1CW5A

Solution structure of carnobacteriocin b2
Total Genus 9
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
9
sequence length
48
structure length
48
Chain Sequence
VNYGNGVSCSKTKCSVNWGQAFQERYTAGINSFVSGVASGAGSIGRRP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords TYPE IIA BACTERIOCIN CARNOBACTERIOCIN B2
publication title Solution structure of carnobacteriocin B2 and implications for structure-activity relationships among type IIa bacteriocins from lactic acid bacteria.
pubmed doi rcsb
molecule tags Toxin
total genus 9
structure length 48
sequence length 48
ec nomenclature
pdb deposition date 1999-08-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01721 Bacteriocin_II Class II bacteriocin
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.20.5.130 Mainly Alpha Up-down Bundle Single alpha-helices involved in coiled-coils or other helix-helix interfaces Single alpha-helices involved in coiled-coils or other helix-helix interfaces 1cw5A00
1CW5A 1RY3A
chains in the Genus database with same CATH superfamily
4UB6H 2WT7B 3BASA 3S1KA 4KJMA 3N7NA 2O01J 3B5ND 4HH2A 1BCCE 4ZKUA 2R44A 3HD7A 3CCLP 3Q2YA 1J1EB 2KS1A 5H2FE 2RH0A 2A06E 3AEDC 1RY3A 1HUCA 4YPCA 1YHQP 2O1JA 3WMM0 1NH4A 1N7SD 2Q7CA 4UB8H 1FZFA 2O01H 1GU4A 2W27A 3PRJA 3D71A 1EDLA 5KJ7D 1Y9BA 2XV5A 4DCKA 3TGUE 4QMAA 1L0NK 1BSNA 2OYHB 1KYOE 1L0NJ 1S5LH 3CC4P 4XE5B 3CX5D 3L71J 4RJTA 1KB9H 1JCDA 4YXWH 1S2EA 2OYHC 3CI9A 3CCMP 1JMMA 3HE5A 1GZLA 4O9BA 5M1BA 1NKNA 4GT1A 1K05A 2Z4EA 1GL2A 5KAIE 3C1LA 1X22A 1T2KC 1IFMA 1YIJP 2A45H 1FZBA 3L37A 1URQB 3B8EB 2NPSA 2N1TB 4GODA 2Z5HA 1L0LG 3CPWO 1RE4C 3TF5A 2YMYA 1KZUB 3LW5J 3H32B 1EXIA 3AE7C 5APTA 4NPDA 1M57D 4D6TE 2N1TC 2P10A 3A5TA 4WB4A 3I5CA 1EDIA 1N7SB 1JY3O 1PGQA 1SFCA 1FZEA 1YJNP 3L74J 4WY4D 3L70G 1U7JA 5APSA 1SQQG 1Q82Q 1JOCA 4PD4D 1NKZB 2AXTH 4HYTB 4OGQD 3GHGB 1PL5A 1NTMD 2PRRA 1IO4A 3LW5H 1AJYA 1BE3J 1M1JC 1ZOYC 4A7PA 5KTBA 4BRYA 3VMAA 3WUUA 1P84I 3GHGC 1SQBG 1BGYD 3TNUB 1VQ8P 5AVYB 3D6ZA 1L2PA 1T3JA 4H0LC 5DJTB 1ZR4A 1NTKD 3M06A 1VQLP 1QVFO 1ZXGA 5KAFE 2LR2A 2KLUA 2FYNB 1Z56A 1MUUA 3AE1C 2IBZI 5E79E 2KNCA 1G1IA 2JDIH 2R5DA 1L4AA 1YQ3C 3UIAA 2ZVOB 1UIIA 4XFJA 3V2QA 3CCVP 3A0HE 1P84D 1KD1Q 3OJAB 1FDOA 2KS1B 1BSHA 1LTBC 3S4RA 1T6AA 1NJIQ 1BDDA 2OYIB 2NZ2A 3HD7C 2PAJA 3B71A 2JWAA 3H1LD 1NU1G 2E74D 3CC7P 4NPEA 1HGZA 4N78D 2NRGA 2XNXA 4L73A 1L0LK 2FYUJ 2E43A 1PIXA 1JEKA 2KK7A 1YITP 5KLVJ 1JTHB 1CI6A 3U59A 2WWWA 3A3YB 1ZLLA 1CSBA 4BXLA 4W7ZA 2YO2A 2OTJP 2E5YA 2QJPB 3BRVB 5L8RJ 1SQQK 1KTMA 2IFMA 3H1KJ 1YBKA 1NTZD 1L0LE 3HE5B 3RK2C 1WT6A 3BCCD 1KQGB 1NYHA 2POHA 3SSUA 2M0BA 1PPJG 1NWQA 1SQBK 3N4XA 4ZNCA 2FY8A 3SFDC 2P58A 3L75G 2CPBA 4IL6H 4LC1A 2NPSB 3L70E 2JWDA 1GL2C 2YKOA 1SQQE 1FZCA 4LLHA 1SQVG 2Y0DA 1PP9G 1SQXG 3C9IA 1W2EA 5KKZB 2JO1A 1FAVA 1R8EA 2BASA 4LGDE 2NPSC 3MD0A 1SFCB 3G3ZA 3VTPC 1N7LA 3FX0A 2CK3H 2WSSH 1SQBE 4I7ZB 3RL0D 2BCCD 3KZIH 1JY2O 1VQ5P 4EDFA 2YNYA 2LXCB 1SFCC 1EZVD 1H88A 2MKVA 5AW8B 1VQNP 3CXHE 4KT0J 2M5AA 4I7ZC 4BRYB 1J1DB 1P84H 2IFNA 3L4FA 1LT9A 2WZ7A 1AQ5A 2IZ0A 5AVZB 2KSEA 3PTZA 1NU1K 2IPPA 5APUA 5CCGD 1J1DC 2H43A 1JY3N 3L73J 3V2NA 2FXPA 3TYYA 3GLMA 1IFIA 3LIDA 2H88C 1PGPA 1KQFB 1FOSE 1NTZJ 3USSA 1BCCD 2JJLA 3Q5SA 4W80A 1JB0J 1L4AB 1DD4A 1HWTC 1NU1E 5AW1B 2ZT9B 2A06D 1X79B 1L4AC 4W7YA 3MTUE 3TSIA 3B5NA 2ZT9C 2RMZA 4R4LA 3WUTA 5APQA 2R3SA 2WPRA 1D7MA 3JSVC 1L0NG 1QX8A 3KHUA 2A45G 3TGUD 3V2PA 4JYCA 3L71G 4AUWA 1Q7YQ 2JKVA 2P1JA 1SQVK 1KYOD 1M1JA 3V4QA 3H1JJ 1IFDA 2DW3A 1CI6B 1EDKA 2Q1KA 2HODA 3SFEC 3FXDA 3C8VA 1KFMA 3W68A 3KYQA 3ITKA 4JF7A 1PPJE 4DT0A 3R4YA 2JP3A 1E79H 1JNMA 1KQLA 1SLQA 3H1IE 1RHZB 3H1HE 1QLED 3WU2H 2OYOA 3L75E 2K1AA 1ZMEC 3EFFK 4MN4C 1VQ4P 4RKUJ 2N9YB 3HUSA 1PP9E 1SQXE 2QJYB 3KDPB 3NFQA 1GW4A 2PP6A 1FBMA 1VDFA 3OA7A 4WVZA 3L72E 2XU6A 3O6QB 1VQPP 3Q1MA 1T2KD 4DOJA 4UB6E 2QJYC 3L74G 4D6TD 2QIWA 1DX7A 4WBAA 1FZCB 1J2JB 2K9YA 5CBNA 1HBWA 3MP7B 3IF4A 3SWYA 1XTCC 1YJWP 2Y0CA 1URQD 1BE3G 2MJZA 1N86A 1DEBA 3CX5I 1FZCC 2N1TD 2AEFA 5AVVB 3CWBJ 3RK3B 3L35A 4TLFA 1KFNA 1LWUA 1NAFA 2GA1A 4PJ0H 4U3FD 1HGVA 3G71P 4UB8E 1NGMB 3RK3C 2QEXP 4H44C 3RBZA 4JYBA 1KN7A 3VP9A 3I56P 2HYNA 1RQUA 2P7JA 1AFOA 3RK3E 1S5LE 1NAYA 3HE4A 4JQ0D 1H89A 2IDBA 1LT9C 2M3EA 2C0WA 1QEXA 4H13C 3VOPA 2KI7B 1VL2A 1OW6A 1OZHA 4OWFA 1PFIA 2WQYC 3QH9A 2FBWC 2ITAA 1JY2N 4GOFA 5B5EH 3FWNA 3AECC 3AE8C 1R5SA 2ZYGA 4PD4I 5GTIH 3M0DA 1HJBA 1L0NE 5TISH 3Q3DA 2B88A 3L71E 1DEEG 1DIPA 2FYUG 4EYYQ 3P8CE 5AW4B 1X8YA 2QM8A 2RKLA 1SQPD 3PH0A 5KLVG 3GG2A 4C7RA 1ZN5A 2PFXA 4IOIH 3IFMA 2C9LY 2V7QJ 1BDCA 1GTWA 3B5NC 1M8OB 1A02J 5APWA 3AEGC 1M1JB 3H1KG 2YXQB 2AXTE 5CCHD 4U3FJ 1EXJA 2HODB 3AEBC 3BVHA 1OW8A 4H0LB 4L75A 1L0LD 3CC2P 1DD3A 1VQMP 1FDIA 2V7QH 2FFDA 2Y0EA 5AW9B 3L74E 1QL2A 3HUSB 2K9JA 1DH3A 3IN6A 2D2CB 3L70D 1SQQD 3VMYA 1HH0A 2M8RA 3CCUP 2J5UA 1OFCX 1NVOA 1BE3E 3A2AA 1LP1B 2YMKA 1MKMA 3HUSC 4GDOA 1OWAA 1YTZT 4EI2A 2D2CC 3BATA 3G4SP 1AA0A 3CX5H 1SQBD 2WITA 2KUBA 2IBZG 5AW3B 3HD7B 3H6PA 2NPSD 1S4XA 2UWJE 3SWFA 3CMAP 1SQPJ 3CXHD 3H25A 2R3CA 4B86A 1IFJA 4IFMA 2E75B 2FYUK 5GTHH 2BEZF 1LT1A 1SFCD 1ZV8A 2J58A 3ZDMA 1W5CE 1S72P 4YXDC 2QRXA 3L73G 3PLNA 1G2CA 5KLVK 1LWUC 1MFZA 1GU5A 2E75C 1RF0C 1NTZG 2Q9IA 3A0BH 1NTMJ 3I55P 2KIKA 2WSEJ 3CD6P 3RL0g 3HE4B 3RK2B 3M9BA 4OGQC 1RE3A 1BGYJ 4TT3H 1KC8Q 2FYUE 2JR8A 1NTKK 2IYPA 1NU1D 4JBZA 4GIFA 1NTKJ 4PD4H 2R32A 2IZ1A 5KLVE 3O8ZA 2G8YA 3NTNA 1GL2B 1YTZI 3MZWB 3E1RA 3ABVC 3PP5A 1KILA 3TDKA 1EZVI 2WSEH 1GK4A 2WPSA 1OX3A 3D70A 5AW2B 1G1JA 3L36A 4XA4A 3AEAC 4HB1A 1VQ7P 4N3YB 3H1JG 3M0DC 1L4AD 1ZRTE 3H1KE 1N73A 2M3BA 4AYCA 5AVXB 5APVA 3GW6A 2ZT9D 2QSIA 2WTYA 2FYZA 2FKWB 1UIXA 4BWNA 1IFPA 5AVUB 1PPJD 2B87A 1LNQA 3KZIE 3H1LJ 3AE2C 3H1ID 3H1HD 1SVFA 1LJ2A 3MGNA 3L75D 2N9BA 1IK7A 1SS1A 3G9RA 2OARA 4R4MA 1P84E 4PV1B 2G3AA 1PP9D 1SQXD 3BRTB 1FZAA 5APXA 2FFDB 1OVUA 1KORA 1EQ7A 3KQGA 3L72D 3CCQP 1MZ9A 3VMXA 1M1KQ 3II6A 4PV1C 1IJDB 2K9JB 1ZR2A 2WSCJ 3GMAA 2FFDC 1JUNA 4N78E 1PGJA 1NTZK 2IBZE 3NMDA 1HJ0A 2WMMA 5AW7B 1VF5B 2Y9YA 1H8AA 3BCCJ 2KSJA 3CWBG 2KNCB 1KYOI 1MV8A 1USDA 4RO0A 3QWOC 2E42A 1VF5C 3VN0A 3L73E 2WSCH 1GDTA 5DJUB 4L76A 1VQ9P 2OQQA 1NTZE 1URQA 4GKGA 5AVRB 2K3RA 3RK3D 5AVSB 2PGDA 2BCCJ 3CCSP 2ZXEB 4HKZH 2KLVA 1N7SA 2ZYDA 1OVVA 3H1IJ 2IYOA 1S9KE 3H1HJ 3AE4C 3V6IA 2GUSA 2H7HA 3KXDA 1CZQA 1JY3P 3GF3A 4CPGA 3FWLA 2YKPA 5KJ7A 2LXBA 1SP4A 1LTSC 3WU2E 4ASWA 3L72J 1QGKB 2B89A 2L91A 1L0ND 3H1JE 1SQVE 5B66H 2R5BA 2HLOA 3L71D 3E7KA 2E76B 1RE3C 3P8CD 1LTAC 5AW6B 1KILB 2H8PD 3OAKA 5AVWB 1BCCJ 2E76C 3KPEA 2JEEA 2IX7C 3V4WA 1KILC 3JCUH 3W67A 4U3FG 4GOEA 1FZGA 3LIEA 1ZW0A 2Q5UA 1A02F 3AE6C 3HTKA 3U1AA 3EQ2A 1N73C 1KILE 1M56D 3D6YA 4H44B 4RESB 2QVAA 3MHVA 2B87B 1MFTA 1JM0A 2WSFJ 3TGUJ 1RF0A 1H0TA 2KOGA 4PJ0E 5H2FH 4WY4A 1NO4A 1M7LA 1RQVA 2WPQA 3F89A 3L74D 2M5AB 2AEJA 2OYIA 1YJ9P 1LT9B 5CCHA 1FJKA 1J1EC 4H13B 1E5WA 2BEQD 3CWBE 3V2RA 1BE3D 1Q86Q 4N6JA 1GW3A 1RH5B 2FXMA 2XDJA 4H0LD 1KB9E 2O3JA 1HF9A 2WSFH 5TJHA 2O1KA 1JTHA 3AE9C 4IFDK 2H89C 5AW5B 1GK6A 1KYOH 1SQPG 5B5EE 2W90A 2WPVB 2D2CD 2LKMA 5GTIE 1VQOP 1VPCA 2W83C 5BVZA 5TISE 1KMIZ 1X9VA 5BU5A 4D6TJ 1OVRA 1AVOA 3P8MC 2ZJSE 1K73Q 1LTGC 3FXEA 1IZNB 5KAIH 2HPCA 3B5NB 4DJGA 2W6BA 2Q3EA 1YYCA 2W6JH 2ZYAA 1NTMG 3CLQA 2OTKE 3HD7D 3P7KA 2XNDH 2V4HA 2HG5D 1PV3A 4WWIA 5KLIB 1BGYG 1USEA 1URQC 1IC2A 3CCEP 1Q81Q 3EWKA 3NXSA 1IK9A 2E75D 1FDMA 3RBXA 1PZQA 1NTKG 4DZOA 5CJ0A 2K37A 2FYUD 5KLIC 3B4SA 3RGUA 1N7SC 2Z5IA 3M91A 5KLVD 2KXPB 1JY2P 3G6EP 3AE5C 1YQ4C 2B9BA 2KB7P 2E5TA 1U57A 1T8ZA 2OTLP 5KJ7C 3CXHI 5C39A 4ZMDA 3RK2D 1PGOA 4U3FE 1ZRTD 3H1KD 1AQTA 1K04A 1S5LX 2L5GB 3CCJP 1R5LA 2HR3A 4I1LA 1GL2D 5KAFH 5CMZA 1W2BO 3H1LG 1AV1A 4AQRD 3CX5E 2J59M 1Y47A 4OH8B 1EC5A 5E79H 3M9HA 5CJ4A 4K35A 1OW7A 1SQPK 4Y28J 3T97A 1X0TA 5AW0B 3CCRP 3HTKB 1YI2P 3Q5RA 2ZXXA 1N8RQ 2FYNC 3AEFC 3PJSK 4NPFX 3A0HH 2QG4A 2WVRA 2Q6QA 1LWUB 2VRSA 3VMZA 1ZP0C 1H0TB 5GTHE 4WY4B 3MUDA 3PHLA 4JPZB 3EFGA 4K3AA 1EDJA 3V5BA 3VYIA 4OGQB 1NTMK 2HFED 1KQSO 4WY4C 2I8DA 3A0BE 3BCCG 1SQPE 2OYIC 1FOSF 2IBZD 1FU1A 1RF1A 3GF7A 1L0LJ 5CCHC 3K5BA 1OIPA 4PV1D 1Y8AA 2GUVA 1KV4A 5CCGA 3M9QA 4EIJA 1JO5A 1Q2NA 2P2UA 4ZKPA 2QE7H 3E1IA 4PD4E 1IFNA 3L70J 3L73D 1U7MA 1SQQJ 2FXOA 2YXRB 1XTGB 1NTME 1LTJA 4C7NA 4U7JA 1HTLC 2AXCA 2QJPC 4EOTA 4IL6E 1VF5D 4M3LA 2YO3A 3HRNA 1BGYE 2BCCG 2HPCB 3MIWA 2QA4P 3O6QA 1EZVG 3H1IG 1SQBJ 3H1HG 4Y99B 1JCCA 1WRGA 1NTKE 2WT7A 1VQ6P 3A7OA 2O01N 4KHXA 1FC2C 1S9KD 2I1JA 1S3JA 2KZIA 1OMIA 2AEMA 4Y99C 2QM7A 3IR9A 2I1KA 4I2LC 3L72G 2E74B 3F5HA 1T3UA 4YTPC 2GM4A 2P67A 3Q5PA 5KKZC 1LTIC 2W6AA 3H1JD 1TU3F 1QL1A 2E74C 3S9OA 1SQVD 5CBOA 1JMBA 4L74A 3VP8A 2YIUB 4C46A 1BCCG 5K5GB 1K9MQ 5APYA 3CXHH 5CHXA 1K8AQ 5BU8B 2C0XA 2QJKB 4IFFA 3OW2O 3AEEC 1LTTC 1FJPA 3H1LE 2YIUC 2Y9ZA 2A06G 3WUVA 2OYHA 2QJKC 1AVYA 3IAOA 1NU1J 1N2DC 1QVGO 1GD2E 2E76D 1GMJA 3CMEP 3P32A 2KZJA 1KB9I 3TK1A 1Q90D 1KILD 3TGUG 2OGUA 3R2PA 4Z1MH 2ZFCA 2SPZA 3T97B 1RE4A 2KP8A 2XKMA 1FE6A 3BCCE 1NHLA 2KYVA 4HJGH 2N1TA 2A45I 4IL6X 4I6MC 4ASVA 2W8ZA 2CPSA 2ZVNB 3CWBD 3H32A 4H44D 5AVQB 3RL0B 1G2CB 1KB9D 3SWKA 3AE3C 5EFWB 3L75J 5AVTB 1M90Q 3MUDC 2ZAEB 3RL0C 1RF1B 1SQXK 1LGHB 3M0AA 1SQVJ 2K88A 1PP9J 1SQXJ 1CW5A 1WMKA 3JC22 3GHGA 4H13D 4D6TG 1RF1C 1NOHA 1OXZA 1HVVA 2BCCE 5B66E 1S1CX 1EZVE 2Q3IA 5CCGC 3TNUA 1LTJB 4C7NB 3CL3D 2RN0A 3U1CA 1VQKP 4OVNF 2YKQA 2XZRA 1FS0E 3FGAD 1LTJC 2C9NY 1N73B 3JCUE 1LP1A
chains in the Genus database with same CATH topology
2HG5D 2H43A 2Q9IA 1JY3N 3V2NA 2WT7B 3TYYA 1URQC 1IC2A 3BASA 1IFIA 3HE4B 3LIDA 3N7NA 3NXSA 1IK9A 3RK2B 3M9BA 1FOSE 1FDMA 3B5ND 2JJLA 4HH2A 4DZOA 1RE3A 5CJ0A 4ZKUA 4W80A 1L4AB 3HD7A 1NTKK 1J1EB 1HWTC 4GIFA 1N7SC 2Z5IA 3M91A 5AW1B 2R32A 1JY2P 3O8ZA 3NTNA 1GL2B 1YTZI 1X79B 2KB7P 1RY3A 1L4AC 1T8ZA 1KILA 3PP5A 1HUCA 5KJ7C 4W7YA 2WSEH 3MTUE 3TSIA 1GK4A 2WPSA 2O1JA 3B5NA 3WMM0 1NH4A 5AW2B 1G1JA 3RK2D 1N7SD 2Q7CA 3L36A 4XA4A 1FZFA 2O01H 1GU4A 2W27A 4N3YB 5APQA 3M0DC 2WPRA 1L4AD 2A45G 5KJ7D 4JYCA 3V2PA 1N73A 2M3BA 2XV5A 4AUWA 4AYCA 5AVXB 2L5GB 5APVA 1L0NK 1SQVK 2P1JA 1M1JA 2OYHB 3V4QA 1IFDA 4I1LA 1GL2D 2WTYA 5CMZA 2FYZA 4XE5B 2FKWB 1CI6B 4AQRD 2HODA 2J59M 1JCDA 4OH8B 5AVUB 1KFMA 3M9HA 3KYQA 2OYHC 3CI9A 4JF7A 5CJ4A 1SQPK 3T97A 5AW0B 3HTKB 1JMMA 1JNMA 1KQLA 3HE5A 1GZLA 1SLQA 1SVFA 4O9BA 3MGNA 1NKNA 4GT1A 2N9BA 2Z4EA 1LWUB 2OARA 2VRSA 1GL2A 3VMZA 1T2KC 3BRTB 1FZAA 3HUSA 4WY4B 5APXA 1IFMA 2A45H 1FZBA 3L37A 3MUDA 2FFDB 3KDPB 3NFQA 1URQB 1GW4A 3B8EB 1EQ7A 3KQGA 3EFGA 2NPSA 2N1TB 2PP6A 1MZ9A 1FBMA 1VDFA 3OA7A 3VMXA 2Z5HA 2XU6A 3V5BA 3VYIA 3II6A 1IJDB 1NTMK 2HFED 1RE4C 1T2KD 2YMYA 1KZUB 4WY4C 4DOJA 1ZR2A 3H32B 2FFDC 2OYIC 1FOSF 1JUNA 4N78E 5APTA 1DX7A 1FU1A 1NTZK 4WBAA 1RF1A 2N1TC 3NMDA 3A5TA 1FZCB 1J2JB 4WB4A 3I5CA 1N7SB 5CCHC 1JY3O 1SFCA 5AW7B 1H8AA 1FZEA 2KSJA 2GUVA 1HBWA 4WY4D 3SWYA 1XTCC 5CCGA 3M9QA 4EIJA 1JO5A 5APSA 1JOCA 1MV8A 1URQD 2MJZA 1N86A 1DEBA 2P2UA 1FZCC 2N1TD 4ZKPA 2E42A 1NKZB 3E1IA 5AVVB 4HYTB 3GHGB 1IFNA 3RK3B 3VN0A 3L35A 1IO4A 1XTGB 3LW5H 1KFNA 2WSCH 1GDTA 1M1JC 5KTBA 1LWUA 1LTJA 4C7NA 1HTLC 1NAFA 1HGVA 4EOTA 3GHGC 3RK3C 4M3LA 4JYBA 3TNUB 2YO3A 1URQA 3HRNA 5AVYB 3VP9A 4GKGA 2HPCB 1T3JA 3MIWA 5AVRB 1ZR4A 2HYNA 3M06A 1JCCA 1WRGA 4Y99B 2WT7A 3RK3D 2P7JA 5AVSB 3A7OA 1AFOA 2ZXEB 3HE4A 4KHXA 2KLVA 1S9KD 1H89A 2I1JA 1LT9C 1N7SA 1Z56A 1S9KE 2C0WA 1MUUA 3VOPA 2GUSA 2H7HA 4Y99C 2QM7A 1CZQA 1JY3P 1G1IA 1PFIA 3IR9A 2I1KA 4I2LC 2R5DA 1L4AA 3UIAA 2YKPA 5KJ7A 1T3UA 2GM4A 1JY2N 2P67A 1SP4A 1LTSC 3V2QA 1LTIC 2W6AA 3OJAB 3M0DA 1QL1A 1HJBA 1LTBC 3VP8A 2R5BA 2HLOA 4C46A 2OYIB 1RE3C 5APYA 5CHXA 5BU8B 2C0XA 3P8CD 1LTAC 4IFFA 5AW6B 1KILB 3HD7C 2PAJA 3P8CE 2H8PD 3OAKA 1LTTC 5AVWB 5AW4B 1X8YA 1FJPA 2QM8A 1HGZA 4C7RA 3KPEA 4N78D 2JEEA 2IX7C 2XNXA 1L0LK 1ZN5A 2OYHA 2E43A 3IFMA 2C9LY 3V4WA 1KILC 1GTWA 3B5NC 1JTHB 1CI6A 1N2DC 3U59A 1A02J 2WWWA 1GD2E 1FZGA 3LIEA 3A3YB 5APWA 1M1JB 1ZLLA 1CSBA 4W7ZA 2YO2A 3P32A 2Q5UA 1A02F 3TK1A 1KILD 5CCHD 3HTKA 3BRVB 3U1AA 3EQ2A 1N73C 1SQQK 2HODB 4RESB 3R2PA 2ZFCA 3BVHA 2IFMA 1RF0A 2KOGA 3HE5B 1RE4A 2KP8A 3RK2C 1WT6A 4WY4A 1NO4A 1M7LA 2WPQA 2FFDA 2OYIA 2XKMA 2POHA 1NHLA 5AW9B 2KYVA 1QL2A 2N1TA 2A45I 1NWQA 4I6MC 1LT9B 1SQBK 5CCHA 1FJKA 2CPSA 3N4XA 1J1EC 3HUSB 1E5WA 1DH3A 2CPBA 3H32A 5AVQB 3RL0B 1G2CB 4LC1A 3V2RA 2NPSB 2YKOA 1GL2C 1HH0A 4N6JA 3VMYA 2M8RA 1GW3A 1FZCA 4LLHA 3A2AA 2FXMA 2XDJA 3C9IA 1W2EA 2WSFH 2O1KA 1FAVA 3HUSC 1JTHA 5AVTB 1OWAA 1YTZT 4IFDK 3RL0C 2BASA 4LGDE 3BATA 1RF1B 2NPSC 5AW5B 1SQXK 1LGHB 3M0AA 1GK6A 3MD0A 1SFCB 1CW5A 3G3ZA 3VTPC 1N7LA 3GHGA 2WITA 5AW3B 3HD7B 2LKMA 3RL0D 1RF1C 3H6PA 1NOHA 1JY2O 2NPSD 1OXZA 1VPCA 1HVVA 2YNYA 5BVZA 1SFCC 3SWFA 1X9VA 1H88A 5AW8B 5BU5A 2Q3IA 2R3CA 3P8MC 5CCGC 3TNUA 4B86A 1LTGC 1IFJA 1LTJB 4C7NB 4IFMA 1J1DB 3CL3D 2IFNA 3L4FA 3U1CA 2HPCA 3B5NB 1LT9A 2W6BA 2FYUK 2WZ7A 2J58A 1SFCD 1ZV8A 1AQ5A 1YYCA 5AVZB 1NU1K 2IPPA 5APUA 3CLQA 2YKQA 5CCGD 2XZRA 1G2CA 5KLVK 1LWUC 1LTJC 1MFZA 3HD7D 1GU5A 3P7KA 1J1DC 2C9NY 1N73B 1RF0C
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CW5 A;  1RY3 A; 
#chains in the Genus database with same CATH topology
 4UB6 H;  2WT7 B;  3BAS A;  3S1K A;  4KJM A;  3N7N A;  2O01 J;  3B5N D;  4HH2 A;  1BCC E;  4ZKU A;  2R44 A;  3HD7 A;  3CCL P;  3Q2Y A;  1J1E B;  2KS1 A;  5H2F E;  2RH0 A;  2A06 E;  3AED C;  1RY3 A;  1HUC A;  4YPC A;  1YHQ P;  2O1J A;  3WMM 0;  1NH4 A;  1N7S D;  2Q7C A;  4UB8 H;  1FZF A;  2O01 H;  1GU4 A;  2W27 A;  3PRJ A;  3D71 A;  1EDL A;  5KJ7 D;  1Y9B A;  2XV5 A;  4DCK A;  3TGU E;  4QMA A;  1L0N K;  1BSN A;  2OYH B;  1KYO E;  1L0N J;  1S5L H;  3CC4 P;  4XE5 B;  3CX5 D;  3L71 J;  4RJT A;  1KB9 H;  1JCD A;  4YXW H;  1S2E A;  2OYH C;  3CI9 A;  3CCM P;  1JMM A;  3HE5 A;  1GZL A;  4O9B A;  5M1B A;  1NKN A;  4GT1 A;  1K05 A;  2Z4E A;  1GL2 A;  5KAI E;  3C1L A;  1X22 A;  1T2K C;  1IFM A;  1YIJ P;  2A45 H;  1FZB A;  3L37 A;  1URQ B;  3B8E B;  2NPS A;  2N1T B;  4GOD A;  2Z5H A;  1L0L G;  3CPW O;  1RE4 C;  3TF5 A;  2YMY A;  1KZU B;  3LW5 J;  3H32 B;  1EXI A;  3AE7 C;  5APT A;  4NPD A;  1M57 D;  4D6T E;  2N1T C;  2P10 A;  3A5T A;  4WB4 A;  3I5C A;  1EDI A;  1N7S B;  1JY3 O;  1PGQ A;  1SFC A;  1FZE A;  1YJN P;  3L74 J;  4WY4 D;  3L70 G;  1U7J A;  5APS A;  1SQQ G;  1Q82 Q;  1JOC A;  4PD4 D;  1NKZ B;  2AXT H;  4HYT B;  4OGQ D;  3GHG B;  1PL5 A;  1NTM D;  2PRR A;  1IO4 A;  3LW5 H;  1AJY A;  1BE3 J;  1M1J C;  1ZOY C;  4A7P A;  5KTB A;  4BRY A;  3VMA A;  3WUU A;  1P84 I;  3GHG C;  1SQB G;  1BGY D;  3TNU B;  1VQ8 P;  5AVY B;  3D6Z A;  1L2P A;  1T3J A;  4H0L C;  5DJT B;  1ZR4 A;  1NTK D;  3M06 A;  1VQL P;  1QVF O;  1ZXG A;  5KAF E;  2LR2 A;  2KLU A;  2FYN B;  1Z56 A;  1MUU A;  3AE1 C;  2IBZ I;  5E79 E;  2KNC A;  1G1I A;  2JDI H;  2R5D A;  1L4A A;  1YQ3 C;  3UIA A;  2ZVO B;  1UII A;  4XFJ A;  3V2Q A;  3CCV P;  3A0H E;  1P84 D;  1KD1 Q;  3OJA B;  1FDO A;  2KS1 B;  1BSH A;  1LTB C;  3S4R A;  1T6A A;  1NJI Q;  1BDD A;  2OYI B;  2NZ2 A;  3HD7 C;  2PAJ A;  3B71 A;  2JWA A;  3H1L D;  1NU1 G;  2E74 D;  3CC7 P;  4NPE A;  1HGZ A;  4N78 D;  2NRG A;  2XNX A;  4L73 A;  1L0L K;  2FYU J;  2E43 A;  1PIX A;  1JEK A;  2KK7 A;  1YIT P;  5KLV J;  1JTH B;  1CI6 A;  3U59 A;  2WWW A;  3A3Y B;  1ZLL A;  1CSB A;  4BXL A;  4W7Z A;  2YO2 A;  2OTJ P;  2E5Y A;  2QJP B;  3BRV B;  5L8R J;  1SQQ K;  1KTM A;  2IFM A;  3H1K J;  1YBK A;  1NTZ D;  1L0L E;  3HE5 B;  3RK2 C;  1WT6 A;  3BCC D;  1KQG B;  1NYH A;  2POH A;  3SSU A;  2M0B A;  1PPJ G;  1NWQ A;  1SQB K;  3N4X A;  4ZNC A;  2FY8 A;  3SFD C;  2P58 A;  3L75 G;  2CPB A;  4IL6 H;  4LC1 A;  2NPS B;  3L70 E;  2JWD A;  1GL2 C;  2YKO A;  1SQQ E;  1FZC A;  4LLH A;  1SQV G;  2Y0D A;  1PP9 G;  1SQX G;  3C9I A;  1W2E A;  5KKZ B;  2JO1 A;  1FAV A;  1R8E A;  2BAS A;  4LGD E;  2NPS C;  3MD0 A;  1SFC B;  3G3Z A;  3VTP C;  1N7L A;  3FX0 A;  2CK3 H;  2WSS H;  1SQB E;  4I7Z B;  3RL0 D;  2BCC D;  3KZI H;  1JY2 O;  1VQ5 P;  4EDF A;  2YNY A;  2LXC B;  1SFC C;  1EZV D;  1H88 A;  2MKV A;  5AW8 B;  1VQN P;  3CXH E;  4KT0 J;  2M5A A;  4I7Z C;  4BRY B;  1J1D B;  1P84 H;  2IFN A;  3L4F A;  1LT9 A;  2WZ7 A;  1AQ5 A;  2IZ0 A;  5AVZ B;  2KSE A;  3PTZ A;  1NU1 K;  2IPP A;  5APU A;  5CCG D;  1J1D C;  2H43 A;  1JY3 N;  3L73 J;  3V2N A;  2FXP A;  3TYY A;  3GLM A;  1IFI A;  3LID A;  2H88 C;  1PGP A;  1KQF B;  1FOS E;  1NTZ J;  3USS A;  1BCC D;  2JJL A;  3Q5S A;  4W80 A;  1JB0 J;  1L4A B;  1DD4 A;  1HWT C;  1NU1 E;  5AW1 B;  2ZT9 B;  2A06 D;  1X79 B;  1L4A C;  4W7Y A;  3MTU E;  3TSI A;  3B5N A;  2ZT9 C;  2RMZ A;  4R4L A;  3WUT A;  5APQ A;  2R3S A;  2WPR A;  1D7M A;  3JSV C;  1L0N G;  1QX8 A;  3KHU A;  2A45 G;  3TGU D;  3V2P A;  4JYC A;  3L71 G;  4AUW A;  1Q7Y Q;  2JKV A;  2P1J A;  1SQV K;  1KYO D;  1M1J A;  3V4Q A;  3H1J J;  1IFD A;  2DW3 A;  1CI6 B;  1EDK A;  2Q1K A;  2HOD A;  3SFE C;  3FXD A;  3C8V A;  1KFM A;  3W68 A;  3KYQ A;  3ITK A;  4JF7 A;  1PPJ E;  4DT0 A;  3R4Y A;  2JP3 A;  1E79 H;  1JNM A;  1KQL A;  1SLQ A;  3H1I E;  1RHZ B;  3H1H E;  1QLE D;  3WU2 H;  2OYO A;  3L75 E;  2K1A A;  1ZME C;  3EFF K;  4MN4 C;  1VQ4 P;  4RKU J;  2N9Y B;  3HUS A;  1PP9 E;  1SQX E;  2QJY B;  3KDP B;  3NFQ A;  1GW4 A;  2PP6 A;  1FBM A;  1VDF A;  3OA7 A;  4WVZ A;  3L72 E;  2XU6 A;  3O6Q B;  1VQP P;  3Q1M A;  1T2K D;  4DOJ A;  4UB6 E;  2QJY C;  3L74 G;  4D6T D;  2QIW A;  1DX7 A;  4WBA A;  1FZC B;  1J2J B;  2K9Y A;  5CBN A;  1HBW A;  3MP7 B;  3IF4 A;  3SWY A;  1XTC C;  1YJW P;  2Y0C A;  1URQ D;  1BE3 G;  2MJZ A;  1N86 A;  1DEB A;  3CX5 I;  1FZC C;  2N1T D;  2AEF A;  5AVV B;  3CWB J;  3RK3 B;  3L35 A;  4TLF A;  1KFN A;  1LWU A;  1NAF A;  2GA1 A;  4PJ0 H;  4U3F D;  1HGV A;  3G71 P;  4UB8 E;  1NGM B;  3RK3 C;  2QEX P;  4H44 C;  3RBZ A;  4JYB A;  1KN7 A;  3VP9 A;  3I56 P;  2HYN A;  1RQU A;  2P7J A;  1AFO A;  3RK3 E;  1S5L E;  1NAY A;  3HE4 A;  4JQ0 D;  1H89 A;  2IDB A;  1LT9 C;  2M3E A;  2C0W A;  1QEX A;  4H13 C;  3VOP A;  2KI7 B;  1VL2 A;  1OW6 A;  1OZH A;  4OWF A;  1PFI A;  2WQY C;  3QH9 A;  2FBW C;  2ITA A;  1JY2 N;  4GOF A;  5B5E H;  3FWN A;  3AEC C;  3AE8 C;  1R5S A;  2ZYG A;  4PD4 I;  5GTI H;  3M0D A;  1HJB A;  1L0N E;  5TIS H;  3Q3D A;  2B88 A;  3L71 E;  1DEE G;  1DIP A;  2FYU G;  4EYY Q;  3P8C E;  5AW4 B;  1X8Y A;  2QM8 A;  2RKL A;  1SQP D;  3PH0 A;  5KLV G;  3GG2 A;  4C7R A;  1ZN5 A;  2PFX A;  4IOI H;  3IFM A;  2C9L Y;  2V7Q J;  1BDC A;  1GTW A;  3B5N C;  1M8O B;  1A02 J;  5APW A;  3AEG C;  1M1J B;  3H1K G;  2YXQ B;  2AXT E;  5CCH D;  4U3F J;  1EXJ A;  2HOD B;  3AEB C;  3BVH A;  1OW8 A;  4H0L B;  4L75 A;  1L0L D;  3CC2 P;  1DD3 A;  1VQM P;  1FDI A;  2V7Q H;  2FFD A;  2Y0E A;  5AW9 B;  3L74 E;  1QL2 A;  3HUS B;  2K9J A;  1DH3 A;  3IN6 A;  2D2C B;  3L70 D;  1SQQ D;  3VMY A;  1HH0 A;  2M8R A;  3CCU P;  2J5U A;  1OFC X;  1NVO A;  1BE3 E;  3A2A A;  1LP1 B;  2YMK A;  1MKM A;  3HUS C;  4GDO A;  1OWA A;  1YTZ T;  4EI2 A;  2D2C C;  3BAT A;  3G4S P;  1AA0 A;  3CX5 H;  1SQB D;  2WIT A;  2KUB A;  2IBZ G;  5AW3 B;  3HD7 B;  3H6P A;  2NPS D;  1S4X A;  2UWJ E;  3SWF A;  3CMA P;  1SQP J;  3CXH D;  3H25 A;  2R3C A;  4B86 A;  1IFJ A;  4IFM A;  2E75 B;  2FYU K;  5GTH H;  2BEZ F;  1LT1 A;  1SFC D;  1ZV8 A;  2J58 A;  3ZDM A;  1W5C E;  1S72 P;  4YXD C;  2QRX A;  3L73 G;  3PLN A;  1G2C A;  5KLV K;  1LWU C;  1MFZ A;  1GU5 A;  2E75 C;  1RF0 C;  1NTZ G;  2Q9I A;  3A0B H;  1NTM J;  3I55 P;  2KIK A;  2WSE J;  3CD6 P;  3RL0 g;  3HE4 B;  3RK2 B;  3M9B A;  4OGQ C;  1RE3 A;  1BGY J;  4TT3 H;  1KC8 Q;  2FYU E;  2JR8 A;  1NTK K;  2IYP A;  1NU1 D;  4JBZ A;  4GIF A;  1NTK J;  4PD4 H;  2R32 A;  2IZ1 A;  5KLV E;  3O8Z A;  2G8Y A;  3NTN A;  1GL2 B;  1YTZ I;  3MZW B;  3E1R A;  3ABV C;  3PP5 A;  1KIL A;  3TDK A;  1EZV I;  2WSE H;  1GK4 A;  2WPS A;  1OX3 A;  3D70 A;  5AW2 B;  1G1J A;  3L36 A;  4XA4 A;  3AEA C;  4HB1 A;  1VQ7 P;  4N3Y B;  3H1J G;  3M0D C;  1L4A D;  1ZRT E;  3H1K E;  1N73 A;  2M3B A;  4AYC A;  5AVX B;  5APV A;  3GW6 A;  2ZT9 D;  2QSI A;  2WTY A;  2FYZ A;  2FKW B;  1UIX A;  4BWN A;  1IFP A;  5AVU B;  1PPJ D;  2B87 A;  1LNQ A;  3KZI E;  3H1L J;  3AE2 C;  3H1I D;  3H1H D;  1SVF A;  1LJ2 A;  3MGN A;  3L75 D;  2N9B A;  1IK7 A;  1SS1 A;  3G9R A;  2OAR A;  4R4M A;  1P84 E;  4PV1 B;  2G3A A;  1PP9 D;  1SQX D;  3BRT B;  1FZA A;  5APX A;  2FFD B;  1OVU A;  1KOR A;  1EQ7 A;  3KQG A;  3L72 D;  3CCQ P;  1MZ9 A;  3VMX A;  1M1K Q;  3II6 A;  4PV1 C;  1IJD B;  2K9J B;  1ZR2 A;  2WSC J;  3GMA A;  2FFD C;  1JUN A;  4N78 E;  1PGJ A;  1NTZ K;  2IBZ E;  3NMD A;  1HJ0 A;  2WMM A;  5AW7 B;  1VF5 B;  2Y9Y A;  1H8A A;  3BCC J;  2KSJ A;  3CWB G;  2KNC B;  1KYO I;  1MV8 A;  1USD A;  4RO0 A;  3QWO C;  2E42 A;  1VF5 C;  3VN0 A;  3L73 E;  2WSC H;  1GDT A;  5DJU B;  4L76 A;  1VQ9 P;  2OQQ A;  1NTZ E;  1URQ A;  4GKG A;  5AVR B;  2K3R A;  3RK3 D;  5AVS B;  2PGD A;  2BCC J;  3CCS P;  2ZXE B;  4HKZ H;  2KLV A;  1N7S A;  2ZYD A;  1OVV A;  3H1I J;  2IYO A;  1S9K E;  3H1H J;  3AE4 C;  3V6I A;  2GUS A;  2H7H A;  3KXD A;  1CZQ A;  1JY3 P;  3GF3 A;  4CPG A;  3FWL A;  2YKP A;  5KJ7 A;  2LXB A;  1SP4 A;  1LTS C;  3WU2 E;  4ASW A;  3L72 J;  1QGK B;  2B89 A;  2L91 A;  1L0N D;  3H1J E;  1SQV E;  5B66 H;  2R5B A;  2HLO A;  3L71 D;  3E7K A;  2E76 B;  1RE3 C;  3P8C D;  1LTA C;  5AW6 B;  1KIL B;  2H8P D;  3OAK A;  5AVW B;  1BCC J;  2E76 C;  3KPE A;  2JEE A;  2IX7 C;  3V4W A;  1KIL C;  3JCU H;  3W67 A;  4U3F G;  4GOE A;  1FZG A;  3LIE A;  1ZW0 A;  2Q5U A;  1A02 F;  3AE6 C;  3HTK A;  3U1A A;  3EQ2 A;  1N73 C;  1KIL E;  1M56 D;  3D6Y A;  4H44 B;  4RES B;  2QVA A;  3MHV A;  2B87 B;  1MFT A;  1JM0 A;  2WSF J;  3TGU J;  1RF0 A;  1H0T A;  2KOG A;  4PJ0 E;  5H2F H;  4WY4 A;  1NO4 A;  1M7L A;  1RQV A;  2WPQ A;  3F89 A;  3L74 D;  2M5A B;  2AEJ A;  2OYI A;  1YJ9 P;  1LT9 B;  5CCH A;  1FJK A;  1J1E C;  4H13 B;  1E5W A;  2BEQ D;  3CWB E;  3V2R A;  1BE3 D;  1Q86 Q;  4N6J A;  1GW3 A;  1RH5 B;  2FXM A;  2XDJ A;  4H0L D;  1KB9 E;  2O3J A;  1HF9 A;  2WSF H;  5TJH A;  2O1K A;  1JTH A;  3AE9 C;  4IFD K;  2H89 C;  5AW5 B;  1GK6 A;  1KYO H;  1SQP G;  5B5E E;  2W90 A;  2WPV B;  2D2C D;  2LKM A;  5GTI E;  1VQO P;  1VPC A;  2W83 C;  5BVZ A;  5TIS E;  1KMI Z;  1X9V A;  5BU5 A;  4D6T J;  1OVR A;  1AVO A;  3P8M C;  2ZJS E;  1K73 Q;  1LTG C;  3FXE A;  1IZN B;  5KAI H;  2HPC A;  3B5N B;  4DJG A;  2W6B A;  2Q3E A;  1YYC A;  2W6J H;  2ZYA A;  1NTM G;  3CLQ A;  2OTK E;  3HD7 D;  3P7K A;  2XND H;  2V4H A;  2HG5 D;  1PV3 A;  4WWI A;  5KLI B;  1BGY G;  1USE A;  1URQ C;  1IC2 A;  3CCE P;  1Q81 Q;  3EWK A;  3NXS A;  1IK9 A;  2E75 D;  1FDM A;  3RBX A;  1PZQ A;  1NTK G;  4DZO A;  5CJ0 A;  2K37 A;  2FYU D;  5KLI C;  3B4S A;  3RGU A;  1N7S C;  2Z5I A;  3M91 A;  5KLV D;  2KXP B;  1JY2 P;  3G6E P;  3AE5 C;  1YQ4 C;  2B9B A;  2KB7 P;  2E5T A;  1U57 A;  1T8Z A;  2OTL P;  5KJ7 C;  3CXH I;  5C39 A;  4ZMD A;  3RK2 D;  1PGO A;  4U3F E;  1ZRT D;  3H1K D;  1AQT A;  1K04 A;  1S5L X;  2L5G B;  3CCJ P;  1R5L A;  2HR3 A;  4I1L A;  1GL2 D;  5KAF H;  5CMZ A;  1W2B O;  3H1L G;  1AV1 A;  4AQR D;  3CX5 E;  2J59 M;  1Y47 A;  4OH8 B;  1EC5 A;  5E79 H;  3M9H A;  5CJ4 A;  4K35 A;  1OW7 A;  1SQP K;  4Y28 J;  3T97 A;  1X0T A;  5AW0 B;  3CCR P;  3HTK B;  1YI2 P;  3Q5R A;  2ZXX A;  1N8R Q;  2FYN C;  3AEF C;  3PJS K;  4NPF X;  3A0H H;  2QG4 A;  2WVR A;  2Q6Q A;  1LWU B;  2VRS A;  3VMZ A;  1ZP0 C;  1H0T B;  5GTH E;  4WY4 B;  3MUD A;  3PHL A;  4JPZ B;  3EFG A;  4K3A A;  1EDJ A;  3V5B A;  3VYI A;  4OGQ B;  1NTM K;  2HFE D;  1KQS O;  4WY4 C;  2I8D A;  3A0B E;  3BCC G;  1SQP E;  2OYI C;  1FOS F;  2IBZ D;  1FU1 A;  1RF1 A;  3GF7 A;  1L0L J;  5CCH C;  3K5B A;  1OIP A;  4PV1 D;  1Y8A A;  2GUV A;  1KV4 A;  5CCG A;  3M9Q A;  4EIJ A;  1JO5 A;  1Q2N A;  2P2U A;  4ZKP A;  2QE7 H;  3E1I A;  4PD4 E;  1IFN A;  3L70 J;  3L73 D;  1U7M A;  1SQQ J;  2FXO A;  2YXR B;  1XTG B;  1NTM E;  1LTJ A;  4C7N A;  4U7J A;  1HTL C;  2AXC A;  2QJP C;  4EOT A;  4IL6 E;  1VF5 D;  4M3L A;  2YO3 A;  3HRN A;  1BGY E;  2BCC G;  2HPC B;  3MIW A;  2QA4 P;  3O6Q A;  1EZV G;  3H1I G;  1SQB J;  3H1H G;  4Y99 B;  1JCC A;  1WRG A;  1NTK E;  2WT7 A;  1VQ6 P;  3A7O A;  2O01 N;  4KHX A;  1FC2 C;  1S9K D;  2I1J A;  1S3J A;  2KZI A;  1OMI A;  2AEM A;  4Y99 C;  2QM7 A;  3IR9 A;  2I1K A;  4I2L C;  3L72 G;  2E74 B;  3F5H A;  1T3U A;  4YTP C;  2GM4 A;  2P67 A;  3Q5P A;  5KKZ C;  1LTI C;  2W6A A;  3H1J D;  1TU3 F;  1QL1 A;  2E74 C;  3S9O A;  1SQV D;  5CBO A;  1JMB A;  4L74 A;  3VP8 A;  2YIU B;  4C46 A;  1BCC G;  5K5G B;  1K9M Q;  5APY A;  3CXH H;  5CHX A;  1K8A Q;  5BU8 B;  2C0X A;  2QJK B;  4IFF A;  3OW2 O;  3AEE C;  1LTT C;  1FJP A;  3H1L E;  2YIU C;  2Y9Z A;  2A06 G;  3WUV A;  2OYH A;  2QJK C;  1AVY A;  3IAO A;  1NU1 J;  1N2D C;  1QVG O;  1GD2 E;  2E76 D;  1GMJ A;  3CME P;  3P32 A;  2KZJ A;  1KB9 I;  3TK1 A;  1Q90 D;  1KIL D;  3TGU G;  2OGU A;  3R2P A;  4Z1M H;  2ZFC A;  2SPZ A;  3T97 B;  1RE4 A;  2KP8 A;  2XKM A;  1FE6 A;  3BCC E;  1NHL A;  2KYV A;  4HJG H;  2N1T A;  2A45 I;  4IL6 X;  4I6M C;  4ASV A;  2W8Z A;  2CPS A;  2ZVN B;  3CWB D;  3H32 A;  4H44 D;  5AVQ B;  3RL0 B;  1G2C B;  1KB9 D;  3SWK A;  3AE3 C;  5EFW B;  3L75 J;  5AVT B;  1M90 Q;  3MUD C;  2ZAE B;  3RL0 C;  1RF1 B;  1SQX K;  1LGH B;  3M0A A;  1SQV J;  2K88 A;  1PP9 J;  1SQX J;  1CW5 A;  1WMK A;  3JC2 2;  3GHG A;  4H13 D;  4D6T G;  1RF1 C;  1NOH A;  1OXZ A;  1HVV A;  2BCC E;  5B66 E;  1S1C X;  1EZV E;  2Q3I A;  5CCG C;  3TNU A;  1LTJ B;  4C7N B;  3CL3 D;  2RN0 A;  3U1C A;  1VQK P;  4OVN F;  2YKQ A;  2XZR A;  1FS0 E;  3FGA D;  1LTJ C;  2C9N Y;  1N73 B;  3JCU E;  1LP1 A; 
#chains in the Genus database with same CATH homology
 2HG5 D;  2H43 A;  2Q9I A;  1JY3 N;  3V2N A;  2WT7 B;  3TYY A;  1URQ C;  1IC2 A;  3BAS A;  1IFI A;  3HE4 B;  3LID A;  3N7N A;  3NXS A;  1IK9 A;  3RK2 B;  3M9B A;  1FOS E;  1FDM A;  3B5N D;  2JJL A;  4HH2 A;  4DZO A;  1RE3 A;  5CJ0 A;  4ZKU A;  4W80 A;  1L4A B;  3HD7 A;  1NTK K;  1J1E B;  1HWT C;  4GIF A;  1N7S C;  2Z5I A;  3M91 A;  5AW1 B;  2R32 A;  1JY2 P;  3O8Z A;  3NTN A;  1GL2 B;  1YTZ I;  1X79 B;  2KB7 P;  1RY3 A;  1L4A C;  1T8Z A;  1KIL A;  3PP5 A;  1HUC A;  5KJ7 C;  4W7Y A;  2WSE H;  3MTU E;  3TSI A;  1GK4 A;  2WPS A;  2O1J A;  3B5N A;  3WMM 0;  1NH4 A;  5AW2 B;  1G1J A;  3RK2 D;  1N7S D;  2Q7C A;  3L36 A;  4XA4 A;  1FZF A;  2O01 H;  1GU4 A;  2W27 A;  4N3Y B;  5APQ A;  3M0D C;  2WPR A;  1L4A D;  2A45 G;  5KJ7 D;  4JYC A;  3V2P A;  1N73 A;  2M3B A;  2XV5 A;  4AUW A;  4AYC A;  5AVX B;  2L5G B;  5APV A;  1L0N K;  1SQV K;  2P1J A;  1M1J A;  2OYH B;  3V4Q A;  1IFD A;  4I1L A;  1GL2 D;  2WTY A;  5CMZ A;  2FYZ A;  4XE5 B;  2FKW B;  1CI6 B;  4AQR D;  2HOD A;  2J59 M;  1JCD A;  4OH8 B;  5AVU B;  1KFM A;  3M9H A;  3KYQ A;  2OYH C;  3CI9 A;  4JF7 A;  5CJ4 A;  1SQP K;  3T97 A;  5AW0 B;  3HTK B;  1JMM A;  1JNM A;  1KQL A;  3HE5 A;  1GZL A;  1SLQ A;  1SVF A;  4O9B A;  3MGN A;  1NKN A;  4GT1 A;  2N9B A;  2Z4E A;  1LWU B;  2OAR A;  2VRS A;  1GL2 A;  3VMZ A;  1T2K C;  3BRT B;  1FZA A;  3HUS A;  4WY4 B;  5APX A;  1IFM A;  2A45 H;  1FZB A;  3L37 A;  3MUD A;  2FFD B;  3KDP B;  3NFQ A;  1URQ B;  1GW4 A;  3B8E B;  1EQ7 A;  3KQG A;  3EFG A;  2NPS A;  2N1T B;  2PP6 A;  1MZ9 A;  1FBM A;  1VDF A;  3OA7 A;  3VMX A;  2Z5H A;  2XU6 A;  3V5B A;  3VYI A;  3II6 A;  1IJD B;  1NTM K;  2HFE D;  1RE4 C;  1T2K D;  2YMY A;  1KZU B;  4WY4 C;  4DOJ A;  1ZR2 A;  3H32 B;  2FFD C;  2OYI C;  1FOS F;  1JUN A;  4N78 E;  5APT A;  1DX7 A;  1FU1 A;  1NTZ K;  4WBA A;  1RF1 A;  2N1T C;  3NMD A;  3A5T A;  1FZC B;  1J2J B;  4WB4 A;  3I5C A;  1N7S B;  5CCH C;  1JY3 O;  1SFC A;  5AW7 B;  1H8A A;  1FZE A;  2KSJ A;  2GUV A;  1HBW A;  4WY4 D;  3SWY A;  1XTC C;  5CCG A;  3M9Q A;  4EIJ A;  1JO5 A;  5APS A;  1JOC A;  1MV8 A;  1URQ D;  2MJZ A;  1N86 A;  1DEB A;  2P2U A;  1FZC C;  2N1T D;  4ZKP A;  2E42 A;  1NKZ B;  3E1I A;  5AVV B;  4HYT B;  3GHG B;  1IFN A;  3RK3 B;  3VN0 A;  3L35 A;  1IO4 A;  1XTG B;  3LW5 H;  1KFN A;  2WSC H;  1GDT A;  1M1J C;  5KTB A;  1LWU A;  1LTJ A;  4C7N A;  1HTL C;  1NAF A;  1HGV A;  4EOT A;  3GHG C;  3RK3 C;  4M3L A;  4JYB A;  3TNU B;  2YO3 A;  1URQ A;  3HRN A;  5AVY B;  3VP9 A;  4GKG A;  2HPC B;  1T3J A;  3MIW A;  5AVR B;  1ZR4 A;  2HYN A;  3M06 A;  1JCC A;  1WRG A;  4Y99 B;  2WT7 A;  3RK3 D;  2P7J A;  5AVS B;  3A7O A;  1AFO A;  2ZXE B;  3HE4 A;  4KHX A;  2KLV A;  1S9K D;  1H89 A;  2I1J A;  1LT9 C;  1N7S A;  1Z56 A;  1S9K E;  2C0W A;  1MUU A;  3VOP A;  2GUS A;  2H7H A;  4Y99 C;  2QM7 A;  1CZQ A;  1JY3 P;  1G1I A;  1PFI A;  3IR9 A;  2I1K A;  4I2L C;  2R5D A;  1L4A A;  3UIA A;  2YKP A;  5KJ7 A;  1T3U A;  2GM4 A;  1JY2 N;  2P67 A;  1SP4 A;  1LTS C;  3V2Q A;  1LTI C;  2W6A A;  3OJA B;  3M0D A;  1QL1 A;  1HJB A;  1LTB C;  3VP8 A;  2R5B A;  2HLO A;  4C46 A;  2OYI B;  1RE3 C;  5APY A;  5CHX A;  5BU8 B;  2C0X A;  3P8C D;  1LTA C;  4IFF A;  5AW6 B;  1KIL B;  3HD7 C;  2PAJ A;  3P8C E;  2H8P D;  3OAK A;  1LTT C;  5AVW B;  5AW4 B;  1X8Y A;  1FJP A;  2QM8 A;  1HGZ A;  4C7R A;  3KPE A;  4N78 D;  2JEE A;  2IX7 C;  2XNX A;  1L0L K;  1ZN5 A;  2OYH A;  2E43 A;  3IFM A;  2C9L Y;  3V4W A;  1KIL C;  1GTW A;  3B5N C;  1JTH B;  1CI6 A;  1N2D C;  3U59 A;  1A02 J;  2WWW A;  1GD2 E;  1FZG A;  3LIE A;  3A3Y B;  5APW A;  1M1J B;  1ZLL A;  1CSB A;  4W7Z A;  2YO2 A;  3P32 A;  2Q5U A;  1A02 F;  3TK1 A;  1KIL D;  5CCH D;  3HTK A;  3BRV B;  3U1A A;  3EQ2 A;  1N73 C;  1SQQ K;  2HOD B;  4RES B;  3R2P A;  2ZFC A;  3BVH A;  2IFM A;  1RF0 A;  2KOG A;  3HE5 B;  1RE4 A;  2KP8 A;  3RK2 C;  1WT6 A;  4WY4 A;  1NO4 A;  1M7L A;  2WPQ A;  2FFD A;  2OYI A;  2XKM A;  2POH A;  1NHL A;  5AW9 B;  2KYV A;  1QL2 A;  2N1T A;  2A45 I;  1NWQ A;  4I6M C;  1LT9 B;  1SQB K;  5CCH A;  1FJK A;  2CPS A;  3N4X A;  1J1E C;  3HUS B;  1E5W A;  1DH3 A;  2CPB A;  3H32 A;  5AVQ B;  3RL0 B;  1G2C B;  4LC1 A;  3V2R A;  2NPS B;  2YKO A;  1GL2 C;  1HH0 A;  4N6J A;  3VMY A;  2M8R A;  1GW3 A;  1FZC A;  4LLH A;  3A2A A;  2FXM A;  2XDJ A;  3C9I A;  1W2E A;  2WSF H;  2O1K A;  1FAV A;  3HUS C;  1JTH A;  5AVT B;  1OWA A;  1YTZ T;  4IFD K;  3RL0 C;  2BAS A;  4LGD E;  3BAT A;  1RF1 B;  2NPS C;  5AW5 B;  1SQX K;  1LGH B;  3M0A A;  1GK6 A;  3MD0 A;  1SFC B;  1CW5 A;  3G3Z A;  3VTP C;  1N7L A;  3GHG A;  2WIT A;  5AW3 B;  3HD7 B;  2LKM A;  3RL0 D;  1RF1 C;  3H6P A;  1NOH A;  1JY2 O;  2NPS D;  1OXZ A;  1VPC A;  1HVV A;  2YNY A;  5BVZ A;  1SFC C;  3SWF A;  1X9V A;  1H88 A;  5AW8 B;  5BU5 A;  2Q3I A;  2R3C A;  3P8M C;  5CCG C;  3TNU A;  4B86 A;  1LTG C;  1IFJ A;  1LTJ B;  4C7N B;  4IFM A;  1J1D B;  3CL3 D;  2IFN A;  3L4F A;  3U1C A;  2HPC A;  3B5N B;  1LT9 A;  2W6B A;  2FYU K;  2WZ7 A;  2J58 A;  1SFC D;  1ZV8 A;  1AQ5 A;  1YYC A;  5AVZ B;  1NU1 K;  2IPP A;  5APU A;  3CLQ A;  2YKQ A;  5CCG D;  2XZR A;  1G2C A;  5KLV K;  1LWU C;  1LTJ C;  1MFZ A;  3HD7 D;  1GU5 A;  3P7K A;  1J1D C;  2C9N Y;  1N73 B;  1RF0 C; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...