1CW5A

Solution structure of carnobacteriocin b2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Toxin
molecule keywords TYPE IIA BACTERIOCIN CARNOBACTERIOCIN B2
publication title Solution structure of carnobacteriocin B2 and implications for structure-activity relationships among type IIa bacteriocins from lactic acid bacteria.
pubmed doi rcsb
total genus 9
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 1999-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01721 Bacteriocin_II Class II bacteriocin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1cw5A00
1CW5A 1RY3A
chains in the Genus database with same CATH superfamily
2W90A 1YTZT 2CK3H 2KS1A 3U59A 2P1JA 1MKMA 3CXHD 5AW3B 3L75J 1SS1A 5CCGA 2OGUA 1KB9D 3KDPB 4D6TJ 3PJSK 1BGYG 2YKPA 1URQC 4XE5B 2P7JA 1VF5B 5E79E 1X22A 1G1JA 3RBZA 3TDKA 2OYHB 2BEZF 1AQ5A 2Q6QA 2QA4P 3RK3E 4DJGA 2QJPB 1JNMA 3H25A 4EYYQ 1SFCA 5AVYB 3M9HA 1AVYA 1BGYJ 2FYZA 2N9BA 2KOGA 2AXTE 1ZOYC 1FJKA 1Q2NA 3R4YA 1FDOA 1U57A 1EC5A 2SPZA 2N9YB 3C1LA 2ZT9C 3QWOC 2KS1B 1D7MA 1R5LA 1L4AC 5AVZB 3E1RA 5H2FH 2BCCE 3A0HH 1EDJA 1KYOH 1KN7A 4EI2A 3VTPC 1FS0E 3L73E 3CX5H 1UIIA 4I7ZB 5CBNA 2W6BA 1FU1A 3Q5SA 2KK7A 1YIJP 5GTIE 3Q2YA 3KHUA 3BVHA 1OFCX 2J5UA 3RK3B 3H1KD 2BCCG 1PGPA 3GF3A 4R4MA 3KZIE 1N7SD 1SFCB 2Q3IA 2WPVB 1GW4A 3PP5A 4OH8B 1FZAA 2PAJA 4PD4E 1P84I 3L73G 2LXCB 1JY3N 3P32A 3A0BE 4IL6X 1LTBC 3L37A 3R2PA 5AVQB 2QVAA 5APTA 3JCUH 3V5BA 1J2JB 1PGOA 1YHQP 1S2EA 2QJKB 2VRSA 2BCCJ 5KLVD 1Z56A 3AE5C 5B66E 3CCJP 3IR9A 2A45G 1P84D 2R3CA 3HD7D 4H44D 3A5TA 4WY4D 3F89A 2E5TA 4W80A 3L73J 1YITP 1K8AQ 4BXLA 1HWTC 3D70A 1U7JA 3L4FA 2M8RA 2P2UA 4RO0A 5AVUB 1ZMEC 2R44A 1VQNP 4XA4A 1HTLC 3HUSC 1YJWP 2HODA 5KJ7D 2A06E 1MUUA 1H88A 2YMYA 1RF0A 5M1BA 2KNCA 3OA7A 4PV1D 1M1JA 2UWJE 2FXOA 5DJTB 2KSJA 2R32A 1FZEA 1XTCC 3CCUP 5KAIH 5KKZC 2G8YA 1EXIA 2IFNA 2KUBA 4GOFA 3NMDA 4C7RA 2QSIA 2M0BA 1M57D 3RL0D 1PP9G 3GF7A 1MV8A 2M5AA 1ZRTE 3VOPA 2E75B 3CMEP 4Y99C 4RKUJ 2MKVA 4LGDE 3FWNA 5AW1B 2RN0A 5E79H 5GTHE 2GUVA 2HODB 1VQ7P 3JSVC 1PP9J 2ZYAA 2WT7A 2H8PD 1LT9C 4OGQC 2KNCB 3CXHE 4H0LC 2W83C 2GM4A 1KB9E 2M3BA 1R5SA 3AEDC 1M1JB 3G9RA 2WWWA 3H1IG 1SFCD 3FX0A 2WTYA 3B4SA 2P67A 2LKMA 2Z5HA 4ASVA 1NH4A 1OWAA 1N7SC 3L70D 3KYQA 1JOCA 4DZOA 1PPJD 2M5AB 5AW8B 1U7MA 3AE1C 4UB6E 1SQVE 4H13C 3H1IJ 1KILD 1RE4A 3M0DC 3IF4A 5AVWB 5KLVK 2H89C 2ZVOB 1BDDA 3VMAA 1K9MQ 4LC1A 3S1KA 2WSFH 4L73A 3AECC 1K04A 2OTLP 1AJYA 1VQLP 3JC22 1IFDA 2WT7B 1Y8AA 4A7PA 5B5EH 1LTJA 4ZNCA 4YXWH 3KZIH 1SQPG 1LGHB 1LTIC 1BE3D 1LT1A 2FYUD 1FC2C 2A45H 2KI7B 1MZ9A 3H1HD 1N2DC 3L74G 3H1LD 2ZJSE 1NKNA 2FKWB 3WUVA 1LJ2A 3H1KE 1VQ4P 1BSNA 1N7SA 5AW7B 2CPBA 5TISH 1SQPJ 1RF1A 2QJPC 1EXJA 2V7QJ 2ZXXA 1M90Q 2QG4A 3RGUA 1AQTA 1EDIA 3M0DA 3L74J 3H1KG 3CC7P 1NU1D 5KLVE 2O01J 3AE6C 1NTKD 3C8VA 2ITAA 3SFEC 4EIJA 3HD7A 4WY4A 3WU2H 3GLMA 4GODA 1P84E 1JY2P 1LTJB 1W2EA 2K9JA 2KLVA 1S9KD 3CC2P 5CCGC 3H1KJ 1IZNB 5KJ7A 1Q90D 3H1JG 4U3FG 5KLVG 1NVOA 4HB1A 4I7ZC 5BU8B 3SWYA 1N7SB 2FBWC 1NO4A 3GHGA 1H89A 3IN6A 1KTMA 1NGMB 3CCLP 2RKLA 3RK3C 1RF1B 2JP3A 2ZVNB 1NKZB 3MIWA 2H7HA 5APYA 3TSIA 2WSCH 1SFCC 3CMAP 1VQ5P 3VMZA 4B86A 1SQBD 5KLVJ 1FZFA 2WSEH 1HUCA 4LLHA 1CW5A 3RBXA 4ASWA 3EWKA 3HD7B 4H44B 4WY4B 5AW5B 2QJKC 3CI9A 5CCHD 1KILC 4DOJA 1S4XA 2KZIA 2K9JB 5CHXA 1NTMD 2Y9ZA 3SFDC 1NTZD 3CWBD 4OVNF 3TF5A 1YQ3C 3V2PA 4IOIH 1L0ND 2Y0CA 1DD4A 4N3YB 3MZWB 1SQQD 1ZW0A 1UIXA 2KLUA 1FBMA 1K05A 4IFMA 4DCKA 1T2KC 2WPSA 3S4RA 1DD3A 2OYOA 1BCCD 3GHGB 2YKOA 3MTUE 1W5CE 4QMAA 1FDMA 5K5GB 4PV1B 2WZ7A 5AVTB 4JQ0D 4KT0J 1VL2A 2G3AA 4ZKPA 4UB6H 1MFTA 2KXPB 4BRYA 3Q5PA 3W68A 1SQVD 2XDJA 2N1TD 5L8RJ 2D2CD 2V7QH 1OMIA 2L5GB 1S5LE 2E76B 3RL0B 1CI6A 3L70E 1JY2O 3K5BA 1PPJE 4WWIA 1OX3A 3HRNA 3NTNA 1GU4A 2E74D 1KILA 2O01H 1KILE 2Y0EA 3AEGC 1OW8A 2IZ0A 4N6JA 1S3JA 2L91A 2E75C 1KYOI 4K35A 1LTGC 1NTKK 1YTZI 1KD1Q 4MN4C 4Z1MH 1JTHA 2YO3A 1EZVI 3TGUD 3L70G 3CX5I 2NZ2A 5AW4B 1PPJG 4YXDC 1YJNP 2FFDA 4JF7A 2QJYB 1Y47A 2KSEA 5C39A 2IBZI 3EFFK 1ZN5A 4GDOA 2OYIA 1KYOD 1BE3E 1AA0A 1RF0C 1HVVA 2FYUE 4HKZH 1GZLA 2GUSA 1USDA 3H1HE 2B88A 4BRYB 1EZVD 4GIFA 2QIWA 2Q7CA 1M1JC 2B87A 3L70J 2KZJA 3H1LE 3BATA 1NYHA 1CI6B 3V6IA 2IBZD 2XNXA 3BCCD 1PFIA 3L72D 4PJ0E 1PV3A 5AW9B 2E5YA 3LW5H 1SQBK 1GMJA 1SQXD 3H6PA 2K1AA 3NXSA 1PGQA 1KILB 3H1HG 2R5BA 1KQLA 2IYPA 1R8EA 2XV5A 3I5CA 1FZCA 2LXBA 1JTHB 2QRXA 1NU1E 1PIXA 3WUUA 4BWNA 1NTKE 1FOSE 3B8EB 3FXDA 4AQRD 1RH5B 2Z4EA 2FFDB 5CCHC 1BE3J 1QGKB 2IFMA 1NTMK 3H1HJ 1VDFA 2K3RA 2NPSA 1NTZK 2ZFCA 2OYIB 3P7KA 3LIDA 1HF9A 2WVRA 1S9KE 1OIPA 1L0NK 3AEFC 3H1LJ 2OTKE 1SQQK 3Q1MA 1M56D 2JEEA 3CCVP 4JBZA 1NTKG 2B87B 3CC4P 3S9OA 2Q9IA 1CSBA 2BEQD 4L74A 5AW2B 1T6AA 1GK4A 2YXQB 1VQKP 2A06G 3U1AA 3CCSP 1IFJA 2LR2A 5CBOA 4RESB 2O3JA 1SQVK 5CMZA 2E76D 2Z5IA 3L71D 1SQBE 1NTKJ 3RL0g 4IL6E 2N1TC 1IO4A 1FZCB 2NRGA 1N86A 1RE4C 1IC2A 4NPFX 1IFNA 3T97A 5DJUB 2K88A 1IFMA 4TLFA 4L75A 5CCHA 1Q81Q 3RK2B 3NFQA 2NPSB 1JB0J 1SQBG 1G2CA 3II6A 1M8OB 3CD6P 1NTME 1L0LD 3USSA 1LTJC 1LWUA 1NTZE 3VP9A 3CWBE 1LNQA 3AE7C 1L0NE 1SQQE 1KZUB 2AXTH 3B5ND 4TT3H 1BCCE 1WMKA 2I8DA 3CPWO 4GOEA 2I1JA 1SQBJ 1DEBA 4O9BA 1JCCA 2ZYDA 1NTMG 3WMM0 1J1DB 1NTZG 4YPCA 2XU6A 1MFZA 1GL2D 2RMZA 1RF1C 1JMMA 1HGZA 5KLIC 2W6JH 1SQQG 2N1TA 2E42A 1QX8A 4K3AA 1OVVA 1YI2P 3T97B 2CPSA 1KQGB 5APSA 1SQXK 3FXEA 2PRRA 2QM7A 1NWQA 4WB4A 5AW6B 4NPDA 2FYNB 1NTMJ 3ABVC 5GTIH 1NTZJ 4DT0A 3HD7C 4H44C 1JCDA 4WY4C 1BDCA 3ITKA 2OQQA 1G2CB 4N78D 2WPQA 3AE2C 1VQ6P 1IFPA 1SQVG 1SQQJ 1BSHA 1LWUB 1XTGB 4JYBA 1IK9A 3N4XA 5APUA 2A45I 5EFWB 1LTTC 2YKQA 1URQD 2Q1KA 3TGUE 3GG2A 1M1KQ 1IFIA 4PD4H 3V2QA 4HH2A 3PTZA 5KJ7C 3A0BH 2KB7P 2I1KA 4YTPC 1KYOE 4ZMDA 5BVZA 4M3LA 3VN0A 1SQVJ 1QEXA 3GHGC 1W2BO 5BU5A 4PV1C 1EZVE 1OW6A 5B66H 2N1TB 5AVSB 3TGUG 3D71A 2D2CB 3AEBC 1E79H 3I56P 1RHZB 1GDTA 2IBZE 3BCCE 1KMIZ 4RJTA 3L72E 2E74B 2RH0A 3I55P 2ZT9D 1JY2N 2E76C 1SQXE 3RL0C 2Q5UA 1RQUA 1EZVG 2QE7H 2WITA 1T3JA 3KPEA 1NOHA 3TGUJ 3A2AA 1DEEG 3E7KA 3RK2D 1N8RQ 3JCUE 1EDKA 2AEFA 2NPSD 1DX7A 3UIAA 3MUDC 2JO1A 2C0WA 1G1IA 1AVOA 2HG5D 1SQXG 1L0LK 3A3YB 2MJZA 1SLQA 1PP9D 2QJYC 2FXMA 3AE8C 5AW0B 2R3SA 3FGAD 3EQ2A 5KLIB 2ZYGA 3AE9C 1EDLA 4L76A 1KC8Q 1KORA 1PGJA 2YIUB 3MGNA 3M91A 2J58A 1SQXJ 3O6QA 1S5LX 3KQGA 3CL3D 3BRVB 2O01N 3VYIA 2Y0DA 5GTHH 3B71A 1YQ4C 2HFED 4I6MC 1VQ9P 3L71E 4KJMA 1ZXGA 3CXHI 5KAIE 3CXHH 3AE3C 1KB9H 5APXA 1N73A 3MUDA 3H1ID 1ZR4A 2B9BA 2OTJP 2KYVA 4HJGH 3GMAA 2IDBA 1Y9BA 4GT1A 3L71G 3D6YA 2FFDC 2KIKA 1FOSF 1K73Q 3IAOA 4W7YA 1L0LE 4OWFA 3V4QA 2FYUK 1HGVA 4Y28J 1VQPP 1QVGO 2OYIC 2HPCA 3B5NA 4IFDK 1S1CX 3HTKA 5CJ4A 2FY8A 5APWA 1CZQA 1RQVA 1LTSC 3O6QB 3VMXA 3VP8A 3L71J 1JUNA 2Y9YA 1L0LG 1AFOA 1GL2A 1WRGA 4XFJA 1SQPD 5APQA 1SP4A 1N73B 1NU1K 2AEMA 4AYCA 3L35A 1FZCC 5KAFE 3L74D 1L0LJ 2IYOA 1NAYA 2XZRA 3HE5A 1JM0A 4OGQD 4N78E 3IFMA 4H0LD 1A02F 3RK2C 2JJLA 1FZBA 1ZV8A 2NPSC 1URQA 3G3ZA 1HBWA 2C0XA 2JR8A 3CCMP 2HPCB 3B5NB 1VQMP 4IFFA 1GD2E 4EDFA 3CLQA 2WMMA 3HTKB 1TU3F 3CX5D 1X79B 2W6AA 2YNYA 3CCRP 1X9VA 5B5EE 3TNUA 5AVRB 5AVXB 3V2RA 4C7NA 1IJDB 4C46A 1GL2B 1L2PA 1NAFA 3G71P 3P8CD 1AV1A 1BE3G 2FYUG 1P84H 4H13D 1J1DC 1QVFO 3N7NA 1J1EC 2AEJA 3H1LG 1JY3P 3H1JD 4U3FD 5TISE 1L4AA 3M9QA 1FDIA 3HE5B 2W8ZA 2YMKA 2FYUJ 2FYNC 2WSFJ 5KTBA 2R5DA 1QL2A 1URQB 3EFGA 1OW7A 3V2NA 3O8ZA 3L36A 3U1CA 3VMYA 1LWUC 2C9LY 2H88C 2JDIH 1NU1G 3L75D 3WU2E 3D6ZA 1GTWA 1VF5D 2AXCA 4D6TD 3AEAC 3TNUB 2JWAA 4C7NB 4W7ZA 1PP9E 3G4SP 1FJPA 1HH0A 3BRTB 1YBKA 2XKMA 1VPCA 1VQOP 1KFNA 2YO2A 2O1KA 2WSSH 1EQ7A 3GW6A 4JPZB 1E5WA 2IPPA 3M06A 1NU1J 4CPGA 3AE4C 1OVRA 2POHA 1H8AA 2ZT9B 1N7LA 2D2CC 1YYCA 2H43A 1HJ0A 1BGYD 1X0TA 1L4AB 3M9BA 1JO5A 1OZHA 1RE3C 2E74C 3OW2O 1SQPK 3G6EP 3Q3DA 1T3UA 1LP1A 3LIEA 2HLOA 1ZLLA 4NPEA 1JMBA 1JEKA 3H1IE 5CCGD 4R4LA 3FWLA 3HUSA 3V4WA 4UB8E 2YXRB 3F5HA 3MP7B 2QEXP 1M7LA 2V4HA 5AVVB 3Q5RA 2QM8A 2B89A 3SSUA 1ZR2A 2FXPA 5TJHA 2JWDA 1S5LH 3RK3D 2PFXA 1LTAC 2JKVA 3CWBG 4ZKUA 1GK6A 1JY3O 1QL1A 1L0NG 1J1EB 5CJ0A 4EOTA 1A02J 1USEA 2YIUC 2WSCJ 2OARA 2IZ1A 1BCCG 3TK1A 5KAFH 1RE3A 2WSEJ 1Q7YQ 1H0TA 1LP1B 3BASA 3CWBJ 1KV4A 1SQPE 3WUTA 2BCCD 3W67A 4KHXA 1L0NJ 4U7JA 3QH9A 1S72P 4WVZA 1IK7A 2WQYC 3MHVA 1PL5A 3HUSB 1BCCJ 3L74E 3E1IA 3L73D 4PD4I 3ZDMA 1LT9A 1FZGA 1FAVA 2PGDA 3SWKA 1PZQA 1T2KD 2HYNA 3PH0A 5H2FE 3A0HE 3OJAB 4I2LC 3HE4A 4PJ0H 2BASA 3PRJA 5KKZB 2E43A 2PP6A 3PLNA 3CX5E 2P58A 4PD4D 4HYTB 2WPRA 1T8ZA 1VF5C 3H32A 2DW3A 4WBAA 2OYHC 3TYYA 4AUWA 1HJBA 1OVUA 3P8CE 4JYCA 1KQFB 1VQ8P 1H0TB 4Y99B 1KFMA 1L4AD 2P10A 2J59M 3SWFA 1WT6A 1GW3A 1X8YA 1ZP0C 3C9IA 2E75D 2KP8A 4I1LA 2M3EA 3H1JE 4U3FE 5APVA 1N73C 2IBZG 3BCCG 1YJ9P 1DH3A 4GKGA 3KXDA 2C9NY 1KQSO 1FE6A 1LT9B 4OGQB 3L72G 2HR3A 4H0LB 1SVFA 3OAKA 2A06D 2ZAEB 2GA1A 1DIPA 3HE4B 1NJIQ 1NHLA 1Q86Q 3L75E 2IX7C 3BCCJ 3PHLA 2K9YA 3H32B 3B5NC 3L72J 4IL6H 3CCQP 4D6TE 2OYHA 1Q82Q 1OXZA 2Q3EA 3MD0A 3AEEC 1RY3A 4H13B 2W27A 2K37A 1GL2C 2ZXEB 1GU5A 2XNDH 3H1JJ 4U3FJ 1ZRTD 3L75G 3CCEP 3A7OA 3LW5J 2O1JA 1KB9I 3P8MC 1BGYE 4D6TG 1QLED 3M0AA 4UB8H
chains in the Genus database with same CATH topology
1N7SA 5CCHA 1YTZT 3TNUA 5AVRB 5AVXB 3V2RA 4C7NA 5AW7B 2CPBA 3RK2B 1IJDB 4C46A 1GL2B 3NFQA 3U59A 1NAFA 2NPSB 2P1JA 1RF1A 1G2CA 3P8CD 3II6A 5AW3B 5CCGA 1LTJC 1LWUA 3VP9A 1J1DC 3KDPB 3M0DA 2YKPA 1URQC 3N7NA 4XE5B 1J1EC 2P7JA 1KZUB 1G1JA 1JY3P 3B5ND 2OYHB 1L4AA 3M9QA 4EIJA 1AQ5A 3HD7A 2I1JA 4WY4A 3HE5B 1DEBA 4O9BA 1JCCA 1JNMA 1JY2P 1SFCA 1LTJB 5KTBA 2R5DA 3WMM0 1J1DB 1QL2A 2XU6A 1MFZA 5AVYB 1GL2D 1RF1C 3M9HA 1W2EA 1URQB 1JMMA 3EFGA 1HGZA 2FYZA 2N9BA 3V2NA 2KLVA 1S9KD 2KOGA 3O8ZA 3L36A 3U1CA 2N1TA 5CCGC 3VMYA 2E42A 1FJKA 1LWUC 2C9LY 5KJ7A 2CPSA 5APSA 1GTWA 1SQXK 2QM7A 1NWQA 5BU8B 3SWYA 4WB4A 1N7SB 5AW6B 1NO4A 3TNUB 3GHGA 4C7NB 1H89A 4W7ZA 1L4AC 1FJPA 5AVZB 1HH0A 3BRTB 3HD7C 3RK3C 1JCDA 1RF1B 4WY4C 2XKMA 1NKZB 3MIWA 1G2CB 4N78D 2H7HA 2WPQA 5APYA 1VPCA 1KFNA 3TSIA 2WSCH 2YO2A 2O1KA 1SFCC 1LWUB 1XTGB 1EQ7A 3VTPC 3VMZA 4JYBA 1IK9A 1E5WA 4B86A 2IPPA 3N4XA 3M06A 1FZFA 5APUA 2A45I 2WSEH 1LTTC 2YKQA 1URQD 2POHA 1H8AA 1N7LA 2W6BA 1IFIA 3V2QA 1YYCA 1FU1A 2H43A 1HUCA 4HH2A 5KJ7C 4LLHA 1CW5A 3BVHA 1L4AB 2KB7P 3HD7B 3RK3B 3M9BA 4WY4B 5AW5B 1RE3C 1JO5A 2I1KA 1SQPK 3CI9A 5BVZA 4M3LA 3VN0A 3GHGC 1N7SD 5CCHD 1T3UA 3LIEA 1SFCB 1KILC 2HLOA 2Q3IA 4DOJA 5BU5A 1ZLLA 1GW4A 3PP5A 4OH8B 1FZAA 5CHXA 2PAJA 2N1TB 5AVSB 1JY3N 3P32A 5CCGD 3V2PA 1LTBC 3L37A 3HUSA 3R2PA 4N3YB 5AVQB 3V4WA 1GDTA 5APTA 3V5BA 1FBMA 1J2JB 4IFMA 1M7LA 5AVVB 2VRSA 1T2KC 2WPSA 2QM8A 1JY2N 1Z56A 3GHGB 1ZR2A 3RL0C 2Q5UA 2YKOA 3MTUE 1FDMA 2WZ7A 3IR9A 2A45G 2R3CA 3HD7D 3RK3D 2WITA 3A5TA 4WY4D 5AVTB 1T3JA 3KPEA 1NOHA 1LTAC 4W80A 3A2AA 4ZKPA 3RK2D 1HWTC 4ZKUA 1GK6A 1JY3O 1QL1A 2NPSD 3L4FA 1DX7A 1J1EB 2M8RA 3UIAA 2P2UA 5CJ0A 4EOTA 1A02J 2XDJA 5AVUB 2N1TD 2C0WA 1G1IA 4XA4A 2OARA 2L5GB 1HTLC 3RL0B 2HG5D 3HUSC 1CI6A 2HODA 5KJ7D 3TK1A 1JY2O 1MUUA 1L0LK 1H88A 1RE3A 2YMYA 3HRNA 1RF0A 3A3YB 3NTNA 1GU4A 1KILA 2MJZA 1SLQA 2FXMA 2O01H 3BASA 5AW0B 4N6JA 3EQ2A 3OA7A 4KHXA 1M1JA 2KSJA 2R32A 1LTGC 1NTKK 1FZEA 1YTZI 1XTCC 3MGNA 1JTHA 3HUSB 3M91A 2YO3A 2J58A 3E1IA 2IFNA 5AW4B 1LT9A 3KQGA 1FZGA 3CL3D 3NMDA 4JF7A 4C7RA 1FAVA 2FFDA 1T2KD 3BRVB 2HYNA 3VYIA 3RL0D 2HFED 4I6MC 1ZN5A 2OYIA 3OJAB 4I2LC 3HE4A 1MV8A 3VOPA 1RF0C 1HVVA 2BASA 1GZLA 2GUSA 4Y99C 2E43A 2PP6A 5APXA 4LGDE 4GIFA 2Q7CA 1N73A 3MUDA 1M1JC 4HYTB 5AW1B 2WPRA 1ZR4A 1T8ZA 3H32A 3BATA 4WBAA 2KYVA 2OYHC 1CI6B 2GUVA 2HODB 2XNXA 3TYYA 1PFIA 2WT7A 2H8PD 4GT1A 5AW9B 1LT9C 4AUWA 1HJBA 3LW5H 2FFDC 3P8CE 1FOSF 4JYCA 1SQBK 4W7YA 3H6PA 2GM4A 3NXSA 1KILB 4Y99B 3V4QA 2FYUK 2M3BA 1HGVA 1KFMA 1L4AD 2OYIC 2R5BA 2J59M 3SWFA 1WT6A 1KQLA 1GW3A 1M1JB 1X8YA 2WWWA 3C9IA 2KP8A 4I1LA 2XV5A 3B5NA 2HPCA 3I5CA 1FZCA 4IFDK 1SFCD 3HTKA 1JTHB 5CJ4A 2WTYA 2P67A 5APVA 5APWA 1FOSE 1N73C 1CZQA 3B8EB 1DH3A 1LTSC 4GKGA 2LKMA 2C9NY 3VMXA 1LT9B 4AQRD 2Z5HA 3VP8A 2Z4EA 2FFDB 1NH4A 1OWAA 1N7SC 5CCHC 1SVFA 3OAKA 1JUNA 3KYQA 1AFOA 1JOCA 2IFMA 1GL2A 1NTMK 1VDFA 4DZOA 2NPSA 1NTZK 2ZFCA 2OYIB 3HE4B 3P7KA 5AW8B 3LIDA 1S9KE 1L0NK 1NHLA 1WRGA 1SQQK 1KILD 5APQA 1RE4A 2JEEA 3M0DC 1SP4A 5AVWB 1N73B 5KLVK 1NU1K 2IX7C 4AYCA 4LC1A 3H32B 3B5NC 3L35A 1FZCC 2WSFH 2Q9IA 1CSBA 2OYHA 5AW2B 1GK4A 1OXZA 3MD0A 1IFDA 2WT7B 2XZRA 3U1AA 3HE5A 1IFJA 4N78E 1RY3A 3IFMA 4RESB 1A02F 1LTJA 1SQVK 3RK2C 5CMZA 2W27A 1GL2C 2JJLA 1FZBA 1ZV8A 2ZXEB 1GU5A 2NPSC 1LGHB 2Z5IA 1URQA 1LTIC 3G3ZA 1HBWA 2C0XA 2A45H 1MZ9A 2N1TC 3A7OA 2HPCB 2O1JA 3B5NB 1IO4A 1FZCB 4IFFA 1GD2E 3P8MC 1N86A 3CLQA 1RE4C 1IC2A 3HTKB 1IFNA 3T97A 1X79B 1N2DC 2W6AA 3M0AA 2YNYA 1IFMA 1NKNA 2FKWB 1X9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CW5 A;  1RY3 A; 
#chains in the Genus database with same CATH topology
 2W90 A;  1YTZ T;  2CK3 H;  2KS1 A;  3U59 A;  2P1J A;  1MKM A;  3CXH D;  5AW3 B;  3L75 J;  1SS1 A;  5CCG A;  2OGU A;  1KB9 D;  3KDP B;  4D6T J;  3PJS K;  1BGY G;  2YKP A;  1URQ C;  4XE5 B;  2P7J A;  1VF5 B;  5E79 E;  1X22 A;  1G1J A;  3RBZ A;  3TDK A;  2OYH B;  2BEZ F;  1AQ5 A;  2Q6Q A;  2QA4 P;  3RK3 E;  4DJG A;  2QJP B;  1JNM A;  3H25 A;  4EYY Q;  1SFC A;  5AVY B;  3M9H A;  1AVY A;  1BGY J;  2FYZ A;  2N9B A;  2KOG A;  2AXT E;  1ZOY C;  1FJK A;  1Q2N A;  3R4Y A;  1FDO A;  1U57 A;  1EC5 A;  2SPZ A;  2N9Y B;  3C1L A;  2ZT9 C;  3QWO C;  2KS1 B;  1D7M A;  1R5L A;  1L4A C;  5AVZ B;  3E1R A;  5H2F H;  2BCC E;  3A0H H;  1EDJ A;  1KYO H;  1KN7 A;  4EI2 A;  3VTP C;  1FS0 E;  3L73 E;  3CX5 H;  1UII A;  4I7Z B;  5CBN A;  2W6B A;  1FU1 A;  3Q5S A;  2KK7 A;  1YIJ P;  5GTI E;  3Q2Y A;  3KHU A;  3BVH A;  1OFC X;  2J5U A;  3RK3 B;  3H1K D;  2BCC G;  1PGP A;  3GF3 A;  4R4M A;  3KZI E;  1N7S D;  1SFC B;  2Q3I A;  2WPV B;  1GW4 A;  3PP5 A;  4OH8 B;  1FZA A;  2PAJ A;  4PD4 E;  1P84 I;  3L73 G;  2LXC B;  1JY3 N;  3P32 A;  3A0B E;  4IL6 X;  1LTB C;  3L37 A;  3R2P A;  5AVQ B;  2QVA A;  5APT A;  3JCU H;  3V5B A;  1J2J B;  1PGO A;  1YHQ P;  1S2E A;  2QJK B;  2VRS A;  2BCC J;  5KLV D;  1Z56 A;  3AE5 C;  5B66 E;  3CCJ P;  3IR9 A;  2A45 G;  1P84 D;  2R3C A;  3HD7 D;  4H44 D;  3A5T A;  4WY4 D;  3F89 A;  2E5T A;  4W80 A;  3L73 J;  1YIT P;  1K8A Q;  4BXL A;  1HWT C;  3D70 A;  1U7J A;  3L4F A;  2M8R A;  2P2U A;  4RO0 A;  5AVU B;  1ZME C;  2R44 A;  1VQN P;  4XA4 A;  1HTL C;  3HUS C;  1YJW P;  2HOD A;  5KJ7 D;  2A06 E;  1MUU A;  1H88 A;  2YMY A;  1RF0 A;  5M1B A;  2KNC A;  3OA7 A;  4PV1 D;  1M1J A;  2UWJ E;  2FXO A;  5DJT B;  2KSJ A;  2R32 A;  1FZE A;  1XTC C;  3CCU P;  5KAI H;  5KKZ C;  2G8Y A;  1EXI A;  2IFN A;  2KUB A;  4GOF A;  3NMD A;  4C7R A;  2QSI A;  2M0B A;  1M57 D;  3RL0 D;  1PP9 G;  3GF7 A;  1MV8 A;  2M5A A;  1ZRT E;  3VOP A;  2E75 B;  3CME P;  4Y99 C;  4RKU J;  2MKV A;  4LGD E;  3FWN A;  5AW1 B;  2RN0 A;  5E79 H;  5GTH E;  2GUV A;  2HOD B;  1VQ7 P;  3JSV C;  1PP9 J;  2ZYA A;  2WT7 A;  2H8P D;  1LT9 C;  4OGQ C;  2KNC B;  3CXH E;  4H0L C;  2W83 C;  2GM4 A;  1KB9 E;  2M3B A;  1R5S A;  3AED C;  1M1J B;  3G9R A;  2WWW A;  3H1I G;  1SFC D;  3FX0 A;  2WTY A;  3B4S A;  2P67 A;  2LKM A;  2Z5H A;  4ASV A;  1NH4 A;  1OWA A;  1N7S C;  3L70 D;  3KYQ A;  1JOC A;  4DZO A;  1PPJ D;  2M5A B;  5AW8 B;  1U7M A;  3AE1 C;  4UB6 E;  1SQV E;  4H13 C;  3H1I J;  1KIL D;  1RE4 A;  3M0D C;  3IF4 A;  5AVW B;  5KLV K;  2H89 C;  2ZVO B;  1BDD A;  3VMA A;  1K9M Q;  4LC1 A;  3S1K A;  2WSF H;  4L73 A;  3AEC C;  1K04 A;  2OTL P;  1AJY A;  1VQL P;  3JC2 2;  1IFD A;  2WT7 B;  1Y8A A;  4A7P A;  5B5E H;  1LTJ A;  4ZNC A;  4YXW H;  3KZI H;  1SQP G;  1LGH B;  1LTI C;  1BE3 D;  1LT1 A;  2FYU D;  1FC2 C;  2A45 H;  2KI7 B;  1MZ9 A;  3H1H D;  1N2D C;  3L74 G;  3H1L D;  2ZJS E;  1NKN A;  2FKW B;  3WUV A;  1LJ2 A;  3H1K E;  1VQ4 P;  1BSN A;  1N7S A;  5AW7 B;  2CPB A;  5TIS H;  1SQP J;  1RF1 A;  2QJP C;  1EXJ A;  2V7Q J;  2ZXX A;  1M90 Q;  2QG4 A;  3RGU A;  1AQT A;  1EDI A;  3M0D A;  3L74 J;  3H1K G;  3CC7 P;  1NU1 D;  5KLV E;  2O01 J;  3AE6 C;  1NTK D;  3C8V A;  2ITA A;  3SFE C;  4EIJ A;  3HD7 A;  4WY4 A;  3WU2 H;  3GLM A;  4GOD A;  1P84 E;  1JY2 P;  1LTJ B;  1W2E A;  2K9J A;  2KLV A;  1S9K D;  3CC2 P;  5CCG C;  3H1K J;  1IZN B;  5KJ7 A;  1Q90 D;  3H1J G;  4U3F G;  5KLV G;  1NVO A;  4HB1 A;  4I7Z C;  5BU8 B;  3SWY A;  1N7S B;  2FBW C;  1NO4 A;  3GHG A;  1H89 A;  3IN6 A;  1KTM A;  1NGM B;  3CCL P;  2RKL A;  3RK3 C;  1RF1 B;  2JP3 A;  2ZVN B;  1NKZ B;  3MIW A;  2H7H A;  5APY A;  3TSI A;  2WSC H;  1SFC C;  3CMA P;  1VQ5 P;  3VMZ A;  4B86 A;  1SQB D;  5KLV J;  1FZF A;  2WSE H;  1HUC A;  4LLH A;  1CW5 A;  3RBX A;  4ASW A;  3EWK A;  3HD7 B;  4H44 B;  4WY4 B;  5AW5 B;  2QJK C;  3CI9 A;  5CCH D;  1KIL C;  4DOJ A;  1S4X A;  2KZI A;  2K9J B;  5CHX A;  1NTM D;  2Y9Z A;  3SFD C;  1NTZ D;  3CWB D;  4OVN F;  3TF5 A;  1YQ3 C;  3V2P A;  4IOI H;  1L0N D;  2Y0C A;  1DD4 A;  4N3Y B;  3MZW B;  1SQQ D;  1ZW0 A;  1UIX A;  2KLU A;  1FBM A;  1K05 A;  4IFM A;  4DCK A;  1T2K C;  2WPS A;  3S4R A;  1DD3 A;  2OYO A;  1BCC D;  3GHG B;  2YKO A;  3MTU E;  1W5C E;  4QMA A;  1FDM A;  5K5G B;  4PV1 B;  2WZ7 A;  5AVT B;  4JQ0 D;  4KT0 J;  1VL2 A;  2G3A A;  4ZKP A;  4UB6 H;  1MFT A;  2KXP B;  4BRY A;  3Q5P A;  3W68 A;  1SQV D;  2XDJ A;  2N1T D;  5L8R J;  2D2C D;  2V7Q H;  1OMI A;  2L5G B;  1S5L E;  2E76 B;  3RL0 B;  1CI6 A;  3L70 E;  1JY2 O;  3K5B A;  1PPJ E;  4WWI A;  1OX3 A;  3HRN A;  3NTN A;  1GU4 A;  2E74 D;  1KIL A;  2O01 H;  1KIL E;  2Y0E A;  3AEG C;  1OW8 A;  2IZ0 A;  4N6J A;  1S3J A;  2L91 A;  2E75 C;  1KYO I;  4K35 A;  1LTG C;  1NTK K;  1YTZ I;  1KD1 Q;  4MN4 C;  4Z1M H;  1JTH A;  2YO3 A;  1EZV I;  3TGU D;  3L70 G;  3CX5 I;  2NZ2 A;  5AW4 B;  1PPJ G;  4YXD C;  1YJN P;  2FFD A;  4JF7 A;  2QJY B;  1Y47 A;  2KSE A;  5C39 A;  2IBZ I;  3EFF K;  1ZN5 A;  4GDO A;  2OYI A;  1KYO D;  1BE3 E;  1AA0 A;  1RF0 C;  1HVV A;  2FYU E;  4HKZ H;  1GZL A;  2GUS A;  1USD A;  3H1H E;  2B88 A;  4BRY B;  1EZV D;  4GIF A;  2QIW A;  2Q7C A;  1M1J C;  2B87 A;  3L70 J;  2KZJ A;  3H1L E;  3BAT A;  1NYH A;  1CI6 B;  3V6I A;  2IBZ D;  2XNX A;  3BCC D;  1PFI A;  3L72 D;  4PJ0 E;  1PV3 A;  5AW9 B;  2E5Y A;  3LW5 H;  1SQB K;  1GMJ A;  1SQX D;  3H6P A;  2K1A A;  3NXS A;  1PGQ A;  1KIL B;  3H1H G;  2R5B A;  1KQL A;  2IYP A;  1R8E A;  2XV5 A;  3I5C A;  1FZC A;  2LXB A;  1JTH B;  2QRX A;  1NU1 E;  1PIX A;  3WUU A;  4BWN A;  1NTK E;  1FOS E;  3B8E B;  3FXD A;  4AQR D;  1RH5 B;  2Z4E A;  2FFD B;  5CCH C;  1BE3 J;  1QGK B;  2IFM A;  1NTM K;  3H1H J;  1VDF A;  2K3R A;  2NPS A;  1NTZ K;  2ZFC A;  2OYI B;  3P7K A;  3LID A;  1HF9 A;  2WVR A;  1S9K E;  1OIP A;  1L0N K;  3AEF C;  3H1L J;  2OTK E;  1SQQ K;  3Q1M A;  1M56 D;  2JEE A;  3CCV P;  4JBZ A;  1NTK G;  2B87 B;  3CC4 P;  3S9O A;  2Q9I A;  1CSB A;  2BEQ D;  4L74 A;  5AW2 B;  1T6A A;  1GK4 A;  2YXQ B;  1VQK P;  2A06 G;  3U1A A;  3CCS P;  1IFJ A;  2LR2 A;  5CBO A;  4RES B;  2O3J A;  1SQV K;  5CMZ A;  2E76 D;  2Z5I A;  3L71 D;  1SQB E;  1NTK J;  3RL0 g;  4IL6 E;  2N1T C;  1IO4 A;  1FZC B;  2NRG A;  1N86 A;  1RE4 C;  1IC2 A;  4NPF X;  1IFN A;  3T97 A;  5DJU B;  2K88 A;  1IFM A;  4TLF A;  4L75 A;  5CCH A;  1Q81 Q;  3RK2 B;  3NFQ A;  2NPS B;  1JB0 J;  1SQB G;  1G2C A;  3II6 A;  1M8O B;  3CD6 P;  1NTM E;  1L0L D;  3USS A;  1LTJ C;  1LWU A;  1NTZ E;  3VP9 A;  3CWB E;  1LNQ A;  3AE7 C;  1L0N E;  1SQQ E;  1KZU B;  2AXT H;  3B5N D;  4TT3 H;  1BCC E;  1WMK A;  2I8D A;  3CPW O;  4GOE A;  2I1J A;  1SQB J;  1DEB A;  4O9B A;  1JCC A;  2ZYD A;  1NTM G;  3WMM 0;  1J1D B;  1NTZ G;  4YPC A;  2XU6 A;  1MFZ A;  1GL2 D;  2RMZ A;  1RF1 C;  1JMM A;  1HGZ A;  5KLI C;  2W6J H;  1SQQ G;  2N1T A;  2E42 A;  1QX8 A;  4K3A A;  1OVV A;  1YI2 P;  3T97 B;  2CPS A;  1KQG B;  5APS A;  1SQX K;  3FXE A;  2PRR A;  2QM7 A;  1NWQ A;  4WB4 A;  5AW6 B;  4NPD A;  2FYN B;  1NTM J;  3ABV C;  5GTI H;  1NTZ J;  4DT0 A;  3HD7 C;  4H44 C;  1JCD A;  4WY4 C;  1BDC A;  3ITK A;  2OQQ A;  1G2C B;  4N78 D;  2WPQ A;  3AE2 C;  1VQ6 P;  1IFP A;  1SQV G;  1SQQ J;  1BSH A;  1LWU B;  1XTG B;  4JYB A;  1IK9 A;  3N4X A;  5APU A;  2A45 I;  5EFW B;  1LTT C;  2YKQ A;  1URQ D;  2Q1K A;  3TGU E;  3GG2 A;  1M1K Q;  1IFI A;  4PD4 H;  3V2Q A;  4HH2 A;  3PTZ A;  5KJ7 C;  3A0B H;  2KB7 P;  2I1K A;  4YTP C;  1KYO E;  4ZMD A;  5BVZ A;  4M3L A;  3VN0 A;  1SQV J;  1QEX A;  3GHG C;  1W2B O;  5BU5 A;  4PV1 C;  1EZV E;  1OW6 A;  5B66 H;  2N1T B;  5AVS B;  3TGU G;  3D71 A;  2D2C B;  3AEB C;  1E79 H;  3I56 P;  1RHZ B;  1GDT A;  2IBZ E;  3BCC E;  1KMI Z;  4RJT A;  3L72 E;  2E74 B;  2RH0 A;  3I55 P;  2ZT9 D;  1JY2 N;  2E76 C;  1SQX E;  3RL0 C;  2Q5U A;  1RQU A;  1EZV G;  2QE7 H;  2WIT A;  1T3J A;  3KPE A;  1NOH A;  3TGU J;  3A2A A;  1DEE G;  3E7K A;  3RK2 D;  1N8R Q;  3JCU E;  1EDK A;  2AEF A;  2NPS D;  1DX7 A;  3UIA A;  3MUD C;  2JO1 A;  2C0W A;  1G1I A;  1AVO A;  2HG5 D;  1SQX G;  1L0L K;  3A3Y B;  2MJZ A;  1SLQ A;  1PP9 D;  2QJY C;  2FXM A;  3AE8 C;  5AW0 B;  2R3S A;  3FGA D;  3EQ2 A;  5KLI B;  2ZYG A;  3AE9 C;  1EDL A;  4L76 A;  1KC8 Q;  1KOR A;  1PGJ A;  2YIU B;  3MGN A;  3M91 A;  2J58 A;  1SQX J;  3O6Q A;  1S5L X;  3KQG A;  3CL3 D;  3BRV B;  2O01 N;  3VYI A;  2Y0D A;  5GTH H;  3B71 A;  1YQ4 C;  2HFE D;  4I6M C;  1VQ9 P;  3L71 E;  4KJM A;  1ZXG A;  3CXH I;  5KAI E;  3CXH H;  3AE3 C;  1KB9 H;  5APX A;  1N73 A;  3MUD A;  3H1I D;  1ZR4 A;  2B9B A;  2OTJ P;  2KYV A;  4HJG H;  3GMA A;  2IDB A;  1Y9B A;  4GT1 A;  3L71 G;  3D6Y A;  2FFD C;  2KIK A;  1FOS F;  1K73 Q;  3IAO A;  4W7Y A;  1L0L E;  4OWF A;  3V4Q A;  2FYU K;  1HGV A;  4Y28 J;  1VQP P;  1QVG O;  2OYI C;  2HPC A;  3B5N A;  4IFD K;  1S1C X;  3HTK A;  5CJ4 A;  2FY8 A;  5APW A;  1CZQ A;  1RQV A;  1LTS C;  3O6Q B;  3VMX A;  3VP8 A;  3L71 J;  1JUN A;  2Y9Y A;  1L0L G;  1AFO A;  1GL2 A;  1WRG A;  4XFJ A;  1SQP D;  5APQ A;  1SP4 A;  1N73 B;  1NU1 K;  2AEM A;  4AYC A;  3L35 A;  1FZC C;  5KAF E;  3L74 D;  1L0L J;  2IYO A;  1NAY A;  2XZR A;  3HE5 A;  1JM0 A;  4OGQ D;  4N78 E;  3IFM A;  4H0L D;  1A02 F;  3RK2 C;  2JJL A;  1FZB A;  1ZV8 A;  2NPS C;  1URQ A;  3G3Z A;  1HBW A;  2C0X A;  2JR8 A;  3CCM P;  2HPC B;  3B5N B;  1VQM P;  4IFF A;  1GD2 E;  4EDF A;  3CLQ A;  2WMM A;  3HTK B;  1TU3 F;  3CX5 D;  1X79 B;  2W6A A;  2YNY A;  3CCR P;  1X9V A;  5B5E E;  3TNU A;  5AVR B;  5AVX B;  3V2R A;  4C7N A;  1IJD B;  4C46 A;  1GL2 B;  1L2P A;  1NAF A;  3G71 P;  3P8C D;  1AV1 A;  1BE3 G;  2FYU G;  1P84 H;  4H13 D;  1J1D C;  1QVF O;  3N7N A;  1J1E C;  2AEJ A;  3H1L G;  1JY3 P;  3H1J D;  4U3F D;  5TIS E;  1L4A A;  3M9Q A;  1FDI A;  3HE5 B;  2W8Z A;  2YMK A;  2FYU J;  2FYN C;  2WSF J;  5KTB A;  2R5D A;  1QL2 A;  1URQ B;  3EFG A;  1OW7 A;  3V2N A;  3O8Z A;  3L36 A;  3U1C A;  3VMY A;  1LWU C;  2C9L Y;  2H88 C;  2JDI H;  1NU1 G;  3L75 D;  3WU2 E;  3D6Z A;  1GTW A;  1VF5 D;  2AXC A;  4D6T D;  3AEA C;  3TNU B;  2JWA A;  4C7N B;  4W7Z A;  1PP9 E;  3G4S P;  1FJP A;  1HH0 A;  3BRT B;  1YBK A;  2XKM A;  1VPC A;  1VQO P;  1KFN A;  2YO2 A;  2O1K A;  2WSS H;  1EQ7 A;  3GW6 A;  4JPZ B;  1E5W A;  2IPP A;  3M06 A;  1NU1 J;  4CPG A;  3AE4 C;  1OVR A;  2POH A;  1H8A A;  2ZT9 B;  1N7L A;  2D2C C;  1YYC A;  2H43 A;  1HJ0 A;  1BGY D;  1X0T A;  1L4A B;  3M9B A;  1JO5 A;  1OZH A;  1RE3 C;  2E74 C;  3OW2 O;  1SQP K;  3G6E P;  3Q3D A;  1T3U A;  1LP1 A;  3LIE A;  2HLO A;  1ZLL A;  4NPE A;  1JMB A;  1JEK A;  3H1I E;  5CCG D;  4R4L A;  3FWL A;  3HUS A;  3V4W A;  4UB8 E;  2YXR B;  3F5H A;  3MP7 B;  2QEX P;  1M7L A;  2V4H A;  5AVV B;  3Q5R A;  2QM8 A;  2B89 A;  3SSU A;  1ZR2 A;  2FXP A;  5TJH A;  2JWD A;  1S5L H;  3RK3 D;  2PFX A;  1LTA C;  2JKV A;  3CWB G;  4ZKU A;  1GK6 A;  1JY3 O;  1QL1 A;  1L0N G;  1J1E B;  5CJ0 A;  4EOT A;  1A02 J;  1USE A;  2YIU C;  2WSC J;  2OAR A;  2IZ1 A;  1BCC G;  3TK1 A;  5KAF H;  1RE3 A;  2WSE J;  1Q7Y Q;  1H0T A;  1LP1 B;  3BAS A;  3CWB J;  1KV4 A;  1SQP E;  3WUT A;  2BCC D;  3W67 A;  4KHX A;  1L0N J;  4U7J A;  3QH9 A;  1S72 P;  4WVZ A;  1IK7 A;  2WQY C;  3MHV A;  1PL5 A;  3HUS B;  1BCC J;  3L74 E;  3E1I A;  3L73 D;  4PD4 I;  3ZDM A;  1LT9 A;  1FZG A;  1FAV A;  2PGD A;  3SWK A;  1PZQ A;  1T2K D;  2HYN A;  3PH0 A;  5H2F E;  3A0H E;  3OJA B;  4I2L C;  3HE4 A;  4PJ0 H;  2BAS A;  3PRJ A;  5KKZ B;  2E43 A;  2PP6 A;  3PLN A;  3CX5 E;  2P58 A;  4PD4 D;  4HYT B;  2WPR A;  1T8Z A;  1VF5 C;  3H32 A;  2DW3 A;  4WBA A;  2OYH C;  3TYY A;  4AUW A;  1HJB A;  1OVU A;  3P8C E;  4JYC A;  1KQF B;  1VQ8 P;  1H0T B;  4Y99 B;  1KFM A;  1L4A D;  2P10 A;  2J59 M;  3SWF A;  1WT6 A;  1GW3 A;  1X8Y A;  1ZP0 C;  3C9I A;  2E75 D;  2KP8 A;  4I1L A;  2M3E A;  3H1J E;  4U3F E;  5APV A;  1N73 C;  2IBZ G;  3BCC G;  1YJ9 P;  1DH3 A;  4GKG A;  3KXD A;  2C9N Y;  1KQS O;  1FE6 A;  1LT9 B;  4OGQ B;  3L72 G;  2HR3 A;  4H0L B;  1SVF A;  3OAK A;  2A06 D;  2ZAE B;  2GA1 A;  1DIP A;  3HE4 B;  1NJI Q;  1NHL A;  1Q86 Q;  3L75 E;  2IX7 C;  3BCC J;  3PHL A;  2K9Y A;  3H32 B;  3B5N C;  3L72 J;  4IL6 H;  3CCQ P;  4D6T E;  2OYH A;  1Q82 Q;  1OXZ A;  2Q3E A;  3MD0 A;  3AEE C;  1RY3 A;  4H13 B;  2W27 A;  2K37 A;  1GL2 C;  2ZXE B;  1GU5 A;  2XND H;  3H1J J;  4U3F J;  1ZRT D;  3L75 G;  3CCE P;  3A7O A;  3LW5 J;  2O1J A;  1KB9 I;  3P8M C;  1BGY E;  4D6T G;  1QLE D;  3M0A A;  4UB8 H; 
#chains in the Genus database with same CATH homology
 1N7S A;  5CCH A;  1YTZ T;  3TNU A;  5AVR B;  5AVX B;  3V2R A;  4C7N A;  5AW7 B;  2CPB A;  3RK2 B;  1IJD B;  4C46 A;  1GL2 B;  3NFQ A;  3U59 A;  1NAF A;  2NPS B;  2P1J A;  1RF1 A;  1G2C A;  3P8C D;  3II6 A;  5AW3 B;  5CCG A;  1LTJ C;  1LWU A;  3VP9 A;  1J1D C;  3KDP B;  3M0D A;  2YKP A;  1URQ C;  3N7N A;  4XE5 B;  1J1E C;  2P7J A;  1KZU B;  1G1J A;  1JY3 P;  3B5N D;  2OYH B;  1L4A A;  3M9Q A;  4EIJ A;  1AQ5 A;  3HD7 A;  2I1J A;  4WY4 A;  3HE5 B;  1DEB A;  4O9B A;  1JCC A;  1JNM A;  1JY2 P;  1SFC A;  1LTJ B;  5KTB A;  2R5D A;  3WMM 0;  1J1D B;  1QL2 A;  2XU6 A;  1MFZ A;  5AVY B;  1GL2 D;  1RF1 C;  3M9H A;  1W2E A;  1URQ B;  1JMM A;  3EFG A;  1HGZ A;  2FYZ A;  2N9B A;  3V2N A;  2KLV A;  1S9K D;  2KOG A;  3O8Z A;  3L36 A;  3U1C A;  2N1T A;  5CCG C;  3VMY A;  2E42 A;  1FJK A;  1LWU C;  2C9L Y;  5KJ7 A;  2CPS A;  5APS A;  1GTW A;  1SQX K;  2QM7 A;  1NWQ A;  5BU8 B;  3SWY A;  4WB4 A;  1N7S B;  5AW6 B;  1NO4 A;  3TNU B;  3GHG A;  4C7N B;  1H89 A;  4W7Z A;  1L4A C;  1FJP A;  5AVZ B;  1HH0 A;  3BRT B;  3HD7 C;  3RK3 C;  1JCD A;  1RF1 B;  4WY4 C;  2XKM A;  1NKZ B;  3MIW A;  1G2C B;  4N78 D;  2H7H A;  2WPQ A;  5APY A;  1VPC A;  1KFN A;  3TSI A;  2WSC H;  2YO2 A;  2O1K A;  1SFC C;  1LWU B;  1XTG B;  1EQ7 A;  3VTP C;  3VMZ A;  4JYB A;  1IK9 A;  1E5W A;  4B86 A;  2IPP A;  3N4X A;  3M06 A;  1FZF A;  5APU A;  2A45 I;  2WSE H;  1LTT C;  2YKQ A;  1URQ D;  2POH A;  1H8A A;  1N7L A;  2W6B A;  1IFI A;  3V2Q A;  1YYC A;  1FU1 A;  2H43 A;  1HUC A;  4HH2 A;  5KJ7 C;  4LLH A;  1CW5 A;  3BVH A;  1L4A B;  2KB7 P;  3HD7 B;  3RK3 B;  3M9B A;  4WY4 B;  5AW5 B;  1RE3 C;  1JO5 A;  2I1K A;  1SQP K;  3CI9 A;  5BVZ A;  4M3L A;  3VN0 A;  3GHG C;  1N7S D;  5CCH D;  1T3U A;  3LIE A;  1SFC B;  1KIL C;  2HLO A;  2Q3I A;  4DOJ A;  5BU5 A;  1ZLL A;  1GW4 A;  3PP5 A;  4OH8 B;  1FZA A;  5CHX A;  2PAJ A;  2N1T B;  5AVS B;  1JY3 N;  3P32 A;  5CCG D;  3V2P A;  1LTB C;  3L37 A;  3HUS A;  3R2P A;  4N3Y B;  5AVQ B;  3V4W A;  1GDT A;  5APT A;  3V5B A;  1FBM A;  1J2J B;  4IFM A;  1M7L A;  5AVV B;  2VRS A;  1T2K C;  2WPS A;  2QM8 A;  1JY2 N;  1Z56 A;  3GHG B;  1ZR2 A;  3RL0 C;  2Q5U A;  2YKO A;  3MTU E;  1FDM A;  2WZ7 A;  3IR9 A;  2A45 G;  2R3C A;  3HD7 D;  3RK3 D;  2WIT A;  3A5T A;  4WY4 D;  5AVT B;  1T3J A;  3KPE A;  1NOH A;  1LTA C;  4W80 A;  3A2A A;  4ZKP A;  3RK2 D;  1HWT C;  4ZKU A;  1GK6 A;  1JY3 O;  1QL1 A;  2NPS D;  3L4F A;  1DX7 A;  1J1E B;  2M8R A;  3UIA A;  2P2U A;  5CJ0 A;  4EOT A;  1A02 J;  2XDJ A;  5AVU B;  2N1T D;  2C0W A;  1G1I A;  4XA4 A;  2OAR A;  2L5G B;  1HTL C;  3RL0 B;  2HG5 D;  3HUS C;  1CI6 A;  2HOD A;  5KJ7 D;  3TK1 A;  1JY2 O;  1MUU A;  1L0L K;  1H88 A;  1RE3 A;  2YMY A;  3HRN A;  1RF0 A;  3A3Y B;  3NTN A;  1GU4 A;  1KIL A;  2MJZ A;  1SLQ A;  2FXM A;  2O01 H;  3BAS A;  5AW0 B;  4N6J A;  3EQ2 A;  3OA7 A;  4KHX A;  1M1J A;  2KSJ A;  2R32 A;  1LTG C;  1NTK K;  1FZE A;  1YTZ I;  1XTC C;  3MGN A;  1JTH A;  3HUS B;  3M91 A;  2YO3 A;  2J58 A;  3E1I A;  2IFN A;  5AW4 B;  1LT9 A;  3KQG A;  1FZG A;  3CL3 D;  3NMD A;  4JF7 A;  4C7R A;  1FAV A;  2FFD A;  1T2K D;  3BRV B;  2HYN A;  3VYI A;  3RL0 D;  2HFE D;  4I6M C;  1ZN5 A;  2OYI A;  3OJA B;  4I2L C;  3HE4 A;  1MV8 A;  3VOP A;  1RF0 C;  1HVV A;  2BAS A;  1GZL A;  2GUS A;  4Y99 C;  2E43 A;  2PP6 A;  5APX A;  4LGD E;  4GIF A;  2Q7C A;  1N73 A;  3MUD A;  1M1J C;  4HYT B;  5AW1 B;  2WPR A;  1ZR4 A;  1T8Z A;  3H32 A;  3BAT A;  4WBA A;  2KYV A;  2OYH C;  1CI6 B;  2GUV A;  2HOD B;  2XNX A;  3TYY A;  1PFI A;  2WT7 A;  2H8P D;  4GT1 A;  5AW9 B;  1LT9 C;  4AUW A;  1HJB A;  3LW5 H;  2FFD C;  3P8C E;  1FOS F;  4JYC A;  1SQB K;  4W7Y A;  3H6P A;  2GM4 A;  3NXS A;  1KIL B;  4Y99 B;  3V4Q A;  2FYU K;  2M3B A;  1HGV A;  1KFM A;  1L4A D;  2OYI C;  2R5B A;  2J59 M;  3SWF A;  1WT6 A;  1KQL A;  1GW3 A;  1M1J B;  1X8Y A;  2WWW A;  3C9I A;  2KP8 A;  4I1L A;  2XV5 A;  3B5N A;  2HPC A;  3I5C A;  1FZC A;  4IFD K;  1SFC D;  3HTK A;  1JTH B;  5CJ4 A;  2WTY A;  2P67 A;  5APV A;  5APW A;  1FOS E;  1N73 C;  1CZQ A;  3B8E B;  1DH3 A;  1LTS C;  4GKG A;  2LKM A;  2C9N Y;  3VMX A;  1LT9 B;  4AQR D;  2Z5H A;  3VP8 A;  2Z4E A;  2FFD B;  1NH4 A;  1OWA A;  1N7S C;  5CCH C;  1SVF A;  3OAK A;  1JUN A;  3KYQ A;  1AFO A;  1JOC A;  2IFM A;  1GL2 A;  1NTM K;  1VDF A;  4DZO A;  2NPS A;  1NTZ K;  2ZFC A;  2OYI B;  3HE4 B;  3P7K A;  5AW8 B;  3LID A;  1S9K E;  1L0N K;  1NHL A;  1WRG A;  1SQQ K;  1KIL D;  5APQ A;  1RE4 A;  2JEE A;  3M0D C;  1SP4 A;  5AVW B;  1N73 B;  5KLV K;  1NU1 K;  2IX7 C;  4AYC A;  4LC1 A;  3H32 B;  3B5N C;  3L35 A;  1FZC C;  2WSF H;  2Q9I A;  1CSB A;  2OYH A;  5AW2 B;  1GK4 A;  1OXZ A;  3MD0 A;  1IFD A;  2WT7 B;  2XZR A;  3U1A A;  3HE5 A;  1IFJ A;  4N78 E;  1RY3 A;  3IFM A;  4RES B;  1A02 F;  1LTJ A;  1SQV K;  3RK2 C;  5CMZ A;  2W27 A;  1GL2 C;  2JJL A;  1FZB A;  1ZV8 A;  2ZXE B;  1GU5 A;  2NPS C;  1LGH B;  2Z5I A;  1URQ A;  1LTI C;  3G3Z A;  1HBW A;  2C0X A;  2A45 H;  1MZ9 A;  2N1T C;  3A7O A;  2HPC B;  2O1J A;  3B5N B;  1IO4 A;  1FZC B;  4IFF A;  1GD2 E;  3P8M C;  1N86 A;  3CLQ A;  1RE4 C;  1IC2 A;  3HTK B;  1IFN A;  3T97 A;  1X79 B;  1N2D C;  2W6A A;  3M0A A;  2YNY A;  1IFM A;  1NKN A;  2FKW B;  1X9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...