q7C A;  3GF7 A;  3L75 D;  1CSB A;  2KOG A;  1E79 H;  1PPJ G;  1VF5 C;  3AEC C;  3BCC E;  2E74 B;  2E43 A;  5L8R J;  4WY4 B;  3BRT B;  5GTH H;  5KLV E;  3SSU A;  4CPG A;  2XV5 A;  4WB4 A;  1KQL A;  1ZW0 A;  2OYH B;  1S5L H;  3CI9 A;  2QJP C;  3QH9 A;  2D2C C;  4PJ0 E;  1IK7 A;  4DOJ A;  3U59 A;  5AW1 B;  1NTZ E;  2JO1 A;  1FDM A;  2JKV A;  3CWB G;  1BCC G;  1NU1 E;  1J1D C;  1SQQ J;  1BE3 D;  1BGY E;  4U7J A;  1WMK A;  1AQT A;  1HF9 A;  1L4A C;  5GTI H;  1M57 D;  3B5N A;  2ZJS E;  5KLI B;  3IFM A;  3AE8 C;  1H0T B;  3HE4 A;  2NPS B;  5DJT B;  2KLU A;  1KB9 E;  2KZI A;  1J1E B;  1LTG C;  3H1I D;  1SFC A;  4PV1 D;  4XE5 B;  3CPW O;  3CX5 D;  1GD2 E;  3RGU A;  5APQ A;  1ZV8 A;  2Y9Z A;  2HYN A;  4L74 A;  2YIU C;  1AA0 A;  4GKG A;  1W2E A;  2OQQ A;  2M3E A;  1N2D C;  4D6T J;  1SQP E;  3D6Z A;  2N9B A;  2E75 B;  3V4W A;  1KYO D;  2YKO A;  3CC4 P;  4O9B A;  3L70 G;  3CCL P;  3KDP B;  5CCH A;  1LTJ B;  3UIA A;  2C0W A;  4QMA A;  4GIF A;  3I5C A;  2AEJ A;  3L74 E;  1GL2 C;  2A06 G;  1XTG B;  3CCV P;  2OYI B;  1P84 H;  2CK3 H;  1PP9 G;  2WSE H;  1FZC B;  3AE6 C;  1QVF O;  1MKM A;  1UII A;  3KZI H;  1KIL D;  2Z5H A;  3CL3 D;  3PP5 A;  3BAT A;  4C7N A;  1CZQ A;  5DJU B;  1SQQ E;  2QM8 A;  2B89 A;  1FZA A;  1VL2 A;  2OYO A;  1MUU A;  3CCS P;  1H89 A;  1N73 B;  4N6J A;  1SVF A;  1FAV A;  5CBO A;  3GF3 A;  1ZN5 A;  2YXQ B;  3A0H E;  3L75 G;  1NTK D;  3P7K A;  2FXP A;  4N3Y B;  1NWQ A;  2E42 A;  2MKV A;  1NTM J;  4UB8 E;  3RK3 D;  1QX8 A;  3FWL A;  2W27 A;  2OTJ P;  1OW6 A;  3AEE C;  2M5A B;  3H25 A;  4D6T E;  1D7M A;  1LTT C;  2ZT9 B;  2E76 C;  1M1J C;  3TF5 A;  2L5G B;  2CPB A;  2Y9Y A;  4XA4 A;  5BU8 B;  3MP7 B;  1JCC A;  3USS A;  3GLM A;  3L73 D;  1ZRT D;  4H44 D;  3H32 A;  2NRG A;  2WT7 A;  3HE5 B;  1K04 A;  1BE3 G;  3D70 A;  1LWU B;  3IN6 A;  3A0B H;  2NPS D;  5KAI E;  2K37 A;  4NPE A;  1ZP0 C;  5CJ0 A;  3HD7 C;  2WSS H;  1E5W A;  4YXD C;  4U3F D;  5AVR B;  3EFF K;  1LT9 A;  3H1I G;  2P10 A;  4TT3 H;  2CPS A;  4IFM A;  3CCM P;  3OW2 O;  1SS1 A;  2QJK C;  2GM4 A;  1H88 A;  1QVG O;  2B87 A;  3HUS C;  4TLF A;  2WWW A;  1CI6 A;  2QSI A;  4AQR D;  2E75 D;  1GW3 A;  4JYB A;  1RF1 C;  1JY3 P;  1NTM E;  2BCC D;  5KKZ C;  3ABV C;  1K73 Q;  1OWA A;  3OJA B;  3WUV A;  4Y99 C;  2YMY A;  2IX7 C;  3B8E B;  3RL0 g;  1AV1 A;  1FC2 C;  2W6A A;  4XFJ A;  1IFI A;  1BCC J;  3M9B A;  4I1L A;  4NPF X;  2RKL A;  4ZNC A;  1SQX J;  4YXW H;  1NYH A;  2Y0C A;  3A3Y B;  3L71 G;  2E5Y A;  4AUW A;  2WSF H;  3H1J J;  2OTK E;  1LTA C;  2WPQ A;  1VQO P;  1EZV D;  1N7S C;  2WSC J;  3CD6 P;  3HTK B;  1SQX K;  1GK4 A;  5CJ4 A;  4N78 D;  3VMY A;  1PPJ E;  3II6 A;  1ZXG A;  4H0L C;  1KFM A;  1URQ D;  1NTK G;  3S1K A;  1MZ9 A;  1Q2N A;  1P84 D;  3AE2 C;  4LLH A;  4OH8 B;  4PJ0 H;  3L72 D;  1OXZ A;  4WBA A;  1LTB C;  1Q82 Q;  3HRN A;  1L4A A;  1KQF B;  2IZ1 A;  3CLQ A;  2K1A A;  4PD4 E;  3NTN A;  1PZQ A;  1S72 P;  1RQU A;  1PV3 A;  2BEZ F;  3NXS A;  1GU4 A;  1L0L J;  3CWB E;  2QIW A;  1YTZ I;  1BCC E;  3TGU D;  1OMI A;  1KB9 H;  2QJY C;  2WTY A;  4HYT B;  1OFC X;  1L0N D;  3Q5S A;  1KZU B;  3H1K D;  3GHG C;  1VPC A;  3CMA P;  1S9K E;  2KS1 A;  1LGH B;  3A5T A;  1L0L K;  1JTH A;  4GOF A;  1BDD A;  3G3Z A;  4HB1 A;  2FY8 A;  3V2N A;  2KYV A;  4Y28 J;  1G1J A;  4L73 A;  4U3F G;  1FS0 E;  5B66 E;  2O1K A;  2N9Y B;  3M9H A;  3KYQ A;  1LP1 A;  4HKZ H;  3B5N D;  1EDI A;  1IFN A;  1GL2 A;  4I2L C;  2WPS A;  2J5U A;  3CX5 I;  4PV1 B;  2GUS A;  1PL5 A;  4RJT A;  1SFC D;  1GW4 A;  1OW7 A;  1T6A A;  4EDF A;  4ASW A;  3L70 E;  1IFJ A;  1TU3 F;  2N1T C;  2RN0 A;  2XKM A;  3IAO A;  1LNQ A;  4RKU J;  2O01 J;  2JP3 A;  3L4F A;  1KYO I;  4OGQ D;  1JCD A;  1PGQ A;  1NVO A;  2A06 E;  3MGN A;  5KLV K;  1OIP A;  2JEE A;  1PP9 E;  2ZYD A;  3CXH E;  1U7J A;  1FOS E;  5CCH D;  5AW4 B;  2JWA A;  3A0H H;  1T3U A;  3O6Q B;  1S3J A;  2AXT E;  2V4H A;  2YO3 A;  1KIL B;  3H1L D;  3LIE A;  1EZV G;  1YBK A;  1KD1 Q;  2Y0D A;  1SQV D;  3BAS A;  3L75 E;  4JYC A;  1M1J A;  2FYU G;  1DEE G;  2H7H A;  2WIT A;  1SQB D;  3RL0 D;  1VQN P;  3MTU E;  2PAJ A;  5CMZ A;  1SQP J;  1Z56 A;  3RK2 D;  4WWI A;  3RK3 B;  3L72 G;  1ZME C;  3TNU A;  3L74 J;  1GZL A;  2I1K A;  4H13 D;  3BCC D;  1X8Y A;  3HD7 A;  5KAI H;  3QWO C;  1SQP K;  2E74 C;  2HOD A;  4HJG H;  4WY4 C;  3L71 J;  5M1B A;  5KLV D;  1HBW A;  2PGD A;  2M3B A;  1BE3 E;  4L75 A;  1Y47 A;  1VQK P;  2M8R A;  1IFP A;  3HUS A;  4H44 B;  3AEA C;  3F89 A;  2XU6 A;  3H1K G;  2H43 A;  2ZVO B;  1RF1 A;  3CCE P;  2Z4E A;  2VRS A;  2KB7 P;  3L36 A;  2BAS A;  3AE1 C;  3H1I E;  1NTZ D;  1SQQ K;  1NTK J;  3EQ2 A;  1IZN B;  1NU1 D;  2FFD B;  1YJ9 P;  2K9J A;  3CX5 E;  1BGY D;  1YHQ P;  1SP4 A;  1NAY A;  3G4S P;  5KLI C;  4YTP C;  1JTH B;  3FX0 A;  2ZFC A;  3G9R A;  4DZO A;  5B5E E;  3TDK A;  1KB9 D;  2B9B A;  3FGA D;  1J1E C;  1U7M A;  1QEX A;  3AEB C;  4I7Z B;  1LT1 A;  2L91 A;  3PRJ A;  3WMM 0;  3CCR P;  2WMM A;  1M1K Q;  1N7S A;  1EDL A;  1VQ8 P;  3VTP C;  3RBX A;  1EDK A;  2FXO A;  5CHX A;  2B88 A;  2KNC B;  1FDI A;  3L71 E;  4IFD K;  3RBZ A;  5AVX B;  3OAK A;  1M8O B;  5AVT B;  1DEB A;  3P32 A;  1LTJ C;  3ZDM A;  1YQ3 C;  1NKZ B;  1R5L A;  3Q5R A;  1T2K C;  3M9Q A;  2OYI C;  1VF5 D;  1EZV I;  4IFF A;  4OWF A;  2Q1K A;  1FZC C;  3MUD C;  1JB0 J;  2R32 A;  1SQV G;  1S4X A;  1NTK E;  2K88 A;  1JMB A;  5AW0 B;  1HGZ A;  4PD4 H;  5TJH A;  3P8M C;  5APS A;  5CCG C;  3RK3 E;  3R4Y A;  1DIP A;  1KMI Z;  1URQ B;  1JUN A;  2W6B A;  2H89 C;  5AVQ B;  3E7K A;  1NJI Q;  5AW6 B;  3Q3D A;  1P84 I;  4JF7 A;  5E79 E;  3P8C E;  2D2C D;  1FJK A;  3FXE A;  1YJN P;  3C1L A;  1M1J B;  4EOT A;  3GHG A;  1RY3 A;  3MZW B;  1K8A Q;  2ZYA A;  1NTM K;  2ZVN B;  2WPR A;  5AVY B;  3M0D C;  2HPC A;  1ZRT E;  3H1H D; 
#chains in the Genus database with same CATH homology
 3A0H H;  4IL6 H;  2AXT H;  3WU2 H;  5B5E H;  1S5L H;  5B66 H;  5KAF H;  3JCU H;  4UB8 H;  5H2F H;  3A0B H;  5KAI H;  3KZI H;  5GTH H;  4UB6 H;  5GTI H;  5TIS H;  5E79 H;  4PJ0 H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...